data_4EY6
# 
_entry.id   4EY6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4EY6         
RCSB  RCSB072216   
WWPDB D_1000072216 
# 
_pdbx_database_status.entry_id                        4EY6 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-05-01 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Cheung, J.'    1 
'Rudolph, M.'   2 
'Burshteyn, F.' 3 
'Cassidy, M.'   4 
'Gary, E.'      5 
'Love, J.'      6 
'Height, J.'    7 
'Franklin, M.'  8 
# 
_citation.id                        primary 
_citation.title                     'Structures of human acetylcholinesterase in complex with pharmacologically important ligands.' 
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            55 
_citation.page_first                10282 
_citation.page_last                 10286 
_citation.year                      2012 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23035744 
_citation.pdbx_database_id_DOI      10.1021/jm300871x 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Cheung, J.'     1 ? 
primary 'Rudolph, M.J.'  2 ? 
primary 'Burshteyn, F.'  3 ? 
primary 'Cassidy, M.S.'  4 ? 
primary 'Gary, E.N.'     5 ? 
primary 'Love, J.'       6 ? 
primary 'Franklin, M.C.' 7 ? 
primary 'Height, J.J.'   8 ? 
# 
_cell.entry_id           4EY6 
_cell.length_a           104.975 
_cell.length_b           104.975 
_cell.length_c           323.400 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4EY6 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Acetylcholinesterase 59447.105 2   3.1.1.7 ? 'UNP Residues 33-574' ? 
2 branched    man 
'2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose' 570.542   2 
?       ? ?                     ? 
3 non-polymer syn '(-)-GALANTHAMINE' 287.354   2   ?       ? ?                     ? 
4 non-polymer syn 1,2-ETHANEDIOL 62.068    3   ?       ? ?                     ? 
5 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   1   ?       ? ?                     ? 
6 non-polymer syn 'NITRATE ION' 62.005    2   ?       ? ?                     ? 
7 non-polymer syn 3,6,9,12,15,18,21-HEPTAOXATRICOSANE-1,23-DIOL 370.436   1   ?       ? ?                     ? 
8 water       nat water 18.015    385 ?       ? ?                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ARG n 
1 3   GLU n 
1 4   ASP n 
1 5   ALA n 
1 6   GLU n 
1 7   LEU n 
1 8   LEU n 
1 9   VAL n 
1 10  THR n 
1 11  VAL n 
1 12  ARG n 
1 13  GLY n 
1 14  GLY n 
1 15  ARG n 
1 16  LEU n 
1 17  ARG n 
1 18  GLY n 
1 19  ILE n 
1 20  ARG n 
1 21  LEU n 
1 22  LYS n 
1 23  THR n 
1 24  PRO n 
1 25  GLY n 
1 26  GLY n 
1 27  PRO n 
1 28  VAL n 
1 29  SER n 
1 30  ALA n 
1 31  PHE n 
1 32  LEU n 
1 33  GLY n 
1 34  ILE n 
1 35  PRO n 
1 36  PHE n 
1 37  ALA n 
1 38  GLU n 
1 39  PRO n 
1 40  PRO n 
1 41  MET n 
1 42  GLY n 
1 43  PRO n 
1 44  ARG n 
1 45  ARG n 
1 46  PHE n 
1 47  LEU n 
1 48  PRO n 
1 49  PRO n 
1 50  GLU n 
1 51  PRO n 
1 52  LYS n 
1 53  GLN n 
1 54  PRO n 
1 55  TRP n 
1 56  SER n 
1 57  GLY n 
1 58  VAL n 
1 59  VAL n 
1 60  ASP n 
1 61  ALA n 
1 62  THR n 
1 63  THR n 
1 64  PHE n 
1 65  GLN n 
1 66  SER n 
1 67  VAL n 
1 68  CYS n 
1 69  TYR n 
1 70  GLN n 
1 71  TYR n 
1 72  VAL n 
1 73  ASP n 
1 74  THR n 
1 75  LEU n 
1 76  TYR n 
1 77  PRO n 
1 78  GLY n 
1 79  PHE n 
1 80  GLU n 
1 81  GLY n 
1 82  THR n 
1 83  GLU n 
1 84  MET n 
1 85  TRP n 
1 86  ASN n 
1 87  PRO n 
1 88  ASN n 
1 89  ARG n 
1 90  GLU n 
1 91  LEU n 
1 92  SER n 
1 93  GLU n 
1 94  ASP n 
1 95  CYS n 
1 96  LEU n 
1 97  TYR n 
1 98  LEU n 
1 99  ASN n 
1 100 VAL n 
1 101 TRP n 
1 102 THR n 
1 103 PRO n 
1 104 TYR n 
1 105 PRO n 
1 106 ARG n 
1 107 PRO n 
1 108 THR n 
1 109 SER n 
1 110 PRO n 
1 111 THR n 
1 112 PRO n 
1 113 VAL n 
1 114 LEU n 
1 115 VAL n 
1 116 TRP n 
1 117 ILE n 
1 118 TYR n 
1 119 GLY n 
1 120 GLY n 
1 121 GLY n 
1 122 PHE n 
1 123 TYR n 
1 124 SER n 
1 125 GLY n 
1 126 ALA n 
1 127 SER n 
1 128 SER n 
1 129 LEU n 
1 130 ASP n 
1 131 VAL n 
1 132 TYR n 
1 133 ASP n 
1 134 GLY n 
1 135 ARG n 
1 136 PHE n 
1 137 LEU n 
1 138 VAL n 
1 139 GLN n 
1 140 ALA n 
1 141 GLU n 
1 142 ARG n 
1 143 THR n 
1 144 VAL n 
1 145 LEU n 
1 146 VAL n 
1 147 SER n 
1 148 MET n 
1 149 ASN n 
1 150 TYR n 
1 151 ARG n 
1 152 VAL n 
1 153 GLY n 
1 154 ALA n 
1 155 PHE n 
1 156 GLY n 
1 157 PHE n 
1 158 LEU n 
1 159 ALA n 
1 160 LEU n 
1 161 PRO n 
1 162 GLY n 
1 163 SER n 
1 164 ARG n 
1 165 GLU n 
1 166 ALA n 
1 167 PRO n 
1 168 GLY n 
1 169 ASN n 
1 170 VAL n 
1 171 GLY n 
1 172 LEU n 
1 173 LEU n 
1 174 ASP n 
1 175 GLN n 
1 176 ARG n 
1 177 LEU n 
1 178 ALA n 
1 179 LEU n 
1 180 GLN n 
1 181 TRP n 
1 182 VAL n 
1 183 GLN n 
1 184 GLU n 
1 185 ASN n 
1 186 VAL n 
1 187 ALA n 
1 188 ALA n 
1 189 PHE n 
1 190 GLY n 
1 191 GLY n 
1 192 ASP n 
1 193 PRO n 
1 194 THR n 
1 195 SER n 
1 196 VAL n 
1 197 THR n 
1 198 LEU n 
1 199 PHE n 
1 200 GLY n 
1 201 GLU n 
1 202 SER n 
1 203 ALA n 
1 204 GLY n 
1 205 ALA n 
1 206 ALA n 
1 207 SER n 
1 208 VAL n 
1 209 GLY n 
1 210 MET n 
1 211 HIS n 
1 212 LEU n 
1 213 LEU n 
1 214 SER n 
1 215 PRO n 
1 216 PRO n 
1 217 SER n 
1 218 ARG n 
1 219 GLY n 
1 220 LEU n 
1 221 PHE n 
1 222 HIS n 
1 223 ARG n 
1 224 ALA n 
1 225 VAL n 
1 226 LEU n 
1 227 GLN n 
1 228 SER n 
1 229 GLY n 
1 230 ALA n 
1 231 PRO n 
1 232 ASN n 
1 233 GLY n 
1 234 PRO n 
1 235 TRP n 
1 236 ALA n 
1 237 THR n 
1 238 VAL n 
1 239 GLY n 
1 240 MET n 
1 241 GLY n 
1 242 GLU n 
1 243 ALA n 
1 244 ARG n 
1 245 ARG n 
1 246 ARG n 
1 247 ALA n 
1 248 THR n 
1 249 GLN n 
1 250 LEU n 
1 251 ALA n 
1 252 HIS n 
1 253 LEU n 
1 254 VAL n 
1 255 GLY n 
1 256 CYS n 
1 257 PRO n 
1 258 PRO n 
1 259 GLY n 
1 260 GLY n 
1 261 THR n 
1 262 GLY n 
1 263 GLY n 
1 264 ASN n 
1 265 ASP n 
1 266 THR n 
1 267 GLU n 
1 268 LEU n 
1 269 VAL n 
1 270 ALA n 
1 271 CYS n 
1 272 LEU n 
1 273 ARG n 
1 274 THR n 
1 275 ARG n 
1 276 PRO n 
1 277 ALA n 
1 278 GLN n 
1 279 VAL n 
1 280 LEU n 
1 281 VAL n 
1 282 ASN n 
1 283 HIS n 
1 284 GLU n 
1 285 TRP n 
1 286 HIS n 
1 287 VAL n 
1 288 LEU n 
1 289 PRO n 
1 290 GLN n 
1 291 GLU n 
1 292 SER n 
1 293 VAL n 
1 294 PHE n 
1 295 ARG n 
1 296 PHE n 
1 297 SER n 
1 298 PHE n 
1 299 VAL n 
1 300 PRO n 
1 301 VAL n 
1 302 VAL n 
1 303 ASP n 
1 304 GLY n 
1 305 ASP n 
1 306 PHE n 
1 307 LEU n 
1 308 SER n 
1 309 ASP n 
1 310 THR n 
1 311 PRO n 
1 312 GLU n 
1 313 ALA n 
1 314 LEU n 
1 315 ILE n 
1 316 ASN n 
1 317 ALA n 
1 318 GLY n 
1 319 ASP n 
1 320 PHE n 
1 321 HIS n 
1 322 GLY n 
1 323 LEU n 
1 324 GLN n 
1 325 VAL n 
1 326 LEU n 
1 327 VAL n 
1 328 GLY n 
1 329 VAL n 
1 330 VAL n 
1 331 LYS n 
1 332 ASP n 
1 333 GLU n 
1 334 GLY n 
1 335 SER n 
1 336 TYR n 
1 337 PHE n 
1 338 LEU n 
1 339 VAL n 
1 340 TYR n 
1 341 GLY n 
1 342 ALA n 
1 343 PRO n 
1 344 GLY n 
1 345 PHE n 
1 346 SER n 
1 347 LYS n 
1 348 ASP n 
1 349 ASN n 
1 350 GLU n 
1 351 SER n 
1 352 LEU n 
1 353 ILE n 
1 354 SER n 
1 355 ARG n 
1 356 ALA n 
1 357 GLU n 
1 358 PHE n 
1 359 LEU n 
1 360 ALA n 
1 361 GLY n 
1 362 VAL n 
1 363 ARG n 
1 364 VAL n 
1 365 GLY n 
1 366 VAL n 
1 367 PRO n 
1 368 GLN n 
1 369 VAL n 
1 370 SER n 
1 371 ASP n 
1 372 LEU n 
1 373 ALA n 
1 374 ALA n 
1 375 GLU n 
1 376 ALA n 
1 377 VAL n 
1 378 VAL n 
1 379 LEU n 
1 380 HIS n 
1 381 TYR n 
1 382 THR n 
1 383 ASP n 
1 384 TRP n 
1 385 LEU n 
1 386 HIS n 
1 387 PRO n 
1 388 GLU n 
1 389 ASP n 
1 390 PRO n 
1 391 ALA n 
1 392 ARG n 
1 393 LEU n 
1 394 ARG n 
1 395 GLU n 
1 396 ALA n 
1 397 LEU n 
1 398 SER n 
1 399 ASP n 
1 400 VAL n 
1 401 VAL n 
1 402 GLY n 
1 403 ASP n 
1 404 HIS n 
1 405 ASN n 
1 406 VAL n 
1 407 VAL n 
1 408 CYS n 
1 409 PRO n 
1 410 VAL n 
1 411 ALA n 
1 412 GLN n 
1 413 LEU n 
1 414 ALA n 
1 415 GLY n 
1 416 ARG n 
1 417 LEU n 
1 418 ALA n 
1 419 ALA n 
1 420 GLN n 
1 421 GLY n 
1 422 ALA n 
1 423 ARG n 
1 424 VAL n 
1 425 TYR n 
1 426 ALA n 
1 427 TYR n 
1 428 VAL n 
1 429 PHE n 
1 430 GLU n 
1 431 HIS n 
1 432 ARG n 
1 433 ALA n 
1 434 SER n 
1 435 THR n 
1 436 LEU n 
1 437 SER n 
1 438 TRP n 
1 439 PRO n 
1 440 LEU n 
1 441 TRP n 
1 442 MET n 
1 443 GLY n 
1 444 VAL n 
1 445 PRO n 
1 446 HIS n 
1 447 GLY n 
1 448 TYR n 
1 449 GLU n 
1 450 ILE n 
1 451 GLU n 
1 452 PHE n 
1 453 ILE n 
1 454 PHE n 
1 455 GLY n 
1 456 ILE n 
1 457 PRO n 
1 458 LEU n 
1 459 ASP n 
1 460 PRO n 
1 461 SER n 
1 462 ARG n 
1 463 ASN n 
1 464 TYR n 
1 465 THR n 
1 466 ALA n 
1 467 GLU n 
1 468 GLU n 
1 469 LYS n 
1 470 ILE n 
1 471 PHE n 
1 472 ALA n 
1 473 GLN n 
1 474 ARG n 
1 475 LEU n 
1 476 MET n 
1 477 ARG n 
1 478 TYR n 
1 479 TRP n 
1 480 ALA n 
1 481 ASN n 
1 482 PHE n 
1 483 ALA n 
1 484 ARG n 
1 485 THR n 
1 486 GLY n 
1 487 ASP n 
1 488 PRO n 
1 489 ASN n 
1 490 GLU n 
1 491 PRO n 
1 492 ARG n 
1 493 ASP n 
1 494 PRO n 
1 495 LYS n 
1 496 ALA n 
1 497 PRO n 
1 498 GLN n 
1 499 TRP n 
1 500 PRO n 
1 501 PRO n 
1 502 TYR n 
1 503 THR n 
1 504 ALA n 
1 505 GLY n 
1 506 ALA n 
1 507 GLN n 
1 508 GLN n 
1 509 TYR n 
1 510 VAL n 
1 511 SER n 
1 512 LEU n 
1 513 ASP n 
1 514 LEU n 
1 515 ARG n 
1 516 PRO n 
1 517 LEU n 
1 518 GLU n 
1 519 VAL n 
1 520 ARG n 
1 521 ARG n 
1 522 GLY n 
1 523 LEU n 
1 524 ARG n 
1 525 ALA n 
1 526 GLN n 
1 527 ALA n 
1 528 CYS n 
1 529 ALA n 
1 530 PHE n 
1 531 TRP n 
1 532 ASN n 
1 533 ARG n 
1 534 PHE n 
1 535 LEU n 
1 536 PRO n 
1 537 LYS n 
1 538 LEU n 
1 539 LEU n 
1 540 SER n 
1 541 ALA n 
1 542 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ACHE 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK-293 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_HUMAN 
_struct_ref.pdbx_db_accession          P22303 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_struct_ref.pdbx_align_begin           33 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4EY6 A 1 ? 542 ? P22303 33 ? 574 ? 2 543 
2 1 4EY6 B 1 ? 542 ? P22303 33 ? 574 ? 2 543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                       ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                      ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                    ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                               ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'           y CYSTEINE                                      ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer                   . 1,2-ETHANEDIOL                                'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                          ?                 'C6 H12 O5'      164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                     ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                               ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                       ?                 'C2 H5 N O2'     75.067  
GNT non-polymer                   . '(-)-GALANTHAMINE'                            ?                 'C17 H21 N O3'   287.354 
HIS 'L-peptide linking'           y HISTIDINE                                     ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                         ?                 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                    ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                       ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                        ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE                                    ?                 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose      ?                 'C8 H15 N O6'    221.208 
NO3 non-polymer                   . 'NITRATE ION'                                 ?                 'N O3 -1'        62.005  
PE8 non-polymer                   . 3,6,9,12,15,18,21-HEPTAOXATRICOSANE-1,23-DIOL ?                 'C16 H34 O9'     370.436 
PHE 'L-peptide linking'           y PHENYLALANINE                                 ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                       ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                        ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                     ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                    ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                      ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                        ?                 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4EY6 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.33 
_exptl_crystal.density_percent_sol   71.57 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'12 to 18% PEG 3350, 0.2M potassium nitrate, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 295K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2012-01-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.075 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.075 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4EY6 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.398 
_reflns.number_obs                   81569 
_reflns.number_all                   82061 
_reflns.percent_possible_obs         99.400 
_reflns.pdbx_Rmerge_I_obs            0.070 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.700 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.percent_possible_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_redundancy 
1 1  2.398 2.440  99.300  0.505 ? ? 3.800 
1 2  2.440 2.490  99.200  0.436 ? ? 3.700 
1 3  2.490 2.530  99.400  0.364 ? ? 3.700 
1 4  2.530 2.590  99.300  0.327 ? ? 3.700 
1 5  2.590 2.640  99.500  0.298 ? ? 3.700 
1 6  2.640 2.700  99.500  0.246 ? ? 3.700 
1 7  2.700 2.770  99.600  0.219 ? ? 3.700 
1 8  2.770 2.850  99.600  0.186 ? ? 3.700 
1 9  2.850 2.930  99.600  0.154 ? ? 3.700 
1 10 2.930 3.020  99.900  0.122 ? ? 3.700 
1 11 3.020 3.130  99.900  0.102 ? ? 3.700 
1 12 3.130 3.260  100.000 0.086 ? ? 3.700 
1 13 3.260 3.410  99.900  0.069 ? ? 3.700 
1 14 3.410 3.580  99.900  0.058 ? ? 3.700 
1 15 3.580 3.810  99.800  0.050 ? ? 3.600 
1 16 3.810 4.100  99.700  0.049 ? ? 3.600 
1 17 4.100 4.520  99.500  0.049 ? ? 3.600 
1 18 4.520 5.170  99.300  0.044 ? ? 3.600 
1 19 5.170 6.510  99.300  0.037 ? ? 3.400 
1 20 6.510 50.000 95.500  0.026 ? ? 3.600 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4EY6 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     81467 
_refine.ls_number_reflns_all                     86150 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             47.191 
_refine.ls_d_res_high                            2.3983 
_refine.ls_percent_reflns_obs                    99.27 
_refine.ls_R_factor_obs                          0.1691 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1671 
_refine.ls_R_factor_R_free                       0.2059 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.99 
_refine.ls_number_reflns_R_free                  4062 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            0.300 
_refine.occupancy_max                            1.000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            7.7748 
_refine.aniso_B[2][2]                            7.7748 
_refine.aniso_B[3][3]                            -15.5496 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             1.10 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 4EY7' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.25 
_refine.pdbx_overall_phase_error                 21.09 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8284 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         177 
_refine_hist.number_atoms_solvent             385 
_refine_hist.number_atoms_total               8846 
_refine_hist.d_res_high                       2.3983 
_refine_hist.d_res_low                        47.191 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.007  ? ? 8824  'X-RAY DIFFRACTION' ? 
f_angle_d          1.133  ? ? 12060 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 16.362 ? ? 3226  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.076  ? ? 1293  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 1581  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.3983 2.4265  2600 0.2286 97.00  0.2856 . . 131 . . 
'X-RAY DIFFRACTION' . 2.4265 2.4561  2635 0.2205 99.00  0.2540 . . 137 . . 
'X-RAY DIFFRACTION' . 2.4561 2.4872  2558 0.2222 99.00  0.2933 . . 171 . . 
'X-RAY DIFFRACTION' . 2.4872 2.5199  2638 0.2106 99.00  0.3031 . . 135 . . 
'X-RAY DIFFRACTION' . 2.5199 2.5544  2660 0.2106 99.00  0.2772 . . 127 . . 
'X-RAY DIFFRACTION' . 2.5544 2.5909  2625 0.2122 99.00  0.2800 . . 132 . . 
'X-RAY DIFFRACTION' . 2.5909 2.6296  2652 0.2062 100.00 0.2951 . . 153 . . 
'X-RAY DIFFRACTION' . 2.6296 2.6707  2624 0.2002 99.00  0.2889 . . 142 . . 
'X-RAY DIFFRACTION' . 2.6707 2.7145  2609 0.1910 99.00  0.2216 . . 147 . . 
'X-RAY DIFFRACTION' . 2.7145 2.7613  2711 0.1917 100.00 0.2442 . . 123 . . 
'X-RAY DIFFRACTION' . 2.7613 2.8115  2595 0.1901 100.00 0.2395 . . 152 . . 
'X-RAY DIFFRACTION' . 2.8115 2.8655  2650 0.1798 100.00 0.2592 . . 143 . . 
'X-RAY DIFFRACTION' . 2.8655 2.9240  2694 0.1839 100.00 0.2224 . . 122 . . 
'X-RAY DIFFRACTION' . 2.9240 2.9876  2650 0.1794 100.00 0.2291 . . 132 . . 
'X-RAY DIFFRACTION' . 2.9876 3.0571  2658 0.1786 100.00 0.2322 . . 140 . . 
'X-RAY DIFFRACTION' . 3.0571 3.1335  2684 0.1781 100.00 0.2637 . . 142 . . 
'X-RAY DIFFRACTION' . 3.1335 3.2182  2636 0.1843 100.00 0.2372 . . 129 . . 
'X-RAY DIFFRACTION' . 3.2182 3.3129  2701 0.1867 100.00 0.2334 . . 142 . . 
'X-RAY DIFFRACTION' . 3.3129 3.4198  2663 0.1763 100.00 0.2183 . . 152 . . 
'X-RAY DIFFRACTION' . 3.4198 3.5420  2667 0.1725 100.00 0.2102 . . 144 . . 
'X-RAY DIFFRACTION' . 3.5420 3.6837  2697 0.1683 100.00 0.1993 . . 134 . . 
'X-RAY DIFFRACTION' . 3.6837 3.8513  2688 0.1546 100.00 0.1881 . . 148 . . 
'X-RAY DIFFRACTION' . 3.8513 4.0543  2722 0.1421 100.00 0.1673 . . 132 . . 
'X-RAY DIFFRACTION' . 4.0543 4.3081  2694 0.1390 100.00 0.1587 . . 139 . . 
'X-RAY DIFFRACTION' . 4.3081 4.6405  2697 0.1257 99.00  0.1626 . . 146 . . 
'X-RAY DIFFRACTION' . 4.6405 5.1070  2710 0.1292 99.00  0.1320 . . 127 . . 
'X-RAY DIFFRACTION' . 5.1070 5.8448  2755 0.1527 100.00 0.1730 . . 160 . . 
'X-RAY DIFFRACTION' . 5.8448 7.3593  2758 0.1653 99.00  0.1872 . . 142 . . 
'X-RAY DIFFRACTION' . 7.3593 47.2001 2774 0.1582 94.00  0.1815 . . 138 . . 
# 
_struct.entry_id                  4EY6 
_struct.title                     'Crystal Structure of Recombinant Human Acetylcholinesterase in Complex with (-)-galantamine' 
_struct.pdbx_descriptor           'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4EY6 
_struct_keywords.text            
'acetylcholinesterase, hydrolase, galantamine, inhibitor, galanthamine, HYDROLASE-HYDROLASE INHIBITOR complex' 
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE INHIBITOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 5 ? 
I N N 3 ? 
J N N 4 ? 
K N N 6 ? 
L N N 6 ? 
M N N 7 ? 
N N N 8 ? 
O N N 8 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 4   ? GLU A 6   ? ASP A 5   GLU A 7   5 ? 3  
HELX_P HELX_P2  2  MET A 41  ? ARG A 45  ? MET A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  3  PHE A 79  ? MET A 84  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  4  LEU A 129 ? ASP A 133 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  5  GLY A 134 ? ARG A 142 ? GLY A 135 ARG A 143 1 ? 9  
HELX_P HELX_P6  6  VAL A 152 ? LEU A 158 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  7  ASN A 169 ? VAL A 186 ? ASN A 170 VAL A 187 1 ? 18 
HELX_P HELX_P8  8  ALA A 187 ? PHE A 189 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  9  SER A 202 ? LEU A 213 ? SER A 203 LEU A 214 1 ? 12 
HELX_P HELX_P10 10 SER A 214 ? GLY A 219 ? SER A 215 GLY A 220 1 ? 6  
HELX_P HELX_P11 11 MET A 240 ? VAL A 254 ? MET A 241 VAL A 255 1 ? 15 
HELX_P HELX_P12 12 ASP A 265 ? THR A 274 ? ASP A 266 THR A 275 1 ? 10 
HELX_P HELX_P13 13 PRO A 276 ? HIS A 283 ? PRO A 277 HIS A 284 1 ? 8  
HELX_P HELX_P14 14 GLU A 284 ? LEU A 288 ? GLU A 285 LEU A 289 5 ? 5  
HELX_P HELX_P15 15 THR A 310 ? ALA A 317 ? THR A 311 ALA A 318 1 ? 8  
HELX_P HELX_P16 16 GLY A 334 ? VAL A 339 ? GLY A 335 VAL A 340 1 ? 6  
HELX_P HELX_P17 17 SER A 354 ? VAL A 366 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 18 SER A 370 ? THR A 382 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 19 ASP A 389 ? VAL A 406 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 20 VAL A 406 ? GLN A 420 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P21 21 PRO A 439 ? GLY A 443 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 22 GLU A 449 ? PHE A 454 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 23 GLY A 455 ? ASP A 459 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P24 24 THR A 465 ? GLY A 486 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P25 25 ARG A 524 ? ARG A 533 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P26 26 ARG A 533 ? SER A 540 ? ARG A 534 SER A 541 1 ? 8  
HELX_P HELX_P27 27 ASP B 4   ? GLU B 6   ? ASP B 5   GLU B 7   5 ? 3  
HELX_P HELX_P28 28 MET B 41  ? ARG B 45  ? MET B 42  ARG B 46  5 ? 5  
HELX_P HELX_P29 29 PHE B 79  ? MET B 84  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P30 30 LEU B 129 ? ASP B 133 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P31 31 GLY B 134 ? ARG B 142 ? GLY B 135 ARG B 143 1 ? 9  
HELX_P HELX_P32 32 VAL B 152 ? LEU B 158 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P33 33 ASN B 169 ? VAL B 186 ? ASN B 170 VAL B 187 1 ? 18 
HELX_P HELX_P34 34 ALA B 187 ? PHE B 189 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P35 35 SER B 202 ? LEU B 213 ? SER B 203 LEU B 214 1 ? 12 
HELX_P HELX_P36 36 SER B 214 ? GLY B 219 ? SER B 215 GLY B 220 1 ? 6  
HELX_P HELX_P37 37 MET B 240 ? VAL B 254 ? MET B 241 VAL B 255 1 ? 15 
HELX_P HELX_P38 38 ASN B 264 ? ARG B 273 ? ASN B 265 ARG B 274 1 ? 10 
HELX_P HELX_P39 39 PRO B 276 ? GLU B 284 ? PRO B 277 GLU B 285 1 ? 9  
HELX_P HELX_P40 40 TRP B 285 ? LEU B 288 ? TRP B 286 LEU B 289 5 ? 4  
HELX_P HELX_P41 41 THR B 310 ? ALA B 317 ? THR B 311 ALA B 318 1 ? 8  
HELX_P HELX_P42 42 GLY B 334 ? VAL B 339 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P43 43 SER B 354 ? VAL B 366 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P44 44 SER B 370 ? THR B 382 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P45 45 ASP B 389 ? VAL B 406 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P46 46 VAL B 406 ? GLN B 420 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P47 47 PRO B 439 ? GLY B 443 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P48 48 GLU B 449 ? PHE B 454 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P49 49 GLY B 455 ? ASP B 459 ? GLY B 456 ASP B 460 5 ? 5  
HELX_P HELX_P50 50 THR B 465 ? GLY B 486 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P51 51 ARG B 524 ? ARG B 533 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P52 52 PHE B 534 ? ALA B 541 ? PHE B 535 ALA B 542 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 68  SG  ? ? ? 1_555 A CYS 95  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.057 ? ?               
disulf2 disulf ?    ? A CYS 256 SG  ? ? ? 1_555 A CYS 271 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.059 ? ?               
disulf3 disulf ?    ? A CYS 408 SG  ? ? ? 1_555 A CYS 528 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf4 disulf ?    ? B CYS 68  SG  ? ? ? 1_555 B CYS 95  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.069 ? ?               
disulf5 disulf ?    ? B CYS 256 SG  ? ? ? 1_555 B CYS 271 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.061 ? ?               
disulf6 disulf ?    ? B CYS 408 SG  ? ? ? 1_555 B CYS 528 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.037 ? ?               
covale1 covale one  ? A ASN 349 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 350 C NAG 1   1_555 ? ? ? ? ? ? ? 1.487 ? N-Glycosylation 
covale2 covale one  ? B ASN 264 ND2 ? ? ? 1_555 H NAG .   C1 ? ? B ASN 265 B NAG 604 1_555 ? ? ? ? ? ? ? 1.511 ? N-Glycosylation 
covale3 covale one  ? B ASN 349 ND2 ? ? ? 1_555 D NAG .   C1 ? ? B ASN 350 D NAG 1   1_555 ? ? ? ? ? ? ? 1.461 ? N-Glycosylation 
covale4 covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1 ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.477 ? ?               
covale5 covale both ? C NAG .   O6  ? ? ? 1_555 C FUC .   C1 ? ? C NAG 1   C FUC 3   1_555 ? ? ? ? ? ? ? 1.458 ? ?               
covale6 covale both ? D NAG .   O4  ? ? ? 1_555 D NAG .   C1 ? ? D NAG 1   D NAG 2   1_555 ? ? ? ? ? ? ? 1.506 ? ?               
covale7 covale both ? D NAG .   O6  ? ? ? 1_555 D FUC .   C1 ? ? D NAG 1   D FUC 3   1_555 ? ? ? ? ? ? ? 1.471 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 104 A . ? TYR 105 A PRO 105 A ? PRO 106 A 1 -0.94 
2 TYR 104 B . ? TYR 105 B PRO 105 B ? PRO 106 B 1 4.10  
3 CYS 256 B . ? CYS 257 B PRO 257 B ? PRO 258 B 1 -4.97 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
C ? 2  ? 
D ? 2  ? 
E ? 3  ? 
F ? 11 ? 
G ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? anti-parallel 
C 1  2  ? parallel      
D 1  2  ? parallel      
E 1  2  ? anti-parallel 
E 2  3  ? parallel      
F 1  2  ? anti-parallel 
F 2  3  ? anti-parallel 
F 3  4  ? anti-parallel 
F 4  5  ? parallel      
F 5  6  ? parallel      
F 6  7  ? parallel      
F 7  8  ? parallel      
F 8  9  ? parallel      
F 9  10 ? parallel      
F 10 11 ? anti-parallel 
G 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 8   ? VAL A 11  ? LEU A 9   VAL A 12  
A 2  GLY A 14  ? ARG A 17  ? GLY A 15  ARG A 18  
A 3  VAL A 58  ? ASP A 60  ? VAL A 59  ASP A 61  
B 1  ILE A 19  ? LEU A 21  ? ILE A 20  LEU A 22  
B 2  VAL A 28  ? PRO A 35  ? VAL A 29  PRO A 36  
B 3  TYR A 97  ? PRO A 103 ? TYR A 98  PRO A 104 
B 4  VAL A 144 ? MET A 148 ? VAL A 145 MET A 149 
B 5  THR A 111 ? ILE A 117 ? THR A 112 ILE A 118 
B 6  GLY A 191 ? GLU A 201 ? GLY A 192 GLU A 202 
B 7  ARG A 223 ? GLN A 227 ? ARG A 224 GLN A 228 
B 8  GLN A 324 ? VAL A 330 ? GLN A 325 VAL A 331 
B 9  ARG A 423 ? PHE A 429 ? ARG A 424 PHE A 430 
B 10 GLN A 508 ? LEU A 512 ? GLN A 509 LEU A 513 
B 11 GLU A 518 ? ARG A 521 ? GLU A 519 ARG A 522 
C 1  VAL A 67  ? CYS A 68  ? VAL A 68  CYS A 69  
C 2  LEU A 91  ? SER A 92  ? LEU A 92  SER A 93  
D 1  VAL A 238 ? GLY A 239 ? VAL A 239 GLY A 240 
D 2  VAL A 301 ? VAL A 302 ? VAL A 302 VAL A 303 
E 1  LEU B 8   ? VAL B 11  ? LEU B 9   VAL B 12  
E 2  GLY B 14  ? ARG B 17  ? GLY B 15  ARG B 18  
E 3  VAL B 58  ? ASP B 60  ? VAL B 59  ASP B 61  
F 1  ILE B 19  ? LEU B 21  ? ILE B 20  LEU B 22  
F 2  VAL B 28  ? PRO B 35  ? VAL B 29  PRO B 36  
F 3  TYR B 97  ? PRO B 103 ? TYR B 98  PRO B 104 
F 4  VAL B 144 ? MET B 148 ? VAL B 145 MET B 149 
F 5  THR B 111 ? ILE B 117 ? THR B 112 ILE B 118 
F 6  GLY B 191 ? GLU B 201 ? GLY B 192 GLU B 202 
F 7  ARG B 223 ? GLN B 227 ? ARG B 224 GLN B 228 
F 8  GLN B 324 ? VAL B 330 ? GLN B 325 VAL B 331 
F 9  ARG B 423 ? PHE B 429 ? ARG B 424 PHE B 430 
F 10 GLN B 508 ? LEU B 512 ? GLN B 509 LEU B 513 
F 11 GLU B 518 ? ARG B 521 ? GLU B 519 ARG B 522 
G 1  VAL B 238 ? GLY B 239 ? VAL B 239 GLY B 240 
G 2  VAL B 301 ? VAL B 302 ? VAL B 302 VAL B 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N VAL A 9   ? N VAL A 10  O LEU A 16  ? O LEU A 17  
A 2  3  N ARG A 15  ? N ARG A 16  O VAL A 59  ? O VAL A 60  
B 1  2  N LEU A 21  ? N LEU A 22  O VAL A 28  ? O VAL A 29  
B 2  3  N PHE A 31  ? N PHE A 32  O VAL A 100 ? O VAL A 101 
B 3  4  N ASN A 99  ? N ASN A 100 O SER A 147 ? O SER A 148 
B 4  5  O VAL A 146 ? O VAL A 147 N TRP A 116 ? N TRP A 117 
B 5  6  N VAL A 113 ? N VAL A 114 O THR A 197 ? O THR A 198 
B 6  7  N LEU A 198 ? N LEU A 199 O ARG A 223 ? O ARG A 224 
B 7  8  N LEU A 226 ? N LEU A 227 O LEU A 326 ? O LEU A 327 
B 8  9  N VAL A 327 ? N VAL A 328 O TYR A 425 ? O TYR A 426 
B 9  10 N VAL A 428 ? N VAL A 429 O LEU A 512 ? O LEU A 513 
B 10 11 N TYR A 509 ? N TYR A 510 O ARG A 520 ? O ARG A 521 
C 1  2  N VAL A 67  ? N VAL A 68  O SER A 92  ? O SER A 93  
D 1  2  N VAL A 238 ? N VAL A 239 O VAL A 302 ? O VAL A 303 
E 1  2  N VAL B 9   ? N VAL B 10  O LEU B 16  ? O LEU B 17  
E 2  3  N ARG B 15  ? N ARG B 16  O VAL B 59  ? O VAL B 60  
F 1  2  N LEU B 21  ? N LEU B 22  O VAL B 28  ? O VAL B 29  
F 2  3  N PHE B 31  ? N PHE B 32  O VAL B 100 ? O VAL B 101 
F 3  4  N ASN B 99  ? N ASN B 100 O SER B 147 ? O SER B 148 
F 4  5  O VAL B 144 ? O VAL B 145 N LEU B 114 ? N LEU B 115 
F 5  6  N THR B 111 ? N THR B 112 O ASP B 192 ? O ASP B 193 
F 6  7  N GLY B 200 ? N GLY B 201 O GLN B 227 ? O GLN B 228 
F 7  8  N LEU B 226 ? N LEU B 227 O LEU B 326 ? O LEU B 327 
F 8  9  N VAL B 327 ? N VAL B 328 O TYR B 425 ? O TYR B 426 
F 9  10 N VAL B 428 ? N VAL B 429 O LEU B 512 ? O LEU B 513 
F 10 11 N TYR B 509 ? N TYR B 510 O ARG B 520 ? O ARG B 521 
G 1  2  N VAL B 238 ? N VAL B 239 O VAL B 302 ? O VAL B 303 
# 
_atom_sites.entry_id                    4EY6 
_atom_sites.fract_transf_matrix[1][1]   0.009526 
_atom_sites.fract_transf_matrix[1][2]   0.005500 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003092 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 3   ? 2.253   -35.720 69.605  1.00 74.14  ? 4   GLU A N   1 
ATOM   2    C CA  . GLU A 1 3   ? 2.134   -35.119 68.279  1.00 78.35  ? 4   GLU A CA  1 
ATOM   3    C C   . GLU A 1 3   ? 3.344   -35.478 67.411  1.00 77.27  ? 4   GLU A C   1 
ATOM   4    O O   . GLU A 1 3   ? 4.489   -35.257 67.815  1.00 70.15  ? 4   GLU A O   1 
ATOM   5    C CB  . GLU A 1 3   ? 1.993   -33.599 68.399  1.00 83.47  ? 4   GLU A CB  1 
ATOM   6    C CG  . GLU A 1 3   ? 1.684   -32.879 67.094  1.00 80.31  ? 4   GLU A CG  1 
ATOM   7    C CD  . GLU A 1 3   ? 0.235   -33.030 66.665  1.00 97.74  ? 4   GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 3   ? -0.559  -33.598 67.448  1.00 98.67  ? 4   GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 3   ? -0.109  -32.578 65.547  1.00 92.53  ? 4   GLU A OE2 1 
ATOM   10   N N   . ASP A 1 4   ? 3.088   -36.032 66.223  1.00 61.08  ? 5   ASP A N   1 
ATOM   11   C CA  . ASP A 1 4   ? 4.161   -36.507 65.343  1.00 52.37  ? 5   ASP A CA  1 
ATOM   12   C C   . ASP A 1 4   ? 4.697   -35.401 64.437  1.00 61.28  ? 5   ASP A C   1 
ATOM   13   O O   . ASP A 1 4   ? 4.029   -34.985 63.488  1.00 46.93  ? 5   ASP A O   1 
ATOM   14   C CB  . ASP A 1 4   ? 3.686   -37.689 64.495  1.00 41.20  ? 5   ASP A CB  1 
ATOM   15   C CG  . ASP A 1 4   ? 4.836   -38.459 63.862  1.00 49.18  ? 5   ASP A CG  1 
ATOM   16   O OD1 . ASP A 1 4   ? 4.617   -39.630 63.472  1.00 42.13  ? 5   ASP A OD1 1 
ATOM   17   O OD2 . ASP A 1 4   ? 5.957   -37.905 63.759  1.00 52.03  ? 5   ASP A OD2 1 
ATOM   18   N N   . ALA A 1 5   ? 5.917   -34.951 64.725  1.00 57.72  ? 6   ALA A N   1 
ATOM   19   C CA  . ALA A 1 5   ? 6.513   -33.824 64.020  1.00 52.56  ? 6   ALA A CA  1 
ATOM   20   C C   . ALA A 1 5   ? 6.826   -34.154 62.562  1.00 52.36  ? 6   ALA A C   1 
ATOM   21   O O   . ALA A 1 5   ? 7.015   -33.252 61.743  1.00 56.27  ? 6   ALA A O   1 
ATOM   22   C CB  . ALA A 1 5   ? 7.771   -33.353 64.743  1.00 36.69  ? 6   ALA A CB  1 
ATOM   23   N N   . GLU A 1 6   ? 6.886   -35.443 62.244  1.00 50.43  ? 7   GLU A N   1 
ATOM   24   C CA  . GLU A 1 6   ? 7.169   -35.881 60.881  1.00 51.40  ? 7   GLU A CA  1 
ATOM   25   C C   . GLU A 1 6   ? 6.028   -35.508 59.937  1.00 47.02  ? 7   GLU A C   1 
ATOM   26   O O   . GLU A 1 6   ? 6.216   -35.387 58.726  1.00 42.42  ? 7   GLU A O   1 
ATOM   27   C CB  . GLU A 1 6   ? 7.409   -37.391 60.848  1.00 55.56  ? 7   GLU A CB  1 
ATOM   28   C CG  . GLU A 1 6   ? 8.678   -37.831 61.563  1.00 50.94  ? 7   GLU A CG  1 
ATOM   29   C CD  . GLU A 1 6   ? 9.942   -37.351 60.865  1.00 62.03  ? 7   GLU A CD  1 
ATOM   30   O OE1 . GLU A 1 6   ? 9.919   -37.173 59.624  1.00 48.71  ? 7   GLU A OE1 1 
ATOM   31   O OE2 . GLU A 1 6   ? 10.961  -37.152 61.562  1.00 71.93  ? 7   GLU A OE2 1 
ATOM   32   N N   . LEU A 1 7   ? 4.851   -35.310 60.516  1.00 35.41  ? 8   LEU A N   1 
ATOM   33   C CA  . LEU A 1 7   ? 3.644   -35.004 59.768  1.00 33.94  ? 8   LEU A CA  1 
ATOM   34   C C   . LEU A 1 7   ? 3.289   -33.518 59.806  1.00 38.59  ? 8   LEU A C   1 
ATOM   35   O O   . LEU A 1 7   ? 2.180   -33.122 59.434  1.00 36.47  ? 8   LEU A O   1 
ATOM   36   C CB  . LEU A 1 7   ? 2.488   -35.826 60.331  1.00 38.81  ? 8   LEU A CB  1 
ATOM   37   C CG  . LEU A 1 7   ? 2.801   -37.322 60.413  1.00 44.85  ? 8   LEU A CG  1 
ATOM   38   C CD1 . LEU A 1 7   ? 1.637   -38.056 61.035  1.00 39.64  ? 8   LEU A CD1 1 
ATOM   39   C CD2 . LEU A 1 7   ? 3.123   -37.886 59.022  1.00 32.56  ? 8   LEU A CD2 1 
ATOM   40   N N   . LEU A 1 8   ? 4.230   -32.698 60.267  1.00 33.56  ? 9   LEU A N   1 
ATOM   41   C CA  . LEU A 1 8   ? 4.037   -31.255 60.264  1.00 35.46  ? 9   LEU A CA  1 
ATOM   42   C C   . LEU A 1 8   ? 5.023   -30.671 59.281  1.00 34.74  ? 9   LEU A C   1 
ATOM   43   O O   . LEU A 1 8   ? 6.209   -30.984 59.331  1.00 33.66  ? 9   LEU A O   1 
ATOM   44   C CB  . LEU A 1 8   ? 4.252   -30.664 61.655  1.00 33.76  ? 9   LEU A CB  1 
ATOM   45   C CG  . LEU A 1 8   ? 3.303   -31.176 62.743  1.00 46.31  ? 9   LEU A CG  1 
ATOM   46   C CD1 . LEU A 1 8   ? 3.642   -30.555 64.100  1.00 35.10  ? 9   LEU A CD1 1 
ATOM   47   C CD2 . LEU A 1 8   ? 1.849   -30.906 62.374  1.00 38.07  ? 9   LEU A CD2 1 
ATOM   48   N N   . VAL A 1 9   ? 4.520   -29.862 58.353  1.00 35.29  ? 10  VAL A N   1 
ATOM   49   C CA  . VAL A 1 9   ? 5.349   -29.271 57.308  1.00 29.67  ? 10  VAL A CA  1 
ATOM   50   C C   . VAL A 1 9   ? 4.904   -27.841 57.093  1.00 27.32  ? 10  VAL A C   1 
ATOM   51   O O   . VAL A 1 9   ? 3.715   -27.529 57.167  1.00 33.67  ? 10  VAL A O   1 
ATOM   52   C CB  . VAL A 1 9   ? 5.219   -30.041 55.971  1.00 35.06  ? 10  VAL A CB  1 
ATOM   53   C CG1 . VAL A 1 9   ? 6.016   -29.364 54.862  1.00 32.64  ? 10  VAL A CG1 1 
ATOM   54   C CG2 . VAL A 1 9   ? 5.680   -31.462 56.135  1.00 41.52  ? 10  VAL A CG2 1 
ATOM   55   N N   . THR A 1 10  ? 5.863   -26.968 56.838  1.00 34.65  ? 11  THR A N   1 
ATOM   56   C CA  . THR A 1 10  ? 5.557   -25.592 56.515  1.00 34.09  ? 11  THR A CA  1 
ATOM   57   C C   . THR A 1 10  ? 5.976   -25.337 55.077  1.00 38.46  ? 11  THR A C   1 
ATOM   58   O O   . THR A 1 10  ? 7.133   -25.537 54.709  1.00 36.53  ? 11  THR A O   1 
ATOM   59   C CB  . THR A 1 10  ? 6.276   -24.613 57.479  1.00 39.85  ? 11  THR A CB  1 
ATOM   60   O OG1 . THR A 1 10  ? 5.782   -24.804 58.814  1.00 42.68  ? 11  THR A OG1 1 
ATOM   61   C CG2 . THR A 1 10  ? 6.028   -23.175 57.073  1.00 26.88  ? 11  THR A CG2 1 
ATOM   62   N N   . VAL A 1 11  ? 5.021   -24.925 54.254  1.00 27.16  ? 12  VAL A N   1 
ATOM   63   C CA  . VAL A 1 11  ? 5.332   -24.552 52.887  1.00 32.33  ? 12  VAL A CA  1 
ATOM   64   C C   . VAL A 1 11  ? 5.092   -23.058 52.784  1.00 35.29  ? 12  VAL A C   1 
ATOM   65   O O   . VAL A 1 11  ? 4.620   -22.440 53.742  1.00 37.77  ? 12  VAL A O   1 
ATOM   66   C CB  . VAL A 1 11  ? 4.465   -25.334 51.874  1.00 32.61  ? 12  VAL A CB  1 
ATOM   67   C CG1 . VAL A 1 11  ? 4.784   -26.817 51.967  1.00 26.81  ? 12  VAL A CG1 1 
ATOM   68   C CG2 . VAL A 1 11  ? 2.972   -25.093 52.133  1.00 22.61  ? 12  VAL A CG2 1 
ATOM   69   N N   . ARG A 1 12  ? 5.421   -22.484 51.635  1.00 27.46  ? 13  ARG A N   1 
ATOM   70   C CA  . ARG A 1 12  ? 5.324   -21.043 51.430  1.00 32.88  ? 13  ARG A CA  1 
ATOM   71   C C   . ARG A 1 12  ? 4.000   -20.449 51.866  1.00 34.10  ? 13  ARG A C   1 
ATOM   72   O O   . ARG A 1 12  ? 3.967   -19.388 52.470  1.00 50.58  ? 13  ARG A O   1 
ATOM   73   C CB  . ARG A 1 12  ? 5.614   -20.679 49.965  1.00 27.78  ? 13  ARG A CB  1 
ATOM   74   C CG  . ARG A 1 12  ? 7.084   -20.871 49.627  1.00 36.51  ? 13  ARG A CG  1 
ATOM   75   C CD  . ARG A 1 12  ? 7.533   -20.149 48.371  1.00 51.92  ? 13  ARG A CD  1 
ATOM   76   N NE  . ARG A 1 12  ? 8.869   -20.598 47.979  1.00 63.67  ? 13  ARG A NE  1 
ATOM   77   C CZ  . ARG A 1 12  ? 9.549   -20.139 46.933  1.00 66.77  ? 13  ARG A CZ  1 
ATOM   78   N NH1 . ARG A 1 12  ? 9.030   -19.198 46.154  1.00 65.51  ? 13  ARG A NH1 1 
ATOM   79   N NH2 . ARG A 1 12  ? 10.757  -20.625 46.668  1.00 69.36  ? 13  ARG A NH2 1 
ATOM   80   N N   . GLY A 1 13  ? 2.907   -21.137 51.573  1.00 39.32  ? 14  GLY A N   1 
ATOM   81   C CA  . GLY A 1 13  ? 1.597   -20.600 51.878  1.00 33.33  ? 14  GLY A CA  1 
ATOM   82   C C   . GLY A 1 13  ? 1.204   -20.763 53.333  1.00 34.99  ? 14  GLY A C   1 
ATOM   83   O O   . GLY A 1 13  ? 0.227   -20.167 53.779  1.00 36.96  ? 14  GLY A O   1 
ATOM   84   N N   . GLY A 1 14  ? 1.946   -21.583 54.074  1.00 30.31  ? 15  GLY A N   1 
ATOM   85   C CA  . GLY A 1 14  ? 1.593   -21.858 55.458  1.00 32.24  ? 15  GLY A CA  1 
ATOM   86   C C   . GLY A 1 14  ? 1.877   -23.274 55.931  1.00 31.29  ? 15  GLY A C   1 
ATOM   87   O O   . GLY A 1 14  ? 2.664   -24.003 55.322  1.00 38.76  ? 15  GLY A O   1 
ATOM   88   N N   . ARG A 1 15  ? 1.214   -23.662 57.016  1.00 30.20  ? 16  ARG A N   1 
ATOM   89   C CA  . ARG A 1 15  ? 1.487   -24.922 57.702  1.00 40.73  ? 16  ARG A CA  1 
ATOM   90   C C   . ARG A 1 15  ? 0.522   -26.054 57.326  1.00 40.24  ? 16  ARG A C   1 
ATOM   91   O O   . ARG A 1 15  ? -0.672  -25.822 57.118  1.00 35.25  ? 16  ARG A O   1 
ATOM   92   C CB  . ARG A 1 15  ? 1.446   -24.705 59.220  1.00 39.68  ? 16  ARG A CB  1 
ATOM   93   C CG  . ARG A 1 15  ? 2.658   -23.995 59.813  1.00 49.22  ? 16  ARG A CG  1 
ATOM   94   C CD  . ARG A 1 15  ? 2.513   -23.836 61.346  1.00 47.91  ? 16  ARG A CD  1 
ATOM   95   N NE  . ARG A 1 15  ? 1.413   -22.938 61.689  1.00 50.38  ? 16  ARG A NE  1 
ATOM   96   C CZ  . ARG A 1 15  ? 0.670   -23.031 62.788  1.00 60.05  ? 16  ARG A CZ  1 
ATOM   97   N NH1 . ARG A 1 15  ? 0.894   -23.993 63.676  1.00 54.30  ? 16  ARG A NH1 1 
ATOM   98   N NH2 . ARG A 1 15  ? -0.308  -22.160 62.997  1.00 61.08  ? 16  ARG A NH2 1 
ATOM   99   N N   . LEU A 1 16  ? 1.051   -27.277 57.284  1.00 31.95  ? 17  LEU A N   1 
ATOM   100  C CA  . LEU A 1 16  ? 0.288   -28.467 56.910  1.00 37.45  ? 17  LEU A CA  1 
ATOM   101  C C   . LEU A 1 16  ? 0.385   -29.560 57.964  1.00 32.86  ? 17  LEU A C   1 
ATOM   102  O O   . LEU A 1 16  ? 1.416   -29.720 58.620  1.00 35.26  ? 17  LEU A O   1 
ATOM   103  C CB  . LEU A 1 16  ? 0.830   -29.061 55.598  1.00 28.87  ? 17  LEU A CB  1 
ATOM   104  C CG  . LEU A 1 16  ? 0.879   -28.169 54.367  1.00 29.77  ? 17  LEU A CG  1 
ATOM   105  C CD1 . LEU A 1 16  ? 1.530   -28.906 53.205  1.00 27.05  ? 17  LEU A CD1 1 
ATOM   106  C CD2 . LEU A 1 16  ? -0.535  -27.738 54.015  1.00 34.59  ? 17  LEU A CD2 1 
ATOM   107  N N   . ARG A 1 17  ? -0.679  -30.341 58.082  1.00 31.97  ? 18  ARG A N   1 
ATOM   108  C CA  . ARG A 1 17  ? -0.659  -31.563 58.875  1.00 34.81  ? 18  ARG A CA  1 
ATOM   109  C C   . ARG A 1 17  ? -0.947  -32.788 58.000  1.00 38.34  ? 18  ARG A C   1 
ATOM   110  O O   . ARG A 1 17  ? -2.044  -32.938 57.444  1.00 30.48  ? 18  ARG A O   1 
ATOM   111  C CB  . ARG A 1 17  ? -1.687  -31.478 60.003  1.00 34.98  ? 18  ARG A CB  1 
ATOM   112  C CG  . ARG A 1 17  ? -1.797  -32.732 60.861  1.00 49.14  ? 18  ARG A CG  1 
ATOM   113  C CD  . ARG A 1 17  ? -2.688  -32.460 62.072  1.00 68.82  ? 18  ARG A CD  1 
ATOM   114  N NE  . ARG A 1 17  ? -3.785  -31.548 61.736  1.00 65.39  ? 18  ARG A NE  1 
ATOM   115  C CZ  . ARG A 1 17  ? -4.996  -31.937 61.338  1.00 64.50  ? 18  ARG A CZ  1 
ATOM   116  N NH1 . ARG A 1 17  ? -5.285  -33.234 61.237  1.00 51.93  ? 18  ARG A NH1 1 
ATOM   117  N NH2 . ARG A 1 17  ? -5.923  -31.030 61.049  1.00 54.13  ? 18  ARG A NH2 1 
ATOM   118  N N   . GLY A 1 18  ? 0.039   -33.669 57.885  1.00 31.48  ? 19  GLY A N   1 
ATOM   119  C CA  . GLY A 1 18  ? -0.143  -34.894 57.133  1.00 38.49  ? 19  GLY A CA  1 
ATOM   120  C C   . GLY A 1 18  ? -0.683  -36.060 57.942  1.00 39.41  ? 19  GLY A C   1 
ATOM   121  O O   . GLY A 1 18  ? -1.292  -35.882 58.995  1.00 35.06  ? 19  GLY A O   1 
ATOM   122  N N   . ILE A 1 19  ? -0.444  -37.260 57.428  1.00 37.26  ? 20  ILE A N   1 
ATOM   123  C CA  . ILE A 1 19  ? -0.952  -38.490 58.012  1.00 24.77  ? 20  ILE A CA  1 
ATOM   124  C C   . ILE A 1 19  ? 0.018   -39.614 57.665  1.00 35.16  ? 20  ILE A C   1 
ATOM   125  O O   . ILE A 1 19  ? 0.606   -39.634 56.578  1.00 37.88  ? 20  ILE A O   1 
ATOM   126  C CB  . ILE A 1 19  ? -2.361  -38.828 57.480  1.00 34.13  ? 20  ILE A CB  1 
ATOM   127  C CG1 . ILE A 1 19  ? -2.966  -40.003 58.250  1.00 30.31  ? 20  ILE A CG1 1 
ATOM   128  C CG2 . ILE A 1 19  ? -2.335  -39.123 55.946  1.00 28.95  ? 20  ILE A CG2 1 
ATOM   129  C CD1 . ILE A 1 19  ? -4.431  -40.269 57.896  1.00 24.48  ? 20  ILE A CD1 1 
ATOM   130  N N   . ARG A 1 20  ? 0.200   -40.528 58.609  1.00 39.87  ? 21  ARG A N   1 
ATOM   131  C CA  . ARG A 1 20  ? 1.060   -41.686 58.430  1.00 39.61  ? 21  ARG A CA  1 
ATOM   132  C C   . ARG A 1 20  ? 0.235   -42.782 57.767  1.00 35.74  ? 21  ARG A C   1 
ATOM   133  O O   . ARG A 1 20  ? -0.897  -43.039 58.163  1.00 39.09  ? 21  ARG A O   1 
ATOM   134  C CB  . ARG A 1 20  ? 1.573   -42.154 59.795  1.00 34.27  ? 21  ARG A CB  1 
ATOM   135  C CG  . ARG A 1 20  ? 2.974   -42.744 59.782  1.00 42.83  ? 21  ARG A CG  1 
ATOM   136  C CD  . ARG A 1 20  ? 3.510   -42.946 61.215  1.00 53.64  ? 21  ARG A CD  1 
ATOM   137  N NE  . ARG A 1 20  ? 2.480   -43.483 62.100  1.00 46.65  ? 21  ARG A NE  1 
ATOM   138  C CZ  . ARG A 1 20  ? 2.036   -42.873 63.191  1.00 46.88  ? 21  ARG A CZ  1 
ATOM   139  N NH1 . ARG A 1 20  ? 2.547   -41.701 63.569  1.00 37.43  ? 21  ARG A NH1 1 
ATOM   140  N NH2 . ARG A 1 20  ? 1.081   -43.443 63.909  1.00 53.61  ? 21  ARG A NH2 1 
ATOM   141  N N   . LEU A 1 21  ? 0.784   -43.410 56.739  1.00 30.17  ? 22  LEU A N   1 
ATOM   142  C CA  . LEU A 1 21  ? 0.073   -44.484 56.064  1.00 38.42  ? 22  LEU A CA  1 
ATOM   143  C C   . LEU A 1 21  ? 0.870   -45.760 56.228  1.00 40.02  ? 22  LEU A C   1 
ATOM   144  O O   . LEU A 1 21  ? 2.101   -45.719 56.266  1.00 36.86  ? 22  LEU A O   1 
ATOM   145  C CB  . LEU A 1 21  ? -0.097  -44.186 54.564  1.00 33.69  ? 22  LEU A CB  1 
ATOM   146  C CG  . LEU A 1 21  ? -0.893  -42.959 54.110  1.00 41.46  ? 22  LEU A CG  1 
ATOM   147  C CD1 . LEU A 1 21  ? -0.918  -42.865 52.587  1.00 40.34  ? 22  LEU A CD1 1 
ATOM   148  C CD2 . LEU A 1 21  ? -2.301  -42.984 54.672  1.00 31.14  ? 22  LEU A CD2 1 
ATOM   149  N N   . LYS A 1 22  ? 0.169   -46.888 56.305  1.00 35.22  ? 23  LYS A N   1 
ATOM   150  C CA  . LYS A 1 22  ? 0.817   -48.191 56.369  1.00 30.89  ? 23  LYS A CA  1 
ATOM   151  C C   . LYS A 1 22  ? 0.966   -48.825 54.989  1.00 30.03  ? 23  LYS A C   1 
ATOM   152  O O   . LYS A 1 22  ? 0.139   -48.611 54.105  1.00 36.62  ? 23  LYS A O   1 
ATOM   153  C CB  . LYS A 1 22  ? 0.007   -49.131 57.257  1.00 33.19  ? 23  LYS A CB  1 
ATOM   154  C CG  . LYS A 1 22  ? -0.190  -48.634 58.677  1.00 42.54  ? 23  LYS A CG  1 
ATOM   155  C CD  . LYS A 1 22  ? -0.995  -49.640 59.486  1.00 39.22  ? 23  LYS A CD  1 
ATOM   156  C CE  . LYS A 1 22  ? -2.405  -49.775 58.947  1.00 37.79  ? 23  LYS A CE  1 
ATOM   157  N NZ  . LYS A 1 22  ? -3.056  -51.042 59.388  1.00 49.30  ? 23  LYS A NZ  1 
ATOM   158  N N   . THR A 1 23  ? 2.035   -49.596 54.820  1.00 26.99  ? 24  THR A N   1 
ATOM   159  C CA  . THR A 1 23  ? 2.226   -50.478 53.677  1.00 30.86  ? 24  THR A CA  1 
ATOM   160  C C   . THR A 1 23  ? 2.835   -51.756 54.239  1.00 38.55  ? 24  THR A C   1 
ATOM   161  O O   . THR A 1 23  ? 3.349   -51.757 55.356  1.00 33.17  ? 24  THR A O   1 
ATOM   162  C CB  . THR A 1 23  ? 3.233   -49.911 52.632  1.00 31.48  ? 24  THR A CB  1 
ATOM   163  O OG1 . THR A 1 23  ? 4.577   -50.197 53.050  1.00 30.04  ? 24  THR A OG1 1 
ATOM   164  C CG2 . THR A 1 23  ? 3.057   -48.422 52.433  1.00 28.36  ? 24  THR A CG2 1 
ATOM   165  N N   . PRO A 1 24  ? 2.804   -52.849 53.464  1.00 34.05  ? 25  PRO A N   1 
ATOM   166  C CA  . PRO A 1 24  ? 3.460   -54.081 53.912  1.00 35.51  ? 25  PRO A CA  1 
ATOM   167  C C   . PRO A 1 24  ? 4.959   -53.928 54.161  1.00 33.34  ? 25  PRO A C   1 
ATOM   168  O O   . PRO A 1 24  ? 5.543   -54.800 54.793  1.00 43.69  ? 25  PRO A O   1 
ATOM   169  C CB  . PRO A 1 24  ? 3.233   -55.034 52.741  1.00 35.55  ? 25  PRO A CB  1 
ATOM   170  C CG  . PRO A 1 24  ? 2.000   -54.553 52.112  1.00 43.47  ? 25  PRO A CG  1 
ATOM   171  C CD  . PRO A 1 24  ? 2.005   -53.063 52.249  1.00 35.92  ? 25  PRO A CD  1 
ATOM   172  N N   . GLY A 1 25  ? 5.571   -52.853 53.671  1.00 31.42  ? 26  GLY A N   1 
ATOM   173  C CA  . GLY A 1 25  ? 6.998   -52.637 53.873  1.00 31.27  ? 26  GLY A CA  1 
ATOM   174  C C   . GLY A 1 25  ? 7.350   -51.567 54.901  1.00 35.85  ? 26  GLY A C   1 
ATOM   175  O O   . GLY A 1 25  ? 8.514   -51.191 55.045  1.00 34.84  ? 26  GLY A O   1 
ATOM   176  N N   . GLY A 1 26  ? 6.350   -51.078 55.627  1.00 26.25  ? 27  GLY A N   1 
ATOM   177  C CA  . GLY A 1 26  ? 6.580   -50.013 56.583  1.00 31.76  ? 27  GLY A CA  1 
ATOM   178  C C   . GLY A 1 26  ? 5.833   -48.731 56.259  1.00 38.90  ? 27  GLY A C   1 
ATOM   179  O O   . GLY A 1 26  ? 5.262   -48.590 55.175  1.00 37.81  ? 27  GLY A O   1 
ATOM   180  N N   . PRO A 1 27  ? 5.836   -47.780 57.203  1.00 31.68  ? 28  PRO A N   1 
ATOM   181  C CA  . PRO A 1 27  ? 5.063   -46.547 57.042  1.00 27.57  ? 28  PRO A CA  1 
ATOM   182  C C   . PRO A 1 27  ? 5.558   -45.633 55.926  1.00 37.55  ? 28  PRO A C   1 
ATOM   183  O O   . PRO A 1 27  ? 6.667   -45.750 55.399  1.00 30.39  ? 28  PRO A O   1 
ATOM   184  C CB  . PRO A 1 27  ? 5.233   -45.841 58.397  1.00 26.05  ? 28  PRO A CB  1 
ATOM   185  C CG  . PRO A 1 27  ? 6.470   -46.415 58.971  1.00 29.02  ? 28  PRO A CG  1 
ATOM   186  C CD  . PRO A 1 27  ? 6.509   -47.843 58.511  1.00 24.13  ? 28  PRO A CD  1 
ATOM   187  N N   . VAL A 1 28  ? 4.704   -44.682 55.594  1.00 27.80  ? 29  VAL A N   1 
ATOM   188  C CA  . VAL A 1 28  ? 5.015   -43.697 54.593  1.00 26.52  ? 29  VAL A CA  1 
ATOM   189  C C   . VAL A 1 28  ? 4.334   -42.434 55.096  1.00 28.48  ? 29  VAL A C   1 
ATOM   190  O O   . VAL A 1 28  ? 3.359   -42.526 55.850  1.00 29.70  ? 29  VAL A O   1 
ATOM   191  C CB  . VAL A 1 28  ? 4.469   -44.183 53.228  1.00 29.43  ? 29  VAL A CB  1 
ATOM   192  C CG1 . VAL A 1 28  ? 3.805   -43.076 52.458  1.00 29.25  ? 29  VAL A CG1 1 
ATOM   193  C CG2 . VAL A 1 28  ? 5.572   -44.876 52.431  1.00 23.96  ? 29  VAL A CG2 1 
ATOM   194  N N   . SER A 1 29  ? 4.855   -41.261 54.743  1.00 27.14  ? 30  SER A N   1 
ATOM   195  C CA  . SER A 1 29  ? 4.171   -40.016 55.104  1.00 33.67  ? 30  SER A CA  1 
ATOM   196  C C   . SER A 1 29  ? 3.376   -39.493 53.911  1.00 32.72  ? 30  SER A C   1 
ATOM   197  O O   . SER A 1 29  ? 3.884   -39.436 52.798  1.00 32.27  ? 30  SER A O   1 
ATOM   198  C CB  . SER A 1 29  ? 5.158   -38.943 55.562  1.00 31.41  ? 30  SER A CB  1 
ATOM   199  O OG  . SER A 1 29  ? 6.111   -39.449 56.479  1.00 45.57  ? 30  SER A OG  1 
ATOM   200  N N   . ALA A 1 30  ? 2.138   -39.090 54.159  1.00 29.67  ? 31  ALA A N   1 
ATOM   201  C CA  . ALA A 1 30  ? 1.288   -38.562 53.111  1.00 28.12  ? 31  ALA A CA  1 
ATOM   202  C C   . ALA A 1 30  ? 0.704   -37.211 53.503  1.00 38.45  ? 31  ALA A C   1 
ATOM   203  O O   . ALA A 1 30  ? 0.270   -37.003 54.640  1.00 29.65  ? 31  ALA A O   1 
ATOM   204  C CB  . ALA A 1 30  ? 0.176   -39.533 52.796  1.00 25.45  ? 31  ALA A CB  1 
ATOM   205  N N   . PHE A 1 31  ? 0.702   -36.298 52.540  1.00 32.37  ? 32  PHE A N   1 
ATOM   206  C CA  . PHE A 1 31  ? 0.088   -34.996 52.704  1.00 25.41  ? 32  PHE A CA  1 
ATOM   207  C C   . PHE A 1 31  ? -0.874  -34.848 51.541  1.00 32.63  ? 32  PHE A C   1 
ATOM   208  O O   . PHE A 1 31  ? -0.458  -34.720 50.376  1.00 31.80  ? 32  PHE A O   1 
ATOM   209  C CB  . PHE A 1 31  ? 1.153   -33.898 52.729  1.00 23.32  ? 32  PHE A CB  1 
ATOM   210  C CG  . PHE A 1 31  ? 2.171   -34.086 53.822  1.00 27.78  ? 32  PHE A CG  1 
ATOM   211  C CD1 . PHE A 1 31  ? 3.250   -34.944 53.648  1.00 33.86  ? 32  PHE A CD1 1 
ATOM   212  C CD2 . PHE A 1 31  ? 2.040   -33.426 55.031  1.00 32.93  ? 32  PHE A CD2 1 
ATOM   213  C CE1 . PHE A 1 31  ? 4.187   -35.134 54.661  1.00 37.95  ? 32  PHE A CE1 1 
ATOM   214  C CE2 . PHE A 1 31  ? 2.970   -33.615 56.058  1.00 36.97  ? 32  PHE A CE2 1 
ATOM   215  C CZ  . PHE A 1 31  ? 4.042   -34.468 55.868  1.00 32.36  ? 32  PHE A CZ  1 
ATOM   216  N N   . LEU A 1 32  ? -2.163  -34.920 51.864  1.00 21.88  ? 33  LEU A N   1 
ATOM   217  C CA  . LEU A 1 32  ? -3.208  -35.047 50.864  1.00 27.10  ? 33  LEU A CA  1 
ATOM   218  C C   . LEU A 1 32  ? -4.136  -33.861 50.932  1.00 26.34  ? 33  LEU A C   1 
ATOM   219  O O   . LEU A 1 32  ? -4.531  -33.451 52.016  1.00 26.50  ? 33  LEU A O   1 
ATOM   220  C CB  . LEU A 1 32  ? -4.015  -36.322 51.118  1.00 27.27  ? 33  LEU A CB  1 
ATOM   221  C CG  . LEU A 1 32  ? -3.210  -37.604 51.329  1.00 25.38  ? 33  LEU A CG  1 
ATOM   222  C CD1 . LEU A 1 32  ? -4.141  -38.776 51.571  1.00 27.35  ? 33  LEU A CD1 1 
ATOM   223  C CD2 . LEU A 1 32  ? -2.312  -37.870 50.136  1.00 25.52  ? 33  LEU A CD2 1 
ATOM   224  N N   . GLY A 1 33  ? -4.511  -33.324 49.777  1.00 22.15  ? 34  GLY A N   1 
ATOM   225  C CA  . GLY A 1 33  ? -5.457  -32.222 49.747  1.00 17.12  ? 34  GLY A CA  1 
ATOM   226  C C   . GLY A 1 33  ? -4.791  -30.894 50.077  1.00 28.68  ? 34  GLY A C   1 
ATOM   227  O O   . GLY A 1 33  ? -5.382  -30.053 50.748  1.00 28.68  ? 34  GLY A O   1 
ATOM   228  N N   . ILE A 1 34  ? -3.552  -30.709 49.626  1.00 26.06  ? 35  ILE A N   1 
ATOM   229  C CA  . ILE A 1 34  ? -2.871  -29.422 49.763  1.00 26.81  ? 35  ILE A CA  1 
ATOM   230  C C   . ILE A 1 34  ? -3.348  -28.477 48.663  1.00 28.47  ? 35  ILE A C   1 
ATOM   231  O O   . ILE A 1 34  ? -3.142  -28.747 47.482  1.00 32.68  ? 35  ILE A O   1 
ATOM   232  C CB  . ILE A 1 34  ? -1.364  -29.572 49.557  1.00 23.63  ? 35  ILE A CB  1 
ATOM   233  C CG1 . ILE A 1 34  ? -0.798  -30.707 50.402  1.00 23.31  ? 35  ILE A CG1 1 
ATOM   234  C CG2 . ILE A 1 34  ? -0.653  -28.267 49.837  1.00 22.99  ? 35  ILE A CG2 1 
ATOM   235  C CD1 . ILE A 1 34  ? 0.683   -30.916 50.170  1.00 18.41  ? 35  ILE A CD1 1 
ATOM   236  N N   . PRO A 1 35  ? -3.977  -27.359 49.038  1.00 29.06  ? 36  PRO A N   1 
ATOM   237  C CA  . PRO A 1 35  ? -4.417  -26.377 48.031  1.00 21.80  ? 36  PRO A CA  1 
ATOM   238  C C   . PRO A 1 35  ? -3.237  -25.699 47.325  1.00 30.13  ? 36  PRO A C   1 
ATOM   239  O O   . PRO A 1 35  ? -2.338  -25.204 48.002  1.00 28.64  ? 36  PRO A O   1 
ATOM   240  C CB  . PRO A 1 35  ? -5.180  -25.351 48.862  1.00 27.12  ? 36  PRO A CB  1 
ATOM   241  C CG  . PRO A 1 35  ? -4.554  -25.456 50.246  1.00 27.12  ? 36  PRO A CG  1 
ATOM   242  C CD  . PRO A 1 35  ? -4.245  -26.916 50.419  1.00 24.32  ? 36  PRO A CD  1 
ATOM   243  N N   . PHE A 1 36  ? -3.237  -25.684 45.991  1.00 22.10  ? 37  PHE A N   1 
ATOM   244  C CA  . PHE A 1 36  ? -2.167  -25.023 45.247  1.00 26.90  ? 37  PHE A CA  1 
ATOM   245  C C   . PHE A 1 36  ? -2.677  -23.875 44.380  1.00 26.55  ? 37  PHE A C   1 
ATOM   246  O O   . PHE A 1 36  ? -1.890  -23.099 43.854  1.00 31.31  ? 37  PHE A O   1 
ATOM   247  C CB  . PHE A 1 36  ? -1.331  -26.022 44.431  1.00 30.33  ? 37  PHE A CB  1 
ATOM   248  C CG  . PHE A 1 36  ? -2.051  -26.620 43.240  1.00 22.78  ? 37  PHE A CG  1 
ATOM   249  C CD1 . PHE A 1 36  ? -2.017  -25.987 41.996  1.00 20.35  ? 37  PHE A CD1 1 
ATOM   250  C CD2 . PHE A 1 36  ? -2.719  -27.837 43.352  1.00 25.19  ? 37  PHE A CD2 1 
ATOM   251  C CE1 . PHE A 1 36  ? -2.665  -26.546 40.877  1.00 29.03  ? 37  PHE A CE1 1 
ATOM   252  C CE2 . PHE A 1 36  ? -3.371  -28.408 42.244  1.00 26.18  ? 37  PHE A CE2 1 
ATOM   253  C CZ  . PHE A 1 36  ? -3.341  -27.754 40.997  1.00 22.40  ? 37  PHE A CZ  1 
ATOM   254  N N   . ALA A 1 37  ? -3.995  -23.753 44.259  1.00 27.23  ? 38  ALA A N   1 
ATOM   255  C CA  . ALA A 1 37  ? -4.591  -22.621 43.562  1.00 23.35  ? 38  ALA A CA  1 
ATOM   256  C C   . ALA A 1 37  ? -5.746  -22.045 44.357  1.00 27.84  ? 38  ALA A C   1 
ATOM   257  O O   . ALA A 1 37  ? -6.305  -22.714 45.214  1.00 27.30  ? 38  ALA A O   1 
ATOM   258  C CB  . ALA A 1 37  ? -5.076  -23.038 42.164  1.00 20.18  ? 38  ALA A CB  1 
ATOM   259  N N   . GLU A 1 38  ? -6.106  -20.799 44.068  1.00 29.83  ? 39  GLU A N   1 
ATOM   260  C CA  . GLU A 1 38  ? -7.378  -20.262 44.525  1.00 29.10  ? 39  GLU A CA  1 
ATOM   261  C C   . GLU A 1 38  ? -8.491  -21.039 43.819  1.00 35.49  ? 39  GLU A C   1 
ATOM   262  O O   . GLU A 1 38  ? -8.382  -21.325 42.625  1.00 31.12  ? 39  GLU A O   1 
ATOM   263  C CB  . GLU A 1 38  ? -7.481  -18.775 44.176  1.00 32.86  ? 39  GLU A CB  1 
ATOM   264  C CG  . GLU A 1 38  ? -6.671  -17.873 45.086  1.00 43.84  ? 39  GLU A CG  1 
ATOM   265  C CD  . GLU A 1 38  ? -7.157  -17.934 46.520  1.00 39.00  ? 39  GLU A CD  1 
ATOM   266  O OE1 . GLU A 1 38  ? -8.363  -17.702 46.743  1.00 53.02  ? 39  GLU A OE1 1 
ATOM   267  O OE2 . GLU A 1 38  ? -6.343  -18.239 47.418  1.00 39.83  ? 39  GLU A OE2 1 
ATOM   268  N N   . PRO A 1 39  ? -9.553  -21.404 44.551  1.00 36.06  ? 40  PRO A N   1 
ATOM   269  C CA  . PRO A 1 39  ? -10.683 -22.109 43.923  1.00 25.01  ? 40  PRO A CA  1 
ATOM   270  C C   . PRO A 1 39  ? -11.160 -21.421 42.638  1.00 33.76  ? 40  PRO A C   1 
ATOM   271  O O   . PRO A 1 39  ? -11.556 -20.256 42.671  1.00 37.78  ? 40  PRO A O   1 
ATOM   272  C CB  . PRO A 1 39  ? -11.764 -22.044 44.996  1.00 26.48  ? 40  PRO A CB  1 
ATOM   273  C CG  . PRO A 1 39  ? -10.966 -22.045 46.314  1.00 28.33  ? 40  PRO A CG  1 
ATOM   274  C CD  . PRO A 1 39  ? -9.686  -21.305 46.020  1.00 28.64  ? 40  PRO A CD  1 
ATOM   275  N N   . PRO A 1 40  ? -11.104 -22.134 41.504  1.00 33.68  ? 41  PRO A N   1 
ATOM   276  C CA  . PRO A 1 40  ? -11.475 -21.529 40.222  1.00 37.40  ? 41  PRO A CA  1 
ATOM   277  C C   . PRO A 1 40  ? -12.993 -21.508 40.041  1.00 38.48  ? 41  PRO A C   1 
ATOM   278  O O   . PRO A 1 40  ? -13.522 -22.137 39.124  1.00 35.56  ? 41  PRO A O   1 
ATOM   279  C CB  . PRO A 1 40  ? -10.810 -22.451 39.202  1.00 27.85  ? 41  PRO A CB  1 
ATOM   280  C CG  . PRO A 1 40  ? -10.783 -23.793 39.872  1.00 28.70  ? 41  PRO A CG  1 
ATOM   281  C CD  . PRO A 1 40  ? -10.713 -23.549 41.362  1.00 29.95  ? 41  PRO A CD  1 
ATOM   282  N N   . MET A 1 41  ? -13.675 -20.776 40.916  1.00 36.95  ? 42  MET A N   1 
ATOM   283  C CA  . MET A 1 41  ? -15.134 -20.755 40.950  1.00 41.51  ? 42  MET A CA  1 
ATOM   284  C C   . MET A 1 41  ? -15.727 -19.392 40.598  1.00 37.31  ? 42  MET A C   1 
ATOM   285  O O   . MET A 1 41  ? -15.027 -18.373 40.619  1.00 41.41  ? 42  MET A O   1 
ATOM   286  C CB  . MET A 1 41  ? -15.620 -21.138 42.345  1.00 42.27  ? 42  MET A CB  1 
ATOM   287  C CG  . MET A 1 41  ? -14.880 -22.292 42.970  1.00 39.99  ? 42  MET A CG  1 
ATOM   288  S SD  . MET A 1 41  ? -15.908 -23.021 44.240  1.00 65.43  ? 42  MET A SD  1 
ATOM   289  C CE  . MET A 1 41  ? -17.293 -23.573 43.246  1.00 53.36  ? 42  MET A CE  1 
ATOM   290  N N   . GLY A 1 42  ? -17.029 -19.382 40.312  1.00 31.42  ? 43  GLY A N   1 
ATOM   291  C CA  . GLY A 1 42  ? -17.743 -18.154 40.005  1.00 30.50  ? 43  GLY A CA  1 
ATOM   292  C C   . GLY A 1 42  ? -17.110 -17.453 38.823  1.00 37.28  ? 43  GLY A C   1 
ATOM   293  O O   . GLY A 1 42  ? -17.010 -18.031 37.746  1.00 34.15  ? 43  GLY A O   1 
ATOM   294  N N   . PRO A 1 43  ? -16.654 -16.211 39.029  1.00 37.39  ? 44  PRO A N   1 
ATOM   295  C CA  . PRO A 1 43  ? -15.969 -15.431 37.990  1.00 30.85  ? 44  PRO A CA  1 
ATOM   296  C C   . PRO A 1 43  ? -14.685 -16.104 37.511  1.00 41.89  ? 44  PRO A C   1 
ATOM   297  O O   . PRO A 1 43  ? -14.235 -15.839 36.386  1.00 39.81  ? 44  PRO A O   1 
ATOM   298  C CB  . PRO A 1 43  ? -15.655 -14.100 38.690  1.00 37.85  ? 44  PRO A CB  1 
ATOM   299  C CG  . PRO A 1 43  ? -15.761 -14.399 40.178  1.00 32.40  ? 44  PRO A CG  1 
ATOM   300  C CD  . PRO A 1 43  ? -16.786 -15.474 40.299  1.00 32.42  ? 44  PRO A CD  1 
ATOM   301  N N   . ARG A 1 44  ? -14.120 -16.981 38.339  1.00 36.10  ? 45  ARG A N   1 
ATOM   302  C CA  . ARG A 1 44  ? -12.868 -17.659 37.989  1.00 37.20  ? 45  ARG A CA  1 
ATOM   303  C C   . ARG A 1 44  ? -12.984 -18.906 37.103  1.00 34.05  ? 45  ARG A C   1 
ATOM   304  O O   . ARG A 1 44  ? -11.968 -19.425 36.636  1.00 33.79  ? 45  ARG A O   1 
ATOM   305  C CB  . ARG A 1 44  ? -12.068 -18.000 39.242  1.00 37.69  ? 45  ARG A CB  1 
ATOM   306  C CG  . ARG A 1 44  ? -11.441 -16.796 39.909  1.00 46.54  ? 45  ARG A CG  1 
ATOM   307  C CD  . ARG A 1 44  ? -10.107 -17.172 40.522  1.00 64.49  ? 45  ARG A CD  1 
ATOM   308  N NE  . ARG A 1 44  ? -9.970  -16.688 41.891  1.00 65.38  ? 45  ARG A NE  1 
ATOM   309  C CZ  . ARG A 1 44  ? -9.500  -15.489 42.217  1.00 76.18  ? 45  ARG A CZ  1 
ATOM   310  N NH1 . ARG A 1 44  ? -9.126  -14.641 41.266  1.00 73.88  ? 45  ARG A NH1 1 
ATOM   311  N NH2 . ARG A 1 44  ? -9.403  -15.138 43.493  1.00 65.39  ? 45  ARG A NH2 1 
ATOM   312  N N   . ARG A 1 45  ? -14.200 -19.394 36.880  1.00 31.26  ? 46  ARG A N   1 
ATOM   313  C CA  . ARG A 1 45  ? -14.404 -20.526 35.977  1.00 34.06  ? 46  ARG A CA  1 
ATOM   314  C C   . ARG A 1 45  ? -13.877 -20.184 34.576  1.00 28.53  ? 46  ARG A C   1 
ATOM   315  O O   . ARG A 1 45  ? -14.056 -19.061 34.115  1.00 36.64  ? 46  ARG A O   1 
ATOM   316  C CB  . ARG A 1 45  ? -15.886 -20.909 35.928  1.00 29.20  ? 46  ARG A CB  1 
ATOM   317  C CG  . ARG A 1 45  ? -16.225 -21.954 34.878  1.00 34.24  ? 46  ARG A CG  1 
ATOM   318  C CD  . ARG A 1 45  ? -17.727 -22.143 34.752  1.00 31.44  ? 46  ARG A CD  1 
ATOM   319  N NE  . ARG A 1 45  ? -18.295 -22.887 35.875  1.00 35.07  ? 46  ARG A NE  1 
ATOM   320  C CZ  . ARG A 1 45  ? -19.599 -23.046 36.077  1.00 39.37  ? 46  ARG A CZ  1 
ATOM   321  N NH1 . ARG A 1 45  ? -20.466 -22.503 35.230  1.00 39.17  ? 46  ARG A NH1 1 
ATOM   322  N NH2 . ARG A 1 45  ? -20.036 -23.744 37.120  1.00 26.61  ? 46  ARG A NH2 1 
ATOM   323  N N   . PHE A 1 46  ? -13.205 -21.143 33.934  1.00 29.31  ? 47  PHE A N   1 
ATOM   324  C CA  . PHE A 1 46  ? -12.590 -20.968 32.607  1.00 30.81  ? 47  PHE A CA  1 
ATOM   325  C C   . PHE A 1 46  ? -11.315 -20.110 32.605  1.00 35.27  ? 47  PHE A C   1 
ATOM   326  O O   . PHE A 1 46  ? -10.608 -20.044 31.594  1.00 34.07  ? 47  PHE A O   1 
ATOM   327  C CB  . PHE A 1 46  ? -13.579 -20.392 31.577  1.00 32.20  ? 47  PHE A CB  1 
ATOM   328  C CG  . PHE A 1 46  ? -14.890 -21.123 31.499  1.00 34.49  ? 47  PHE A CG  1 
ATOM   329  C CD1 . PHE A 1 46  ? -14.929 -22.498 31.316  1.00 25.12  ? 47  PHE A CD1 1 
ATOM   330  C CD2 . PHE A 1 46  ? -16.088 -20.427 31.601  1.00 30.82  ? 47  PHE A CD2 1 
ATOM   331  C CE1 . PHE A 1 46  ? -16.135 -23.162 31.233  1.00 30.82  ? 47  PHE A CE1 1 
ATOM   332  C CE2 . PHE A 1 46  ? -17.301 -21.081 31.514  1.00 21.70  ? 47  PHE A CE2 1 
ATOM   333  C CZ  . PHE A 1 46  ? -17.330 -22.450 31.337  1.00 30.86  ? 47  PHE A CZ  1 
ATOM   334  N N   . LEU A 1 47  ? -11.027 -19.439 33.716  1.00 26.04  ? 48  LEU A N   1 
ATOM   335  C CA  . LEU A 1 47  ? -9.838  -18.595 33.787  1.00 33.05  ? 48  LEU A CA  1 
ATOM   336  C C   . LEU A 1 47  ? -8.604  -19.400 34.201  1.00 34.35  ? 48  LEU A C   1 
ATOM   337  O O   . LEU A 1 47  ? -8.725  -20.459 34.811  1.00 33.10  ? 48  LEU A O   1 
ATOM   338  C CB  . LEU A 1 47  ? -10.055 -17.416 34.742  1.00 32.12  ? 48  LEU A CB  1 
ATOM   339  C CG  . LEU A 1 47  ? -11.029 -16.302 34.333  1.00 37.25  ? 48  LEU A CG  1 
ATOM   340  C CD1 . LEU A 1 47  ? -10.863 -15.089 35.248  1.00 24.82  ? 48  LEU A CD1 1 
ATOM   341  C CD2 . LEU A 1 47  ? -10.828 -15.904 32.894  1.00 34.60  ? 48  LEU A CD2 1 
ATOM   342  N N   . PRO A 1 48  ? -7.407  -18.908 33.847  1.00 35.54  ? 49  PRO A N   1 
ATOM   343  C CA  . PRO A 1 48  ? -6.185  -19.564 34.318  1.00 27.03  ? 49  PRO A CA  1 
ATOM   344  C C   . PRO A 1 48  ? -6.168  -19.591 35.828  1.00 33.82  ? 49  PRO A C   1 
ATOM   345  O O   . PRO A 1 48  ? -6.794  -18.735 36.455  1.00 35.60  ? 49  PRO A O   1 
ATOM   346  C CB  . PRO A 1 48  ? -5.082  -18.649 33.798  1.00 24.42  ? 49  PRO A CB  1 
ATOM   347  C CG  . PRO A 1 48  ? -5.668  -18.061 32.549  1.00 33.55  ? 49  PRO A CG  1 
ATOM   348  C CD  . PRO A 1 48  ? -7.117  -17.832 32.882  1.00 30.35  ? 49  PRO A CD  1 
ATOM   349  N N   . PRO A 1 49  ? -5.465  -20.568 36.413  1.00 31.19  ? 50  PRO A N   1 
ATOM   350  C CA  . PRO A 1 49  ? -5.414  -20.713 37.867  1.00 29.13  ? 50  PRO A CA  1 
ATOM   351  C C   . PRO A 1 49  ? -4.623  -19.585 38.529  1.00 39.05  ? 50  PRO A C   1 
ATOM   352  O O   . PRO A 1 49  ? -3.604  -19.149 38.001  1.00 36.90  ? 50  PRO A O   1 
ATOM   353  C CB  . PRO A 1 49  ? -4.673  -22.040 38.049  1.00 28.89  ? 50  PRO A CB  1 
ATOM   354  C CG  . PRO A 1 49  ? -3.809  -22.144 36.845  1.00 24.59  ? 50  PRO A CG  1 
ATOM   355  C CD  . PRO A 1 49  ? -4.647  -21.583 35.730  1.00 29.17  ? 50  PRO A CD  1 
ATOM   356  N N   . GLU A 1 50  ? -5.099  -19.117 39.675  1.00 36.70  ? 51  GLU A N   1 
ATOM   357  C CA  . GLU A 1 50  ? -4.344  -18.165 40.477  1.00 39.02  ? 51  GLU A CA  1 
ATOM   358  C C   . GLU A 1 50  ? -3.697  -18.884 41.645  1.00 33.80  ? 51  GLU A C   1 
ATOM   359  O O   . GLU A 1 50  ? -4.315  -19.761 42.251  1.00 36.49  ? 51  GLU A O   1 
ATOM   360  C CB  . GLU A 1 50  ? -5.248  -17.044 40.982  1.00 36.67  ? 51  GLU A CB  1 
ATOM   361  C CG  . GLU A 1 50  ? -5.550  -15.995 39.931  1.00 59.37  ? 51  GLU A CG  1 
ATOM   362  C CD  . GLU A 1 50  ? -6.133  -14.738 40.533  1.00 87.30  ? 51  GLU A CD  1 
ATOM   363  O OE1 . GLU A 1 50  ? -6.615  -14.807 41.683  1.00 86.83  ? 51  GLU A OE1 1 
ATOM   364  O OE2 . GLU A 1 50  ? -6.101  -13.681 39.866  1.00 100.10 ? 51  GLU A OE2 1 
ATOM   365  N N   . PRO A 1 51  ? -2.444  -18.525 41.959  1.00 34.95  ? 52  PRO A N   1 
ATOM   366  C CA  . PRO A 1 51  ? -1.721  -19.133 43.088  1.00 30.20  ? 52  PRO A CA  1 
ATOM   367  C C   . PRO A 1 51  ? -2.537  -19.021 44.365  1.00 29.08  ? 52  PRO A C   1 
ATOM   368  O O   . PRO A 1 51  ? -3.209  -18.013 44.572  1.00 35.09  ? 52  PRO A O   1 
ATOM   369  C CB  . PRO A 1 51  ? -0.454  -18.283 43.191  1.00 29.70  ? 52  PRO A CB  1 
ATOM   370  C CG  . PRO A 1 51  ? -0.251  -17.736 41.800  1.00 26.21  ? 52  PRO A CG  1 
ATOM   371  C CD  . PRO A 1 51  ? -1.637  -17.515 41.251  1.00 26.78  ? 52  PRO A CD  1 
ATOM   372  N N   . LYS A 1 52  ? -2.513  -20.067 45.182  1.00 31.26  ? 53  LYS A N   1 
ATOM   373  C CA  . LYS A 1 52  ? -3.246  -20.084 46.440  1.00 34.77  ? 53  LYS A CA  1 
ATOM   374  C C   . LYS A 1 52  ? -2.657  -19.054 47.395  1.00 39.72  ? 53  LYS A C   1 
ATOM   375  O O   . LYS A 1 52  ? -1.450  -19.042 47.634  1.00 38.83  ? 53  LYS A O   1 
ATOM   376  C CB  . LYS A 1 52  ? -3.173  -21.475 47.078  1.00 30.44  ? 53  LYS A CB  1 
ATOM   377  C CG  . LYS A 1 52  ? -3.717  -21.548 48.511  1.00 28.87  ? 53  LYS A CG  1 
ATOM   378  C CD  . LYS A 1 52  ? -5.227  -21.371 48.528  1.00 33.05  ? 53  LYS A CD  1 
ATOM   379  C CE  . LYS A 1 52  ? -5.802  -21.580 49.917  1.00 28.24  ? 53  LYS A CE  1 
ATOM   380  N NZ  . LYS A 1 52  ? -7.286  -21.415 49.909  1.00 35.28  ? 53  LYS A NZ  1 
ATOM   381  N N   A GLN A 1 53  ? -3.515  -18.197 47.937  0.44 37.40  ? 54  GLN A N   1 
ATOM   382  N N   B GLN A 1 53  ? -3.505  -18.183 47.928  0.56 37.39  ? 54  GLN A N   1 
ATOM   383  C CA  A GLN A 1 53  ? -3.092  -17.178 48.891  0.44 39.65  ? 54  GLN A CA  1 
ATOM   384  C CA  B GLN A 1 53  ? -3.048  -17.173 48.875  0.56 39.66  ? 54  GLN A CA  1 
ATOM   385  C C   A GLN A 1 53  ? -2.723  -17.832 50.219  0.44 36.49  ? 54  GLN A C   1 
ATOM   386  C C   B GLN A 1 53  ? -2.717  -17.824 50.210  0.56 36.48  ? 54  GLN A C   1 
ATOM   387  O O   A GLN A 1 53  ? -3.354  -18.808 50.624  0.44 36.24  ? 54  GLN A O   1 
ATOM   388  O O   B GLN A 1 53  ? -3.369  -18.785 50.613  0.56 36.24  ? 54  GLN A O   1 
ATOM   389  C CB  A GLN A 1 53  ? -4.208  -16.143 49.092  0.44 38.38  ? 54  GLN A CB  1 
ATOM   390  C CB  B GLN A 1 53  ? -4.097  -16.068 49.059  0.56 38.37  ? 54  GLN A CB  1 
ATOM   391  C CG  A GLN A 1 53  ? -4.589  -15.387 47.817  0.44 42.02  ? 54  GLN A CG  1 
ATOM   392  C CG  B GLN A 1 53  ? -4.183  -15.089 47.891  0.56 42.69  ? 54  GLN A CG  1 
ATOM   393  C CD  A GLN A 1 53  ? -5.947  -14.708 47.905  0.44 46.66  ? 54  GLN A CD  1 
ATOM   394  C CD  B GLN A 1 53  ? -2.895  -14.308 47.684  0.56 43.85  ? 54  GLN A CD  1 
ATOM   395  O OE1 A GLN A 1 53  ? -6.592  -14.708 48.956  0.44 45.30  ? 54  GLN A OE1 1 
ATOM   396  O OE1 B GLN A 1 53  ? -2.398  -13.647 48.599  0.56 46.19  ? 54  GLN A OE1 1 
ATOM   397  N NE2 A GLN A 1 53  ? -6.394  -14.136 46.790  0.44 42.50  ? 54  GLN A NE2 1 
ATOM   398  N NE2 B GLN A 1 53  ? -2.346  -14.387 46.479  0.56 35.84  ? 54  GLN A NE2 1 
ATOM   399  N N   . PRO A 1 54  ? -1.688  -17.306 50.893  1.00 42.25  ? 55  PRO A N   1 
ATOM   400  C CA  . PRO A 1 54  ? -1.279  -17.799 52.217  1.00 36.79  ? 55  PRO A CA  1 
ATOM   401  C C   . PRO A 1 54  ? -2.431  -17.896 53.213  1.00 32.93  ? 55  PRO A C   1 
ATOM   402  O O   . PRO A 1 54  ? -3.368  -17.094 53.186  1.00 32.81  ? 55  PRO A O   1 
ATOM   403  C CB  . PRO A 1 54  ? -0.262  -16.754 52.682  1.00 29.75  ? 55  PRO A CB  1 
ATOM   404  C CG  . PRO A 1 54  ? 0.336   -16.245 51.405  1.00 38.34  ? 55  PRO A CG  1 
ATOM   405  C CD  . PRO A 1 54  ? -0.780  -16.259 50.385  1.00 31.81  ? 55  PRO A CD  1 
ATOM   406  N N   . TRP A 1 55  ? -2.356  -18.908 54.069  1.00 31.38  ? 56  TRP A N   1 
ATOM   407  C CA  . TRP A 1 55  ? -3.368  -19.161 55.078  1.00 33.88  ? 56  TRP A CA  1 
ATOM   408  C C   . TRP A 1 55  ? -2.721  -19.119 56.457  1.00 43.18  ? 56  TRP A C   1 
ATOM   409  O O   . TRP A 1 55  ? -1.514  -19.373 56.608  1.00 34.07  ? 56  TRP A O   1 
ATOM   410  C CB  . TRP A 1 55  ? -4.008  -20.535 54.860  1.00 32.33  ? 56  TRP A CB  1 
ATOM   411  C CG  . TRP A 1 55  ? -3.009  -21.664 54.880  1.00 32.95  ? 56  TRP A CG  1 
ATOM   412  C CD1 . TRP A 1 55  ? -2.577  -22.363 55.972  1.00 31.85  ? 56  TRP A CD1 1 
ATOM   413  C CD2 . TRP A 1 55  ? -2.314  -22.215 53.750  1.00 38.91  ? 56  TRP A CD2 1 
ATOM   414  N NE1 . TRP A 1 55  ? -1.654  -23.310 55.592  1.00 37.24  ? 56  TRP A NE1 1 
ATOM   415  C CE2 . TRP A 1 55  ? -1.478  -23.242 54.235  1.00 31.25  ? 56  TRP A CE2 1 
ATOM   416  C CE3 . TRP A 1 55  ? -2.319  -21.937 52.375  1.00 31.85  ? 56  TRP A CE3 1 
ATOM   417  C CZ2 . TRP A 1 55  ? -0.653  -23.991 53.395  1.00 31.34  ? 56  TRP A CZ2 1 
ATOM   418  C CZ3 . TRP A 1 55  ? -1.496  -22.683 51.544  1.00 34.60  ? 56  TRP A CZ3 1 
ATOM   419  C CH2 . TRP A 1 55  ? -0.675  -23.696 52.058  1.00 28.05  ? 56  TRP A CH2 1 
ATOM   420  N N   . SER A 1 56  ? -3.521  -18.800 57.466  1.00 33.71  ? 57  SER A N   1 
ATOM   421  C CA  . SER A 1 56  ? -3.047  -18.887 58.841  1.00 48.33  ? 57  SER A CA  1 
ATOM   422  C C   . SER A 1 56  ? -3.529  -20.211 59.424  1.00 43.43  ? 57  SER A C   1 
ATOM   423  O O   . SER A 1 56  ? -4.423  -20.854 58.870  1.00 50.56  ? 57  SER A O   1 
ATOM   424  C CB  . SER A 1 56  ? -3.546  -17.702 59.668  1.00 48.41  ? 57  SER A CB  1 
ATOM   425  O OG  . SER A 1 56  ? -4.956  -17.728 59.787  1.00 54.04  ? 57  SER A OG  1 
ATOM   426  N N   . GLY A 1 57  ? -2.932  -20.633 60.528  1.00 44.81  ? 58  GLY A N   1 
ATOM   427  C CA  . GLY A 1 57  ? -3.279  -21.921 61.098  1.00 41.87  ? 58  GLY A CA  1 
ATOM   428  C C   . GLY A 1 57  ? -2.736  -23.101 60.305  1.00 51.44  ? 58  GLY A C   1 
ATOM   429  O O   . GLY A 1 57  ? -1.822  -22.964 59.487  1.00 43.94  ? 58  GLY A O   1 
ATOM   430  N N   . VAL A 1 58  ? -3.311  -24.272 60.552  1.00 45.83  ? 59  VAL A N   1 
ATOM   431  C CA  . VAL A 1 58  ? -2.798  -25.516 60.002  1.00 41.94  ? 59  VAL A CA  1 
ATOM   432  C C   . VAL A 1 58  ? -3.828  -26.166 59.092  1.00 46.04  ? 59  VAL A C   1 
ATOM   433  O O   . VAL A 1 58  ? -4.907  -26.551 59.549  1.00 40.98  ? 59  VAL A O   1 
ATOM   434  C CB  . VAL A 1 58  ? -2.467  -26.518 61.128  1.00 44.73  ? 59  VAL A CB  1 
ATOM   435  C CG1 . VAL A 1 58  ? -1.900  -27.808 60.548  1.00 34.25  ? 59  VAL A CG1 1 
ATOM   436  C CG2 . VAL A 1 58  ? -1.499  -25.902 62.129  1.00 35.18  ? 59  VAL A CG2 1 
ATOM   437  N N   . VAL A 1 59  ? -3.495  -26.283 57.806  1.00 40.33  ? 60  VAL A N   1 
ATOM   438  C CA  . VAL A 1 59  ? -4.337  -27.006 56.854  1.00 34.51  ? 60  VAL A CA  1 
ATOM   439  C C   . VAL A 1 59  ? -4.304  -28.499 57.168  1.00 35.70  ? 60  VAL A C   1 
ATOM   440  O O   . VAL A 1 59  ? -3.231  -29.102 57.306  1.00 33.10  ? 60  VAL A O   1 
ATOM   441  C CB  . VAL A 1 59  ? -3.896  -26.770 55.383  1.00 35.23  ? 60  VAL A CB  1 
ATOM   442  C CG1 . VAL A 1 59  ? -4.446  -27.857 54.468  1.00 37.14  ? 60  VAL A CG1 1 
ATOM   443  C CG2 . VAL A 1 59  ? -4.330  -25.394 54.897  1.00 31.67  ? 60  VAL A CG2 1 
ATOM   444  N N   . ASP A 1 60  ? -5.492  -29.075 57.313  1.00 27.57  ? 61  ASP A N   1 
ATOM   445  C CA  . ASP A 1 60  ? -5.663  -30.513 57.458  1.00 39.98  ? 61  ASP A CA  1 
ATOM   446  C C   . ASP A 1 60  ? -5.348  -31.201 56.128  1.00 37.41  ? 61  ASP A C   1 
ATOM   447  O O   . ASP A 1 60  ? -6.120  -31.101 55.184  1.00 41.22  ? 61  ASP A O   1 
ATOM   448  C CB  . ASP A 1 60  ? -7.113  -30.799 57.866  1.00 38.90  ? 61  ASP A CB  1 
ATOM   449  C CG  . ASP A 1 60  ? -7.491  -32.265 57.748  1.00 54.43  ? 61  ASP A CG  1 
ATOM   450  O OD1 . ASP A 1 60  ? -6.601  -33.141 57.835  1.00 54.46  ? 61  ASP A OD1 1 
ATOM   451  O OD2 . ASP A 1 60  ? -8.698  -32.541 57.580  1.00 62.93  ? 61  ASP A OD2 1 
ATOM   452  N N   . ALA A 1 61  ? -4.214  -31.891 56.055  1.00 33.22  ? 62  ALA A N   1 
ATOM   453  C CA  . ALA A 1 61  ? -3.843  -32.593 54.835  1.00 30.91  ? 62  ALA A CA  1 
ATOM   454  C C   . ALA A 1 61  ? -3.806  -34.105 55.053  1.00 30.10  ? 62  ALA A C   1 
ATOM   455  O O   . ALA A 1 61  ? -2.825  -34.771 54.709  1.00 29.19  ? 62  ALA A O   1 
ATOM   456  C CB  . ALA A 1 61  ? -2.496  -32.088 54.307  1.00 26.55  ? 62  ALA A CB  1 
ATOM   457  N N   . THR A 1 62  ? -4.885  -34.641 55.614  1.00 30.02  ? 63  THR A N   1 
ATOM   458  C CA  . THR A 1 62  ? -4.933  -36.047 56.005  1.00 30.01  ? 63  THR A CA  1 
ATOM   459  C C   . THR A 1 62  ? -5.863  -36.862 55.114  1.00 35.40  ? 63  THR A C   1 
ATOM   460  O O   . THR A 1 62  ? -5.904  -38.090 55.212  1.00 38.80  ? 63  THR A O   1 
ATOM   461  C CB  . THR A 1 62  ? -5.422  -36.215 57.464  1.00 33.25  ? 63  THR A CB  1 
ATOM   462  O OG1 . THR A 1 62  ? -6.731  -35.660 57.579  1.00 32.89  ? 63  THR A OG1 1 
ATOM   463  C CG2 . THR A 1 62  ? -4.507  -35.504 58.440  1.00 24.11  ? 63  THR A CG2 1 
ATOM   464  N N   . THR A 1 63  ? -6.623  -36.189 54.256  1.00 31.20  ? 64  THR A N   1 
ATOM   465  C CA  . THR A 1 63  ? -7.498  -36.910 53.335  1.00 42.05  ? 64  THR A CA  1 
ATOM   466  C C   . THR A 1 63  ? -7.545  -36.281 51.932  1.00 37.48  ? 64  THR A C   1 
ATOM   467  O O   . THR A 1 63  ? -7.258  -35.100 51.760  1.00 33.18  ? 64  THR A O   1 
ATOM   468  C CB  . THR A 1 63  ? -8.924  -37.066 53.921  1.00 34.03  ? 64  THR A CB  1 
ATOM   469  O OG1 . THR A 1 63  ? -9.788  -37.663 52.941  1.00 61.66  ? 64  THR A OG1 1 
ATOM   470  C CG2 . THR A 1 63  ? -9.473  -35.719 54.326  1.00 28.53  ? 64  THR A CG2 1 
ATOM   471  N N   . PHE A 1 64  ? -7.890  -37.080 50.928  1.00 33.91  ? 65  PHE A N   1 
ATOM   472  C CA  . PHE A 1 64  ? -8.052  -36.548 49.586  1.00 28.67  ? 65  PHE A CA  1 
ATOM   473  C C   . PHE A 1 64  ? -9.160  -35.510 49.538  1.00 30.47  ? 65  PHE A C   1 
ATOM   474  O O   . PHE A 1 64  ? -10.155 -35.596 50.256  1.00 33.29  ? 65  PHE A O   1 
ATOM   475  C CB  . PHE A 1 64  ? -8.346  -37.657 48.585  1.00 26.39  ? 65  PHE A CB  1 
ATOM   476  C CG  . PHE A 1 64  ? -7.171  -38.523 48.286  1.00 26.99  ? 65  PHE A CG  1 
ATOM   477  C CD1 . PHE A 1 64  ? -6.036  -37.987 47.698  1.00 22.22  ? 65  PHE A CD1 1 
ATOM   478  C CD2 . PHE A 1 64  ? -7.204  -39.879 48.570  1.00 25.20  ? 65  PHE A CD2 1 
ATOM   479  C CE1 . PHE A 1 64  ? -4.940  -38.790 47.408  1.00 25.75  ? 65  PHE A CE1 1 
ATOM   480  C CE2 . PHE A 1 64  ? -6.115  -40.691 48.285  1.00 21.73  ? 65  PHE A CE2 1 
ATOM   481  C CZ  . PHE A 1 64  ? -4.980  -40.148 47.705  1.00 25.94  ? 65  PHE A CZ  1 
ATOM   482  N N   . GLN A 1 65  ? -8.979  -34.526 48.674  1.00 28.46  ? 66  GLN A N   1 
ATOM   483  C CA  . GLN A 1 65  ? -9.983  -33.499 48.492  1.00 27.88  ? 66  GLN A CA  1 
ATOM   484  C C   . GLN A 1 65  ? -10.904 -33.825 47.323  1.00 28.76  ? 66  GLN A C   1 
ATOM   485  O O   . GLN A 1 65  ? -10.763 -34.861 46.669  1.00 28.03  ? 66  GLN A O   1 
ATOM   486  C CB  . GLN A 1 65  ? -9.307  -32.149 48.272  1.00 31.36  ? 66  GLN A CB  1 
ATOM   487  C CG  . GLN A 1 65  ? -9.023  -31.405 49.549  1.00 28.24  ? 66  GLN A CG  1 
ATOM   488  C CD  . GLN A 1 65  ? -10.250 -30.675 50.057  1.00 40.30  ? 66  GLN A CD  1 
ATOM   489  O OE1 . GLN A 1 65  ? -11.300 -30.648 49.402  1.00 40.61  ? 66  GLN A OE1 1 
ATOM   490  N NE2 . GLN A 1 65  ? -10.123 -30.069 51.222  1.00 36.78  ? 66  GLN A NE2 1 
ATOM   491  N N   . SER A 1 66  ? -11.841 -32.922 47.067  1.00 18.65  ? 67  SER A N   1 
ATOM   492  C CA  . SER A 1 66  ? -12.849 -33.098 46.031  1.00 31.68  ? 67  SER A CA  1 
ATOM   493  C C   . SER A 1 66  ? -12.305 -33.383 44.618  1.00 31.68  ? 67  SER A C   1 
ATOM   494  O O   . SER A 1 66  ? -11.203 -32.982 44.259  1.00 32.63  ? 67  SER A O   1 
ATOM   495  C CB  . SER A 1 66  ? -13.739 -31.860 45.994  1.00 30.75  ? 67  SER A CB  1 
ATOM   496  O OG  . SER A 1 66  ? -14.247 -31.574 47.284  1.00 32.65  ? 67  SER A OG  1 
ATOM   497  N N   . VAL A 1 67  ? -13.104 -34.085 43.828  1.00 27.75  ? 68  VAL A N   1 
ATOM   498  C CA  . VAL A 1 67  ? -12.780 -34.373 42.439  1.00 26.24  ? 68  VAL A CA  1 
ATOM   499  C C   . VAL A 1 67  ? -13.314 -33.240 41.573  1.00 26.20  ? 68  VAL A C   1 
ATOM   500  O O   . VAL A 1 67  ? -14.373 -32.687 41.861  1.00 30.29  ? 68  VAL A O   1 
ATOM   501  C CB  . VAL A 1 67  ? -13.401 -35.723 42.020  1.00 27.18  ? 68  VAL A CB  1 
ATOM   502  C CG1 . VAL A 1 67  ? -13.204 -35.990 40.555  1.00 22.86  ? 68  VAL A CG1 1 
ATOM   503  C CG2 . VAL A 1 67  ? -12.800 -36.852 42.859  1.00 27.61  ? 68  VAL A CG2 1 
ATOM   504  N N   . CYS A 1 68  ? -12.566 -32.856 40.541  1.00 23.32  ? 69  CYS A N   1 
ATOM   505  C CA  . CYS A 1 68  ? -13.050 -31.835 39.616  1.00 23.46  ? 69  CYS A CA  1 
ATOM   506  C C   . CYS A 1 68  ? -14.285 -32.362 38.894  1.00 25.18  ? 69  CYS A C   1 
ATOM   507  O O   . CYS A 1 68  ? -14.339 -33.545 38.531  1.00 27.97  ? 69  CYS A O   1 
ATOM   508  C CB  . CYS A 1 68  ? -11.954 -31.441 38.609  1.00 22.33  ? 69  CYS A CB  1 
ATOM   509  S SG  . CYS A 1 68  ? -10.471 -30.678 39.388  1.00 33.61  ? 69  CYS A SG  1 
ATOM   510  N N   . TYR A 1 69  ? -15.268 -31.488 38.697  1.00 24.06  ? 70  TYR A N   1 
ATOM   511  C CA  . TYR A 1 69  ? -16.482 -31.825 37.947  1.00 27.09  ? 70  TYR A CA  1 
ATOM   512  C C   . TYR A 1 69  ? -16.243 -32.568 36.632  1.00 29.92  ? 70  TYR A C   1 
ATOM   513  O O   . TYR A 1 69  ? -15.454 -32.137 35.788  1.00 28.05  ? 70  TYR A O   1 
ATOM   514  C CB  . TYR A 1 69  ? -17.317 -30.578 37.687  1.00 29.32  ? 70  TYR A CB  1 
ATOM   515  C CG  . TYR A 1 69  ? -18.429 -30.421 38.685  1.00 35.50  ? 70  TYR A CG  1 
ATOM   516  C CD1 . TYR A 1 69  ? -18.245 -29.674 39.835  1.00 26.41  ? 70  TYR A CD1 1 
ATOM   517  C CD2 . TYR A 1 69  ? -19.662 -31.040 38.490  1.00 38.14  ? 70  TYR A CD2 1 
ATOM   518  C CE1 . TYR A 1 69  ? -19.261 -29.523 40.761  1.00 34.88  ? 70  TYR A CE1 1 
ATOM   519  C CE2 . TYR A 1 69  ? -20.687 -30.907 39.424  1.00 34.64  ? 70  TYR A CE2 1 
ATOM   520  C CZ  . TYR A 1 69  ? -20.473 -30.146 40.558  1.00 36.89  ? 70  TYR A CZ  1 
ATOM   521  O OH  . TYR A 1 69  ? -21.470 -29.985 41.492  1.00 53.91  ? 70  TYR A OH  1 
ATOM   522  N N   . GLN A 1 70  ? -16.940 -33.685 36.465  1.00 29.52  ? 71  GLN A N   1 
ATOM   523  C CA  . GLN A 1 70  ? -16.728 -34.533 35.304  1.00 30.54  ? 71  GLN A CA  1 
ATOM   524  C C   . GLN A 1 70  ? -17.870 -35.513 35.104  1.00 32.24  ? 71  GLN A C   1 
ATOM   525  O O   . GLN A 1 70  ? -18.594 -35.840 36.040  1.00 32.15  ? 71  GLN A O   1 
ATOM   526  C CB  . GLN A 1 70  ? -15.443 -35.324 35.480  1.00 27.66  ? 71  GLN A CB  1 
ATOM   527  C CG  . GLN A 1 70  ? -15.439 -36.198 36.739  1.00 22.01  ? 71  GLN A CG  1 
ATOM   528  C CD  . GLN A 1 70  ? -14.081 -36.799 36.983  1.00 26.11  ? 71  GLN A CD  1 
ATOM   529  O OE1 . GLN A 1 70  ? -13.864 -37.989 36.757  1.00 24.89  ? 71  GLN A OE1 1 
ATOM   530  N NE2 . GLN A 1 70  ? -13.142 -35.971 37.424  1.00 26.81  ? 71  GLN A NE2 1 
ATOM   531  N N   . TYR A 1 71  ? -18.000 -35.993 33.874  1.00 29.62  ? 72  TYR A N   1 
ATOM   532  C CA  . TYR A 1 71  ? -18.997 -36.987 33.525  1.00 30.99  ? 72  TYR A CA  1 
ATOM   533  C C   . TYR A 1 71  ? -18.701 -38.295 34.234  1.00 25.29  ? 72  TYR A C   1 
ATOM   534  O O   . TYR A 1 71  ? -17.553 -38.729 34.270  1.00 32.11  ? 72  TYR A O   1 
ATOM   535  C CB  . TYR A 1 71  ? -19.008 -37.201 32.009  1.00 27.97  ? 72  TYR A CB  1 
ATOM   536  C CG  . TYR A 1 71  ? -19.964 -38.273 31.573  1.00 32.76  ? 72  TYR A CG  1 
ATOM   537  C CD1 . TYR A 1 71  ? -21.327 -38.012 31.471  1.00 33.03  ? 72  TYR A CD1 1 
ATOM   538  C CD2 . TYR A 1 71  ? -19.512 -39.555 31.272  1.00 32.83  ? 72  TYR A CD2 1 
ATOM   539  C CE1 . TYR A 1 71  ? -22.218 -38.998 31.072  1.00 39.62  ? 72  TYR A CE1 1 
ATOM   540  C CE2 . TYR A 1 71  ? -20.393 -40.548 30.870  1.00 40.44  ? 72  TYR A CE2 1 
ATOM   541  C CZ  . TYR A 1 71  ? -21.744 -40.261 30.772  1.00 46.18  ? 72  TYR A CZ  1 
ATOM   542  O OH  . TYR A 1 71  ? -22.623 -41.239 30.385  1.00 43.02  ? 72  TYR A OH  1 
ATOM   543  N N   . VAL A 1 72  ? -19.731 -38.921 34.803  1.00 33.03  ? 73  VAL A N   1 
ATOM   544  C CA  . VAL A 1 72  ? -19.548 -40.182 35.528  1.00 31.24  ? 73  VAL A CA  1 
ATOM   545  C C   . VAL A 1 72  ? -20.041 -41.362 34.697  1.00 36.84  ? 73  VAL A C   1 
ATOM   546  O O   . VAL A 1 72  ? -21.193 -41.391 34.265  1.00 38.58  ? 73  VAL A O   1 
ATOM   547  C CB  . VAL A 1 72  ? -20.268 -40.169 36.883  1.00 35.09  ? 73  VAL A CB  1 
ATOM   548  C CG1 . VAL A 1 72  ? -20.152 -41.527 37.566  1.00 30.89  ? 73  VAL A CG1 1 
ATOM   549  C CG2 . VAL A 1 72  ? -19.703 -39.070 37.764  1.00 31.89  ? 73  VAL A CG2 1 
ATOM   550  N N   . ASP A 1 73  ? -19.156 -42.328 34.480  1.00 38.56  ? 74  ASP A N   1 
ATOM   551  C CA  . ASP A 1 73  ? -19.428 -43.455 33.594  1.00 42.81  ? 74  ASP A CA  1 
ATOM   552  C C   . ASP A 1 73  ? -20.440 -44.421 34.194  1.00 45.81  ? 74  ASP A C   1 
ATOM   553  O O   . ASP A 1 73  ? -20.217 -44.962 35.273  1.00 46.02  ? 74  ASP A O   1 
ATOM   554  C CB  . ASP A 1 73  ? -18.128 -44.202 33.285  1.00 42.17  ? 74  ASP A CB  1 
ATOM   555  C CG  . ASP A 1 73  ? -18.330 -45.377 32.330  1.00 50.38  ? 74  ASP A CG  1 
ATOM   556  O OD1 . ASP A 1 73  ? -17.442 -46.254 32.269  1.00 49.32  ? 74  ASP A OD1 1 
ATOM   557  O OD2 . ASP A 1 73  ? -19.367 -45.429 31.640  1.00 49.76  ? 74  ASP A OD2 1 
ATOM   558  N N   . THR A 1 74  ? -21.540 -44.652 33.478  1.00 47.16  ? 75  THR A N   1 
ATOM   559  C CA  . THR A 1 74  ? -22.570 -45.588 33.936  1.00 55.70  ? 75  THR A CA  1 
ATOM   560  C C   . THR A 1 74  ? -22.901 -46.677 32.906  1.00 49.84  ? 75  THR A C   1 
ATOM   561  O O   . THR A 1 74  ? -23.998 -47.228 32.925  1.00 55.81  ? 75  THR A O   1 
ATOM   562  C CB  . THR A 1 74  ? -23.878 -44.856 34.299  1.00 39.14  ? 75  THR A CB  1 
ATOM   563  O OG1 . THR A 1 74  ? -24.323 -44.091 33.170  1.00 44.88  ? 75  THR A OG1 1 
ATOM   564  C CG2 . THR A 1 74  ? -23.658 -43.920 35.463  1.00 36.48  ? 75  THR A CG2 1 
ATOM   565  N N   . LEU A 1 75  ? -21.961 -46.985 32.016  1.00 49.55  ? 76  LEU A N   1 
ATOM   566  C CA  . LEU A 1 75  ? -22.186 -47.998 30.981  1.00 53.57  ? 76  LEU A CA  1 
ATOM   567  C C   . LEU A 1 75  ? -22.392 -49.382 31.589  1.00 56.59  ? 76  LEU A C   1 
ATOM   568  O O   . LEU A 1 75  ? -23.239 -50.154 31.127  1.00 50.23  ? 76  LEU A O   1 
ATOM   569  C CB  . LEU A 1 75  ? -21.019 -48.045 29.988  1.00 40.58  ? 76  LEU A CB  1 
ATOM   570  C CG  . LEU A 1 75  ? -21.132 -49.045 28.833  1.00 53.16  ? 76  LEU A CG  1 
ATOM   571  C CD1 . LEU A 1 75  ? -22.254 -48.655 27.885  1.00 38.75  ? 76  LEU A CD1 1 
ATOM   572  C CD2 . LEU A 1 75  ? -19.814 -49.148 28.075  1.00 50.74  ? 76  LEU A CD2 1 
ATOM   573  N N   . TYR A 1 76  ? -21.609 -49.694 32.617  1.00 33.48  ? 77  TYR A N   1 
ATOM   574  C CA  . TYR A 1 76  ? -21.724 -50.979 33.291  1.00 38.53  ? 77  TYR A CA  1 
ATOM   575  C C   . TYR A 1 76  ? -21.771 -50.767 34.803  1.00 39.42  ? 77  TYR A C   1 
ATOM   576  O O   . TYR A 1 76  ? -20.805 -51.054 35.496  1.00 42.44  ? 77  TYR A O   1 
ATOM   577  C CB  . TYR A 1 76  ? -20.546 -51.894 32.920  1.00 40.42  ? 77  TYR A CB  1 
ATOM   578  C CG  . TYR A 1 76  ? -20.446 -52.284 31.449  1.00 49.22  ? 77  TYR A CG  1 
ATOM   579  C CD1 . TYR A 1 76  ? -21.435 -53.054 30.833  1.00 52.01  ? 77  TYR A CD1 1 
ATOM   580  C CD2 . TYR A 1 76  ? -19.346 -51.905 30.684  1.00 52.16  ? 77  TYR A CD2 1 
ATOM   581  C CE1 . TYR A 1 76  ? -21.337 -53.417 29.490  1.00 43.13  ? 77  TYR A CE1 1 
ATOM   582  C CE2 . TYR A 1 76  ? -19.238 -52.264 29.341  1.00 51.61  ? 77  TYR A CE2 1 
ATOM   583  C CZ  . TYR A 1 76  ? -20.234 -53.019 28.749  1.00 54.98  ? 77  TYR A CZ  1 
ATOM   584  O OH  . TYR A 1 76  ? -20.119 -53.374 27.418  1.00 50.38  ? 77  TYR A OH  1 
ATOM   585  N N   . PRO A 1 77  ? -22.902 -50.261 35.319  1.00 45.58  ? 78  PRO A N   1 
ATOM   586  C CA  . PRO A 1 77  ? -23.011 -49.844 36.729  1.00 46.35  ? 78  PRO A CA  1 
ATOM   587  C C   . PRO A 1 77  ? -22.553 -50.921 37.701  1.00 39.80  ? 78  PRO A C   1 
ATOM   588  O O   . PRO A 1 77  ? -23.003 -52.057 37.590  1.00 44.11  ? 78  PRO A O   1 
ATOM   589  C CB  . PRO A 1 77  ? -24.510 -49.594 36.906  1.00 33.75  ? 78  PRO A CB  1 
ATOM   590  C CG  . PRO A 1 77  ? -24.995 -49.245 35.534  1.00 59.60  ? 78  PRO A CG  1 
ATOM   591  C CD  . PRO A 1 77  ? -24.167 -50.080 34.585  1.00 44.84  ? 78  PRO A CD  1 
ATOM   592  N N   . GLY A 1 78  ? -21.653 -50.572 38.618  1.00 43.44  ? 79  GLY A N   1 
ATOM   593  C CA  . GLY A 1 78  ? -21.178 -51.505 39.631  1.00 32.72  ? 79  GLY A CA  1 
ATOM   594  C C   . GLY A 1 78  ? -20.023 -52.400 39.205  1.00 39.23  ? 79  GLY A C   1 
ATOM   595  O O   . GLY A 1 78  ? -19.362 -53.011 40.042  1.00 43.20  ? 79  GLY A O   1 
ATOM   596  N N   . PHE A 1 79  ? -19.784 -52.478 37.900  1.00 46.33  ? 80  PHE A N   1 
ATOM   597  C CA  . PHE A 1 79  ? -18.662 -53.234 37.341  1.00 37.42  ? 80  PHE A CA  1 
ATOM   598  C C   . PHE A 1 79  ? -17.343 -52.596 37.781  1.00 35.74  ? 80  PHE A C   1 
ATOM   599  O O   . PHE A 1 79  ? -17.167 -51.380 37.686  1.00 41.68  ? 80  PHE A O   1 
ATOM   600  C CB  . PHE A 1 79  ? -18.788 -53.252 35.807  1.00 38.82  ? 80  PHE A CB  1 
ATOM   601  C CG  . PHE A 1 79  ? -17.712 -54.027 35.096  1.00 40.45  ? 80  PHE A CG  1 
ATOM   602  C CD1 . PHE A 1 79  ? -17.482 -55.363 35.390  1.00 32.88  ? 80  PHE A CD1 1 
ATOM   603  C CD2 . PHE A 1 79  ? -16.963 -53.427 34.095  1.00 35.29  ? 80  PHE A CD2 1 
ATOM   604  C CE1 . PHE A 1 79  ? -16.502 -56.083 34.720  1.00 34.28  ? 80  PHE A CE1 1 
ATOM   605  C CE2 . PHE A 1 79  ? -15.978 -54.139 33.420  1.00 36.68  ? 80  PHE A CE2 1 
ATOM   606  C CZ  . PHE A 1 79  ? -15.749 -55.469 33.733  1.00 39.65  ? 80  PHE A CZ  1 
ATOM   607  N N   . GLU A 1 80  ? -16.417 -53.419 38.252  1.00 29.83  ? 81  GLU A N   1 
ATOM   608  C CA  . GLU A 1 80  ? -15.140 -52.930 38.772  1.00 36.88  ? 81  GLU A CA  1 
ATOM   609  C C   . GLU A 1 80  ? -14.329 -52.194 37.709  1.00 48.90  ? 81  GLU A C   1 
ATOM   610  O O   . GLU A 1 80  ? -13.691 -51.169 37.985  1.00 33.11  ? 81  GLU A O   1 
ATOM   611  C CB  . GLU A 1 80  ? -14.323 -54.094 39.342  1.00 36.94  ? 81  GLU A CB  1 
ATOM   612  C CG  . GLU A 1 80  ? -13.672 -53.803 40.701  1.00 78.04  ? 81  GLU A CG  1 
ATOM   613  C CD  . GLU A 1 80  ? -12.336 -53.086 40.579  1.00 77.74  ? 81  GLU A CD  1 
ATOM   614  O OE1 . GLU A 1 80  ? -11.629 -53.315 39.571  1.00 88.55  ? 81  GLU A OE1 1 
ATOM   615  O OE2 . GLU A 1 80  ? -11.996 -52.296 41.490  1.00 64.95  ? 81  GLU A OE2 1 
ATOM   616  N N   . GLY A 1 81  ? -14.374 -52.719 36.488  1.00 43.77  ? 82  GLY A N   1 
ATOM   617  C CA  . GLY A 1 81  ? -13.636 -52.150 35.379  1.00 37.06  ? 82  GLY A CA  1 
ATOM   618  C C   . GLY A 1 81  ? -14.089 -50.756 34.997  1.00 32.44  ? 82  GLY A C   1 
ATOM   619  O O   . GLY A 1 81  ? -13.377 -50.046 34.292  1.00 44.03  ? 82  GLY A O   1 
ATOM   620  N N   . THR A 1 82  ? -15.272 -50.357 35.444  1.00 33.36  ? 83  THR A N   1 
ATOM   621  C CA  . THR A 1 82  ? -15.690 -48.977 35.267  1.00 38.31  ? 83  THR A CA  1 
ATOM   622  C C   . THR A 1 82  ? -15.580 -48.167 36.567  1.00 42.32  ? 83  THR A C   1 
ATOM   623  O O   . THR A 1 82  ? -15.198 -46.997 36.541  1.00 35.53  ? 83  THR A O   1 
ATOM   624  C CB  . THR A 1 82  ? -17.121 -48.866 34.690  1.00 41.26  ? 83  THR A CB  1 
ATOM   625  O OG1 . THR A 1 82  ? -18.011 -49.667 35.469  1.00 52.84  ? 83  THR A OG1 1 
ATOM   626  C CG2 . THR A 1 82  ? -17.159 -49.341 33.237  1.00 56.23  ? 83  THR A CG2 1 
ATOM   627  N N   . GLU A 1 83  ? -15.902 -48.778 37.702  1.00 28.95  ? 84  GLU A N   1 
ATOM   628  C CA  . GLU A 1 83  ? -15.967 -48.013 38.949  1.00 44.17  ? 84  GLU A CA  1 
ATOM   629  C C   . GLU A 1 83  ? -14.604 -47.540 39.468  1.00 36.51  ? 84  GLU A C   1 
ATOM   630  O O   . GLU A 1 83  ? -14.518 -46.506 40.134  1.00 29.58  ? 84  GLU A O   1 
ATOM   631  C CB  . GLU A 1 83  ? -16.737 -48.763 40.051  1.00 32.06  ? 84  GLU A CB  1 
ATOM   632  C CG  . GLU A 1 83  ? -18.214 -49.039 39.740  1.00 44.87  ? 84  GLU A CG  1 
ATOM   633  C CD  . GLU A 1 83  ? -19.025 -47.796 39.352  1.00 50.71  ? 84  GLU A CD  1 
ATOM   634  O OE1 . GLU A 1 83  ? -20.117 -47.966 38.759  1.00 43.99  ? 84  GLU A OE1 1 
ATOM   635  O OE2 . GLU A 1 83  ? -18.595 -46.657 39.648  1.00 47.01  ? 84  GLU A OE2 1 
ATOM   636  N N   . MET A 1 84  ? -13.550 -48.285 39.148  1.00 30.07  ? 85  MET A N   1 
ATOM   637  C CA  . MET A 1 84  ? -12.200 -47.952 39.603  1.00 24.57  ? 85  MET A CA  1 
ATOM   638  C C   . MET A 1 84  ? -11.702 -46.629 39.010  1.00 31.79  ? 85  MET A C   1 
ATOM   639  O O   . MET A 1 84  ? -10.707 -46.093 39.482  1.00 34.46  ? 85  MET A O   1 
ATOM   640  C CB  . MET A 1 84  ? -11.217 -49.065 39.228  1.00 19.68  ? 85  MET A CB  1 
ATOM   641  C CG  . MET A 1 84  ? -10.965 -49.141 37.696  1.00 35.43  ? 85  MET A CG  1 
ATOM   642  S SD  . MET A 1 84  ? -9.920  -50.512 37.158  1.00 38.55  ? 85  MET A SD  1 
ATOM   643  C CE  . MET A 1 84  ? -8.286  -49.895 37.548  1.00 28.51  ? 85  MET A CE  1 
ATOM   644  N N   . TRP A 1 85  ? -12.391 -46.117 37.983  1.00 26.97  ? 86  TRP A N   1 
ATOM   645  C CA  . TRP A 1 85  ? -12.009 -44.871 37.302  1.00 26.38  ? 86  TRP A CA  1 
ATOM   646  C C   . TRP A 1 85  ? -12.919 -43.708 37.683  1.00 28.39  ? 86  TRP A C   1 
ATOM   647  O O   . TRP A 1 85  ? -12.594 -42.542 37.435  1.00 30.20  ? 86  TRP A O   1 
ATOM   648  C CB  . TRP A 1 85  ? -12.037 -45.026 35.764  1.00 20.54  ? 86  TRP A CB  1 
ATOM   649  C CG  . TRP A 1 85  ? -11.243 -46.168 35.234  1.00 29.30  ? 86  TRP A CG  1 
ATOM   650  C CD1 . TRP A 1 85  ? -11.731 -47.303 34.655  1.00 28.21  ? 86  TRP A CD1 1 
ATOM   651  C CD2 . TRP A 1 85  ? -9.811  -46.302 35.236  1.00 31.07  ? 86  TRP A CD2 1 
ATOM   652  N NE1 . TRP A 1 85  ? -10.696 -48.136 34.299  1.00 20.83  ? 86  TRP A NE1 1 
ATOM   653  C CE2 . TRP A 1 85  ? -9.507  -47.548 34.644  1.00 21.51  ? 86  TRP A CE2 1 
ATOM   654  C CE3 . TRP A 1 85  ? -8.759  -45.489 35.676  1.00 19.81  ? 86  TRP A CE3 1 
ATOM   655  C CZ2 . TRP A 1 85  ? -8.193  -48.000 34.474  1.00 24.52  ? 86  TRP A CZ2 1 
ATOM   656  C CZ3 . TRP A 1 85  ? -7.453  -45.946 35.521  1.00 26.64  ? 86  TRP A CZ3 1 
ATOM   657  C CH2 . TRP A 1 85  ? -7.182  -47.189 34.922  1.00 26.96  ? 86  TRP A CH2 1 
ATOM   658  N N   . ASN A 1 86  ? -14.074 -44.029 38.254  1.00 28.59  ? 87  ASN A N   1 
ATOM   659  C CA  . ASN A 1 86  ? -15.050 -43.012 38.641  1.00 26.27  ? 87  ASN A CA  1 
ATOM   660  C C   . ASN A 1 86  ? -14.646 -42.279 39.924  1.00 26.32  ? 87  ASN A C   1 
ATOM   661  O O   . ASN A 1 86  ? -13.877 -42.812 40.735  1.00 24.99  ? 87  ASN A O   1 
ATOM   662  C CB  . ASN A 1 86  ? -16.439 -43.643 38.799  1.00 29.80  ? 87  ASN A CB  1 
ATOM   663  C CG  . ASN A 1 86  ? -17.144 -43.854 37.467  1.00 39.87  ? 87  ASN A CG  1 
ATOM   664  O OD1 . ASN A 1 86  ? -16.937 -43.109 36.504  1.00 30.94  ? 87  ASN A OD1 1 
ATOM   665  N ND2 . ASN A 1 86  ? -17.990 -44.874 37.411  1.00 36.20  ? 87  ASN A ND2 1 
ATOM   666  N N   . PRO A 1 87  ? -15.156 -41.048 40.104  1.00 21.83  ? 88  PRO A N   1 
ATOM   667  C CA  . PRO A 1 87  ? -14.845 -40.225 41.278  1.00 24.11  ? 88  PRO A CA  1 
ATOM   668  C C   . PRO A 1 87  ? -15.092 -40.965 42.586  1.00 35.45  ? 88  PRO A C   1 
ATOM   669  O O   . PRO A 1 87  ? -16.149 -41.569 42.757  1.00 33.79  ? 88  PRO A O   1 
ATOM   670  C CB  . PRO A 1 87  ? -15.823 -39.055 41.141  1.00 23.28  ? 88  PRO A CB  1 
ATOM   671  C CG  . PRO A 1 87  ? -16.003 -38.915 39.672  1.00 23.66  ? 88  PRO A CG  1 
ATOM   672  C CD  . PRO A 1 87  ? -15.967 -40.307 39.117  1.00 25.79  ? 88  PRO A CD  1 
ATOM   673  N N   . ASN A 1 88  ? -14.116 -40.932 43.486  1.00 32.42  ? 89  ASN A N   1 
ATOM   674  C CA  . ASN A 1 88  ? -14.278 -41.530 44.802  1.00 26.18  ? 89  ASN A CA  1 
ATOM   675  C C   . ASN A 1 88  ? -14.276 -40.464 45.903  1.00 33.57  ? 89  ASN A C   1 
ATOM   676  O O   . ASN A 1 88  ? -13.956 -40.743 47.061  1.00 33.16  ? 89  ASN A O   1 
ATOM   677  C CB  . ASN A 1 88  ? -13.195 -42.578 45.052  1.00 27.78  ? 89  ASN A CB  1 
ATOM   678  C CG  . ASN A 1 88  ? -11.817 -41.972 45.143  1.00 36.55  ? 89  ASN A CG  1 
ATOM   679  O OD1 . ASN A 1 88  ? -11.602 -40.822 44.760  1.00 37.85  ? 89  ASN A OD1 1 
ATOM   680  N ND2 . ASN A 1 88  ? -10.868 -42.748 45.631  1.00 35.37  ? 89  ASN A ND2 1 
ATOM   681  N N   . ARG A 1 89  ? -14.603 -39.235 45.508  1.00 30.46  ? 90  ARG A N   1 
ATOM   682  C CA  . ARG A 1 89  ? -14.838 -38.123 46.426  1.00 27.89  ? 90  ARG A CA  1 
ATOM   683  C C   . ARG A 1 89  ? -15.881 -37.256 45.750  1.00 32.92  ? 90  ARG A C   1 
ATOM   684  O O   . ARG A 1 89  ? -16.125 -37.404 44.551  1.00 33.95  ? 90  ARG A O   1 
ATOM   685  C CB  . ARG A 1 89  ? -13.564 -37.311 46.682  1.00 22.97  ? 90  ARG A CB  1 
ATOM   686  C CG  . ARG A 1 89  ? -12.480 -38.040 47.465  1.00 31.07  ? 90  ARG A CG  1 
ATOM   687  C CD  . ARG A 1 89  ? -12.923 -38.356 48.912  1.00 28.28  ? 90  ARG A CD  1 
ATOM   688  N NE  . ARG A 1 89  ? -11.798 -38.816 49.724  1.00 33.25  ? 90  ARG A NE  1 
ATOM   689  C CZ  . ARG A 1 89  ? -11.360 -40.073 49.754  1.00 36.64  ? 90  ARG A CZ  1 
ATOM   690  N NH1 . ARG A 1 89  ? -11.962 -41.006 49.029  1.00 34.22  ? 90  ARG A NH1 1 
ATOM   691  N NH2 . ARG A 1 89  ? -10.316 -40.402 50.508  1.00 33.72  ? 90  ARG A NH2 1 
ATOM   692  N N   . GLU A 1 90  ? -16.500 -36.354 46.499  1.00 27.73  ? 91  GLU A N   1 
ATOM   693  C CA  . GLU A 1 90  ? -17.567 -35.542 45.930  1.00 33.82  ? 91  GLU A CA  1 
ATOM   694  C C   . GLU A 1 90  ? -17.027 -34.641 44.821  1.00 35.74  ? 91  GLU A C   1 
ATOM   695  O O   . GLU A 1 90  ? -15.856 -34.255 44.828  1.00 31.22  ? 91  GLU A O   1 
ATOM   696  C CB  . GLU A 1 90  ? -18.272 -34.716 47.014  1.00 33.41  ? 91  GLU A CB  1 
ATOM   697  C CG  . GLU A 1 90  ? -17.400 -33.636 47.647  1.00 65.86  ? 91  GLU A CG  1 
ATOM   698  C CD  . GLU A 1 90  ? -18.208 -32.604 48.434  1.00 89.65  ? 91  GLU A CD  1 
ATOM   699  O OE1 . GLU A 1 90  ? -19.378 -32.894 48.776  1.00 85.38  ? 91  GLU A OE1 1 
ATOM   700  O OE2 . GLU A 1 90  ? -17.670 -31.502 48.702  1.00 68.70  ? 91  GLU A OE2 1 
ATOM   701  N N   . LEU A 1 91  ? -17.874 -34.331 43.850  1.00 32.03  ? 92  LEU A N   1 
ATOM   702  C CA  . LEU A 1 91  ? -17.476 -33.436 42.781  1.00 33.63  ? 92  LEU A CA  1 
ATOM   703  C C   . LEU A 1 91  ? -17.554 -32.006 43.293  1.00 25.00  ? 92  LEU A C   1 
ATOM   704  O O   . LEU A 1 91  ? -18.442 -31.670 44.066  1.00 36.85  ? 92  LEU A O   1 
ATOM   705  C CB  . LEU A 1 91  ? -18.385 -33.602 41.554  1.00 26.69  ? 92  LEU A CB  1 
ATOM   706  C CG  . LEU A 1 91  ? -18.516 -34.972 40.888  1.00 30.92  ? 92  LEU A CG  1 
ATOM   707  C CD1 . LEU A 1 91  ? -19.412 -34.872 39.661  1.00 22.06  ? 92  LEU A CD1 1 
ATOM   708  C CD2 . LEU A 1 91  ? -17.159 -35.508 40.501  1.00 31.11  ? 92  LEU A CD2 1 
ATOM   709  N N   . SER A 1 92  ? -16.629 -31.167 42.849  1.00 30.72  ? 93  SER A N   1 
ATOM   710  C CA  . SER A 1 92  ? -16.656 -29.746 43.178  1.00 33.90  ? 93  SER A CA  1 
ATOM   711  C C   . SER A 1 92  ? -15.762 -28.991 42.210  1.00 28.51  ? 93  SER A C   1 
ATOM   712  O O   . SER A 1 92  ? -14.782 -29.553 41.716  1.00 33.34  ? 93  SER A O   1 
ATOM   713  C CB  . SER A 1 92  ? -16.153 -29.517 44.607  1.00 23.12  ? 93  SER A CB  1 
ATOM   714  O OG  . SER A 1 92  ? -16.004 -28.129 44.844  1.00 28.95  ? 93  SER A OG  1 
ATOM   715  N N   . GLU A 1 93  ? -16.079 -27.728 41.932  1.00 27.16  ? 94  GLU A N   1 
ATOM   716  C CA  . GLU A 1 93  ? -15.168 -26.904 41.129  1.00 29.86  ? 94  GLU A CA  1 
ATOM   717  C C   . GLU A 1 93  ? -13.973 -26.474 41.975  1.00 34.54  ? 94  GLU A C   1 
ATOM   718  O O   . GLU A 1 93  ? -12.932 -26.089 41.452  1.00 35.88  ? 94  GLU A O   1 
ATOM   719  C CB  . GLU A 1 93  ? -15.869 -25.679 40.539  1.00 26.01  ? 94  GLU A CB  1 
ATOM   720  C CG  . GLU A 1 93  ? -16.826 -25.990 39.402  1.00 33.61  ? 94  GLU A CG  1 
ATOM   721  C CD  . GLU A 1 93  ? -17.342 -24.730 38.729  1.00 38.86  ? 94  GLU A CD  1 
ATOM   722  O OE1 . GLU A 1 93  ? -16.654 -24.223 37.819  1.00 31.45  ? 94  GLU A OE1 1 
ATOM   723  O OE2 . GLU A 1 93  ? -18.425 -24.238 39.114  1.00 36.08  ? 94  GLU A OE2 1 
ATOM   724  N N   . ASP A 1 94  ? -14.148 -26.536 43.292  1.00 31.05  ? 95  ASP A N   1 
ATOM   725  C CA  . ASP A 1 94  ? -13.072 -26.302 44.239  1.00 29.27  ? 95  ASP A CA  1 
ATOM   726  C C   . ASP A 1 94  ? -12.331 -27.630 44.343  1.00 29.82  ? 95  ASP A C   1 
ATOM   727  O O   . ASP A 1 94  ? -12.606 -28.437 45.231  1.00 30.23  ? 95  ASP A O   1 
ATOM   728  C CB  . ASP A 1 94  ? -13.681 -25.904 45.589  1.00 27.14  ? 95  ASP A CB  1 
ATOM   729  C CG  . ASP A 1 94  ? -12.646 -25.535 46.636  1.00 35.71  ? 95  ASP A CG  1 
ATOM   730  O OD1 . ASP A 1 94  ? -11.441 -25.829 46.465  1.00 36.13  ? 95  ASP A OD1 1 
ATOM   731  O OD2 . ASP A 1 94  ? -13.059 -24.950 47.659  1.00 41.86  ? 95  ASP A OD2 1 
ATOM   732  N N   . CYS A 1 95  ? -11.403 -27.865 43.425  1.00 24.38  ? 96  CYS A N   1 
ATOM   733  C CA  . CYS A 1 95  ? -10.801 -29.190 43.289  1.00 27.84  ? 96  CYS A CA  1 
ATOM   734  C C   . CYS A 1 95  ? -9.306  -29.127 43.051  1.00 18.98  ? 96  CYS A C   1 
ATOM   735  O O   . CYS A 1 95  ? -8.669  -30.153 42.863  1.00 28.13  ? 96  CYS A O   1 
ATOM   736  C CB  . CYS A 1 95  ? -11.434 -29.935 42.118  1.00 19.95  ? 96  CYS A CB  1 
ATOM   737  S SG  . CYS A 1 95  ? -11.168 -29.102 40.512  1.00 25.96  ? 96  CYS A SG  1 
ATOM   738  N N   . LEU A 1 96  ? -8.748  -27.926 43.047  1.00 21.96  ? 97  LEU A N   1 
ATOM   739  C CA  . LEU A 1 96  ? -7.339  -27.761 42.729  1.00 26.02  ? 97  LEU A CA  1 
ATOM   740  C C   . LEU A 1 96  ? -6.466  -28.007 43.959  1.00 31.53  ? 97  LEU A C   1 
ATOM   741  O O   . LEU A 1 96  ? -6.024  -27.066 44.618  1.00 27.25  ? 97  LEU A O   1 
ATOM   742  C CB  . LEU A 1 96  ? -7.080  -26.388 42.102  1.00 19.68  ? 97  LEU A CB  1 
ATOM   743  C CG  . LEU A 1 96  ? -7.683  -26.223 40.698  1.00 30.02  ? 97  LEU A CG  1 
ATOM   744  C CD1 . LEU A 1 96  ? -7.268  -24.899 40.048  1.00 26.67  ? 97  LEU A CD1 1 
ATOM   745  C CD2 . LEU A 1 96  ? -7.323  -27.405 39.771  1.00 20.45  ? 97  LEU A CD2 1 
ATOM   746  N N   . TYR A 1 97  ? -6.242  -29.288 44.261  1.00 27.35  ? 98  TYR A N   1 
ATOM   747  C CA  . TYR A 1 97  ? -5.390  -29.709 45.363  1.00 20.94  ? 98  TYR A CA  1 
ATOM   748  C C   . TYR A 1 97  ? -4.374  -30.698 44.841  1.00 24.57  ? 98  TYR A C   1 
ATOM   749  O O   . TYR A 1 97  ? -4.575  -31.308 43.796  1.00 27.73  ? 98  TYR A O   1 
ATOM   750  C CB  . TYR A 1 97  ? -6.226  -30.335 46.502  1.00 25.33  ? 98  TYR A CB  1 
ATOM   751  C CG  . TYR A 1 97  ? -7.231  -29.358 47.054  1.00 27.60  ? 98  TYR A CG  1 
ATOM   752  C CD1 . TYR A 1 97  ? -6.973  -28.651 48.217  1.00 25.40  ? 98  TYR A CD1 1 
ATOM   753  C CD2 . TYR A 1 97  ? -8.427  -29.106 46.378  1.00 27.97  ? 98  TYR A CD2 1 
ATOM   754  C CE1 . TYR A 1 97  ? -7.884  -27.730 48.707  1.00 25.43  ? 98  TYR A CE1 1 
ATOM   755  C CE2 . TYR A 1 97  ? -9.336  -28.193 46.852  1.00 25.73  ? 98  TYR A CE2 1 
ATOM   756  C CZ  . TYR A 1 97  ? -9.060  -27.506 48.020  1.00 34.48  ? 98  TYR A CZ  1 
ATOM   757  O OH  . TYR A 1 97  ? -9.970  -26.592 48.490  1.00 33.18  ? 98  TYR A OH  1 
ATOM   758  N N   . LEU A 1 98  ? -3.270  -30.848 45.556  1.00 24.04  ? 99  LEU A N   1 
ATOM   759  C CA  . LEU A 1 98  ? -2.262  -31.821 45.164  1.00 24.57  ? 99  LEU A CA  1 
ATOM   760  C C   . LEU A 1 98  ? -1.865  -32.658 46.389  1.00 27.36  ? 99  LEU A C   1 
ATOM   761  O O   . LEU A 1 98  ? -2.208  -32.324 47.522  1.00 26.15  ? 99  LEU A O   1 
ATOM   762  C CB  . LEU A 1 98  ? -1.055  -31.133 44.492  1.00 26.84  ? 99  LEU A CB  1 
ATOM   763  C CG  . LEU A 1 98  ? -0.286  -30.019 45.224  1.00 26.50  ? 99  LEU A CG  1 
ATOM   764  C CD1 . LEU A 1 98  ? 0.614   -30.587 46.309  1.00 16.70  ? 99  LEU A CD1 1 
ATOM   765  C CD2 . LEU A 1 98  ? 0.532   -29.176 44.267  1.00 22.23  ? 99  LEU A CD2 1 
ATOM   766  N N   . ASN A 1 99  ? -1.145  -33.742 46.147  1.00 21.88  ? 100 ASN A N   1 
ATOM   767  C CA  . ASN A 1 99  ? -0.837  -34.704 47.177  1.00 21.65  ? 100 ASN A CA  1 
ATOM   768  C C   . ASN A 1 99  ? 0.643   -34.991 47.154  1.00 23.08  ? 100 ASN A C   1 
ATOM   769  O O   . ASN A 1 99  ? 1.237   -35.081 46.086  1.00 28.20  ? 100 ASN A O   1 
ATOM   770  C CB  . ASN A 1 99  ? -1.609  -35.995 46.920  1.00 18.91  ? 100 ASN A CB  1 
ATOM   771  C CG  . ASN A 1 99  ? -3.037  -35.732 46.512  1.00 28.61  ? 100 ASN A CG  1 
ATOM   772  O OD1 . ASN A 1 99  ? -3.843  -35.264 47.311  1.00 30.61  ? 100 ASN A OD1 1 
ATOM   773  N ND2 . ASN A 1 99  ? -3.360  -36.024 45.256  1.00 30.67  ? 100 ASN A ND2 1 
ATOM   774  N N   . VAL A 1 100 ? 1.241   -35.120 48.334  1.00 26.36  ? 101 VAL A N   1 
ATOM   775  C CA  . VAL A 1 100 ? 2.643   -35.497 48.441  1.00 23.93  ? 101 VAL A CA  1 
ATOM   776  C C   . VAL A 1 100 ? 2.770   -36.740 49.321  1.00 30.81  ? 101 VAL A C   1 
ATOM   777  O O   . VAL A 1 100 ? 2.218   -36.789 50.431  1.00 28.82  ? 101 VAL A O   1 
ATOM   778  C CB  . VAL A 1 100 ? 3.479   -34.360 49.074  1.00 30.62  ? 101 VAL A CB  1 
ATOM   779  C CG1 . VAL A 1 100 ? 4.967   -34.685 49.027  1.00 20.17  ? 101 VAL A CG1 1 
ATOM   780  C CG2 . VAL A 1 100 ? 3.185   -33.034 48.396  1.00 18.97  ? 101 VAL A CG2 1 
ATOM   781  N N   . TRP A 1 101 ? 3.473   -37.747 48.812  1.00 26.56  ? 102 TRP A N   1 
ATOM   782  C CA  . TRP A 1 101 ? 3.826   -38.932 49.587  1.00 24.74  ? 102 TRP A CA  1 
ATOM   783  C C   . TRP A 1 101 ? 5.333   -38.920 49.722  1.00 31.87  ? 102 TRP A C   1 
ATOM   784  O O   . TRP A 1 101 ? 6.044   -38.637 48.756  1.00 29.31  ? 102 TRP A O   1 
ATOM   785  C CB  . TRP A 1 101 ? 3.443   -40.231 48.865  1.00 26.55  ? 102 TRP A CB  1 
ATOM   786  C CG  . TRP A 1 101 ? 1.980   -40.551 48.782  1.00 26.35  ? 102 TRP A CG  1 
ATOM   787  C CD1 . TRP A 1 101 ? 1.271   -41.353 49.624  1.00 31.14  ? 102 TRP A CD1 1 
ATOM   788  C CD2 . TRP A 1 101 ? 1.060   -40.115 47.776  1.00 25.56  ? 102 TRP A CD2 1 
ATOM   789  N NE1 . TRP A 1 101 ? -0.039  -41.428 49.217  1.00 30.87  ? 102 TRP A NE1 1 
ATOM   790  C CE2 . TRP A 1 101 ? -0.192  -40.675 48.083  1.00 30.16  ? 102 TRP A CE2 1 
ATOM   791  C CE3 . TRP A 1 101 ? 1.173   -39.303 46.644  1.00 30.50  ? 102 TRP A CE3 1 
ATOM   792  C CZ2 . TRP A 1 101 ? -1.325  -40.448 47.301  1.00 29.28  ? 102 TRP A CZ2 1 
ATOM   793  C CZ3 . TRP A 1 101 ? 0.051   -39.081 45.873  1.00 28.03  ? 102 TRP A CZ3 1 
ATOM   794  C CH2 . TRP A 1 101 ? -1.182  -39.650 46.206  1.00 25.73  ? 102 TRP A CH2 1 
ATOM   795  N N   . THR A 1 102 ? 5.826   -39.250 50.908  1.00 32.67  ? 103 THR A N   1 
ATOM   796  C CA  . THR A 1 102 ? 7.257   -39.217 51.158  1.00 35.56  ? 103 THR A CA  1 
ATOM   797  C C   . THR A 1 102 ? 7.631   -40.366 52.100  1.00 32.69  ? 103 THR A C   1 
ATOM   798  O O   . THR A 1 102 ? 6.773   -40.877 52.824  1.00 37.64  ? 103 THR A O   1 
ATOM   799  C CB  . THR A 1 102 ? 7.675   -37.828 51.724  1.00 33.69  ? 103 THR A CB  1 
ATOM   800  O OG1 . THR A 1 102 ? 9.079   -37.636 51.552  1.00 55.11  ? 103 THR A OG1 1 
ATOM   801  C CG2 . THR A 1 102 ? 7.334   -37.709 53.183  1.00 30.48  ? 103 THR A CG2 1 
ATOM   802  N N   . PRO A 1 103 ? 8.893   -40.822 52.050  1.00 27.49  ? 104 PRO A N   1 
ATOM   803  C CA  . PRO A 1 103 ? 9.297   -41.872 52.988  1.00 27.24  ? 104 PRO A CA  1 
ATOM   804  C C   . PRO A 1 103 ? 9.123   -41.414 54.431  1.00 42.79  ? 104 PRO A C   1 
ATOM   805  O O   . PRO A 1 103 ? 9.076   -40.211 54.698  1.00 38.50  ? 104 PRO A O   1 
ATOM   806  C CB  . PRO A 1 103 ? 10.779  -42.066 52.672  1.00 33.94  ? 104 PRO A CB  1 
ATOM   807  C CG  . PRO A 1 103 ? 10.893  -41.712 51.218  1.00 29.21  ? 104 PRO A CG  1 
ATOM   808  C CD  . PRO A 1 103 ? 9.921   -40.571 51.021  1.00 30.88  ? 104 PRO A CD  1 
ATOM   809  N N   . TYR A 1 104 ? 8.991   -42.371 55.343  1.00 38.07  ? 105 TYR A N   1 
ATOM   810  C CA  . TYR A 1 104 ? 8.883   -42.071 56.765  1.00 40.99  ? 105 TYR A CA  1 
ATOM   811  C C   . TYR A 1 104 ? 10.047  -42.731 57.507  1.00 45.58  ? 105 TYR A C   1 
ATOM   812  O O   . TYR A 1 104 ? 10.283  -43.934 57.349  1.00 40.40  ? 105 TYR A O   1 
ATOM   813  C CB  . TYR A 1 104 ? 7.544   -42.546 57.324  1.00 35.17  ? 105 TYR A CB  1 
ATOM   814  C CG  . TYR A 1 104 ? 7.298   -42.181 58.779  1.00 42.90  ? 105 TYR A CG  1 
ATOM   815  C CD1 . TYR A 1 104 ? 7.949   -42.851 59.815  1.00 38.18  ? 105 TYR A CD1 1 
ATOM   816  C CD2 . TYR A 1 104 ? 6.386   -41.186 59.117  1.00 39.46  ? 105 TYR A CD2 1 
ATOM   817  C CE1 . TYR A 1 104 ? 7.710   -42.523 61.154  1.00 40.76  ? 105 TYR A CE1 1 
ATOM   818  C CE2 . TYR A 1 104 ? 6.139   -40.853 60.441  1.00 42.43  ? 105 TYR A CE2 1 
ATOM   819  C CZ  . TYR A 1 104 ? 6.803   -41.524 61.456  1.00 49.18  ? 105 TYR A CZ  1 
ATOM   820  O OH  . TYR A 1 104 ? 6.556   -41.190 62.770  1.00 46.74  ? 105 TYR A OH  1 
ATOM   821  N N   . PRO A 1 105 ? 10.781  -41.945 58.315  1.00 50.99  ? 106 PRO A N   1 
ATOM   822  C CA  . PRO A 1 105 ? 10.553  -40.507 58.514  1.00 47.14  ? 106 PRO A CA  1 
ATOM   823  C C   . PRO A 1 105 ? 10.984  -39.717 57.276  1.00 38.66  ? 106 PRO A C   1 
ATOM   824  O O   . PRO A 1 105 ? 11.699  -40.277 56.443  1.00 35.60  ? 106 PRO A O   1 
ATOM   825  C CB  . PRO A 1 105 ? 11.463  -40.178 59.707  1.00 41.24  ? 106 PRO A CB  1 
ATOM   826  C CG  . PRO A 1 105 ? 12.573  -41.175 59.603  1.00 38.98  ? 106 PRO A CG  1 
ATOM   827  C CD  . PRO A 1 105 ? 11.943  -42.434 59.084  1.00 36.73  ? 106 PRO A CD  1 
ATOM   828  N N   . ARG A 1 106 ? 10.545  -38.464 57.151  1.00 47.95  ? 107 ARG A N   1 
ATOM   829  C CA  . ARG A 1 106 ? 10.857  -37.654 55.973  1.00 39.81  ? 107 ARG A CA  1 
ATOM   830  C C   . ARG A 1 106 ? 12.339  -37.680 55.637  1.00 38.63  ? 107 ARG A C   1 
ATOM   831  O O   . ARG A 1 106 ? 13.182  -37.613 56.527  1.00 57.17  ? 107 ARG A O   1 
ATOM   832  C CB  . ARG A 1 106 ? 10.378  -36.206 56.142  1.00 42.02  ? 107 ARG A CB  1 
ATOM   833  C CG  . ARG A 1 106 ? 8.872   -36.066 56.344  1.00 53.77  ? 107 ARG A CG  1 
ATOM   834  C CD  . ARG A 1 106 ? 8.350   -34.757 55.754  1.00 51.43  ? 107 ARG A CD  1 
ATOM   835  N NE  . ARG A 1 106 ? 9.185   -33.604 56.102  1.00 52.91  ? 107 ARG A NE  1 
ATOM   836  C CZ  . ARG A 1 106 ? 8.957   -32.795 57.133  1.00 46.77  ? 107 ARG A CZ  1 
ATOM   837  N NH1 . ARG A 1 106 ? 7.924   -33.011 57.937  1.00 46.51  ? 107 ARG A NH1 1 
ATOM   838  N NH2 . ARG A 1 106 ? 9.767   -31.770 57.365  1.00 62.11  ? 107 ARG A NH2 1 
ATOM   839  N N   . PRO A 1 107 ? 12.657  -37.798 54.345  1.00 43.35  ? 108 PRO A N   1 
ATOM   840  C CA  . PRO A 1 107 ? 14.047  -37.842 53.889  1.00 49.76  ? 108 PRO A CA  1 
ATOM   841  C C   . PRO A 1 107 ? 14.786  -36.614 54.387  1.00 54.37  ? 108 PRO A C   1 
ATOM   842  O O   . PRO A 1 107 ? 14.226  -35.518 54.348  1.00 55.84  ? 108 PRO A O   1 
ATOM   843  C CB  . PRO A 1 107 ? 13.918  -37.777 52.362  1.00 45.94  ? 108 PRO A CB  1 
ATOM   844  C CG  . PRO A 1 107 ? 12.548  -38.257 52.065  1.00 43.23  ? 108 PRO A CG  1 
ATOM   845  C CD  . PRO A 1 107 ? 11.698  -37.840 53.228  1.00 39.11  ? 108 PRO A CD  1 
ATOM   846  N N   . THR A 1 108 ? 16.015  -36.785 54.859  1.00 61.90  ? 109 THR A N   1 
ATOM   847  C CA  . THR A 1 108 ? 16.763  -35.640 55.368  1.00 68.24  ? 109 THR A CA  1 
ATOM   848  C C   . THR A 1 108 ? 17.707  -35.097 54.316  1.00 62.13  ? 109 THR A C   1 
ATOM   849  O O   . THR A 1 108 ? 18.420  -34.135 54.567  1.00 63.66  ? 109 THR A O   1 
ATOM   850  C CB  . THR A 1 108 ? 17.540  -35.952 56.674  1.00 54.38  ? 109 THR A CB  1 
ATOM   851  O OG1 . THR A 1 108 ? 18.413  -37.073 56.476  1.00 64.38  ? 109 THR A OG1 1 
ATOM   852  C CG2 . THR A 1 108 ? 16.577  -36.246 57.810  1.00 42.74  ? 109 THR A CG2 1 
ATOM   853  N N   . SER A 1 109 ? 17.696  -35.717 53.138  1.00 51.75  ? 110 SER A N   1 
ATOM   854  C CA  . SER A 1 109 ? 18.482  -35.240 52.001  1.00 53.86  ? 110 SER A CA  1 
ATOM   855  C C   . SER A 1 109 ? 17.652  -35.266 50.706  1.00 55.15  ? 110 SER A C   1 
ATOM   856  O O   . SER A 1 109 ? 16.678  -36.013 50.617  1.00 45.74  ? 110 SER A O   1 
ATOM   857  C CB  . SER A 1 109 ? 19.763  -36.066 51.865  1.00 44.22  ? 110 SER A CB  1 
ATOM   858  O OG  . SER A 1 109 ? 19.525  -37.420 52.180  1.00 54.90  ? 110 SER A OG  1 
ATOM   859  N N   . PRO A 1 110 ? 18.021  -34.436 49.709  1.00 50.72  ? 111 PRO A N   1 
ATOM   860  C CA  . PRO A 1 110 ? 17.264  -34.342 48.451  1.00 48.89  ? 111 PRO A CA  1 
ATOM   861  C C   . PRO A 1 110 ? 16.933  -35.699 47.823  1.00 49.19  ? 111 PRO A C   1 
ATOM   862  O O   . PRO A 1 110 ? 17.828  -36.431 47.404  1.00 54.60  ? 111 PRO A O   1 
ATOM   863  C CB  . PRO A 1 110 ? 18.205  -33.550 47.537  1.00 35.38  ? 111 PRO A CB  1 
ATOM   864  C CG  . PRO A 1 110 ? 18.972  -32.689 48.461  1.00 46.53  ? 111 PRO A CG  1 
ATOM   865  C CD  . PRO A 1 110 ? 19.158  -33.497 49.724  1.00 38.40  ? 111 PRO A CD  1 
ATOM   866  N N   . THR A 1 111 ? 15.640  -36.010 47.778  1.00 47.16  ? 112 THR A N   1 
ATOM   867  C CA  . THR A 1 111 ? 15.116  -37.240 47.191  1.00 47.31  ? 112 THR A CA  1 
ATOM   868  C C   . THR A 1 111 ? 14.497  -36.960 45.806  1.00 35.52  ? 112 THR A C   1 
ATOM   869  O O   . THR A 1 111 ? 13.786  -35.972 45.641  1.00 38.14  ? 112 THR A O   1 
ATOM   870  C CB  . THR A 1 111 ? 14.038  -37.812 48.122  1.00 48.63  ? 112 THR A CB  1 
ATOM   871  O OG1 . THR A 1 111 ? 14.618  -38.104 49.399  1.00 52.56  ? 112 THR A OG1 1 
ATOM   872  C CG2 . THR A 1 111 ? 13.427  -39.068 47.552  1.00 43.74  ? 112 THR A CG2 1 
ATOM   873  N N   . PRO A 1 112 ? 14.776  -37.816 44.805  1.00 50.87  ? 113 PRO A N   1 
ATOM   874  C CA  . PRO A 1 112 ? 14.189  -37.648 43.463  1.00 39.19  ? 113 PRO A CA  1 
ATOM   875  C C   . PRO A 1 112 ? 12.657  -37.647 43.485  1.00 31.78  ? 113 PRO A C   1 
ATOM   876  O O   . PRO A 1 112 ? 12.038  -38.397 44.245  1.00 35.49  ? 113 PRO A O   1 
ATOM   877  C CB  . PRO A 1 112 ? 14.716  -38.859 42.688  1.00 42.14  ? 113 PRO A CB  1 
ATOM   878  C CG  . PRO A 1 112 ? 15.156  -39.838 43.740  1.00 47.78  ? 113 PRO A CG  1 
ATOM   879  C CD  . PRO A 1 112 ? 15.658  -38.993 44.868  1.00 54.82  ? 113 PRO A CD  1 
ATOM   880  N N   . VAL A 1 113 ? 12.058  -36.787 42.668  1.00 31.70  ? 114 VAL A N   1 
ATOM   881  C CA  . VAL A 1 113 ? 10.615  -36.574 42.689  1.00 29.86  ? 114 VAL A CA  1 
ATOM   882  C C   . VAL A 1 113 ? 9.934   -37.126 41.442  1.00 27.30  ? 114 VAL A C   1 
ATOM   883  O O   . VAL A 1 113 ? 10.349  -36.823 40.321  1.00 28.06  ? 114 VAL A O   1 
ATOM   884  C CB  . VAL A 1 113 ? 10.283  -35.075 42.769  1.00 29.52  ? 114 VAL A CB  1 
ATOM   885  C CG1 . VAL A 1 113 ? 8.768   -34.865 42.837  1.00 21.49  ? 114 VAL A CG1 1 
ATOM   886  C CG2 . VAL A 1 113 ? 10.978  -34.444 43.962  1.00 26.65  ? 114 VAL A CG2 1 
ATOM   887  N N   . LEU A 1 114 ? 8.895   -37.934 41.652  1.00 25.92  ? 115 LEU A N   1 
ATOM   888  C CA  . LEU A 1 114 ? 8.001   -38.379 40.584  1.00 29.02  ? 115 LEU A CA  1 
ATOM   889  C C   . LEU A 1 114 ? 6.698   -37.598 40.673  1.00 33.81  ? 115 LEU A C   1 
ATOM   890  O O   . LEU A 1 114 ? 6.083   -37.515 41.746  1.00 28.87  ? 115 LEU A O   1 
ATOM   891  C CB  . LEU A 1 114 ? 7.712   -39.880 40.702  1.00 24.47  ? 115 LEU A CB  1 
ATOM   892  C CG  . LEU A 1 114 ? 8.771   -40.826 40.126  1.00 25.27  ? 115 LEU A CG  1 
ATOM   893  C CD1 . LEU A 1 114 ? 8.699   -42.180 40.793  1.00 33.78  ? 115 LEU A CD1 1 
ATOM   894  C CD2 . LEU A 1 114 ? 8.585   -40.970 38.628  1.00 29.99  ? 115 LEU A CD2 1 
ATOM   895  N N   . VAL A 1 115 ? 6.277   -37.019 39.555  1.00 22.91  ? 116 VAL A N   1 
ATOM   896  C CA  . VAL A 1 115 ? 5.026   -36.260 39.519  1.00 24.46  ? 116 VAL A CA  1 
ATOM   897  C C   . VAL A 1 115 ? 4.050   -36.932 38.569  1.00 26.33  ? 116 VAL A C   1 
ATOM   898  O O   . VAL A 1 115 ? 4.337   -37.091 37.383  1.00 27.41  ? 116 VAL A O   1 
ATOM   899  C CB  . VAL A 1 115 ? 5.251   -34.796 39.074  1.00 22.79  ? 116 VAL A CB  1 
ATOM   900  C CG1 . VAL A 1 115 ? 3.930   -34.024 39.053  1.00 22.05  ? 116 VAL A CG1 1 
ATOM   901  C CG2 . VAL A 1 115 ? 6.241   -34.122 39.998  1.00 22.33  ? 116 VAL A CG2 1 
ATOM   902  N N   . TRP A 1 116 ? 2.900   -37.327 39.099  1.00 23.51  ? 117 TRP A N   1 
ATOM   903  C CA  . TRP A 1 116 ? 1.909   -38.072 38.335  1.00 20.96  ? 117 TRP A CA  1 
ATOM   904  C C   . TRP A 1 116 ? 0.809   -37.169 37.784  1.00 25.02  ? 117 TRP A C   1 
ATOM   905  O O   . TRP A 1 116 ? 0.227   -36.368 38.514  1.00 19.80  ? 117 TRP A O   1 
ATOM   906  C CB  . TRP A 1 116 ? 1.284   -39.167 39.212  1.00 21.53  ? 117 TRP A CB  1 
ATOM   907  C CG  . TRP A 1 116 ? 0.160   -39.927 38.540  1.00 23.96  ? 117 TRP A CG  1 
ATOM   908  C CD1 . TRP A 1 116 ? -1.172  -39.852 38.830  1.00 21.21  ? 117 TRP A CD1 1 
ATOM   909  C CD2 . TRP A 1 116 ? 0.284   -40.871 37.469  1.00 20.65  ? 117 TRP A CD2 1 
ATOM   910  N NE1 . TRP A 1 116 ? -1.884  -40.706 38.018  1.00 25.36  ? 117 TRP A NE1 1 
ATOM   911  C CE2 . TRP A 1 116 ? -1.014  -41.335 37.169  1.00 24.96  ? 117 TRP A CE2 1 
ATOM   912  C CE3 . TRP A 1 116 ? 1.368   -41.368 36.734  1.00 23.61  ? 117 TRP A CE3 1 
ATOM   913  C CZ2 . TRP A 1 116 ? -1.257  -42.269 36.164  1.00 24.45  ? 117 TRP A CZ2 1 
ATOM   914  C CZ3 . TRP A 1 116 ? 1.122   -42.298 35.731  1.00 25.33  ? 117 TRP A CZ3 1 
ATOM   915  C CH2 . TRP A 1 116 ? -0.178  -42.736 35.458  1.00 23.84  ? 117 TRP A CH2 1 
ATOM   916  N N   . ILE A 1 117 ? 0.520   -37.301 36.492  1.00 22.51  ? 118 ILE A N   1 
ATOM   917  C CA  . ILE A 1 117 ? -0.620  -36.609 35.902  1.00 21.22  ? 118 ILE A CA  1 
ATOM   918  C C   . ILE A 1 117 ? -1.623  -37.642 35.408  1.00 22.30  ? 118 ILE A C   1 
ATOM   919  O O   . ILE A 1 117 ? -1.326  -38.383 34.481  1.00 25.13  ? 118 ILE A O   1 
ATOM   920  C CB  . ILE A 1 117 ? -0.188  -35.740 34.719  1.00 22.04  ? 118 ILE A CB  1 
ATOM   921  C CG1 . ILE A 1 117 ? 0.885   -34.743 35.159  1.00 20.94  ? 118 ILE A CG1 1 
ATOM   922  C CG2 . ILE A 1 117 ? -1.392  -35.022 34.120  1.00 17.06  ? 118 ILE A CG2 1 
ATOM   923  C CD1 . ILE A 1 117 ? 1.349   -33.841 34.023  1.00 21.76  ? 118 ILE A CD1 1 
ATOM   924  N N   . TYR A 1 118 ? -2.807  -37.703 36.010  1.00 19.99  ? 119 TYR A N   1 
ATOM   925  C CA  . TYR A 1 118 ? -3.765  -38.753 35.636  1.00 23.10  ? 119 TYR A CA  1 
ATOM   926  C C   . TYR A 1 118 ? -4.345  -38.526 34.243  1.00 24.19  ? 119 TYR A C   1 
ATOM   927  O O   . TYR A 1 118 ? -4.361  -37.397 33.745  1.00 19.60  ? 119 TYR A O   1 
ATOM   928  C CB  . TYR A 1 118 ? -4.904  -38.887 36.657  1.00 18.28  ? 119 TYR A CB  1 
ATOM   929  C CG  . TYR A 1 118 ? -5.679  -37.612 36.894  1.00 19.23  ? 119 TYR A CG  1 
ATOM   930  C CD1 . TYR A 1 118 ? -6.592  -37.143 35.955  1.00 19.55  ? 119 TYR A CD1 1 
ATOM   931  C CD2 . TYR A 1 118 ? -5.506  -36.880 38.065  1.00 16.70  ? 119 TYR A CD2 1 
ATOM   932  C CE1 . TYR A 1 118 ? -7.297  -35.974 36.164  1.00 21.01  ? 119 TYR A CE1 1 
ATOM   933  C CE2 . TYR A 1 118 ? -6.217  -35.704 38.289  1.00 19.63  ? 119 TYR A CE2 1 
ATOM   934  C CZ  . TYR A 1 118 ? -7.106  -35.256 37.340  1.00 21.21  ? 119 TYR A CZ  1 
ATOM   935  O OH  . TYR A 1 118 ? -7.803  -34.090 37.557  1.00 20.55  ? 119 TYR A OH  1 
ATOM   936  N N   . GLY A 1 119 ? -4.826  -39.606 33.630  1.00 24.32  ? 120 GLY A N   1 
ATOM   937  C CA  . GLY A 1 119 ? -5.552  -39.528 32.373  1.00 20.67  ? 120 GLY A CA  1 
ATOM   938  C C   . GLY A 1 119 ? -7.054  -39.523 32.617  1.00 30.13  ? 120 GLY A C   1 
ATOM   939  O O   . GLY A 1 119 ? -7.518  -39.333 33.750  1.00 28.86  ? 120 GLY A O   1 
ATOM   940  N N   . GLY A 1 120 ? -7.815  -39.733 31.551  1.00 23.39  ? 121 GLY A N   1 
ATOM   941  C CA  . GLY A 1 120 ? -9.261  -39.645 31.602  1.00 22.61  ? 121 GLY A CA  1 
ATOM   942  C C   . GLY A 1 120 ? -9.840  -38.926 30.392  1.00 22.80  ? 121 GLY A C   1 
ATOM   943  O O   . GLY A 1 120 ? -10.904 -38.322 30.478  1.00 28.98  ? 121 GLY A O   1 
ATOM   944  N N   . GLY A 1 121 ? -9.132  -38.969 29.267  1.00 24.20  ? 122 GLY A N   1 
ATOM   945  C CA  . GLY A 1 121 ? -9.610  -38.359 28.032  1.00 22.63  ? 122 GLY A CA  1 
ATOM   946  C C   . GLY A 1 121 ? -9.779  -36.849 28.117  1.00 24.24  ? 122 GLY A C   1 
ATOM   947  O O   . GLY A 1 121 ? -10.503 -36.258 27.318  1.00 21.01  ? 122 GLY A O   1 
ATOM   948  N N   . PHE A 1 122 ? -9.114  -36.233 29.096  1.00 25.70  ? 123 PHE A N   1 
ATOM   949  C CA  . PHE A 1 122 ? -9.217  -34.795 29.367  1.00 18.56  ? 123 PHE A CA  1 
ATOM   950  C C   . PHE A 1 122 ? -10.594 -34.357 29.865  1.00 23.97  ? 123 PHE A C   1 
ATOM   951  O O   . PHE A 1 122 ? -10.844 -33.163 30.022  1.00 25.14  ? 123 PHE A O   1 
ATOM   952  C CB  . PHE A 1 122 ? -8.811  -33.947 28.149  1.00 20.76  ? 123 PHE A CB  1 
ATOM   953  C CG  . PHE A 1 122 ? -7.335  -33.935 27.885  1.00 22.93  ? 123 PHE A CG  1 
ATOM   954  C CD1 . PHE A 1 122 ? -6.462  -33.327 28.783  1.00 20.88  ? 123 PHE A CD1 1 
ATOM   955  C CD2 . PHE A 1 122 ? -6.817  -34.521 26.736  1.00 18.86  ? 123 PHE A CD2 1 
ATOM   956  C CE1 . PHE A 1 122 ? -5.100  -33.313 28.542  1.00 22.56  ? 123 PHE A CE1 1 
ATOM   957  C CE2 . PHE A 1 122 ? -5.454  -34.506 26.487  1.00 20.32  ? 123 PHE A CE2 1 
ATOM   958  C CZ  . PHE A 1 122 ? -4.596  -33.904 27.387  1.00 21.83  ? 123 PHE A CZ  1 
ATOM   959  N N   . TYR A 1 123 ? -11.485 -35.310 30.119  1.00 18.54  ? 124 TYR A N   1 
ATOM   960  C CA  . TYR A 1 123 ? -12.820 -34.951 30.588  1.00 26.96  ? 124 TYR A CA  1 
ATOM   961  C C   . TYR A 1 123 ? -13.140 -35.579 31.939  1.00 23.20  ? 124 TYR A C   1 
ATOM   962  O O   . TYR A 1 123 ? -14.200 -35.338 32.507  1.00 26.37  ? 124 TYR A O   1 
ATOM   963  C CB  . TYR A 1 123 ? -13.900 -35.321 29.561  1.00 17.91  ? 124 TYR A CB  1 
ATOM   964  C CG  . TYR A 1 123 ? -14.182 -36.811 29.422  1.00 22.41  ? 124 TYR A CG  1 
ATOM   965  C CD1 . TYR A 1 123 ? -15.076 -37.455 30.276  1.00 21.51  ? 124 TYR A CD1 1 
ATOM   966  C CD2 . TYR A 1 123 ? -13.589 -37.564 28.408  1.00 26.61  ? 124 TYR A CD2 1 
ATOM   967  C CE1 . TYR A 1 123 ? -15.342 -38.804 30.153  1.00 25.63  ? 124 TYR A CE1 1 
ATOM   968  C CE2 . TYR A 1 123 ? -13.857 -38.926 28.272  1.00 22.43  ? 124 TYR A CE2 1 
ATOM   969  C CZ  . TYR A 1 123 ? -14.739 -39.533 29.149  1.00 31.27  ? 124 TYR A CZ  1 
ATOM   970  O OH  . TYR A 1 123 ? -15.015 -40.869 29.027  1.00 30.50  ? 124 TYR A OH  1 
ATOM   971  N N   . SER A 1 124 ? -12.231 -36.402 32.438  1.00 23.33  ? 125 SER A N   1 
ATOM   972  C CA  . SER A 1 124 ? -12.443 -37.059 33.711  1.00 24.66  ? 125 SER A CA  1 
ATOM   973  C C   . SER A 1 124 ? -11.112 -37.395 34.362  1.00 23.45  ? 125 SER A C   1 
ATOM   974  O O   . SER A 1 124 ? -10.060 -37.157 33.788  1.00 25.68  ? 125 SER A O   1 
ATOM   975  C CB  . SER A 1 124 ? -13.223 -38.346 33.489  1.00 24.09  ? 125 SER A CB  1 
ATOM   976  O OG  . SER A 1 124 ? -12.435 -39.256 32.747  1.00 24.91  ? 125 SER A OG  1 
ATOM   977  N N   . GLY A 1 125 ? -11.177 -37.988 35.549  1.00 22.69  ? 126 GLY A N   1 
ATOM   978  C CA  . GLY A 1 125 ? -9.995  -38.426 36.256  1.00 21.18  ? 126 GLY A CA  1 
ATOM   979  C C   . GLY A 1 125 ? -9.868  -37.712 37.585  1.00 25.39  ? 126 GLY A C   1 
ATOM   980  O O   . GLY A 1 125 ? -10.526 -36.699 37.823  1.00 23.50  ? 126 GLY A O   1 
ATOM   981  N N   . ALA A 1 126 ? -9.009  -38.243 38.446  1.00 19.43  ? 127 ALA A N   1 
ATOM   982  C CA  . ALA A 1 126 ? -8.777  -37.672 39.768  1.00 22.88  ? 127 ALA A CA  1 
ATOM   983  C C   . ALA A 1 126 ? -7.484  -38.244 40.347  1.00 25.17  ? 127 ALA A C   1 
ATOM   984  O O   . ALA A 1 126 ? -7.101  -39.372 40.025  1.00 21.69  ? 127 ALA A O   1 
ATOM   985  C CB  . ALA A 1 126 ? -9.956  -37.975 40.700  1.00 18.46  ? 127 ALA A CB  1 
ATOM   986  N N   . SER A 1 127 ? -6.813  -37.474 41.202  1.00 21.89  ? 128 SER A N   1 
ATOM   987  C CA  . SER A 1 127 ? -5.574  -37.941 41.823  1.00 21.37  ? 128 SER A CA  1 
ATOM   988  C C   . SER A 1 127 ? -5.843  -38.858 43.019  1.00 26.16  ? 128 SER A C   1 
ATOM   989  O O   . SER A 1 127 ? -4.932  -39.521 43.525  1.00 21.80  ? 128 SER A O   1 
ATOM   990  C CB  . SER A 1 127 ? -4.699  -36.753 42.247  1.00 28.23  ? 128 SER A CB  1 
ATOM   991  O OG  . SER A 1 127 ? -5.384  -35.916 43.166  1.00 32.75  ? 128 SER A OG  1 
ATOM   992  N N   . SER A 1 128 ? -7.096  -38.896 43.463  1.00 18.44  ? 129 SER A N   1 
ATOM   993  C CA  . SER A 1 128 ? -7.476  -39.687 44.638  1.00 23.97  ? 129 SER A CA  1 
ATOM   994  C C   . SER A 1 128 ? -7.828  -41.154 44.369  1.00 27.70  ? 129 SER A C   1 
ATOM   995  O O   . SER A 1 128 ? -8.117  -41.893 45.305  1.00 27.57  ? 129 SER A O   1 
ATOM   996  C CB  . SER A 1 128 ? -8.660  -39.035 45.341  1.00 19.81  ? 129 SER A CB  1 
ATOM   997  O OG  . SER A 1 128 ? -9.697  -38.760 44.422  1.00 20.19  ? 129 SER A OG  1 
ATOM   998  N N   . LEU A 1 129 ? -7.822  -41.576 43.109  1.00 23.91  ? 130 LEU A N   1 
ATOM   999  C CA  . LEU A 1 129 ? -8.239  -42.939 42.779  1.00 25.47  ? 130 LEU A CA  1 
ATOM   1000 C C   . LEU A 1 129 ? -7.319  -43.959 43.446  1.00 30.45  ? 130 LEU A C   1 
ATOM   1001 O O   . LEU A 1 129 ? -6.122  -43.707 43.614  1.00 27.82  ? 130 LEU A O   1 
ATOM   1002 C CB  . LEU A 1 129 ? -8.285  -43.154 41.257  1.00 23.21  ? 130 LEU A CB  1 
ATOM   1003 C CG  . LEU A 1 129 ? -9.226  -42.243 40.457  1.00 30.54  ? 130 LEU A CG  1 
ATOM   1004 C CD1 . LEU A 1 129 ? -9.358  -42.684 38.990  1.00 20.98  ? 130 LEU A CD1 1 
ATOM   1005 C CD2 . LEU A 1 129 ? -10.588 -42.148 41.118  1.00 23.83  ? 130 LEU A CD2 1 
ATOM   1006 N N   . ASP A 1 130 ? -7.877  -45.104 43.834  1.00 26.45  ? 131 ASP A N   1 
ATOM   1007 C CA  . ASP A 1 130 ? -7.095  -46.136 44.522  1.00 27.54  ? 131 ASP A CA  1 
ATOM   1008 C C   . ASP A 1 130 ? -5.887  -46.542 43.704  1.00 29.09  ? 131 ASP A C   1 
ATOM   1009 O O   . ASP A 1 130 ? -4.818  -46.787 44.242  1.00 34.71  ? 131 ASP A O   1 
ATOM   1010 C CB  . ASP A 1 130 ? -7.931  -47.391 44.764  1.00 27.70  ? 131 ASP A CB  1 
ATOM   1011 C CG  . ASP A 1 130 ? -8.959  -47.216 45.854  1.00 32.54  ? 131 ASP A CG  1 
ATOM   1012 O OD1 . ASP A 1 130 ? -9.001  -46.137 46.497  1.00 27.63  ? 131 ASP A OD1 1 
ATOM   1013 O OD2 . ASP A 1 130 ? -9.719  -48.180 46.068  1.00 42.47  ? 131 ASP A OD2 1 
ATOM   1014 N N   . VAL A 1 131 ? -6.081  -46.618 42.393  1.00 25.45  ? 132 VAL A N   1 
ATOM   1015 C CA  . VAL A 1 131 ? -5.064  -47.132 41.494  1.00 29.57  ? 132 VAL A CA  1 
ATOM   1016 C C   . VAL A 1 131 ? -3.860  -46.170 41.354  1.00 29.59  ? 132 VAL A C   1 
ATOM   1017 O O   . VAL A 1 131 ? -2.805  -46.567 40.866  1.00 27.94  ? 132 VAL A O   1 
ATOM   1018 C CB  . VAL A 1 131 ? -5.696  -47.504 40.124  1.00 30.64  ? 132 VAL A CB  1 
ATOM   1019 C CG1 . VAL A 1 131 ? -6.212  -46.261 39.416  1.00 26.44  ? 132 VAL A CG1 1 
ATOM   1020 C CG2 . VAL A 1 131 ? -4.722  -48.280 39.258  1.00 29.39  ? 132 VAL A CG2 1 
ATOM   1021 N N   . TYR A 1 132 ? -4.010  -44.927 41.820  1.00 28.18  ? 133 TYR A N   1 
ATOM   1022 C CA  . TYR A 1 132 ? -2.904  -43.963 41.819  1.00 29.78  ? 133 TYR A CA  1 
ATOM   1023 C C   . TYR A 1 132 ? -2.278  -43.754 43.206  1.00 31.72  ? 133 TYR A C   1 
ATOM   1024 O O   . TYR A 1 132 ? -1.563  -42.771 43.415  1.00 25.64  ? 133 TYR A O   1 
ATOM   1025 C CB  . TYR A 1 132 ? -3.346  -42.597 41.287  1.00 17.28  ? 133 TYR A CB  1 
ATOM   1026 C CG  . TYR A 1 132 ? -4.034  -42.632 39.949  1.00 28.00  ? 133 TYR A CG  1 
ATOM   1027 C CD1 . TYR A 1 132 ? -3.695  -43.579 38.994  1.00 21.65  ? 133 TYR A CD1 1 
ATOM   1028 C CD2 . TYR A 1 132 ? -5.034  -41.717 39.647  1.00 22.05  ? 133 TYR A CD2 1 
ATOM   1029 C CE1 . TYR A 1 132 ? -4.330  -43.610 37.781  1.00 21.56  ? 133 TYR A CE1 1 
ATOM   1030 C CE2 . TYR A 1 132 ? -5.682  -41.745 38.445  1.00 21.26  ? 133 TYR A CE2 1 
ATOM   1031 C CZ  . TYR A 1 132 ? -5.323  -42.690 37.513  1.00 25.69  ? 133 TYR A CZ  1 
ATOM   1032 O OH  . TYR A 1 132 ? -5.971  -42.714 36.312  1.00 20.49  ? 133 TYR A OH  1 
ATOM   1033 N N   . ASP A 1 133 ? -2.555  -44.662 44.141  1.00 31.53  ? 134 ASP A N   1 
ATOM   1034 C CA  . ASP A 1 133 ? -2.044  -44.579 45.510  1.00 22.16  ? 134 ASP A CA  1 
ATOM   1035 C C   . ASP A 1 133 ? -0.515  -44.599 45.519  1.00 27.32  ? 134 ASP A C   1 
ATOM   1036 O O   . ASP A 1 133 ? 0.097   -45.592 45.144  1.00 24.16  ? 134 ASP A O   1 
ATOM   1037 C CB  . ASP A 1 133 ? -2.580  -45.766 46.310  1.00 29.47  ? 134 ASP A CB  1 
ATOM   1038 C CG  . ASP A 1 133 ? -2.349  -45.634 47.819  1.00 40.87  ? 134 ASP A CG  1 
ATOM   1039 O OD1 . ASP A 1 133 ? -1.601  -44.731 48.257  1.00 31.07  ? 134 ASP A OD1 1 
ATOM   1040 O OD2 . ASP A 1 133 ? -2.924  -46.457 48.569  1.00 41.11  ? 134 ASP A OD2 1 
ATOM   1041 N N   . GLY A 1 134 ? 0.108   -43.513 45.966  1.00 28.60  ? 135 GLY A N   1 
ATOM   1042 C CA  . GLY A 1 134 ? 1.560   -43.412 45.895  1.00 28.45  ? 135 GLY A CA  1 
ATOM   1043 C C   . GLY A 1 134 ? 2.359   -44.175 46.948  1.00 35.46  ? 135 GLY A C   1 
ATOM   1044 O O   . GLY A 1 134 ? 3.599   -44.258 46.866  1.00 26.99  ? 135 GLY A O   1 
ATOM   1045 N N   . ARG A 1 135 ? 1.666   -44.751 47.926  1.00 29.03  ? 136 ARG A N   1 
ATOM   1046 C CA  . ARG A 1 135 ? 2.340   -45.306 49.101  1.00 30.36  ? 136 ARG A CA  1 
ATOM   1047 C C   . ARG A 1 135 ? 3.337   -46.426 48.798  1.00 31.10  ? 136 ARG A C   1 
ATOM   1048 O O   . ARG A 1 135 ? 4.383   -46.506 49.437  1.00 29.11  ? 136 ARG A O   1 
ATOM   1049 C CB  . ARG A 1 135 ? 1.323   -45.767 50.151  1.00 30.36  ? 136 ARG A CB  1 
ATOM   1050 C CG  . ARG A 1 135 ? 0.787   -47.172 49.947  1.00 29.12  ? 136 ARG A CG  1 
ATOM   1051 C CD  . ARG A 1 135 ? -0.197  -47.524 51.037  1.00 33.36  ? 136 ARG A CD  1 
ATOM   1052 N NE  . ARG A 1 135 ? -1.392  -46.702 50.931  1.00 27.76  ? 136 ARG A NE  1 
ATOM   1053 C CZ  . ARG A 1 135 ? -2.272  -46.529 51.904  1.00 37.49  ? 136 ARG A CZ  1 
ATOM   1054 N NH1 . ARG A 1 135 ? -2.084  -47.108 53.090  1.00 36.95  ? 136 ARG A NH1 1 
ATOM   1055 N NH2 . ARG A 1 135 ? -3.327  -45.757 51.692  1.00 32.04  ? 136 ARG A NH2 1 
ATOM   1056 N N   . PHE A 1 136 ? 3.040   -47.281 47.823  1.00 28.70  ? 137 PHE A N   1 
ATOM   1057 C CA  . PHE A 1 136 ? 3.914   -48.436 47.579  1.00 23.57  ? 137 PHE A CA  1 
ATOM   1058 C C   . PHE A 1 136 ? 5.186   -48.038 46.843  1.00 31.93  ? 137 PHE A C   1 
ATOM   1059 O O   . PHE A 1 136 ? 6.251   -48.601 47.102  1.00 28.51  ? 137 PHE A O   1 
ATOM   1060 C CB  . PHE A 1 136 ? 3.173   -49.552 46.828  1.00 28.05  ? 137 PHE A CB  1 
ATOM   1061 C CG  . PHE A 1 136 ? 1.872   -49.928 47.459  1.00 32.99  ? 137 PHE A CG  1 
ATOM   1062 C CD1 . PHE A 1 136 ? 0.675   -49.436 46.959  1.00 25.37  ? 137 PHE A CD1 1 
ATOM   1063 C CD2 . PHE A 1 136 ? 1.843   -50.740 48.585  1.00 28.82  ? 137 PHE A CD2 1 
ATOM   1064 C CE1 . PHE A 1 136 ? -0.536  -49.766 47.566  1.00 26.57  ? 137 PHE A CE1 1 
ATOM   1065 C CE2 . PHE A 1 136 ? 0.641   -51.068 49.197  1.00 27.52  ? 137 PHE A CE2 1 
ATOM   1066 C CZ  . PHE A 1 136 ? -0.549  -50.579 48.687  1.00 25.18  ? 137 PHE A CZ  1 
ATOM   1067 N N   . LEU A 1 137 ? 5.070   -47.072 45.925  1.00 33.12  ? 138 LEU A N   1 
ATOM   1068 C CA  . LEU A 1 137 ? 6.221   -46.596 45.150  1.00 31.86  ? 138 LEU A CA  1 
ATOM   1069 C C   . LEU A 1 137 ? 7.189   -45.895 46.075  1.00 30.16  ? 138 LEU A C   1 
ATOM   1070 O O   . LEU A 1 137 ? 8.398   -46.084 46.004  1.00 30.24  ? 138 LEU A O   1 
ATOM   1071 C CB  . LEU A 1 137 ? 5.787   -45.603 44.066  1.00 26.64  ? 138 LEU A CB  1 
ATOM   1072 C CG  . LEU A 1 137 ? 5.872   -46.079 42.623  1.00 33.74  ? 138 LEU A CG  1 
ATOM   1073 C CD1 . LEU A 1 137 ? 5.247   -45.031 41.725  1.00 36.39  ? 138 LEU A CD1 1 
ATOM   1074 C CD2 . LEU A 1 137 ? 7.318   -46.344 42.237  1.00 24.70  ? 138 LEU A CD2 1 
ATOM   1075 N N   . VAL A 1 138 ? 6.638   -45.068 46.949  1.00 24.12  ? 139 VAL A N   1 
ATOM   1076 C CA  . VAL A 1 138 ? 7.462   -44.276 47.831  1.00 26.45  ? 139 VAL A CA  1 
ATOM   1077 C C   . VAL A 1 138 ? 8.188   -45.164 48.836  1.00 32.12  ? 139 VAL A C   1 
ATOM   1078 O O   . VAL A 1 138 ? 9.382   -44.987 49.071  1.00 29.68  ? 139 VAL A O   1 
ATOM   1079 C CB  . VAL A 1 138 ? 6.625   -43.209 48.524  1.00 32.50  ? 139 VAL A CB  1 
ATOM   1080 C CG1 . VAL A 1 138 ? 7.421   -42.549 49.590  1.00 27.17  ? 139 VAL A CG1 1 
ATOM   1081 C CG2 . VAL A 1 138 ? 6.158   -42.188 47.488  1.00 27.75  ? 139 VAL A CG2 1 
ATOM   1082 N N   . GLN A 1 139 ? 7.482   -46.142 49.397  1.00 32.91  ? 140 GLN A N   1 
ATOM   1083 C CA  . GLN A 1 139 ? 8.109   -47.068 50.339  1.00 31.74  ? 140 GLN A CA  1 
ATOM   1084 C C   . GLN A 1 139 ? 9.187   -47.890 49.638  1.00 39.30  ? 140 GLN A C   1 
ATOM   1085 O O   . GLN A 1 139 ? 10.335  -47.930 50.084  1.00 43.09  ? 140 GLN A O   1 
ATOM   1086 C CB  . GLN A 1 139 ? 7.070   -47.992 50.994  1.00 31.75  ? 140 GLN A CB  1 
ATOM   1087 C CG  . GLN A 1 139 ? 7.564   -48.733 52.242  1.00 33.73  ? 140 GLN A CG  1 
ATOM   1088 C CD  . GLN A 1 139 ? 8.497   -49.885 51.918  1.00 31.74  ? 140 GLN A CD  1 
ATOM   1089 O OE1 . GLN A 1 139 ? 8.208   -50.702 51.051  1.00 35.36  ? 140 GLN A OE1 1 
ATOM   1090 N NE2 . GLN A 1 139 ? 9.632   -49.947 52.609  1.00 32.77  ? 140 GLN A NE2 1 
ATOM   1091 N N   . ALA A 1 140 ? 8.817   -48.537 48.536  1.00 32.26  ? 141 ALA A N   1 
ATOM   1092 C CA  . ALA A 1 140 ? 9.718   -49.468 47.874  1.00 28.69  ? 141 ALA A CA  1 
ATOM   1093 C C   . ALA A 1 140 ? 10.924  -48.793 47.231  1.00 34.55  ? 141 ALA A C   1 
ATOM   1094 O O   . ALA A 1 140 ? 12.024  -49.340 47.243  1.00 30.39  ? 141 ALA A O   1 
ATOM   1095 C CB  . ALA A 1 140 ? 8.962   -50.283 46.842  1.00 30.82  ? 141 ALA A CB  1 
ATOM   1096 N N   . GLU A 1 141 ? 10.723  -47.609 46.668  1.00 26.50  ? 142 GLU A N   1 
ATOM   1097 C CA  . GLU A 1 141 ? 11.760  -46.998 45.844  1.00 28.87  ? 142 GLU A CA  1 
ATOM   1098 C C   . GLU A 1 141 ? 12.320  -45.689 46.406  1.00 33.49  ? 142 GLU A C   1 
ATOM   1099 O O   . GLU A 1 141 ? 13.281  -45.130 45.867  1.00 28.25  ? 142 GLU A O   1 
ATOM   1100 C CB  . GLU A 1 141 ? 11.276  -46.836 44.393  1.00 30.53  ? 142 GLU A CB  1 
ATOM   1101 C CG  . GLU A 1 141 ? 11.128  -48.170 43.661  1.00 24.64  ? 142 GLU A CG  1 
ATOM   1102 C CD  . GLU A 1 141 ? 12.444  -48.928 43.593  1.00 36.37  ? 142 GLU A CD  1 
ATOM   1103 O OE1 . GLU A 1 141 ? 13.500  -48.261 43.564  1.00 39.70  ? 142 GLU A OE1 1 
ATOM   1104 O OE2 . GLU A 1 141 ? 12.437  -50.183 43.576  1.00 37.86  ? 142 GLU A OE2 1 
ATOM   1105 N N   . ARG A 1 142 ? 11.719  -45.221 47.495  1.00 33.14  ? 143 ARG A N   1 
ATOM   1106 C CA  . ARG A 1 142 ? 12.246  -44.093 48.253  1.00 33.88  ? 143 ARG A CA  1 
ATOM   1107 C C   . ARG A 1 142 ? 12.405  -42.825 47.427  1.00 35.17  ? 143 ARG A C   1 
ATOM   1108 O O   . ARG A 1 142 ? 13.416  -42.138 47.496  1.00 37.32  ? 143 ARG A O   1 
ATOM   1109 C CB  . ARG A 1 142 ? 13.527  -44.495 48.996  1.00 32.81  ? 143 ARG A CB  1 
ATOM   1110 C CG  . ARG A 1 142 ? 13.228  -45.577 50.040  1.00 41.69  ? 143 ARG A CG  1 
ATOM   1111 C CD  . ARG A 1 142 ? 14.368  -45.840 50.996  1.00 45.69  ? 143 ARG A CD  1 
ATOM   1112 N NE  . ARG A 1 142 ? 14.697  -44.679 51.819  1.00 49.01  ? 143 ARG A NE  1 
ATOM   1113 C CZ  . ARG A 1 142 ? 14.096  -44.374 52.967  1.00 54.77  ? 143 ARG A CZ  1 
ATOM   1114 N NH1 . ARG A 1 142 ? 13.114  -45.134 53.438  1.00 36.56  ? 143 ARG A NH1 1 
ATOM   1115 N NH2 . ARG A 1 142 ? 14.476  -43.299 53.643  1.00 46.18  ? 143 ARG A NH2 1 
ATOM   1116 N N   . THR A 1 143 ? 11.374  -42.546 46.640  1.00 33.06  ? 144 THR A N   1 
ATOM   1117 C CA  . THR A 1 143 ? 11.227  -41.291 45.929  1.00 32.44  ? 144 THR A CA  1 
ATOM   1118 C C   . THR A 1 143 ? 10.197  -40.447 46.676  1.00 30.98  ? 144 THR A C   1 
ATOM   1119 O O   . THR A 1 143 ? 9.502   -40.939 47.559  1.00 29.85  ? 144 THR A O   1 
ATOM   1120 C CB  . THR A 1 143 ? 10.649  -41.541 44.533  1.00 42.73  ? 144 THR A CB  1 
ATOM   1121 O OG1 . THR A 1 143 ? 9.519   -42.410 44.663  1.00 42.98  ? 144 THR A OG1 1 
ATOM   1122 C CG2 . THR A 1 143 ? 11.678  -42.199 43.616  1.00 34.45  ? 144 THR A CG2 1 
ATOM   1123 N N   . VAL A 1 144 ? 10.084  -39.176 46.315  1.00 29.70  ? 145 VAL A N   1 
ATOM   1124 C CA  . VAL A 1 144 ? 8.910   -38.403 46.696  1.00 27.73  ? 145 VAL A CA  1 
ATOM   1125 C C   . VAL A 1 144 ? 7.930   -38.442 45.515  1.00 32.47  ? 145 VAL A C   1 
ATOM   1126 O O   . VAL A 1 144 ? 8.352   -38.383 44.355  1.00 28.06  ? 145 VAL A O   1 
ATOM   1127 C CB  . VAL A 1 144 ? 9.290   -36.959 47.050  1.00 33.64  ? 145 VAL A CB  1 
ATOM   1128 C CG1 . VAL A 1 144 ? 8.044   -36.090 47.227  1.00 27.64  ? 145 VAL A CG1 1 
ATOM   1129 C CG2 . VAL A 1 144 ? 10.152  -36.945 48.318  1.00 31.79  ? 145 VAL A CG2 1 
ATOM   1130 N N   . LEU A 1 145 ? 6.638   -38.584 45.805  1.00 25.60  ? 146 LEU A N   1 
ATOM   1131 C CA  . LEU A 1 145 ? 5.621   -38.700 44.761  1.00 26.84  ? 146 LEU A CA  1 
ATOM   1132 C C   . LEU A 1 145 ? 4.603   -37.592 44.938  1.00 28.05  ? 146 LEU A C   1 
ATOM   1133 O O   . LEU A 1 145 ? 4.051   -37.413 46.023  1.00 30.25  ? 146 LEU A O   1 
ATOM   1134 C CB  . LEU A 1 145 ? 4.936   -40.078 44.817  1.00 26.90  ? 146 LEU A CB  1 
ATOM   1135 C CG  . LEU A 1 145 ? 3.976   -40.651 43.751  1.00 31.09  ? 146 LEU A CG  1 
ATOM   1136 C CD1 . LEU A 1 145 ? 2.689   -39.849 43.572  1.00 33.36  ? 146 LEU A CD1 1 
ATOM   1137 C CD2 . LEU A 1 145 ? 4.659   -40.812 42.418  1.00 39.83  ? 146 LEU A CD2 1 
ATOM   1138 N N   . VAL A 1 146 ? 4.356   -36.853 43.863  1.00 25.02  ? 147 VAL A N   1 
ATOM   1139 C CA  . VAL A 1 146 ? 3.366   -35.788 43.872  1.00 25.38  ? 147 VAL A CA  1 
ATOM   1140 C C   . VAL A 1 146 ? 2.324   -36.063 42.794  1.00 27.59  ? 147 VAL A C   1 
ATOM   1141 O O   . VAL A 1 146 ? 2.658   -36.489 41.690  1.00 25.06  ? 147 VAL A O   1 
ATOM   1142 C CB  . VAL A 1 146 ? 4.011   -34.402 43.588  1.00 27.46  ? 147 VAL A CB  1 
ATOM   1143 C CG1 . VAL A 1 146 ? 2.957   -33.290 43.631  1.00 18.43  ? 147 VAL A CG1 1 
ATOM   1144 C CG2 . VAL A 1 146 ? 5.129   -34.112 44.570  1.00 22.68  ? 147 VAL A CG2 1 
ATOM   1145 N N   . SER A 1 147 ? 1.059   -35.825 43.109  1.00 21.12  ? 148 SER A N   1 
ATOM   1146 C CA  . SER A 1 147 ? 0.030   -35.860 42.082  1.00 26.31  ? 148 SER A CA  1 
ATOM   1147 C C   . SER A 1 147 ? -0.913  -34.710 42.353  1.00 27.52  ? 148 SER A C   1 
ATOM   1148 O O   . SER A 1 147 ? -1.119  -34.315 43.502  1.00 24.67  ? 148 SER A O   1 
ATOM   1149 C CB  . SER A 1 147 ? -0.729  -37.182 42.102  1.00 21.67  ? 148 SER A CB  1 
ATOM   1150 O OG  . SER A 1 147 ? -1.335  -37.373 43.364  1.00 24.72  ? 148 SER A OG  1 
ATOM   1151 N N   . MET A 1 148 ? -1.479  -34.164 41.290  1.00 21.82  ? 149 MET A N   1 
ATOM   1152 C CA  . MET A 1 148 ? -2.349  -33.020 41.425  1.00 27.88  ? 149 MET A CA  1 
ATOM   1153 C C   . MET A 1 148 ? -3.657  -33.279 40.698  1.00 28.00  ? 149 MET A C   1 
ATOM   1154 O O   . MET A 1 148 ? -3.708  -34.080 39.767  1.00 23.57  ? 149 MET A O   1 
ATOM   1155 C CB  . MET A 1 148 ? -1.668  -31.768 40.857  1.00 24.86  ? 149 MET A CB  1 
ATOM   1156 C CG  . MET A 1 148 ? -1.910  -31.534 39.358  1.00 26.15  ? 149 MET A CG  1 
ATOM   1157 S SD  . MET A 1 148 ? -1.093  -32.745 38.305  1.00 27.58  ? 149 MET A SD  1 
ATOM   1158 C CE  . MET A 1 148 ? 0.643   -32.389 38.609  1.00 23.35  ? 149 MET A CE  1 
ATOM   1159 N N   . ASN A 1 149 ? -4.713  -32.614 41.148  1.00 20.16  ? 150 ASN A N   1 
ATOM   1160 C CA  . ASN A 1 149 ? -5.941  -32.530 40.379  1.00 22.78  ? 150 ASN A CA  1 
ATOM   1161 C C   . ASN A 1 149 ? -5.817  -31.361 39.423  1.00 23.00  ? 150 ASN A C   1 
ATOM   1162 O O   . ASN A 1 149 ? -5.228  -30.343 39.758  1.00 30.46  ? 150 ASN A O   1 
ATOM   1163 C CB  . ASN A 1 149 ? -7.128  -32.291 41.304  1.00 25.83  ? 150 ASN A CB  1 
ATOM   1164 C CG  . ASN A 1 149 ? -7.699  -33.577 41.881  1.00 27.55  ? 150 ASN A CG  1 
ATOM   1165 O OD1 . ASN A 1 149 ? -7.153  -34.671 41.699  1.00 24.18  ? 150 ASN A OD1 1 
ATOM   1166 N ND2 . ASN A 1 149 ? -8.818  -33.448 42.574  1.00 26.72  ? 150 ASN A ND2 1 
ATOM   1167 N N   . TYR A 1 150 ? -6.360  -31.506 38.227  1.00 23.62  ? 151 TYR A N   1 
ATOM   1168 C CA  . TYR A 1 150 ? -6.422  -30.399 37.291  1.00 19.26  ? 151 TYR A CA  1 
ATOM   1169 C C   . TYR A 1 150 ? -7.800  -30.424 36.667  1.00 23.65  ? 151 TYR A C   1 
ATOM   1170 O O   . TYR A 1 150 ? -8.396  -31.494 36.521  1.00 22.75  ? 151 TYR A O   1 
ATOM   1171 C CB  . TYR A 1 150 ? -5.329  -30.514 36.221  1.00 18.58  ? 151 TYR A CB  1 
ATOM   1172 C CG  . TYR A 1 150 ? -5.430  -31.759 35.360  1.00 19.03  ? 151 TYR A CG  1 
ATOM   1173 C CD1 . TYR A 1 150 ? -4.793  -32.941 35.731  1.00 17.14  ? 151 TYR A CD1 1 
ATOM   1174 C CD2 . TYR A 1 150 ? -6.166  -31.752 34.179  1.00 17.67  ? 151 TYR A CD2 1 
ATOM   1175 C CE1 . TYR A 1 150 ? -4.885  -34.083 34.952  1.00 17.68  ? 151 TYR A CE1 1 
ATOM   1176 C CE2 . TYR A 1 150 ? -6.257  -32.888 33.386  1.00 16.57  ? 151 TYR A CE2 1 
ATOM   1177 C CZ  . TYR A 1 150 ? -5.624  -34.046 33.776  1.00 23.13  ? 151 TYR A CZ  1 
ATOM   1178 O OH  . TYR A 1 150 ? -5.723  -35.170 32.982  1.00 20.83  ? 151 TYR A OH  1 
ATOM   1179 N N   . ARG A 1 151 ? -8.303  -29.254 36.293  1.00 21.70  ? 152 ARG A N   1 
ATOM   1180 C CA  . ARG A 1 151 ? -9.629  -29.148 35.686  1.00 25.69  ? 152 ARG A CA  1 
ATOM   1181 C C   . ARG A 1 151 ? -9.772  -29.922 34.380  1.00 30.18  ? 152 ARG A C   1 
ATOM   1182 O O   . ARG A 1 151 ? -8.870  -29.925 33.534  1.00 29.35  ? 152 ARG A O   1 
ATOM   1183 C CB  . ARG A 1 151 ? -9.988  -27.683 35.456  1.00 25.53  ? 152 ARG A CB  1 
ATOM   1184 C CG  . ARG A 1 151 ? -10.379 -26.959 36.725  1.00 25.79  ? 152 ARG A CG  1 
ATOM   1185 C CD  . ARG A 1 151 ? -10.519 -25.482 36.453  1.00 26.93  ? 152 ARG A CD  1 
ATOM   1186 N NE  . ARG A 1 151 ? -9.214  -24.844 36.364  1.00 26.70  ? 152 ARG A NE  1 
ATOM   1187 C CZ  . ARG A 1 151 ? -9.042  -23.558 36.095  1.00 30.64  ? 152 ARG A CZ  1 
ATOM   1188 N NH1 . ARG A 1 151 ? -10.103 -22.792 35.885  1.00 24.51  ? 152 ARG A NH1 1 
ATOM   1189 N NH2 . ARG A 1 151 ? -7.818  -23.044 36.028  1.00 23.74  ? 152 ARG A NH2 1 
ATOM   1190 N N   . VAL A 1 152 ? -10.914 -30.576 34.217  1.00 24.41  ? 153 VAL A N   1 
ATOM   1191 C CA  . VAL A 1 152 ? -11.160 -31.353 33.015  1.00 17.70  ? 153 VAL A CA  1 
ATOM   1192 C C   . VAL A 1 152 ? -12.472 -30.926 32.370  1.00 30.48  ? 153 VAL A C   1 
ATOM   1193 O O   . VAL A 1 152 ? -13.200 -30.081 32.913  1.00 23.87  ? 153 VAL A O   1 
ATOM   1194 C CB  . VAL A 1 152 ? -11.168 -32.865 33.305  1.00 24.29  ? 153 VAL A CB  1 
ATOM   1195 C CG1 . VAL A 1 152 ? -9.765  -33.346 33.653  1.00 20.45  ? 153 VAL A CG1 1 
ATOM   1196 C CG2 . VAL A 1 152 ? -12.137 -33.191 34.442  1.00 22.35  ? 153 VAL A CG2 1 
ATOM   1197 N N   . GLY A 1 153 ? -12.757 -31.500 31.202  1.00 25.64  ? 154 GLY A N   1 
ATOM   1198 C CA  . GLY A 1 153 ? -13.967 -31.183 30.472  1.00 19.77  ? 154 GLY A CA  1 
ATOM   1199 C C   . GLY A 1 153 ? -13.962 -29.718 30.118  1.00 23.99  ? 154 GLY A C   1 
ATOM   1200 O O   . GLY A 1 153 ? -12.900 -29.130 29.961  1.00 29.21  ? 154 GLY A O   1 
ATOM   1201 N N   . ALA A 1 154 ? -15.145 -29.124 30.016  1.00 28.22  ? 155 ALA A N   1 
ATOM   1202 C CA  . ALA A 1 154 ? -15.267 -27.707 29.692  1.00 30.30  ? 155 ALA A CA  1 
ATOM   1203 C C   . ALA A 1 154 ? -14.509 -26.828 30.687  1.00 30.05  ? 155 ALA A C   1 
ATOM   1204 O O   . ALA A 1 154 ? -13.926 -25.819 30.306  1.00 31.92  ? 155 ALA A O   1 
ATOM   1205 C CB  . ALA A 1 154 ? -16.744 -27.299 29.639  1.00 27.63  ? 155 ALA A CB  1 
ATOM   1206 N N   . PHE A 1 155 ? -14.523 -27.222 31.960  1.00 24.32  ? 156 PHE A N   1 
ATOM   1207 C CA  . PHE A 1 155 ? -13.907 -26.433 33.032  1.00 27.33  ? 156 PHE A CA  1 
ATOM   1208 C C   . PHE A 1 155 ? -12.417 -26.242 32.837  1.00 24.74  ? 156 PHE A C   1 
ATOM   1209 O O   . PHE A 1 155 ? -11.860 -25.223 33.228  1.00 25.75  ? 156 PHE A O   1 
ATOM   1210 C CB  . PHE A 1 155 ? -14.205 -27.069 34.393  1.00 22.47  ? 156 PHE A CB  1 
ATOM   1211 C CG  . PHE A 1 155 ? -15.657 -27.371 34.581  1.00 28.67  ? 156 PHE A CG  1 
ATOM   1212 C CD1 . PHE A 1 155 ? -16.163 -28.631 34.282  1.00 26.18  ? 156 PHE A CD1 1 
ATOM   1213 C CD2 . PHE A 1 155 ? -16.535 -26.373 34.987  1.00 24.64  ? 156 PHE A CD2 1 
ATOM   1214 C CE1 . PHE A 1 155 ? -17.509 -28.904 34.426  1.00 29.11  ? 156 PHE A CE1 1 
ATOM   1215 C CE2 . PHE A 1 155 ? -17.886 -26.638 35.136  1.00 32.95  ? 156 PHE A CE2 1 
ATOM   1216 C CZ  . PHE A 1 155 ? -18.375 -27.904 34.848  1.00 30.92  ? 156 PHE A CZ  1 
ATOM   1217 N N   . GLY A 1 156 ? -11.777 -27.216 32.206  1.00 25.35  ? 157 GLY A N   1 
ATOM   1218 C CA  . GLY A 1 156 ? -10.353 -27.142 31.968  1.00 22.28  ? 157 GLY A CA  1 
ATOM   1219 C C   . GLY A 1 156 ? -9.980  -26.766 30.553  1.00 29.44  ? 157 GLY A C   1 
ATOM   1220 O O   . GLY A 1 156 ? -8.884  -26.246 30.325  1.00 29.20  ? 157 GLY A O   1 
ATOM   1221 N N   . PHE A 1 157 ? -10.885 -26.998 29.603  1.00 23.03  ? 158 PHE A N   1 
ATOM   1222 C CA  . PHE A 1 157 ? -10.499 -26.934 28.200  1.00 23.60  ? 158 PHE A CA  1 
ATOM   1223 C C   . PHE A 1 157 ? -11.469 -26.261 27.236  1.00 29.32  ? 158 PHE A C   1 
ATOM   1224 O O   . PHE A 1 157 ? -11.220 -26.247 26.034  1.00 27.07  ? 158 PHE A O   1 
ATOM   1225 C CB  . PHE A 1 157 ? -10.109 -28.338 27.701  1.00 25.07  ? 158 PHE A CB  1 
ATOM   1226 C CG  . PHE A 1 157 ? -8.969  -28.931 28.462  1.00 26.65  ? 158 PHE A CG  1 
ATOM   1227 C CD1 . PHE A 1 157 ? -9.191  -29.866 29.459  1.00 22.89  ? 158 PHE A CD1 1 
ATOM   1228 C CD2 . PHE A 1 157 ? -7.674  -28.497 28.236  1.00 27.13  ? 158 PHE A CD2 1 
ATOM   1229 C CE1 . PHE A 1 157 ? -8.136  -30.388 30.187  1.00 22.10  ? 158 PHE A CE1 1 
ATOM   1230 C CE2 . PHE A 1 157 ? -6.617  -29.014 28.964  1.00 27.03  ? 158 PHE A CE2 1 
ATOM   1231 C CZ  . PHE A 1 157 ? -6.851  -29.961 29.944  1.00 21.30  ? 158 PHE A CZ  1 
ATOM   1232 N N   . LEU A 1 158 ? -12.563 -25.702 27.739  1.00 29.69  ? 159 LEU A N   1 
ATOM   1233 C CA  . LEU A 1 158 ? -13.423 -24.903 26.873  1.00 28.64  ? 159 LEU A CA  1 
ATOM   1234 C C   . LEU A 1 158 ? -12.618 -23.703 26.384  1.00 35.25  ? 159 LEU A C   1 
ATOM   1235 O O   . LEU A 1 158 ? -11.962 -23.020 27.170  1.00 33.01  ? 159 LEU A O   1 
ATOM   1236 C CB  . LEU A 1 158 ? -14.690 -24.429 27.593  1.00 30.96  ? 159 LEU A CB  1 
ATOM   1237 C CG  . LEU A 1 158 ? -15.605 -23.553 26.722  1.00 28.54  ? 159 LEU A CG  1 
ATOM   1238 C CD1 . LEU A 1 158 ? -17.050 -24.047 26.717  1.00 22.64  ? 159 LEU A CD1 1 
ATOM   1239 C CD2 . LEU A 1 158 ? -15.532 -22.097 27.145  1.00 26.12  ? 159 LEU A CD2 1 
ATOM   1240 N N   . ALA A 1 159 ? -12.657 -23.451 25.083  1.00 32.40  ? 160 ALA A N   1 
ATOM   1241 C CA  . ALA A 1 159 ? -11.851 -22.381 24.521  1.00 38.39  ? 160 ALA A CA  1 
ATOM   1242 C C   . ALA A 1 159 ? -12.623 -21.547 23.510  1.00 38.66  ? 160 ALA A C   1 
ATOM   1243 O O   . ALA A 1 159 ? -13.184 -22.071 22.560  1.00 35.81  ? 160 ALA A O   1 
ATOM   1244 C CB  . ALA A 1 159 ? -10.584 -22.950 23.884  1.00 25.89  ? 160 ALA A CB  1 
ATOM   1245 N N   . LEU A 1 160 ? -12.669 -20.246 23.753  1.00 34.41  ? 161 LEU A N   1 
ATOM   1246 C CA  . LEU A 1 160 ? -13.013 -19.285 22.725  1.00 36.01  ? 161 LEU A CA  1 
ATOM   1247 C C   . LEU A 1 160 ? -11.715 -18.534 22.437  1.00 41.52  ? 161 LEU A C   1 
ATOM   1248 O O   . LEU A 1 160 ? -11.415 -17.532 23.086  1.00 44.45  ? 161 LEU A O   1 
ATOM   1249 C CB  . LEU A 1 160 ? -14.104 -18.335 23.215  1.00 36.53  ? 161 LEU A CB  1 
ATOM   1250 C CG  . LEU A 1 160 ? -15.476 -18.973 23.452  1.00 47.48  ? 161 LEU A CG  1 
ATOM   1251 C CD1 . LEU A 1 160 ? -16.317 -18.072 24.322  1.00 49.83  ? 161 LEU A CD1 1 
ATOM   1252 C CD2 . LEU A 1 160 ? -16.199 -19.265 22.130  1.00 35.06  ? 161 LEU A CD2 1 
ATOM   1253 N N   . PRO A 1 161 ? -10.922 -19.044 21.480  1.00 43.14  ? 162 PRO A N   1 
ATOM   1254 C CA  . PRO A 1 161 ? -9.575  -18.532 21.204  1.00 48.58  ? 162 PRO A CA  1 
ATOM   1255 C C   . PRO A 1 161 ? -9.573  -17.034 20.911  1.00 43.87  ? 162 PRO A C   1 
ATOM   1256 O O   . PRO A 1 161 ? -10.430 -16.533 20.185  1.00 39.77  ? 162 PRO A O   1 
ATOM   1257 C CB  . PRO A 1 161 ? -9.155  -19.317 19.960  1.00 35.93  ? 162 PRO A CB  1 
ATOM   1258 C CG  . PRO A 1 161 ? -9.978  -20.565 19.998  1.00 36.09  ? 162 PRO A CG  1 
ATOM   1259 C CD  . PRO A 1 161 ? -11.301 -20.116 20.541  1.00 39.21  ? 162 PRO A CD  1 
ATOM   1260 N N   . GLY A 1 162 ? -8.619  -16.326 21.497  1.00 46.89  ? 163 GLY A N   1 
ATOM   1261 C CA  . GLY A 1 162 ? -8.566  -14.885 21.364  1.00 38.00  ? 163 GLY A CA  1 
ATOM   1262 C C   . GLY A 1 162 ? -9.198  -14.168 22.542  1.00 53.61  ? 163 GLY A C   1 
ATOM   1263 O O   . GLY A 1 162 ? -8.864  -13.020 22.820  1.00 46.50  ? 163 GLY A O   1 
ATOM   1264 N N   . SER A 1 163 ? -10.108 -14.843 23.240  1.00 43.83  ? 164 SER A N   1 
ATOM   1265 C CA  . SER A 1 163 ? -10.859 -14.198 24.304  1.00 44.08  ? 164 SER A CA  1 
ATOM   1266 C C   . SER A 1 163 ? -10.114 -14.280 25.616  1.00 45.29  ? 164 SER A C   1 
ATOM   1267 O O   . SER A 1 163 ? -9.366  -15.218 25.865  1.00 51.45  ? 164 SER A O   1 
ATOM   1268 C CB  . SER A 1 163 ? -12.229 -14.841 24.473  1.00 53.79  ? 164 SER A CB  1 
ATOM   1269 O OG  . SER A 1 163 ? -12.149 -15.928 25.376  1.00 52.25  ? 164 SER A OG  1 
ATOM   1270 N N   . ARG A 1 164 ? -10.331 -13.292 26.463  1.00 50.92  ? 165 ARG A N   1 
ATOM   1271 C CA  . ARG A 1 164 ? -9.684  -13.263 27.757  1.00 51.19  ? 165 ARG A CA  1 
ATOM   1272 C C   . ARG A 1 164 ? -10.505 -14.072 28.763  1.00 46.70  ? 165 ARG A C   1 
ATOM   1273 O O   . ARG A 1 164 ? -9.980  -14.559 29.758  1.00 58.50  ? 165 ARG A O   1 
ATOM   1274 C CB  . ARG A 1 164 ? -9.516  -11.811 28.208  1.00 55.26  ? 165 ARG A CB  1 
ATOM   1275 C CG  . ARG A 1 164 ? -8.734  -11.639 29.492  1.00 93.65  ? 165 ARG A CG  1 
ATOM   1276 C CD  . ARG A 1 164 ? -8.356  -10.182 29.730  1.00 97.62  ? 165 ARG A CD  1 
ATOM   1277 N NE  . ARG A 1 164 ? -7.711  -10.014 31.029  1.00 100.91 ? 165 ARG A NE  1 
ATOM   1278 C CZ  . ARG A 1 164 ? -6.416  -10.215 31.251  1.00 107.34 ? 165 ARG A CZ  1 
ATOM   1279 N NH1 . ARG A 1 164 ? -5.619  -10.586 30.256  1.00 100.70 ? 165 ARG A NH1 1 
ATOM   1280 N NH2 . ARG A 1 164 ? -5.917  -10.042 32.468  1.00 108.04 ? 165 ARG A NH2 1 
ATOM   1281 N N   . GLU A 1 165 ? -11.792 -14.236 28.477  1.00 50.13  ? 166 GLU A N   1 
ATOM   1282 C CA  . GLU A 1 165 ? -12.721 -14.870 29.410  1.00 46.85  ? 166 GLU A CA  1 
ATOM   1283 C C   . GLU A 1 165 ? -12.700 -16.400 29.356  1.00 46.18  ? 166 GLU A C   1 
ATOM   1284 O O   . GLU A 1 165 ? -13.067 -17.059 30.322  1.00 44.84  ? 166 GLU A O   1 
ATOM   1285 C CB  . GLU A 1 165 ? -14.149 -14.352 29.193  1.00 44.81  ? 166 GLU A CB  1 
ATOM   1286 C CG  . GLU A 1 165 ? -14.317 -12.836 29.356  1.00 48.95  ? 166 GLU A CG  1 
ATOM   1287 C CD  . GLU A 1 165 ? -14.212 -12.067 28.027  1.00 77.28  ? 166 GLU A CD  1 
ATOM   1288 O OE1 . GLU A 1 165 ? -13.789 -12.661 27.001  1.00 59.80  ? 166 GLU A OE1 1 
ATOM   1289 O OE2 . GLU A 1 165 ? -14.559 -10.861 28.007  1.00 65.71  ? 166 GLU A OE2 1 
ATOM   1290 N N   . ALA A 1 166 ? -12.274 -16.960 28.230  1.00 43.77  ? 167 ALA A N   1 
ATOM   1291 C CA  . ALA A 1 166 ? -12.112 -18.410 28.103  1.00 38.59  ? 167 ALA A CA  1 
ATOM   1292 C C   . ALA A 1 166 ? -11.022 -18.729 27.087  1.00 31.59  ? 167 ALA A C   1 
ATOM   1293 O O   . ALA A 1 166 ? -11.317 -19.096 25.943  1.00 41.95  ? 167 ALA A O   1 
ATOM   1294 C CB  . ALA A 1 166 ? -13.424 -19.060 27.695  1.00 35.60  ? 167 ALA A CB  1 
ATOM   1295 N N   . PRO A 1 167 ? -9.756  -18.571 27.495  1.00 36.01  ? 168 PRO A N   1 
ATOM   1296 C CA  . PRO A 1 167 ? -8.589  -18.685 26.605  1.00 25.76  ? 168 PRO A CA  1 
ATOM   1297 C C   . PRO A 1 167 ? -8.212  -20.115 26.251  1.00 35.05  ? 168 PRO A C   1 
ATOM   1298 O O   . PRO A 1 167 ? -7.490  -20.324 25.279  1.00 34.16  ? 168 PRO A O   1 
ATOM   1299 C CB  . PRO A 1 167 ? -7.466  -18.045 27.424  1.00 28.23  ? 168 PRO A CB  1 
ATOM   1300 C CG  . PRO A 1 167 ? -7.897  -18.214 28.845  1.00 29.87  ? 168 PRO A CG  1 
ATOM   1301 C CD  . PRO A 1 167 ? -9.386  -18.103 28.842  1.00 28.06  ? 168 PRO A CD  1 
ATOM   1302 N N   . GLY A 1 168 ? -8.682  -21.085 27.029  1.00 38.61  ? 169 GLY A N   1 
ATOM   1303 C CA  . GLY A 1 168 ? -8.380  -22.478 26.748  1.00 33.06  ? 169 GLY A CA  1 
ATOM   1304 C C   . GLY A 1 168 ? -7.120  -22.950 27.454  1.00 33.68  ? 169 GLY A C   1 
ATOM   1305 O O   . GLY A 1 168 ? -6.327  -22.139 27.940  1.00 31.42  ? 169 GLY A O   1 
ATOM   1306 N N   . ASN A 1 169 ? -6.955  -24.269 27.527  1.00 28.57  ? 170 ASN A N   1 
ATOM   1307 C CA  . ASN A 1 169 ? -5.776  -24.875 28.129  1.00 26.86  ? 170 ASN A CA  1 
ATOM   1308 C C   . ASN A 1 169 ? -5.587  -24.595 29.624  1.00 24.17  ? 170 ASN A C   1 
ATOM   1309 O O   . ASN A 1 169 ? -4.507  -24.833 30.147  1.00 28.20  ? 170 ASN A O   1 
ATOM   1310 C CB  . ASN A 1 169 ? -4.503  -24.471 27.368  1.00 26.46  ? 170 ASN A CB  1 
ATOM   1311 C CG  . ASN A 1 169 ? -4.526  -24.912 25.921  1.00 30.90  ? 170 ASN A CG  1 
ATOM   1312 O OD1 . ASN A 1 169 ? -5.172  -25.898 25.574  1.00 30.58  ? 170 ASN A OD1 1 
ATOM   1313 N ND2 . ASN A 1 169 ? -3.822  -24.180 25.065  1.00 32.76  ? 170 ASN A ND2 1 
ATOM   1314 N N   . VAL A 1 170 ? -6.617  -24.120 30.323  1.00 25.69  ? 171 VAL A N   1 
ATOM   1315 C CA  . VAL A 1 170 ? -6.433  -23.826 31.748  1.00 29.11  ? 171 VAL A CA  1 
ATOM   1316 C C   . VAL A 1 170 ? -6.127  -25.065 32.603  1.00 26.90  ? 171 VAL A C   1 
ATOM   1317 O O   . VAL A 1 170 ? -5.363  -24.989 33.559  1.00 27.98  ? 171 VAL A O   1 
ATOM   1318 C CB  . VAL A 1 170 ? -7.582  -22.975 32.348  1.00 30.36  ? 171 VAL A CB  1 
ATOM   1319 C CG1 . VAL A 1 170 ? -7.682  -21.645 31.614  1.00 24.72  ? 171 VAL A CG1 1 
ATOM   1320 C CG2 . VAL A 1 170 ? -8.910  -23.723 32.331  1.00 29.42  ? 171 VAL A CG2 1 
ATOM   1321 N N   . GLY A 1 171 ? -6.692  -26.211 32.242  1.00 24.57  ? 172 GLY A N   1 
ATOM   1322 C CA  . GLY A 1 171 ? -6.357  -27.445 32.927  1.00 22.02  ? 172 GLY A CA  1 
ATOM   1323 C C   . GLY A 1 171 ? -4.875  -27.763 32.796  1.00 26.61  ? 172 GLY A C   1 
ATOM   1324 O O   . GLY A 1 171 ? -4.252  -28.321 33.711  1.00 29.86  ? 172 GLY A O   1 
ATOM   1325 N N   . LEU A 1 172 ? -4.302  -27.411 31.648  1.00 24.48  ? 173 LEU A N   1 
ATOM   1326 C CA  . LEU A 1 172 ? -2.869  -27.575 31.445  1.00 22.78  ? 173 LEU A CA  1 
ATOM   1327 C C   . LEU A 1 172 ? -2.105  -26.593 32.330  1.00 23.32  ? 173 LEU A C   1 
ATOM   1328 O O   . LEU A 1 172 ? -1.053  -26.932 32.878  1.00 20.92  ? 173 LEU A O   1 
ATOM   1329 C CB  . LEU A 1 172 ? -2.498  -27.379 29.975  1.00 24.29  ? 173 LEU A CB  1 
ATOM   1330 C CG  . LEU A 1 172 ? -2.736  -28.551 29.027  1.00 23.91  ? 173 LEU A CG  1 
ATOM   1331 C CD1 . LEU A 1 172 ? -2.378  -28.152 27.609  1.00 21.47  ? 173 LEU A CD1 1 
ATOM   1332 C CD2 . LEU A 1 172 ? -1.916  -29.745 29.458  1.00 20.25  ? 173 LEU A CD2 1 
ATOM   1333 N N   . LEU A 1 173 ? -2.641  -25.384 32.482  1.00 19.81  ? 174 LEU A N   1 
ATOM   1334 C CA  . LEU A 1 173 ? -2.023  -24.408 33.381  1.00 28.10  ? 174 LEU A CA  1 
ATOM   1335 C C   . LEU A 1 173 ? -2.185  -24.810 34.852  1.00 25.91  ? 174 LEU A C   1 
ATOM   1336 O O   . LEU A 1 173 ? -1.355  -24.439 35.688  1.00 29.27  ? 174 LEU A O   1 
ATOM   1337 C CB  . LEU A 1 173 ? -2.540  -22.983 33.132  1.00 17.22  ? 174 LEU A CB  1 
ATOM   1338 C CG  . LEU A 1 173 ? -2.274  -22.392 31.734  1.00 37.97  ? 174 LEU A CG  1 
ATOM   1339 C CD1 . LEU A 1 173 ? -2.925  -21.026 31.579  1.00 23.27  ? 174 LEU A CD1 1 
ATOM   1340 C CD2 . LEU A 1 173 ? -0.780  -22.301 31.436  1.00 22.42  ? 174 LEU A CD2 1 
ATOM   1341 N N   . ASP A 1 174 ? -3.240  -25.566 35.164  1.00 27.11  ? 175 ASP A N   1 
ATOM   1342 C CA  . ASP A 1 174 ? -3.395  -26.122 36.514  1.00 23.95  ? 175 ASP A CA  1 
ATOM   1343 C C   . ASP A 1 174 ? -2.227  -27.055 36.770  1.00 27.22  ? 175 ASP A C   1 
ATOM   1344 O O   . ASP A 1 174 ? -1.615  -27.015 37.840  1.00 25.01  ? 175 ASP A O   1 
ATOM   1345 C CB  . ASP A 1 174 ? -4.705  -26.896 36.685  1.00 17.84  ? 175 ASP A CB  1 
ATOM   1346 C CG  . ASP A 1 174 ? -5.932  -26.011 36.562  1.00 25.53  ? 175 ASP A CG  1 
ATOM   1347 O OD1 . ASP A 1 174 ? -5.792  -24.778 36.695  1.00 22.92  ? 175 ASP A OD1 1 
ATOM   1348 O OD2 . ASP A 1 174 ? -7.040  -26.555 36.346  1.00 22.86  ? 175 ASP A OD2 1 
ATOM   1349 N N   . GLN A 1 175 ? -1.904  -27.879 35.775  1.00 21.58  ? 176 GLN A N   1 
ATOM   1350 C CA  . GLN A 1 175 ? -0.765  -28.786 35.897  1.00 28.09  ? 176 GLN A CA  1 
ATOM   1351 C C   . GLN A 1 175 ? 0.567   -28.029 36.056  1.00 27.41  ? 176 GLN A C   1 
ATOM   1352 O O   . GLN A 1 175 ? 1.396   -28.379 36.901  1.00 30.68  ? 176 GLN A O   1 
ATOM   1353 C CB  . GLN A 1 175 ? -0.701  -29.741 34.704  1.00 21.86  ? 176 GLN A CB  1 
ATOM   1354 C CG  . GLN A 1 175 ? -1.884  -30.693 34.572  1.00 22.09  ? 176 GLN A CG  1 
ATOM   1355 C CD  . GLN A 1 175 ? -1.883  -31.404 33.225  1.00 27.24  ? 176 GLN A CD  1 
ATOM   1356 O OE1 . GLN A 1 175 ? -0.900  -31.348 32.492  1.00 23.24  ? 176 GLN A OE1 1 
ATOM   1357 N NE2 . GLN A 1 175 ? -2.989  -32.061 32.890  1.00 23.17  ? 176 GLN A NE2 1 
ATOM   1358 N N   . ARG A 1 176 ? 0.761   -26.987 35.254  1.00 22.03  ? 177 ARG A N   1 
ATOM   1359 C CA  . ARG A 1 176 ? 1.982   -26.194 35.325  1.00 23.50  ? 177 ARG A CA  1 
ATOM   1360 C C   . ARG A 1 176 ? 2.130   -25.517 36.687  1.00 27.34  ? 177 ARG A C   1 
ATOM   1361 O O   . ARG A 1 176 ? 3.217   -25.515 37.268  1.00 27.20  ? 177 ARG A O   1 
ATOM   1362 C CB  . ARG A 1 176 ? 2.025   -25.144 34.211  1.00 26.63  ? 177 ARG A CB  1 
ATOM   1363 C CG  . ARG A 1 176 ? 3.158   -24.137 34.370  1.00 28.27  ? 177 ARG A CG  1 
ATOM   1364 C CD  . ARG A 1 176 ? 3.179   -23.149 33.223  1.00 25.17  ? 177 ARG A CD  1 
ATOM   1365 N NE  . ARG A 1 176 ? 3.458   -23.804 31.944  1.00 27.21  ? 177 ARG A NE  1 
ATOM   1366 C CZ  . ARG A 1 176 ? 3.251   -23.235 30.760  1.00 37.28  ? 177 ARG A CZ  1 
ATOM   1367 N NH1 . ARG A 1 176 ? 2.756   -22.005 30.707  1.00 31.00  ? 177 ARG A NH1 1 
ATOM   1368 N NH2 . ARG A 1 176 ? 3.523   -23.890 29.635  1.00 31.23  ? 177 ARG A NH2 1 
ATOM   1369 N N   . LEU A 1 177 ? 1.036   -24.952 37.190  1.00 22.03  ? 178 LEU A N   1 
ATOM   1370 C CA  . LEU A 1 177 ? 1.036   -24.307 38.505  1.00 23.50  ? 178 LEU A CA  1 
ATOM   1371 C C   . LEU A 1 177 ? 1.459   -25.290 39.598  1.00 30.48  ? 178 LEU A C   1 
ATOM   1372 O O   . LEU A 1 177 ? 2.229   -24.933 40.494  1.00 28.63  ? 178 LEU A O   1 
ATOM   1373 C CB  . LEU A 1 177 ? -0.335  -23.709 38.822  1.00 24.70  ? 178 LEU A CB  1 
ATOM   1374 C CG  . LEU A 1 177 ? -0.492  -22.985 40.159  1.00 29.28  ? 178 LEU A CG  1 
ATOM   1375 C CD1 . LEU A 1 177 ? 0.519   -21.867 40.288  1.00 23.45  ? 178 LEU A CD1 1 
ATOM   1376 C CD2 . LEU A 1 177 ? -1.893  -22.441 40.276  1.00 28.39  ? 178 LEU A CD2 1 
ATOM   1377 N N   . ALA A 1 178 ? 0.984   -26.532 39.504  1.00 24.64  ? 179 ALA A N   1 
ATOM   1378 C CA  . ALA A 1 178 ? 1.379   -27.568 40.456  1.00 24.37  ? 179 ALA A CA  1 
ATOM   1379 C C   . ALA A 1 178 ? 2.866   -27.876 40.330  1.00 23.21  ? 179 ALA A C   1 
ATOM   1380 O O   . ALA A 1 178 ? 3.556   -28.039 41.338  1.00 28.00  ? 179 ALA A O   1 
ATOM   1381 C CB  . ALA A 1 178 ? 0.547   -28.838 40.267  1.00 20.88  ? 179 ALA A CB  1 
ATOM   1382 N N   . LEU A 1 179 ? 3.357   -27.953 39.092  1.00 24.39  ? 180 LEU A N   1 
ATOM   1383 C CA  . LEU A 1 179 ? 4.792   -28.114 38.843  1.00 27.41  ? 180 LEU A CA  1 
ATOM   1384 C C   . LEU A 1 179 ? 5.617   -26.946 39.411  1.00 30.33  ? 180 LEU A C   1 
ATOM   1385 O O   . LEU A 1 179 ? 6.702   -27.150 39.948  1.00 28.51  ? 180 LEU A O   1 
ATOM   1386 C CB  . LEU A 1 179 ? 5.069   -28.294 37.349  1.00 31.29  ? 180 LEU A CB  1 
ATOM   1387 C CG  . LEU A 1 179 ? 4.554   -29.599 36.729  1.00 25.91  ? 180 LEU A CG  1 
ATOM   1388 C CD1 . LEU A 1 179 ? 4.850   -29.639 35.237  1.00 26.76  ? 180 LEU A CD1 1 
ATOM   1389 C CD2 . LEU A 1 179 ? 5.172   -30.781 37.421  1.00 25.47  ? 180 LEU A CD2 1 
ATOM   1390 N N   . GLN A 1 180 ? 5.097   -25.726 39.296  1.00 28.92  ? 181 GLN A N   1 
ATOM   1391 C CA  . GLN A 1 180 ? 5.723   -24.577 39.936  1.00 28.22  ? 181 GLN A CA  1 
ATOM   1392 C C   . GLN A 1 180 ? 5.692   -24.730 41.452  1.00 34.74  ? 181 GLN A C   1 
ATOM   1393 O O   . GLN A 1 180 ? 6.675   -24.428 42.135  1.00 32.38  ? 181 GLN A O   1 
ATOM   1394 C CB  . GLN A 1 180 ? 5.024   -23.280 39.529  1.00 29.57  ? 181 GLN A CB  1 
ATOM   1395 C CG  . GLN A 1 180 ? 5.344   -22.832 38.118  1.00 40.38  ? 181 GLN A CG  1 
ATOM   1396 C CD  . GLN A 1 180 ? 4.376   -21.783 37.608  1.00 46.79  ? 181 GLN A CD  1 
ATOM   1397 O OE1 . GLN A 1 180 ? 3.427   -21.417 38.296  1.00 50.20  ? 181 GLN A OE1 1 
ATOM   1398 N NE2 . GLN A 1 180 ? 4.608   -21.300 36.391  1.00 39.72  ? 181 GLN A NE2 1 
ATOM   1399 N N   . TRP A 1 181 ? 4.563   -25.203 41.974  1.00 25.06  ? 182 TRP A N   1 
ATOM   1400 C CA  . TRP A 1 181 ? 4.421   -25.409 43.412  1.00 32.05  ? 182 TRP A CA  1 
ATOM   1401 C C   . TRP A 1 181 ? 5.466   -26.424 43.877  1.00 29.09  ? 182 TRP A C   1 
ATOM   1402 O O   . TRP A 1 181 ? 6.075   -26.259 44.929  1.00 33.07  ? 182 TRP A O   1 
ATOM   1403 C CB  . TRP A 1 181 ? 2.992   -25.857 43.760  1.00 20.63  ? 182 TRP A CB  1 
ATOM   1404 C CG  . TRP A 1 181 ? 2.711   -26.014 45.230  1.00 26.97  ? 182 TRP A CG  1 
ATOM   1405 C CD1 . TRP A 1 181 ? 2.051   -25.124 46.047  1.00 20.38  ? 182 TRP A CD1 1 
ATOM   1406 C CD2 . TRP A 1 181 ? 3.054   -27.141 46.061  1.00 23.73  ? 182 TRP A CD2 1 
ATOM   1407 N NE1 . TRP A 1 181 ? 1.977   -25.629 47.330  1.00 32.37  ? 182 TRP A NE1 1 
ATOM   1408 C CE2 . TRP A 1 181 ? 2.583   -26.860 47.365  1.00 22.88  ? 182 TRP A CE2 1 
ATOM   1409 C CE3 . TRP A 1 181 ? 3.719   -28.353 45.829  1.00 25.34  ? 182 TRP A CE3 1 
ATOM   1410 C CZ2 . TRP A 1 181 ? 2.753   -27.746 48.429  1.00 23.46  ? 182 TRP A CZ2 1 
ATOM   1411 C CZ3 . TRP A 1 181 ? 3.885   -29.237 46.885  1.00 19.98  ? 182 TRP A CZ3 1 
ATOM   1412 C CH2 . TRP A 1 181 ? 3.403   -28.927 48.171  1.00 24.77  ? 182 TRP A CH2 1 
ATOM   1413 N N   . VAL A 1 182 ? 5.699   -27.449 43.062  1.00 32.78  ? 183 VAL A N   1 
ATOM   1414 C CA  . VAL A 1 182 ? 6.708   -28.453 43.377  1.00 34.94  ? 183 VAL A CA  1 
ATOM   1415 C C   . VAL A 1 182 ? 8.114   -27.851 43.432  1.00 35.20  ? 183 VAL A C   1 
ATOM   1416 O O   . VAL A 1 182 ? 8.860   -28.114 44.371  1.00 35.62  ? 183 VAL A O   1 
ATOM   1417 C CB  . VAL A 1 182 ? 6.662   -29.651 42.400  1.00 25.24  ? 183 VAL A CB  1 
ATOM   1418 C CG1 . VAL A 1 182 ? 7.894   -30.518 42.564  1.00 22.25  ? 183 VAL A CG1 1 
ATOM   1419 C CG2 . VAL A 1 182 ? 5.410   -30.467 42.649  1.00 21.56  ? 183 VAL A CG2 1 
ATOM   1420 N N   . GLN A 1 183 ? 8.461   -27.034 42.440  1.00 28.59  ? 184 GLN A N   1 
ATOM   1421 C CA  . GLN A 1 183 ? 9.738   -26.321 42.440  1.00 32.46  ? 184 GLN A CA  1 
ATOM   1422 C C   . GLN A 1 183 ? 9.961   -25.544 43.734  1.00 30.23  ? 184 GLN A C   1 
ATOM   1423 O O   . GLN A 1 183 ? 11.021  -25.632 44.350  1.00 31.13  ? 184 GLN A O   1 
ATOM   1424 C CB  . GLN A 1 183 ? 9.827   -25.374 41.245  1.00 28.48  ? 184 GLN A CB  1 
ATOM   1425 C CG  . GLN A 1 183 ? 10.117  -26.091 39.955  1.00 24.01  ? 184 GLN A CG  1 
ATOM   1426 C CD  . GLN A 1 183 ? 11.377  -26.927 40.052  1.00 37.24  ? 184 GLN A CD  1 
ATOM   1427 O OE1 . GLN A 1 183 ? 12.463  -26.401 40.293  1.00 47.36  ? 184 GLN A OE1 1 
ATOM   1428 N NE2 . GLN A 1 183 ? 11.240  -28.234 39.877  1.00 35.84  ? 184 GLN A NE2 1 
ATOM   1429 N N   . GLU A 1 184 ? 8.936   -24.822 44.157  1.00 24.95  ? 185 GLU A N   1 
ATOM   1430 C CA  . GLU A 1 184 ? 9.026   -23.965 45.324  1.00 32.92  ? 185 GLU A CA  1 
ATOM   1431 C C   . GLU A 1 184 ? 8.924   -24.669 46.684  1.00 43.84  ? 185 GLU A C   1 
ATOM   1432 O O   . GLU A 1 184 ? 9.483   -24.182 47.658  1.00 47.01  ? 185 GLU A O   1 
ATOM   1433 C CB  . GLU A 1 184 ? 7.982   -22.853 45.226  1.00 38.87  ? 185 GLU A CB  1 
ATOM   1434 C CG  . GLU A 1 184 ? 8.182   -21.968 43.996  1.00 46.86  ? 185 GLU A CG  1 
ATOM   1435 C CD  . GLU A 1 184 ? 7.198   -20.816 43.931  1.00 64.20  ? 185 GLU A CD  1 
ATOM   1436 O OE1 . GLU A 1 184 ? 7.024   -20.245 42.829  1.00 61.57  ? 185 GLU A OE1 1 
ATOM   1437 O OE2 . GLU A 1 184 ? 6.602   -20.483 44.981  1.00 66.78  ? 185 GLU A OE2 1 
ATOM   1438 N N   . ASN A 1 185 ? 8.243   -25.810 46.758  1.00 38.79  ? 186 ASN A N   1 
ATOM   1439 C CA  . ASN A 1 185 ? 7.915   -26.383 48.062  1.00 28.88  ? 186 ASN A CA  1 
ATOM   1440 C C   . ASN A 1 185 ? 8.336   -27.823 48.330  1.00 38.13  ? 186 ASN A C   1 
ATOM   1441 O O   . ASN A 1 185 ? 8.241   -28.293 49.473  1.00 33.01  ? 186 ASN A O   1 
ATOM   1442 C CB  . ASN A 1 185 ? 6.414   -26.275 48.320  1.00 27.58  ? 186 ASN A CB  1 
ATOM   1443 C CG  . ASN A 1 185 ? 5.918   -24.855 48.260  1.00 32.52  ? 186 ASN A CG  1 
ATOM   1444 O OD1 . ASN A 1 185 ? 6.216   -24.051 49.135  1.00 40.07  ? 186 ASN A OD1 1 
ATOM   1445 N ND2 . ASN A 1 185 ? 5.145   -24.539 47.229  1.00 32.92  ? 186 ASN A ND2 1 
ATOM   1446 N N   . VAL A 1 186 ? 8.776   -28.539 47.303  1.00 29.35  ? 187 VAL A N   1 
ATOM   1447 C CA  . VAL A 1 186 ? 8.968   -29.970 47.487  1.00 32.75  ? 187 VAL A CA  1 
ATOM   1448 C C   . VAL A 1 186 ? 10.148  -30.279 48.401  1.00 32.90  ? 187 VAL A C   1 
ATOM   1449 O O   . VAL A 1 186 ? 10.170  -31.330 49.043  1.00 34.18  ? 187 VAL A O   1 
ATOM   1450 C CB  . VAL A 1 186 ? 9.070   -30.739 46.154  1.00 30.99  ? 187 VAL A CB  1 
ATOM   1451 C CG1 . VAL A 1 186 ? 10.435  -30.539 45.513  1.00 27.19  ? 187 VAL A CG1 1 
ATOM   1452 C CG2 . VAL A 1 186 ? 8.782   -32.239 46.382  1.00 25.22  ? 187 VAL A CG2 1 
ATOM   1453 N N   . ALA A 1 187 ? 11.113  -29.359 48.478  1.00 32.13  ? 188 ALA A N   1 
ATOM   1454 C CA  . ALA A 1 187 ? 12.269  -29.534 49.365  1.00 34.93  ? 188 ALA A CA  1 
ATOM   1455 C C   . ALA A 1 187 ? 11.826  -29.634 50.823  1.00 28.80  ? 188 ALA A C   1 
ATOM   1456 O O   . ALA A 1 187 ? 12.412  -30.371 51.606  1.00 37.67  ? 188 ALA A O   1 
ATOM   1457 C CB  . ALA A 1 187 ? 13.274  -28.408 49.187  1.00 27.72  ? 188 ALA A CB  1 
ATOM   1458 N N   . ALA A 1 188 ? 10.759  -28.920 51.166  1.00 28.96  ? 189 ALA A N   1 
ATOM   1459 C CA  . ALA A 1 188 ? 10.221  -28.941 52.519  1.00 29.31  ? 189 ALA A CA  1 
ATOM   1460 C C   . ALA A 1 188 ? 9.734   -30.331 52.921  1.00 43.12  ? 189 ALA A C   1 
ATOM   1461 O O   . ALA A 1 188 ? 9.389   -30.553 54.081  1.00 40.01  ? 189 ALA A O   1 
ATOM   1462 C CB  . ALA A 1 188 ? 9.082   -27.925 52.655  1.00 27.69  ? 189 ALA A CB  1 
ATOM   1463 N N   . PHE A 1 189 ? 9.687   -31.256 51.960  1.00 38.58  ? 190 PHE A N   1 
ATOM   1464 C CA  . PHE A 1 189 ? 9.227   -32.621 52.222  1.00 34.23  ? 190 PHE A CA  1 
ATOM   1465 C C   . PHE A 1 189 ? 10.369  -33.616 52.066  1.00 33.98  ? 190 PHE A C   1 
ATOM   1466 O O   . PHE A 1 189 ? 10.187  -34.813 52.272  1.00 36.69  ? 190 PHE A O   1 
ATOM   1467 C CB  . PHE A 1 189 ? 8.096   -33.015 51.261  1.00 33.95  ? 190 PHE A CB  1 
ATOM   1468 C CG  . PHE A 1 189 ? 6.869   -32.142 51.357  1.00 29.80  ? 190 PHE A CG  1 
ATOM   1469 C CD1 . PHE A 1 189 ? 6.805   -30.935 50.683  1.00 27.02  ? 190 PHE A CD1 1 
ATOM   1470 C CD2 . PHE A 1 189 ? 5.776   -32.543 52.102  1.00 26.79  ? 190 PHE A CD2 1 
ATOM   1471 C CE1 . PHE A 1 189 ? 5.685   -30.145 50.760  1.00 27.07  ? 190 PHE A CE1 1 
ATOM   1472 C CE2 . PHE A 1 189 ? 4.649   -31.756 52.179  1.00 22.48  ? 190 PHE A CE2 1 
ATOM   1473 C CZ  . PHE A 1 189 ? 4.604   -30.556 51.510  1.00 24.77  ? 190 PHE A CZ  1 
ATOM   1474 N N   . GLY A 1 190 ? 11.544  -33.124 51.686  1.00 27.00  ? 191 GLY A N   1 
ATOM   1475 C CA  . GLY A 1 190 ? 12.674  -33.995 51.417  1.00 32.43  ? 191 GLY A CA  1 
ATOM   1476 C C   . GLY A 1 190 ? 12.924  -34.179 49.931  1.00 40.09  ? 191 GLY A C   1 
ATOM   1477 O O   . GLY A 1 190 ? 13.838  -34.898 49.516  1.00 39.41  ? 191 GLY A O   1 
ATOM   1478 N N   . GLY A 1 191 ? 12.115  -33.512 49.117  1.00 33.27  ? 192 GLY A N   1 
ATOM   1479 C CA  . GLY A 1 191 ? 12.199  -33.698 47.685  1.00 32.49  ? 192 GLY A CA  1 
ATOM   1480 C C   . GLY A 1 191 ? 13.257  -32.826 47.063  1.00 35.83  ? 192 GLY A C   1 
ATOM   1481 O O   . GLY A 1 191 ? 13.559  -31.756 47.569  1.00 48.00  ? 192 GLY A O   1 
ATOM   1482 N N   . ASP A 1 192 ? 13.803  -33.287 45.948  1.00 35.71  ? 193 ASP A N   1 
ATOM   1483 C CA  . ASP A 1 192 ? 14.836  -32.568 45.227  1.00 31.00  ? 193 ASP A CA  1 
ATOM   1484 C C   . ASP A 1 192 ? 14.244  -31.925 43.975  1.00 38.95  ? 193 ASP A C   1 
ATOM   1485 O O   . ASP A 1 192 ? 14.040  -32.594 42.964  1.00 41.41  ? 193 ASP A O   1 
ATOM   1486 C CB  . ASP A 1 192 ? 15.956  -33.551 44.871  1.00 32.48  ? 193 ASP A CB  1 
ATOM   1487 C CG  . ASP A 1 192 ? 17.042  -32.941 44.011  1.00 36.80  ? 193 ASP A CG  1 
ATOM   1488 O OD1 . ASP A 1 192 ? 17.026  -31.716 43.755  1.00 37.90  ? 193 ASP A OD1 1 
ATOM   1489 O OD2 . ASP A 1 192 ? 17.935  -33.708 43.588  1.00 44.34  ? 193 ASP A OD2 1 
ATOM   1490 N N   . PRO A 1 193 ? 13.991  -30.610 44.030  1.00 42.65  ? 194 PRO A N   1 
ATOM   1491 C CA  . PRO A 1 193 ? 13.433  -29.871 42.888  1.00 28.77  ? 194 PRO A CA  1 
ATOM   1492 C C   . PRO A 1 193 ? 14.305  -29.919 41.632  1.00 42.76  ? 194 PRO A C   1 
ATOM   1493 O O   . PRO A 1 193 ? 13.814  -29.561 40.559  1.00 40.79  ? 194 PRO A O   1 
ATOM   1494 C CB  . PRO A 1 193 ? 13.326  -28.434 43.409  1.00 36.56  ? 194 PRO A CB  1 
ATOM   1495 C CG  . PRO A 1 193 ? 14.248  -28.379 44.615  1.00 30.35  ? 194 PRO A CG  1 
ATOM   1496 C CD  . PRO A 1 193 ? 14.191  -29.751 45.211  1.00 32.45  ? 194 PRO A CD  1 
ATOM   1497 N N   . THR A 1 194 ? 15.559  -30.356 41.755  1.00 45.36  ? 195 THR A N   1 
ATOM   1498 C CA  . THR A 1 194 ? 16.450  -30.485 40.594  1.00 42.69  ? 195 THR A CA  1 
ATOM   1499 C C   . THR A 1 194 ? 16.345  -31.856 39.921  1.00 42.53  ? 195 THR A C   1 
ATOM   1500 O O   . THR A 1 194 ? 16.982  -32.098 38.892  1.00 42.66  ? 195 THR A O   1 
ATOM   1501 C CB  . THR A 1 194 ? 17.940  -30.245 40.959  1.00 45.69  ? 195 THR A CB  1 
ATOM   1502 O OG1 . THR A 1 194 ? 18.385  -31.261 41.867  1.00 41.62  ? 195 THR A OG1 1 
ATOM   1503 C CG2 . THR A 1 194 ? 18.139  -28.875 41.587  1.00 33.98  ? 195 THR A CG2 1 
ATOM   1504 N N   . SER A 1 195 ? 15.560  -32.753 40.509  1.00 35.83  ? 196 SER A N   1 
ATOM   1505 C CA  . SER A 1 195 ? 15.290  -34.048 39.887  1.00 39.57  ? 196 SER A CA  1 
ATOM   1506 C C   . SER A 1 195 ? 13.795  -34.392 39.913  1.00 41.35  ? 196 SER A C   1 
ATOM   1507 O O   . SER A 1 195 ? 13.331  -35.179 40.747  1.00 35.49  ? 196 SER A O   1 
ATOM   1508 C CB  . SER A 1 195 ? 16.098  -35.156 40.558  1.00 39.65  ? 196 SER A CB  1 
ATOM   1509 O OG  . SER A 1 195 ? 15.971  -36.367 39.830  1.00 50.22  ? 196 SER A OG  1 
ATOM   1510 N N   . VAL A 1 196 ? 13.049  -33.788 38.996  1.00 27.57  ? 197 VAL A N   1 
ATOM   1511 C CA  . VAL A 1 196 ? 11.618  -34.020 38.886  1.00 27.94  ? 197 VAL A CA  1 
ATOM   1512 C C   . VAL A 1 196 ? 11.302  -34.770 37.591  1.00 28.57  ? 197 VAL A C   1 
ATOM   1513 O O   . VAL A 1 196 ? 11.548  -34.265 36.498  1.00 30.28  ? 197 VAL A O   1 
ATOM   1514 C CB  . VAL A 1 196 ? 10.831  -32.687 38.936  1.00 30.32  ? 197 VAL A CB  1 
ATOM   1515 C CG1 . VAL A 1 196 ? 9.359   -32.905 38.589  1.00 26.55  ? 197 VAL A CG1 1 
ATOM   1516 C CG2 . VAL A 1 196 ? 10.973  -32.030 40.304  1.00 25.19  ? 197 VAL A CG2 1 
ATOM   1517 N N   . THR A 1 197 ? 10.777  -35.986 37.728  1.00 32.00  ? 198 THR A N   1 
ATOM   1518 C CA  . THR A 1 197 ? 10.340  -36.785 36.589  1.00 27.03  ? 198 THR A CA  1 
ATOM   1519 C C   . THR A 1 197 ? 8.817   -36.748 36.472  1.00 28.18  ? 198 THR A C   1 
ATOM   1520 O O   . THR A 1 197 ? 8.117   -37.116 37.410  1.00 32.09  ? 198 THR A O   1 
ATOM   1521 C CB  . THR A 1 197 ? 10.787  -38.262 36.723  1.00 34.63  ? 198 THR A CB  1 
ATOM   1522 O OG1 . THR A 1 197 ? 12.215  -38.333 36.843  1.00 30.24  ? 198 THR A OG1 1 
ATOM   1523 C CG2 . THR A 1 197 ? 10.340  -39.077 35.503  1.00 26.47  ? 198 THR A CG2 1 
ATOM   1524 N N   . LEU A 1 198 ? 8.312   -36.287 35.328  1.00 25.29  ? 199 LEU A N   1 
ATOM   1525 C CA  . LEU A 1 198 ? 6.885   -36.340 35.034  1.00 22.80  ? 199 LEU A CA  1 
ATOM   1526 C C   . LEU A 1 198 ? 6.516   -37.714 34.496  1.00 31.86  ? 199 LEU A C   1 
ATOM   1527 O O   . LEU A 1 198 ? 7.204   -38.249 33.622  1.00 27.65  ? 199 LEU A O   1 
ATOM   1528 C CB  . LEU A 1 198 ? 6.506   -35.318 33.960  1.00 28.18  ? 199 LEU A CB  1 
ATOM   1529 C CG  . LEU A 1 198 ? 6.533   -33.843 34.316  1.00 32.17  ? 199 LEU A CG  1 
ATOM   1530 C CD1 . LEU A 1 198 ? 5.909   -33.012 33.194  1.00 26.40  ? 199 LEU A CD1 1 
ATOM   1531 C CD2 . LEU A 1 198 ? 5.801   -33.648 35.608  1.00 31.95  ? 199 LEU A CD2 1 
ATOM   1532 N N   . PHE A 1 199 ? 5.435   -38.286 35.013  1.00 21.67  ? 200 PHE A N   1 
ATOM   1533 C CA  . PHE A 1 199 ? 4.839   -39.456 34.375  1.00 24.18  ? 200 PHE A CA  1 
ATOM   1534 C C   . PHE A 1 199 ? 3.323   -39.370 34.352  1.00 26.18  ? 200 PHE A C   1 
ATOM   1535 O O   . PHE A 1 199 ? 2.704   -38.760 35.229  1.00 24.65  ? 200 PHE A O   1 
ATOM   1536 C CB  . PHE A 1 199 ? 5.361   -40.799 34.925  1.00 23.63  ? 200 PHE A CB  1 
ATOM   1537 C CG  . PHE A 1 199 ? 4.939   -41.131 36.341  1.00 25.13  ? 200 PHE A CG  1 
ATOM   1538 C CD1 . PHE A 1 199 ? 4.915   -40.171 37.339  1.00 27.36  ? 200 PHE A CD1 1 
ATOM   1539 C CD2 . PHE A 1 199 ? 4.610   -42.437 36.672  1.00 21.86  ? 200 PHE A CD2 1 
ATOM   1540 C CE1 . PHE A 1 199 ? 4.550   -40.506 38.643  1.00 29.86  ? 200 PHE A CE1 1 
ATOM   1541 C CE2 . PHE A 1 199 ? 4.253   -42.781 37.967  1.00 28.50  ? 200 PHE A CE2 1 
ATOM   1542 C CZ  . PHE A 1 199 ? 4.223   -41.810 38.956  1.00 25.83  ? 200 PHE A CZ  1 
ATOM   1543 N N   . GLY A 1 200 ? 2.733   -39.943 33.314  1.00 22.95  ? 201 GLY A N   1 
ATOM   1544 C CA  . GLY A 1 200 ? 1.299   -39.840 33.126  1.00 23.34  ? 201 GLY A CA  1 
ATOM   1545 C C   . GLY A 1 200 ? 0.863   -40.914 32.163  1.00 27.57  ? 201 GLY A C   1 
ATOM   1546 O O   . GLY A 1 200 ? 1.687   -41.478 31.437  1.00 25.59  ? 201 GLY A O   1 
ATOM   1547 N N   . GLU A 1 201 ? -0.428  -41.215 32.162  1.00 23.37  ? 202 GLU A N   1 
ATOM   1548 C CA  . GLU A 1 201 ? -0.937  -42.265 31.298  1.00 20.74  ? 202 GLU A CA  1 
ATOM   1549 C C   . GLU A 1 201 ? -2.071  -41.711 30.448  1.00 27.59  ? 202 GLU A C   1 
ATOM   1550 O O   . GLU A 1 201 ? -2.900  -40.944 30.948  1.00 20.51  ? 202 GLU A O   1 
ATOM   1551 C CB  . GLU A 1 201 ? -1.387  -43.467 32.128  1.00 24.54  ? 202 GLU A CB  1 
ATOM   1552 C CG  . GLU A 1 201 ? -1.793  -44.686 31.315  1.00 19.51  ? 202 GLU A CG  1 
ATOM   1553 C CD  . GLU A 1 201 ? -3.280  -44.710 31.006  1.00 33.03  ? 202 GLU A CD  1 
ATOM   1554 O OE1 . GLU A 1 201 ? -4.010  -43.819 31.506  1.00 24.78  ? 202 GLU A OE1 1 
ATOM   1555 O OE2 . GLU A 1 201 ? -3.712  -45.612 30.249  1.00 28.82  ? 202 GLU A OE2 1 
ATOM   1556 N N   . SER A 1 202 ? -2.078  -42.071 29.161  1.00 23.61  ? 203 SER A N   1 
ATOM   1557 C CA  . SER A 1 202 ? -3.163  -41.693 28.261  1.00 21.91  ? 203 SER A CA  1 
ATOM   1558 C C   . SER A 1 202 ? -3.267  -40.162 28.162  1.00 20.29  ? 203 SER A C   1 
ATOM   1559 O O   . SER A 1 202 ? -2.305  -39.520 27.757  1.00 26.29  ? 203 SER A O   1 
ATOM   1560 C CB  . SER A 1 202 ? -4.471  -42.358 28.707  1.00 22.44  ? 203 SER A CB  1 
ATOM   1561 O OG  . SER A 1 202 ? -5.473  -42.284 27.709  1.00 32.06  ? 203 SER A OG  1 
ATOM   1562 N N   . ALA A 1 203 ? -4.389  -39.559 28.544  1.00 20.45  ? 204 ALA A N   1 
ATOM   1563 C CA  . ALA A 1 203 ? -4.462  -38.090 28.505  1.00 23.44  ? 204 ALA A CA  1 
ATOM   1564 C C   . ALA A 1 203 ? -3.405  -37.434 29.417  1.00 28.90  ? 204 ALA A C   1 
ATOM   1565 O O   . ALA A 1 203 ? -2.923  -36.326 29.140  1.00 25.37  ? 204 ALA A O   1 
ATOM   1566 C CB  . ALA A 1 203 ? -5.854  -37.596 28.848  1.00 21.19  ? 204 ALA A CB  1 
ATOM   1567 N N   . GLY A 1 204 ? -3.044  -38.132 30.494  1.00 25.70  ? 205 GLY A N   1 
ATOM   1568 C CA  . GLY A 1 204 ? -1.916  -37.749 31.327  1.00 19.25  ? 205 GLY A CA  1 
ATOM   1569 C C   . GLY A 1 204 ? -0.585  -37.750 30.591  1.00 22.44  ? 205 GLY A C   1 
ATOM   1570 O O   . GLY A 1 204 ? 0.204   -36.811 30.708  1.00 25.36  ? 205 GLY A O   1 
ATOM   1571 N N   . ALA A 1 205 ? -0.336  -38.813 29.834  1.00 23.24  ? 206 ALA A N   1 
ATOM   1572 C CA  . ALA A 1 205 ? 0.818   -38.889 28.947  1.00 23.85  ? 206 ALA A CA  1 
ATOM   1573 C C   . ALA A 1 205 ? 0.787   -37.779 27.886  1.00 26.80  ? 206 ALA A C   1 
ATOM   1574 O O   . ALA A 1 205 ? 1.810   -37.177 27.577  1.00 27.12  ? 206 ALA A O   1 
ATOM   1575 C CB  . ALA A 1 205 ? 0.884   -40.269 28.277  1.00 21.90  ? 206 ALA A CB  1 
ATOM   1576 N N   . ALA A 1 206 ? -0.385  -37.512 27.323  1.00 25.53  ? 207 ALA A N   1 
ATOM   1577 C CA  . ALA A 1 206 ? -0.508  -36.441 26.348  1.00 22.77  ? 207 ALA A CA  1 
ATOM   1578 C C   . ALA A 1 206 ? -0.138  -35.123 27.022  1.00 26.09  ? 207 ALA A C   1 
ATOM   1579 O O   . ALA A 1 206 ? 0.535   -34.275 26.433  1.00 28.32  ? 207 ALA A O   1 
ATOM   1580 C CB  . ALA A 1 206 ? -1.926  -36.380 25.794  1.00 22.13  ? 207 ALA A CB  1 
ATOM   1581 N N   . SER A 1 207 ? -0.575  -34.974 28.268  1.00 23.46  ? 208 SER A N   1 
ATOM   1582 C CA  . SER A 1 207 ? -0.245  -33.803 29.067  1.00 27.16  ? 208 SER A CA  1 
ATOM   1583 C C   . SER A 1 207 ? 1.265   -33.638 29.252  1.00 25.18  ? 208 SER A C   1 
ATOM   1584 O O   . SER A 1 207 ? 1.805   -32.553 29.017  1.00 26.26  ? 208 SER A O   1 
ATOM   1585 C CB  . SER A 1 207 ? -0.950  -33.870 30.427  1.00 22.92  ? 208 SER A CB  1 
ATOM   1586 O OG  . SER A 1 207 ? -2.333  -33.580 30.286  1.00 23.43  ? 208 SER A OG  1 
ATOM   1587 N N   . VAL A 1 208 ? 1.937   -34.707 29.678  1.00 20.78  ? 209 VAL A N   1 
ATOM   1588 C CA  . VAL A 1 208 ? 3.388   -34.684 29.841  1.00 22.56  ? 209 VAL A CA  1 
ATOM   1589 C C   . VAL A 1 208 ? 4.061   -34.203 28.550  1.00 28.46  ? 209 VAL A C   1 
ATOM   1590 O O   . VAL A 1 208 ? 4.899   -33.307 28.569  1.00 26.39  ? 209 VAL A O   1 
ATOM   1591 C CB  . VAL A 1 208 ? 3.950   -36.079 30.187  1.00 20.01  ? 209 VAL A CB  1 
ATOM   1592 C CG1 . VAL A 1 208 ? 5.465   -36.093 30.036  1.00 20.36  ? 209 VAL A CG1 1 
ATOM   1593 C CG2 . VAL A 1 208 ? 3.546   -36.500 31.576  1.00 18.62  ? 209 VAL A CG2 1 
ATOM   1594 N N   . GLY A 1 209 ? 3.675   -34.793 27.427  1.00 24.92  ? 210 GLY A N   1 
ATOM   1595 C CA  . GLY A 1 209 ? 4.235   -34.406 26.142  1.00 26.37  ? 210 GLY A CA  1 
ATOM   1596 C C   . GLY A 1 209 ? 4.034   -32.932 25.836  1.00 29.54  ? 210 GLY A C   1 
ATOM   1597 O O   . GLY A 1 209 ? 4.912   -32.274 25.285  1.00 30.44  ? 210 GLY A O   1 
ATOM   1598 N N   . MET A 1 210 ? 2.886   -32.394 26.220  1.00 24.56  ? 211 MET A N   1 
ATOM   1599 C CA  . MET A 1 210 ? 2.632   -30.982 25.991  1.00 22.14  ? 211 MET A CA  1 
ATOM   1600 C C   . MET A 1 210 ? 3.488   -30.070 26.849  1.00 33.18  ? 211 MET A C   1 
ATOM   1601 O O   . MET A 1 210 ? 3.885   -28.995 26.395  1.00 32.03  ? 211 MET A O   1 
ATOM   1602 C CB  . MET A 1 210 ? 1.150   -30.676 26.140  1.00 29.60  ? 211 MET A CB  1 
ATOM   1603 C CG  . MET A 1 210 ? 0.387   -31.279 24.977  1.00 35.54  ? 211 MET A CG  1 
ATOM   1604 S SD  . MET A 1 210 ? -1.367  -31.078 25.115  1.00 40.77  ? 211 MET A SD  1 
ATOM   1605 C CE  . MET A 1 210 ? -1.908  -32.481 24.134  1.00 23.99  ? 211 MET A CE  1 
ATOM   1606 N N   . HIS A 1 211 ? 3.787   -30.496 28.076  1.00 21.79  ? 212 HIS A N   1 
ATOM   1607 C CA  . HIS A 1 211 ? 4.747   -29.767 28.892  1.00 26.95  ? 212 HIS A CA  1 
ATOM   1608 C C   . HIS A 1 211 ? 6.159   -29.806 28.289  1.00 30.57  ? 212 HIS A C   1 
ATOM   1609 O O   . HIS A 1 211 ? 6.909   -28.837 28.398  1.00 26.22  ? 212 HIS A O   1 
ATOM   1610 C CB  . HIS A 1 211 ? 4.747   -30.278 30.333  1.00 22.24  ? 212 HIS A CB  1 
ATOM   1611 C CG  . HIS A 1 211 ? 3.473   -29.994 31.061  1.00 28.61  ? 212 HIS A CG  1 
ATOM   1612 N ND1 . HIS A 1 211 ? 3.088   -28.718 31.409  1.00 25.99  ? 212 HIS A ND1 1 
ATOM   1613 C CD2 . HIS A 1 211 ? 2.488   -30.817 31.494  1.00 28.09  ? 212 HIS A CD2 1 
ATOM   1614 C CE1 . HIS A 1 211 ? 1.919   -28.765 32.023  1.00 22.86  ? 212 HIS A CE1 1 
ATOM   1615 N NE2 . HIS A 1 211 ? 1.537   -30.028 32.096  1.00 27.02  ? 212 HIS A NE2 1 
ATOM   1616 N N   . LEU A 1 212 ? 6.507   -30.922 27.652  1.00 26.05  ? 213 LEU A N   1 
ATOM   1617 C CA  . LEU A 1 212 ? 7.781   -31.055 26.951  1.00 30.64  ? 213 LEU A CA  1 
ATOM   1618 C C   . LEU A 1 212 ? 7.925   -30.026 25.845  1.00 38.02  ? 213 LEU A C   1 
ATOM   1619 O O   . LEU A 1 212 ? 9.026   -29.544 25.582  1.00 44.65  ? 213 LEU A O   1 
ATOM   1620 C CB  . LEU A 1 212 ? 7.891   -32.432 26.302  1.00 33.14  ? 213 LEU A CB  1 
ATOM   1621 C CG  . LEU A 1 212 ? 8.438   -33.551 27.166  1.00 40.05  ? 213 LEU A CG  1 
ATOM   1622 C CD1 . LEU A 1 212 ? 8.445   -34.818 26.349  1.00 30.96  ? 213 LEU A CD1 1 
ATOM   1623 C CD2 . LEU A 1 212 ? 9.835   -33.186 27.645  1.00 34.85  ? 213 LEU A CD2 1 
ATOM   1624 N N   . LEU A 1 213 ? 6.808   -29.710 25.192  1.00 29.57  ? 214 LEU A N   1 
ATOM   1625 C CA  . LEU A 1 213 ? 6.821   -28.897 23.983  1.00 28.13  ? 214 LEU A CA  1 
ATOM   1626 C C   . LEU A 1 213 ? 6.411   -27.463 24.263  1.00 26.21  ? 214 LEU A C   1 
ATOM   1627 O O   . LEU A 1 213 ? 6.211   -26.679 23.342  1.00 31.32  ? 214 LEU A O   1 
ATOM   1628 C CB  . LEU A 1 213 ? 5.877   -29.496 22.943  1.00 21.92  ? 214 LEU A CB  1 
ATOM   1629 C CG  . LEU A 1 213 ? 6.126   -30.971 22.639  1.00 31.64  ? 214 LEU A CG  1 
ATOM   1630 C CD1 . LEU A 1 213 ? 4.966   -31.557 21.846  1.00 26.50  ? 214 LEU A CD1 1 
ATOM   1631 C CD2 . LEU A 1 213 ? 7.449   -31.152 21.895  1.00 35.43  ? 214 LEU A CD2 1 
ATOM   1632 N N   . SER A 1 214 ? 6.264   -27.124 25.535  1.00 27.44  ? 215 SER A N   1 
ATOM   1633 C CA  . SER A 1 214 ? 5.910   -25.763 25.911  1.00 25.78  ? 215 SER A CA  1 
ATOM   1634 C C   . SER A 1 214 ? 6.996   -25.216 26.836  1.00 31.98  ? 215 SER A C   1 
ATOM   1635 O O   . SER A 1 214 ? 7.137   -25.675 27.970  1.00 36.46  ? 215 SER A O   1 
ATOM   1636 C CB  . SER A 1 214 ? 4.541   -25.744 26.587  1.00 29.40  ? 215 SER A CB  1 
ATOM   1637 O OG  . SER A 1 214 ? 4.104   -24.422 26.840  1.00 30.76  ? 215 SER A OG  1 
ATOM   1638 N N   . PRO A 1 215 ? 7.795   -24.255 26.339  1.00 40.50  ? 216 PRO A N   1 
ATOM   1639 C CA  . PRO A 1 215 ? 8.962   -23.748 27.087  1.00 27.99  ? 216 PRO A CA  1 
ATOM   1640 C C   . PRO A 1 215 ? 8.720   -23.279 28.531  1.00 31.15  ? 216 PRO A C   1 
ATOM   1641 O O   . PRO A 1 215 ? 9.565   -23.570 29.381  1.00 34.66  ? 216 PRO A O   1 
ATOM   1642 C CB  . PRO A 1 215 ? 9.487   -22.620 26.195  1.00 31.46  ? 216 PRO A CB  1 
ATOM   1643 C CG  . PRO A 1 215 ? 9.132   -23.105 24.776  1.00 27.49  ? 216 PRO A CG  1 
ATOM   1644 C CD  . PRO A 1 215 ? 7.761   -23.745 24.952  1.00 35.05  ? 216 PRO A CD  1 
ATOM   1645 N N   . PRO A 1 216 ? 7.605   -22.584 28.821  1.00 27.78  ? 217 PRO A N   1 
ATOM   1646 C CA  . PRO A 1 216 ? 7.424   -22.230 30.245  1.00 22.71  ? 217 PRO A CA  1 
ATOM   1647 C C   . PRO A 1 216 ? 7.290   -23.446 31.187  1.00 33.03  ? 217 PRO A C   1 
ATOM   1648 O O   . PRO A 1 216 ? 7.548   -23.304 32.382  1.00 37.38  ? 217 PRO A O   1 
ATOM   1649 C CB  . PRO A 1 216 ? 6.136   -21.404 30.252  1.00 23.36  ? 217 PRO A CB  1 
ATOM   1650 C CG  . PRO A 1 216 ? 6.001   -20.879 28.810  1.00 23.07  ? 217 PRO A CG  1 
ATOM   1651 C CD  . PRO A 1 216 ? 6.589   -21.963 27.947  1.00 21.07  ? 217 PRO A CD  1 
ATOM   1652 N N   . SER A 1 217 ? 6.911   -24.613 30.668  1.00 29.95  ? 218 SER A N   1 
ATOM   1653 C CA  . SER A 1 217 ? 6.846   -25.831 31.491  1.00 37.79  ? 218 SER A CA  1 
ATOM   1654 C C   . SER A 1 217 ? 8.160   -26.591 31.528  1.00 34.49  ? 218 SER A C   1 
ATOM   1655 O O   . SER A 1 217 ? 8.461   -27.280 32.501  1.00 41.09  ? 218 SER A O   1 
ATOM   1656 C CB  . SER A 1 217 ? 5.752   -26.787 30.998  1.00 24.88  ? 218 SER A CB  1 
ATOM   1657 O OG  . SER A 1 217 ? 4.468   -26.233 31.192  1.00 32.68  ? 218 SER A OG  1 
ATOM   1658 N N   . ARG A 1 218 ? 8.930   -26.467 30.458  1.00 36.59  ? 219 ARG A N   1 
ATOM   1659 C CA  . ARG A 1 218 ? 10.087  -27.315 30.229  1.00 35.95  ? 219 ARG A CA  1 
ATOM   1660 C C   . ARG A 1 218 ? 11.155  -27.160 31.321  1.00 35.98  ? 219 ARG A C   1 
ATOM   1661 O O   . ARG A 1 218 ? 11.880  -28.103 31.638  1.00 43.65  ? 219 ARG A O   1 
ATOM   1662 C CB  . ARG A 1 218 ? 10.637  -27.071 28.809  1.00 41.29  ? 219 ARG A CB  1 
ATOM   1663 C CG  . ARG A 1 218 ? 11.761  -27.993 28.370  1.00 44.74  ? 219 ARG A CG  1 
ATOM   1664 C CD  . ARG A 1 218 ? 11.324  -29.437 28.273  1.00 42.98  ? 219 ARG A CD  1 
ATOM   1665 N NE  . ARG A 1 218 ? 12.470  -30.347 28.191  1.00 53.86  ? 219 ARG A NE  1 
ATOM   1666 C CZ  . ARG A 1 218 ? 13.084  -30.890 29.245  1.00 54.97  ? 219 ARG A CZ  1 
ATOM   1667 N NH1 . ARG A 1 218 ? 12.680  -30.621 30.487  1.00 34.20  ? 219 ARG A NH1 1 
ATOM   1668 N NH2 . ARG A 1 218 ? 14.114  -31.707 29.057  1.00 46.71  ? 219 ARG A NH2 1 
ATOM   1669 N N   . GLY A 1 219 ? 11.226  -25.986 31.932  1.00 31.19  ? 220 GLY A N   1 
ATOM   1670 C CA  . GLY A 1 219 ? 12.152  -25.789 33.033  1.00 26.18  ? 220 GLY A CA  1 
ATOM   1671 C C   . GLY A 1 219 ? 11.646  -26.218 34.404  1.00 35.75  ? 220 GLY A C   1 
ATOM   1672 O O   . GLY A 1 219 ? 12.328  -26.007 35.403  1.00 44.21  ? 220 GLY A O   1 
ATOM   1673 N N   . LEU A 1 220 ? 10.462  -26.823 34.469  1.00 35.44  ? 221 LEU A N   1 
ATOM   1674 C CA  . LEU A 1 220 ? 9.919   -27.287 35.749  1.00 32.12  ? 221 LEU A CA  1 
ATOM   1675 C C   . LEU A 1 220 ? 10.121  -28.783 36.006  1.00 31.46  ? 221 LEU A C   1 
ATOM   1676 O O   . LEU A 1 220 ? 9.668   -29.305 37.024  1.00 35.10  ? 221 LEU A O   1 
ATOM   1677 C CB  . LEU A 1 220 ? 8.435   -26.951 35.846  1.00 28.32  ? 221 LEU A CB  1 
ATOM   1678 C CG  . LEU A 1 220 ? 8.096   -25.495 35.548  1.00 32.52  ? 221 LEU A CG  1 
ATOM   1679 C CD1 . LEU A 1 220 ? 6.598   -25.329 35.485  1.00 27.69  ? 221 LEU A CD1 1 
ATOM   1680 C CD2 . LEU A 1 220 ? 8.700   -24.594 36.619  1.00 22.37  ? 221 LEU A CD2 1 
ATOM   1681 N N   . PHE A 1 221 ? 10.788  -29.473 35.085  1.00 29.82  ? 222 PHE A N   1 
ATOM   1682 C CA  . PHE A 1 221 ? 11.045  -30.901 35.252  1.00 32.16  ? 222 PHE A CA  1 
ATOM   1683 C C   . PHE A 1 221 ? 12.232  -31.328 34.389  1.00 33.82  ? 222 PHE A C   1 
ATOM   1684 O O   . PHE A 1 221 ? 12.711  -30.555 33.576  1.00 32.14  ? 222 PHE A O   1 
ATOM   1685 C CB  . PHE A 1 221 ? 9.792   -31.730 34.930  1.00 27.90  ? 222 PHE A CB  1 
ATOM   1686 C CG  . PHE A 1 221 ? 9.368   -31.675 33.477  1.00 26.29  ? 222 PHE A CG  1 
ATOM   1687 C CD1 . PHE A 1 221 ? 8.639   -30.601 32.989  1.00 29.51  ? 222 PHE A CD1 1 
ATOM   1688 C CD2 . PHE A 1 221 ? 9.685   -32.709 32.609  1.00 25.10  ? 222 PHE A CD2 1 
ATOM   1689 C CE1 . PHE A 1 221 ? 8.245   -30.551 31.652  1.00 30.31  ? 222 PHE A CE1 1 
ATOM   1690 C CE2 . PHE A 1 221 ? 9.298   -32.670 31.271  1.00 24.38  ? 222 PHE A CE2 1 
ATOM   1691 C CZ  . PHE A 1 221 ? 8.574   -31.592 30.793  1.00 29.70  ? 222 PHE A CZ  1 
ATOM   1692 N N   . HIS A 1 222 ? 12.687  -32.565 34.554  1.00 29.70  ? 223 HIS A N   1 
ATOM   1693 C CA  . HIS A 1 222 ? 13.948  -32.985 33.964  1.00 33.78  ? 223 HIS A CA  1 
ATOM   1694 C C   . HIS A 1 222 ? 13.839  -34.233 33.093  1.00 31.48  ? 223 HIS A C   1 
ATOM   1695 O O   . HIS A 1 222 ? 14.578  -34.387 32.127  1.00 43.50  ? 223 HIS A O   1 
ATOM   1696 C CB  . HIS A 1 222 ? 14.986  -33.142 35.083  1.00 35.65  ? 223 HIS A CB  1 
ATOM   1697 C CG  . HIS A 1 222 ? 15.022  -31.955 35.996  1.00 50.58  ? 223 HIS A CG  1 
ATOM   1698 N ND1 . HIS A 1 222 ? 14.252  -31.870 37.138  1.00 47.46  ? 223 HIS A ND1 1 
ATOM   1699 C CD2 . HIS A 1 222 ? 15.661  -30.765 35.884  1.00 40.44  ? 223 HIS A CD2 1 
ATOM   1700 C CE1 . HIS A 1 222 ? 14.445  -30.695 37.710  1.00 39.86  ? 223 HIS A CE1 1 
ATOM   1701 N NE2 . HIS A 1 222 ? 15.297  -30.006 36.970  1.00 48.27  ? 223 HIS A NE2 1 
ATOM   1702 N N   . ARG A 1 223 ? 12.911  -35.117 33.431  1.00 31.86  ? 224 ARG A N   1 
ATOM   1703 C CA  . ARG A 1 223 ? 12.680  -36.327 32.648  1.00 32.78  ? 224 ARG A CA  1 
ATOM   1704 C C   . ARG A 1 223 ? 11.188  -36.566 32.495  1.00 25.53  ? 224 ARG A C   1 
ATOM   1705 O O   . ARG A 1 223 ? 10.378  -36.012 33.241  1.00 27.81  ? 224 ARG A O   1 
ATOM   1706 C CB  . ARG A 1 223 ? 13.310  -37.538 33.328  1.00 28.22  ? 224 ARG A CB  1 
ATOM   1707 C CG  . ARG A 1 223 ? 14.797  -37.479 33.420  1.00 39.12  ? 224 ARG A CG  1 
ATOM   1708 C CD  . ARG A 1 223 ? 15.333  -38.540 34.366  1.00 35.30  ? 224 ARG A CD  1 
ATOM   1709 N NE  . ARG A 1 223 ? 16.742  -38.300 34.662  1.00 48.67  ? 224 ARG A NE  1 
ATOM   1710 C CZ  . ARG A 1 223 ? 17.169  -37.484 35.623  1.00 70.05  ? 224 ARG A CZ  1 
ATOM   1711 N NH1 . ARG A 1 223 ? 16.294  -36.835 36.389  1.00 57.25  ? 224 ARG A NH1 1 
ATOM   1712 N NH2 . ARG A 1 223 ? 18.474  -37.322 35.823  1.00 74.39  ? 224 ARG A NH2 1 
ATOM   1713 N N   . ALA A 1 224 ? 10.829  -37.419 31.548  1.00 25.41  ? 225 ALA A N   1 
ATOM   1714 C CA  . ALA A 1 224 ? 9.429   -37.628 31.225  1.00 26.78  ? 225 ALA A CA  1 
ATOM   1715 C C   . ALA A 1 224 ? 9.127   -39.091 30.921  1.00 31.88  ? 225 ALA A C   1 
ATOM   1716 O O   . ALA A 1 224 ? 9.938   -39.799 30.319  1.00 28.27  ? 225 ALA A O   1 
ATOM   1717 C CB  . ALA A 1 224 ? 9.026   -36.744 30.055  1.00 22.02  ? 225 ALA A CB  1 
ATOM   1718 N N   . VAL A 1 225 ? 7.952   -39.533 31.354  1.00 28.47  ? 226 VAL A N   1 
ATOM   1719 C CA  . VAL A 1 225 ? 7.461   -40.870 31.074  1.00 25.92  ? 226 VAL A CA  1 
ATOM   1720 C C   . VAL A 1 225 ? 6.069   -40.746 30.492  1.00 29.23  ? 226 VAL A C   1 
ATOM   1721 O O   . VAL A 1 225 ? 5.189   -40.170 31.128  1.00 27.04  ? 226 VAL A O   1 
ATOM   1722 C CB  . VAL A 1 225 ? 7.362   -41.713 32.353  1.00 26.27  ? 226 VAL A CB  1 
ATOM   1723 C CG1 . VAL A 1 225 ? 6.934   -43.128 32.021  1.00 21.47  ? 226 VAL A CG1 1 
ATOM   1724 C CG2 . VAL A 1 225 ? 8.684   -41.709 33.103  1.00 21.77  ? 226 VAL A CG2 1 
ATOM   1725 N N   . LEU A 1 226 ? 5.875   -41.280 29.287  1.00 25.03  ? 227 LEU A N   1 
ATOM   1726 C CA  . LEU A 1 226 ? 4.583   -41.220 28.613  1.00 25.86  ? 227 LEU A CA  1 
ATOM   1727 C C   . LEU A 1 226 ? 4.018   -42.620 28.390  1.00 25.31  ? 227 LEU A C   1 
ATOM   1728 O O   . LEU A 1 226 ? 4.499   -43.363 27.533  1.00 28.10  ? 227 LEU A O   1 
ATOM   1729 C CB  . LEU A 1 226 ? 4.692   -40.475 27.278  1.00 24.47  ? 227 LEU A CB  1 
ATOM   1730 C CG  . LEU A 1 226 ? 5.093   -39.004 27.350  1.00 26.99  ? 227 LEU A CG  1 
ATOM   1731 C CD1 . LEU A 1 226 ? 6.597   -38.860 27.386  1.00 26.48  ? 227 LEU A CD1 1 
ATOM   1732 C CD2 . LEU A 1 226 ? 4.504   -38.220 26.186  1.00 26.14  ? 227 LEU A CD2 1 
ATOM   1733 N N   . GLN A 1 227 ? 2.990   -42.970 29.159  1.00 26.75  ? 228 GLN A N   1 
ATOM   1734 C CA  . GLN A 1 227 ? 2.390   -44.301 29.100  1.00 26.54  ? 228 GLN A CA  1 
ATOM   1735 C C   . GLN A 1 227 ? 1.099   -44.269 28.275  1.00 27.51  ? 228 GLN A C   1 
ATOM   1736 O O   . GLN A 1 227 ? 0.139   -43.590 28.657  1.00 23.60  ? 228 GLN A O   1 
ATOM   1737 C CB  . GLN A 1 227 ? 2.084   -44.797 30.524  1.00 22.21  ? 228 GLN A CB  1 
ATOM   1738 C CG  . GLN A 1 227 ? 3.291   -44.843 31.443  1.00 22.62  ? 228 GLN A CG  1 
ATOM   1739 C CD  . GLN A 1 227 ? 2.923   -45.076 32.910  1.00 31.06  ? 228 GLN A CD  1 
ATOM   1740 O OE1 . GLN A 1 227 ? 3.676   -44.713 33.817  1.00 26.57  ? 228 GLN A OE1 1 
ATOM   1741 N NE2 . GLN A 1 227 ? 1.770   -45.689 33.144  1.00 24.89  ? 228 GLN A NE2 1 
ATOM   1742 N N   . SER A 1 228 ? 1.089   -44.989 27.148  1.00 26.39  ? 229 SER A N   1 
ATOM   1743 C CA  . SER A 1 228 ? -0.104  -45.142 26.295  1.00 18.13  ? 229 SER A CA  1 
ATOM   1744 C C   . SER A 1 228 ? -0.721  -43.814 25.900  1.00 22.52  ? 229 SER A C   1 
ATOM   1745 O O   . SER A 1 228 ? -1.941  -43.662 25.935  1.00 24.94  ? 229 SER A O   1 
ATOM   1746 C CB  . SER A 1 228 ? -1.191  -45.981 26.988  1.00 19.92  ? 229 SER A CB  1 
ATOM   1747 O OG  . SER A 1 228 ? -0.756  -47.302 27.260  1.00 28.67  ? 229 SER A OG  1 
ATOM   1748 N N   . GLY A 1 229 ? 0.110   -42.847 25.544  1.00 21.98  ? 230 GLY A N   1 
ATOM   1749 C CA  . GLY A 1 229 ? -0.400  -41.550 25.135  1.00 21.38  ? 230 GLY A CA  1 
ATOM   1750 C C   . GLY A 1 229 ? 0.704   -40.656 24.602  1.00 27.28  ? 230 GLY A C   1 
ATOM   1751 O O   . GLY A 1 229 ? 1.878   -40.875 24.885  1.00 25.83  ? 230 GLY A O   1 
ATOM   1752 N N   . ALA A 1 230 ? 0.319   -39.644 23.835  1.00 20.10  ? 231 ALA A N   1 
ATOM   1753 C CA  . ALA A 1 230 ? 1.270   -38.746 23.204  1.00 23.04  ? 231 ALA A CA  1 
ATOM   1754 C C   . ALA A 1 230 ? 0.548   -37.450 22.847  1.00 24.85  ? 231 ALA A C   1 
ATOM   1755 O O   . ALA A 1 230 ? -0.660  -37.455 22.617  1.00 26.51  ? 231 ALA A O   1 
ATOM   1756 C CB  . ALA A 1 230 ? 1.877   -39.401 21.965  1.00 27.54  ? 231 ALA A CB  1 
ATOM   1757 N N   . PRO A 1 231 ? 1.276   -36.326 22.833  1.00 26.05  ? 232 PRO A N   1 
ATOM   1758 C CA  . PRO A 1 231 ? 0.612   -35.046 22.555  1.00 22.51  ? 232 PRO A CA  1 
ATOM   1759 C C   . PRO A 1 231 ? 0.165   -34.943 21.100  1.00 31.06  ? 232 PRO A C   1 
ATOM   1760 O O   . PRO A 1 231 ? -0.747  -34.172 20.795  1.00 30.06  ? 232 PRO A O   1 
ATOM   1761 C CB  . PRO A 1 231 ? 1.693   -34.004 22.887  1.00 24.94  ? 232 PRO A CB  1 
ATOM   1762 C CG  . PRO A 1 231 ? 2.997   -34.741 22.756  1.00 24.84  ? 232 PRO A CG  1 
ATOM   1763 C CD  . PRO A 1 231 ? 2.706   -36.163 23.158  1.00 22.90  ? 232 PRO A CD  1 
ATOM   1764 N N   . ASN A 1 232 ? 0.786   -35.726 20.220  1.00 35.74  ? 233 ASN A N   1 
ATOM   1765 C CA  . ASN A 1 232 ? 0.411   -35.750 18.806  1.00 30.81  ? 233 ASN A CA  1 
ATOM   1766 C C   . ASN A 1 232 ? -0.728  -36.722 18.460  1.00 35.08  ? 233 ASN A C   1 
ATOM   1767 O O   . ASN A 1 232 ? -1.062  -36.911 17.289  1.00 29.58  ? 233 ASN A O   1 
ATOM   1768 C CB  . ASN A 1 232 ? 1.630   -36.034 17.922  1.00 27.26  ? 233 ASN A CB  1 
ATOM   1769 C CG  . ASN A 1 232 ? 2.465   -37.203 18.427  1.00 26.16  ? 233 ASN A CG  1 
ATOM   1770 O OD1 . ASN A 1 232 ? 2.879   -37.225 19.583  1.00 30.92  ? 233 ASN A OD1 1 
ATOM   1771 N ND2 . ASN A 1 232 ? 2.707   -38.179 17.565  1.00 26.58  ? 233 ASN A ND2 1 
ATOM   1772 N N   . GLY A 1 233 ? -1.338  -37.338 19.464  1.00 37.70  ? 234 GLY A N   1 
ATOM   1773 C CA  . GLY A 1 233 ? -2.542  -38.116 19.193  1.00 53.94  ? 234 GLY A CA  1 
ATOM   1774 C C   . GLY A 1 233 ? -3.657  -37.271 18.565  1.00 59.94  ? 234 GLY A C   1 
ATOM   1775 O O   . GLY A 1 233 ? -3.979  -36.196 19.088  1.00 53.24  ? 234 GLY A O   1 
ATOM   1776 N N   . PRO A 1 234 ? -4.266  -37.756 17.457  1.00 37.04  ? 235 PRO A N   1 
ATOM   1777 C CA  . PRO A 1 234 ? -5.404  -37.134 16.756  1.00 27.01  ? 235 PRO A CA  1 
ATOM   1778 C C   . PRO A 1 234 ? -6.594  -36.771 17.666  1.00 30.07  ? 235 PRO A C   1 
ATOM   1779 O O   . PRO A 1 234 ? -7.529  -36.121 17.218  1.00 37.55  ? 235 PRO A O   1 
ATOM   1780 C CB  . PRO A 1 234 ? -5.852  -38.228 15.783  1.00 27.62  ? 235 PRO A CB  1 
ATOM   1781 C CG  . PRO A 1 234 ? -5.345  -39.505 16.394  1.00 28.09  ? 235 PRO A CG  1 
ATOM   1782 C CD  . PRO A 1 234 ? -4.021  -39.121 16.967  1.00 30.08  ? 235 PRO A CD  1 
ATOM   1783 N N   . TRP A 1 235 ? -6.561  -37.196 18.922  1.00 30.85  ? 236 TRP A N   1 
ATOM   1784 C CA  . TRP A 1 235 ? -7.608  -36.864 19.882  1.00 30.26  ? 236 TRP A CA  1 
ATOM   1785 C C   . TRP A 1 235 ? -7.153  -35.836 20.925  1.00 28.49  ? 236 TRP A C   1 
ATOM   1786 O O   . TRP A 1 235 ? -7.980  -35.187 21.566  1.00 28.55  ? 236 TRP A O   1 
ATOM   1787 C CB  . TRP A 1 235 ? -8.039  -38.135 20.606  1.00 22.85  ? 236 TRP A CB  1 
ATOM   1788 C CG  . TRP A 1 235 ? -6.880  -38.859 21.201  1.00 27.99  ? 236 TRP A CG  1 
ATOM   1789 C CD1 . TRP A 1 235 ? -6.120  -39.816 20.599  1.00 22.84  ? 236 TRP A CD1 1 
ATOM   1790 C CD2 . TRP A 1 235 ? -6.335  -38.679 22.518  1.00 21.49  ? 236 TRP A CD2 1 
ATOM   1791 N NE1 . TRP A 1 235 ? -5.139  -40.253 21.461  1.00 26.94  ? 236 TRP A NE1 1 
ATOM   1792 C CE2 . TRP A 1 235 ? -5.251  -39.572 22.645  1.00 24.62  ? 236 TRP A CE2 1 
ATOM   1793 C CE3 . TRP A 1 235 ? -6.672  -37.865 23.604  1.00 26.61  ? 236 TRP A CE3 1 
ATOM   1794 C CZ2 . TRP A 1 235 ? -4.488  -39.664 23.812  1.00 25.15  ? 236 TRP A CZ2 1 
ATOM   1795 C CZ3 . TRP A 1 235 ? -5.921  -37.962 24.771  1.00 20.59  ? 236 TRP A CZ3 1 
ATOM   1796 C CH2 . TRP A 1 235 ? -4.839  -38.855 24.863  1.00 29.10  ? 236 TRP A CH2 1 
ATOM   1797 N N   . ALA A 1 236 ? -5.840  -35.699 21.099  1.00 27.76  ? 237 ALA A N   1 
ATOM   1798 C CA  . ALA A 1 236 ? -5.283  -34.937 22.222  1.00 28.99  ? 237 ALA A CA  1 
ATOM   1799 C C   . ALA A 1 236 ? -5.325  -33.414 22.060  1.00 26.77  ? 237 ALA A C   1 
ATOM   1800 O O   . ALA A 1 236 ? -5.242  -32.680 23.047  1.00 33.42  ? 237 ALA A O   1 
ATOM   1801 C CB  . ALA A 1 236 ? -3.860  -35.400 22.526  1.00 24.95  ? 237 ALA A CB  1 
ATOM   1802 N N   . THR A 1 237 ? -5.437  -32.937 20.825  1.00 24.58  ? 238 THR A N   1 
ATOM   1803 C CA  . THR A 1 237 ? -5.542  -31.500 20.588  1.00 29.80  ? 238 THR A CA  1 
ATOM   1804 C C   . THR A 1 237 ? -6.672  -31.188 19.618  1.00 24.15  ? 238 THR A C   1 
ATOM   1805 O O   . THR A 1 237 ? -7.166  -32.059 18.901  1.00 29.23  ? 238 THR A O   1 
ATOM   1806 C CB  . THR A 1 237 ? -4.228  -30.890 20.032  1.00 25.75  ? 238 THR A CB  1 
ATOM   1807 O OG1 . THR A 1 237 ? -3.893  -31.529 18.796  1.00 24.83  ? 238 THR A OG1 1 
ATOM   1808 C CG2 . THR A 1 237 ? -3.080  -31.085 21.010  1.00 29.62  ? 238 THR A CG2 1 
ATOM   1809 N N   . VAL A 1 238 ? -7.069  -29.928 19.596  1.00 26.53  ? 239 VAL A N   1 
ATOM   1810 C CA  . VAL A 1 238 ? -8.093  -29.476 18.672  1.00 31.17  ? 239 VAL A CA  1 
ATOM   1811 C C   . VAL A 1 238 ? -7.678  -28.093 18.156  1.00 33.06  ? 239 VAL A C   1 
ATOM   1812 O O   . VAL A 1 238 ? -6.981  -27.351 18.864  1.00 32.39  ? 239 VAL A O   1 
ATOM   1813 C CB  . VAL A 1 238 ? -9.481  -29.441 19.370  1.00 30.89  ? 239 VAL A CB  1 
ATOM   1814 C CG1 . VAL A 1 238 ? -9.569  -28.292 20.391  1.00 25.46  ? 239 VAL A CG1 1 
ATOM   1815 C CG2 . VAL A 1 238 ? -10.571 -29.328 18.365  1.00 34.32  ? 239 VAL A CG2 1 
ATOM   1816 N N   . GLY A 1 239 ? -8.071  -27.761 16.923  1.00 37.19  ? 240 GLY A N   1 
ATOM   1817 C CA  . GLY A 1 239 ? -7.748  -26.466 16.339  1.00 25.62  ? 240 GLY A CA  1 
ATOM   1818 C C   . GLY A 1 239 ? -8.611  -25.338 16.889  1.00 37.85  ? 240 GLY A C   1 
ATOM   1819 O O   . GLY A 1 239 ? -9.681  -25.590 17.440  1.00 36.36  ? 240 GLY A O   1 
ATOM   1820 N N   . MET A 1 240 ? -8.151  -24.096 16.743  1.00 34.93  ? 241 MET A N   1 
ATOM   1821 C CA  . MET A 1 240 ? -8.908  -22.933 17.213  1.00 34.75  ? 241 MET A CA  1 
ATOM   1822 C C   . MET A 1 240 ? -10.355 -22.910 16.709  1.00 37.04  ? 241 MET A C   1 
ATOM   1823 O O   . MET A 1 240 ? -11.294 -22.729 17.490  1.00 35.13  ? 241 MET A O   1 
ATOM   1824 C CB  . MET A 1 240 ? -8.203  -21.631 16.822  1.00 31.95  ? 241 MET A CB  1 
ATOM   1825 C CG  . MET A 1 240 ? -7.027  -21.275 17.699  1.00 48.81  ? 241 MET A CG  1 
ATOM   1826 S SD  . MET A 1 240 ? -6.029  -19.919 17.047  1.00 59.77  ? 241 MET A SD  1 
ATOM   1827 C CE  . MET A 1 240 ? -7.029  -18.479 17.394  1.00 51.93  ? 241 MET A CE  1 
ATOM   1828 N N   . GLY A 1 241 ? -10.524 -23.102 15.406  1.00 37.06  ? 242 GLY A N   1 
ATOM   1829 C CA  . GLY A 1 241 ? -11.837 -23.092 14.787  1.00 33.97  ? 242 GLY A CA  1 
ATOM   1830 C C   . GLY A 1 241 ? -12.802 -24.123 15.350  1.00 35.54  ? 242 GLY A C   1 
ATOM   1831 O O   . GLY A 1 241 ? -13.950 -23.805 15.653  1.00 33.59  ? 242 GLY A O   1 
ATOM   1832 N N   . GLU A 1 242 ? -12.348 -25.364 15.483  1.00 36.08  ? 243 GLU A N   1 
ATOM   1833 C CA  . GLU A 1 242 ? -13.203 -26.409 16.030  1.00 33.66  ? 243 GLU A CA  1 
ATOM   1834 C C   . GLU A 1 242 ? -13.435 -26.205 17.541  1.00 39.48  ? 243 GLU A C   1 
ATOM   1835 O O   . GLU A 1 242 ? -14.490 -26.559 18.069  1.00 36.92  ? 243 GLU A O   1 
ATOM   1836 C CB  . GLU A 1 242 ? -12.628 -27.796 15.716  1.00 30.65  ? 243 GLU A CB  1 
ATOM   1837 C CG  . GLU A 1 242 ? -13.399 -28.985 16.313  1.00 33.50  ? 243 GLU A CG  1 
ATOM   1838 C CD  . GLU A 1 242 ? -14.769 -29.204 15.680  1.00 40.63  ? 243 GLU A CD  1 
ATOM   1839 O OE1 . GLU A 1 242 ? -15.114 -28.472 14.730  1.00 52.05  ? 243 GLU A OE1 1 
ATOM   1840 O OE2 . GLU A 1 242 ? -15.500 -30.118 16.128  1.00 39.60  ? 243 GLU A OE2 1 
ATOM   1841 N N   . ALA A 1 243 ? -12.465 -25.616 18.233  1.00 31.60  ? 244 ALA A N   1 
ATOM   1842 C CA  . ALA A 1 243 ? -12.646 -25.331 19.653  1.00 33.66  ? 244 ALA A CA  1 
ATOM   1843 C C   . ALA A 1 243 ? -13.766 -24.316 19.823  1.00 36.65  ? 244 ALA A C   1 
ATOM   1844 O O   . ALA A 1 243 ? -14.653 -24.500 20.656  1.00 37.01  ? 244 ALA A O   1 
ATOM   1845 C CB  . ALA A 1 243 ? -11.356 -24.821 20.287  1.00 29.44  ? 244 ALA A CB  1 
ATOM   1846 N N   . ARG A 1 244 ? -13.730 -23.257 19.017  1.00 36.23  ? 245 ARG A N   1 
ATOM   1847 C CA  . ARG A 1 244 ? -14.770 -22.233 19.048  1.00 38.55  ? 245 ARG A CA  1 
ATOM   1848 C C   . ARG A 1 244 ? -16.145 -22.798 18.710  1.00 36.68  ? 245 ARG A C   1 
ATOM   1849 O O   . ARG A 1 244 ? -17.141 -22.455 19.344  1.00 39.48  ? 245 ARG A O   1 
ATOM   1850 C CB  . ARG A 1 244 ? -14.443 -21.095 18.087  1.00 37.96  ? 245 ARG A CB  1 
ATOM   1851 C CG  . ARG A 1 244 ? -15.589 -20.104 17.901  1.00 36.24  ? 245 ARG A CG  1 
ATOM   1852 C CD  . ARG A 1 244 ? -15.103 -18.838 17.225  1.00 31.99  ? 245 ARG A CD  1 
ATOM   1853 N NE  . ARG A 1 244 ? -14.107 -18.151 18.038  1.00 40.80  ? 245 ARG A NE  1 
ATOM   1854 C CZ  . ARG A 1 244 ? -14.408 -17.294 19.004  1.00 41.35  ? 245 ARG A CZ  1 
ATOM   1855 N NH1 . ARG A 1 244 ? -15.679 -17.031 19.264  1.00 41.03  ? 245 ARG A NH1 1 
ATOM   1856 N NH2 . ARG A 1 244 ? -13.445 -16.702 19.707  1.00 39.96  ? 245 ARG A NH2 1 
ATOM   1857 N N   . ARG A 1 245 ? -16.200 -23.675 17.719  1.00 30.52  ? 246 ARG A N   1 
ATOM   1858 C CA  . ARG A 1 245 ? -17.478 -24.247 17.344  1.00 39.16  ? 246 ARG A CA  1 
ATOM   1859 C C   . ARG A 1 245 ? -18.066 -25.052 18.496  1.00 33.63  ? 246 ARG A C   1 
ATOM   1860 O O   . ARG A 1 245 ? -19.261 -24.971 18.762  1.00 40.30  ? 246 ARG A O   1 
ATOM   1861 C CB  . ARG A 1 245 ? -17.371 -25.111 16.080  1.00 34.26  ? 246 ARG A CB  1 
ATOM   1862 C CG  . ARG A 1 245 ? -18.728 -25.610 15.620  1.00 41.66  ? 246 ARG A CG  1 
ATOM   1863 C CD  . ARG A 1 245 ? -18.654 -26.800 14.680  1.00 42.64  ? 246 ARG A CD  1 
ATOM   1864 N NE  . ARG A 1 245 ? -18.139 -28.018 15.307  1.00 43.31  ? 246 ARG A NE  1 
ATOM   1865 C CZ  . ARG A 1 245 ? -18.851 -28.864 16.052  1.00 49.90  ? 246 ARG A CZ  1 
ATOM   1866 N NH1 . ARG A 1 245 ? -20.133 -28.635 16.323  1.00 48.53  ? 246 ARG A NH1 1 
ATOM   1867 N NH2 . ARG A 1 245 ? -18.267 -29.948 16.543  1.00 40.51  ? 246 ARG A NH2 1 
ATOM   1868 N N   . ARG A 1 246 ? -17.223 -25.817 19.184  1.00 38.51  ? 247 ARG A N   1 
ATOM   1869 C CA  . ARG A 1 246 ? -17.686 -26.659 20.285  1.00 35.36  ? 247 ARG A CA  1 
ATOM   1870 C C   . ARG A 1 246 ? -18.124 -25.847 21.495  1.00 34.00  ? 247 ARG A C   1 
ATOM   1871 O O   . ARG A 1 246 ? -19.130 -26.165 22.129  1.00 34.88  ? 247 ARG A O   1 
ATOM   1872 C CB  . ARG A 1 246 ? -16.618 -27.671 20.687  1.00 35.27  ? 247 ARG A CB  1 
ATOM   1873 C CG  . ARG A 1 246 ? -16.331 -28.695 19.599  1.00 36.03  ? 247 ARG A CG  1 
ATOM   1874 C CD  . ARG A 1 246 ? -15.280 -29.681 20.051  1.00 29.02  ? 247 ARG A CD  1 
ATOM   1875 N NE  . ARG A 1 246 ? -14.822 -30.525 18.959  1.00 32.31  ? 247 ARG A NE  1 
ATOM   1876 C CZ  . ARG A 1 246 ? -13.918 -31.482 19.099  1.00 38.24  ? 247 ARG A CZ  1 
ATOM   1877 N NH1 . ARG A 1 246 ? -13.394 -31.713 20.293  1.00 27.26  ? 247 ARG A NH1 1 
ATOM   1878 N NH2 . ARG A 1 246 ? -13.543 -32.209 18.053  1.00 30.76  ? 247 ARG A NH2 1 
ATOM   1879 N N   . ALA A 1 247 ? -17.374 -24.800 21.816  1.00 31.74  ? 248 ALA A N   1 
ATOM   1880 C CA  . ALA A 1 247 ? -17.742 -23.940 22.935  1.00 35.02  ? 248 ALA A CA  1 
ATOM   1881 C C   . ALA A 1 247 ? -19.078 -23.280 22.621  1.00 45.20  ? 248 ALA A C   1 
ATOM   1882 O O   . ALA A 1 247 ? -19.930 -23.112 23.503  1.00 37.95  ? 248 ALA A O   1 
ATOM   1883 C CB  . ALA A 1 247 ? -16.666 -22.890 23.186  1.00 29.44  ? 248 ALA A CB  1 
ATOM   1884 N N   . THR A 1 248 ? -19.266 -22.933 21.349  1.00 33.68  ? 249 THR A N   1 
ATOM   1885 C CA  . THR A 1 248 ? -20.484 -22.260 20.916  1.00 32.10  ? 249 THR A CA  1 
ATOM   1886 C C   . THR A 1 248 ? -21.683 -23.197 20.991  1.00 29.36  ? 249 THR A C   1 
ATOM   1887 O O   . THR A 1 248 ? -22.748 -22.829 21.479  1.00 36.55  ? 249 THR A O   1 
ATOM   1888 C CB  . THR A 1 248 ? -20.319 -21.684 19.507  1.00 39.61  ? 249 THR A CB  1 
ATOM   1889 O OG1 . THR A 1 248 ? -19.316 -20.663 19.547  1.00 42.87  ? 249 THR A OG1 1 
ATOM   1890 C CG2 . THR A 1 248 ? -21.627 -21.084 19.016  1.00 41.36  ? 249 THR A CG2 1 
ATOM   1891 N N   . GLN A 1 249 ? -21.486 -24.422 20.529  1.00 29.74  ? 250 GLN A N   1 
ATOM   1892 C CA  . GLN A 1 249 ? -22.503 -25.459 20.615  1.00 32.38  ? 250 GLN A CA  1 
ATOM   1893 C C   . GLN A 1 249 ? -22.877 -25.800 22.063  1.00 42.09  ? 250 GLN A C   1 
ATOM   1894 O O   . GLN A 1 249 ? -24.037 -26.102 22.353  1.00 44.49  ? 250 GLN A O   1 
ATOM   1895 C CB  . GLN A 1 249 ? -22.028 -26.704 19.853  1.00 31.41  ? 250 GLN A CB  1 
ATOM   1896 C CG  . GLN A 1 249 ? -22.810 -27.974 20.100  1.00 47.19  ? 250 GLN A CG  1 
ATOM   1897 C CD  . GLN A 1 249 ? -24.112 -28.024 19.338  1.00 48.72  ? 250 GLN A CD  1 
ATOM   1898 O OE1 . GLN A 1 249 ? -24.566 -27.021 18.782  1.00 54.84  ? 250 GLN A OE1 1 
ATOM   1899 N NE2 . GLN A 1 249 ? -24.726 -29.202 19.307  1.00 53.26  ? 250 GLN A NE2 1 
ATOM   1900 N N   . LEU A 1 250 ? -21.910 -25.753 22.977  1.00 37.28  ? 251 LEU A N   1 
ATOM   1901 C CA  . LEU A 1 250 ? -22.235 -26.019 24.377  1.00 41.54  ? 251 LEU A CA  1 
ATOM   1902 C C   . LEU A 1 250 ? -23.125 -24.911 24.916  1.00 33.55  ? 251 LEU A C   1 
ATOM   1903 O O   . LEU A 1 250 ? -24.115 -25.182 25.594  1.00 34.54  ? 251 LEU A O   1 
ATOM   1904 C CB  . LEU A 1 250 ? -20.986 -26.175 25.250  1.00 34.36  ? 251 LEU A CB  1 
ATOM   1905 C CG  . LEU A 1 250 ? -21.250 -26.533 26.724  1.00 40.04  ? 251 LEU A CG  1 
ATOM   1906 C CD1 . LEU A 1 250 ? -21.914 -27.898 26.859  1.00 30.55  ? 251 LEU A CD1 1 
ATOM   1907 C CD2 . LEU A 1 250 ? -19.968 -26.493 27.539  1.00 36.77  ? 251 LEU A CD2 1 
ATOM   1908 N N   . ALA A 1 251 ? -22.777 -23.668 24.597  1.00 35.46  ? 252 ALA A N   1 
ATOM   1909 C CA  . ALA A 1 251 ? -23.556 -22.524 25.063  1.00 46.28  ? 252 ALA A CA  1 
ATOM   1910 C C   . ALA A 1 251 ? -24.999 -22.663 24.613  1.00 43.48  ? 252 ALA A C   1 
ATOM   1911 O O   . ALA A 1 251 ? -25.924 -22.526 25.412  1.00 41.91  ? 252 ALA A O   1 
ATOM   1912 C CB  . ALA A 1 251 ? -22.962 -21.214 24.558  1.00 37.00  ? 252 ALA A CB  1 
ATOM   1913 N N   . HIS A 1 252 ? -25.177 -22.971 23.335  1.00 40.07  ? 253 HIS A N   1 
ATOM   1914 C CA  . HIS A 1 252 ? -26.505 -23.156 22.767  1.00 44.16  ? 253 HIS A CA  1 
ATOM   1915 C C   . HIS A 1 252 ? -27.293 -24.253 23.495  1.00 40.21  ? 253 HIS A C   1 
ATOM   1916 O O   . HIS A 1 252 ? -28.470 -24.074 23.820  1.00 42.36  ? 253 HIS A O   1 
ATOM   1917 C CB  . HIS A 1 252 ? -26.406 -23.457 21.261  1.00 40.72  ? 253 HIS A CB  1 
ATOM   1918 C CG  . HIS A 1 252 ? -27.707 -23.871 20.640  1.00 62.85  ? 253 HIS A CG  1 
ATOM   1919 N ND1 . HIS A 1 252 ? -28.105 -25.190 20.551  1.00 59.89  ? 253 HIS A ND1 1 
ATOM   1920 C CD2 . HIS A 1 252 ? -28.702 -23.141 20.081  1.00 59.58  ? 253 HIS A CD2 1 
ATOM   1921 C CE1 . HIS A 1 252 ? -29.288 -25.253 19.967  1.00 60.00  ? 253 HIS A CE1 1 
ATOM   1922 N NE2 . HIS A 1 252 ? -29.672 -24.024 19.670  1.00 75.76  ? 253 HIS A NE2 1 
ATOM   1923 N N   . LEU A 1 253 ? -26.635 -25.378 23.758  1.00 37.13  ? 254 LEU A N   1 
ATOM   1924 C CA  . LEU A 1 253 ? -27.290 -26.528 24.373  1.00 31.56  ? 254 LEU A CA  1 
ATOM   1925 C C   . LEU A 1 253 ? -27.740 -26.265 25.801  1.00 36.47  ? 254 LEU A C   1 
ATOM   1926 O O   . LEU A 1 253 ? -28.607 -26.969 26.315  1.00 41.46  ? 254 LEU A O   1 
ATOM   1927 C CB  . LEU A 1 253 ? -26.371 -27.750 24.357  1.00 36.01  ? 254 LEU A CB  1 
ATOM   1928 C CG  . LEU A 1 253 ? -26.094 -28.419 23.011  1.00 42.24  ? 254 LEU A CG  1 
ATOM   1929 C CD1 . LEU A 1 253 ? -24.985 -29.457 23.141  1.00 38.21  ? 254 LEU A CD1 1 
ATOM   1930 C CD2 . LEU A 1 253 ? -27.363 -29.060 22.476  1.00 36.83  ? 254 LEU A CD2 1 
ATOM   1931 N N   . VAL A 1 254 ? -27.147 -25.266 26.447  1.00 33.96  ? 255 VAL A N   1 
ATOM   1932 C CA  . VAL A 1 254 ? -27.490 -24.964 27.837  1.00 35.62  ? 255 VAL A CA  1 
ATOM   1933 C C   . VAL A 1 254 ? -28.213 -23.621 27.970  1.00 39.36  ? 255 VAL A C   1 
ATOM   1934 O O   . VAL A 1 254 ? -28.399 -23.106 29.074  1.00 29.80  ? 255 VAL A O   1 
ATOM   1935 C CB  . VAL A 1 254 ? -26.261 -25.055 28.790  1.00 29.72  ? 255 VAL A CB  1 
ATOM   1936 C CG1 . VAL A 1 254 ? -25.502 -26.343 28.538  1.00 29.61  ? 255 VAL A CG1 1 
ATOM   1937 C CG2 . VAL A 1 254 ? -25.343 -23.859 28.637  1.00 24.93  ? 255 VAL A CG2 1 
ATOM   1938 N N   . GLY A 1 255 ? -28.629 -23.067 26.833  1.00 29.60  ? 256 GLY A N   1 
ATOM   1939 C CA  . GLY A 1 255 ? -29.494 -21.903 26.833  1.00 27.81  ? 256 GLY A CA  1 
ATOM   1940 C C   . GLY A 1 255 ? -28.801 -20.560 26.887  1.00 29.77  ? 256 GLY A C   1 
ATOM   1941 O O   . GLY A 1 255 ? -29.395 -19.574 27.311  1.00 37.76  ? 256 GLY A O   1 
ATOM   1942 N N   . CYS A 1 256 ? -27.551 -20.512 26.442  1.00 36.27  ? 257 CYS A N   1 
ATOM   1943 C CA  . CYS A 1 256 ? -26.792 -19.266 26.403  1.00 43.33  ? 257 CYS A CA  1 
ATOM   1944 C C   . CYS A 1 256 ? -26.611 -18.779 24.970  1.00 46.59  ? 257 CYS A C   1 
ATOM   1945 O O   . CYS A 1 256 ? -26.557 -19.588 24.052  1.00 50.22  ? 257 CYS A O   1 
ATOM   1946 C CB  . CYS A 1 256 ? -25.433 -19.460 27.078  1.00 36.27  ? 257 CYS A CB  1 
ATOM   1947 S SG  . CYS A 1 256 ? -25.593 -19.838 28.812  1.00 46.91  ? 257 CYS A SG  1 
ATOM   1948 N N   . PRO A 1 257 ? -26.525 -17.450 24.780  1.00 62.62  ? 258 PRO A N   1 
ATOM   1949 C CA  . PRO A 1 257 ? -26.334 -16.836 23.459  1.00 60.73  ? 258 PRO A CA  1 
ATOM   1950 C C   . PRO A 1 257 ? -25.077 -17.325 22.730  1.00 61.65  ? 258 PRO A C   1 
ATOM   1951 O O   . PRO A 1 257 ? -25.057 -17.334 21.489  1.00 75.11  ? 258 PRO A O   1 
ATOM   1952 C CB  . PRO A 1 257 ? -26.211 -15.339 23.784  1.00 62.12  ? 258 PRO A CB  1 
ATOM   1953 C CG  . PRO A 1 257 ? -25.919 -15.267 25.263  1.00 54.91  ? 258 PRO A CG  1 
ATOM   1954 C CD  . PRO A 1 257 ? -26.636 -16.436 25.845  1.00 54.90  ? 258 PRO A CD  1 
ATOM   1955 N N   . ASN A 1 264 ? -20.870 -12.276 20.857  1.00 63.18  ? 265 ASN A N   1 
ATOM   1956 C CA  . ASN A 1 264 ? -19.839 -11.707 21.716  1.00 53.44  ? 265 ASN A CA  1 
ATOM   1957 C C   . ASN A 1 264 ? -19.366 -12.712 22.769  1.00 63.18  ? 265 ASN A C   1 
ATOM   1958 O O   . ASN A 1 264 ? -20.159 -13.191 23.580  1.00 57.58  ? 265 ASN A O   1 
ATOM   1959 C CB  . ASN A 1 264 ? -20.359 -10.436 22.388  1.00 63.69  ? 265 ASN A CB  1 
ATOM   1960 C CG  . ASN A 1 264 ? -19.266 -9.659  23.100  1.00 77.03  ? 265 ASN A CG  1 
ATOM   1961 O OD1 . ASN A 1 264 ? -18.080 -9.822  22.807  1.00 83.96  ? 265 ASN A OD1 1 
ATOM   1962 N ND2 . ASN A 1 264 ? -19.663 -8.800  24.035  1.00 70.35  ? 265 ASN A ND2 1 
ATOM   1963 N N   . ASP A 1 265 ? -18.072 -13.029 22.750  1.00 57.07  ? 266 ASP A N   1 
ATOM   1964 C CA  . ASP A 1 265 ? -17.500 -14.020 23.658  1.00 47.90  ? 266 ASP A CA  1 
ATOM   1965 C C   . ASP A 1 265 ? -17.766 -13.683 25.135  1.00 57.47  ? 266 ASP A C   1 
ATOM   1966 O O   . ASP A 1 265 ? -18.058 -14.568 25.941  1.00 42.85  ? 266 ASP A O   1 
ATOM   1967 C CB  . ASP A 1 265 ? -15.987 -14.167 23.426  1.00 47.13  ? 266 ASP A CB  1 
ATOM   1968 C CG  . ASP A 1 265 ? -15.640 -14.779 22.069  1.00 53.56  ? 266 ASP A CG  1 
ATOM   1969 O OD1 . ASP A 1 265 ? -16.485 -15.484 21.476  1.00 49.12  ? 266 ASP A OD1 1 
ATOM   1970 O OD2 . ASP A 1 265 ? -14.499 -14.563 21.603  1.00 52.97  ? 266 ASP A OD2 1 
ATOM   1971 N N   . THR A 1 266 ? -17.661 -12.403 25.479  1.00 48.96  ? 267 THR A N   1 
ATOM   1972 C CA  . THR A 1 266 ? -17.897 -11.944 26.844  1.00 42.64  ? 267 THR A CA  1 
ATOM   1973 C C   . THR A 1 266 ? -19.268 -12.371 27.369  1.00 43.63  ? 267 THR A C   1 
ATOM   1974 O O   . THR A 1 266 ? -19.373 -12.949 28.452  1.00 49.22  ? 267 THR A O   1 
ATOM   1975 C CB  . THR A 1 266 ? -17.800 -10.409 26.939  1.00 53.98  ? 267 THR A CB  1 
ATOM   1976 O OG1 . THR A 1 266 ? -16.509 -9.982  26.492  1.00 52.96  ? 267 THR A OG1 1 
ATOM   1977 C CG2 . THR A 1 266 ? -18.017 -9.936  28.376  1.00 41.51  ? 267 THR A CG2 1 
ATOM   1978 N N   . GLU A 1 267 ? -20.310 -12.083 26.595  1.00 49.22  ? 268 GLU A N   1 
ATOM   1979 C CA  . GLU A 1 267 ? -21.675 -12.412 26.985  1.00 47.04  ? 268 GLU A CA  1 
ATOM   1980 C C   . GLU A 1 267 ? -21.858 -13.916 27.069  1.00 46.23  ? 268 GLU A C   1 
ATOM   1981 O O   . GLU A 1 267 ? -22.520 -14.422 27.975  1.00 55.35  ? 268 GLU A O   1 
ATOM   1982 C CB  . GLU A 1 267 ? -22.682 -11.829 25.991  1.00 46.09  ? 268 GLU A CB  1 
ATOM   1983 C CG  . GLU A 1 267 ? -22.717 -10.307 25.937  1.00 72.31  ? 268 GLU A CG  1 
ATOM   1984 C CD  . GLU A 1 267 ? -23.515 -9.784  24.749  1.00 99.44  ? 268 GLU A CD  1 
ATOM   1985 O OE1 . GLU A 1 267 ? -24.352 -10.544 24.210  1.00 107.77 ? 268 GLU A OE1 1 
ATOM   1986 O OE2 . GLU A 1 267 ? -23.297 -8.617  24.350  1.00 93.24  ? 268 GLU A OE2 1 
ATOM   1987 N N   . LEU A 1 268 ? -21.263 -14.625 26.119  1.00 43.88  ? 269 LEU A N   1 
ATOM   1988 C CA  . LEU A 1 268 ? -21.375 -16.076 26.061  1.00 45.55  ? 269 LEU A CA  1 
ATOM   1989 C C   . LEU A 1 268 ? -20.748 -16.723 27.303  1.00 42.53  ? 269 LEU A C   1 
ATOM   1990 O O   . LEU A 1 268 ? -21.367 -17.560 27.963  1.00 40.20  ? 269 LEU A O   1 
ATOM   1991 C CB  . LEU A 1 268 ? -20.729 -16.584 24.767  1.00 43.77  ? 269 LEU A CB  1 
ATOM   1992 C CG  . LEU A 1 268 ? -20.931 -18.018 24.271  1.00 52.03  ? 269 LEU A CG  1 
ATOM   1993 C CD1 . LEU A 1 268 ? -20.683 -18.084 22.774  1.00 46.06  ? 269 LEU A CD1 1 
ATOM   1994 C CD2 . LEU A 1 268 ? -19.984 -18.970 24.979  1.00 49.31  ? 269 LEU A CD2 1 
ATOM   1995 N N   . VAL A 1 269 ? -19.525 -16.319 27.629  1.00 40.40  ? 270 VAL A N   1 
ATOM   1996 C CA  . VAL A 1 269 ? -18.836 -16.872 28.788  1.00 38.30  ? 270 VAL A CA  1 
ATOM   1997 C C   . VAL A 1 269 ? -19.576 -16.501 30.072  1.00 44.23  ? 270 VAL A C   1 
ATOM   1998 O O   . VAL A 1 269 ? -19.710 -17.326 30.979  1.00 40.37  ? 270 VAL A O   1 
ATOM   1999 C CB  . VAL A 1 269 ? -17.356 -16.411 28.848  1.00 41.17  ? 270 VAL A CB  1 
ATOM   2000 C CG1 . VAL A 1 269 ? -16.658 -16.957 30.078  1.00 30.22  ? 270 VAL A CG1 1 
ATOM   2001 C CG2 . VAL A 1 269 ? -16.616 -16.867 27.608  1.00 41.01  ? 270 VAL A CG2 1 
ATOM   2002 N N   . ALA A 1 270 ? -20.073 -15.267 30.136  1.00 38.48  ? 271 ALA A N   1 
ATOM   2003 C CA  . ALA A 1 270 ? -20.764 -14.784 31.328  1.00 43.13  ? 271 ALA A CA  1 
ATOM   2004 C C   . ALA A 1 270 ? -22.015 -15.611 31.609  1.00 38.01  ? 271 ALA A C   1 
ATOM   2005 O O   . ALA A 1 270 ? -22.312 -15.937 32.756  1.00 42.95  ? 271 ALA A O   1 
ATOM   2006 C CB  . ALA A 1 270 ? -21.117 -13.304 31.190  1.00 27.56  ? 271 ALA A CB  1 
ATOM   2007 N N   . CYS A 1 271 ? -22.740 -15.953 30.554  1.00 33.63  ? 272 CYS A N   1 
ATOM   2008 C CA  . CYS A 1 271 ? -23.934 -16.772 30.688  1.00 36.71  ? 272 CYS A CA  1 
ATOM   2009 C C   . CYS A 1 271 ? -23.553 -18.197 31.093  1.00 32.31  ? 272 CYS A C   1 
ATOM   2010 O O   . CYS A 1 271 ? -24.216 -18.802 31.935  1.00 41.46  ? 272 CYS A O   1 
ATOM   2011 C CB  . CYS A 1 271 ? -24.763 -16.760 29.388  1.00 34.09  ? 272 CYS A CB  1 
ATOM   2012 S SG  . CYS A 1 271 ? -26.154 -17.936 29.365  1.00 48.77  ? 272 CYS A SG  1 
ATOM   2013 N N   . LEU A 1 272 ? -22.486 -18.725 30.495  1.00 37.07  ? 273 LEU A N   1 
ATOM   2014 C CA  . LEU A 1 272 ? -21.966 -20.036 30.878  1.00 34.63  ? 273 LEU A CA  1 
ATOM   2015 C C   . LEU A 1 272 ? -21.588 -20.066 32.355  1.00 37.66  ? 273 LEU A C   1 
ATOM   2016 O O   . LEU A 1 272 ? -21.805 -21.073 33.038  1.00 32.93  ? 273 LEU A O   1 
ATOM   2017 C CB  . LEU A 1 272 ? -20.749 -20.420 30.038  1.00 36.72  ? 273 LEU A CB  1 
ATOM   2018 C CG  . LEU A 1 272 ? -20.991 -20.882 28.598  1.00 37.29  ? 273 LEU A CG  1 
ATOM   2019 C CD1 . LEU A 1 272 ? -19.669 -21.076 27.876  1.00 26.55  ? 273 LEU A CD1 1 
ATOM   2020 C CD2 . LEU A 1 272 ? -21.790 -22.169 28.576  1.00 34.90  ? 273 LEU A CD2 1 
ATOM   2021 N N   . ARG A 1 273 ? -21.036 -18.959 32.848  1.00 37.19  ? 274 ARG A N   1 
ATOM   2022 C CA  . ARG A 1 273 ? -20.602 -18.885 34.242  1.00 38.51  ? 274 ARG A CA  1 
ATOM   2023 C C   . ARG A 1 273 ? -21.771 -18.960 35.230  1.00 34.10  ? 274 ARG A C   1 
ATOM   2024 O O   . ARG A 1 273 ? -21.567 -19.270 36.395  1.00 34.62  ? 274 ARG A O   1 
ATOM   2025 C CB  . ARG A 1 273 ? -19.729 -17.641 34.507  1.00 33.56  ? 274 ARG A CB  1 
ATOM   2026 C CG  . ARG A 1 273 ? -18.333 -17.711 33.882  1.00 36.82  ? 274 ARG A CG  1 
ATOM   2027 C CD  . ARG A 1 273 ? -17.305 -16.850 34.616  1.00 32.62  ? 274 ARG A CD  1 
ATOM   2028 N NE  . ARG A 1 273 ? -16.857 -15.697 33.833  1.00 50.36  ? 274 ARG A NE  1 
ATOM   2029 C CZ  . ARG A 1 273 ? -15.695 -15.613 33.180  1.00 58.09  ? 274 ARG A CZ  1 
ATOM   2030 N NH1 . ARG A 1 273 ? -14.823 -16.620 33.191  1.00 35.21  ? 274 ARG A NH1 1 
ATOM   2031 N NH2 . ARG A 1 273 ? -15.398 -14.509 32.504  1.00 60.68  ? 274 ARG A NH2 1 
ATOM   2032 N N   . THR A 1 274 ? -22.990 -18.695 34.761  1.00 36.90  ? 275 THR A N   1 
ATOM   2033 C CA  . THR A 1 274 ? -24.166 -18.705 35.638  1.00 28.22  ? 275 THR A CA  1 
ATOM   2034 C C   . THR A 1 274 ? -24.761 -20.101 35.748  1.00 38.89  ? 275 THR A C   1 
ATOM   2035 O O   . THR A 1 274 ? -25.645 -20.342 36.565  1.00 41.25  ? 275 THR A O   1 
ATOM   2036 C CB  . THR A 1 274 ? -25.291 -17.763 35.137  1.00 37.46  ? 275 THR A CB  1 
ATOM   2037 O OG1 . THR A 1 274 ? -25.877 -18.304 33.948  1.00 39.39  ? 275 THR A OG1 1 
ATOM   2038 C CG2 . THR A 1 274 ? -24.767 -16.353 34.856  1.00 30.86  ? 275 THR A CG2 1 
ATOM   2039 N N   . ARG A 1 275 ? -24.281 -21.019 34.916  1.00 36.11  ? 276 ARG A N   1 
ATOM   2040 C CA  . ARG A 1 275 ? -24.826 -22.367 34.881  1.00 30.63  ? 276 ARG A CA  1 
ATOM   2041 C C   . ARG A 1 275 ? -24.186 -23.275 35.924  1.00 33.41  ? 276 ARG A C   1 
ATOM   2042 O O   . ARG A 1 275 ? -22.967 -23.263 36.094  1.00 33.97  ? 276 ARG A O   1 
ATOM   2043 C CB  . ARG A 1 275 ? -24.635 -22.967 33.492  1.00 29.67  ? 276 ARG A CB  1 
ATOM   2044 C CG  . ARG A 1 275 ? -25.406 -22.257 32.395  1.00 31.63  ? 276 ARG A CG  1 
ATOM   2045 C CD  . ARG A 1 275 ? -26.879 -22.426 32.604  1.00 36.35  ? 276 ARG A CD  1 
ATOM   2046 N NE  . ARG A 1 275 ? -27.668 -21.988 31.460  1.00 34.62  ? 276 ARG A NE  1 
ATOM   2047 C CZ  . ARG A 1 275 ? -28.211 -20.781 31.347  1.00 41.37  ? 276 ARG A CZ  1 
ATOM   2048 N NH1 . ARG A 1 275 ? -28.040 -19.882 32.305  1.00 34.75  ? 276 ARG A NH1 1 
ATOM   2049 N NH2 . ARG A 1 275 ? -28.919 -20.469 30.270  1.00 38.19  ? 276 ARG A NH2 1 
ATOM   2050 N N   . PRO A 1 276 ? -25.007 -24.068 36.627  1.00 36.60  ? 277 PRO A N   1 
ATOM   2051 C CA  . PRO A 1 276 ? -24.451 -25.067 37.548  1.00 31.80  ? 277 PRO A CA  1 
ATOM   2052 C C   . PRO A 1 276 ? -23.489 -25.985 36.807  1.00 35.06  ? 277 PRO A C   1 
ATOM   2053 O O   . PRO A 1 276 ? -23.773 -26.378 35.676  1.00 32.33  ? 277 PRO A O   1 
ATOM   2054 C CB  . PRO A 1 276 ? -25.686 -25.855 38.004  1.00 27.09  ? 277 PRO A CB  1 
ATOM   2055 C CG  . PRO A 1 276 ? -26.824 -24.898 37.842  1.00 38.46  ? 277 PRO A CG  1 
ATOM   2056 C CD  . PRO A 1 276 ? -26.481 -24.067 36.628  1.00 32.35  ? 277 PRO A CD  1 
ATOM   2057 N N   . ALA A 1 277 ? -22.368 -26.310 37.440  1.00 37.03  ? 278 ALA A N   1 
ATOM   2058 C CA  . ALA A 1 277 ? -21.342 -27.144 36.829  1.00 35.33  ? 278 ALA A CA  1 
ATOM   2059 C C   . ALA A 1 277 ? -21.918 -28.420 36.232  1.00 32.68  ? 278 ALA A C   1 
ATOM   2060 O O   . ALA A 1 277 ? -21.561 -28.816 35.115  1.00 31.94  ? 278 ALA A O   1 
ATOM   2061 C CB  . ALA A 1 277 ? -20.260 -27.485 37.851  1.00 32.73  ? 278 ALA A CB  1 
ATOM   2062 N N   . GLN A 1 278 ? -22.813 -29.057 36.978  1.00 32.11  ? 279 GLN A N   1 
ATOM   2063 C CA  . GLN A 1 278 ? -23.408 -30.311 36.541  1.00 32.68  ? 279 GLN A CA  1 
ATOM   2064 C C   . GLN A 1 278 ? -24.110 -30.165 35.187  1.00 37.36  ? 279 GLN A C   1 
ATOM   2065 O O   . GLN A 1 278 ? -24.119 -31.098 34.385  1.00 35.02  ? 279 GLN A O   1 
ATOM   2066 C CB  . GLN A 1 278 ? -24.366 -30.851 37.602  1.00 29.99  ? 279 GLN A CB  1 
ATOM   2067 C CG  . GLN A 1 278 ? -24.841 -32.271 37.339  1.00 31.54  ? 279 GLN A CG  1 
ATOM   2068 C CD  . GLN A 1 278 ? -23.693 -33.249 37.148  1.00 44.24  ? 279 GLN A CD  1 
ATOM   2069 O OE1 . GLN A 1 278 ? -22.837 -33.404 38.023  1.00 41.83  ? 279 GLN A OE1 1 
ATOM   2070 N NE2 . GLN A 1 278 ? -23.671 -33.915 35.998  1.00 33.27  ? 279 GLN A NE2 1 
ATOM   2071 N N   . VAL A 1 279 ? -24.667 -28.987 34.926  1.00 28.39  ? 280 VAL A N   1 
ATOM   2072 C CA  . VAL A 1 279 ? -25.386 -28.760 33.685  1.00 33.77  ? 280 VAL A CA  1 
ATOM   2073 C C   . VAL A 1 279 ? -24.425 -28.792 32.496  1.00 39.89  ? 280 VAL A C   1 
ATOM   2074 O O   . VAL A 1 279 ? -24.757 -29.330 31.441  1.00 35.37  ? 280 VAL A O   1 
ATOM   2075 C CB  . VAL A 1 279 ? -26.198 -27.436 33.722  1.00 32.37  ? 280 VAL A CB  1 
ATOM   2076 C CG1 . VAL A 1 279 ? -26.703 -27.062 32.334  1.00 35.96  ? 280 VAL A CG1 1 
ATOM   2077 C CG2 . VAL A 1 279 ? -27.353 -27.568 34.683  1.00 31.81  ? 280 VAL A CG2 1 
ATOM   2078 N N   . LEU A 1 280 ? -23.227 -28.237 32.673  1.00 40.53  ? 281 LEU A N   1 
ATOM   2079 C CA  . LEU A 1 280 ? -22.231 -28.282 31.609  1.00 31.64  ? 281 LEU A CA  1 
ATOM   2080 C C   . LEU A 1 280 ? -21.838 -29.728 31.356  1.00 31.06  ? 281 LEU A C   1 
ATOM   2081 O O   . LEU A 1 280 ? -21.768 -30.174 30.210  1.00 39.21  ? 281 LEU A O   1 
ATOM   2082 C CB  . LEU A 1 280 ? -21.003 -27.440 31.950  1.00 27.88  ? 281 LEU A CB  1 
ATOM   2083 C CG  . LEU A 1 280 ? -21.247 -25.958 32.257  1.00 31.75  ? 281 LEU A CG  1 
ATOM   2084 C CD1 . LEU A 1 280 ? -19.933 -25.191 32.213  1.00 33.79  ? 281 LEU A CD1 1 
ATOM   2085 C CD2 . LEU A 1 280 ? -22.250 -25.348 31.295  1.00 33.44  ? 281 LEU A CD2 1 
ATOM   2086 N N   . VAL A 1 281 ? -21.610 -30.466 32.432  1.00 26.71  ? 282 VAL A N   1 
ATOM   2087 C CA  . VAL A 1 281 ? -21.283 -31.880 32.323  1.00 36.23  ? 282 VAL A CA  1 
ATOM   2088 C C   . VAL A 1 281 ? -22.341 -32.667 31.542  1.00 40.54  ? 282 VAL A C   1 
ATOM   2089 O O   . VAL A 1 281 ? -22.005 -33.502 30.706  1.00 42.37  ? 282 VAL A O   1 
ATOM   2090 C CB  . VAL A 1 281 ? -21.092 -32.512 33.707  1.00 26.44  ? 282 VAL A CB  1 
ATOM   2091 C CG1 . VAL A 1 281 ? -20.951 -34.016 33.586  1.00 34.43  ? 282 VAL A CG1 1 
ATOM   2092 C CG2 . VAL A 1 281 ? -19.881 -31.918 34.385  1.00 25.15  ? 282 VAL A CG2 1 
ATOM   2093 N N   . ASN A 1 282 ? -23.614 -32.383 31.805  1.00 36.87  ? 283 ASN A N   1 
ATOM   2094 C CA  . ASN A 1 282 ? -24.714 -33.137 31.203  1.00 35.78  ? 283 ASN A CA  1 
ATOM   2095 C C   . ASN A 1 282 ? -24.796 -33.064 29.683  1.00 38.84  ? 283 ASN A C   1 
ATOM   2096 O O   . ASN A 1 282 ? -25.321 -33.972 29.051  1.00 38.84  ? 283 ASN A O   1 
ATOM   2097 C CB  . ASN A 1 282 ? -26.053 -32.724 31.814  1.00 38.87  ? 283 ASN A CB  1 
ATOM   2098 C CG  . ASN A 1 282 ? -26.203 -33.194 33.240  1.00 37.18  ? 283 ASN A CG  1 
ATOM   2099 O OD1 . ASN A 1 282 ? -25.423 -34.017 33.716  1.00 44.90  ? 283 ASN A OD1 1 
ATOM   2100 N ND2 . ASN A 1 282 ? -27.205 -32.675 33.932  1.00 44.07  ? 283 ASN A ND2 1 
ATOM   2101 N N   . HIS A 1 283 ? -24.271 -31.993 29.101  1.00 34.22  ? 284 HIS A N   1 
ATOM   2102 C CA  . HIS A 1 283 ? -24.330 -31.816 27.659  1.00 42.07  ? 284 HIS A CA  1 
ATOM   2103 C C   . HIS A 1 283 ? -22.977 -31.965 26.971  1.00 46.90  ? 284 HIS A C   1 
ATOM   2104 O O   . HIS A 1 283 ? -22.845 -31.658 25.790  1.00 44.82  ? 284 HIS A O   1 
ATOM   2105 C CB  . HIS A 1 283 ? -24.907 -30.443 27.329  1.00 44.93  ? 284 HIS A CB  1 
ATOM   2106 C CG  . HIS A 1 283 ? -26.313 -30.266 27.792  1.00 52.02  ? 284 HIS A CG  1 
ATOM   2107 N ND1 . HIS A 1 283 ? -27.389 -30.784 27.105  1.00 50.23  ? 284 HIS A ND1 1 
ATOM   2108 C CD2 . HIS A 1 283 ? -26.822 -29.646 28.881  1.00 38.41  ? 284 HIS A CD2 1 
ATOM   2109 C CE1 . HIS A 1 283 ? -28.503 -30.477 27.744  1.00 49.00  ? 284 HIS A CE1 1 
ATOM   2110 N NE2 . HIS A 1 283 ? -28.186 -29.789 28.827  1.00 55.52  ? 284 HIS A NE2 1 
ATOM   2111 N N   . GLU A 1 284 ? -21.978 -32.431 27.705  1.00 44.71  ? 285 GLU A N   1 
ATOM   2112 C CA  . GLU A 1 284 ? -20.617 -32.415 27.198  1.00 43.29  ? 285 GLU A CA  1 
ATOM   2113 C C   . GLU A 1 284 ? -20.480 -33.300 25.960  1.00 51.30  ? 285 GLU A C   1 
ATOM   2114 O O   . GLU A 1 284 ? -19.933 -32.879 24.937  1.00 39.20  ? 285 GLU A O   1 
ATOM   2115 C CB  . GLU A 1 284 ? -19.645 -32.878 28.279  1.00 49.67  ? 285 GLU A CB  1 
ATOM   2116 C CG  . GLU A 1 284 ? -18.194 -32.721 27.884  1.00 64.61  ? 285 GLU A CG  1 
ATOM   2117 C CD  . GLU A 1 284 ? -17.296 -33.722 28.577  1.00 61.93  ? 285 GLU A CD  1 
ATOM   2118 O OE1 . GLU A 1 284 ? -17.254 -33.708 29.822  1.00 48.46  ? 285 GLU A OE1 1 
ATOM   2119 O OE2 . GLU A 1 284 ? -16.647 -34.528 27.872  1.00 63.65  ? 285 GLU A OE2 1 
ATOM   2120 N N   . TRP A 1 285 ? -20.995 -34.521 26.057  1.00 41.15  ? 286 TRP A N   1 
ATOM   2121 C CA  . TRP A 1 285 ? -20.850 -35.489 24.990  1.00 45.63  ? 286 TRP A CA  1 
ATOM   2122 C C   . TRP A 1 285 ? -21.458 -35.003 23.682  1.00 60.90  ? 286 TRP A C   1 
ATOM   2123 O O   . TRP A 1 285 ? -20.906 -35.239 22.599  1.00 45.68  ? 286 TRP A O   1 
ATOM   2124 C CB  . TRP A 1 285 ? -21.433 -36.829 25.417  1.00 45.72  ? 286 TRP A CB  1 
ATOM   2125 C CG  . TRP A 1 285 ? -20.471 -37.594 26.274  1.00 63.53  ? 286 TRP A CG  1 
ATOM   2126 C CD1 . TRP A 1 285 ? -20.615 -37.917 27.598  1.00 55.11  ? 286 TRP A CD1 1 
ATOM   2127 C CD2 . TRP A 1 285 ? -19.190 -38.103 25.872  1.00 58.56  ? 286 TRP A CD2 1 
ATOM   2128 N NE1 . TRP A 1 285 ? -19.511 -38.615 28.037  1.00 48.40  ? 286 TRP A NE1 1 
ATOM   2129 C CE2 . TRP A 1 285 ? -18.621 -38.741 26.999  1.00 61.48  ? 286 TRP A CE2 1 
ATOM   2130 C CE3 . TRP A 1 285 ? -18.472 -38.090 24.666  1.00 53.32  ? 286 TRP A CE3 1 
ATOM   2131 C CZ2 . TRP A 1 285 ? -17.367 -39.360 26.955  1.00 51.99  ? 286 TRP A CZ2 1 
ATOM   2132 C CZ3 . TRP A 1 285 ? -17.226 -38.706 24.623  1.00 50.37  ? 286 TRP A CZ3 1 
ATOM   2133 C CH2 . TRP A 1 285 ? -16.688 -39.334 25.762  1.00 47.12  ? 286 TRP A CH2 1 
ATOM   2134 N N   . HIS A 1 286 ? -22.555 -34.264 23.804  1.00 49.67  ? 287 HIS A N   1 
ATOM   2135 C CA  . HIS A 1 286 ? -23.361 -33.853 22.668  1.00 50.05  ? 287 HIS A CA  1 
ATOM   2136 C C   . HIS A 1 286 ? -22.829 -32.680 21.853  1.00 48.57  ? 287 HIS A C   1 
ATOM   2137 O O   . HIS A 1 286 ? -23.587 -32.061 21.116  1.00 63.80  ? 287 HIS A O   1 
ATOM   2138 C CB  . HIS A 1 286 ? -24.790 -33.574 23.137  1.00 53.61  ? 287 HIS A CB  1 
ATOM   2139 C CG  . HIS A 1 286 ? -25.397 -34.716 23.890  1.00 71.60  ? 287 HIS A CG  1 
ATOM   2140 N ND1 . HIS A 1 286 ? -25.604 -34.684 25.254  1.00 76.88  ? 287 HIS A ND1 1 
ATOM   2141 C CD2 . HIS A 1 286 ? -25.813 -35.936 23.477  1.00 66.93  ? 287 HIS A CD2 1 
ATOM   2142 C CE1 . HIS A 1 286 ? -26.134 -35.829 25.645  1.00 76.01  ? 287 HIS A CE1 1 
ATOM   2143 N NE2 . HIS A 1 286 ? -26.270 -36.607 24.585  1.00 89.02  ? 287 HIS A NE2 1 
ATOM   2144 N N   . VAL A 1 287 ? -21.538 -32.378 21.955  1.00 49.77  ? 288 VAL A N   1 
ATOM   2145 C CA  . VAL A 1 287 ? -20.963 -31.303 21.131  1.00 41.47  ? 288 VAL A CA  1 
ATOM   2146 C C   . VAL A 1 287 ? -19.991 -31.830 20.068  1.00 45.36  ? 288 VAL A C   1 
ATOM   2147 O O   . VAL A 1 287 ? -19.487 -31.069 19.232  1.00 52.37  ? 288 VAL A O   1 
ATOM   2148 C CB  . VAL A 1 287 ? -20.315 -30.172 21.994  1.00 48.14  ? 288 VAL A CB  1 
ATOM   2149 C CG1 . VAL A 1 287 ? -21.008 -30.086 23.342  1.00 46.10  ? 288 VAL A CG1 1 
ATOM   2150 C CG2 . VAL A 1 287 ? -18.833 -30.404 22.200  1.00 27.18  ? 288 VAL A CG2 1 
ATOM   2151 N N   . LEU A 1 288 ? -19.748 -33.137 20.086  1.00 38.30  ? 289 LEU A N   1 
ATOM   2152 C CA  . LEU A 1 288 ? -18.887 -33.758 19.087  1.00 39.66  ? 289 LEU A CA  1 
ATOM   2153 C C   . LEU A 1 288 ? -19.579 -33.778 17.720  1.00 56.08  ? 289 LEU A C   1 
ATOM   2154 O O   . LEU A 1 288 ? -20.790 -34.008 17.636  1.00 52.11  ? 289 LEU A O   1 
ATOM   2155 C CB  . LEU A 1 288 ? -18.479 -35.174 19.513  1.00 30.14  ? 289 LEU A CB  1 
ATOM   2156 C CG  . LEU A 1 288 ? -17.374 -35.248 20.578  1.00 37.83  ? 289 LEU A CG  1 
ATOM   2157 C CD1 . LEU A 1 288 ? -17.115 -36.691 21.020  1.00 31.21  ? 289 LEU A CD1 1 
ATOM   2158 C CD2 . LEU A 1 288 ? -16.089 -34.580 20.101  1.00 26.66  ? 289 LEU A CD2 1 
ATOM   2159 N N   . PRO A 1 289 ? -18.807 -33.534 16.644  1.00 52.09  ? 290 PRO A N   1 
ATOM   2160 C CA  . PRO A 1 289 ? -19.375 -33.375 15.299  1.00 59.20  ? 290 PRO A CA  1 
ATOM   2161 C C   . PRO A 1 289 ? -19.853 -34.681 14.655  1.00 57.84  ? 290 PRO A C   1 
ATOM   2162 O O   . PRO A 1 289 ? -20.581 -34.616 13.670  1.00 66.76  ? 290 PRO A O   1 
ATOM   2163 C CB  . PRO A 1 289 ? -18.218 -32.764 14.499  1.00 49.46  ? 290 PRO A CB  1 
ATOM   2164 C CG  . PRO A 1 289 ? -16.984 -33.247 15.190  1.00 56.60  ? 290 PRO A CG  1 
ATOM   2165 C CD  . PRO A 1 289 ? -17.340 -33.361 16.653  1.00 50.37  ? 290 PRO A CD  1 
ATOM   2166 N N   . GLN A 1 290 ? -19.455 -35.836 15.185  1.00 50.84  ? 291 GLN A N   1 
ATOM   2167 C CA  . GLN A 1 290 ? -19.977 -37.109 14.684  1.00 57.30  ? 291 GLN A CA  1 
ATOM   2168 C C   . GLN A 1 290 ? -19.837 -38.234 15.709  1.00 58.81  ? 291 GLN A C   1 
ATOM   2169 O O   . GLN A 1 290 ? -19.065 -38.127 16.665  1.00 68.02  ? 291 GLN A O   1 
ATOM   2170 C CB  . GLN A 1 290 ? -19.327 -37.507 13.343  1.00 60.63  ? 291 GLN A CB  1 
ATOM   2171 C CG  . GLN A 1 290 ? -18.129 -38.454 13.465  1.00 69.26  ? 291 GLN A CG  1 
ATOM   2172 C CD  . GLN A 1 290 ? -17.906 -39.328 12.217  1.00 92.14  ? 291 GLN A CD  1 
ATOM   2173 O OE1 . GLN A 1 290 ? -17.556 -38.825 11.139  1.00 77.78  ? 291 GLN A OE1 1 
ATOM   2174 N NE2 . GLN A 1 290 ? -18.100 -40.646 12.369  1.00 55.46  ? 291 GLN A NE2 1 
ATOM   2175 N N   . GLU A 1 291 ? -20.614 -39.296 15.514  1.00 59.98  ? 292 GLU A N   1 
ATOM   2176 C CA  . GLU A 1 291 ? -20.513 -40.500 16.328  1.00 51.94  ? 292 GLU A CA  1 
ATOM   2177 C C   . GLU A 1 291 ? -19.097 -41.054 16.186  1.00 54.99  ? 292 GLU A C   1 
ATOM   2178 O O   . GLU A 1 291 ? -18.577 -41.167 15.073  1.00 59.10  ? 292 GLU A O   1 
ATOM   2179 C CB  . GLU A 1 291 ? -21.544 -41.529 15.857  1.00 51.86  ? 292 GLU A CB  1 
ATOM   2180 C CG  . GLU A 1 291 ? -21.452 -42.898 16.522  1.00 85.30  ? 292 GLU A CG  1 
ATOM   2181 C CD  . GLU A 1 291 ? -22.176 -43.990 15.731  1.00 94.67  ? 292 GLU A CD  1 
ATOM   2182 O OE1 . GLU A 1 291 ? -22.674 -43.698 14.619  1.00 83.52  ? 292 GLU A OE1 1 
ATOM   2183 O OE2 . GLU A 1 291 ? -22.240 -45.142 16.221  1.00 85.57  ? 292 GLU A OE2 1 
ATOM   2184 N N   . SER A 1 292 ? -18.471 -41.385 17.310  1.00 44.72  ? 293 SER A N   1 
ATOM   2185 C CA  . SER A 1 292 ? -17.067 -41.778 17.309  1.00 41.34  ? 293 SER A CA  1 
ATOM   2186 C C   . SER A 1 292 ? -16.668 -42.568 18.548  1.00 42.98  ? 293 SER A C   1 
ATOM   2187 O O   . SER A 1 292 ? -17.357 -42.546 19.561  1.00 47.97  ? 293 SER A O   1 
ATOM   2188 C CB  . SER A 1 292 ? -16.187 -40.529 17.223  1.00 38.80  ? 293 SER A CB  1 
ATOM   2189 O OG  . SER A 1 292 ? -16.501 -39.619 18.259  1.00 49.23  ? 293 SER A OG  1 
ATOM   2190 N N   . VAL A 1 293 ? -15.554 -43.280 18.461  1.00 39.90  ? 294 VAL A N   1 
ATOM   2191 C CA  . VAL A 1 293 ? -14.875 -43.699 19.675  1.00 34.15  ? 294 VAL A CA  1 
ATOM   2192 C C   . VAL A 1 293 ? -13.563 -42.927 19.714  1.00 38.22  ? 294 VAL A C   1 
ATOM   2193 O O   . VAL A 1 293 ? -13.116 -42.390 18.688  1.00 34.48  ? 294 VAL A O   1 
ATOM   2194 C CB  . VAL A 1 293 ? -14.659 -45.227 19.761  1.00 41.05  ? 294 VAL A CB  1 
ATOM   2195 C CG1 . VAL A 1 293 ? -15.987 -45.949 19.593  1.00 47.25  ? 294 VAL A CG1 1 
ATOM   2196 C CG2 . VAL A 1 293 ? -13.661 -45.703 18.732  1.00 31.65  ? 294 VAL A CG2 1 
ATOM   2197 N N   . PHE A 1 294 ? -12.992 -42.821 20.906  1.00 30.49  ? 295 PHE A N   1 
ATOM   2198 C CA  . PHE A 1 294 ? -11.708 -42.151 21.118  1.00 26.73  ? 295 PHE A CA  1 
ATOM   2199 C C   . PHE A 1 294 ? -11.662 -40.686 20.673  1.00 28.57  ? 295 PHE A C   1 
ATOM   2200 O O   . PHE A 1 294 ? -10.632 -40.214 20.190  1.00 31.22  ? 295 PHE A O   1 
ATOM   2201 C CB  . PHE A 1 294 ? -10.570 -42.947 20.472  1.00 22.62  ? 295 PHE A CB  1 
ATOM   2202 C CG  . PHE A 1 294 ? -9.361  -43.096 21.354  1.00 29.38  ? 295 PHE A CG  1 
ATOM   2203 C CD1 . PHE A 1 294 ? -8.698  -41.975 21.848  1.00 21.84  ? 295 PHE A CD1 1 
ATOM   2204 C CD2 . PHE A 1 294 ? -8.876  -44.354 21.683  1.00 18.75  ? 295 PHE A CD2 1 
ATOM   2205 C CE1 . PHE A 1 294 ? -7.576  -42.110 22.656  1.00 23.22  ? 295 PHE A CE1 1 
ATOM   2206 C CE2 . PHE A 1 294 ? -7.752  -44.491 22.484  1.00 21.05  ? 295 PHE A CE2 1 
ATOM   2207 C CZ  . PHE A 1 294 ? -7.107  -43.375 22.981  1.00 15.81  ? 295 PHE A CZ  1 
ATOM   2208 N N   . ARG A 1 295 ? -12.775 -39.973 20.828  1.00 25.21  ? 296 ARG A N   1 
ATOM   2209 C CA  . ARG A 1 295 ? -12.795 -38.526 20.610  1.00 21.75  ? 296 ARG A CA  1 
ATOM   2210 C C   . ARG A 1 295 ? -13.488 -37.856 21.783  1.00 28.79  ? 296 ARG A C   1 
ATOM   2211 O O   . ARG A 1 295 ? -14.476 -38.369 22.305  1.00 24.49  ? 296 ARG A O   1 
ATOM   2212 C CB  . ARG A 1 295 ? -13.509 -38.146 19.310  1.00 21.36  ? 296 ARG A CB  1 
ATOM   2213 C CG  . ARG A 1 295 ? -12.764 -38.564 18.035  1.00 30.24  ? 296 ARG A CG  1 
ATOM   2214 C CD  . ARG A 1 295 ? -11.438 -37.829 17.870  1.00 28.64  ? 296 ARG A CD  1 
ATOM   2215 N NE  . ARG A 1 295 ? -10.770 -38.266 16.647  1.00 37.61  ? 296 ARG A NE  1 
ATOM   2216 C CZ  . ARG A 1 295 ? -9.992  -39.344 16.564  1.00 37.99  ? 296 ARG A CZ  1 
ATOM   2217 N NH1 . ARG A 1 295 ? -9.756  -40.093 17.644  1.00 23.69  ? 296 ARG A NH1 1 
ATOM   2218 N NH2 . ARG A 1 295 ? -9.439  -39.667 15.403  1.00 31.61  ? 296 ARG A NH2 1 
ATOM   2219 N N   . PHE A 1 296 ? -12.980 -36.697 22.177  1.00 26.48  ? 297 PHE A N   1 
ATOM   2220 C CA  . PHE A 1 296 ? -13.462 -36.015 23.374  1.00 27.63  ? 297 PHE A CA  1 
ATOM   2221 C C   . PHE A 1 296 ? -13.645 -34.531 23.076  1.00 29.04  ? 297 PHE A C   1 
ATOM   2222 O O   . PHE A 1 296 ? -12.908 -33.955 22.272  1.00 35.63  ? 297 PHE A O   1 
ATOM   2223 C CB  . PHE A 1 296 ? -12.498 -36.281 24.534  1.00 19.30  ? 297 PHE A CB  1 
ATOM   2224 C CG  . PHE A 1 296 ? -12.006 -37.693 24.558  1.00 20.87  ? 297 PHE A CG  1 
ATOM   2225 C CD1 . PHE A 1 296 ? -12.863 -38.727 24.898  1.00 25.26  ? 297 PHE A CD1 1 
ATOM   2226 C CD2 . PHE A 1 296 ? -10.716 -38.002 24.163  1.00 26.33  ? 297 PHE A CD2 1 
ATOM   2227 C CE1 . PHE A 1 296 ? -12.437 -40.049 24.872  1.00 26.12  ? 297 PHE A CE1 1 
ATOM   2228 C CE2 . PHE A 1 296 ? -10.270 -39.326 24.139  1.00 19.12  ? 297 PHE A CE2 1 
ATOM   2229 C CZ  . PHE A 1 296 ? -11.139 -40.349 24.491  1.00 24.60  ? 297 PHE A CZ  1 
ATOM   2230 N N   . SER A 1 297 ? -14.644 -33.927 23.709  1.00 28.32  ? 298 SER A N   1 
ATOM   2231 C CA  . SER A 1 297 ? -15.117 -32.601 23.326  1.00 31.65  ? 298 SER A CA  1 
ATOM   2232 C C   . SER A 1 297 ? -14.149 -31.473 23.648  1.00 30.39  ? 298 SER A C   1 
ATOM   2233 O O   . SER A 1 297 ? -13.821 -30.659 22.781  1.00 29.89  ? 298 SER A O   1 
ATOM   2234 C CB  . SER A 1 297 ? -16.469 -32.325 23.979  1.00 33.57  ? 298 SER A CB  1 
ATOM   2235 O OG  . SER A 1 297 ? -17.452 -33.192 23.448  1.00 44.45  ? 298 SER A OG  1 
ATOM   2236 N N   . PHE A 1 298 ? -13.703 -31.416 24.897  1.00 22.73  ? 299 PHE A N   1 
ATOM   2237 C CA  . PHE A 1 298 ? -12.847 -30.324 25.326  1.00 22.21  ? 299 PHE A CA  1 
ATOM   2238 C C   . PHE A 1 298 ? -11.460 -30.822 25.680  1.00 31.35  ? 299 PHE A C   1 
ATOM   2239 O O   . PHE A 1 298 ? -11.259 -31.483 26.704  1.00 26.72  ? 299 PHE A O   1 
ATOM   2240 C CB  . PHE A 1 298 ? -13.508 -29.534 26.453  1.00 24.20  ? 299 PHE A CB  1 
ATOM   2241 C CG  . PHE A 1 298 ? -14.852 -29.015 26.072  1.00 30.21  ? 299 PHE A CG  1 
ATOM   2242 C CD1 . PHE A 1 298 ? -14.962 -27.925 25.217  1.00 26.72  ? 299 PHE A CD1 1 
ATOM   2243 C CD2 . PHE A 1 298 ? -16.010 -29.651 26.506  1.00 22.75  ? 299 PHE A CD2 1 
ATOM   2244 C CE1 . PHE A 1 298 ? -16.210 -27.454 24.812  1.00 27.00  ? 299 PHE A CE1 1 
ATOM   2245 C CE2 . PHE A 1 298 ? -17.260 -29.185 26.112  1.00 24.50  ? 299 PHE A CE2 1 
ATOM   2246 C CZ  . PHE A 1 298 ? -17.359 -28.085 25.268  1.00 32.34  ? 299 PHE A CZ  1 
ATOM   2247 N N   . VAL A 1 299 ? -10.520 -30.515 24.786  1.00 20.72  ? 300 VAL A N   1 
ATOM   2248 C CA  . VAL A 1 299 ? -9.143  -30.970 24.886  1.00 21.13  ? 300 VAL A CA  1 
ATOM   2249 C C   . VAL A 1 299 ? -8.256  -29.749 24.658  1.00 25.09  ? 300 VAL A C   1 
ATOM   2250 O O   . VAL A 1 299 ? -8.769  -28.692 24.280  1.00 24.02  ? 300 VAL A O   1 
ATOM   2251 C CB  . VAL A 1 299 ? -8.855  -32.100 23.867  1.00 24.98  ? 300 VAL A CB  1 
ATOM   2252 C CG1 . VAL A 1 299 ? -9.774  -33.286 24.131  1.00 23.10  ? 300 VAL A CG1 1 
ATOM   2253 C CG2 . VAL A 1 299 ? -9.002  -31.595 22.434  1.00 22.10  ? 300 VAL A CG2 1 
ATOM   2254 N N   . PRO A 1 300 ? -6.942  -29.865 24.936  1.00 28.47  ? 301 PRO A N   1 
ATOM   2255 C CA  . PRO A 1 300 ? -6.030  -28.742 24.679  1.00 23.47  ? 301 PRO A CA  1 
ATOM   2256 C C   . PRO A 1 300 ? -6.170  -28.177 23.259  1.00 34.27  ? 301 PRO A C   1 
ATOM   2257 O O   . PRO A 1 300 ? -6.371  -28.928 22.308  1.00 27.44  ? 301 PRO A O   1 
ATOM   2258 C CB  . PRO A 1 300 ? -4.651  -29.382 24.838  1.00 26.43  ? 301 PRO A CB  1 
ATOM   2259 C CG  . PRO A 1 300 ? -4.866  -30.455 25.856  1.00 28.19  ? 301 PRO A CG  1 
ATOM   2260 C CD  . PRO A 1 300 ? -6.243  -31.001 25.576  1.00 22.80  ? 301 PRO A CD  1 
ATOM   2261 N N   . VAL A 1 301 ? -6.083  -26.859 23.131  1.00 30.90  ? 302 VAL A N   1 
ATOM   2262 C CA  . VAL A 1 301 ? -6.229  -26.213 21.844  1.00 29.21  ? 302 VAL A CA  1 
ATOM   2263 C C   . VAL A 1 301 ? -4.894  -25.626 21.355  1.00 40.89  ? 302 VAL A C   1 
ATOM   2264 O O   . VAL A 1 301 ? -4.133  -25.037 22.136  1.00 32.51  ? 302 VAL A O   1 
ATOM   2265 C CB  . VAL A 1 301 ? -7.349  -25.122 21.885  1.00 34.36  ? 302 VAL A CB  1 
ATOM   2266 C CG1 . VAL A 1 301 ? -7.021  -24.034 22.892  1.00 29.85  ? 302 VAL A CG1 1 
ATOM   2267 C CG2 . VAL A 1 301 ? -7.576  -24.524 20.504  1.00 31.31  ? 302 VAL A CG2 1 
ATOM   2268 N N   . VAL A 1 302 ? -4.610  -25.809 20.066  1.00 34.50  ? 303 VAL A N   1 
ATOM   2269 C CA  . VAL A 1 302 ? -3.438  -25.203 19.440  1.00 37.70  ? 303 VAL A CA  1 
ATOM   2270 C C   . VAL A 1 302 ? -3.763  -23.776 19.033  1.00 36.03  ? 303 VAL A C   1 
ATOM   2271 O O   . VAL A 1 302 ? -4.388  -23.551 17.997  1.00 37.52  ? 303 VAL A O   1 
ATOM   2272 C CB  . VAL A 1 302 ? -3.008  -25.952 18.159  1.00 40.45  ? 303 VAL A CB  1 
ATOM   2273 C CG1 . VAL A 1 302 ? -1.672  -25.418 17.674  1.00 34.04  ? 303 VAL A CG1 1 
ATOM   2274 C CG2 . VAL A 1 302 ? -2.923  -27.449 18.399  1.00 28.82  ? 303 VAL A CG2 1 
ATOM   2275 N N   . ASP A 1 303 ? -3.342  -22.809 19.839  1.00 37.25  ? 304 ASP A N   1 
ATOM   2276 C CA  . ASP A 1 303 ? -3.691  -21.418 19.574  1.00 42.48  ? 304 ASP A CA  1 
ATOM   2277 C C   . ASP A 1 303 ? -2.491  -20.476 19.577  1.00 41.13  ? 304 ASP A C   1 
ATOM   2278 O O   . ASP A 1 303 ? -2.664  -19.261 19.618  1.00 45.77  ? 304 ASP A O   1 
ATOM   2279 C CB  . ASP A 1 303 ? -4.701  -20.929 20.608  1.00 45.31  ? 304 ASP A CB  1 
ATOM   2280 C CG  . ASP A 1 303 ? -4.106  -20.850 22.006  1.00 43.92  ? 304 ASP A CG  1 
ATOM   2281 O OD1 . ASP A 1 303 ? -3.096  -21.540 22.267  1.00 39.41  ? 304 ASP A OD1 1 
ATOM   2282 O OD2 . ASP A 1 303 ? -4.651  -20.102 22.844  1.00 58.22  ? 304 ASP A OD2 1 
ATOM   2283 N N   . GLY A 1 304 ? -1.280  -21.027 19.566  1.00 35.59  ? 305 GLY A N   1 
ATOM   2284 C CA  . GLY A 1 304 ? -0.084  -20.205 19.519  1.00 28.93  ? 305 GLY A CA  1 
ATOM   2285 C C   . GLY A 1 304 ? 0.513   -19.865 20.872  1.00 46.40  ? 305 GLY A C   1 
ATOM   2286 O O   . GLY A 1 304 ? 1.676   -19.464 20.954  1.00 51.94  ? 305 GLY A O   1 
ATOM   2287 N N   . ASP A 1 305 ? -0.271  -20.040 21.935  1.00 38.81  ? 306 ASP A N   1 
ATOM   2288 C CA  . ASP A 1 305 ? 0.140   -19.641 23.281  1.00 37.04  ? 306 ASP A CA  1 
ATOM   2289 C C   . ASP A 1 305 ? 0.852   -20.775 24.036  1.00 42.34  ? 306 ASP A C   1 
ATOM   2290 O O   . ASP A 1 305 ? 2.080   -20.855 24.011  1.00 37.66  ? 306 ASP A O   1 
ATOM   2291 C CB  . ASP A 1 305 ? -1.065  -19.110 24.067  1.00 34.59  ? 306 ASP A CB  1 
ATOM   2292 C CG  . ASP A 1 305 ? -0.668  -18.418 25.361  1.00 51.75  ? 306 ASP A CG  1 
ATOM   2293 O OD1 . ASP A 1 305 ? 0.551   -18.308 25.630  1.00 38.70  ? 306 ASP A OD1 1 
ATOM   2294 O OD2 . ASP A 1 305 ? -1.580  -17.970 26.101  1.00 48.28  ? 306 ASP A OD2 1 
ATOM   2295 N N   . PHE A 1 306 ? 0.091   -21.640 24.707  1.00 39.86  ? 307 PHE A N   1 
ATOM   2296 C CA  . PHE A 1 306 ? 0.673   -22.812 25.363  1.00 30.86  ? 307 PHE A CA  1 
ATOM   2297 C C   . PHE A 1 306 ? 1.426   -23.684 24.345  1.00 40.17  ? 307 PHE A C   1 
ATOM   2298 O O   . PHE A 1 306 ? 2.571   -24.088 24.573  1.00 40.67  ? 307 PHE A O   1 
ATOM   2299 C CB  . PHE A 1 306 ? -0.407  -23.637 26.068  1.00 29.11  ? 307 PHE A CB  1 
ATOM   2300 C CG  . PHE A 1 306 ? 0.140   -24.645 27.041  1.00 30.29  ? 307 PHE A CG  1 
ATOM   2301 C CD1 . PHE A 1 306 ? 0.736   -25.818 26.591  1.00 26.53  ? 307 PHE A CD1 1 
ATOM   2302 C CD2 . PHE A 1 306 ? 0.063   -24.417 28.408  1.00 24.19  ? 307 PHE A CD2 1 
ATOM   2303 C CE1 . PHE A 1 306 ? 1.250   -26.743 27.489  1.00 29.50  ? 307 PHE A CE1 1 
ATOM   2304 C CE2 . PHE A 1 306 ? 0.569   -25.336 29.318  1.00 27.09  ? 307 PHE A CE2 1 
ATOM   2305 C CZ  . PHE A 1 306 ? 1.166   -26.504 28.861  1.00 24.71  ? 307 PHE A CZ  1 
ATOM   2306 N N   . LEU A 1 307 ? 0.765   -23.984 23.233  1.00 33.25  ? 308 LEU A N   1 
ATOM   2307 C CA  . LEU A 1 307 ? 1.419   -24.628 22.098  1.00 39.83  ? 308 LEU A CA  1 
ATOM   2308 C C   . LEU A 1 307 ? 1.526   -23.637 20.938  1.00 41.14  ? 308 LEU A C   1 
ATOM   2309 O O   . LEU A 1 307 ? 0.513   -23.234 20.364  1.00 40.31  ? 308 LEU A O   1 
ATOM   2310 C CB  . LEU A 1 307 ? 0.623   -25.854 21.655  1.00 35.91  ? 308 LEU A CB  1 
ATOM   2311 C CG  . LEU A 1 307 ? 0.368   -26.894 22.750  1.00 38.28  ? 308 LEU A CG  1 
ATOM   2312 C CD1 . LEU A 1 307 ? -0.701  -27.875 22.319  1.00 27.97  ? 308 LEU A CD1 1 
ATOM   2313 C CD2 . LEU A 1 307 ? 1.656   -27.621 23.102  1.00 32.72  ? 308 LEU A CD2 1 
ATOM   2314 N N   . SER A 1 308 ? 2.747   -23.238 20.596  1.00 39.17  ? 309 SER A N   1 
ATOM   2315 C CA  . SER A 1 308 ? 2.951   -22.295 19.495  1.00 42.61  ? 309 SER A CA  1 
ATOM   2316 C C   . SER A 1 308 ? 2.673   -22.898 18.108  1.00 40.70  ? 309 SER A C   1 
ATOM   2317 O O   . SER A 1 308 ? 2.508   -22.173 17.136  1.00 55.68  ? 309 SER A O   1 
ATOM   2318 C CB  . SER A 1 308 ? 4.361   -21.718 19.548  1.00 39.39  ? 309 SER A CB  1 
ATOM   2319 O OG  . SER A 1 308 ? 5.321   -22.738 19.388  1.00 46.80  ? 309 SER A OG  1 
ATOM   2320 N N   . ASP A 1 309 ? 2.619   -24.222 18.025  1.00 45.36  ? 310 ASP A N   1 
ATOM   2321 C CA  . ASP A 1 309 ? 2.279   -24.913 16.781  1.00 41.54  ? 310 ASP A CA  1 
ATOM   2322 C C   . ASP A 1 309 ? 1.643   -26.242 17.180  1.00 38.98  ? 310 ASP A C   1 
ATOM   2323 O O   . ASP A 1 309 ? 1.554   -26.554 18.368  1.00 42.25  ? 310 ASP A O   1 
ATOM   2324 C CB  . ASP A 1 309 ? 3.546   -25.153 15.954  1.00 45.34  ? 310 ASP A CB  1 
ATOM   2325 C CG  . ASP A 1 309 ? 3.277   -25.264 14.449  1.00 55.29  ? 310 ASP A CG  1 
ATOM   2326 O OD1 . ASP A 1 309 ? 2.192   -25.736 14.039  1.00 46.48  ? 310 ASP A OD1 1 
ATOM   2327 O OD2 . ASP A 1 309 ? 4.183   -24.890 13.668  1.00 50.65  ? 310 ASP A OD2 1 
ATOM   2328 N N   . THR A 1 310 ? 1.189   -27.020 16.204  1.00 40.11  ? 311 THR A N   1 
ATOM   2329 C CA  . THR A 1 310 ? 0.715   -28.371 16.486  1.00 39.65  ? 311 THR A CA  1 
ATOM   2330 C C   . THR A 1 310 ? 1.856   -29.178 17.108  1.00 43.22  ? 311 THR A C   1 
ATOM   2331 O O   . THR A 1 310 ? 3.026   -28.930 16.812  1.00 43.94  ? 311 THR A O   1 
ATOM   2332 C CB  . THR A 1 310 ? 0.235   -29.084 15.208  1.00 45.09  ? 311 THR A CB  1 
ATOM   2333 O OG1 . THR A 1 310 ? 1.363   -29.411 14.384  1.00 40.59  ? 311 THR A OG1 1 
ATOM   2334 C CG2 . THR A 1 310 ? -0.727  -28.199 14.436  1.00 31.11  ? 311 THR A CG2 1 
ATOM   2335 N N   . PRO A 1 311 ? 1.522   -30.133 17.986  1.00 38.57  ? 312 PRO A N   1 
ATOM   2336 C CA  . PRO A 1 311 ? 2.566   -30.948 18.605  1.00 36.07  ? 312 PRO A CA  1 
ATOM   2337 C C   . PRO A 1 311 ? 3.418   -31.667 17.564  1.00 37.14  ? 312 PRO A C   1 
ATOM   2338 O O   . PRO A 1 311 ? 4.627   -31.758 17.740  1.00 43.79  ? 312 PRO A O   1 
ATOM   2339 C CB  . PRO A 1 311 ? 1.770   -31.945 19.455  1.00 35.94  ? 312 PRO A CB  1 
ATOM   2340 C CG  . PRO A 1 311 ? 0.523   -31.216 19.795  1.00 31.64  ? 312 PRO A CG  1 
ATOM   2341 C CD  . PRO A 1 311 ? 0.196   -30.416 18.561  1.00 42.91  ? 312 PRO A CD  1 
ATOM   2342 N N   A GLU A 1 312 ? 2.785   -32.165 16.506  0.49 41.48  ? 313 GLU A N   1 
ATOM   2343 N N   B GLU A 1 312 ? 2.802   -32.158 16.493  0.51 41.49  ? 313 GLU A N   1 
ATOM   2344 C CA  A GLU A 1 312 ? 3.502   -32.792 15.397  0.49 46.09  ? 313 GLU A CA  1 
ATOM   2345 C CA  B GLU A 1 312 ? 3.564   -32.807 15.427  0.51 46.09  ? 313 GLU A CA  1 
ATOM   2346 C C   A GLU A 1 312 ? 4.610   -31.884 14.867  0.49 43.78  ? 313 GLU A C   1 
ATOM   2347 C C   B GLU A 1 312 ? 4.640   -31.875 14.877  0.51 43.78  ? 313 GLU A C   1 
ATOM   2348 O O   A GLU A 1 312 ? 5.751   -32.313 14.701  0.49 44.92  ? 313 GLU A O   1 
ATOM   2349 O O   B GLU A 1 312 ? 5.788   -32.279 14.703  0.51 44.90  ? 313 GLU A O   1 
ATOM   2350 C CB  A GLU A 1 312 ? 2.539   -33.158 14.260  0.49 44.33  ? 313 GLU A CB  1 
ATOM   2351 C CB  B GLU A 1 312 ? 2.658   -33.281 14.288  0.51 44.42  ? 313 GLU A CB  1 
ATOM   2352 C CG  A GLU A 1 312 ? 1.705   -34.413 14.502  0.49 44.80  ? 313 GLU A CG  1 
ATOM   2353 C CG  B GLU A 1 312 ? 3.376   -34.198 13.307  0.51 52.13  ? 313 GLU A CG  1 
ATOM   2354 C CD  A GLU A 1 312 ? 0.334   -34.121 15.100  0.49 47.39  ? 313 GLU A CD  1 
ATOM   2355 C CD  B GLU A 1 312 ? 2.769   -34.184 11.918  0.51 56.50  ? 313 GLU A CD  1 
ATOM   2356 O OE1 A GLU A 1 312 ? -0.618  -34.861 14.763  0.49 47.36  ? 313 GLU A OE1 1 
ATOM   2357 O OE1 B GLU A 1 312 ? 1.571   -33.848 11.787  0.51 61.39  ? 313 GLU A OE1 1 
ATOM   2358 O OE2 A GLU A 1 312 ? 0.207   -33.168 15.904  0.49 32.18  ? 313 GLU A OE2 1 
ATOM   2359 O OE2 B GLU A 1 312 ? 3.500   -34.505 10.956  0.51 45.33  ? 313 GLU A OE2 1 
ATOM   2360 N N   . ALA A 1 313 ? 4.269   -30.625 14.615  1.00 38.63  ? 314 ALA A N   1 
ATOM   2361 C CA  . ALA A 1 313 ? 5.234   -29.656 14.107  1.00 39.14  ? 314 ALA A CA  1 
ATOM   2362 C C   . ALA A 1 313 ? 6.346   -29.419 15.118  1.00 43.90  ? 314 ALA A C   1 
ATOM   2363 O O   . ALA A 1 313 ? 7.526   -29.439 14.765  1.00 45.92  ? 314 ALA A O   1 
ATOM   2364 C CB  . ALA A 1 313 ? 4.551   -28.347 13.752  1.00 35.28  ? 314 ALA A CB  1 
ATOM   2365 N N   . LEU A 1 314 ? 5.961   -29.210 16.376  1.00 45.62  ? 315 LEU A N   1 
ATOM   2366 C CA  . LEU A 1 314 ? 6.922   -28.928 17.439  1.00 38.11  ? 315 LEU A CA  1 
ATOM   2367 C C   . LEU A 1 314 ? 7.864   -30.099 17.670  1.00 35.79  ? 315 LEU A C   1 
ATOM   2368 O O   . LEU A 1 314 ? 9.044   -29.913 17.960  1.00 43.42  ? 315 LEU A O   1 
ATOM   2369 C CB  . LEU A 1 314 ? 6.196   -28.586 18.733  1.00 39.33  ? 315 LEU A CB  1 
ATOM   2370 C CG  . LEU A 1 314 ? 5.393   -27.294 18.671  1.00 43.16  ? 315 LEU A CG  1 
ATOM   2371 C CD1 . LEU A 1 314 ? 4.654   -27.077 19.975  1.00 35.57  ? 315 LEU A CD1 1 
ATOM   2372 C CD2 . LEU A 1 314 ? 6.308   -26.123 18.355  1.00 31.75  ? 315 LEU A CD2 1 
ATOM   2373 N N   . ILE A 1 315 ? 7.326   -31.306 17.540  1.00 38.57  ? 316 ILE A N   1 
ATOM   2374 C CA  . ILE A 1 315 ? 8.113   -32.519 17.673  1.00 44.29  ? 316 ILE A CA  1 
ATOM   2375 C C   . ILE A 1 315 ? 9.154   -32.612 16.557  1.00 42.28  ? 316 ILE A C   1 
ATOM   2376 O O   . ILE A 1 315 ? 10.326  -32.850 16.830  1.00 48.17  ? 316 ILE A O   1 
ATOM   2377 C CB  . ILE A 1 315 ? 7.211   -33.775 17.698  1.00 41.93  ? 316 ILE A CB  1 
ATOM   2378 C CG1 . ILE A 1 315 ? 6.489   -33.875 19.033  1.00 38.84  ? 316 ILE A CG1 1 
ATOM   2379 C CG2 . ILE A 1 315 ? 8.014   -35.040 17.504  1.00 35.28  ? 316 ILE A CG2 1 
ATOM   2380 C CD1 . ILE A 1 315 ? 5.405   -34.919 19.030  1.00 38.83  ? 316 ILE A CD1 1 
ATOM   2381 N N   . ASN A 1 316 ? 8.731   -32.407 15.309  1.00 54.62  ? 317 ASN A N   1 
ATOM   2382 C CA  . ASN A 1 316 ? 9.647   -32.487 14.166  1.00 48.98  ? 317 ASN A CA  1 
ATOM   2383 C C   . ASN A 1 316 ? 10.750  -31.430 14.169  1.00 49.20  ? 317 ASN A C   1 
ATOM   2384 O O   . ASN A 1 316 ? 11.832  -31.668 13.638  1.00 63.58  ? 317 ASN A O   1 
ATOM   2385 C CB  . ASN A 1 316 ? 8.884   -32.431 12.844  1.00 48.65  ? 317 ASN A CB  1 
ATOM   2386 C CG  . ASN A 1 316 ? 7.838   -33.516 12.732  1.00 52.09  ? 317 ASN A CG  1 
ATOM   2387 O OD1 . ASN A 1 316 ? 7.907   -34.538 13.417  1.00 56.29  ? 317 ASN A OD1 1 
ATOM   2388 N ND2 . ASN A 1 316 ? 6.852   -33.295 11.871  1.00 61.27  ? 317 ASN A ND2 1 
ATOM   2389 N N   . ALA A 1 317 ? 10.481  -30.282 14.790  1.00 51.76  ? 318 ALA A N   1 
ATOM   2390 C CA  . ALA A 1 317 ? 11.405  -29.147 14.776  1.00 40.22  ? 318 ALA A CA  1 
ATOM   2391 C C   . ALA A 1 317 ? 12.211  -28.956 16.058  1.00 56.06  ? 318 ALA A C   1 
ATOM   2392 O O   . ALA A 1 317 ? 12.922  -27.958 16.203  1.00 57.63  ? 318 ALA A O   1 
ATOM   2393 C CB  . ALA A 1 317 ? 10.643  -27.864 14.459  1.00 46.71  ? 318 ALA A CB  1 
ATOM   2394 N N   . GLY A 1 318 ? 12.109  -29.898 16.988  1.00 55.24  ? 319 GLY A N   1 
ATOM   2395 C CA  . GLY A 1 318 ? 12.754  -29.734 18.278  1.00 31.87  ? 319 GLY A CA  1 
ATOM   2396 C C   . GLY A 1 318 ? 14.155  -30.315 18.374  1.00 43.70  ? 319 GLY A C   1 
ATOM   2397 O O   . GLY A 1 318 ? 14.480  -31.292 17.693  1.00 42.02  ? 319 GLY A O   1 
ATOM   2398 N N   . ASP A 1 319 ? 14.982  -29.695 19.219  1.00 38.71  ? 320 ASP A N   1 
ATOM   2399 C CA  . ASP A 1 319 ? 16.292  -30.219 19.590  1.00 46.50  ? 320 ASP A CA  1 
ATOM   2400 C C   . ASP A 1 319 ? 16.075  -30.884 20.938  1.00 44.55  ? 320 ASP A C   1 
ATOM   2401 O O   . ASP A 1 319 ? 15.798  -30.215 21.928  1.00 41.01  ? 320 ASP A O   1 
ATOM   2402 C CB  . ASP A 1 319 ? 17.326  -29.076 19.696  1.00 41.99  ? 320 ASP A CB  1 
ATOM   2403 C CG  . ASP A 1 319 ? 18.713  -29.539 20.206  1.00 59.60  ? 320 ASP A CG  1 
ATOM   2404 O OD1 . ASP A 1 319 ? 18.860  -30.687 20.682  1.00 52.64  ? 320 ASP A OD1 1 
ATOM   2405 O OD2 . ASP A 1 319 ? 19.673  -28.730 20.145  1.00 59.83  ? 320 ASP A OD2 1 
ATOM   2406 N N   . PHE A 1 320 ? 16.196  -32.203 20.981  1.00 44.73  ? 321 PHE A N   1 
ATOM   2407 C CA  . PHE A 1 320 ? 15.890  -32.913 22.216  1.00 43.60  ? 321 PHE A CA  1 
ATOM   2408 C C   . PHE A 1 320 ? 17.101  -33.533 22.890  1.00 43.40  ? 321 PHE A C   1 
ATOM   2409 O O   . PHE A 1 320 ? 16.956  -34.425 23.728  1.00 43.58  ? 321 PHE A O   1 
ATOM   2410 C CB  . PHE A 1 320 ? 14.785  -33.947 21.982  1.00 35.35  ? 321 PHE A CB  1 
ATOM   2411 C CG  . PHE A 1 320 ? 13.466  -33.328 21.635  1.00 37.11  ? 321 PHE A CG  1 
ATOM   2412 C CD1 . PHE A 1 320 ? 12.703  -32.713 22.611  1.00 30.79  ? 321 PHE A CD1 1 
ATOM   2413 C CD2 . PHE A 1 320 ? 13.010  -33.320 20.328  1.00 35.70  ? 321 PHE A CD2 1 
ATOM   2414 C CE1 . PHE A 1 320 ? 11.494  -32.129 22.298  1.00 30.19  ? 321 PHE A CE1 1 
ATOM   2415 C CE2 . PHE A 1 320 ? 11.798  -32.733 20.005  1.00 38.74  ? 321 PHE A CE2 1 
ATOM   2416 C CZ  . PHE A 1 320 ? 11.039  -32.142 20.992  1.00 41.01  ? 321 PHE A CZ  1 
ATOM   2417 N N   . HIS A 1 321 ? 18.290  -33.062 22.523  1.00 49.29  ? 322 HIS A N   1 
ATOM   2418 C CA  . HIS A 1 321 ? 19.507  -33.423 23.249  1.00 51.28  ? 322 HIS A CA  1 
ATOM   2419 C C   . HIS A 1 321 ? 19.348  -33.034 24.716  1.00 34.88  ? 322 HIS A C   1 
ATOM   2420 O O   . HIS A 1 321 ? 18.852  -31.952 25.020  1.00 45.57  ? 322 HIS A O   1 
ATOM   2421 C CB  . HIS A 1 321 ? 20.741  -32.743 22.635  1.00 41.18  ? 322 HIS A CB  1 
ATOM   2422 C CG  . HIS A 1 321 ? 21.138  -33.315 21.311  1.00 41.04  ? 322 HIS A CG  1 
ATOM   2423 N ND1 . HIS A 1 321 ? 20.715  -32.781 20.111  1.00 39.39  ? 322 HIS A ND1 1 
ATOM   2424 C CD2 . HIS A 1 321 ? 21.879  -34.403 21.001  1.00 31.45  ? 322 HIS A CD2 1 
ATOM   2425 C CE1 . HIS A 1 321 ? 21.192  -33.509 19.116  1.00 41.17  ? 322 HIS A CE1 1 
ATOM   2426 N NE2 . HIS A 1 321 ? 21.904  -34.498 19.629  1.00 46.55  ? 322 HIS A NE2 1 
ATOM   2427 N N   . GLY A 1 322 ? 19.734  -33.932 25.618  1.00 35.75  ? 323 GLY A N   1 
ATOM   2428 C CA  . GLY A 1 322 ? 19.653  -33.660 27.044  1.00 36.67  ? 323 GLY A CA  1 
ATOM   2429 C C   . GLY A 1 322 ? 18.424  -34.272 27.693  1.00 45.09  ? 323 GLY A C   1 
ATOM   2430 O O   . GLY A 1 322 ? 18.297  -34.291 28.917  1.00 50.60  ? 323 GLY A O   1 
ATOM   2431 N N   . LEU A 1 323 ? 17.517  -34.779 26.864  1.00 36.16  ? 324 LEU A N   1 
ATOM   2432 C CA  . LEU A 1 323 ? 16.268  -35.358 27.342  1.00 41.68  ? 324 LEU A CA  1 
ATOM   2433 C C   . LEU A 1 323 ? 16.329  -36.888 27.372  1.00 28.67  ? 324 LEU A C   1 
ATOM   2434 O O   . LEU A 1 323 ? 16.845  -37.521 26.444  1.00 32.39  ? 324 LEU A O   1 
ATOM   2435 C CB  . LEU A 1 323 ? 15.108  -34.898 26.450  1.00 37.24  ? 324 LEU A CB  1 
ATOM   2436 C CG  . LEU A 1 323 ? 13.698  -35.449 26.692  1.00 38.53  ? 324 LEU A CG  1 
ATOM   2437 C CD1 . LEU A 1 323 ? 13.098  -34.875 27.970  1.00 28.14  ? 324 LEU A CD1 1 
ATOM   2438 C CD2 . LEU A 1 323 ? 12.817  -35.125 25.501  1.00 33.51  ? 324 LEU A CD2 1 
ATOM   2439 N N   . GLN A 1 324 ? 15.815  -37.473 28.449  1.00 27.69  ? 325 GLN A N   1 
ATOM   2440 C CA  . GLN A 1 324 ? 15.529  -38.905 28.473  1.00 33.14  ? 325 GLN A CA  1 
ATOM   2441 C C   . GLN A 1 324 ? 14.018  -39.118 28.609  1.00 34.63  ? 325 GLN A C   1 
ATOM   2442 O O   . GLN A 1 324 ? 13.374  -38.495 29.450  1.00 32.58  ? 325 GLN A O   1 
ATOM   2443 C CB  . GLN A 1 324 ? 16.271  -39.612 29.610  1.00 36.49  ? 325 GLN A CB  1 
ATOM   2444 C CG  . GLN A 1 324 ? 17.788  -39.477 29.562  1.00 39.61  ? 325 GLN A CG  1 
ATOM   2445 C CD  . GLN A 1 324 ? 18.279  -38.271 30.327  1.00 36.14  ? 325 GLN A CD  1 
ATOM   2446 O OE1 . GLN A 1 324 ? 17.908  -38.058 31.482  1.00 45.61  ? 325 GLN A OE1 1 
ATOM   2447 N NE2 . GLN A 1 324 ? 19.107  -37.465 29.685  1.00 47.26  ? 325 GLN A NE2 1 
ATOM   2448 N N   . VAL A 1 325 ? 13.453  -39.975 27.764  1.00 27.46  ? 326 VAL A N   1 
ATOM   2449 C CA  . VAL A 1 325 ? 12.039  -40.301 27.859  1.00 27.15  ? 326 VAL A CA  1 
ATOM   2450 C C   . VAL A 1 325 ? 11.833  -41.798 27.970  1.00 28.12  ? 326 VAL A C   1 
ATOM   2451 O O   . VAL A 1 325 ? 12.586  -42.583 27.393  1.00 30.93  ? 326 VAL A O   1 
ATOM   2452 C CB  . VAL A 1 325 ? 11.223  -39.793 26.651  1.00 25.96  ? 326 VAL A CB  1 
ATOM   2453 C CG1 . VAL A 1 325 ? 10.294  -38.697 27.076  1.00 33.22  ? 326 VAL A CG1 1 
ATOM   2454 C CG2 . VAL A 1 325 ? 12.134  -39.313 25.545  1.00 41.02  ? 326 VAL A CG2 1 
ATOM   2455 N N   . LEU A 1 326 ? 10.810  -42.177 28.729  1.00 31.21  ? 327 LEU A N   1 
ATOM   2456 C CA  . LEU A 1 326 ? 10.344  -43.557 28.801  1.00 31.17  ? 327 LEU A CA  1 
ATOM   2457 C C   . LEU A 1 326 ? 8.919   -43.583 28.253  1.00 32.36  ? 327 LEU A C   1 
ATOM   2458 O O   . LEU A 1 326 ? 8.024   -42.928 28.799  1.00 31.78  ? 327 LEU A O   1 
ATOM   2459 C CB  . LEU A 1 326 ? 10.373  -44.045 30.248  1.00 28.28  ? 327 LEU A CB  1 
ATOM   2460 C CG  . LEU A 1 326 ? 9.866   -45.451 30.591  1.00 31.35  ? 327 LEU A CG  1 
ATOM   2461 C CD1 . LEU A 1 326 ? 10.658  -46.505 29.888  1.00 33.48  ? 327 LEU A CD1 1 
ATOM   2462 C CD2 . LEU A 1 326 ? 9.965   -45.665 32.085  1.00 29.75  ? 327 LEU A CD2 1 
ATOM   2463 N N   . VAL A 1 327 ? 8.714   -44.312 27.160  1.00 23.82  ? 328 VAL A N   1 
ATOM   2464 C CA  . VAL A 1 327 ? 7.402   -44.371 26.522  1.00 27.80  ? 328 VAL A CA  1 
ATOM   2465 C C   . VAL A 1 327 ? 7.003   -45.818 26.317  1.00 26.34  ? 328 VAL A C   1 
ATOM   2466 O O   . VAL A 1 327 ? 7.852   -46.704 26.276  1.00 24.38  ? 328 VAL A O   1 
ATOM   2467 C CB  . VAL A 1 327 ? 7.388   -43.655 25.150  1.00 24.36  ? 328 VAL A CB  1 
ATOM   2468 C CG1 . VAL A 1 327 ? 7.985   -42.279 25.277  1.00 18.26  ? 328 VAL A CG1 1 
ATOM   2469 C CG2 . VAL A 1 327 ? 8.153   -44.463 24.118  1.00 17.75  ? 328 VAL A CG2 1 
ATOM   2470 N N   . GLY A 1 328 ? 5.708   -46.071 26.188  1.00 23.08  ? 329 GLY A N   1 
ATOM   2471 C CA  . GLY A 1 328 ? 5.268   -47.432 25.975  1.00 16.81  ? 329 GLY A CA  1 
ATOM   2472 C C   . GLY A 1 328 ? 3.774   -47.551 25.825  1.00 26.77  ? 329 GLY A C   1 
ATOM   2473 O O   . GLY A 1 328 ? 3.042   -46.563 25.939  1.00 23.72  ? 329 GLY A O   1 
ATOM   2474 N N   . VAL A 1 329 ? 3.323   -48.774 25.564  1.00 23.55  ? 330 VAL A N   1 
ATOM   2475 C CA  . VAL A 1 329 ? 1.925   -49.037 25.276  1.00 22.62  ? 330 VAL A CA  1 
ATOM   2476 C C   . VAL A 1 329 ? 1.545   -50.365 25.903  1.00 26.35  ? 330 VAL A C   1 
ATOM   2477 O O   . VAL A 1 329 ? 2.425   -51.164 26.230  1.00 27.40  ? 330 VAL A O   1 
ATOM   2478 C CB  . VAL A 1 329 ? 1.702   -49.140 23.750  1.00 25.64  ? 330 VAL A CB  1 
ATOM   2479 C CG1 . VAL A 1 329 ? 2.072   -47.825 23.062  1.00 20.94  ? 330 VAL A CG1 1 
ATOM   2480 C CG2 . VAL A 1 329 ? 2.523   -50.307 23.161  1.00 18.86  ? 330 VAL A CG2 1 
ATOM   2481 N N   . VAL A 1 330 ? 0.246   -50.611 26.071  1.00 24.67  ? 331 VAL A N   1 
ATOM   2482 C CA  . VAL A 1 330 ? -0.211  -51.954 26.427  1.00 27.26  ? 331 VAL A CA  1 
ATOM   2483 C C   . VAL A 1 330 ? -0.413  -52.793 25.162  1.00 26.36  ? 331 VAL A C   1 
ATOM   2484 O O   . VAL A 1 330 ? -0.489  -52.249 24.060  1.00 27.25  ? 331 VAL A O   1 
ATOM   2485 C CB  . VAL A 1 330 ? -1.505  -51.936 27.253  1.00 27.90  ? 331 VAL A CB  1 
ATOM   2486 C CG1 . VAL A 1 330 ? -1.276  -51.240 28.595  1.00 20.32  ? 331 VAL A CG1 1 
ATOM   2487 C CG2 . VAL A 1 330 ? -2.622  -51.278 26.472  1.00 24.51  ? 331 VAL A CG2 1 
ATOM   2488 N N   A LYS A 1 331 ? -0.511  -54.109 25.349  0.53 28.07  ? 332 LYS A N   1 
ATOM   2489 N N   B LYS A 1 331 ? -0.501  -54.111 25.319  0.47 27.98  ? 332 LYS A N   1 
ATOM   2490 C CA  A LYS A 1 331 ? -0.647  -55.073 24.258  0.53 29.55  ? 332 LYS A CA  1 
ATOM   2491 C CA  B LYS A 1 331 ? -0.602  -54.995 24.164  0.47 29.56  ? 332 LYS A CA  1 
ATOM   2492 C C   A LYS A 1 331 ? -1.876  -54.815 23.386  0.53 29.01  ? 332 LYS A C   1 
ATOM   2493 C C   B LYS A 1 331 ? -1.874  -54.758 23.345  0.47 29.09  ? 332 LYS A C   1 
ATOM   2494 O O   A LYS A 1 331 ? -1.841  -55.025 22.182  0.53 31.80  ? 332 LYS A O   1 
ATOM   2495 O O   B LYS A 1 331 ? -1.870  -54.927 22.132  0.47 31.79  ? 332 LYS A O   1 
ATOM   2496 C CB  A LYS A 1 331 ? -0.690  -56.505 24.817  0.53 33.16  ? 332 LYS A CB  1 
ATOM   2497 C CB  B LYS A 1 331 ? -0.494  -56.469 24.573  0.47 33.38  ? 332 LYS A CB  1 
ATOM   2498 C CG  A LYS A 1 331 ? -0.716  -57.614 23.757  0.53 30.10  ? 332 LYS A CG  1 
ATOM   2499 C CG  B LYS A 1 331 ? -0.316  -57.418 23.386  0.47 27.59  ? 332 LYS A CG  1 
ATOM   2500 C CD  A LYS A 1 331 ? -0.611  -59.012 24.389  0.53 30.61  ? 332 LYS A CD  1 
ATOM   2501 C CD  B LYS A 1 331 ? -0.381  -58.882 23.797  0.47 32.26  ? 332 LYS A CD  1 
ATOM   2502 C CE  A LYS A 1 331 ? -1.924  -59.472 25.042  0.53 38.39  ? 332 LYS A CE  1 
ATOM   2503 C CE  B LYS A 1 331 ? -0.428  -59.783 22.567  0.47 32.85  ? 332 LYS A CE  1 
ATOM   2504 N NZ  A LYS A 1 331 ? -3.035  -59.798 24.076  0.53 20.35  ? 332 LYS A NZ  1 
ATOM   2505 N NZ  B LYS A 1 331 ? -0.917  -61.148 22.875  0.47 26.02  ? 332 LYS A NZ  1 
ATOM   2506 N N   . ASP A 1 332 ? -2.956  -54.348 23.997  1.00 29.05  ? 333 ASP A N   1 
ATOM   2507 C CA  . ASP A 1 332 ? -4.218  -54.164 23.282  1.00 27.89  ? 333 ASP A CA  1 
ATOM   2508 C C   . ASP A 1 332 ? -4.861  -52.794 23.489  1.00 30.81  ? 333 ASP A C   1 
ATOM   2509 O O   . ASP A 1 332 ? -5.911  -52.684 24.124  1.00 25.65  ? 333 ASP A O   1 
ATOM   2510 C CB  . ASP A 1 332 ? -5.192  -55.280 23.663  1.00 27.32  ? 333 ASP A CB  1 
ATOM   2511 C CG  . ASP A 1 332 ? -4.657  -56.658 23.302  1.00 33.10  ? 333 ASP A CG  1 
ATOM   2512 O OD1 . ASP A 1 332 ? -4.748  -57.029 22.110  1.00 37.81  ? 333 ASP A OD1 1 
ATOM   2513 O OD2 . ASP A 1 332 ? -4.141  -57.365 24.203  1.00 32.39  ? 333 ASP A OD2 1 
ATOM   2514 N N   . GLU A 1 333 ? -4.237  -51.764 22.922  1.00 27.41  ? 334 GLU A N   1 
ATOM   2515 C CA  . GLU A 1 333 ? -4.648  -50.382 23.138  1.00 26.45  ? 334 GLU A CA  1 
ATOM   2516 C C   . GLU A 1 333 ? -6.086  -50.086 22.749  1.00 29.38  ? 334 GLU A C   1 
ATOM   2517 O O   . GLU A 1 333 ? -6.732  -49.237 23.363  1.00 33.51  ? 334 GLU A O   1 
ATOM   2518 C CB  . GLU A 1 333 ? -3.711  -49.419 22.391  1.00 25.71  ? 334 GLU A CB  1 
ATOM   2519 C CG  . GLU A 1 333 ? -2.315  -49.296 23.002  1.00 26.77  ? 334 GLU A CG  1 
ATOM   2520 C CD  . GLU A 1 333 ? -2.328  -48.639 24.394  1.00 33.15  ? 334 GLU A CD  1 
ATOM   2521 O OE1 . GLU A 1 333 ? -3.384  -48.101 24.796  1.00 27.11  ? 334 GLU A OE1 1 
ATOM   2522 O OE2 . GLU A 1 333 ? -1.281  -48.654 25.086  1.00 27.26  ? 334 GLU A OE2 1 
ATOM   2523 N N   . GLY A 1 334 ? -6.596  -50.781 21.739  1.00 26.45  ? 335 GLY A N   1 
ATOM   2524 C CA  . GLY A 1 334 ? -7.873  -50.406 21.157  1.00 23.78  ? 335 GLY A CA  1 
ATOM   2525 C C   . GLY A 1 334 ? -9.112  -51.048 21.759  1.00 28.28  ? 335 GLY A C   1 
ATOM   2526 O O   . GLY A 1 334 ? -10.202 -50.470 21.711  1.00 24.35  ? 335 GLY A O   1 
ATOM   2527 N N   . SER A 1 335 ? -8.949  -52.239 22.324  1.00 25.09  ? 336 SER A N   1 
ATOM   2528 C CA  . SER A 1 335 ? -10.087 -53.072 22.709  1.00 26.74  ? 336 SER A CA  1 
ATOM   2529 C C   . SER A 1 335 ? -11.098 -52.364 23.623  1.00 31.53  ? 336 SER A C   1 
ATOM   2530 O O   . SER A 1 335 ? -12.294 -52.347 23.337  1.00 32.82  ? 336 SER A O   1 
ATOM   2531 C CB  . SER A 1 335 ? -9.596  -54.372 23.348  1.00 32.52  ? 336 SER A CB  1 
ATOM   2532 O OG  . SER A 1 335 ? -8.881  -54.116 24.547  1.00 34.71  ? 336 SER A OG  1 
ATOM   2533 N N   . TYR A 1 336 ? -10.608 -51.767 24.704  1.00 29.76  ? 337 TYR A N   1 
ATOM   2534 C CA  . TYR A 1 336 ? -11.462 -51.085 25.670  1.00 23.71  ? 337 TYR A CA  1 
ATOM   2535 C C   . TYR A 1 336 ? -12.418 -50.078 25.018  1.00 28.09  ? 337 TYR A C   1 
ATOM   2536 O O   . TYR A 1 336 ? -13.594 -50.012 25.357  1.00 30.26  ? 337 TYR A O   1 
ATOM   2537 C CB  . TYR A 1 336 ? -10.602 -50.408 26.758  1.00 27.76  ? 337 TYR A CB  1 
ATOM   2538 C CG  . TYR A 1 336 ? -11.361 -49.419 27.604  1.00 29.88  ? 337 TYR A CG  1 
ATOM   2539 C CD1 . TYR A 1 336 ? -12.089 -49.841 28.710  1.00 34.61  ? 337 TYR A CD1 1 
ATOM   2540 C CD2 . TYR A 1 336 ? -11.370 -48.057 27.287  1.00 34.15  ? 337 TYR A CD2 1 
ATOM   2541 C CE1 . TYR A 1 336 ? -12.796 -48.938 29.495  1.00 39.92  ? 337 TYR A CE1 1 
ATOM   2542 C CE2 . TYR A 1 336 ? -12.085 -47.147 28.060  1.00 38.13  ? 337 TYR A CE2 1 
ATOM   2543 C CZ  . TYR A 1 336 ? -12.792 -47.599 29.167  1.00 41.08  ? 337 TYR A CZ  1 
ATOM   2544 O OH  . TYR A 1 336 ? -13.501 -46.710 29.946  1.00 46.35  ? 337 TYR A OH  1 
ATOM   2545 N N   . PHE A 1 337 ? -11.920 -49.304 24.066  1.00 26.93  ? 338 PHE A N   1 
ATOM   2546 C CA  . PHE A 1 337 ? -12.742 -48.260 23.459  1.00 30.35  ? 338 PHE A CA  1 
ATOM   2547 C C   . PHE A 1 337 ? -13.860 -48.781 22.558  1.00 36.28  ? 338 PHE A C   1 
ATOM   2548 O O   . PHE A 1 337 ? -14.849 -48.079 22.332  1.00 32.74  ? 338 PHE A O   1 
ATOM   2549 C CB  . PHE A 1 337 ? -11.855 -47.242 22.732  1.00 29.20  ? 338 PHE A CB  1 
ATOM   2550 C CG  . PHE A 1 337 ? -10.873 -46.572 23.643  1.00 31.33  ? 338 PHE A CG  1 
ATOM   2551 C CD1 . PHE A 1 337 ? -9.644  -47.152 23.901  1.00 25.18  ? 338 PHE A CD1 1 
ATOM   2552 C CD2 . PHE A 1 337 ? -11.204 -45.393 24.293  1.00 28.47  ? 338 PHE A CD2 1 
ATOM   2553 C CE1 . PHE A 1 337 ? -8.749  -46.554 24.773  1.00 27.87  ? 338 PHE A CE1 1 
ATOM   2554 C CE2 . PHE A 1 337 ? -10.315 -44.792 25.150  1.00 25.61  ? 338 PHE A CE2 1 
ATOM   2555 C CZ  . PHE A 1 337 ? -9.083  -45.376 25.390  1.00 24.99  ? 338 PHE A CZ  1 
ATOM   2556 N N   . LEU A 1 338 ? -13.716 -50.011 22.067  1.00 30.04  ? 339 LEU A N   1 
ATOM   2557 C CA  . LEU A 1 338 ? -14.706 -50.589 21.155  1.00 38.73  ? 339 LEU A CA  1 
ATOM   2558 C C   . LEU A 1 338 ? -16.077 -50.796 21.808  1.00 38.36  ? 339 LEU A C   1 
ATOM   2559 O O   . LEU A 1 338 ? -17.113 -50.599 21.172  1.00 40.78  ? 339 LEU A O   1 
ATOM   2560 C CB  . LEU A 1 338 ? -14.191 -51.898 20.549  1.00 34.30  ? 339 LEU A CB  1 
ATOM   2561 C CG  . LEU A 1 338 ? -12.979 -51.732 19.626  1.00 37.73  ? 339 LEU A CG  1 
ATOM   2562 C CD1 . LEU A 1 338 ? -12.551 -53.047 19.016  1.00 37.86  ? 339 LEU A CD1 1 
ATOM   2563 C CD2 . LEU A 1 338 ? -13.271 -50.718 18.547  1.00 33.78  ? 339 LEU A CD2 1 
ATOM   2564 N N   . VAL A 1 339 ? -16.090 -51.167 23.083  1.00 32.22  ? 340 VAL A N   1 
ATOM   2565 C CA  . VAL A 1 339 ? -17.359 -51.336 23.783  1.00 43.96  ? 340 VAL A CA  1 
ATOM   2566 C C   . VAL A 1 339 ? -18.020 -50.027 24.199  1.00 45.27  ? 340 VAL A C   1 
ATOM   2567 O O   . VAL A 1 339 ? -19.048 -50.043 24.858  1.00 57.61  ? 340 VAL A O   1 
ATOM   2568 C CB  . VAL A 1 339 ? -17.216 -52.246 24.990  1.00 45.97  ? 340 VAL A CB  1 
ATOM   2569 C CG1 . VAL A 1 339 ? -16.705 -53.602 24.525  1.00 43.86  ? 340 VAL A CG1 1 
ATOM   2570 C CG2 . VAL A 1 339 ? -16.285 -51.621 26.016  1.00 42.88  ? 340 VAL A CG2 1 
ATOM   2571 N N   . TYR A 1 340 ? -17.446 -48.900 23.790  1.00 46.10  ? 341 TYR A N   1 
ATOM   2572 C CA  . TYR A 1 340 ? -18.050 -47.595 24.050  1.00 42.50  ? 341 TYR A CA  1 
ATOM   2573 C C   . TYR A 1 340 ? -18.587 -46.909 22.792  1.00 54.65  ? 341 TYR A C   1 
ATOM   2574 O O   . TYR A 1 340 ? -18.630 -45.673 22.728  1.00 51.39  ? 341 TYR A O   1 
ATOM   2575 C CB  . TYR A 1 340 ? -17.053 -46.671 24.762  1.00 40.98  ? 341 TYR A CB  1 
ATOM   2576 C CG  . TYR A 1 340 ? -16.887 -46.988 26.227  1.00 37.07  ? 341 TYR A CG  1 
ATOM   2577 C CD1 . TYR A 1 340 ? -17.544 -46.238 27.198  1.00 47.62  ? 341 TYR A CD1 1 
ATOM   2578 C CD2 . TYR A 1 340 ? -16.095 -48.050 26.643  1.00 35.31  ? 341 TYR A CD2 1 
ATOM   2579 C CE1 . TYR A 1 340 ? -17.408 -46.524 28.547  1.00 40.31  ? 341 TYR A CE1 1 
ATOM   2580 C CE2 . TYR A 1 340 ? -15.956 -48.354 27.998  1.00 43.46  ? 341 TYR A CE2 1 
ATOM   2581 C CZ  . TYR A 1 340 ? -16.617 -47.583 28.944  1.00 40.92  ? 341 TYR A CZ  1 
ATOM   2582 O OH  . TYR A 1 340 ? -16.483 -47.867 30.285  1.00 55.01  ? 341 TYR A OH  1 
ATOM   2583 N N   . GLY A 1 341 ? -18.990 -47.693 21.792  1.00 47.93  ? 342 GLY A N   1 
ATOM   2584 C CA  . GLY A 1 341 ? -19.611 -47.102 20.619  1.00 48.58  ? 342 GLY A CA  1 
ATOM   2585 C C   . GLY A 1 341 ? -19.470 -47.828 19.297  1.00 52.88  ? 342 GLY A C   1 
ATOM   2586 O O   . GLY A 1 341 ? -20.135 -47.477 18.319  1.00 61.62  ? 342 GLY A O   1 
ATOM   2587 N N   . ALA A 1 342 ? -18.602 -48.830 19.247  1.00 55.34  ? 343 ALA A N   1 
ATOM   2588 C CA  . ALA A 1 342 ? -18.443 -49.603 18.023  1.00 51.64  ? 343 ALA A CA  1 
ATOM   2589 C C   . ALA A 1 342 ? -19.573 -50.626 17.903  1.00 57.67  ? 343 ALA A C   1 
ATOM   2590 O O   . ALA A 1 342 ? -19.813 -51.405 18.827  1.00 47.85  ? 343 ALA A O   1 
ATOM   2591 C CB  . ALA A 1 342 ? -17.086 -50.285 17.983  1.00 39.10  ? 343 ALA A CB  1 
ATOM   2592 N N   . PRO A 1 343 ? -20.276 -50.614 16.758  1.00 58.16  ? 344 PRO A N   1 
ATOM   2593 C CA  . PRO A 1 343 ? -21.392 -51.526 16.487  1.00 51.19  ? 344 PRO A CA  1 
ATOM   2594 C C   . PRO A 1 343 ? -21.021 -52.996 16.648  1.00 44.21  ? 344 PRO A C   1 
ATOM   2595 O O   . PRO A 1 343 ? -20.004 -53.456 16.123  1.00 44.19  ? 344 PRO A O   1 
ATOM   2596 C CB  . PRO A 1 343 ? -21.747 -51.225 15.022  1.00 49.72  ? 344 PRO A CB  1 
ATOM   2597 C CG  . PRO A 1 343 ? -20.576 -50.474 14.472  1.00 54.67  ? 344 PRO A CG  1 
ATOM   2598 C CD  . PRO A 1 343 ? -20.029 -49.705 15.626  1.00 43.15  ? 344 PRO A CD  1 
ATOM   2599 N N   . GLY A 1 344 ? -21.847 -53.725 17.388  1.00 47.16  ? 345 GLY A N   1 
ATOM   2600 C CA  . GLY A 1 344 ? -21.644 -55.148 17.576  1.00 43.44  ? 345 GLY A CA  1 
ATOM   2601 C C   . GLY A 1 344 ? -20.715 -55.519 18.716  1.00 45.66  ? 345 GLY A C   1 
ATOM   2602 O O   . GLY A 1 344 ? -20.421 -56.701 18.901  1.00 49.14  ? 345 GLY A O   1 
ATOM   2603 N N   . PHE A 1 345 ? -20.257 -54.532 19.488  1.00 46.50  ? 346 PHE A N   1 
ATOM   2604 C CA  . PHE A 1 345 ? -19.336 -54.810 20.602  1.00 47.07  ? 346 PHE A CA  1 
ATOM   2605 C C   . PHE A 1 345 ? -19.976 -54.801 21.988  1.00 41.93  ? 346 PHE A C   1 
ATOM   2606 O O   . PHE A 1 345 ? -20.826 -53.963 22.293  1.00 45.02  ? 346 PHE A O   1 
ATOM   2607 C CB  . PHE A 1 345 ? -18.140 -53.853 20.582  1.00 35.12  ? 346 PHE A CB  1 
ATOM   2608 C CG  . PHE A 1 345 ? -17.134 -54.171 19.512  1.00 39.70  ? 346 PHE A CG  1 
ATOM   2609 C CD1 . PHE A 1 345 ? -16.030 -54.963 19.795  1.00 35.60  ? 346 PHE A CD1 1 
ATOM   2610 C CD2 . PHE A 1 345 ? -17.299 -53.690 18.221  1.00 33.91  ? 346 PHE A CD2 1 
ATOM   2611 C CE1 . PHE A 1 345 ? -15.105 -55.264 18.814  1.00 34.78  ? 346 PHE A CE1 1 
ATOM   2612 C CE2 . PHE A 1 345 ? -16.376 -53.985 17.232  1.00 43.93  ? 346 PHE A CE2 1 
ATOM   2613 C CZ  . PHE A 1 345 ? -15.276 -54.771 17.528  1.00 35.21  ? 346 PHE A CZ  1 
ATOM   2614 N N   . SER A 1 346 ? -19.551 -55.742 22.825  1.00 43.97  ? 347 SER A N   1 
ATOM   2615 C CA  . SER A 1 346 ? -19.922 -55.743 24.239  1.00 48.59  ? 347 SER A CA  1 
ATOM   2616 C C   . SER A 1 346 ? -18.859 -56.436 25.068  1.00 39.56  ? 347 SER A C   1 
ATOM   2617 O O   . SER A 1 346 ? -18.159 -57.322 24.584  1.00 46.49  ? 347 SER A O   1 
ATOM   2618 C CB  . SER A 1 346 ? -21.274 -56.434 24.464  1.00 48.30  ? 347 SER A CB  1 
ATOM   2619 O OG  . SER A 1 346 ? -21.513 -56.637 25.852  1.00 56.55  ? 347 SER A OG  1 
ATOM   2620 N N   . LYS A 1 347 ? -18.745 -56.048 26.330  1.00 45.46  ? 348 LYS A N   1 
ATOM   2621 C CA  . LYS A 1 347 ? -17.844 -56.747 27.227  1.00 43.74  ? 348 LYS A CA  1 
ATOM   2622 C C   . LYS A 1 347 ? -18.473 -58.084 27.613  1.00 45.07  ? 348 LYS A C   1 
ATOM   2623 O O   . LYS A 1 347 ? -17.796 -58.977 28.122  1.00 41.63  ? 348 LYS A O   1 
ATOM   2624 C CB  . LYS A 1 347 ? -17.569 -55.909 28.480  1.00 42.45  ? 348 LYS A CB  1 
ATOM   2625 C CG  . LYS A 1 347 ? -18.589 -56.092 29.598  1.00 38.63  ? 348 LYS A CG  1 
ATOM   2626 C CD  . LYS A 1 347 ? -18.165 -55.368 30.880  1.00 42.76  ? 348 LYS A CD  1 
ATOM   2627 C CE  . LYS A 1 347 ? -19.095 -55.698 32.041  1.00 42.55  ? 348 LYS A CE  1 
ATOM   2628 N NZ  . LYS A 1 347 ? -19.059 -57.154 32.392  1.00 31.59  ? 348 LYS A NZ  1 
ATOM   2629 N N   . ASP A 1 348 ? -19.774 -58.211 27.353  1.00 43.20  ? 349 ASP A N   1 
ATOM   2630 C CA  . ASP A 1 348 ? -20.558 -59.354 27.819  1.00 45.47  ? 349 ASP A CA  1 
ATOM   2631 C C   . ASP A 1 348 ? -20.770 -60.457 26.781  1.00 52.09  ? 349 ASP A C   1 
ATOM   2632 O O   . ASP A 1 348 ? -21.390 -61.472 27.085  1.00 45.63  ? 349 ASP A O   1 
ATOM   2633 C CB  . ASP A 1 348 ? -21.909 -58.885 28.364  1.00 45.07  ? 349 ASP A CB  1 
ATOM   2634 C CG  . ASP A 1 348 ? -21.777 -58.145 29.683  1.00 51.55  ? 349 ASP A CG  1 
ATOM   2635 O OD1 . ASP A 1 348 ? -20.957 -58.579 30.526  1.00 36.49  ? 349 ASP A OD1 1 
ATOM   2636 O OD2 . ASP A 1 348 ? -22.486 -57.130 29.864  1.00 44.90  ? 349 ASP A OD2 1 
ATOM   2637 N N   . ASN A 1 349 ? -20.286 -60.246 25.557  1.00 43.02  ? 350 ASN A N   1 
ATOM   2638 C CA  . ASN A 1 349 ? -20.126 -61.349 24.610  1.00 49.35  ? 350 ASN A CA  1 
ATOM   2639 C C   . ASN A 1 349 ? -18.768 -61.338 23.916  1.00 52.79  ? 350 ASN A C   1 
ATOM   2640 O O   . ASN A 1 349 ? -17.869 -60.575 24.282  1.00 44.68  ? 350 ASN A O   1 
ATOM   2641 C CB  . ASN A 1 349 ? -21.289 -61.457 23.600  1.00 35.29  ? 350 ASN A CB  1 
ATOM   2642 C CG  . ASN A 1 349 ? -21.466 -60.216 22.747  1.00 46.09  ? 350 ASN A CG  1 
ATOM   2643 O OD1 . ASN A 1 349 ? -20.497 -59.643 22.244  1.00 46.51  ? 350 ASN A OD1 1 
ATOM   2644 N ND2 . ASN A 1 349 ? -22.729 -59.802 22.577  1.00 41.87  ? 350 ASN A ND2 1 
ATOM   2645 N N   . GLU A 1 350 ? -18.631 -62.197 22.917  1.00 40.07  ? 351 GLU A N   1 
ATOM   2646 C CA  . GLU A 1 350 ? -17.363 -62.395 22.242  1.00 43.56  ? 351 GLU A CA  1 
ATOM   2647 C C   . GLU A 1 350 ? -17.054 -61.260 21.270  1.00 39.64  ? 351 GLU A C   1 
ATOM   2648 O O   . GLU A 1 350 ? -15.956 -61.197 20.708  1.00 42.00  ? 351 GLU A O   1 
ATOM   2649 C CB  . GLU A 1 350 ? -17.385 -63.726 21.495  1.00 52.08  ? 351 GLU A CB  1 
ATOM   2650 C CG  . GLU A 1 350 ? -17.176 -64.923 22.384  1.00 50.84  ? 351 GLU A CG  1 
ATOM   2651 C CD  . GLU A 1 350 ? -15.780 -64.946 22.952  1.00 70.80  ? 351 GLU A CD  1 
ATOM   2652 O OE1 . GLU A 1 350 ? -14.848 -65.331 22.211  1.00 81.67  ? 351 GLU A OE1 1 
ATOM   2653 O OE2 . GLU A 1 350 ? -15.613 -64.558 24.128  1.00 66.90  ? 351 GLU A OE2 1 
ATOM   2654 N N   . SER A 1 351 ? -18.029 -60.378 21.075  1.00 31.06  ? 352 SER A N   1 
ATOM   2655 C CA  . SER A 1 351 ? -17.920 -59.295 20.101  1.00 33.59  ? 352 SER A CA  1 
ATOM   2656 C C   . SER A 1 351 ? -17.425 -59.770 18.722  1.00 39.35  ? 352 SER A C   1 
ATOM   2657 O O   . SER A 1 351 ? -16.634 -59.089 18.065  1.00 38.33  ? 352 SER A O   1 
ATOM   2658 C CB  . SER A 1 351 ? -17.015 -58.190 20.648  1.00 37.00  ? 352 SER A CB  1 
ATOM   2659 O OG  . SER A 1 351 ? -17.643 -57.495 21.709  1.00 38.11  ? 352 SER A OG  1 
ATOM   2660 N N   . LEU A 1 352 ? -17.892 -60.939 18.293  1.00 39.03  ? 353 LEU A N   1 
ATOM   2661 C CA  . LEU A 1 352 ? -17.524 -61.490 16.994  1.00 31.89  ? 353 LEU A CA  1 
ATOM   2662 C C   . LEU A 1 352 ? -18.302 -60.823 15.873  1.00 36.30  ? 353 LEU A C   1 
ATOM   2663 O O   . LEU A 1 352 ? -19.314 -61.349 15.423  1.00 53.84  ? 353 LEU A O   1 
ATOM   2664 C CB  . LEU A 1 352 ? -17.781 -62.991 16.979  1.00 28.78  ? 353 LEU A CB  1 
ATOM   2665 C CG  . LEU A 1 352 ? -16.794 -63.755 17.856  1.00 38.63  ? 353 LEU A CG  1 
ATOM   2666 C CD1 . LEU A 1 352 ? -17.138 -65.232 17.907  1.00 36.48  ? 353 LEU A CD1 1 
ATOM   2667 C CD2 . LEU A 1 352 ? -15.388 -63.550 17.338  1.00 33.45  ? 353 LEU A CD2 1 
ATOM   2668 N N   . ILE A 1 353 ? -17.819 -59.673 15.414  1.00 36.95  ? 354 ILE A N   1 
ATOM   2669 C CA  . ILE A 1 353 ? -18.538 -58.854 14.438  1.00 36.43  ? 354 ILE A CA  1 
ATOM   2670 C C   . ILE A 1 353 ? -18.515 -59.370 12.979  1.00 44.05  ? 354 ILE A C   1 
ATOM   2671 O O   . ILE A 1 353 ? -17.732 -60.247 12.611  1.00 39.36  ? 354 ILE A O   1 
ATOM   2672 C CB  . ILE A 1 353 ? -18.012 -57.408 14.460  1.00 36.96  ? 354 ILE A CB  1 
ATOM   2673 C CG1 . ILE A 1 353 ? -16.513 -57.392 14.133  1.00 36.43  ? 354 ILE A CG1 1 
ATOM   2674 C CG2 . ILE A 1 353 ? -18.268 -56.783 15.824  1.00 40.68  ? 354 ILE A CG2 1 
ATOM   2675 C CD1 . ILE A 1 353 ? -15.940 -56.013 13.912  1.00 30.64  ? 354 ILE A CD1 1 
ATOM   2676 N N   . SER A 1 354 ? -19.399 -58.806 12.163  1.00 35.63  ? 355 SER A N   1 
ATOM   2677 C CA  . SER A 1 354 ? -19.491 -59.107 10.740  1.00 38.64  ? 355 SER A CA  1 
ATOM   2678 C C   . SER A 1 354 ? -18.679 -58.078 9.966   1.00 44.40  ? 355 SER A C   1 
ATOM   2679 O O   . SER A 1 354 ? -18.316 -57.030 10.514  1.00 37.63  ? 355 SER A O   1 
ATOM   2680 C CB  . SER A 1 354 ? -20.941 -58.975 10.294  1.00 28.79  ? 355 SER A CB  1 
ATOM   2681 O OG  . SER A 1 354 ? -21.318 -57.601 10.294  1.00 35.16  ? 355 SER A OG  1 
ATOM   2682 N N   . ARG A 1 355 ? -18.417 -58.353 8.691   1.00 37.08  ? 356 ARG A N   1 
ATOM   2683 C CA  . ARG A 1 355 ? -17.665 -57.405 7.876   1.00 33.69  ? 356 ARG A CA  1 
ATOM   2684 C C   . ARG A 1 355 ? -18.382 -56.065 7.774   1.00 35.86  ? 356 ARG A C   1 
ATOM   2685 O O   . ARG A 1 355 ? -17.749 -55.011 7.824   1.00 41.17  ? 356 ARG A O   1 
ATOM   2686 C CB  . ARG A 1 355 ? -17.365 -57.961 6.482   1.00 40.90  ? 356 ARG A CB  1 
ATOM   2687 C CG  . ARG A 1 355 ? -16.719 -56.922 5.555   1.00 39.78  ? 356 ARG A CG  1 
ATOM   2688 C CD  . ARG A 1 355 ? -15.582 -57.510 4.771   1.00 33.98  ? 356 ARG A CD  1 
ATOM   2689 N NE  . ARG A 1 355 ? -14.734 -56.496 4.152   1.00 43.55  ? 356 ARG A NE  1 
ATOM   2690 C CZ  . ARG A 1 355 ? -13.485 -56.246 4.528   1.00 42.48  ? 356 ARG A CZ  1 
ATOM   2691 N NH1 . ARG A 1 355 ? -12.941 -56.935 5.527   1.00 36.88  ? 356 ARG A NH1 1 
ATOM   2692 N NH2 . ARG A 1 355 ? -12.779 -55.312 3.907   1.00 34.43  ? 356 ARG A NH2 1 
ATOM   2693 N N   . ALA A 1 356 ? -19.702 -56.115 7.633   1.00 39.76  ? 357 ALA A N   1 
ATOM   2694 C CA  . ALA A 1 356 ? -20.525 -54.910 7.592   1.00 36.11  ? 357 ALA A CA  1 
ATOM   2695 C C   . ALA A 1 356 ? -20.312 -54.059 8.841   1.00 43.03  ? 357 ALA A C   1 
ATOM   2696 O O   . ALA A 1 356 ? -20.180 -52.839 8.753   1.00 45.75  ? 357 ALA A O   1 
ATOM   2697 C CB  . ALA A 1 356 ? -21.986 -55.286 7.458   1.00 34.58  ? 357 ALA A CB  1 
ATOM   2698 N N   . GLU A 1 357 ? -20.278 -54.714 10.001  1.00 37.26  ? 358 GLU A N   1 
ATOM   2699 C CA  . GLU A 1 357 ? -20.026 -54.027 11.264  1.00 45.58  ? 358 GLU A CA  1 
ATOM   2700 C C   . GLU A 1 357 ? -18.594 -53.501 11.316  1.00 40.76  ? 358 GLU A C   1 
ATOM   2701 O O   . GLU A 1 357 ? -18.348 -52.383 11.771  1.00 40.68  ? 358 GLU A O   1 
ATOM   2702 C CB  . GLU A 1 357 ? -20.318 -54.947 12.459  1.00 41.19  ? 358 GLU A CB  1 
ATOM   2703 C CG  . GLU A 1 357 ? -21.813 -55.197 12.696  1.00 38.93  ? 358 GLU A CG  1 
ATOM   2704 C CD  . GLU A 1 357 ? -22.086 -56.311 13.712  1.00 50.99  ? 358 GLU A CD  1 
ATOM   2705 O OE1 . GLU A 1 357 ? -21.338 -57.311 13.737  1.00 45.63  ? 358 GLU A OE1 1 
ATOM   2706 O OE2 . GLU A 1 357 ? -23.055 -56.183 14.491  1.00 59.49  ? 358 GLU A OE2 1 
ATOM   2707 N N   . PHE A 1 358 ? -17.653 -54.304 10.830  1.00 39.76  ? 359 PHE A N   1 
ATOM   2708 C CA  . PHE A 1 358 ? -16.262 -53.878 10.765  1.00 40.58  ? 359 PHE A CA  1 
ATOM   2709 C C   . PHE A 1 358 ? -16.161 -52.596 9.949   1.00 35.42  ? 359 PHE A C   1 
ATOM   2710 O O   . PHE A 1 358 ? -15.569 -51.618 10.400  1.00 44.79  ? 359 PHE A O   1 
ATOM   2711 C CB  . PHE A 1 358 ? -15.370 -54.987 10.192  1.00 32.45  ? 359 PHE A CB  1 
ATOM   2712 C CG  . PHE A 1 358 ? -13.977 -54.534 9.842   1.00 40.55  ? 359 PHE A CG  1 
ATOM   2713 C CD1 . PHE A 1 358 ? -12.971 -54.526 10.796  1.00 35.36  ? 359 PHE A CD1 1 
ATOM   2714 C CD2 . PHE A 1 358 ? -13.672 -54.120 8.555   1.00 34.05  ? 359 PHE A CD2 1 
ATOM   2715 C CE1 . PHE A 1 358 ? -11.694 -54.116 10.474  1.00 31.07  ? 359 PHE A CE1 1 
ATOM   2716 C CE2 . PHE A 1 358 ? -12.395 -53.707 8.230   1.00 36.87  ? 359 PHE A CE2 1 
ATOM   2717 C CZ  . PHE A 1 358 ? -11.407 -53.703 9.187   1.00 34.52  ? 359 PHE A CZ  1 
ATOM   2718 N N   . LEU A 1 359 ? -16.776 -52.594 8.771   1.00 37.70  ? 360 LEU A N   1 
ATOM   2719 C CA  . LEU A 1 359 ? -16.788 -51.416 7.904   1.00 39.94  ? 360 LEU A CA  1 
ATOM   2720 C C   . LEU A 1 359 ? -17.468 -50.209 8.552   1.00 38.19  ? 360 LEU A C   1 
ATOM   2721 O O   . LEU A 1 359 ? -17.014 -49.078 8.404   1.00 45.30  ? 360 LEU A O   1 
ATOM   2722 C CB  . LEU A 1 359 ? -17.466 -51.733 6.572   1.00 40.97  ? 360 LEU A CB  1 
ATOM   2723 C CG  . LEU A 1 359 ? -16.779 -52.739 5.653   1.00 46.32  ? 360 LEU A CG  1 
ATOM   2724 C CD1 . LEU A 1 359 ? -17.552 -52.869 4.341   1.00 35.08  ? 360 LEU A CD1 1 
ATOM   2725 C CD2 . LEU A 1 359 ? -15.338 -52.318 5.398   1.00 40.29  ? 360 LEU A CD2 1 
ATOM   2726 N N   . ALA A 1 360 ? -18.565 -50.443 9.261   1.00 44.78  ? 361 ALA A N   1 
ATOM   2727 C CA  . ALA A 1 360 ? -19.224 -49.356 9.975   1.00 46.87  ? 361 ALA A CA  1 
ATOM   2728 C C   . ALA A 1 360 ? -18.346 -48.911 11.137  1.00 46.28  ? 361 ALA A C   1 
ATOM   2729 O O   . ALA A 1 360 ? -18.288 -47.726 11.472  1.00 40.64  ? 361 ALA A O   1 
ATOM   2730 C CB  . ALA A 1 360 ? -20.591 -49.793 10.476  1.00 44.43  ? 361 ALA A CB  1 
ATOM   2731 N N   . GLY A 1 361 ? -17.662 -49.874 11.747  1.00 34.84  ? 362 GLY A N   1 
ATOM   2732 C CA  . GLY A 1 361 ? -16.768 -49.592 12.854  1.00 36.64  ? 362 GLY A CA  1 
ATOM   2733 C C   . GLY A 1 361 ? -15.616 -48.688 12.456  1.00 41.21  ? 362 GLY A C   1 
ATOM   2734 O O   . GLY A 1 361 ? -15.171 -47.872 13.251  1.00 38.07  ? 362 GLY A O   1 
ATOM   2735 N N   . VAL A 1 362 ? -15.140 -48.823 11.219  1.00 36.72  ? 363 VAL A N   1 
ATOM   2736 C CA  . VAL A 1 362 ? -14.005 -48.033 10.752  1.00 28.49  ? 363 VAL A CA  1 
ATOM   2737 C C   . VAL A 1 362 ? -14.332 -46.541 10.688  1.00 31.64  ? 363 VAL A C   1 
ATOM   2738 O O   . VAL A 1 362 ? -13.516 -45.715 11.083  1.00 39.33  ? 363 VAL A O   1 
ATOM   2739 C CB  . VAL A 1 362 ? -13.484 -48.536 9.384   1.00 35.57  ? 363 VAL A CB  1 
ATOM   2740 C CG1 . VAL A 1 362 ? -12.591 -47.500 8.718   1.00 19.80  ? 363 VAL A CG1 1 
ATOM   2741 C CG2 . VAL A 1 362 ? -12.751 -49.856 9.554   1.00 26.73  ? 363 VAL A CG2 1 
ATOM   2742 N N   . ARG A 1 363 ? -15.525 -46.197 10.210  1.00 31.46  ? 364 ARG A N   1 
ATOM   2743 C CA  . ARG A 1 363 ? -15.941 -44.794 10.160  1.00 34.16  ? 364 ARG A CA  1 
ATOM   2744 C C   . ARG A 1 363 ? -16.079 -44.204 11.563  1.00 35.78  ? 364 ARG A C   1 
ATOM   2745 O O   . ARG A 1 363 ? -15.862 -43.013 11.771  1.00 42.30  ? 364 ARG A O   1 
ATOM   2746 C CB  . ARG A 1 363 ? -17.267 -44.625 9.413   1.00 41.83  ? 364 ARG A CB  1 
ATOM   2747 C CG  . ARG A 1 363 ? -17.339 -45.265 8.022   1.00 48.95  ? 364 ARG A CG  1 
ATOM   2748 C CD  . ARG A 1 363 ? -16.119 -44.975 7.147   1.00 45.28  ? 364 ARG A CD  1 
ATOM   2749 N NE  . ARG A 1 363 ? -15.782 -43.555 7.046   1.00 47.11  ? 364 ARG A NE  1 
ATOM   2750 C CZ  . ARG A 1 363 ? -16.000 -42.807 5.968   1.00 52.62  ? 364 ARG A CZ  1 
ATOM   2751 N NH1 . ARG A 1 363 ? -16.571 -43.341 4.894   1.00 45.79  ? 364 ARG A NH1 1 
ATOM   2752 N NH2 . ARG A 1 363 ? -15.646 -41.527 5.964   1.00 41.34  ? 364 ARG A NH2 1 
ATOM   2753 N N   . VAL A 1 364 ? -16.446 -45.046 12.522  1.00 33.05  ? 365 VAL A N   1 
ATOM   2754 C CA  . VAL A 1 364 ? -16.570 -44.626 13.917  1.00 40.29  ? 365 VAL A CA  1 
ATOM   2755 C C   . VAL A 1 364 ? -15.191 -44.471 14.560  1.00 39.11  ? 365 VAL A C   1 
ATOM   2756 O O   . VAL A 1 364 ? -14.903 -43.466 15.215  1.00 40.26  ? 365 VAL A O   1 
ATOM   2757 C CB  . VAL A 1 364 ? -17.430 -45.628 14.724  1.00 33.44  ? 365 VAL A CB  1 
ATOM   2758 C CG1 . VAL A 1 364 ? -17.324 -45.362 16.199  1.00 42.50  ? 365 VAL A CG1 1 
ATOM   2759 C CG2 . VAL A 1 364 ? -18.878 -45.531 14.285  1.00 40.20  ? 365 VAL A CG2 1 
ATOM   2760 N N   . GLY A 1 365 ? -14.336 -45.465 14.346  1.00 35.33  ? 366 GLY A N   1 
ATOM   2761 C CA  . GLY A 1 365 ? -12.984 -45.449 14.876  1.00 34.45  ? 366 GLY A CA  1 
ATOM   2762 C C   . GLY A 1 365 ? -12.055 -44.446 14.214  1.00 38.27  ? 366 GLY A C   1 
ATOM   2763 O O   . GLY A 1 365 ? -11.047 -44.053 14.800  1.00 41.85  ? 366 GLY A O   1 
ATOM   2764 N N   . VAL A 1 366 ? -12.380 -44.034 12.990  1.00 40.74  ? 367 VAL A N   1 
ATOM   2765 C CA  . VAL A 1 366 ? -11.565 -43.046 12.281  1.00 35.10  ? 367 VAL A CA  1 
ATOM   2766 C C   . VAL A 1 366 ? -12.453 -41.923 11.773  1.00 37.07  ? 367 VAL A C   1 
ATOM   2767 O O   . VAL A 1 366 ? -12.578 -41.721 10.564  1.00 38.23  ? 367 VAL A O   1 
ATOM   2768 C CB  . VAL A 1 366 ? -10.812 -43.670 11.077  1.00 34.99  ? 367 VAL A CB  1 
ATOM   2769 C CG1 . VAL A 1 366 ? -9.678  -42.757 10.613  1.00 32.42  ? 367 VAL A CG1 1 
ATOM   2770 C CG2 . VAL A 1 366 ? -10.269 -45.043 11.438  1.00 32.06  ? 367 VAL A CG2 1 
ATOM   2771 N N   . PRO A 1 367 ? -13.067 -41.175 12.699  1.00 42.91  ? 368 PRO A N   1 
ATOM   2772 C CA  . PRO A 1 367 ? -14.075 -40.187 12.304  1.00 37.02  ? 368 PRO A CA  1 
ATOM   2773 C C   . PRO A 1 367 ? -13.477 -38.999 11.558  1.00 37.88  ? 368 PRO A C   1 
ATOM   2774 O O   . PRO A 1 367 ? -12.282 -38.732 11.675  1.00 45.51  ? 368 PRO A O   1 
ATOM   2775 C CB  . PRO A 1 367 ? -14.652 -39.733 13.649  1.00 36.38  ? 368 PRO A CB  1 
ATOM   2776 C CG  . PRO A 1 367 ? -13.540 -39.924 14.606  1.00 36.63  ? 368 PRO A CG  1 
ATOM   2777 C CD  . PRO A 1 367 ? -12.787 -41.135 14.148  1.00 33.44  ? 368 PRO A CD  1 
ATOM   2778 N N   . GLN A 1 368 ? -14.312 -38.312 10.784  1.00 44.85  ? 369 GLN A N   1 
ATOM   2779 C CA  . GLN A 1 368 ? -13.934 -37.058 10.127  1.00 53.44  ? 369 GLN A CA  1 
ATOM   2780 C C   . GLN A 1 368 ? -12.846 -37.169 9.045   1.00 50.81  ? 369 GLN A C   1 
ATOM   2781 O O   . GLN A 1 368 ? -12.098 -36.216 8.813   1.00 49.44  ? 369 GLN A O   1 
ATOM   2782 C CB  . GLN A 1 368 ? -13.535 -36.000 11.167  1.00 63.38  ? 369 GLN A CB  1 
ATOM   2783 C CG  . GLN A 1 368 ? -14.558 -35.776 12.283  1.00 67.63  ? 369 GLN A CG  1 
ATOM   2784 C CD  . GLN A 1 368 ? -15.867 -35.213 11.771  1.00 78.08  ? 369 GLN A CD  1 
ATOM   2785 O OE1 . GLN A 1 368 ? -16.021 -33.998 11.636  1.00 78.36  ? 369 GLN A OE1 1 
ATOM   2786 N NE2 . GLN A 1 368 ? -16.820 -36.095 11.480  1.00 67.93  ? 369 GLN A NE2 1 
ATOM   2787 N N   . VAL A 1 369 ? -12.757 -38.314 8.376   1.00 45.54  ? 370 VAL A N   1 
ATOM   2788 C CA  . VAL A 1 369 ? -11.843 -38.436 7.242   1.00 38.34  ? 370 VAL A CA  1 
ATOM   2789 C C   . VAL A 1 369 ? -12.618 -38.738 5.970   1.00 36.07  ? 370 VAL A C   1 
ATOM   2790 O O   . VAL A 1 369 ? -13.766 -39.175 6.020   1.00 43.97  ? 370 VAL A O   1 
ATOM   2791 C CB  . VAL A 1 369 ? -10.777 -39.531 7.454   1.00 38.67  ? 370 VAL A CB  1 
ATOM   2792 C CG1 . VAL A 1 369 ? -9.994  -39.276 8.730   1.00 27.92  ? 370 VAL A CG1 1 
ATOM   2793 C CG2 . VAL A 1 369 ? -11.421 -40.914 7.470   1.00 31.93  ? 370 VAL A CG2 1 
ATOM   2794 N N   . SER A 1 370 ? -11.986 -38.518 4.825   1.00 42.25  ? 371 SER A N   1 
ATOM   2795 C CA  . SER A 1 370 ? -12.638 -38.783 3.547   1.00 35.52  ? 371 SER A CA  1 
ATOM   2796 C C   . SER A 1 370 ? -12.914 -40.271 3.368   1.00 41.79  ? 371 SER A C   1 
ATOM   2797 O O   . SER A 1 370 ? -12.273 -41.115 4.007   1.00 39.99  ? 371 SER A O   1 
ATOM   2798 C CB  . SER A 1 370 ? -11.773 -38.276 2.396   1.00 31.80  ? 371 SER A CB  1 
ATOM   2799 O OG  . SER A 1 370 ? -10.533 -38.961 2.355   1.00 46.36  ? 371 SER A OG  1 
ATOM   2800 N N   . ASP A 1 371 ? -13.872 -40.585 2.499   1.00 39.62  ? 372 ASP A N   1 
ATOM   2801 C CA  . ASP A 1 371 ? -14.165 -41.966 2.144   1.00 41.57  ? 372 ASP A CA  1 
ATOM   2802 C C   . ASP A 1 371 ? -12.916 -42.649 1.602   1.00 41.06  ? 372 ASP A C   1 
ATOM   2803 O O   . ASP A 1 371 ? -12.690 -43.840 1.839   1.00 37.30  ? 372 ASP A O   1 
ATOM   2804 C CB  . ASP A 1 371 ? -15.282 -42.029 1.105   1.00 44.35  ? 372 ASP A CB  1 
ATOM   2805 C CG  . ASP A 1 371 ? -16.603 -41.523 1.639   1.00 62.58  ? 372 ASP A CG  1 
ATOM   2806 O OD1 . ASP A 1 371 ? -16.819 -41.612 2.868   1.00 59.73  ? 372 ASP A OD1 1 
ATOM   2807 O OD2 . ASP A 1 371 ? -17.426 -41.039 0.830   1.00 62.61  ? 372 ASP A OD2 1 
ATOM   2808 N N   . LEU A 1 372 ? -12.100 -41.892 0.878   1.00 31.69  ? 373 LEU A N   1 
ATOM   2809 C CA  . LEU A 1 372 ? -10.867 -42.452 0.344   1.00 42.20  ? 373 LEU A CA  1 
ATOM   2810 C C   . LEU A 1 372 ? -9.939  -42.877 1.490   1.00 38.17  ? 373 LEU A C   1 
ATOM   2811 O O   . LEU A 1 372 ? -9.398  -43.990 1.487   1.00 36.32  ? 373 LEU A O   1 
ATOM   2812 C CB  . LEU A 1 372 ? -10.178 -41.460 -0.595  1.00 34.06  ? 373 LEU A CB  1 
ATOM   2813 C CG  . LEU A 1 372 ? -8.893  -41.995 -1.223  1.00 39.69  ? 373 LEU A CG  1 
ATOM   2814 C CD1 . LEU A 1 372 ? -9.200  -43.220 -2.070  1.00 38.65  ? 373 LEU A CD1 1 
ATOM   2815 C CD2 . LEU A 1 372 ? -8.205  -40.920 -2.042  1.00 37.72  ? 373 LEU A CD2 1 
ATOM   2816 N N   . ALA A 1 373 ? -9.781  -41.995 2.475   1.00 37.08  ? 374 ALA A N   1 
ATOM   2817 C CA  . ALA A 1 373 ? -8.965  -42.281 3.657   1.00 31.39  ? 374 ALA A CA  1 
ATOM   2818 C C   . ALA A 1 373 ? -9.448  -43.543 4.374   1.00 28.43  ? 374 ALA A C   1 
ATOM   2819 O O   . ALA A 1 373 ? -8.649  -44.425 4.704   1.00 31.98  ? 374 ALA A O   1 
ATOM   2820 C CB  . ALA A 1 373 ? -8.967  -41.089 4.598   1.00 29.33  ? 374 ALA A CB  1 
ATOM   2821 N N   . ALA A 1 374 ? -10.759 -43.634 4.585   1.00 26.96  ? 375 ALA A N   1 
ATOM   2822 C CA  . ALA A 1 374 ? -11.370 -44.819 5.189   1.00 25.62  ? 375 ALA A CA  1 
ATOM   2823 C C   . ALA A 1 374 ? -11.112 -46.095 4.382   1.00 34.77  ? 375 ALA A C   1 
ATOM   2824 O O   . ALA A 1 374 ? -10.845 -47.154 4.961   1.00 36.33  ? 375 ALA A O   1 
ATOM   2825 C CB  . ALA A 1 374 ? -12.863 -44.610 5.375   1.00 27.17  ? 375 ALA A CB  1 
ATOM   2826 N N   . GLU A 1 375 ? -11.196 -45.991 3.053   1.00 33.54  ? 376 GLU A N   1 
ATOM   2827 C CA  . GLU A 1 375 ? -10.950 -47.132 2.170   1.00 30.04  ? 376 GLU A CA  1 
ATOM   2828 C C   . GLU A 1 375 ? -9.533  -47.636 2.340   1.00 29.66  ? 376 GLU A C   1 
ATOM   2829 O O   . GLU A 1 375 ? -9.288  -48.845 2.402   1.00 30.15  ? 376 GLU A O   1 
ATOM   2830 C CB  . GLU A 1 375 ? -11.173 -46.758 0.695   1.00 41.69  ? 376 GLU A CB  1 
ATOM   2831 C CG  . GLU A 1 375 ? -12.632 -46.697 0.256   1.00 44.53  ? 376 GLU A CG  1 
ATOM   2832 C CD  . GLU A 1 375 ? -13.368 -48.006 0.473   1.00 59.49  ? 376 GLU A CD  1 
ATOM   2833 O OE1 . GLU A 1 375 ? -12.725 -49.081 0.429   1.00 59.13  ? 376 GLU A OE1 1 
ATOM   2834 O OE2 . GLU A 1 375 ? -14.596 -47.956 0.693   1.00 73.81  ? 376 GLU A OE2 1 
ATOM   2835 N N   . ALA A 1 376 ? -8.597  -46.696 2.392   1.00 23.84  ? 377 ALA A N   1 
ATOM   2836 C CA  . ALA A 1 376 ? -7.210  -47.031 2.666   1.00 25.93  ? 377 ALA A CA  1 
ATOM   2837 C C   . ALA A 1 376 ? -7.070  -47.773 3.994   1.00 31.04  ? 377 ALA A C   1 
ATOM   2838 O O   . ALA A 1 376 ? -6.284  -48.719 4.084   1.00 30.80  ? 377 ALA A O   1 
ATOM   2839 C CB  . ALA A 1 376 ? -6.341  -45.781 2.654   1.00 24.94  ? 377 ALA A CB  1 
ATOM   2840 N N   . VAL A 1 377 ? -7.821  -47.355 5.020   1.00 23.30  ? 378 VAL A N   1 
ATOM   2841 C CA  . VAL A 1 377 ? -7.750  -48.046 6.306   1.00 24.51  ? 378 VAL A CA  1 
ATOM   2842 C C   . VAL A 1 377 ? -8.230  -49.479 6.143   1.00 25.35  ? 378 VAL A C   1 
ATOM   2843 O O   . VAL A 1 377 ? -7.579  -50.430 6.591   1.00 26.50  ? 378 VAL A O   1 
ATOM   2844 C CB  . VAL A 1 377 ? -8.607  -47.376 7.403   1.00 29.56  ? 378 VAL A CB  1 
ATOM   2845 C CG1 . VAL A 1 377 ? -8.476  -48.154 8.695   1.00 22.43  ? 378 VAL A CG1 1 
ATOM   2846 C CG2 . VAL A 1 377 ? -8.202  -45.920 7.611   1.00 25.07  ? 378 VAL A CG2 1 
ATOM   2847 N N   . VAL A 1 378 ? -9.370  -49.615 5.475   1.00 27.05  ? 379 VAL A N   1 
ATOM   2848 C CA  . VAL A 1 378 ? -9.983  -50.909 5.229   1.00 27.71  ? 379 VAL A CA  1 
ATOM   2849 C C   . VAL A 1 378 ? -9.054  -51.823 4.439   1.00 35.59  ? 379 VAL A C   1 
ATOM   2850 O O   . VAL A 1 378 ? -8.974  -53.029 4.700   1.00 36.27  ? 379 VAL A O   1 
ATOM   2851 C CB  . VAL A 1 378 ? -11.326 -50.743 4.495   1.00 33.08  ? 379 VAL A CB  1 
ATOM   2852 C CG1 . VAL A 1 378 ? -11.849 -52.082 4.037   1.00 33.74  ? 379 VAL A CG1 1 
ATOM   2853 C CG2 . VAL A 1 378 ? -12.343 -50.057 5.406   1.00 24.54  ? 379 VAL A CG2 1 
ATOM   2854 N N   . LEU A 1 379 ? -8.336  -51.241 3.484   1.00 29.65  ? 380 LEU A N   1 
ATOM   2855 C CA  . LEU A 1 379 ? -7.359  -51.992 2.702   1.00 27.68  ? 380 LEU A CA  1 
ATOM   2856 C C   . LEU A 1 379 ? -6.254  -52.540 3.585   1.00 35.62  ? 380 LEU A C   1 
ATOM   2857 O O   . LEU A 1 379 ? -5.924  -53.729 3.517   1.00 36.10  ? 380 LEU A O   1 
ATOM   2858 C CB  . LEU A 1 379 ? -6.737  -51.112 1.602   1.00 31.27  ? 380 LEU A CB  1 
ATOM   2859 C CG  . LEU A 1 379 ? -5.400  -51.597 1.019   1.00 30.44  ? 380 LEU A CG  1 
ATOM   2860 C CD1 . LEU A 1 379 ? -5.590  -52.777 0.069   1.00 28.32  ? 380 LEU A CD1 1 
ATOM   2861 C CD2 . LEU A 1 379 ? -4.636  -50.466 0.338   1.00 32.04  ? 380 LEU A CD2 1 
ATOM   2862 N N   A HIS A 1 380 ? -5.678  -51.669 4.408   0.56 27.75  ? 381 HIS A N   1 
ATOM   2863 N N   B HIS A 1 380 ? -5.674  -51.682 4.421   0.44 27.89  ? 381 HIS A N   1 
ATOM   2864 C CA  A HIS A 1 380 ? -4.538  -52.057 5.219   0.56 31.05  ? 381 HIS A CA  1 
ATOM   2865 C CA  B HIS A 1 380 ? -4.516  -52.090 5.208   0.44 31.04  ? 381 HIS A CA  1 
ATOM   2866 C C   A HIS A 1 380 ? -4.918  -53.130 6.237   0.56 30.21  ? 381 HIS A C   1 
ATOM   2867 C C   B HIS A 1 380 ? -4.854  -53.027 6.364   0.44 30.21  ? 381 HIS A C   1 
ATOM   2868 O O   A HIS A 1 380 ? -4.173  -54.085 6.445   0.56 30.08  ? 381 HIS A O   1 
ATOM   2869 O O   B HIS A 1 380 ? -4.003  -53.796 6.805   0.44 31.29  ? 381 HIS A O   1 
ATOM   2870 C CB  A HIS A 1 380 ? -3.936  -50.840 5.922   0.56 28.60  ? 381 HIS A CB  1 
ATOM   2871 C CB  B HIS A 1 380 ? -3.712  -50.876 5.688   0.44 28.48  ? 381 HIS A CB  1 
ATOM   2872 C CG  A HIS A 1 380 ? -2.625  -51.118 6.584   0.56 30.09  ? 381 HIS A CG  1 
ATOM   2873 C CG  B HIS A 1 380 ? -2.961  -50.194 4.589   0.44 32.09  ? 381 HIS A CG  1 
ATOM   2874 N ND1 A HIS A 1 380 ? -1.421  -51.018 5.918   0.56 23.88  ? 381 HIS A ND1 1 
ATOM   2875 N ND1 B HIS A 1 380 ? -3.478  -49.127 3.885   0.44 32.43  ? 381 HIS A ND1 1 
ATOM   2876 C CD2 A HIS A 1 380 ? -2.326  -51.508 7.849   0.56 33.66  ? 381 HIS A CD2 1 
ATOM   2877 C CD2 B HIS A 1 380 ? -1.750  -50.455 4.043   0.44 30.70  ? 381 HIS A CD2 1 
ATOM   2878 C CE1 A HIS A 1 380 ? -0.438  -51.326 6.747   0.56 35.01  ? 381 HIS A CE1 1 
ATOM   2879 C CE1 B HIS A 1 380 ? -2.609  -48.749 2.964   0.44 30.88  ? 381 HIS A CE1 1 
ATOM   2880 N NE2 A HIS A 1 380 ? -0.960  -51.629 7.924   0.56 39.06  ? 381 HIS A NE2 1 
ATOM   2881 N NE2 B HIS A 1 380 ? -1.554  -49.540 3.038   0.44 29.76  ? 381 HIS A NE2 1 
ATOM   2882 N N   . TYR A 1 381 ? -6.094  -52.981 6.840   1.00 29.95  ? 382 TYR A N   1 
ATOM   2883 C CA  . TYR A 1 381 ? -6.494  -53.818 7.976   1.00 29.83  ? 382 TYR A CA  1 
ATOM   2884 C C   . TYR A 1 381 ? -7.341  -55.036 7.627   1.00 34.91  ? 382 TYR A C   1 
ATOM   2885 O O   . TYR A 1 381 ? -7.786  -55.771 8.509   1.00 32.84  ? 382 TYR A O   1 
ATOM   2886 C CB  . TYR A 1 381 ? -7.162  -52.972 9.066   1.00 27.10  ? 382 TYR A CB  1 
ATOM   2887 C CG  . TYR A 1 381 ? -6.152  -52.164 9.846   1.00 32.79  ? 382 TYR A CG  1 
ATOM   2888 C CD1 . TYR A 1 381 ? -5.628  -52.642 11.044  1.00 23.78  ? 382 TYR A CD1 1 
ATOM   2889 C CD2 . TYR A 1 381 ? -5.697  -50.934 9.366   1.00 28.46  ? 382 TYR A CD2 1 
ATOM   2890 C CE1 . TYR A 1 381 ? -4.682  -51.912 11.755  1.00 22.98  ? 382 TYR A CE1 1 
ATOM   2891 C CE2 . TYR A 1 381 ? -4.749  -50.199 10.064  1.00 29.50  ? 382 TYR A CE2 1 
ATOM   2892 C CZ  . TYR A 1 381 ? -4.249  -50.697 11.266  1.00 31.05  ? 382 TYR A CZ  1 
ATOM   2893 O OH  . TYR A 1 381 ? -3.309  -49.981 11.964  1.00 29.39  ? 382 TYR A OH  1 
ATOM   2894 N N   . THR A 1 382 ? -7.553  -55.263 6.338   1.00 37.83  ? 383 THR A N   1 
ATOM   2895 C CA  . THR A 1 382 ? -8.258  -56.458 5.916   1.00 26.02  ? 383 THR A CA  1 
ATOM   2896 C C   . THR A 1 382 ? -7.254  -57.538 5.558   1.00 27.54  ? 383 THR A C   1 
ATOM   2897 O O   . THR A 1 382 ? -6.303  -57.279 4.823   1.00 32.56  ? 383 THR A O   1 
ATOM   2898 C CB  . THR A 1 382 ? -9.148  -56.168 4.708   1.00 30.45  ? 383 THR A CB  1 
ATOM   2899 O OG1 . THR A 1 382 ? -10.190 -55.259 5.092   1.00 29.37  ? 383 THR A OG1 1 
ATOM   2900 C CG2 . THR A 1 382 ? -9.761  -57.453 4.165   1.00 28.76  ? 383 THR A CG2 1 
ATOM   2901 N N   . ASP A 1 383 ? -7.442  -58.737 6.103   1.00 25.85  ? 384 ASP A N   1 
ATOM   2902 C CA  . ASP A 1 383 ? -6.781  -59.922 5.563   1.00 27.26  ? 384 ASP A CA  1 
ATOM   2903 C C   . ASP A 1 383 ? -7.605  -60.389 4.355   1.00 33.72  ? 384 ASP A C   1 
ATOM   2904 O O   . ASP A 1 383 ? -8.712  -60.902 4.506   1.00 28.74  ? 384 ASP A O   1 
ATOM   2905 C CB  . ASP A 1 383 ? -6.707  -61.020 6.617   1.00 31.52  ? 384 ASP A CB  1 
ATOM   2906 C CG  . ASP A 1 383 ? -6.007  -62.278 6.120   1.00 37.94  ? 384 ASP A CG  1 
ATOM   2907 O OD1 . ASP A 1 383 ? -5.976  -62.527 4.896   1.00 40.97  ? 384 ASP A OD1 1 
ATOM   2908 O OD2 . ASP A 1 383 ? -5.486  -63.034 6.971   1.00 34.80  ? 384 ASP A OD2 1 
ATOM   2909 N N   . TRP A 1 384 ? -7.063  -60.226 3.155   1.00 29.31  ? 385 TRP A N   1 
ATOM   2910 C CA  . TRP A 1 384 ? -7.837  -60.520 1.949   1.00 34.33  ? 385 TRP A CA  1 
ATOM   2911 C C   . TRP A 1 384 ? -7.929  -62.008 1.619   1.00 36.69  ? 385 TRP A C   1 
ATOM   2912 O O   . TRP A 1 384 ? -8.593  -62.401 0.651   1.00 34.88  ? 385 TRP A O   1 
ATOM   2913 C CB  . TRP A 1 384 ? -7.339  -59.692 0.764   1.00 25.38  ? 385 TRP A CB  1 
ATOM   2914 C CG  . TRP A 1 384 ? -7.530  -58.234 1.015   1.00 25.99  ? 385 TRP A CG  1 
ATOM   2915 C CD1 . TRP A 1 384 ? -6.603  -57.353 1.497   1.00 27.42  ? 385 TRP A CD1 1 
ATOM   2916 C CD2 . TRP A 1 384 ? -8.742  -57.492 0.850   1.00 25.72  ? 385 TRP A CD2 1 
ATOM   2917 N NE1 . TRP A 1 384 ? -7.160  -56.099 1.621   1.00 27.22  ? 385 TRP A NE1 1 
ATOM   2918 C CE2 . TRP A 1 384 ? -8.469  -56.156 1.225   1.00 25.85  ? 385 TRP A CE2 1 
ATOM   2919 C CE3 . TRP A 1 384 ? -10.026 -57.822 0.411   1.00 21.86  ? 385 TRP A CE3 1 
ATOM   2920 C CZ2 . TRP A 1 384 ? -9.435  -55.153 1.170   1.00 23.15  ? 385 TRP A CZ2 1 
ATOM   2921 C CZ3 . TRP A 1 384 ? -10.986 -56.821 0.351   1.00 22.84  ? 385 TRP A CZ3 1 
ATOM   2922 C CH2 . TRP A 1 384 ? -10.686 -55.502 0.732   1.00 26.04  ? 385 TRP A CH2 1 
ATOM   2923 N N   . LEU A 1 385 ? -7.269  -62.829 2.431   1.00 26.06  ? 386 LEU A N   1 
ATOM   2924 C CA  . LEU A 1 385 ? -7.513  -64.268 2.414   1.00 35.22  ? 386 LEU A CA  1 
ATOM   2925 C C   . LEU A 1 385 ? -8.677  -64.649 3.335   1.00 43.12  ? 386 LEU A C   1 
ATOM   2926 O O   . LEU A 1 385 ? -9.287  -65.705 3.168   1.00 38.73  ? 386 LEU A O   1 
ATOM   2927 C CB  . LEU A 1 385 ? -6.252  -65.042 2.797   1.00 36.03  ? 386 LEU A CB  1 
ATOM   2928 C CG  . LEU A 1 385 ? -5.180  -65.032 1.706   1.00 40.34  ? 386 LEU A CG  1 
ATOM   2929 C CD1 . LEU A 1 385 ? -3.895  -65.685 2.185   1.00 39.60  ? 386 LEU A CD1 1 
ATOM   2930 C CD2 . LEU A 1 385 ? -5.722  -65.729 0.486   1.00 35.47  ? 386 LEU A CD2 1 
ATOM   2931 N N   . HIS A 1 386 ? -8.979  -63.786 4.306   1.00 45.14  ? 387 HIS A N   1 
ATOM   2932 C CA  . HIS A 1 386 ? -10.060 -64.038 5.262   1.00 40.29  ? 387 HIS A CA  1 
ATOM   2933 C C   . HIS A 1 386 ? -10.861 -62.773 5.518   1.00 35.80  ? 387 HIS A C   1 
ATOM   2934 O O   . HIS A 1 386 ? -10.943 -62.315 6.656   1.00 39.61  ? 387 HIS A O   1 
ATOM   2935 C CB  . HIS A 1 386 ? -9.493  -64.530 6.597   1.00 28.73  ? 387 HIS A CB  1 
ATOM   2936 C CG  . HIS A 1 386 ? -8.607  -65.725 6.476   1.00 34.54  ? 387 HIS A CG  1 
ATOM   2937 N ND1 . HIS A 1 386 ? -9.098  -67.012 6.411   1.00 33.60  ? 387 HIS A ND1 1 
ATOM   2938 C CD2 . HIS A 1 386 ? -7.258  -65.831 6.414   1.00 40.41  ? 387 HIS A CD2 1 
ATOM   2939 C CE1 . HIS A 1 386 ? -8.090  -67.860 6.308   1.00 36.78  ? 387 HIS A CE1 1 
ATOM   2940 N NE2 . HIS A 1 386 ? -6.962  -67.169 6.306   1.00 41.38  ? 387 HIS A NE2 1 
ATOM   2941 N N   . PRO A 1 387 ? -11.462 -62.200 4.468   1.00 42.36  ? 388 PRO A N   1 
ATOM   2942 C CA  . PRO A 1 387 ? -12.031 -60.856 4.633   1.00 34.99  ? 388 PRO A CA  1 
ATOM   2943 C C   . PRO A 1 387 ? -13.231 -60.781 5.573   1.00 35.98  ? 388 PRO A C   1 
ATOM   2944 O O   . PRO A 1 387 ? -13.591 -59.673 5.982   1.00 36.73  ? 388 PRO A O   1 
ATOM   2945 C CB  . PRO A 1 387 ? -12.450 -60.475 3.205   1.00 33.17  ? 388 PRO A CB  1 
ATOM   2946 C CG  . PRO A 1 387 ? -12.658 -61.785 2.507   1.00 29.01  ? 388 PRO A CG  1 
ATOM   2947 C CD  . PRO A 1 387 ? -11.663 -62.733 3.105   1.00 36.58  ? 388 PRO A CD  1 
ATOM   2948 N N   . GLU A 1 388 ? -13.824 -61.923 5.921   1.00 35.47  ? 389 GLU A N   1 
ATOM   2949 C CA  . GLU A 1 388 ? -15.105 -61.925 6.634   1.00 36.69  ? 389 GLU A CA  1 
ATOM   2950 C C   . GLU A 1 388 ? -15.104 -62.673 7.966   1.00 36.57  ? 389 GLU A C   1 
ATOM   2951 O O   . GLU A 1 388 ? -16.147 -62.816 8.594   1.00 35.27  ? 389 GLU A O   1 
ATOM   2952 C CB  . GLU A 1 388 ? -16.205 -62.492 5.737   1.00 29.70  ? 389 GLU A CB  1 
ATOM   2953 C CG  . GLU A 1 388 ? -16.254 -61.855 4.363   1.00 47.23  ? 389 GLU A CG  1 
ATOM   2954 C CD  . GLU A 1 388 ? -17.660 -61.528 3.924   1.00 63.45  ? 389 GLU A CD  1 
ATOM   2955 O OE1 . GLU A 1 388 ? -18.614 -62.004 4.574   1.00 68.50  ? 389 GLU A OE1 1 
ATOM   2956 O OE2 . GLU A 1 388 ? -17.808 -60.784 2.931   1.00 82.31  ? 389 GLU A OE2 1 
ATOM   2957 N N   . ASP A 1 389 ? -13.941 -63.154 8.388   1.00 30.77  ? 390 ASP A N   1 
ATOM   2958 C CA  . ASP A 1 389 ? -13.826 -63.883 9.638   1.00 37.94  ? 390 ASP A CA  1 
ATOM   2959 C C   . ASP A 1 389 ? -14.010 -62.955 10.855  1.00 37.90  ? 390 ASP A C   1 
ATOM   2960 O O   . ASP A 1 389 ? -13.188 -62.074 11.106  1.00 33.43  ? 390 ASP A O   1 
ATOM   2961 C CB  . ASP A 1 389 ? -12.477 -64.598 9.683   1.00 31.90  ? 390 ASP A CB  1 
ATOM   2962 C CG  . ASP A 1 389 ? -12.191 -65.213 11.033  1.00 46.34  ? 390 ASP A CG  1 
ATOM   2963 O OD1 . ASP A 1 389 ? -13.157 -65.491 11.773  1.00 58.65  ? 390 ASP A OD1 1 
ATOM   2964 O OD2 . ASP A 1 389 ? -11.001 -65.423 11.356  1.00 54.44  ? 390 ASP A OD2 1 
ATOM   2965 N N   . PRO A 1 390 ? -15.098 -63.162 11.612  1.00 45.61  ? 391 PRO A N   1 
ATOM   2966 C CA  . PRO A 1 390 ? -15.464 -62.329 12.772  1.00 40.75  ? 391 PRO A CA  1 
ATOM   2967 C C   . PRO A 1 390 ? -14.328 -62.105 13.777  1.00 32.22  ? 391 PRO A C   1 
ATOM   2968 O O   . PRO A 1 390 ? -14.043 -60.958 14.128  1.00 31.27  ? 391 PRO A O   1 
ATOM   2969 C CB  . PRO A 1 390 ? -16.616 -63.112 13.407  1.00 40.68  ? 391 PRO A CB  1 
ATOM   2970 C CG  . PRO A 1 390 ? -17.266 -63.793 12.221  1.00 40.89  ? 391 PRO A CG  1 
ATOM   2971 C CD  . PRO A 1 390 ? -16.097 -64.216 11.358  1.00 37.51  ? 391 PRO A CD  1 
ATOM   2972 N N   . ALA A 1 391 ? -13.674 -63.173 14.212  1.00 27.63  ? 392 ALA A N   1 
ATOM   2973 C CA  . ALA A 1 391 ? -12.552 -63.035 15.133  1.00 36.90  ? 392 ALA A CA  1 
ATOM   2974 C C   . ALA A 1 391 ? -11.454 -62.107 14.592  1.00 41.21  ? 392 ALA A C   1 
ATOM   2975 O O   . ALA A 1 391 ? -10.934 -61.260 15.319  1.00 36.26  ? 392 ALA A O   1 
ATOM   2976 C CB  . ALA A 1 391 ? -11.981 -64.391 15.489  1.00 33.58  ? 392 ALA A CB  1 
ATOM   2977 N N   . ARG A 1 392 ? -11.112 -62.261 13.318  1.00 38.48  ? 393 ARG A N   1 
ATOM   2978 C CA  . ARG A 1 392 ? -10.084 -61.421 12.713  1.00 29.54  ? 393 ARG A CA  1 
ATOM   2979 C C   . ARG A 1 392 ? -10.562 -59.980 12.548  1.00 27.72  ? 393 ARG A C   1 
ATOM   2980 O O   . ARG A 1 392 ? -9.785  -59.045 12.710  1.00 30.22  ? 393 ARG A O   1 
ATOM   2981 C CB  . ARG A 1 392 ? -9.641  -61.997 11.370  1.00 34.67  ? 393 ARG A CB  1 
ATOM   2982 C CG  . ARG A 1 392 ? -8.722  -63.212 11.478  1.00 36.45  ? 393 ARG A CG  1 
ATOM   2983 C CD  . ARG A 1 392 ? -8.409  -63.731 10.080  1.00 34.88  ? 393 ARG A CD  1 
ATOM   2984 N NE  . ARG A 1 392 ? -7.322  -64.705 10.055  1.00 40.14  ? 393 ARG A NE  1 
ATOM   2985 C CZ  . ARG A 1 392 ? -7.505  -66.014 9.907   1.00 41.72  ? 393 ARG A CZ  1 
ATOM   2986 N NH1 . ARG A 1 392 ? -8.732  -66.501 9.779   1.00 39.42  ? 393 ARG A NH1 1 
ATOM   2987 N NH2 . ARG A 1 392 ? -6.466  -66.834 9.882   1.00 35.22  ? 393 ARG A NH2 1 
ATOM   2988 N N   . LEU A 1 393 ? -11.840 -59.808 12.221  1.00 24.95  ? 394 LEU A N   1 
ATOM   2989 C CA  . LEU A 1 393 ? -12.438 -58.480 12.104  1.00 28.88  ? 394 LEU A CA  1 
ATOM   2990 C C   . LEU A 1 393 ? -12.454 -57.734 13.444  1.00 38.69  ? 394 LEU A C   1 
ATOM   2991 O O   . LEU A 1 393 ? -12.273 -56.516 13.491  1.00 31.15  ? 394 LEU A O   1 
ATOM   2992 C CB  . LEU A 1 393 ? -13.855 -58.587 11.552  1.00 24.40  ? 394 LEU A CB  1 
ATOM   2993 C CG  . LEU A 1 393 ? -13.933 -59.017 10.086  1.00 44.27  ? 394 LEU A CG  1 
ATOM   2994 C CD1 . LEU A 1 393 ? -15.355 -59.427 9.719   1.00 28.75  ? 394 LEU A CD1 1 
ATOM   2995 C CD2 . LEU A 1 393 ? -13.446 -57.890 9.185   1.00 27.07  ? 394 LEU A CD2 1 
ATOM   2996 N N   . ARG A 1 394 ? -12.681 -58.472 14.526  1.00 33.37  ? 395 ARG A N   1 
ATOM   2997 C CA  . ARG A 1 394 ? -12.654 -57.900 15.862  1.00 33.15  ? 395 ARG A CA  1 
ATOM   2998 C C   . ARG A 1 394 ? -11.241 -57.422 16.216  1.00 32.07  ? 395 ARG A C   1 
ATOM   2999 O O   . ARG A 1 394 ? -11.048 -56.271 16.594  1.00 30.99  ? 395 ARG A O   1 
ATOM   3000 C CB  . ARG A 1 394 ? -13.138 -58.928 16.885  1.00 35.87  ? 395 ARG A CB  1 
ATOM   3001 C CG  . ARG A 1 394 ? -13.213 -58.426 18.324  1.00 32.59  ? 395 ARG A CG  1 
ATOM   3002 C CD  . ARG A 1 394 ? -13.512 -59.586 19.234  1.00 28.79  ? 395 ARG A CD  1 
ATOM   3003 N NE  . ARG A 1 394 ? -12.432 -60.564 19.197  1.00 37.21  ? 395 ARG A NE  1 
ATOM   3004 C CZ  . ARG A 1 394 ? -12.550 -61.819 19.617  1.00 43.08  ? 395 ARG A CZ  1 
ATOM   3005 N NH1 . ARG A 1 394 ? -13.711 -62.256 20.091  1.00 39.27  ? 395 ARG A NH1 1 
ATOM   3006 N NH2 . ARG A 1 394 ? -11.508 -62.638 19.565  1.00 34.18  ? 395 ARG A NH2 1 
ATOM   3007 N N   . GLU A 1 395 ? -10.261 -58.310 16.087  1.00 34.47  ? 396 GLU A N   1 
ATOM   3008 C CA  . GLU A 1 395 ? -8.866  -57.949 16.318  1.00 37.55  ? 396 GLU A CA  1 
ATOM   3009 C C   . GLU A 1 395 ? -8.433  -56.780 15.433  1.00 34.89  ? 396 GLU A C   1 
ATOM   3010 O O   . GLU A 1 395 ? -7.750  -55.872 15.895  1.00 38.11  ? 396 GLU A O   1 
ATOM   3011 C CB  . GLU A 1 395 ? -7.946  -59.153 16.100  1.00 30.10  ? 396 GLU A CB  1 
ATOM   3012 C CG  . GLU A 1 395 ? -7.550  -59.906 17.368  1.00 44.51  ? 396 GLU A CG  1 
ATOM   3013 C CD  . GLU A 1 395 ? -8.730  -60.217 18.301  1.00 72.28  ? 396 GLU A CD  1 
ATOM   3014 O OE1 . GLU A 1 395 ? -8.964  -59.442 19.269  1.00 68.64  ? 396 GLU A OE1 1 
ATOM   3015 O OE2 . GLU A 1 395 ? -9.407  -61.249 18.078  1.00 56.16  ? 396 GLU A OE2 1 
ATOM   3016 N N   . ALA A 1 396 ? -8.853  -56.780 14.172  1.00 33.24  ? 397 ALA A N   1 
ATOM   3017 C CA  . ALA A 1 396 ? -8.406  -55.739 13.256  1.00 34.49  ? 397 ALA A CA  1 
ATOM   3018 C C   . ALA A 1 396 ? -8.984  -54.378 13.629  1.00 27.40  ? 397 ALA A C   1 
ATOM   3019 O O   . ALA A 1 396 ? -8.282  -53.378 13.591  1.00 27.97  ? 397 ALA A O   1 
ATOM   3020 C CB  . ALA A 1 396 ? -8.732  -56.095 11.797  1.00 25.80  ? 397 ALA A CB  1 
ATOM   3021 N N   . LEU A 1 397 ? -10.260 -54.336 13.988  1.00 20.59  ? 398 LEU A N   1 
ATOM   3022 C CA  . LEU A 1 397 ? -10.866 -53.068 14.361  1.00 29.05  ? 398 LEU A CA  1 
ATOM   3023 C C   . LEU A 1 397 ? -10.250 -52.534 15.670  1.00 36.01  ? 398 LEU A C   1 
ATOM   3024 O O   . LEU A 1 397 ? -10.057 -51.328 15.838  1.00 36.12  ? 398 LEU A O   1 
ATOM   3025 C CB  . LEU A 1 397 ? -12.377 -53.200 14.485  1.00 23.67  ? 398 LEU A CB  1 
ATOM   3026 C CG  . LEU A 1 397 ? -13.030 -51.841 14.700  1.00 30.45  ? 398 LEU A CG  1 
ATOM   3027 C CD1 . LEU A 1 397 ? -12.783 -50.947 13.494  1.00 21.76  ? 398 LEU A CD1 1 
ATOM   3028 C CD2 . LEU A 1 397 ? -14.510 -51.997 14.981  1.00 39.61  ? 398 LEU A CD2 1 
ATOM   3029 N N   . SER A 1 398 ? -9.925  -53.441 16.582  1.00 24.32  ? 399 SER A N   1 
ATOM   3030 C CA  . SER A 1 398 ? -9.173  -53.085 17.775  1.00 32.75  ? 399 SER A CA  1 
ATOM   3031 C C   . SER A 1 398 ? -7.828  -52.466 17.374  1.00 29.08  ? 399 SER A C   1 
ATOM   3032 O O   . SER A 1 398 ? -7.435  -51.428 17.907  1.00 32.28  ? 399 SER A O   1 
ATOM   3033 C CB  . SER A 1 398 ? -8.983  -54.320 18.666  1.00 27.33  ? 399 SER A CB  1 
ATOM   3034 O OG  . SER A 1 398 ? -8.005  -54.100 19.671  1.00 39.59  ? 399 SER A OG  1 
ATOM   3035 N N   . ASP A 1 399 ? -7.144  -53.096 16.420  1.00 29.80  ? 400 ASP A N   1 
ATOM   3036 C CA  . ASP A 1 399 ? -5.884  -52.572 15.877  1.00 28.00  ? 400 ASP A CA  1 
ATOM   3037 C C   . ASP A 1 399 ? -6.044  -51.195 15.246  1.00 27.67  ? 400 ASP A C   1 
ATOM   3038 O O   . ASP A 1 399 ? -5.222  -50.308 15.457  1.00 25.62  ? 400 ASP A O   1 
ATOM   3039 C CB  . ASP A 1 399 ? -5.288  -53.523 14.838  1.00 27.52  ? 400 ASP A CB  1 
ATOM   3040 C CG  . ASP A 1 399 ? -4.684  -54.771 15.457  1.00 35.51  ? 400 ASP A CG  1 
ATOM   3041 O OD1 . ASP A 1 399 ? -4.412  -54.771 16.679  1.00 32.03  ? 400 ASP A OD1 1 
ATOM   3042 O OD2 . ASP A 1 399 ? -4.468  -55.752 14.709  1.00 49.04  ? 400 ASP A OD2 1 
ATOM   3043 N N   . VAL A 1 400 ? -7.105  -51.006 14.473  1.00 24.79  ? 401 VAL A N   1 
ATOM   3044 C CA  . VAL A 1 400 ? -7.338  -49.702 13.868  1.00 29.23  ? 401 VAL A CA  1 
ATOM   3045 C C   . VAL A 1 400 ? -7.396  -48.617 14.944  1.00 26.30  ? 401 VAL A C   1 
ATOM   3046 O O   . VAL A 1 400 ? -6.615  -47.670 14.922  1.00 28.00  ? 401 VAL A O   1 
ATOM   3047 C CB  . VAL A 1 400 ? -8.627  -49.672 13.013  1.00 25.57  ? 401 VAL A CB  1 
ATOM   3048 C CG1 . VAL A 1 400 ? -8.925  -48.250 12.571  1.00 20.59  ? 401 VAL A CG1 1 
ATOM   3049 C CG2 . VAL A 1 400 ? -8.479  -50.596 11.803  1.00 21.65  ? 401 VAL A CG2 1 
ATOM   3050 N N   . VAL A 1 401 ? -8.307  -48.784 15.898  1.00 30.27  ? 402 VAL A N   1 
ATOM   3051 C CA  . VAL A 1 401 ? -8.531  -47.796 16.936  1.00 25.70  ? 402 VAL A CA  1 
ATOM   3052 C C   . VAL A 1 401 ? -7.283  -47.565 17.791  1.00 32.24  ? 402 VAL A C   1 
ATOM   3053 O O   . VAL A 1 401 ? -6.942  -46.421 18.106  1.00 26.85  ? 402 VAL A O   1 
ATOM   3054 C CB  . VAL A 1 401 ? -9.743  -48.180 17.815  1.00 34.10  ? 402 VAL A CB  1 
ATOM   3055 C CG1 . VAL A 1 401 ? -9.799  -47.309 19.060  1.00 24.38  ? 402 VAL A CG1 1 
ATOM   3056 C CG2 . VAL A 1 401 ? -11.023 -48.045 17.012  1.00 28.23  ? 402 VAL A CG2 1 
ATOM   3057 N N   . GLY A 1 402 ? -6.588  -48.646 18.133  1.00 23.94  ? 403 GLY A N   1 
ATOM   3058 C CA  . GLY A 1 402 ? -5.390  -48.545 18.950  1.00 26.28  ? 403 GLY A CA  1 
ATOM   3059 C C   . GLY A 1 402 ? -4.153  -48.013 18.248  1.00 26.53  ? 403 GLY A C   1 
ATOM   3060 O O   . GLY A 1 402 ? -3.353  -47.294 18.860  1.00 24.49  ? 403 GLY A O   1 
ATOM   3061 N N   . ASP A 1 403 ? -3.982  -48.370 16.971  1.00 26.13  ? 404 ASP A N   1 
ATOM   3062 C CA  . ASP A 1 403 ? -2.832  -47.910 16.198  1.00 21.49  ? 404 ASP A CA  1 
ATOM   3063 C C   . ASP A 1 403 ? -2.996  -46.425 15.901  1.00 25.31  ? 404 ASP A C   1 
ATOM   3064 O O   . ASP A 1 403 ? -2.085  -45.623 16.108  1.00 24.65  ? 404 ASP A O   1 
ATOM   3065 C CB  . ASP A 1 403 ? -2.693  -48.690 14.879  1.00 23.74  ? 404 ASP A CB  1 
ATOM   3066 C CG  . ASP A 1 403 ? -2.427  -50.174 15.089  1.00 25.65  ? 404 ASP A CG  1 
ATOM   3067 O OD1 . ASP A 1 403 ? -2.014  -50.580 16.205  1.00 25.69  ? 404 ASP A OD1 1 
ATOM   3068 O OD2 . ASP A 1 403 ? -2.648  -50.947 14.131  1.00 26.63  ? 404 ASP A OD2 1 
ATOM   3069 N N   . HIS A 1 404 ? -4.181  -46.066 15.430  1.00 21.42  ? 405 HIS A N   1 
ATOM   3070 C CA  . HIS A 1 404 ? -4.483  -44.691 15.068  1.00 28.05  ? 405 HIS A CA  1 
ATOM   3071 C C   . HIS A 1 404 ? -4.389  -43.757 16.280  1.00 24.20  ? 405 HIS A C   1 
ATOM   3072 O O   . HIS A 1 404 ? -3.789  -42.683 16.210  1.00 26.53  ? 405 HIS A O   1 
ATOM   3073 C CB  . HIS A 1 404 ? -5.875  -44.641 14.438  1.00 23.27  ? 405 HIS A CB  1 
ATOM   3074 C CG  . HIS A 1 404 ? -6.362  -43.264 14.124  1.00 22.48  ? 405 HIS A CG  1 
ATOM   3075 N ND1 . HIS A 1 404 ? -5.599  -42.341 13.445  1.00 29.70  ? 405 HIS A ND1 1 
ATOM   3076 C CD2 . HIS A 1 404 ? -7.547  -42.658 14.386  1.00 29.35  ? 405 HIS A CD2 1 
ATOM   3077 C CE1 . HIS A 1 404 ? -6.295  -41.226 13.294  1.00 28.89  ? 405 HIS A CE1 1 
ATOM   3078 N NE2 . HIS A 1 404 ? -7.478  -41.391 13.861  1.00 35.24  ? 405 HIS A NE2 1 
ATOM   3079 N N   . ASN A 1 405 ? -4.959  -44.174 17.400  1.00 26.01  ? 406 ASN A N   1 
ATOM   3080 C CA  . ASN A 1 405 ? -5.042  -43.280 18.550  1.00 23.67  ? 406 ASN A CA  1 
ATOM   3081 C C   . ASN A 1 405 ? -3.857  -43.316 19.500  1.00 24.01  ? 406 ASN A C   1 
ATOM   3082 O O   . ASN A 1 405 ? -3.549  -42.302 20.105  1.00 25.32  ? 406 ASN A O   1 
ATOM   3083 C CB  . ASN A 1 405 ? -6.343  -43.485 19.317  1.00 18.72  ? 406 ASN A CB  1 
ATOM   3084 C CG  . ASN A 1 405 ? -7.547  -43.039 18.528  1.00 25.88  ? 406 ASN A CG  1 
ATOM   3085 O OD1 . ASN A 1 405 ? -7.752  -41.843 18.304  1.00 25.82  ? 406 ASN A OD1 1 
ATOM   3086 N ND2 . ASN A 1 405 ? -8.347  -44.000 18.087  1.00 23.61  ? 406 ASN A ND2 1 
ATOM   3087 N N   . VAL A 1 406 ? -3.184  -44.460 19.616  1.00 23.90  ? 407 VAL A N   1 
ATOM   3088 C CA  . VAL A 1 406 ? -2.139  -44.606 20.628  1.00 21.29  ? 407 VAL A CA  1 
ATOM   3089 C C   . VAL A 1 406 ? -0.776  -45.084 20.125  1.00 28.00  ? 407 VAL A C   1 
ATOM   3090 O O   . VAL A 1 406 ? 0.223   -44.372 20.259  1.00 24.42  ? 407 VAL A O   1 
ATOM   3091 C CB  . VAL A 1 406 ? -2.582  -45.555 21.765  1.00 29.33  ? 407 VAL A CB  1 
ATOM   3092 C CG1 . VAL A 1 406 ? -1.456  -45.725 22.789  1.00 20.15  ? 407 VAL A CG1 1 
ATOM   3093 C CG2 . VAL A 1 406 ? -3.843  -45.037 22.419  1.00 22.25  ? 407 VAL A CG2 1 
ATOM   3094 N N   . VAL A 1 407 ? -0.727  -46.295 19.578  1.00 21.49  ? 408 VAL A N   1 
ATOM   3095 C CA  . VAL A 1 407 ? 0.556   -46.903 19.223  1.00 21.33  ? 408 VAL A CA  1 
ATOM   3096 C C   . VAL A 1 407 ? 1.350   -46.037 18.239  1.00 27.78  ? 408 VAL A C   1 
ATOM   3097 O O   . VAL A 1 407 ? 2.538   -45.748 18.443  1.00 25.28  ? 408 VAL A O   1 
ATOM   3098 C CB  . VAL A 1 407 ? 0.387   -48.333 18.638  1.00 26.13  ? 408 VAL A CB  1 
ATOM   3099 C CG1 . VAL A 1 407 ? 1.748   -48.936 18.319  1.00 22.28  ? 408 VAL A CG1 1 
ATOM   3100 C CG2 . VAL A 1 407 ? -0.390  -49.233 19.604  1.00 16.77  ? 408 VAL A CG2 1 
ATOM   3101 N N   . CYS A 1 408 ? 0.688   -45.595 17.182  1.00 24.08  ? 409 CYS A N   1 
ATOM   3102 C CA  . CYS A 1 408 ? 1.401   -44.858 16.147  1.00 25.59  ? 409 CYS A CA  1 
ATOM   3103 C C   . CYS A 1 408 ? 1.755   -43.421 16.531  1.00 26.10  ? 409 CYS A C   1 
ATOM   3104 O O   . CYS A 1 408 ? 2.848   -42.955 16.196  1.00 28.64  ? 409 CYS A O   1 
ATOM   3105 C CB  . CYS A 1 408 ? 0.675   -44.949 14.803  1.00 24.31  ? 409 CYS A CB  1 
ATOM   3106 S SG  . CYS A 1 408 ? 0.503   -46.666 14.260  1.00 28.46  ? 409 CYS A SG  1 
ATOM   3107 N N   . PRO A 1 409 ? 0.846   -42.711 17.226  1.00 24.43  ? 410 PRO A N   1 
ATOM   3108 C CA  . PRO A 1 409 ? 1.331   -41.438 17.778  1.00 29.60  ? 410 PRO A CA  1 
ATOM   3109 C C   . PRO A 1 409 ? 2.531   -41.631 18.716  1.00 30.23  ? 410 PRO A C   1 
ATOM   3110 O O   . PRO A 1 409 ? 3.451   -40.813 18.671  1.00 26.48  ? 410 PRO A O   1 
ATOM   3111 C CB  . PRO A 1 409 ? 0.122   -40.907 18.547  1.00 21.54  ? 410 PRO A CB  1 
ATOM   3112 C CG  . PRO A 1 409 ? -1.045  -41.459 17.803  1.00 23.50  ? 410 PRO A CG  1 
ATOM   3113 C CD  . PRO A 1 409 ? -0.617  -42.844 17.371  1.00 23.14  ? 410 PRO A CD  1 
ATOM   3114 N N   . VAL A 1 410 ? 2.537   -42.696 19.517  1.00 24.79  ? 411 VAL A N   1 
ATOM   3115 C CA  . VAL A 1 410 ? 3.648   -42.942 20.437  1.00 22.29  ? 411 VAL A CA  1 
ATOM   3116 C C   . VAL A 1 410 ? 4.916   -43.318 19.669  1.00 32.73  ? 411 VAL A C   1 
ATOM   3117 O O   . VAL A 1 410 ? 6.012   -42.854 20.005  1.00 25.14  ? 411 VAL A O   1 
ATOM   3118 C CB  . VAL A 1 410 ? 3.300   -44.016 21.512  1.00 26.66  ? 411 VAL A CB  1 
ATOM   3119 C CG1 . VAL A 1 410 ? 4.555   -44.557 22.196  1.00 21.93  ? 411 VAL A CG1 1 
ATOM   3120 C CG2 . VAL A 1 410 ? 2.352   -43.449 22.541  1.00 17.34  ? 411 VAL A CG2 1 
ATOM   3121 N N   . ALA A 1 411 ? 4.761   -44.134 18.627  1.00 24.83  ? 412 ALA A N   1 
ATOM   3122 C CA  . ALA A 1 411 ? 5.891   -44.517 17.783  1.00 28.60  ? 412 ALA A CA  1 
ATOM   3123 C C   . ALA A 1 411 ? 6.529   -43.299 17.127  1.00 26.49  ? 412 ALA A C   1 
ATOM   3124 O O   . ALA A 1 411 ? 7.756   -43.184 17.038  1.00 26.49  ? 412 ALA A O   1 
ATOM   3125 C CB  . ALA A 1 411 ? 5.460   -45.523 16.725  1.00 30.29  ? 412 ALA A CB  1 
ATOM   3126 N N   . GLN A 1 412 ? 5.695   -42.376 16.682  1.00 26.45  ? 413 GLN A N   1 
ATOM   3127 C CA  . GLN A 1 412 ? 6.206   -41.191 16.023  1.00 25.61  ? 413 GLN A CA  1 
ATOM   3128 C C   . GLN A 1 412 ? 6.971   -40.304 17.003  1.00 37.83  ? 413 GLN A C   1 
ATOM   3129 O O   . GLN A 1 412 ? 8.066   -39.830 16.701  1.00 31.75  ? 413 GLN A O   1 
ATOM   3130 C CB  . GLN A 1 412 ? 5.069   -40.408 15.386  1.00 31.58  ? 413 GLN A CB  1 
ATOM   3131 C CG  . GLN A 1 412 ? 5.488   -39.033 14.944  1.00 36.39  ? 413 GLN A CG  1 
ATOM   3132 C CD  . GLN A 1 412 ? 4.886   -38.653 13.630  1.00 42.29  ? 413 GLN A CD  1 
ATOM   3133 O OE1 . GLN A 1 412 ? 3.711   -38.302 13.555  1.00 53.71  ? 413 GLN A OE1 1 
ATOM   3134 N NE2 . GLN A 1 412 ? 5.687   -38.726 12.570  1.00 56.74  ? 413 GLN A NE2 1 
ATOM   3135 N N   . LEU A 1 413 ? 6.379   -40.074 18.171  1.00 28.54  ? 414 LEU A N   1 
ATOM   3136 C CA  . LEU A 1 413 ? 7.043   -39.331 19.228  1.00 24.68  ? 414 LEU A CA  1 
ATOM   3137 C C   . LEU A 1 413 ? 8.408   -39.954 19.527  1.00 24.05  ? 414 LEU A C   1 
ATOM   3138 O O   . LEU A 1 413 ? 9.429   -39.273 19.509  1.00 27.96  ? 414 LEU A O   1 
ATOM   3139 C CB  . LEU A 1 413 ? 6.180   -39.315 20.495  1.00 24.16  ? 414 LEU A CB  1 
ATOM   3140 C CG  . LEU A 1 413 ? 6.774   -38.607 21.722  1.00 28.64  ? 414 LEU A CG  1 
ATOM   3141 C CD1 . LEU A 1 413 ? 6.831   -37.119 21.491  1.00 37.43  ? 414 LEU A CD1 1 
ATOM   3142 C CD2 . LEU A 1 413 ? 5.942   -38.892 22.936  1.00 30.95  ? 414 LEU A CD2 1 
ATOM   3143 N N   . ALA A 1 414 ? 8.419   -41.256 19.776  1.00 18.64  ? 415 ALA A N   1 
ATOM   3144 C CA  . ALA A 1 414 ? 9.652   -41.968 20.087  1.00 22.30  ? 415 ALA A CA  1 
ATOM   3145 C C   . ALA A 1 414 ? 10.699  -41.827 18.975  1.00 33.04  ? 415 ALA A C   1 
ATOM   3146 O O   . ALA A 1 414 ? 11.860  -41.523 19.246  1.00 32.59  ? 415 ALA A O   1 
ATOM   3147 C CB  . ALA A 1 414 ? 9.358   -43.438 20.363  1.00 23.42  ? 415 ALA A CB  1 
ATOM   3148 N N   . GLY A 1 415 ? 10.278  -42.036 17.729  1.00 28.81  ? 416 GLY A N   1 
ATOM   3149 C CA  . GLY A 1 415 ? 11.176  -41.945 16.595  1.00 22.07  ? 416 GLY A CA  1 
ATOM   3150 C C   . GLY A 1 415 ? 11.781  -40.567 16.408  1.00 25.16  ? 416 GLY A C   1 
ATOM   3151 O O   . GLY A 1 415 ? 12.991  -40.428 16.251  1.00 34.37  ? 416 GLY A O   1 
ATOM   3152 N N   . ARG A 1 416 ? 10.944  -39.539 16.424  1.00 25.74  ? 417 ARG A N   1 
ATOM   3153 C CA  . ARG A 1 416 ? 11.435  -38.180 16.245  1.00 26.28  ? 417 ARG A CA  1 
ATOM   3154 C C   . ARG A 1 416 ? 12.309  -37.738 17.406  1.00 37.34  ? 417 ARG A C   1 
ATOM   3155 O O   . ARG A 1 416 ? 13.360  -37.139 17.191  1.00 42.52  ? 417 ARG A O   1 
ATOM   3156 C CB  . ARG A 1 416 ? 10.283  -37.199 16.057  1.00 32.27  ? 417 ARG A CB  1 
ATOM   3157 C CG  . ARG A 1 416 ? 9.480   -37.428 14.791  1.00 41.95  ? 417 ARG A CG  1 
ATOM   3158 C CD  . ARG A 1 416 ? 10.397  -37.792 13.648  1.00 40.35  ? 417 ARG A CD  1 
ATOM   3159 N NE  . ARG A 1 416 ? 10.036  -37.109 12.414  1.00 74.28  ? 417 ARG A NE  1 
ATOM   3160 C CZ  . ARG A 1 416 ? 10.583  -35.968 12.011  1.00 65.52  ? 417 ARG A CZ  1 
ATOM   3161 N NH1 . ARG A 1 416 ? 11.516  -35.383 12.751  1.00 55.64  ? 417 ARG A NH1 1 
ATOM   3162 N NH2 . ARG A 1 416 ? 10.198  -35.417 10.867  1.00 53.13  ? 417 ARG A NH2 1 
ATOM   3163 N N   . LEU A 1 417 ? 11.880  -38.024 18.633  1.00 31.26  ? 418 LEU A N   1 
ATOM   3164 C CA  . LEU A 1 417 ? 12.680  -37.652 19.795  1.00 30.89  ? 418 LEU A CA  1 
ATOM   3165 C C   . LEU A 1 417 ? 14.055  -38.320 19.741  1.00 28.16  ? 418 LEU A C   1 
ATOM   3166 O O   . LEU A 1 417 ? 15.078  -37.667 19.937  1.00 36.57  ? 418 LEU A O   1 
ATOM   3167 C CB  . LEU A 1 417 ? 11.966  -37.986 21.115  1.00 29.18  ? 418 LEU A CB  1 
ATOM   3168 C CG  . LEU A 1 417 ? 10.688  -37.221 21.494  1.00 37.50  ? 418 LEU A CG  1 
ATOM   3169 C CD1 . LEU A 1 417 ? 10.285  -37.499 22.929  1.00 30.90  ? 418 LEU A CD1 1 
ATOM   3170 C CD2 . LEU A 1 417 ? 10.830  -35.745 21.284  1.00 35.19  ? 418 LEU A CD2 1 
ATOM   3171 N N   . ALA A 1 418 ? 14.077  -39.618 19.467  1.00 22.80  ? 419 ALA A N   1 
ATOM   3172 C CA  . ALA A 1 418 ? 15.337  -40.347 19.399  1.00 33.82  ? 419 ALA A CA  1 
ATOM   3173 C C   . ALA A 1 418 ? 16.245  -39.794 18.305  1.00 40.40  ? 419 ALA A C   1 
ATOM   3174 O O   . ALA A 1 418 ? 17.455  -39.666 18.503  1.00 40.44  ? 419 ALA A O   1 
ATOM   3175 C CB  . ALA A 1 418 ? 15.090  -41.839 19.184  1.00 26.11  ? 419 ALA A CB  1 
ATOM   3176 N N   . ALA A 1 419 ? 15.648  -39.454 17.163  1.00 34.92  ? 420 ALA A N   1 
ATOM   3177 C CA  . ALA A 1 419 ? 16.400  -38.956 16.011  1.00 33.46  ? 420 ALA A CA  1 
ATOM   3178 C C   . ALA A 1 419 ? 16.852  -37.518 16.193  1.00 35.16  ? 420 ALA A C   1 
ATOM   3179 O O   . ALA A 1 419 ? 17.598  -36.998 15.373  1.00 43.08  ? 420 ALA A O   1 
ATOM   3180 C CB  . ALA A 1 419 ? 15.572  -39.078 14.732  1.00 23.04  ? 420 ALA A CB  1 
ATOM   3181 N N   . GLN A 1 420 ? 16.397  -36.868 17.257  1.00 34.81  ? 421 GLN A N   1 
ATOM   3182 C CA  . GLN A 1 420 ? 16.701  -35.454 17.446  1.00 27.84  ? 421 GLN A CA  1 
ATOM   3183 C C   . GLN A 1 420 ? 17.339  -35.161 18.793  1.00 30.94  ? 421 GLN A C   1 
ATOM   3184 O O   . GLN A 1 420 ? 17.213  -34.057 19.334  1.00 35.07  ? 421 GLN A O   1 
ATOM   3185 C CB  . GLN A 1 420 ? 15.452  -34.610 17.217  1.00 28.25  ? 421 GLN A CB  1 
ATOM   3186 C CG  . GLN A 1 420 ? 14.956  -34.767 15.788  1.00 43.45  ? 421 GLN A CG  1 
ATOM   3187 C CD  . GLN A 1 420 ? 13.561  -34.250 15.585  1.00 50.38  ? 421 GLN A CD  1 
ATOM   3188 O OE1 . GLN A 1 420 ? 12.833  -34.746 14.729  1.00 46.28  ? 421 GLN A OE1 1 
ATOM   3189 N NE2 . GLN A 1 420 ? 13.176  -33.245 16.366  1.00 48.20  ? 421 GLN A NE2 1 
ATOM   3190 N N   . GLY A 1 421 ? 18.024  -36.166 19.329  1.00 33.68  ? 422 GLY A N   1 
ATOM   3191 C CA  . GLY A 1 421 ? 18.874  -35.961 20.485  1.00 40.12  ? 422 GLY A CA  1 
ATOM   3192 C C   . GLY A 1 421 ? 18.449  -36.612 21.783  1.00 35.78  ? 422 GLY A C   1 
ATOM   3193 O O   . GLY A 1 421 ? 19.247  -36.699 22.706  1.00 44.11  ? 422 GLY A O   1 
ATOM   3194 N N   . ALA A 1 422 ? 17.202  -37.064 21.863  1.00 39.97  ? 423 ALA A N   1 
ATOM   3195 C CA  . ALA A 1 422 ? 16.686  -37.650 23.096  1.00 34.44  ? 423 ALA A CA  1 
ATOM   3196 C C   . ALA A 1 422 ? 17.157  -39.083 23.217  1.00 34.26  ? 423 ALA A C   1 
ATOM   3197 O O   . ALA A 1 422 ? 17.339  -39.761 22.207  1.00 36.86  ? 423 ALA A O   1 
ATOM   3198 C CB  . ALA A 1 422 ? 15.162  -37.600 23.115  1.00 31.94  ? 423 ALA A CB  1 
ATOM   3199 N N   . ARG A 1 423 ? 17.369  -39.536 24.450  1.00 29.36  ? 424 ARG A N   1 
ATOM   3200 C CA  . ARG A 1 423 ? 17.553  -40.960 24.712  1.00 32.45  ? 424 ARG A CA  1 
ATOM   3201 C C   . ARG A 1 423 ? 16.202  -41.535 25.117  1.00 32.79  ? 424 ARG A C   1 
ATOM   3202 O O   . ARG A 1 423 ? 15.622  -41.135 26.130  1.00 35.39  ? 424 ARG A O   1 
ATOM   3203 C CB  . ARG A 1 423 ? 18.584  -41.209 25.820  1.00 29.51  ? 424 ARG A CB  1 
ATOM   3204 C CG  . ARG A 1 423 ? 18.976  -42.684 25.939  1.00 32.68  ? 424 ARG A CG  1 
ATOM   3205 C CD  . ARG A 1 423 ? 20.309  -42.885 26.656  1.00 47.08  ? 424 ARG A CD  1 
ATOM   3206 N NE  . ARG A 1 423 ? 20.149  -42.972 28.111  1.00 65.71  ? 424 ARG A NE  1 
ATOM   3207 C CZ  . ARG A 1 423 ? 20.694  -42.126 28.983  1.00 47.85  ? 424 ARG A CZ  1 
ATOM   3208 N NH1 . ARG A 1 423 ? 21.446  -41.118 28.558  1.00 62.32  ? 424 ARG A NH1 1 
ATOM   3209 N NH2 . ARG A 1 423 ? 20.488  -42.289 30.281  1.00 46.05  ? 424 ARG A NH2 1 
ATOM   3210 N N   . VAL A 1 424 ? 15.703  -42.470 24.323  1.00 28.84  ? 425 VAL A N   1 
ATOM   3211 C CA  . VAL A 1 424 ? 14.356  -42.983 24.505  1.00 24.59  ? 425 VAL A CA  1 
ATOM   3212 C C   . VAL A 1 424 ? 14.365  -44.458 24.884  1.00 29.75  ? 425 VAL A C   1 
ATOM   3213 O O   . VAL A 1 424 ? 15.109  -45.246 24.306  1.00 29.61  ? 425 VAL A O   1 
ATOM   3214 C CB  . VAL A 1 424 ? 13.532  -42.787 23.211  1.00 29.63  ? 425 VAL A CB  1 
ATOM   3215 C CG1 . VAL A 1 424 ? 12.096  -43.270 23.391  1.00 23.19  ? 425 VAL A CG1 1 
ATOM   3216 C CG2 . VAL A 1 424 ? 13.568  -41.323 22.784  1.00 24.43  ? 425 VAL A CG2 1 
ATOM   3217 N N   . TYR A 1 425 ? 13.544  -44.825 25.866  1.00 27.38  ? 426 TYR A N   1 
ATOM   3218 C CA  . TYR A 1 425 ? 13.287  -46.232 26.164  1.00 30.92  ? 426 TYR A CA  1 
ATOM   3219 C C   . TYR A 1 425 ? 11.818  -46.546 25.900  1.00 28.42  ? 426 TYR A C   1 
ATOM   3220 O O   . TYR A 1 425 ? 10.937  -45.787 26.302  1.00 30.07  ? 426 TYR A O   1 
ATOM   3221 C CB  . TYR A 1 425 ? 13.665  -46.579 27.611  1.00 24.87  ? 426 TYR A CB  1 
ATOM   3222 C CG  . TYR A 1 425 ? 15.127  -46.346 27.913  1.00 26.99  ? 426 TYR A CG  1 
ATOM   3223 C CD1 . TYR A 1 425 ? 16.060  -47.381 27.808  1.00 30.52  ? 426 TYR A CD1 1 
ATOM   3224 C CD2 . TYR A 1 425 ? 15.581  -45.086 28.286  1.00 26.33  ? 426 TYR A CD2 1 
ATOM   3225 C CE1 . TYR A 1 425 ? 17.413  -47.158 28.076  1.00 29.71  ? 426 TYR A CE1 1 
ATOM   3226 C CE2 . TYR A 1 425 ? 16.919  -44.853 28.554  1.00 32.88  ? 426 TYR A CE2 1 
ATOM   3227 C CZ  . TYR A 1 425 ? 17.831  -45.886 28.450  1.00 33.18  ? 426 TYR A CZ  1 
ATOM   3228 O OH  . TYR A 1 425 ? 19.160  -45.630 28.722  1.00 33.71  ? 426 TYR A OH  1 
ATOM   3229 N N   . ALA A 1 426 ? 11.572  -47.672 25.232  1.00 24.05  ? 427 ALA A N   1 
ATOM   3230 C CA  . ALA A 1 426 ? 10.229  -48.081 24.830  1.00 25.13  ? 427 ALA A CA  1 
ATOM   3231 C C   . ALA A 1 426 ? 9.863   -49.473 25.359  1.00 25.07  ? 427 ALA A C   1 
ATOM   3232 O O   . ALA A 1 426 ? 10.711  -50.364 25.443  1.00 28.49  ? 427 ALA A O   1 
ATOM   3233 C CB  . ALA A 1 426 ? 10.098  -48.042 23.281  1.00 22.40  ? 427 ALA A CB  1 
ATOM   3234 N N   . TYR A 1 427 ? 8.592   -49.665 25.691  1.00 22.53  ? 428 TYR A N   1 
ATOM   3235 C CA  . TYR A 1 427 ? 8.124   -50.954 26.181  1.00 20.56  ? 428 TYR A CA  1 
ATOM   3236 C C   . TYR A 1 427 ? 6.753   -51.280 25.625  1.00 24.21  ? 428 TYR A C   1 
ATOM   3237 O O   . TYR A 1 427 ? 5.972   -50.388 25.286  1.00 24.24  ? 428 TYR A O   1 
ATOM   3238 C CB  . TYR A 1 427 ? 8.024   -50.954 27.720  1.00 23.13  ? 428 TYR A CB  1 
ATOM   3239 C CG  . TYR A 1 427 ? 6.946   -50.021 28.240  1.00 23.97  ? 428 TYR A CG  1 
ATOM   3240 C CD1 . TYR A 1 427 ? 5.605   -50.417 28.287  1.00 17.71  ? 428 TYR A CD1 1 
ATOM   3241 C CD2 . TYR A 1 427 ? 7.264   -48.739 28.678  1.00 23.70  ? 428 TYR A CD2 1 
ATOM   3242 C CE1 . TYR A 1 427 ? 4.614   -49.557 28.738  1.00 22.28  ? 428 TYR A CE1 1 
ATOM   3243 C CE2 . TYR A 1 427 ? 6.278   -47.872 29.142  1.00 23.31  ? 428 TYR A CE2 1 
ATOM   3244 C CZ  . TYR A 1 427 ? 4.956   -48.286 29.163  1.00 21.33  ? 428 TYR A CZ  1 
ATOM   3245 O OH  . TYR A 1 427 ? 3.978   -47.431 29.602  1.00 29.69  ? 428 TYR A OH  1 
ATOM   3246 N N   . VAL A 1 428 ? 6.447   -52.568 25.589  1.00 25.53  ? 429 VAL A N   1 
ATOM   3247 C CA  . VAL A 1 428 ? 5.073   -53.014 25.459  1.00 27.87  ? 429 VAL A CA  1 
ATOM   3248 C C   . VAL A 1 428 ? 4.724   -53.809 26.706  1.00 28.36  ? 429 VAL A C   1 
ATOM   3249 O O   . VAL A 1 428 ? 5.452   -54.731 27.106  1.00 25.65  ? 429 VAL A O   1 
ATOM   3250 C CB  . VAL A 1 428 ? 4.848   -53.870 24.192  1.00 31.20  ? 429 VAL A CB  1 
ATOM   3251 C CG1 . VAL A 1 428 ? 3.404   -54.314 24.112  1.00 26.88  ? 429 VAL A CG1 1 
ATOM   3252 C CG2 . VAL A 1 428 ? 5.186   -53.052 22.962  1.00 35.30  ? 429 VAL A CG2 1 
ATOM   3253 N N   . PHE A 1 429 ? 3.616   -53.440 27.329  1.00 27.14  ? 430 PHE A N   1 
ATOM   3254 C CA  . PHE A 1 429 ? 3.191   -54.092 28.556  1.00 26.56  ? 430 PHE A CA  1 
ATOM   3255 C C   . PHE A 1 429 ? 2.207   -55.195 28.189  1.00 26.81  ? 430 PHE A C   1 
ATOM   3256 O O   . PHE A 1 429 ? 1.144   -54.924 27.645  1.00 28.65  ? 430 PHE A O   1 
ATOM   3257 C CB  . PHE A 1 429 ? 2.564   -53.065 29.494  1.00 20.97  ? 430 PHE A CB  1 
ATOM   3258 C CG  . PHE A 1 429 ? 2.133   -53.628 30.812  1.00 24.45  ? 430 PHE A CG  1 
ATOM   3259 C CD1 . PHE A 1 429 ? 2.999   -53.633 31.892  1.00 25.75  ? 430 PHE A CD1 1 
ATOM   3260 C CD2 . PHE A 1 429 ? 0.857   -54.142 30.980  1.00 27.94  ? 430 PHE A CD2 1 
ATOM   3261 C CE1 . PHE A 1 429 ? 2.599   -54.149 33.117  1.00 33.21  ? 430 PHE A CE1 1 
ATOM   3262 C CE2 . PHE A 1 429 ? 0.452   -54.664 32.215  1.00 30.59  ? 430 PHE A CE2 1 
ATOM   3263 C CZ  . PHE A 1 429 ? 1.326   -54.667 33.272  1.00 31.56  ? 430 PHE A CZ  1 
ATOM   3264 N N   . GLU A 1 430 ? 2.562   -56.439 28.482  1.00 26.36  ? 431 GLU A N   1 
ATOM   3265 C CA  . GLU A 1 430 ? 1.834   -57.573 27.916  1.00 33.84  ? 431 GLU A CA  1 
ATOM   3266 C C   . GLU A 1 430 ? 1.264   -58.516 28.952  1.00 38.33  ? 431 GLU A C   1 
ATOM   3267 O O   . GLU A 1 430 ? 0.857   -59.622 28.611  1.00 33.88  ? 431 GLU A O   1 
ATOM   3268 C CB  . GLU A 1 430 ? 2.742   -58.376 26.988  1.00 27.79  ? 431 GLU A CB  1 
ATOM   3269 C CG  . GLU A 1 430 ? 3.147   -57.647 25.736  1.00 33.82  ? 431 GLU A CG  1 
ATOM   3270 C CD  . GLU A 1 430 ? 3.952   -58.523 24.790  1.00 42.94  ? 431 GLU A CD  1 
ATOM   3271 O OE1 . GLU A 1 430 ? 3.991   -58.205 23.583  1.00 55.20  ? 431 GLU A OE1 1 
ATOM   3272 O OE2 . GLU A 1 430 ? 4.544   -59.525 25.249  1.00 49.42  ? 431 GLU A OE2 1 
ATOM   3273 N N   . HIS A 1 431 ? 1.249   -58.096 30.210  1.00 30.81  ? 432 HIS A N   1 
ATOM   3274 C CA  . HIS A 1 431 ? 0.690   -58.932 31.259  1.00 31.77  ? 432 HIS A CA  1 
ATOM   3275 C C   . HIS A 1 431 ? -0.783  -58.652 31.505  1.00 35.51  ? 432 HIS A C   1 
ATOM   3276 O O   . HIS A 1 431 ? -1.179  -57.516 31.765  1.00 34.95  ? 432 HIS A O   1 
ATOM   3277 C CB  . HIS A 1 431 ? 1.447   -58.763 32.566  1.00 26.84  ? 432 HIS A CB  1 
ATOM   3278 C CG  . HIS A 1 431 ? 0.885   -59.583 33.681  1.00 39.60  ? 432 HIS A CG  1 
ATOM   3279 N ND1 . HIS A 1 431 ? 0.838   -60.960 33.637  1.00 41.54  ? 432 HIS A ND1 1 
ATOM   3280 C CD2 . HIS A 1 431 ? 0.316   -59.223 34.856  1.00 36.85  ? 432 HIS A CD2 1 
ATOM   3281 C CE1 . HIS A 1 431 ? 0.283   -61.414 34.746  1.00 32.36  ? 432 HIS A CE1 1 
ATOM   3282 N NE2 . HIS A 1 431 ? -0.046  -60.379 35.500  1.00 39.29  ? 432 HIS A NE2 1 
ATOM   3283 N N   . ARG A 1 432 ? -1.595  -59.698 31.429  1.00 35.70  ? 433 ARG A N   1 
ATOM   3284 C CA  . ARG A 1 432 ? -3.002  -59.571 31.769  1.00 41.32  ? 433 ARG A CA  1 
ATOM   3285 C C   . ARG A 1 432 ? -3.148  -59.909 33.251  1.00 39.11  ? 433 ARG A C   1 
ATOM   3286 O O   . ARG A 1 432 ? -2.786  -61.003 33.687  1.00 42.45  ? 433 ARG A O   1 
ATOM   3287 C CB  . ARG A 1 432 ? -3.859  -60.496 30.898  1.00 36.27  ? 433 ARG A CB  1 
ATOM   3288 C CG  . ARG A 1 432 ? -5.339  -60.210 31.018  1.00 36.59  ? 433 ARG A CG  1 
ATOM   3289 C CD  . ARG A 1 432 ? -6.186  -61.181 30.213  1.00 28.28  ? 433 ARG A CD  1 
ATOM   3290 N NE  . ARG A 1 432 ? -7.493  -61.333 30.846  1.00 41.63  ? 433 ARG A NE  1 
ATOM   3291 C CZ  . ARG A 1 432 ? -8.581  -60.658 30.492  1.00 47.21  ? 433 ARG A CZ  1 
ATOM   3292 N NH1 . ARG A 1 432 ? -8.535  -59.788 29.478  1.00 30.12  ? 433 ARG A NH1 1 
ATOM   3293 N NH2 . ARG A 1 432 ? -9.720  -60.863 31.148  1.00 37.18  ? 433 ARG A NH2 1 
ATOM   3294 N N   . ALA A 1 433 ? -3.639  -58.953 34.028  1.00 34.01  ? 434 ALA A N   1 
ATOM   3295 C CA  . ALA A 1 433 ? -3.721  -59.124 35.470  1.00 38.39  ? 434 ALA A CA  1 
ATOM   3296 C C   . ALA A 1 433 ? -4.658  -60.269 35.811  1.00 43.86  ? 434 ALA A C   1 
ATOM   3297 O O   . ALA A 1 433 ? -5.728  -60.393 35.220  1.00 42.58  ? 434 ALA A O   1 
ATOM   3298 C CB  . ALA A 1 433 ? -4.195  -57.845 36.125  1.00 34.57  ? 434 ALA A CB  1 
ATOM   3299 N N   . SER A 1 434 ? -4.252  -61.099 36.769  1.00 35.58  ? 435 SER A N   1 
ATOM   3300 C CA  . SER A 1 434 ? -5.076  -62.217 37.234  1.00 37.03  ? 435 SER A CA  1 
ATOM   3301 C C   . SER A 1 434 ? -6.420  -61.729 37.761  1.00 34.97  ? 435 SER A C   1 
ATOM   3302 O O   . SER A 1 434 ? -7.391  -62.472 37.790  1.00 40.29  ? 435 SER A O   1 
ATOM   3303 C CB  . SER A 1 434 ? -4.354  -62.979 38.342  1.00 35.35  ? 435 SER A CB  1 
ATOM   3304 O OG  . SER A 1 434 ? -4.233  -62.160 39.495  1.00 49.18  ? 435 SER A OG  1 
ATOM   3305 N N   . THR A 1 435 ? -6.470  -60.469 38.166  1.00 39.41  ? 436 THR A N   1 
ATOM   3306 C CA  . THR A 1 435 ? -7.672  -59.902 38.760  1.00 41.91  ? 436 THR A CA  1 
ATOM   3307 C C   . THR A 1 435 ? -8.542  -59.154 37.755  1.00 37.51  ? 436 THR A C   1 
ATOM   3308 O O   . THR A 1 435 ? -9.534  -58.535 38.138  1.00 39.30  ? 436 THR A O   1 
ATOM   3309 C CB  . THR A 1 435 ? -7.302  -58.922 39.889  1.00 46.39  ? 436 THR A CB  1 
ATOM   3310 O OG1 . THR A 1 435 ? -6.524  -57.839 39.350  1.00 41.75  ? 436 THR A OG1 1 
ATOM   3311 C CG2 . THR A 1 435 ? -6.493  -59.643 40.956  1.00 38.35  ? 436 THR A CG2 1 
ATOM   3312 N N   . LEU A 1 436 ? -8.173  -59.204 36.477  1.00 34.33  ? 437 LEU A N   1 
ATOM   3313 C CA  . LEU A 1 436 ? -8.846  -58.383 35.472  1.00 36.59  ? 437 LEU A CA  1 
ATOM   3314 C C   . LEU A 1 436 ? -10.268 -58.873 35.230  1.00 36.24  ? 437 LEU A C   1 
ATOM   3315 O O   . LEU A 1 436 ? -10.498 -60.069 35.070  1.00 40.73  ? 437 LEU A O   1 
ATOM   3316 C CB  . LEU A 1 436 ? -8.043  -58.348 34.161  1.00 38.41  ? 437 LEU A CB  1 
ATOM   3317 C CG  . LEU A 1 436 ? -8.393  -57.240 33.158  1.00 41.37  ? 437 LEU A CG  1 
ATOM   3318 C CD1 . LEU A 1 436 ? -8.034  -55.897 33.733  1.00 40.03  ? 437 LEU A CD1 1 
ATOM   3319 C CD2 . LEU A 1 436 ? -7.691  -57.434 31.818  1.00 38.28  ? 437 LEU A CD2 1 
ATOM   3320 N N   . SER A 1 437 ? -11.213 -57.939 35.197  1.00 36.04  ? 438 SER A N   1 
ATOM   3321 C CA  . SER A 1 437 ? -12.631 -58.271 35.085  1.00 36.87  ? 438 SER A CA  1 
ATOM   3322 C C   . SER A 1 437 ? -13.198 -58.106 33.670  1.00 41.76  ? 438 SER A C   1 
ATOM   3323 O O   . SER A 1 437 ? -14.328 -58.513 33.406  1.00 41.89  ? 438 SER A O   1 
ATOM   3324 C CB  . SER A 1 437 ? -13.442 -57.414 36.061  1.00 40.01  ? 438 SER A CB  1 
ATOM   3325 O OG  . SER A 1 437 ? -13.159 -56.033 35.871  1.00 43.41  ? 438 SER A OG  1 
ATOM   3326 N N   . TRP A 1 438 ? -12.434 -57.481 32.775  1.00 40.23  ? 439 TRP A N   1 
ATOM   3327 C CA  . TRP A 1 438 ? -12.814 -57.419 31.365  1.00 40.14  ? 439 TRP A CA  1 
ATOM   3328 C C   . TRP A 1 438 ? -12.636 -58.796 30.744  1.00 34.13  ? 439 TRP A C   1 
ATOM   3329 O O   . TRP A 1 438 ? -11.771 -59.565 31.175  1.00 32.44  ? 439 TRP A O   1 
ATOM   3330 C CB  . TRP A 1 438 ? -11.978 -56.382 30.600  1.00 39.30  ? 439 TRP A CB  1 
ATOM   3331 C CG  . TRP A 1 438 ? -12.170 -54.987 31.092  1.00 34.60  ? 439 TRP A CG  1 
ATOM   3332 C CD1 . TRP A 1 438 ? -11.352 -54.302 31.942  1.00 33.61  ? 439 TRP A CD1 1 
ATOM   3333 C CD2 . TRP A 1 438 ? -13.255 -54.106 30.785  1.00 30.74  ? 439 TRP A CD2 1 
ATOM   3334 N NE1 . TRP A 1 438 ? -11.860 -53.048 32.181  1.00 29.19  ? 439 TRP A NE1 1 
ATOM   3335 C CE2 . TRP A 1 438 ? -13.026 -52.900 31.483  1.00 34.70  ? 439 TRP A CE2 1 
ATOM   3336 C CE3 . TRP A 1 438 ? -14.401 -54.220 30.001  1.00 27.18  ? 439 TRP A CE3 1 
ATOM   3337 C CZ2 . TRP A 1 438 ? -13.894 -51.812 31.406  1.00 29.62  ? 439 TRP A CZ2 1 
ATOM   3338 C CZ3 . TRP A 1 438 ? -15.266 -53.131 29.923  1.00 36.78  ? 439 TRP A CZ3 1 
ATOM   3339 C CH2 . TRP A 1 438 ? -15.004 -51.945 30.623  1.00 32.02  ? 439 TRP A CH2 1 
ATOM   3340 N N   . PRO A 1 439 ? -13.455 -59.119 29.730  1.00 31.14  ? 440 PRO A N   1 
ATOM   3341 C CA  . PRO A 1 439 ? -13.368 -60.437 29.094  1.00 36.21  ? 440 PRO A CA  1 
ATOM   3342 C C   . PRO A 1 439 ? -12.009 -60.699 28.462  1.00 40.94  ? 440 PRO A C   1 
ATOM   3343 O O   . PRO A 1 439 ? -11.270 -59.766 28.146  1.00 37.76  ? 440 PRO A O   1 
ATOM   3344 C CB  . PRO A 1 439 ? -14.446 -60.377 28.004  1.00 30.01  ? 440 PRO A CB  1 
ATOM   3345 C CG  . PRO A 1 439 ? -14.684 -58.933 27.772  1.00 36.63  ? 440 PRO A CG  1 
ATOM   3346 C CD  . PRO A 1 439 ? -14.496 -58.285 29.112  1.00 35.55  ? 440 PRO A CD  1 
ATOM   3347 N N   . LEU A 1 440 ? -11.706 -61.978 28.284  1.00 39.05  ? 441 LEU A N   1 
ATOM   3348 C CA  . LEU A 1 440 ? -10.461 -62.433 27.686  1.00 37.48  ? 441 LEU A CA  1 
ATOM   3349 C C   . LEU A 1 440 ? -10.134 -61.826 26.315  1.00 42.53  ? 441 LEU A C   1 
ATOM   3350 O O   . LEU A 1 440 ? -8.957  -61.623 25.991  1.00 41.82  ? 441 LEU A O   1 
ATOM   3351 C CB  . LEU A 1 440 ? -10.486 -63.952 27.561  1.00 47.30  ? 441 LEU A CB  1 
ATOM   3352 C CG  . LEU A 1 440 ? -9.122  -64.616 27.698  1.00 58.57  ? 441 LEU A CG  1 
ATOM   3353 C CD1 . LEU A 1 440 ? -8.774  -64.740 29.171  1.00 48.08  ? 441 LEU A CD1 1 
ATOM   3354 C CD2 . LEU A 1 440 ? -9.092  -65.969 26.997  1.00 50.66  ? 441 LEU A CD2 1 
ATOM   3355 N N   . TRP A 1 441 ? -11.152 -61.543 25.504  1.00 31.34  ? 442 TRP A N   1 
ATOM   3356 C CA  . TRP A 1 441 ? -10.881 -61.081 24.143  1.00 31.83  ? 442 TRP A CA  1 
ATOM   3357 C C   . TRP A 1 441 ? -10.288 -59.679 24.106  1.00 38.47  ? 442 TRP A C   1 
ATOM   3358 O O   . TRP A 1 441 ? -9.648  -59.296 23.125  1.00 41.86  ? 442 TRP A O   1 
ATOM   3359 C CB  . TRP A 1 441 ? -12.111 -61.185 23.221  1.00 35.39  ? 442 TRP A CB  1 
ATOM   3360 C CG  . TRP A 1 441 ? -13.231 -60.226 23.530  1.00 37.11  ? 442 TRP A CG  1 
ATOM   3361 C CD1 . TRP A 1 441 ? -14.361 -60.494 24.243  1.00 39.42  ? 442 TRP A CD1 1 
ATOM   3362 C CD2 . TRP A 1 441 ? -13.331 -58.852 23.122  1.00 38.36  ? 442 TRP A CD2 1 
ATOM   3363 N NE1 . TRP A 1 441 ? -15.156 -59.372 24.315  1.00 37.63  ? 442 TRP A NE1 1 
ATOM   3364 C CE2 . TRP A 1 441 ? -14.546 -58.352 23.633  1.00 27.79  ? 442 TRP A CE2 1 
ATOM   3365 C CE3 . TRP A 1 441 ? -12.511 -57.997 22.376  1.00 34.17  ? 442 TRP A CE3 1 
ATOM   3366 C CZ2 . TRP A 1 441 ? -14.961 -57.035 23.424  1.00 27.90  ? 442 TRP A CZ2 1 
ATOM   3367 C CZ3 . TRP A 1 441 ? -12.926 -56.688 22.169  1.00 24.49  ? 442 TRP A CZ3 1 
ATOM   3368 C CH2 . TRP A 1 441 ? -14.137 -56.220 22.696  1.00 37.76  ? 442 TRP A CH2 1 
ATOM   3369 N N   . MET A 1 442 ? -10.501 -58.914 25.171  1.00 38.01  ? 443 MET A N   1 
ATOM   3370 C CA  . MET A 1 442 ? -9.928  -57.577 25.257  1.00 32.87  ? 443 MET A CA  1 
ATOM   3371 C C   . MET A 1 442 ? -8.408  -57.589 25.499  1.00 31.96  ? 443 MET A C   1 
ATOM   3372 O O   . MET A 1 442 ? -7.746  -56.566 25.338  1.00 32.32  ? 443 MET A O   1 
ATOM   3373 C CB  . MET A 1 442 ? -10.635 -56.757 26.331  1.00 30.37  ? 443 MET A CB  1 
ATOM   3374 C CG  . MET A 1 442 ? -12.030 -56.274 25.954  1.00 40.56  ? 443 MET A CG  1 
ATOM   3375 S SD  . MET A 1 442 ? -12.537 -55.005 27.131  1.00 43.57  ? 443 MET A SD  1 
ATOM   3376 C CE  . MET A 1 442 ? -14.127 -54.529 26.530  1.00 37.05  ? 443 MET A CE  1 
ATOM   3377 N N   . GLY A 1 443 ? -7.857  -58.746 25.862  1.00 24.67  ? 444 GLY A N   1 
ATOM   3378 C CA  . GLY A 1 443 ? -6.429  -58.866 26.105  1.00 21.53  ? 444 GLY A CA  1 
ATOM   3379 C C   . GLY A 1 443 ? -5.956  -58.003 27.274  1.00 39.42  ? 444 GLY A C   1 
ATOM   3380 O O   . GLY A 1 443 ? -6.546  -58.034 28.365  1.00 26.67  ? 444 GLY A O   1 
ATOM   3381 N N   . VAL A 1 444 ? -4.885  -57.241 27.046  1.00 28.66  ? 445 VAL A N   1 
ATOM   3382 C CA  . VAL A 1 444 ? -4.382  -56.271 28.021  1.00 29.45  ? 445 VAL A CA  1 
ATOM   3383 C C   . VAL A 1 444 ? -4.827  -54.866 27.601  1.00 25.42  ? 445 VAL A C   1 
ATOM   3384 O O   . VAL A 1 444 ? -4.198  -54.245 26.751  1.00 29.71  ? 445 VAL A O   1 
ATOM   3385 C CB  . VAL A 1 444 ? -2.836  -56.290 28.087  1.00 26.35  ? 445 VAL A CB  1 
ATOM   3386 C CG1 . VAL A 1 444 ? -2.340  -55.409 29.210  1.00 32.51  ? 445 VAL A CG1 1 
ATOM   3387 C CG2 . VAL A 1 444 ? -2.315  -57.711 28.248  1.00 30.35  ? 445 VAL A CG2 1 
ATOM   3388 N N   . PRO A 1 445 ? -5.919  -54.361 28.187  1.00 23.87  ? 446 PRO A N   1 
ATOM   3389 C CA  . PRO A 1 445 ? -6.519  -53.111 27.706  1.00 25.48  ? 446 PRO A CA  1 
ATOM   3390 C C   . PRO A 1 445 ? -5.816  -51.842 28.192  1.00 28.28  ? 446 PRO A C   1 
ATOM   3391 O O   . PRO A 1 445 ? -5.052  -51.865 29.160  1.00 27.77  ? 446 PRO A O   1 
ATOM   3392 C CB  . PRO A 1 445 ? -7.948  -53.153 28.291  1.00 22.90  ? 446 PRO A CB  1 
ATOM   3393 C CG  . PRO A 1 445 ? -8.129  -54.550 28.826  1.00 25.48  ? 446 PRO A CG  1 
ATOM   3394 C CD  . PRO A 1 445 ? -6.749  -54.997 29.218  1.00 22.40  ? 446 PRO A CD  1 
ATOM   3395 N N   . HIS A 1 446 ? -6.096  -50.745 27.494  1.00 29.26  ? 447 HIS A N   1 
ATOM   3396 C CA  . HIS A 1 446 ? -5.694  -49.395 27.867  1.00 26.48  ? 447 HIS A CA  1 
ATOM   3397 C C   . HIS A 1 446 ? -5.959  -49.143 29.352  1.00 30.85  ? 447 HIS A C   1 
ATOM   3398 O O   . HIS A 1 446 ? -7.072  -49.356 29.835  1.00 25.98  ? 447 HIS A O   1 
ATOM   3399 C CB  . HIS A 1 446 ? -6.530  -48.430 27.038  1.00 28.34  ? 447 HIS A CB  1 
ATOM   3400 C CG  . HIS A 1 446 ? -6.050  -47.011 27.045  1.00 34.78  ? 447 HIS A CG  1 
ATOM   3401 N ND1 . HIS A 1 446 ? -4.911  -46.604 26.384  1.00 27.44  ? 447 HIS A ND1 1 
ATOM   3402 C CD2 . HIS A 1 446 ? -6.598  -45.891 27.572  1.00 31.63  ? 447 HIS A CD2 1 
ATOM   3403 C CE1 . HIS A 1 446 ? -4.767  -45.298 26.522  1.00 23.87  ? 447 HIS A CE1 1 
ATOM   3404 N NE2 . HIS A 1 446 ? -5.781  -44.841 27.235  1.00 27.97  ? 447 HIS A NE2 1 
ATOM   3405 N N   . GLY A 1 447 ? -4.928  -48.715 30.074  1.00 24.46  ? 448 GLY A N   1 
ATOM   3406 C CA  . GLY A 1 447 ? -5.062  -48.371 31.479  1.00 23.19  ? 448 GLY A CA  1 
ATOM   3407 C C   . GLY A 1 447 ? -4.629  -49.435 32.479  1.00 27.80  ? 448 GLY A C   1 
ATOM   3408 O O   . GLY A 1 447 ? -4.496  -49.146 33.662  1.00 27.54  ? 448 GLY A O   1 
ATOM   3409 N N   . TYR A 1 448 ? -4.391  -50.662 32.027  1.00 26.80  ? 449 TYR A N   1 
ATOM   3410 C CA  . TYR A 1 448 ? -4.225  -51.759 32.982  1.00 26.65  ? 449 TYR A CA  1 
ATOM   3411 C C   . TYR A 1 448 ? -2.793  -52.139 33.307  1.00 28.12  ? 449 TYR A C   1 
ATOM   3412 O O   . TYR A 1 448 ? -2.546  -53.172 33.924  1.00 34.25  ? 449 TYR A O   1 
ATOM   3413 C CB  . TYR A 1 448 ? -5.138  -52.953 32.644  1.00 17.64  ? 449 TYR A CB  1 
ATOM   3414 C CG  . TYR A 1 448 ? -6.558  -52.540 32.931  1.00 25.82  ? 449 TYR A CG  1 
ATOM   3415 C CD1 . TYR A 1 448 ? -7.079  -52.644 34.207  1.00 23.16  ? 449 TYR A CD1 1 
ATOM   3416 C CD2 . TYR A 1 448 ? -7.339  -51.941 31.957  1.00 23.10  ? 449 TYR A CD2 1 
ATOM   3417 C CE1 . TYR A 1 448 ? -8.362  -52.212 34.493  1.00 26.42  ? 449 TYR A CE1 1 
ATOM   3418 C CE2 . TYR A 1 448 ? -8.619  -51.510 32.234  1.00 22.60  ? 449 TYR A CE2 1 
ATOM   3419 C CZ  . TYR A 1 448 ? -9.124  -51.644 33.506  1.00 26.79  ? 449 TYR A CZ  1 
ATOM   3420 O OH  . TYR A 1 448 ? -10.401 -51.209 33.795  1.00 33.04  ? 449 TYR A OH  1 
ATOM   3421 N N   . GLU A 1 449 ? -1.860  -51.267 32.932  1.00 27.71  ? 450 GLU A N   1 
ATOM   3422 C CA  . GLU A 1 449 ? -0.491  -51.369 33.421  1.00 27.52  ? 450 GLU A CA  1 
ATOM   3423 C C   . GLU A 1 449 ? -0.288  -50.499 34.665  1.00 27.99  ? 450 GLU A C   1 
ATOM   3424 O O   . GLU A 1 449 ? 0.601   -50.767 35.465  1.00 31.00  ? 450 GLU A O   1 
ATOM   3425 C CB  . GLU A 1 449 ? 0.508   -50.959 32.338  1.00 26.61  ? 450 GLU A CB  1 
ATOM   3426 C CG  . GLU A 1 449 ? 0.902   -49.499 32.363  1.00 21.40  ? 450 GLU A CG  1 
ATOM   3427 C CD  . GLU A 1 449 ? -0.141  -48.581 31.754  1.00 30.06  ? 450 GLU A CD  1 
ATOM   3428 O OE1 . GLU A 1 449 ? -1.319  -48.986 31.656  1.00 30.44  ? 450 GLU A OE1 1 
ATOM   3429 O OE2 . GLU A 1 449 ? 0.224   -47.445 31.356  1.00 33.06  ? 450 GLU A OE2 1 
ATOM   3430 N N   . ILE A 1 450 ? -1.123  -49.474 34.829  1.00 24.58  ? 451 ILE A N   1 
ATOM   3431 C CA  . ILE A 1 450 ? -0.955  -48.497 35.904  1.00 26.03  ? 451 ILE A CA  1 
ATOM   3432 C C   . ILE A 1 450 ? -0.875  -49.119 37.308  1.00 32.39  ? 451 ILE A C   1 
ATOM   3433 O O   . ILE A 1 450 ? 0.022   -48.784 38.082  1.00 32.37  ? 451 ILE A O   1 
ATOM   3434 C CB  . ILE A 1 450 ? -2.075  -47.437 35.895  1.00 30.13  ? 451 ILE A CB  1 
ATOM   3435 C CG1 . ILE A 1 450 ? -2.185  -46.774 34.521  1.00 23.32  ? 451 ILE A CG1 1 
ATOM   3436 C CG2 . ILE A 1 450 ? -1.845  -46.403 37.003  1.00 25.72  ? 451 ILE A CG2 1 
ATOM   3437 C CD1 . ILE A 1 450 ? -3.269  -45.717 34.442  1.00 19.06  ? 451 ILE A CD1 1 
ATOM   3438 N N   . GLU A 1 451 ? -1.798  -50.027 37.620  1.00 25.26  ? 452 GLU A N   1 
ATOM   3439 C CA  . GLU A 1 451 ? -1.835  -50.677 38.932  1.00 28.30  ? 452 GLU A CA  1 
ATOM   3440 C C   . GLU A 1 451 ? -0.525  -51.402 39.232  1.00 28.30  ? 452 GLU A C   1 
ATOM   3441 O O   . GLU A 1 451 ? -0.128  -51.510 40.393  1.00 29.63  ? 452 GLU A O   1 
ATOM   3442 C CB  . GLU A 1 451 ? -3.022  -51.645 39.038  1.00 28.40  ? 452 GLU A CB  1 
ATOM   3443 C CG  . GLU A 1 451 ? -2.996  -52.769 37.983  1.00 34.35  ? 452 GLU A CG  1 
ATOM   3444 C CD  . GLU A 1 451 ? -4.365  -53.398 37.739  1.00 39.57  ? 452 GLU A CD  1 
ATOM   3445 O OE1 . GLU A 1 451 ? -4.479  -54.631 37.885  1.00 49.63  ? 452 GLU A OE1 1 
ATOM   3446 O OE2 . GLU A 1 451 ? -5.326  -52.671 37.394  1.00 37.74  ? 452 GLU A OE2 1 
ATOM   3447 N N   . PHE A 1 452 ? 0.157   -51.874 38.188  1.00 27.43  ? 453 PHE A N   1 
ATOM   3448 C CA  . PHE A 1 452 ? 1.471   -52.494 38.368  1.00 26.29  ? 453 PHE A CA  1 
ATOM   3449 C C   . PHE A 1 452 ? 2.593   -51.484 38.590  1.00 35.43  ? 453 PHE A C   1 
ATOM   3450 O O   . PHE A 1 452 ? 3.487   -51.717 39.405  1.00 31.32  ? 453 PHE A O   1 
ATOM   3451 C CB  . PHE A 1 452 ? 1.798   -53.459 37.225  1.00 25.30  ? 453 PHE A CB  1 
ATOM   3452 C CG  . PHE A 1 452 ? 0.958   -54.685 37.249  1.00 33.62  ? 453 PHE A CG  1 
ATOM   3453 C CD1 . PHE A 1 452 ? -0.272  -54.708 36.614  1.00 37.05  ? 453 PHE A CD1 1 
ATOM   3454 C CD2 . PHE A 1 452 ? 1.366   -55.801 37.956  1.00 31.11  ? 453 PHE A CD2 1 
ATOM   3455 C CE1 . PHE A 1 452 ? -1.070  -55.832 36.667  1.00 40.49  ? 453 PHE A CE1 1 
ATOM   3456 C CE2 . PHE A 1 452 ? 0.565   -56.931 38.011  1.00 34.17  ? 453 PHE A CE2 1 
ATOM   3457 C CZ  . PHE A 1 452 ? -0.651  -56.943 37.372  1.00 30.08  ? 453 PHE A CZ  1 
ATOM   3458 N N   . ILE A 1 453 ? 2.541   -50.364 37.875  1.00 28.60  ? 454 ILE A N   1 
ATOM   3459 C CA  . ILE A 1 453 ? 3.538   -49.323 38.048  1.00 26.48  ? 454 ILE A CA  1 
ATOM   3460 C C   . ILE A 1 453 ? 3.474   -48.766 39.480  1.00 26.35  ? 454 ILE A C   1 
ATOM   3461 O O   . ILE A 1 453 ? 4.506   -48.503 40.090  1.00 27.16  ? 454 ILE A O   1 
ATOM   3462 C CB  . ILE A 1 453 ? 3.349   -48.174 37.027  1.00 33.31  ? 454 ILE A CB  1 
ATOM   3463 C CG1 . ILE A 1 453 ? 3.345   -48.703 35.581  1.00 27.28  ? 454 ILE A CG1 1 
ATOM   3464 C CG2 . ILE A 1 453 ? 4.425   -47.119 37.209  1.00 30.69  ? 454 ILE A CG2 1 
ATOM   3465 C CD1 . ILE A 1 453 ? 4.548   -49.521 35.218  1.00 29.20  ? 454 ILE A CD1 1 
ATOM   3466 N N   . PHE A 1 454 ? 2.265   -48.605 40.018  1.00 25.46  ? 455 PHE A N   1 
ATOM   3467 C CA  . PHE A 1 454 ? 2.098   -48.076 41.375  1.00 26.66  ? 455 PHE A CA  1 
ATOM   3468 C C   . PHE A 1 454 ? 2.253   -49.138 42.455  1.00 27.67  ? 455 PHE A C   1 
ATOM   3469 O O   . PHE A 1 454 ? 2.136   -48.836 43.629  1.00 26.51  ? 455 PHE A O   1 
ATOM   3470 C CB  . PHE A 1 454 ? 0.755   -47.358 41.538  1.00 19.96  ? 455 PHE A CB  1 
ATOM   3471 C CG  . PHE A 1 454 ? 0.751   -45.967 40.979  1.00 29.10  ? 455 PHE A CG  1 
ATOM   3472 C CD1 . PHE A 1 454 ? 0.641   -45.749 39.607  1.00 21.46  ? 455 PHE A CD1 1 
ATOM   3473 C CD2 . PHE A 1 454 ? 0.884   -44.875 41.814  1.00 24.13  ? 455 PHE A CD2 1 
ATOM   3474 C CE1 . PHE A 1 454 ? 0.652   -44.458 39.085  1.00 22.24  ? 455 PHE A CE1 1 
ATOM   3475 C CE2 . PHE A 1 454 ? 0.894   -43.579 41.303  1.00 32.67  ? 455 PHE A CE2 1 
ATOM   3476 C CZ  . PHE A 1 454 ? 0.773   -43.369 39.933  1.00 28.11  ? 455 PHE A CZ  1 
ATOM   3477 N N   . GLY A 1 455 ? 2.508   -50.377 42.051  1.00 29.73  ? 456 GLY A N   1 
ATOM   3478 C CA  . GLY A 1 455 ? 2.697   -51.456 42.996  1.00 24.50  ? 456 GLY A CA  1 
ATOM   3479 C C   . GLY A 1 455 ? 1.450   -51.813 43.785  1.00 28.63  ? 456 GLY A C   1 
ATOM   3480 O O   . GLY A 1 455 ? 1.551   -52.346 44.887  1.00 31.62  ? 456 GLY A O   1 
ATOM   3481 N N   . ILE A 1 456 ? 0.273   -51.526 43.231  1.00 34.45  ? 457 ILE A N   1 
ATOM   3482 C CA  . ILE A 1 456 ? -0.992  -51.965 43.836  1.00 30.70  ? 457 ILE A CA  1 
ATOM   3483 C C   . ILE A 1 456 ? -1.042  -53.471 44.176  1.00 36.50  ? 457 ILE A C   1 
ATOM   3484 O O   . ILE A 1 456 ? -1.629  -53.854 45.193  1.00 32.01  ? 457 ILE A O   1 
ATOM   3485 C CB  . ILE A 1 456 ? -2.211  -51.572 42.977  1.00 31.26  ? 457 ILE A CB  1 
ATOM   3486 C CG1 . ILE A 1 456 ? -2.222  -50.063 42.722  1.00 26.94  ? 457 ILE A CG1 1 
ATOM   3487 C CG2 . ILE A 1 456 ? -3.500  -51.996 43.650  1.00 30.70  ? 457 ILE A CG2 1 
ATOM   3488 C CD1 . ILE A 1 456 ? -2.140  -49.233 43.993  1.00 28.61  ? 457 ILE A CD1 1 
ATOM   3489 N N   . PRO A 1 457 ? -0.413  -54.334 43.349  1.00 36.77  ? 458 PRO A N   1 
ATOM   3490 C CA  . PRO A 1 457 ? -0.389  -55.735 43.785  1.00 38.32  ? 458 PRO A CA  1 
ATOM   3491 C C   . PRO A 1 457 ? 0.202   -56.016 45.175  1.00 42.41  ? 458 PRO A C   1 
ATOM   3492 O O   . PRO A 1 457 ? -0.095  -57.075 45.717  1.00 49.91  ? 458 PRO A O   1 
ATOM   3493 C CB  . PRO A 1 457 ? 0.442   -56.413 42.700  1.00 34.26  ? 458 PRO A CB  1 
ATOM   3494 C CG  . PRO A 1 457 ? 0.088   -55.656 41.473  1.00 32.60  ? 458 PRO A CG  1 
ATOM   3495 C CD  . PRO A 1 457 ? 0.000   -54.217 41.937  1.00 39.94  ? 458 PRO A CD  1 
ATOM   3496 N N   . LEU A 1 458 ? 0.998   -55.113 45.744  1.00 39.86  ? 459 LEU A N   1 
ATOM   3497 C CA  . LEU A 1 458 ? 1.565   -55.357 47.067  1.00 37.60  ? 459 LEU A CA  1 
ATOM   3498 C C   . LEU A 1 458 ? 0.525   -55.215 48.179  1.00 31.16  ? 459 LEU A C   1 
ATOM   3499 O O   . LEU A 1 458 ? 0.747   -55.665 49.295  1.00 47.39  ? 459 LEU A O   1 
ATOM   3500 C CB  . LEU A 1 458 ? 2.765   -54.448 47.342  1.00 36.23  ? 459 LEU A CB  1 
ATOM   3501 C CG  . LEU A 1 458 ? 3.982   -54.640 46.437  1.00 45.65  ? 459 LEU A CG  1 
ATOM   3502 C CD1 . LEU A 1 458 ? 5.092   -53.701 46.869  1.00 33.89  ? 459 LEU A CD1 1 
ATOM   3503 C CD2 . LEU A 1 458 ? 4.455   -56.085 46.454  1.00 38.90  ? 459 LEU A CD2 1 
ATOM   3504 N N   . ASP A 1 459 ? -0.600  -54.581 47.870  1.00 33.66  ? 460 ASP A N   1 
ATOM   3505 C CA  . ASP A 1 459 ? -1.698  -54.442 48.818  1.00 34.85  ? 460 ASP A CA  1 
ATOM   3506 C C   . ASP A 1 459 ? -2.234  -55.825 49.196  1.00 47.09  ? 460 ASP A C   1 
ATOM   3507 O O   . ASP A 1 459 ? -2.766  -56.547 48.346  1.00 43.19  ? 460 ASP A O   1 
ATOM   3508 C CB  . ASP A 1 459 ? -2.814  -53.587 48.215  1.00 34.56  ? 460 ASP A CB  1 
ATOM   3509 C CG  . ASP A 1 459 ? -3.902  -53.237 49.220  1.00 45.65  ? 460 ASP A CG  1 
ATOM   3510 O OD1 . ASP A 1 459 ? -3.965  -53.869 50.295  1.00 45.76  ? 460 ASP A OD1 1 
ATOM   3511 O OD2 . ASP A 1 459 ? -4.706  -52.328 48.926  1.00 55.85  ? 460 ASP A OD2 1 
ATOM   3512 N N   . PRO A 1 460 ? -2.095  -56.194 50.481  1.00 54.46  ? 461 PRO A N   1 
ATOM   3513 C CA  . PRO A 1 460 ? -2.460  -57.526 50.986  1.00 56.77  ? 461 PRO A CA  1 
ATOM   3514 C C   . PRO A 1 460 ? -3.930  -57.861 50.746  1.00 51.09  ? 461 PRO A C   1 
ATOM   3515 O O   . PRO A 1 460 ? -4.253  -58.984 50.354  1.00 59.96  ? 461 PRO A O   1 
ATOM   3516 C CB  . PRO A 1 460 ? -2.181  -57.418 52.490  1.00 47.34  ? 461 PRO A CB  1 
ATOM   3517 C CG  . PRO A 1 460 ? -1.163  -56.342 52.605  1.00 58.30  ? 461 PRO A CG  1 
ATOM   3518 C CD  . PRO A 1 460 ? -1.519  -55.345 51.539  1.00 44.69  ? 461 PRO A CD  1 
ATOM   3519 N N   . SER A 1 461 ? -4.802  -56.881 50.958  1.00 37.42  ? 462 SER A N   1 
ATOM   3520 C CA  . SER A 1 461 ? -6.235  -57.069 50.769  1.00 40.00  ? 462 SER A CA  1 
ATOM   3521 C C   . SER A 1 461 ? -6.687  -57.230 49.310  1.00 51.70  ? 462 SER A C   1 
ATOM   3522 O O   . SER A 1 461 ? -7.882  -57.271 49.035  1.00 58.28  ? 462 SER A O   1 
ATOM   3523 C CB  . SER A 1 461 ? -6.997  -55.911 51.405  1.00 48.21  ? 462 SER A CB  1 
ATOM   3524 O OG  . SER A 1 461 ? -6.754  -54.707 50.712  1.00 46.02  ? 462 SER A OG  1 
ATOM   3525 N N   . ARG A 1 462 ? -5.751  -57.306 48.373  1.00 45.12  ? 463 ARG A N   1 
ATOM   3526 C CA  . ARG A 1 462 ? -6.125  -57.590 46.989  1.00 54.70  ? 463 ARG A CA  1 
ATOM   3527 C C   . ARG A 1 462 ? -5.618  -58.970 46.579  1.00 45.13  ? 463 ARG A C   1 
ATOM   3528 O O   . ARG A 1 462 ? -4.834  -59.582 47.302  1.00 51.73  ? 463 ARG A O   1 
ATOM   3529 C CB  . ARG A 1 462 ? -5.650  -56.483 46.043  1.00 42.95  ? 463 ARG A CB  1 
ATOM   3530 C CG  . ARG A 1 462 ? -6.310  -55.150 46.348  1.00 45.78  ? 463 ARG A CG  1 
ATOM   3531 C CD  . ARG A 1 462 ? -5.861  -54.048 45.408  1.00 45.43  ? 463 ARG A CD  1 
ATOM   3532 N NE  . ARG A 1 462 ? -6.312  -52.732 45.860  1.00 51.99  ? 463 ARG A NE  1 
ATOM   3533 C CZ  . ARG A 1 462 ? -7.370  -52.094 45.369  1.00 52.42  ? 463 ARG A CZ  1 
ATOM   3534 N NH1 . ARG A 1 462 ? -8.086  -52.643 44.395  1.00 48.63  ? 463 ARG A NH1 1 
ATOM   3535 N NH2 . ARG A 1 462 ? -7.705  -50.899 45.844  1.00 48.81  ? 463 ARG A NH2 1 
ATOM   3536 N N   . ASN A 1 463 ? -6.068  -59.459 45.429  1.00 47.48  ? 464 ASN A N   1 
ATOM   3537 C CA  . ASN A 1 463 ? -5.923  -60.879 45.114  1.00 54.96  ? 464 ASN A CA  1 
ATOM   3538 C C   . ASN A 1 463 ? -4.886  -61.205 44.049  1.00 46.78  ? 464 ASN A C   1 
ATOM   3539 O O   . ASN A 1 463 ? -5.075  -62.119 43.251  1.00 58.50  ? 464 ASN A O   1 
ATOM   3540 C CB  . ASN A 1 463 ? -7.280  -61.475 44.720  1.00 54.72  ? 464 ASN A CB  1 
ATOM   3541 C CG  . ASN A 1 463 ? -8.249  -61.535 45.886  1.00 74.00  ? 464 ASN A CG  1 
ATOM   3542 O OD1 . ASN A 1 463 ? -7.838  -61.688 47.040  1.00 77.32  ? 464 ASN A OD1 1 
ATOM   3543 N ND2 . ASN A 1 463 ? -9.542  -61.413 45.593  1.00 70.60  ? 464 ASN A ND2 1 
ATOM   3544 N N   . TYR A 1 464 ? -3.786  -60.467 44.042  1.00 40.87  ? 465 TYR A N   1 
ATOM   3545 C CA  . TYR A 1 464 ? -2.750  -60.691 43.044  1.00 42.94  ? 465 TYR A CA  1 
ATOM   3546 C C   . TYR A 1 464 ? -1.883  -61.879 43.442  1.00 35.05  ? 465 TYR A C   1 
ATOM   3547 O O   . TYR A 1 464 ? -1.713  -62.162 44.619  1.00 39.39  ? 465 TYR A O   1 
ATOM   3548 C CB  . TYR A 1 464 ? -1.895  -59.427 42.863  1.00 37.22  ? 465 TYR A CB  1 
ATOM   3549 C CG  . TYR A 1 464 ? -2.624  -58.265 42.212  1.00 30.29  ? 465 TYR A CG  1 
ATOM   3550 C CD1 . TYR A 1 464 ? -3.349  -57.359 42.976  1.00 28.83  ? 465 TYR A CD1 1 
ATOM   3551 C CD2 . TYR A 1 464 ? -2.578  -58.074 40.832  1.00 31.36  ? 465 TYR A CD2 1 
ATOM   3552 C CE1 . TYR A 1 464 ? -4.013  -56.296 42.392  1.00 31.15  ? 465 TYR A CE1 1 
ATOM   3553 C CE2 . TYR A 1 464 ? -3.243  -57.016 40.235  1.00 25.52  ? 465 TYR A CE2 1 
ATOM   3554 C CZ  . TYR A 1 464 ? -3.952  -56.128 41.018  1.00 38.41  ? 465 TYR A CZ  1 
ATOM   3555 O OH  . TYR A 1 464 ? -4.610  -55.075 40.427  1.00 37.79  ? 465 TYR A OH  1 
ATOM   3556 N N   . THR A 1 465 ? -1.329  -62.574 42.459  1.00 39.61  ? 466 THR A N   1 
ATOM   3557 C CA  . THR A 1 465 ? -0.430  -63.684 42.743  1.00 37.08  ? 466 THR A CA  1 
ATOM   3558 C C   . THR A 1 465 ? 0.908   -63.196 43.292  1.00 36.31  ? 466 THR A C   1 
ATOM   3559 O O   . THR A 1 465 ? 1.237   -62.015 43.195  1.00 45.17  ? 466 THR A O   1 
ATOM   3560 C CB  . THR A 1 465 ? -0.151  -64.515 41.478  1.00 40.90  ? 466 THR A CB  1 
ATOM   3561 O OG1 . THR A 1 465 ? 0.608   -63.734 40.546  1.00 45.71  ? 466 THR A OG1 1 
ATOM   3562 C CG2 . THR A 1 465 ? -1.454  -64.956 40.833  1.00 31.48  ? 466 THR A CG2 1 
ATOM   3563 N N   . ALA A 1 466 ? 1.684   -64.114 43.855  1.00 39.75  ? 467 ALA A N   1 
ATOM   3564 C CA  . ALA A 1 466 ? 3.025   -63.790 44.324  1.00 42.27  ? 467 ALA A CA  1 
ATOM   3565 C C   . ALA A 1 466 ? 3.928   -63.401 43.146  1.00 39.40  ? 467 ALA A C   1 
ATOM   3566 O O   . ALA A 1 466 ? 4.829   -62.575 43.291  1.00 43.43  ? 467 ALA A O   1 
ATOM   3567 C CB  . ALA A 1 466 ? 3.622   -64.967 45.114  1.00 27.46  ? 467 ALA A CB  1 
ATOM   3568 N N   . GLU A 1 467 ? 3.683   -64.000 41.983  1.00 42.84  ? 468 GLU A N   1 
ATOM   3569 C CA  . GLU A 1 467 ? 4.407   -63.639 40.763  1.00 41.86  ? 468 GLU A CA  1 
ATOM   3570 C C   . GLU A 1 467 ? 4.118   -62.196 40.367  1.00 38.99  ? 468 GLU A C   1 
ATOM   3571 O O   . GLU A 1 467 ? 5.018   -61.454 39.975  1.00 30.61  ? 468 GLU A O   1 
ATOM   3572 C CB  . GLU A 1 467 ? 4.003   -64.545 39.604  1.00 41.35  ? 468 GLU A CB  1 
ATOM   3573 C CG  . GLU A 1 467 ? 4.723   -65.873 39.517  1.00 57.65  ? 468 GLU A CG  1 
ATOM   3574 C CD  . GLU A 1 467 ? 4.181   -66.728 38.375  1.00 98.03  ? 468 GLU A CD  1 
ATOM   3575 O OE1 . GLU A 1 467 ? 2.967   -66.631 38.067  1.00 82.73  ? 468 GLU A OE1 1 
ATOM   3576 O OE2 . GLU A 1 467 ? 4.973   -67.486 37.776  1.00 97.80  ? 468 GLU A OE2 1 
ATOM   3577 N N   . GLU A 1 468 ? 2.852   -61.808 40.453  1.00 30.60  ? 469 GLU A N   1 
ATOM   3578 C CA  . GLU A 1 468 ? 2.458   -60.458 40.097  1.00 27.08  ? 469 GLU A CA  1 
ATOM   3579 C C   . GLU A 1 468 ? 3.091   -59.430 41.038  1.00 44.95  ? 469 GLU A C   1 
ATOM   3580 O O   . GLU A 1 468 ? 3.469   -58.336 40.599  1.00 33.97  ? 469 GLU A O   1 
ATOM   3581 C CB  . GLU A 1 468 ? 0.936   -60.340 40.043  1.00 25.59  ? 469 GLU A CB  1 
ATOM   3582 C CG  . GLU A 1 468 ? 0.345   -61.002 38.802  1.00 30.14  ? 469 GLU A CG  1 
ATOM   3583 C CD  . GLU A 1 468 ? -1.172  -61.050 38.809  1.00 39.27  ? 469 GLU A CD  1 
ATOM   3584 O OE1 . GLU A 1 468 ? -1.757  -61.325 39.875  1.00 42.11  ? 469 GLU A OE1 1 
ATOM   3585 O OE2 . GLU A 1 468 ? -1.786  -60.815 37.743  1.00 40.16  ? 469 GLU A OE2 1 
ATOM   3586 N N   . LYS A 1 469 ? 3.247   -59.795 42.314  1.00 35.52  ? 470 LYS A N   1 
ATOM   3587 C CA  . LYS A 1 469 ? 3.909   -58.910 43.279  1.00 28.23  ? 470 LYS A CA  1 
ATOM   3588 C C   . LYS A 1 469 ? 5.360   -58.653 42.897  1.00 27.29  ? 470 LYS A C   1 
ATOM   3589 O O   . LYS A 1 469 ? 5.804   -57.506 42.835  1.00 37.85  ? 470 LYS A O   1 
ATOM   3590 C CB  . LYS A 1 469 ? 3.805   -59.448 44.712  1.00 32.41  ? 470 LYS A CB  1 
ATOM   3591 C CG  . LYS A 1 469 ? 2.384   -59.437 45.252  1.00 39.50  ? 470 LYS A CG  1 
ATOM   3592 C CD  . LYS A 1 469 ? 2.281   -60.127 46.600  1.00 46.24  ? 470 LYS A CD  1 
ATOM   3593 C CE  . LYS A 1 469 ? 0.843   -60.128 47.091  1.00 44.58  ? 470 LYS A CE  1 
ATOM   3594 N NZ  . LYS A 1 469 ? 0.758   -60.372 48.554  1.00 58.11  ? 470 LYS A NZ  1 
ATOM   3595 N N   . ILE A 1 470 ? 6.096   -59.720 42.630  1.00 32.58  ? 471 ILE A N   1 
ATOM   3596 C CA  . ILE A 1 470 ? 7.472   -59.600 42.168  1.00 36.73  ? 471 ILE A CA  1 
ATOM   3597 C C   . ILE A 1 470 ? 7.568   -58.724 40.918  1.00 37.27  ? 471 ILE A C   1 
ATOM   3598 O O   . ILE A 1 470 ? 8.472   -57.892 40.806  1.00 37.75  ? 471 ILE A O   1 
ATOM   3599 C CB  . ILE A 1 470 ? 8.081   -60.991 41.914  1.00 44.47  ? 471 ILE A CB  1 
ATOM   3600 C CG1 . ILE A 1 470 ? 8.341   -61.694 43.256  1.00 35.08  ? 471 ILE A CG1 1 
ATOM   3601 C CG2 . ILE A 1 470 ? 9.364   -60.886 41.108  1.00 31.58  ? 471 ILE A CG2 1 
ATOM   3602 C CD1 . ILE A 1 470 ? 8.427   -63.201 43.143  1.00 35.06  ? 471 ILE A CD1 1 
ATOM   3603 N N   . PHE A 1 471 ? 6.608   -58.897 40.011  1.00 28.03  ? 472 PHE A N   1 
ATOM   3604 C CA  . PHE A 1 471 ? 6.540   -58.167 38.747  1.00 33.04  ? 472 PHE A CA  1 
ATOM   3605 C C   . PHE A 1 471 ? 6.334   -56.671 38.989  1.00 37.94  ? 472 PHE A C   1 
ATOM   3606 O O   . PHE A 1 471 ? 7.054   -55.828 38.432  1.00 27.79  ? 472 PHE A O   1 
ATOM   3607 C CB  . PHE A 1 471 ? 5.402   -58.746 37.894  1.00 30.06  ? 472 PHE A CB  1 
ATOM   3608 C CG  . PHE A 1 471 ? 5.198   -58.062 36.571  1.00 30.32  ? 472 PHE A CG  1 
ATOM   3609 C CD1 . PHE A 1 471 ? 6.255   -57.894 35.680  1.00 33.63  ? 472 PHE A CD1 1 
ATOM   3610 C CD2 . PHE A 1 471 ? 3.929   -57.643 36.187  1.00 33.04  ? 472 PHE A CD2 1 
ATOM   3611 C CE1 . PHE A 1 471 ? 6.059   -57.283 34.448  1.00 27.76  ? 472 PHE A CE1 1 
ATOM   3612 C CE2 . PHE A 1 471 ? 3.718   -57.031 34.941  1.00 27.23  ? 472 PHE A CE2 1 
ATOM   3613 C CZ  . PHE A 1 471 ? 4.790   -56.854 34.072  1.00 28.12  ? 472 PHE A CZ  1 
ATOM   3614 N N   . ALA A 1 472 ? 5.356   -56.344 39.830  1.00 27.23  ? 473 ALA A N   1 
ATOM   3615 C CA  . ALA A 1 472 ? 5.113   -54.952 40.193  1.00 30.26  ? 473 ALA A CA  1 
ATOM   3616 C C   . ALA A 1 472 ? 6.391   -54.333 40.754  1.00 36.28  ? 473 ALA A C   1 
ATOM   3617 O O   . ALA A 1 472 ? 6.739   -53.192 40.427  1.00 30.63  ? 473 ALA A O   1 
ATOM   3618 C CB  . ALA A 1 472 ? 3.967   -54.839 41.192  1.00 24.11  ? 473 ALA A CB  1 
ATOM   3619 N N   . GLN A 1 473 ? 7.109   -55.111 41.560  1.00 27.70  ? 474 GLN A N   1 
ATOM   3620 C CA  . GLN A 1 473 ? 8.350   -54.645 42.160  1.00 35.85  ? 474 GLN A CA  1 
ATOM   3621 C C   . GLN A 1 473 ? 9.425   -54.393 41.117  1.00 27.02  ? 474 GLN A C   1 
ATOM   3622 O O   . GLN A 1 473 ? 10.183  -53.430 41.227  1.00 30.82  ? 474 GLN A O   1 
ATOM   3623 C CB  . GLN A 1 473 ? 8.841   -55.619 43.232  1.00 29.65  ? 474 GLN A CB  1 
ATOM   3624 C CG  . GLN A 1 473 ? 7.992   -55.578 44.481  1.00 33.49  ? 474 GLN A CG  1 
ATOM   3625 C CD  . GLN A 1 473 ? 8.439   -56.575 45.528  1.00 48.25  ? 474 GLN A CD  1 
ATOM   3626 O OE1 . GLN A 1 473 ? 8.644   -57.757 45.236  1.00 47.22  ? 474 GLN A OE1 1 
ATOM   3627 N NE2 . GLN A 1 473 ? 8.595   -56.102 46.759  1.00 41.78  ? 474 GLN A NE2 1 
ATOM   3628 N N   . ARG A 1 474 ? 9.489   -55.256 40.108  1.00 31.28  ? 475 ARG A N   1 
ATOM   3629 C CA  . ARG A 1 474 ? 10.385  -55.035 38.980  1.00 31.89  ? 475 ARG A CA  1 
ATOM   3630 C C   . ARG A 1 474 ? 10.040  -53.721 38.294  1.00 29.85  ? 475 ARG A C   1 
ATOM   3631 O O   . ARG A 1 474 ? 10.926  -52.932 37.955  1.00 31.41  ? 475 ARG A O   1 
ATOM   3632 C CB  . ARG A 1 474 ? 10.257  -56.155 37.951  1.00 39.92  ? 475 ARG A CB  1 
ATOM   3633 C CG  . ARG A 1 474 ? 11.009  -57.420 38.265  1.00 39.05  ? 475 ARG A CG  1 
ATOM   3634 C CD  . ARG A 1 474 ? 10.817  -58.431 37.130  1.00 39.27  ? 475 ARG A CD  1 
ATOM   3635 N NE  . ARG A 1 474 ? 11.213  -57.878 35.840  1.00 36.66  ? 475 ARG A NE  1 
ATOM   3636 C CZ  . ARG A 1 474 ? 10.604  -58.156 34.691  1.00 38.94  ? 475 ARG A CZ  1 
ATOM   3637 N NH1 . ARG A 1 474 ? 9.562   -58.976 34.669  1.00 35.88  ? 475 ARG A NH1 1 
ATOM   3638 N NH2 . ARG A 1 474 ? 11.031  -57.605 33.564  1.00 27.68  ? 475 ARG A NH2 1 
ATOM   3639 N N   . LEU A 1 475 ? 8.745   -53.496 38.089  1.00 22.98  ? 476 LEU A N   1 
ATOM   3640 C CA  . LEU A 1 475 ? 8.294   -52.334 37.324  1.00 35.27  ? 476 LEU A CA  1 
ATOM   3641 C C   . LEU A 1 475 ? 8.559   -51.033 38.071  1.00 34.11  ? 476 LEU A C   1 
ATOM   3642 O O   . LEU A 1 475 ? 8.985   -50.035 37.470  1.00 30.42  ? 476 LEU A O   1 
ATOM   3643 C CB  . LEU A 1 475 ? 6.815   -52.461 36.949  1.00 30.24  ? 476 LEU A CB  1 
ATOM   3644 C CG  . LEU A 1 475 ? 6.483   -53.542 35.919  1.00 35.56  ? 476 LEU A CG  1 
ATOM   3645 C CD1 . LEU A 1 475 ? 5.030   -53.463 35.540  1.00 42.78  ? 476 LEU A CD1 1 
ATOM   3646 C CD2 . LEU A 1 475 ? 7.355   -53.411 34.687  1.00 27.05  ? 476 LEU A CD2 1 
ATOM   3647 N N   . MET A 1 476 ? 8.310   -51.054 39.381  1.00 28.65  ? 477 MET A N   1 
ATOM   3648 C CA  . MET A 1 476 ? 8.588   -49.898 40.228  1.00 26.94  ? 477 MET A CA  1 
ATOM   3649 C C   . MET A 1 476 ? 10.073  -49.569 40.182  1.00 26.12  ? 477 MET A C   1 
ATOM   3650 O O   . MET A 1 476 ? 10.448  -48.402 40.139  1.00 29.32  ? 477 MET A O   1 
ATOM   3651 C CB  . MET A 1 476 ? 8.131   -50.142 41.668  1.00 35.71  ? 477 MET A CB  1 
ATOM   3652 C CG  . MET A 1 476 ? 6.622   -50.174 41.842  1.00 30.84  ? 477 MET A CG  1 
ATOM   3653 S SD  . MET A 1 476 ? 6.132   -50.108 43.574  1.00 39.99  ? 477 MET A SD  1 
ATOM   3654 C CE  . MET A 1 476 ? 6.829   -51.650 44.165  1.00 34.67  ? 477 MET A CE  1 
ATOM   3655 N N   . ARG A 1 477 ? 10.907  -50.606 40.156  1.00 27.93  ? 478 ARG A N   1 
ATOM   3656 C CA  . ARG A 1 477 ? 12.358  -50.440 40.062  1.00 25.79  ? 478 ARG A CA  1 
ATOM   3657 C C   . ARG A 1 477 ? 12.795  -49.826 38.731  1.00 34.50  ? 478 ARG A C   1 
ATOM   3658 O O   . ARG A 1 477 ? 13.628  -48.914 38.724  1.00 30.31  ? 478 ARG A O   1 
ATOM   3659 C CB  . ARG A 1 477 ? 13.079  -51.775 40.294  1.00 25.95  ? 478 ARG A CB  1 
ATOM   3660 C CG  . ARG A 1 477 ? 14.598  -51.696 40.203  1.00 24.88  ? 478 ARG A CG  1 
ATOM   3661 C CD  . ARG A 1 477 ? 15.180  -50.717 41.224  1.00 37.44  ? 478 ARG A CD  1 
ATOM   3662 N NE  . ARG A 1 477 ? 14.758  -51.055 42.575  1.00 38.61  ? 478 ARG A NE  1 
ATOM   3663 C CZ  . ARG A 1 477 ? 15.322  -52.005 43.311  1.00 38.40  ? 478 ARG A CZ  1 
ATOM   3664 N NH1 . ARG A 1 477 ? 16.337  -52.713 42.833  1.00 35.91  ? 478 ARG A NH1 1 
ATOM   3665 N NH2 . ARG A 1 477 ? 14.867  -52.248 44.525  1.00 29.70  ? 478 ARG A NH2 1 
ATOM   3666 N N   . TYR A 1 478 ? 12.248  -50.314 37.611  1.00 26.59  ? 479 TYR A N   1 
ATOM   3667 C CA  . TYR A 1 478 ? 12.547  -49.704 36.307  1.00 24.95  ? 479 TYR A CA  1 
ATOM   3668 C C   . TYR A 1 478 ? 12.193  -48.217 36.328  1.00 27.26  ? 479 TYR A C   1 
ATOM   3669 O O   . TYR A 1 478 ? 13.021  -47.373 35.983  1.00 29.32  ? 479 TYR A O   1 
ATOM   3670 C CB  . TYR A 1 478 ? 11.785  -50.385 35.154  1.00 30.75  ? 479 TYR A CB  1 
ATOM   3671 C CG  . TYR A 1 478 ? 12.234  -51.789 34.809  1.00 27.53  ? 479 TYR A CG  1 
ATOM   3672 C CD1 . TYR A 1 478 ? 13.576  -52.114 34.722  1.00 25.03  ? 479 TYR A CD1 1 
ATOM   3673 C CD2 . TYR A 1 478 ? 11.304  -52.790 34.569  1.00 30.47  ? 479 TYR A CD2 1 
ATOM   3674 C CE1 . TYR A 1 478 ? 13.980  -53.397 34.403  1.00 29.01  ? 479 TYR A CE1 1 
ATOM   3675 C CE2 . TYR A 1 478 ? 11.698  -54.077 34.254  1.00 25.33  ? 479 TYR A CE2 1 
ATOM   3676 C CZ  . TYR A 1 478 ? 13.034  -54.377 34.171  1.00 28.66  ? 479 TYR A CZ  1 
ATOM   3677 O OH  . TYR A 1 478 ? 13.421  -55.663 33.856  1.00 31.56  ? 479 TYR A OH  1 
ATOM   3678 N N   . TRP A 1 479 ? 10.965  -47.904 36.749  1.00 23.87  ? 480 TRP A N   1 
ATOM   3679 C CA  . TRP A 1 479 ? 10.458  -46.534 36.691  1.00 24.98  ? 480 TRP A CA  1 
ATOM   3680 C C   . TRP A 1 479 ? 11.268  -45.601 37.576  1.00 29.54  ? 480 TRP A C   1 
ATOM   3681 O O   . TRP A 1 479 ? 11.593  -44.474 37.189  1.00 28.48  ? 480 TRP A O   1 
ATOM   3682 C CB  . TRP A 1 479 ? 8.987   -46.488 37.109  1.00 18.49  ? 480 TRP A CB  1 
ATOM   3683 C CG  . TRP A 1 479 ? 8.017   -46.374 35.966  1.00 33.46  ? 480 TRP A CG  1 
ATOM   3684 C CD1 . TRP A 1 479 ? 7.116   -45.374 35.763  1.00 26.03  ? 480 TRP A CD1 1 
ATOM   3685 C CD2 . TRP A 1 479 ? 7.845   -47.298 34.875  1.00 23.83  ? 480 TRP A CD2 1 
ATOM   3686 N NE1 . TRP A 1 479 ? 6.397   -45.611 34.621  1.00 22.56  ? 480 TRP A NE1 1 
ATOM   3687 C CE2 . TRP A 1 479 ? 6.822   -46.787 34.057  1.00 25.27  ? 480 TRP A CE2 1 
ATOM   3688 C CE3 . TRP A 1 479 ? 8.454   -48.510 34.519  1.00 24.84  ? 480 TRP A CE3 1 
ATOM   3689 C CZ2 . TRP A 1 479 ? 6.394   -47.439 32.890  1.00 18.87  ? 480 TRP A CZ2 1 
ATOM   3690 C CZ3 . TRP A 1 479 ? 8.022   -49.161 33.371  1.00 26.03  ? 480 TRP A CZ3 1 
ATOM   3691 C CH2 . TRP A 1 479 ? 7.002   -48.619 32.568  1.00 25.41  ? 480 TRP A CH2 1 
ATOM   3692 N N   . ALA A 1 480 ? 11.595  -46.079 38.770  1.00 26.50  ? 481 ALA A N   1 
ATOM   3693 C CA  . ALA A 1 480 ? 12.319  -45.266 39.736  1.00 29.32  ? 481 ALA A CA  1 
ATOM   3694 C C   . ALA A 1 480 ? 13.794  -45.132 39.342  1.00 30.85  ? 481 ALA A C   1 
ATOM   3695 O O   . ALA A 1 480 ? 14.410  -44.081 39.557  1.00 30.43  ? 481 ALA A O   1 
ATOM   3696 C CB  . ALA A 1 480 ? 12.172  -45.849 41.125  1.00 24.23  ? 481 ALA A CB  1 
ATOM   3697 N N   . ASN A 1 481 ? 14.350  -46.197 38.764  1.00 24.45  ? 482 ASN A N   1 
ATOM   3698 C CA  . ASN A 1 481 ? 15.689  -46.126 38.180  1.00 29.46  ? 482 ASN A CA  1 
ATOM   3699 C C   . ASN A 1 481 ? 15.729  -45.035 37.142  1.00 35.27  ? 482 ASN A C   1 
ATOM   3700 O O   . ASN A 1 481 ? 16.659  -44.216 37.125  1.00 34.47  ? 482 ASN A O   1 
ATOM   3701 C CB  . ASN A 1 481 ? 16.104  -47.453 37.539  1.00 28.79  ? 482 ASN A CB  1 
ATOM   3702 C CG  . ASN A 1 481 ? 16.661  -48.432 38.550  1.00 31.69  ? 482 ASN A CG  1 
ATOM   3703 O OD1 . ASN A 1 481 ? 16.719  -48.132 39.739  1.00 34.61  ? 482 ASN A OD1 1 
ATOM   3704 N ND2 . ASN A 1 481 ? 17.063  -49.612 38.087  1.00 31.56  ? 482 ASN A ND2 1 
ATOM   3705 N N   . PHE A 1 482 ? 14.708  -45.018 36.284  1.00 28.36  ? 483 PHE A N   1 
ATOM   3706 C CA  . PHE A 1 482 ? 14.628  -44.010 35.237  1.00 29.19  ? 483 PHE A CA  1 
ATOM   3707 C C   . PHE A 1 482 ? 14.565  -42.598 35.827  1.00 31.78  ? 483 PHE A C   1 
ATOM   3708 O O   . PHE A 1 482 ? 15.297  -41.708 35.394  1.00 31.64  ? 483 PHE A O   1 
ATOM   3709 C CB  . PHE A 1 482 ? 13.447  -44.265 34.291  1.00 24.62  ? 483 PHE A CB  1 
ATOM   3710 C CG  . PHE A 1 482 ? 13.272  -43.189 33.270  1.00 23.10  ? 483 PHE A CG  1 
ATOM   3711 C CD1 . PHE A 1 482 ? 14.104  -43.128 32.164  1.00 21.87  ? 483 PHE A CD1 1 
ATOM   3712 C CD2 . PHE A 1 482 ? 12.308  -42.209 33.434  1.00 22.05  ? 483 PHE A CD2 1 
ATOM   3713 C CE1 . PHE A 1 482 ? 13.956  -42.123 31.221  1.00 21.17  ? 483 PHE A CE1 1 
ATOM   3714 C CE2 . PHE A 1 482 ? 12.162  -41.197 32.500  1.00 27.08  ? 483 PHE A CE2 1 
ATOM   3715 C CZ  . PHE A 1 482 ? 12.994  -41.154 31.392  1.00 25.93  ? 483 PHE A CZ  1 
ATOM   3716 N N   . ALA A 1 483 ? 13.700  -42.399 36.817  1.00 25.78  ? 484 ALA A N   1 
ATOM   3717 C CA  . ALA A 1 483 ? 13.614  -41.115 37.507  1.00 31.48  ? 484 ALA A CA  1 
ATOM   3718 C C   . ALA A 1 483 ? 14.950  -40.669 38.135  1.00 36.34  ? 484 ALA A C   1 
ATOM   3719 O O   . ALA A 1 483 ? 15.264  -39.474 38.181  1.00 33.41  ? 484 ALA A O   1 
ATOM   3720 C CB  . ALA A 1 483 ? 12.518  -41.168 38.574  1.00 25.85  ? 484 ALA A CB  1 
ATOM   3721 N N   . ARG A 1 484 ? 15.728  -41.631 38.624  1.00 28.42  ? 485 ARG A N   1 
ATOM   3722 C CA  . ARG A 1 484 ? 16.984  -41.316 39.299  1.00 33.33  ? 485 ARG A CA  1 
ATOM   3723 C C   . ARG A 1 484 ? 18.121  -41.026 38.332  1.00 33.76  ? 485 ARG A C   1 
ATOM   3724 O O   . ARG A 1 484 ? 18.949  -40.172 38.609  1.00 41.88  ? 485 ARG A O   1 
ATOM   3725 C CB  . ARG A 1 484 ? 17.395  -42.439 40.263  1.00 31.82  ? 485 ARG A CB  1 
ATOM   3726 C CG  . ARG A 1 484 ? 16.600  -42.462 41.568  1.00 34.33  ? 485 ARG A CG  1 
ATOM   3727 C CD  . ARG A 1 484 ? 17.091  -43.552 42.521  1.00 23.49  ? 485 ARG A CD  1 
ATOM   3728 N NE  . ARG A 1 484 ? 16.868  -44.896 41.990  1.00 33.35  ? 485 ARG A NE  1 
ATOM   3729 C CZ  . ARG A 1 484 ? 15.880  -45.693 42.384  1.00 29.65  ? 485 ARG A CZ  1 
ATOM   3730 N NH1 . ARG A 1 484 ? 15.029  -45.276 43.316  1.00 28.15  ? 485 ARG A NH1 1 
ATOM   3731 N NH2 . ARG A 1 484 ? 15.741  -46.900 41.850  1.00 25.59  ? 485 ARG A NH2 1 
ATOM   3732 N N   . THR A 1 485 ? 18.157  -41.729 37.201  1.00 28.50  ? 486 THR A N   1 
ATOM   3733 C CA  . THR A 1 485 ? 19.329  -41.703 36.322  1.00 25.38  ? 486 THR A CA  1 
ATOM   3734 C C   . THR A 1 485 ? 19.050  -41.472 34.830  1.00 30.99  ? 486 THR A C   1 
ATOM   3735 O O   . THR A 1 485 ? 19.981  -41.337 34.037  1.00 35.35  ? 486 THR A O   1 
ATOM   3736 C CB  . THR A 1 485 ? 20.120  -43.027 36.419  1.00 32.19  ? 486 THR A CB  1 
ATOM   3737 O OG1 . THR A 1 485 ? 19.357  -44.086 35.824  1.00 33.83  ? 486 THR A OG1 1 
ATOM   3738 C CG2 . THR A 1 485 ? 20.440  -43.379 37.873  1.00 29.76  ? 486 THR A CG2 1 
ATOM   3739 N N   . GLY A 1 486 ? 17.783  -41.452 34.436  1.00 31.58  ? 487 GLY A N   1 
ATOM   3740 C CA  . GLY A 1 486 ? 17.448  -41.400 33.021  1.00 36.06  ? 487 GLY A CA  1 
ATOM   3741 C C   . GLY A 1 486 ? 17.659  -42.729 32.305  1.00 31.66  ? 487 GLY A C   1 
ATOM   3742 O O   . GLY A 1 486 ? 17.699  -42.790 31.080  1.00 36.10  ? 487 GLY A O   1 
ATOM   3743 N N   . ASP A 1 487 ? 17.774  -43.806 33.072  1.00 32.25  ? 488 ASP A N   1 
ATOM   3744 C CA  . ASP A 1 487 ? 18.001  -45.125 32.496  1.00 33.40  ? 488 ASP A CA  1 
ATOM   3745 C C   . ASP A 1 487 ? 17.372  -46.190 33.406  1.00 29.92  ? 488 ASP A C   1 
ATOM   3746 O O   . ASP A 1 487 ? 17.782  -46.355 34.557  1.00 36.91  ? 488 ASP A O   1 
ATOM   3747 C CB  . ASP A 1 487 ? 19.511  -45.324 32.290  1.00 29.51  ? 488 ASP A CB  1 
ATOM   3748 C CG  . ASP A 1 487 ? 19.890  -46.730 31.859  1.00 32.19  ? 488 ASP A CG  1 
ATOM   3749 O OD1 . ASP A 1 487 ? 19.006  -47.564 31.574  1.00 42.93  ? 488 ASP A OD1 1 
ATOM   3750 O OD2 . ASP A 1 487 ? 21.109  -46.997 31.797  1.00 42.13  ? 488 ASP A OD2 1 
ATOM   3751 N N   . PRO A 1 488 ? 16.362  -46.909 32.884  1.00 35.67  ? 489 PRO A N   1 
ATOM   3752 C CA  . PRO A 1 488 ? 15.593  -47.882 33.674  1.00 31.98  ? 489 PRO A CA  1 
ATOM   3753 C C   . PRO A 1 488 ? 16.430  -49.070 34.129  1.00 34.47  ? 489 PRO A C   1 
ATOM   3754 O O   . PRO A 1 488 ? 16.060  -49.755 35.084  1.00 35.56  ? 489 PRO A O   1 
ATOM   3755 C CB  . PRO A 1 488 ? 14.519  -48.362 32.692  1.00 26.02  ? 489 PRO A CB  1 
ATOM   3756 C CG  . PRO A 1 488 ? 15.140  -48.145 31.324  1.00 31.02  ? 489 PRO A CG  1 
ATOM   3757 C CD  . PRO A 1 488 ? 15.927  -46.872 31.473  1.00 30.19  ? 489 PRO A CD  1 
ATOM   3758 N N   . ASN A 1 489 ? 17.548  -49.310 33.456  1.00 33.64  ? 490 ASN A N   1 
ATOM   3759 C CA  . ASN A 1 489 ? 18.329  -50.517 33.705  1.00 33.81  ? 490 ASN A CA  1 
ATOM   3760 C C   . ASN A 1 489 ? 18.908  -50.692 35.102  1.00 43.93  ? 490 ASN A C   1 
ATOM   3761 O O   . ASN A 1 489 ? 19.418  -49.747 35.709  1.00 40.06  ? 490 ASN A O   1 
ATOM   3762 C CB  . ASN A 1 489 ? 19.445  -50.659 32.677  1.00 34.51  ? 490 ASN A CB  1 
ATOM   3763 C CG  . ASN A 1 489 ? 18.927  -51.036 31.327  1.00 34.94  ? 490 ASN A CG  1 
ATOM   3764 O OD1 . ASN A 1 489 ? 18.544  -52.183 31.100  1.00 40.08  ? 490 ASN A OD1 1 
ATOM   3765 N ND2 . ASN A 1 489 ? 18.901  -50.074 30.414  1.00 27.86  ? 490 ASN A ND2 1 
ATOM   3766 N N   . GLU A 1 490 ? 18.816  -51.928 35.581  1.00 48.34  ? 491 GLU A N   1 
ATOM   3767 C CA  . GLU A 1 490 ? 19.526  -52.406 36.755  1.00 58.38  ? 491 GLU A CA  1 
ATOM   3768 C C   . GLU A 1 490 ? 20.957  -52.792 36.361  1.00 72.82  ? 491 GLU A C   1 
ATOM   3769 O O   . GLU A 1 490 ? 21.256  -52.908 35.171  1.00 75.24  ? 491 GLU A O   1 
ATOM   3770 C CB  . GLU A 1 490 ? 18.789  -53.627 37.311  1.00 59.48  ? 491 GLU A CB  1 
ATOM   3771 C CG  . GLU A 1 490 ? 17.537  -53.302 38.121  1.00 62.63  ? 491 GLU A CG  1 
ATOM   3772 C CD  . GLU A 1 490 ? 17.856  -52.862 39.548  1.00 52.44  ? 491 GLU A CD  1 
ATOM   3773 O OE1 . GLU A 1 490 ? 18.695  -51.955 39.730  1.00 60.57  ? 491 GLU A OE1 1 
ATOM   3774 O OE2 . GLU A 1 490 ? 17.274  -53.434 40.493  1.00 62.82  ? 491 GLU A OE2 1 
ATOM   3775 N N   . PRO A 1 491 ? 21.852  -52.976 37.351  1.00 81.14  ? 492 PRO A N   1 
ATOM   3776 C CA  . PRO A 1 491 ? 23.186  -53.520 37.055  1.00 90.00  ? 492 PRO A CA  1 
ATOM   3777 C C   . PRO A 1 491 ? 23.132  -54.829 36.254  1.00 90.74  ? 492 PRO A C   1 
ATOM   3778 O O   . PRO A 1 491 ? 22.236  -55.651 36.465  1.00 78.10  ? 492 PRO A O   1 
ATOM   3779 C CB  . PRO A 1 491 ? 23.774  -53.765 38.445  1.00 75.80  ? 492 PRO A CB  1 
ATOM   3780 C CG  . PRO A 1 491 ? 23.148  -52.704 39.289  1.00 77.53  ? 492 PRO A CG  1 
ATOM   3781 C CD  . PRO A 1 491 ? 21.746  -52.513 38.749  1.00 77.77  ? 492 PRO A CD  1 
ATOM   3782 N N   . ARG A 1 492 ? 24.093  -55.006 35.350  1.00 92.94  ? 493 ARG A N   1 
ATOM   3783 C CA  . ARG A 1 492 ? 24.071  -56.099 34.378  1.00 89.69  ? 493 ARG A CA  1 
ATOM   3784 C C   . ARG A 1 492 ? 23.969  -57.487 35.013  1.00 98.75  ? 493 ARG A C   1 
ATOM   3785 O O   . ARG A 1 492 ? 24.547  -57.743 36.076  1.00 87.68  ? 493 ARG A O   1 
ATOM   3786 C CB  . ARG A 1 492 ? 25.285  -56.016 33.447  1.00 72.10  ? 493 ARG A CB  1 
ATOM   3787 C CG  . ARG A 1 492 ? 25.269  -57.032 32.323  1.00 89.01  ? 493 ARG A CG  1 
ATOM   3788 C CD  . ARG A 1 492 ? 26.293  -56.692 31.257  1.00 117.78 ? 493 ARG A CD  1 
ATOM   3789 N NE  . ARG A 1 492 ? 26.019  -55.400 30.635  1.00 117.30 ? 493 ARG A NE  1 
ATOM   3790 C CZ  . ARG A 1 492 ? 26.630  -54.952 29.543  1.00 121.17 ? 493 ARG A CZ  1 
ATOM   3791 N NH1 . ARG A 1 492 ? 27.552  -55.694 28.941  1.00 112.39 ? 493 ARG A NH1 1 
ATOM   3792 N NH2 . ARG A 1 492 ? 26.313  -53.761 29.049  1.00 118.58 ? 493 ARG A NH2 1 
ATOM   3793 N N   . ASP A 1 493 ? 23.219  -58.363 34.344  1.00 97.48  ? 494 ASP A N   1 
ATOM   3794 C CA  . ASP A 1 493 ? 22.956  -59.722 34.807  1.00 98.74  ? 494 ASP A CA  1 
ATOM   3795 C C   . ASP A 1 493 ? 22.187  -60.497 33.739  1.00 87.09  ? 494 ASP A C   1 
ATOM   3796 O O   . ASP A 1 493 ? 22.672  -61.494 33.205  1.00 83.66  ? 494 ASP A O   1 
ATOM   3797 C CB  . ASP A 1 493 ? 22.156  -59.696 36.115  1.00 110.65 ? 494 ASP A CB  1 
ATOM   3798 C CG  . ASP A 1 493 ? 21.857  -61.084 36.650  1.00 105.19 ? 494 ASP A CG  1 
ATOM   3799 O OD1 . ASP A 1 493 ? 22.618  -62.025 36.343  1.00 104.25 ? 494 ASP A OD1 1 
ATOM   3800 O OD2 . ASP A 1 493 ? 20.859  -61.232 37.386  1.00 101.07 ? 494 ASP A OD2 1 
ATOM   3801 N N   . PRO A 1 497 ? 19.021  -59.256 31.614  1.00 75.03  ? 498 PRO A N   1 
ATOM   3802 C CA  . PRO A 1 497 ? 19.041  -58.797 30.214  1.00 78.84  ? 498 PRO A CA  1 
ATOM   3803 C C   . PRO A 1 497 ? 18.787  -57.291 30.128  1.00 62.60  ? 498 PRO A C   1 
ATOM   3804 O O   . PRO A 1 497 ? 17.929  -56.772 30.846  1.00 55.90  ? 498 PRO A O   1 
ATOM   3805 C CB  . PRO A 1 497 ? 17.892  -59.577 29.560  1.00 66.32  ? 498 PRO A CB  1 
ATOM   3806 C CG  . PRO A 1 497 ? 17.647  -60.744 30.474  1.00 74.65  ? 498 PRO A CG  1 
ATOM   3807 C CD  . PRO A 1 497 ? 17.960  -60.248 31.859  1.00 69.09  ? 498 PRO A CD  1 
ATOM   3808 N N   . GLN A 1 498 ? 19.529  -56.598 29.270  1.00 43.06  ? 499 GLN A N   1 
ATOM   3809 C CA  . GLN A 1 498 ? 19.503  -55.145 29.271  1.00 38.10  ? 499 GLN A CA  1 
ATOM   3810 C C   . GLN A 1 498 ? 18.403  -54.563 28.376  1.00 49.98  ? 499 GLN A C   1 
ATOM   3811 O O   . GLN A 1 498 ? 18.048  -55.135 27.347  1.00 40.35  ? 499 GLN A O   1 
ATOM   3812 C CB  . GLN A 1 498 ? 20.870  -54.585 28.884  1.00 38.77  ? 499 GLN A CB  1 
ATOM   3813 C CG  . GLN A 1 498 ? 21.973  -54.885 29.889  1.00 51.47  ? 499 GLN A CG  1 
ATOM   3814 C CD  . GLN A 1 498 ? 21.729  -54.266 31.261  1.00 55.80  ? 499 GLN A CD  1 
ATOM   3815 O OE1 . GLN A 1 498 ? 21.851  -53.051 31.438  1.00 50.94  ? 499 GLN A OE1 1 
ATOM   3816 N NE2 . GLN A 1 498 ? 21.395  -55.105 32.242  1.00 42.59  ? 499 GLN A NE2 1 
ATOM   3817 N N   . TRP A 1 499 ? 17.867  -53.424 28.802  1.00 44.88  ? 500 TRP A N   1 
ATOM   3818 C CA  . TRP A 1 499 ? 16.825  -52.706 28.087  1.00 31.35  ? 500 TRP A CA  1 
ATOM   3819 C C   . TRP A 1 499 ? 17.510  -51.639 27.246  1.00 32.07  ? 500 TRP A C   1 
ATOM   3820 O O   . TRP A 1 499 ? 17.967  -50.636 27.777  1.00 38.79  ? 500 TRP A O   1 
ATOM   3821 C CB  . TRP A 1 499 ? 15.858  -52.077 29.109  1.00 31.78  ? 500 TRP A CB  1 
ATOM   3822 C CG  . TRP A 1 499 ? 14.657  -51.330 28.549  1.00 38.35  ? 500 TRP A CG  1 
ATOM   3823 C CD1 . TRP A 1 499 ? 14.481  -50.872 27.268  1.00 34.05  ? 500 TRP A CD1 1 
ATOM   3824 C CD2 . TRP A 1 499 ? 13.469  -50.957 29.269  1.00 30.23  ? 500 TRP A CD2 1 
ATOM   3825 N NE1 . TRP A 1 499 ? 13.263  -50.241 27.152  1.00 29.19  ? 500 TRP A NE1 1 
ATOM   3826 C CE2 . TRP A 1 499 ? 12.624  -50.281 28.363  1.00 29.00  ? 500 TRP A CE2 1 
ATOM   3827 C CE3 . TRP A 1 499 ? 13.040  -51.132 30.588  1.00 31.94  ? 500 TRP A CE3 1 
ATOM   3828 C CZ2 . TRP A 1 499 ? 11.379  -49.780 28.736  1.00 28.44  ? 500 TRP A CZ2 1 
ATOM   3829 C CZ3 . TRP A 1 499 ? 11.804  -50.635 30.956  1.00 28.22  ? 500 TRP A CZ3 1 
ATOM   3830 C CH2 . TRP A 1 499 ? 10.987  -49.967 30.035  1.00 29.67  ? 500 TRP A CH2 1 
ATOM   3831 N N   . PRO A 1 500 ? 17.578  -51.853 25.923  1.00 35.09  ? 501 PRO A N   1 
ATOM   3832 C CA  . PRO A 1 500 ? 18.274  -50.937 25.010  1.00 34.73  ? 501 PRO A CA  1 
ATOM   3833 C C   . PRO A 1 500 ? 17.433  -49.724 24.660  1.00 31.63  ? 501 PRO A C   1 
ATOM   3834 O O   . PRO A 1 500 ? 16.208  -49.809 24.655  1.00 36.14  ? 501 PRO A O   1 
ATOM   3835 C CB  . PRO A 1 500 ? 18.465  -51.777 23.740  1.00 28.56  ? 501 PRO A CB  1 
ATOM   3836 C CG  . PRO A 1 500 ? 17.559  -52.981 23.893  1.00 37.91  ? 501 PRO A CG  1 
ATOM   3837 C CD  . PRO A 1 500 ? 16.823  -52.883 25.194  1.00 28.72  ? 501 PRO A CD  1 
ATOM   3838 N N   . PRO A 1 501 ? 18.086  -48.603 24.356  1.00 29.15  ? 502 PRO A N   1 
ATOM   3839 C CA  . PRO A 1 501 ? 17.391  -47.404 23.872  1.00 27.41  ? 502 PRO A CA  1 
ATOM   3840 C C   . PRO A 1 501 ? 16.671  -47.645 22.543  1.00 38.43  ? 502 PRO A C   1 
ATOM   3841 O O   . PRO A 1 501 ? 17.154  -48.407 21.698  1.00 30.30  ? 502 PRO A O   1 
ATOM   3842 C CB  . PRO A 1 501 ? 18.532  -46.394 23.663  1.00 24.55  ? 502 PRO A CB  1 
ATOM   3843 C CG  . PRO A 1 501 ? 19.610  -46.844 24.591  1.00 30.56  ? 502 PRO A CG  1 
ATOM   3844 C CD  . PRO A 1 501 ? 19.516  -48.358 24.611  1.00 26.29  ? 502 PRO A CD  1 
ATOM   3845 N N   . TYR A 1 502 ? 15.523  -46.994 22.370  1.00 33.98  ? 503 TYR A N   1 
ATOM   3846 C CA  . TYR A 1 502 ? 14.786  -47.022 21.114  1.00 29.58  ? 503 TYR A CA  1 
ATOM   3847 C C   . TYR A 1 502 ? 15.413  -46.036 20.138  1.00 30.28  ? 503 TYR A C   1 
ATOM   3848 O O   . TYR A 1 502 ? 15.724  -44.909 20.507  1.00 30.60  ? 503 TYR A O   1 
ATOM   3849 C CB  . TYR A 1 502 ? 13.324  -46.637 21.361  1.00 35.81  ? 503 TYR A CB  1 
ATOM   3850 C CG  . TYR A 1 502 ? 12.440  -46.654 20.126  1.00 28.02  ? 503 TYR A CG  1 
ATOM   3851 C CD1 . TYR A 1 502 ? 12.316  -45.530 19.311  1.00 30.01  ? 503 TYR A CD1 1 
ATOM   3852 C CD2 . TYR A 1 502 ? 11.716  -47.793 19.785  1.00 30.93  ? 503 TYR A CD2 1 
ATOM   3853 C CE1 . TYR A 1 502 ? 11.504  -45.547 18.187  1.00 29.80  ? 503 TYR A CE1 1 
ATOM   3854 C CE2 . TYR A 1 502 ? 10.902  -47.818 18.665  1.00 25.11  ? 503 TYR A CE2 1 
ATOM   3855 C CZ  . TYR A 1 502 ? 10.799  -46.694 17.871  1.00 27.72  ? 503 TYR A CZ  1 
ATOM   3856 O OH  . TYR A 1 502 ? 9.992   -46.724 16.754  1.00 37.98  ? 503 TYR A OH  1 
ATOM   3857 N N   . THR A 1 503 ? 15.592  -46.458 18.893  1.00 28.53  ? 504 THR A N   1 
ATOM   3858 C CA  . THR A 1 503 ? 16.148  -45.588 17.857  1.00 35.95  ? 504 THR A CA  1 
ATOM   3859 C C   . THR A 1 503 ? 15.272  -45.659 16.608  1.00 35.84  ? 504 THR A C   1 
ATOM   3860 O O   . THR A 1 503 ? 14.562  -46.648 16.404  1.00 32.46  ? 504 THR A O   1 
ATOM   3861 C CB  . THR A 1 503 ? 17.595  -45.991 17.507  1.00 30.06  ? 504 THR A CB  1 
ATOM   3862 O OG1 . THR A 1 503 ? 17.650  -47.400 17.253  1.00 37.28  ? 504 THR A OG1 1 
ATOM   3863 C CG2 . THR A 1 503 ? 18.535  -45.669 18.669  1.00 28.59  ? 504 THR A CG2 1 
ATOM   3864 N N   . ALA A 1 504 ? 15.303  -44.614 15.784  1.00 36.22  ? 505 ALA A N   1 
ATOM   3865 C CA  . ALA A 1 504 ? 14.471  -44.587 14.571  1.00 39.70  ? 505 ALA A CA  1 
ATOM   3866 C C   . ALA A 1 504 ? 14.739  -45.767 13.637  1.00 27.91  ? 505 ALA A C   1 
ATOM   3867 O O   . ALA A 1 504 ? 13.820  -46.280 13.004  1.00 36.56  ? 505 ALA A O   1 
ATOM   3868 C CB  . ALA A 1 504 ? 14.630  -43.277 13.827  1.00 31.09  ? 505 ALA A CB  1 
ATOM   3869 N N   . GLY A 1 505 ? 15.987  -46.224 13.588  1.00 34.45  ? 506 GLY A N   1 
ATOM   3870 C CA  . GLY A 1 505 ? 16.344  -47.350 12.739  1.00 19.92  ? 506 GLY A CA  1 
ATOM   3871 C C   . GLY A 1 505 ? 16.132  -48.722 13.349  1.00 28.75  ? 506 GLY A C   1 
ATOM   3872 O O   . GLY A 1 505 ? 15.350  -49.523 12.844  1.00 32.75  ? 506 GLY A O   1 
ATOM   3873 N N   . ALA A 1 506 ? 16.830  -49.014 14.441  1.00 36.26  ? 507 ALA A N   1 
ATOM   3874 C CA  . ALA A 1 506 ? 16.712  -50.343 15.031  1.00 30.27  ? 507 ALA A CA  1 
ATOM   3875 C C   . ALA A 1 506 ? 15.342  -50.567 15.694  1.00 29.34  ? 507 ALA A C   1 
ATOM   3876 O O   . ALA A 1 506 ? 14.842  -51.690 15.720  1.00 29.51  ? 507 ALA A O   1 
ATOM   3877 C CB  . ALA A 1 506 ? 17.853  -50.613 15.986  1.00 22.66  ? 507 ALA A CB  1 
ATOM   3878 N N   . GLN A 1 507 ? 14.744  -49.490 16.205  1.00 28.70  ? 508 GLN A N   1 
ATOM   3879 C CA  . GLN A 1 507 ? 13.369  -49.515 16.717  1.00 32.95  ? 508 GLN A CA  1 
ATOM   3880 C C   . GLN A 1 507 ? 13.161  -50.536 17.829  1.00 32.33  ? 508 GLN A C   1 
ATOM   3881 O O   . GLN A 1 507 ? 12.126  -51.201 17.887  1.00 30.34  ? 508 GLN A O   1 
ATOM   3882 C CB  . GLN A 1 507 ? 12.377  -49.794 15.581  1.00 28.36  ? 508 GLN A CB  1 
ATOM   3883 C CG  . GLN A 1 507 ? 12.243  -48.670 14.561  1.00 31.11  ? 508 GLN A CG  1 
ATOM   3884 C CD  . GLN A 1 507 ? 11.484  -49.115 13.318  1.00 41.25  ? 508 GLN A CD  1 
ATOM   3885 O OE1 . GLN A 1 507 ? 10.282  -49.369 13.367  1.00 37.52  ? 508 GLN A OE1 1 
ATOM   3886 N NE2 . GLN A 1 507 ? 12.191  -49.235 12.204  1.00 27.96  ? 508 GLN A NE2 1 
ATOM   3887 N N   . GLN A 1 508 ? 14.149  -50.668 18.705  1.00 27.88  ? 509 GLN A N   1 
ATOM   3888 C CA  . GLN A 1 508 ? 14.089  -51.680 19.751  1.00 32.52  ? 509 GLN A CA  1 
ATOM   3889 C C   . GLN A 1 508 ? 13.249  -51.255 20.953  1.00 34.70  ? 509 GLN A C   1 
ATOM   3890 O O   . GLN A 1 508 ? 13.294  -50.104 21.402  1.00 30.46  ? 509 GLN A O   1 
ATOM   3891 C CB  . GLN A 1 508 ? 15.491  -52.078 20.201  1.00 28.86  ? 509 GLN A CB  1 
ATOM   3892 C CG  . GLN A 1 508 ? 16.235  -52.932 19.202  1.00 38.91  ? 509 GLN A CG  1 
ATOM   3893 C CD  . GLN A 1 508 ? 17.697  -53.087 19.557  1.00 32.42  ? 509 GLN A CD  1 
ATOM   3894 O OE1 . GLN A 1 508 ? 18.398  -52.103 19.788  1.00 39.87  ? 509 GLN A OE1 1 
ATOM   3895 N NE2 . GLN A 1 508 ? 18.164  -54.328 19.605  1.00 28.12  ? 509 GLN A NE2 1 
ATOM   3896 N N   . TYR A 1 509 ? 12.476  -52.202 21.460  1.00 27.71  ? 510 TYR A N   1 
ATOM   3897 C CA  . TYR A 1 509 ? 11.690  -51.982 22.659  1.00 30.69  ? 510 TYR A CA  1 
ATOM   3898 C C   . TYR A 1 509 ? 11.677  -53.302 23.424  1.00 34.78  ? 510 TYR A C   1 
ATOM   3899 O O   . TYR A 1 509 ? 12.059  -54.332 22.867  1.00 34.06  ? 510 TYR A O   1 
ATOM   3900 C CB  . TYR A 1 509 ? 10.272  -51.552 22.281  1.00 26.45  ? 510 TYR A CB  1 
ATOM   3901 C CG  . TYR A 1 509 ? 9.476   -52.633 21.594  1.00 31.66  ? 510 TYR A CG  1 
ATOM   3902 C CD1 . TYR A 1 509 ? 9.480   -52.762 20.206  1.00 31.55  ? 510 TYR A CD1 1 
ATOM   3903 C CD2 . TYR A 1 509 ? 8.721   -53.533 22.331  1.00 34.54  ? 510 TYR A CD2 1 
ATOM   3904 C CE1 . TYR A 1 509 ? 8.748   -53.760 19.584  1.00 27.28  ? 510 TYR A CE1 1 
ATOM   3905 C CE2 . TYR A 1 509 ? 7.996   -54.534 21.716  1.00 35.41  ? 510 TYR A CE2 1 
ATOM   3906 C CZ  . TYR A 1 509 ? 8.008   -54.641 20.353  1.00 32.52  ? 510 TYR A CZ  1 
ATOM   3907 O OH  . TYR A 1 509 ? 7.275   -55.648 19.780  1.00 44.39  ? 510 TYR A OH  1 
ATOM   3908 N N   . VAL A 1 510 ? 11.248  -53.287 24.686  1.00 27.52  ? 511 VAL A N   1 
ATOM   3909 C CA  . VAL A 1 510 ? 11.144  -54.531 25.443  1.00 26.69  ? 511 VAL A CA  1 
ATOM   3910 C C   . VAL A 1 510 ? 9.707   -54.884 25.786  1.00 27.15  ? 511 VAL A C   1 
ATOM   3911 O O   . VAL A 1 510 ? 8.846   -54.015 25.879  1.00 29.60  ? 511 VAL A O   1 
ATOM   3912 C CB  . VAL A 1 510 ? 11.973  -54.507 26.745  1.00 31.32  ? 511 VAL A CB  1 
ATOM   3913 C CG1 . VAL A 1 510 ? 13.447  -54.326 26.436  1.00 26.50  ? 511 VAL A CG1 1 
ATOM   3914 C CG2 . VAL A 1 510 ? 11.465  -53.421 27.688  1.00 28.72  ? 511 VAL A CG2 1 
ATOM   3915 N N   . SER A 1 511 ? 9.451   -56.172 25.976  1.00 26.90  ? 512 SER A N   1 
ATOM   3916 C CA  . SER A 1 511 ? 8.153   -56.606 26.459  1.00 26.26  ? 512 SER A CA  1 
ATOM   3917 C C   . SER A 1 511 ? 8.200   -56.661 27.975  1.00 34.64  ? 512 SER A C   1 
ATOM   3918 O O   . SER A 1 511 ? 9.156   -57.167 28.561  1.00 30.26  ? 512 SER A O   1 
ATOM   3919 C CB  . SER A 1 511 ? 7.786   -57.976 25.884  1.00 32.17  ? 512 SER A CB  1 
ATOM   3920 O OG  . SER A 1 511 ? 8.793   -58.926 26.171  1.00 41.62  ? 512 SER A OG  1 
ATOM   3921 N N   . LEU A 1 512 ? 7.176   -56.112 28.612  1.00 36.37  ? 513 LEU A N   1 
ATOM   3922 C CA  . LEU A 1 512 ? 7.074   -56.164 30.055  1.00 23.78  ? 513 LEU A CA  1 
ATOM   3923 C C   . LEU A 1 512 ? 6.003   -57.171 30.436  1.00 31.78  ? 513 LEU A C   1 
ATOM   3924 O O   . LEU A 1 512 ? 4.817   -56.928 30.220  1.00 37.02  ? 513 LEU A O   1 
ATOM   3925 C CB  . LEU A 1 512 ? 6.711   -54.788 30.607  1.00 27.51  ? 513 LEU A CB  1 
ATOM   3926 C CG  . LEU A 1 512 ? 7.764   -53.696 30.424  1.00 32.34  ? 513 LEU A CG  1 
ATOM   3927 C CD1 . LEU A 1 512 ? 7.304   -52.375 31.052  1.00 22.10  ? 513 LEU A CD1 1 
ATOM   3928 C CD2 . LEU A 1 512 ? 9.101   -54.151 30.999  1.00 20.62  ? 513 LEU A CD2 1 
ATOM   3929 N N   . ASP A 1 513 ? 6.425   -58.308 30.979  1.00 30.89  ? 514 ASP A N   1 
ATOM   3930 C CA  . ASP A 1 513 ? 5.499   -59.290 31.548  1.00 37.18  ? 514 ASP A CA  1 
ATOM   3931 C C   . ASP A 1 513 ? 6.217   -60.117 32.609  1.00 31.52  ? 514 ASP A C   1 
ATOM   3932 O O   . ASP A 1 513 ? 7.296   -59.737 33.055  1.00 37.14  ? 514 ASP A O   1 
ATOM   3933 C CB  . ASP A 1 513 ? 4.881   -60.186 30.468  1.00 31.12  ? 514 ASP A CB  1 
ATOM   3934 C CG  . ASP A 1 513 ? 5.922   -60.914 29.636  1.00 45.32  ? 514 ASP A CG  1 
ATOM   3935 O OD1 . ASP A 1 513 ? 7.070   -61.085 30.104  1.00 46.68  ? 514 ASP A OD1 1 
ATOM   3936 O OD2 . ASP A 1 513 ? 5.583   -61.330 28.506  1.00 60.98  ? 514 ASP A OD2 1 
ATOM   3937 N N   . LEU A 1 514 ? 5.637   -61.252 32.988  1.00 40.19  ? 515 LEU A N   1 
ATOM   3938 C CA  . LEU A 1 514 ? 6.204   -62.089 34.054  1.00 41.71  ? 515 LEU A CA  1 
ATOM   3939 C C   . LEU A 1 514 ? 7.533   -62.739 33.677  1.00 37.37  ? 515 LEU A C   1 
ATOM   3940 O O   . LEU A 1 514 ? 8.303   -63.117 34.549  1.00 53.83  ? 515 LEU A O   1 
ATOM   3941 C CB  . LEU A 1 514 ? 5.209   -63.165 34.475  1.00 27.99  ? 515 LEU A CB  1 
ATOM   3942 C CG  . LEU A 1 514 ? 3.879   -62.637 34.990  1.00 34.98  ? 515 LEU A CG  1 
ATOM   3943 C CD1 . LEU A 1 514 ? 2.960   -63.794 35.354  1.00 34.86  ? 515 LEU A CD1 1 
ATOM   3944 C CD2 . LEU A 1 514 ? 4.115   -61.735 36.177  1.00 34.35  ? 515 LEU A CD2 1 
ATOM   3945 N N   . ARG A 1 515 ? 7.795   -62.866 32.380  1.00 41.04  ? 516 ARG A N   1 
ATOM   3946 C CA  . ARG A 1 515 ? 9.053   -63.423 31.891  1.00 39.30  ? 516 ARG A CA  1 
ATOM   3947 C C   . ARG A 1 515 ? 10.110  -62.332 31.932  1.00 36.37  ? 516 ARG A C   1 
ATOM   3948 O O   . ARG A 1 515 ? 9.775   -61.158 32.005  1.00 39.99  ? 516 ARG A O   1 
ATOM   3949 C CB  . ARG A 1 515 ? 8.891   -63.913 30.444  1.00 37.93  ? 516 ARG A CB  1 
ATOM   3950 C CG  . ARG A 1 515 ? 7.766   -64.917 30.216  1.00 46.77  ? 516 ARG A CG  1 
ATOM   3951 C CD  . ARG A 1 515 ? 7.597   -65.225 28.720  1.00 57.70  ? 516 ARG A CD  1 
ATOM   3952 N NE  . ARG A 1 515 ? 7.183   -64.044 27.958  1.00 74.24  ? 516 ARG A NE  1 
ATOM   3953 C CZ  . ARG A 1 515 ? 7.945   -63.388 27.079  1.00 61.48  ? 516 ARG A CZ  1 
ATOM   3954 N NH1 . ARG A 1 515 ? 9.182   -63.792 26.817  1.00 65.04  ? 516 ARG A NH1 1 
ATOM   3955 N NH2 . ARG A 1 515 ? 7.460   -62.325 26.452  1.00 59.93  ? 516 ARG A NH2 1 
ATOM   3956 N N   . PRO A 1 516 ? 11.395  -62.707 31.865  1.00 46.95  ? 517 PRO A N   1 
ATOM   3957 C CA  . PRO A 1 516 ? 12.440  -61.680 31.807  1.00 33.30  ? 517 PRO A CA  1 
ATOM   3958 C C   . PRO A 1 516 ? 12.313  -60.830 30.547  1.00 49.55  ? 517 PRO A C   1 
ATOM   3959 O O   . PRO A 1 516 ? 11.716  -61.285 29.562  1.00 41.24  ? 517 PRO A O   1 
ATOM   3960 C CB  . PRO A 1 516 ? 13.725  -62.503 31.719  1.00 38.13  ? 517 PRO A CB  1 
ATOM   3961 C CG  . PRO A 1 516 ? 13.365  -63.826 32.297  1.00 39.82  ? 517 PRO A CG  1 
ATOM   3962 C CD  . PRO A 1 516 ? 11.962  -64.065 31.873  1.00 40.69  ? 517 PRO A CD  1 
ATOM   3963 N N   . LEU A 1 517 ? 12.875  -59.622 30.586  1.00 41.76  ? 518 LEU A N   1 
ATOM   3964 C CA  . LEU A 1 517 ? 12.901  -58.733 29.434  1.00 40.58  ? 518 LEU A CA  1 
ATOM   3965 C C   . LEU A 1 517 ? 13.255  -59.473 28.155  1.00 45.61  ? 518 LEU A C   1 
ATOM   3966 O O   . LEU A 1 517 ? 14.193  -60.265 28.112  1.00 48.00  ? 518 LEU A O   1 
ATOM   3967 C CB  . LEU A 1 517 ? 13.901  -57.587 29.632  1.00 38.28  ? 518 LEU A CB  1 
ATOM   3968 C CG  . LEU A 1 517 ? 13.548  -56.464 30.604  1.00 47.25  ? 518 LEU A CG  1 
ATOM   3969 C CD1 . LEU A 1 517 ? 14.576  -55.347 30.500  1.00 41.58  ? 518 LEU A CD1 1 
ATOM   3970 C CD2 . LEU A 1 517 ? 12.140  -55.936 30.352  1.00 38.75  ? 518 LEU A CD2 1 
ATOM   3971 N N   . GLU A 1 518 ? 12.473  -59.216 27.120  1.00 35.54  ? 519 GLU A N   1 
ATOM   3972 C CA  . GLU A 1 518 ? 12.760  -59.727 25.800  1.00 44.33  ? 519 GLU A CA  1 
ATOM   3973 C C   . GLU A 1 518 ? 12.776  -58.525 24.871  1.00 39.37  ? 519 GLU A C   1 
ATOM   3974 O O   . GLU A 1 518 ? 11.835  -57.738 24.860  1.00 31.17  ? 519 GLU A O   1 
ATOM   3975 C CB  . GLU A 1 518 ? 11.692  -60.733 25.384  1.00 40.79  ? 519 GLU A CB  1 
ATOM   3976 C CG  . GLU A 1 518 ? 11.791  -61.171 23.937  1.00 61.80  ? 519 GLU A CG  1 
ATOM   3977 C CD  . GLU A 1 518 ? 10.645  -62.078 23.536  1.00 74.00  ? 519 GLU A CD  1 
ATOM   3978 O OE1 . GLU A 1 518 ? 10.146  -62.819 24.417  1.00 77.51  ? 519 GLU A OE1 1 
ATOM   3979 O OE2 . GLU A 1 518 ? 10.240  -62.040 22.350  1.00 65.84  ? 519 GLU A OE2 1 
ATOM   3980 N N   . VAL A 1 519 ? 13.865  -58.361 24.130  1.00 34.40  ? 520 VAL A N   1 
ATOM   3981 C CA  . VAL A 1 519 ? 13.998  -57.240 23.214  1.00 33.43  ? 520 VAL A CA  1 
ATOM   3982 C C   . VAL A 1 519 ? 13.372  -57.572 21.874  1.00 37.07  ? 520 VAL A C   1 
ATOM   3983 O O   . VAL A 1 519 ? 13.623  -58.640 21.327  1.00 46.22  ? 520 VAL A O   1 
ATOM   3984 C CB  . VAL A 1 519 ? 15.469  -56.883 22.981  1.00 38.47  ? 520 VAL A CB  1 
ATOM   3985 C CG1 . VAL A 1 519 ? 15.586  -55.810 21.893  1.00 33.77  ? 520 VAL A CG1 1 
ATOM   3986 C CG2 . VAL A 1 519 ? 16.113  -56.423 24.290  1.00 32.33  ? 520 VAL A CG2 1 
ATOM   3987 N N   . ARG A 1 520 ? 12.555  -56.658 21.355  1.00 39.28  ? 521 ARG A N   1 
ATOM   3988 C CA  . ARG A 1 520 ? 11.939  -56.810 20.039  1.00 34.19  ? 521 ARG A CA  1 
ATOM   3989 C C   . ARG A 1 520 ? 12.127  -55.555 19.195  1.00 30.76  ? 521 ARG A C   1 
ATOM   3990 O O   . ARG A 1 520 ? 12.550  -54.521 19.714  1.00 39.58  ? 521 ARG A O   1 
ATOM   3991 C CB  . ARG A 1 520 ? 10.455  -57.106 20.193  1.00 34.52  ? 521 ARG A CB  1 
ATOM   3992 C CG  . ARG A 1 520 ? 10.180  -58.400 20.904  1.00 39.82  ? 521 ARG A CG  1 
ATOM   3993 C CD  . ARG A 1 520 ? 8.709   -58.532 21.217  1.00 48.42  ? 521 ARG A CD  1 
ATOM   3994 N NE  . ARG A 1 520 ? 8.475   -59.651 22.121  1.00 47.30  ? 521 ARG A NE  1 
ATOM   3995 C CZ  . ARG A 1 520 ? 7.330   -59.868 22.756  1.00 54.51  ? 521 ARG A CZ  1 
ATOM   3996 N NH1 . ARG A 1 520 ? 6.310   -59.034 22.586  1.00 44.10  ? 521 ARG A NH1 1 
ATOM   3997 N NH2 . ARG A 1 520 ? 7.210   -60.916 23.561  1.00 49.09  ? 521 ARG A NH2 1 
ATOM   3998 N N   . ARG A 1 521 ? 11.804  -55.650 17.902  1.00 32.20  ? 522 ARG A N   1 
ATOM   3999 C CA  . ARG A 1 521 ? 11.941  -54.525 16.966  1.00 32.12  ? 522 ARG A CA  1 
ATOM   4000 C C   . ARG A 1 521 ? 10.596  -54.053 16.416  1.00 36.27  ? 522 ARG A C   1 
ATOM   4001 O O   . ARG A 1 521 ? 9.729   -54.863 16.089  1.00 40.17  ? 522 ARG A O   1 
ATOM   4002 C CB  . ARG A 1 521 ? 12.833  -54.904 15.779  1.00 32.89  ? 522 ARG A CB  1 
ATOM   4003 C CG  . ARG A 1 521 ? 14.305  -55.124 16.106  1.00 32.91  ? 522 ARG A CG  1 
ATOM   4004 C CD  . ARG A 1 521 ? 15.166  -55.080 14.841  1.00 29.23  ? 522 ARG A CD  1 
ATOM   4005 N NE  . ARG A 1 521 ? 15.151  -53.763 14.199  1.00 39.11  ? 522 ARG A NE  1 
ATOM   4006 C CZ  . ARG A 1 521 ? 14.833  -53.546 12.920  1.00 49.33  ? 522 ARG A CZ  1 
ATOM   4007 N NH1 . ARG A 1 521 ? 14.512  -54.563 12.128  1.00 41.85  ? 522 ARG A NH1 1 
ATOM   4008 N NH2 . ARG A 1 521 ? 14.841  -52.308 12.428  1.00 26.11  ? 522 ARG A NH2 1 
ATOM   4009 N N   . GLY A 1 522 ? 10.430  -52.738 16.307  1.00 39.40  ? 523 GLY A N   1 
ATOM   4010 C CA  . GLY A 1 522 ? 9.264   -52.165 15.652  1.00 37.39  ? 523 GLY A CA  1 
ATOM   4011 C C   . GLY A 1 522 ? 7.979   -52.081 16.457  1.00 34.93  ? 523 GLY A C   1 
ATOM   4012 O O   . GLY A 1 522 ? 7.369   -53.097 16.801  1.00 32.45  ? 523 GLY A O   1 
ATOM   4013 N N   . LEU A 1 523 ? 7.558   -50.856 16.750  1.00 34.11  ? 524 LEU A N   1 
ATOM   4014 C CA  . LEU A 1 523 ? 6.253   -50.627 17.360  1.00 31.02  ? 524 LEU A CA  1 
ATOM   4015 C C   . LEU A 1 523 ? 5.207   -50.636 16.250  1.00 32.40  ? 524 LEU A C   1 
ATOM   4016 O O   . LEU A 1 523 ? 4.819   -49.573 15.754  1.00 27.66  ? 524 LEU A O   1 
ATOM   4017 C CB  . LEU A 1 523 ? 6.231   -49.284 18.101  1.00 25.14  ? 524 LEU A CB  1 
ATOM   4018 C CG  . LEU A 1 523 ? 7.088   -49.201 19.372  1.00 34.55  ? 524 LEU A CG  1 
ATOM   4019 C CD1 . LEU A 1 523 ? 7.179   -47.776 19.913  1.00 28.41  ? 524 LEU A CD1 1 
ATOM   4020 C CD2 . LEU A 1 523 ? 6.527   -50.124 20.433  1.00 29.62  ? 524 LEU A CD2 1 
ATOM   4021 N N   A ARG A 1 524 ? 4.770   -51.835 15.868  0.46 31.20  ? 525 ARG A N   1 
ATOM   4022 N N   B ARG A 1 524 ? 4.753   -51.828 15.866  0.54 31.19  ? 525 ARG A N   1 
ATOM   4023 C CA  A ARG A 1 524 ? 3.838   -52.016 14.756  0.46 32.46  ? 525 ARG A CA  1 
ATOM   4024 C CA  B ARG A 1 524 ? 3.798   -51.972 14.766  0.54 32.48  ? 525 ARG A CA  1 
ATOM   4025 C C   A ARG A 1 524 ? 4.259   -51.173 13.558  0.46 33.69  ? 525 ARG A C   1 
ATOM   4026 C C   B ARG A 1 524 ? 4.257   -51.158 13.554  0.54 33.72  ? 525 ARG A C   1 
ATOM   4027 O O   A ARG A 1 524 ? 3.494   -50.345 13.062  0.46 33.11  ? 525 ARG A O   1 
ATOM   4028 O O   B ARG A 1 524 ? 3.509   -50.323 13.043  0.54 33.13  ? 525 ARG A O   1 
ATOM   4029 C CB  A ARG A 1 524 ? 2.412   -51.681 15.190  0.46 29.80  ? 525 ARG A CB  1 
ATOM   4030 C CB  B ARG A 1 524 ? 2.403   -51.510 15.203  0.54 29.65  ? 525 ARG A CB  1 
ATOM   4031 C CG  A ARG A 1 524 ? 1.980   -52.464 16.416  0.46 30.87  ? 525 ARG A CG  1 
ATOM   4032 C CG  B ARG A 1 524 ? 1.877   -52.172 16.477  0.54 31.08  ? 525 ARG A CG  1 
ATOM   4033 C CD  A ARG A 1 524 ? 0.487   -52.401 16.648  0.46 23.67  ? 525 ARG A CD  1 
ATOM   4034 C CD  B ARG A 1 524 ? 0.956   -53.337 16.164  0.54 28.97  ? 525 ARG A CD  1 
ATOM   4035 N NE  A ARG A 1 524 ? 0.096   -53.322 17.707  0.46 20.44  ? 525 ARG A NE  1 
ATOM   4036 N NE  B ARG A 1 524 ? -0.127  -52.934 15.274  0.54 40.03  ? 525 ARG A NE  1 
ATOM   4037 C CZ  A ARG A 1 524 ? -1.150  -53.713 17.932  0.46 24.39  ? 525 ARG A CZ  1 
ATOM   4038 C CZ  B ARG A 1 524 ? -0.659  -53.718 14.340  0.54 31.61  ? 525 ARG A CZ  1 
ATOM   4039 N NH1 A ARG A 1 524 ? -2.134  -53.255 17.168  0.46 24.31  ? 525 ARG A NH1 1 
ATOM   4040 N NH1 B ARG A 1 524 ? -0.215  -54.954 14.182  0.54 35.32  ? 525 ARG A NH1 1 
ATOM   4041 N NH2 A ARG A 1 524 ? -1.410  -54.558 18.921  0.46 20.08  ? 525 ARG A NH2 1 
ATOM   4042 N NH2 B ARG A 1 524 ? -1.635  -53.264 13.570  0.54 16.85  ? 525 ARG A NH2 1 
ATOM   4043 N N   . ALA A 1 525 ? 5.496   -51.383 13.120  1.00 28.58  ? 526 ALA A N   1 
ATOM   4044 C CA  . ALA A 1 525 ? 6.104   -50.552 12.086  1.00 27.45  ? 526 ALA A CA  1 
ATOM   4045 C C   . ALA A 1 525 ? 5.335   -50.504 10.757  1.00 28.93  ? 526 ALA A C   1 
ATOM   4046 O O   . ALA A 1 525 ? 5.244   -49.451 10.132  1.00 27.50  ? 526 ALA A O   1 
ATOM   4047 C CB  . ALA A 1 525 ? 7.558   -50.969 11.858  1.00 30.63  ? 526 ALA A CB  1 
ATOM   4048 N N   . GLN A 1 526 ? 4.774   -51.628 10.335  1.00 29.06  ? 527 GLN A N   1 
ATOM   4049 C CA  . GLN A 1 526 ? 4.055   -51.650 9.068   1.00 29.89  ? 527 GLN A CA  1 
ATOM   4050 C C   . GLN A 1 526 ? 2.792   -50.807 9.156   1.00 25.90  ? 527 GLN A C   1 
ATOM   4051 O O   . GLN A 1 526 ? 2.478   -50.051 8.245   1.00 38.86  ? 527 GLN A O   1 
ATOM   4052 C CB  . GLN A 1 526 ? 3.718   -53.082 8.654   1.00 26.12  ? 527 GLN A CB  1 
ATOM   4053 C CG  . GLN A 1 526 ? 4.935   -53.971 8.529   1.00 33.81  ? 527 GLN A CG  1 
ATOM   4054 C CD  . GLN A 1 526 ? 5.981   -53.401 7.579   1.00 41.17  ? 527 GLN A CD  1 
ATOM   4055 O OE1 . GLN A 1 526 ? 7.158   -53.318 7.920   1.00 46.18  ? 527 GLN A OE1 1 
ATOM   4056 N NE2 . GLN A 1 526 ? 5.556   -53.032 6.373   1.00 35.11  ? 527 GLN A NE2 1 
ATOM   4057 N N   . ALA A 1 527 ? 2.076   -50.925 10.265  1.00 35.07  ? 528 ALA A N   1 
ATOM   4058 C CA  . ALA A 1 527 ? 0.835   -50.185 10.426  1.00 29.81  ? 528 ALA A CA  1 
ATOM   4059 C C   . ALA A 1 527 ? 1.119   -48.705 10.657  1.00 29.74  ? 528 ALA A C   1 
ATOM   4060 O O   . ALA A 1 527 ? 0.407   -47.832 10.159  1.00 40.34  ? 528 ALA A O   1 
ATOM   4061 C CB  . ALA A 1 527 ? 0.015   -50.767 11.575  1.00 29.54  ? 528 ALA A CB  1 
ATOM   4062 N N   . CYS A 1 528 ? 2.168   -48.415 11.405  1.00 22.22  ? 529 CYS A N   1 
ATOM   4063 C CA  . CYS A 1 528 ? 2.462   -47.028 11.723  1.00 24.82  ? 529 CYS A CA  1 
ATOM   4064 C C   . CYS A 1 528 ? 3.065   -46.259 10.552  1.00 30.79  ? 529 CYS A C   1 
ATOM   4065 O O   . CYS A 1 528 ? 2.953   -45.031 10.490  1.00 27.99  ? 529 CYS A O   1 
ATOM   4066 C CB  . CYS A 1 528 ? 3.313   -46.939 12.989  1.00 29.41  ? 529 CYS A CB  1 
ATOM   4067 S SG  . CYS A 1 528 ? 2.351   -47.500 14.441  1.00 33.66  ? 529 CYS A SG  1 
ATOM   4068 N N   . ALA A 1 529 ? 3.683   -46.977 9.614   1.00 27.02  ? 530 ALA A N   1 
ATOM   4069 C CA  . ALA A 1 529 ? 4.085   -46.352 8.354   1.00 31.89  ? 530 ALA A CA  1 
ATOM   4070 C C   . ALA A 1 529 ? 2.850   -45.783 7.677   1.00 28.10  ? 530 ALA A C   1 
ATOM   4071 O O   . ALA A 1 529 ? 2.878   -44.667 7.161   1.00 26.52  ? 530 ALA A O   1 
ATOM   4072 C CB  . ALA A 1 529 ? 4.784   -47.342 7.439   1.00 28.18  ? 530 ALA A CB  1 
ATOM   4073 N N   . PHE A 1 530 ? 1.757   -46.539 7.709   1.00 23.19  ? 531 PHE A N   1 
ATOM   4074 C CA  . PHE A 1 530 ? 0.519   -46.070 7.098   1.00 24.37  ? 531 PHE A CA  1 
ATOM   4075 C C   . PHE A 1 530 ? 0.002   -44.803 7.779   1.00 29.95  ? 531 PHE A C   1 
ATOM   4076 O O   . PHE A 1 530 ? -0.217  -43.792 7.114   1.00 31.63  ? 531 PHE A O   1 
ATOM   4077 C CB  . PHE A 1 530 ? -0.547  -47.177 7.081   1.00 28.49  ? 531 PHE A CB  1 
ATOM   4078 C CG  . PHE A 1 530 ? -1.941  -46.672 6.827   1.00 26.77  ? 531 PHE A CG  1 
ATOM   4079 C CD1 . PHE A 1 530 ? -2.346  -46.323 5.550   1.00 32.16  ? 531 PHE A CD1 1 
ATOM   4080 C CD2 . PHE A 1 530 ? -2.851  -46.561 7.865   1.00 24.62  ? 531 PHE A CD2 1 
ATOM   4081 C CE1 . PHE A 1 530 ? -3.630  -45.854 5.311   1.00 29.35  ? 531 PHE A CE1 1 
ATOM   4082 C CE2 . PHE A 1 530 ? -4.130  -46.089 7.637   1.00 30.17  ? 531 PHE A CE2 1 
ATOM   4083 C CZ  . PHE A 1 530 ? -4.522  -45.737 6.354   1.00 35.29  ? 531 PHE A CZ  1 
ATOM   4084 N N   . TRP A 1 531 ? -0.161  -44.844 9.104   1.00 26.28  ? 532 TRP A N   1 
ATOM   4085 C CA  . TRP A 1 531 ? -0.733  -43.703 9.828   1.00 27.94  ? 532 TRP A CA  1 
ATOM   4086 C C   . TRP A 1 531 ? 0.182   -42.492 9.869   1.00 29.38  ? 532 TRP A C   1 
ATOM   4087 O O   . TRP A 1 531 ? -0.285  -41.357 9.740   1.00 29.87  ? 532 TRP A O   1 
ATOM   4088 C CB  . TRP A 1 531 ? -1.137  -44.084 11.260  1.00 15.18  ? 532 TRP A CB  1 
ATOM   4089 C CG  . TRP A 1 531 ? -2.187  -45.151 11.319  1.00 22.24  ? 532 TRP A CG  1 
ATOM   4090 C CD1 . TRP A 1 531 ? -1.998  -46.488 11.545  1.00 24.75  ? 532 TRP A CD1 1 
ATOM   4091 C CD2 . TRP A 1 531 ? -3.594  -44.970 11.138  1.00 18.73  ? 532 TRP A CD2 1 
ATOM   4092 N NE1 . TRP A 1 531 ? -3.204  -47.147 11.521  1.00 22.39  ? 532 TRP A NE1 1 
ATOM   4093 C CE2 . TRP A 1 531 ? -4.199  -46.235 11.273  1.00 21.66  ? 532 TRP A CE2 1 
ATOM   4094 C CE3 . TRP A 1 531 ? -4.402  -43.859 10.874  1.00 18.37  ? 532 TRP A CE3 1 
ATOM   4095 C CZ2 . TRP A 1 531 ? -5.573  -46.416 11.158  1.00 25.87  ? 532 TRP A CZ2 1 
ATOM   4096 C CZ3 . TRP A 1 531 ? -5.762  -44.040 10.757  1.00 22.04  ? 532 TRP A CZ3 1 
ATOM   4097 C CH2 . TRP A 1 531 ? -6.336  -45.308 10.899  1.00 23.12  ? 532 TRP A CH2 1 
ATOM   4098 N N   . ASN A 1 532 ? 1.478   -42.732 10.056  1.00 24.16  ? 533 ASN A N   1 
ATOM   4099 C CA  . ASN A 1 532 ? 2.434   -41.640 10.218  1.00 26.14  ? 533 ASN A CA  1 
ATOM   4100 C C   . ASN A 1 532 ? 3.030   -41.114 8.906   1.00 31.67  ? 533 ASN A C   1 
ATOM   4101 O O   . ASN A 1 532 ? 3.346   -39.935 8.808   1.00 31.11  ? 533 ASN A O   1 
ATOM   4102 C CB  . ASN A 1 532 ? 3.553   -42.028 11.196  1.00 23.64  ? 533 ASN A CB  1 
ATOM   4103 C CG  . ASN A 1 532 ? 3.030   -42.335 12.600  1.00 28.90  ? 533 ASN A CG  1 
ATOM   4104 O OD1 . ASN A 1 532 ? 2.020   -41.786 13.030  1.00 29.93  ? 533 ASN A OD1 1 
ATOM   4105 N ND2 . ASN A 1 532 ? 3.724   -43.214 13.316  1.00 26.31  ? 533 ASN A ND2 1 
ATOM   4106 N N   . ARG A 1 533 ? 3.183   -41.976 7.901   1.00 26.20  ? 534 ARG A N   1 
ATOM   4107 C CA  . ARG A 1 533 ? 3.823   -41.550 6.648   1.00 32.00  ? 534 ARG A CA  1 
ATOM   4108 C C   . ARG A 1 533 ? 2.843   -41.309 5.511   1.00 33.59  ? 534 ARG A C   1 
ATOM   4109 O O   . ARG A 1 533 ? 2.838   -40.235 4.924   1.00 39.98  ? 534 ARG A O   1 
ATOM   4110 C CB  . ARG A 1 533 ? 4.916   -42.532 6.211   1.00 27.80  ? 534 ARG A CB  1 
ATOM   4111 C CG  . ARG A 1 533 ? 6.004   -42.716 7.271   1.00 27.81  ? 534 ARG A CG  1 
ATOM   4112 C CD  . ARG A 1 533 ? 6.936   -43.867 6.949   1.00 34.46  ? 534 ARG A CD  1 
ATOM   4113 N NE  . ARG A 1 533 ? 7.807   -44.138 8.086   1.00 41.44  ? 534 ARG A NE  1 
ATOM   4114 C CZ  . ARG A 1 533 ? 8.917   -43.460 8.354   1.00 44.82  ? 534 ARG A CZ  1 
ATOM   4115 N NH1 . ARG A 1 533 ? 9.301   -42.473 7.551   1.00 34.09  ? 534 ARG A NH1 1 
ATOM   4116 N NH2 . ARG A 1 533 ? 9.642   -43.768 9.424   1.00 44.66  ? 534 ARG A NH2 1 
ATOM   4117 N N   . PHE A 1 534 ? 2.005   -42.295 5.211   1.00 31.75  ? 535 PHE A N   1 
ATOM   4118 C CA  . PHE A 1 534 ? 1.128   -42.194 4.050   1.00 28.62  ? 535 PHE A CA  1 
ATOM   4119 C C   . PHE A 1 534 ? -0.141  -41.379 4.270   1.00 31.94  ? 535 PHE A C   1 
ATOM   4120 O O   . PHE A 1 534 ? -0.408  -40.442 3.526   1.00 37.55  ? 535 PHE A O   1 
ATOM   4121 C CB  . PHE A 1 534 ? 0.748   -43.572 3.497   1.00 32.04  ? 535 PHE A CB  1 
ATOM   4122 C CG  . PHE A 1 534 ? -0.151  -43.494 2.301   1.00 26.54  ? 535 PHE A CG  1 
ATOM   4123 C CD1 . PHE A 1 534 ? 0.334   -43.036 1.086   1.00 32.33  ? 535 PHE A CD1 1 
ATOM   4124 C CD2 . PHE A 1 534 ? -1.489  -43.840 2.397   1.00 32.24  ? 535 PHE A CD2 1 
ATOM   4125 C CE1 . PHE A 1 534 ? -0.495  -42.938 -0.023  1.00 25.65  ? 535 PHE A CE1 1 
ATOM   4126 C CE2 . PHE A 1 534 ? -2.325  -43.743 1.298   1.00 33.44  ? 535 PHE A CE2 1 
ATOM   4127 C CZ  . PHE A 1 534 ? -1.825  -43.296 0.081   1.00 28.89  ? 535 PHE A CZ  1 
ATOM   4128 N N   . LEU A 1 535 ? -0.933  -41.756 5.270   1.00 40.67  ? 536 LEU A N   1 
ATOM   4129 C CA  . LEU A 1 535 ? -2.227  -41.109 5.508   1.00 33.46  ? 536 LEU A CA  1 
ATOM   4130 C C   . LEU A 1 535 ? -2.233  -39.571 5.561   1.00 37.64  ? 536 LEU A C   1 
ATOM   4131 O O   . LEU A 1 535 ? -3.165  -38.950 5.056   1.00 47.76  ? 536 LEU A O   1 
ATOM   4132 C CB  . LEU A 1 535 ? -2.917  -41.689 6.742   1.00 28.22  ? 536 LEU A CB  1 
ATOM   4133 C CG  . LEU A 1 535 ? -4.415  -41.379 6.758   1.00 43.35  ? 536 LEU A CG  1 
ATOM   4134 C CD1 . LEU A 1 535 ? -5.083  -41.990 5.545   1.00 39.58  ? 536 LEU A CD1 1 
ATOM   4135 C CD2 . LEU A 1 535 ? -5.065  -41.875 8.018   1.00 36.34  ? 536 LEU A CD2 1 
ATOM   4136 N N   . PRO A 1 536 ? -1.213  -38.949 6.180   1.00 42.39  ? 537 PRO A N   1 
ATOM   4137 C CA  . PRO A 1 536 ? -1.209  -37.484 6.132   1.00 35.20  ? 537 PRO A CA  1 
ATOM   4138 C C   . PRO A 1 536 ? -1.134  -36.931 4.708   1.00 48.67  ? 537 PRO A C   1 
ATOM   4139 O O   . PRO A 1 536 ? -1.825  -35.955 4.409   1.00 50.64  ? 537 PRO A O   1 
ATOM   4140 C CB  . PRO A 1 536 ? 0.056   -37.116 6.908   1.00 39.12  ? 537 PRO A CB  1 
ATOM   4141 C CG  . PRO A 1 536 ? 0.243   -38.231 7.860   1.00 37.20  ? 537 PRO A CG  1 
ATOM   4142 C CD  . PRO A 1 536 ? -0.205  -39.464 7.128   1.00 40.16  ? 537 PRO A CD  1 
ATOM   4143 N N   . LYS A 1 537 ? -0.313  -37.540 3.854   1.00 50.85  ? 538 LYS A N   1 
ATOM   4144 C CA  . LYS A 1 537 ? -0.168  -37.097 2.463   1.00 36.63  ? 538 LYS A CA  1 
ATOM   4145 C C   . LYS A 1 537 ? -1.504  -37.167 1.749   1.00 40.40  ? 538 LYS A C   1 
ATOM   4146 O O   . LYS A 1 537 ? -1.887  -36.254 1.024   1.00 49.44  ? 538 LYS A O   1 
ATOM   4147 C CB  . LYS A 1 537 ? 0.848   -37.962 1.722   1.00 35.29  ? 538 LYS A CB  1 
ATOM   4148 C CG  . LYS A 1 537 ? 2.289   -37.801 2.188   1.00 38.92  ? 538 LYS A CG  1 
ATOM   4149 C CD  . LYS A 1 537 ? 3.169   -38.871 1.569   1.00 40.59  ? 538 LYS A CD  1 
ATOM   4150 C CE  . LYS A 1 537 ? 4.631   -38.463 1.566   1.00 50.81  ? 538 LYS A CE  1 
ATOM   4151 N NZ  . LYS A 1 537 ? 5.192   -38.322 2.927   1.00 50.91  ? 538 LYS A NZ  1 
ATOM   4152 N N   . LEU A 1 538 ? -2.213  -38.263 1.972   1.00 44.79  ? 539 LEU A N   1 
ATOM   4153 C CA  . LEU A 1 538 ? -3.505  -38.482 1.349   1.00 49.13  ? 539 LEU A CA  1 
ATOM   4154 C C   . LEU A 1 538 ? -4.495  -37.401 1.754   1.00 43.21  ? 539 LEU A C   1 
ATOM   4155 O O   . LEU A 1 538 ? -5.205  -36.858 0.910   1.00 61.46  ? 539 LEU A O   1 
ATOM   4156 C CB  . LEU A 1 538 ? -4.025  -39.874 1.713   1.00 41.01  ? 539 LEU A CB  1 
ATOM   4157 C CG  . LEU A 1 538 ? -5.395  -40.325 1.219   1.00 44.53  ? 539 LEU A CG  1 
ATOM   4158 C CD1 . LEU A 1 538 ? -5.419  -41.831 1.169   1.00 39.24  ? 539 LEU A CD1 1 
ATOM   4159 C CD2 . LEU A 1 538 ? -6.500  -39.822 2.137   1.00 41.43  ? 539 LEU A CD2 1 
ATOM   4160 N N   . LEU A 1 539 ? -4.548  -37.102 3.048   1.00 59.80  ? 540 LEU A N   1 
ATOM   4161 C CA  . LEU A 1 539 ? -5.458  -36.081 3.578   1.00 64.40  ? 540 LEU A CA  1 
ATOM   4162 C C   . LEU A 1 539 ? -5.149  -34.671 3.054   1.00 54.67  ? 540 LEU A C   1 
ATOM   4163 O O   . LEU A 1 539 ? -6.028  -33.813 3.022   1.00 71.20  ? 540 LEU A O   1 
ATOM   4164 C CB  . LEU A 1 539 ? -5.468  -36.100 5.113   1.00 57.66  ? 540 LEU A CB  1 
ATOM   4165 C CG  . LEU A 1 539 ? -6.048  -37.365 5.760   1.00 53.87  ? 540 LEU A CG  1 
ATOM   4166 C CD1 . LEU A 1 539 ? -5.884  -37.338 7.263   1.00 36.42  ? 540 LEU A CD1 1 
ATOM   4167 C CD2 . LEU A 1 539 ? -7.514  -37.535 5.394   1.00 52.54  ? 540 LEU A CD2 1 
ATOM   4168 N N   . SER A 1 540 ? -3.904  -34.445 2.637   1.00 56.30  ? 541 SER A N   1 
ATOM   4169 C CA  . SER A 1 540 ? -3.503  -33.172 2.038   1.00 61.20  ? 541 SER A CA  1 
ATOM   4170 C C   . SER A 1 540 ? -3.748  -33.136 0.530   1.00 71.65  ? 541 SER A C   1 
ATOM   4171 O O   . SER A 1 540 ? -3.075  -32.402 -0.192  1.00 79.84  ? 541 SER A O   1 
ATOM   4172 C CB  . SER A 1 540 ? -2.024  -32.897 2.306   1.00 49.00  ? 541 SER A CB  1 
ATOM   4173 O OG  . SER A 1 540 ? -1.769  -32.837 3.696   1.00 73.62  ? 541 SER A OG  1 
ATOM   4174 N N   . ALA A 1 541 ? -4.708  -33.929 0.059   1.00 76.38  ? 542 ALA A N   1 
ATOM   4175 C CA  . ALA A 1 541 ? -5.022  -33.993 -1.364  1.00 76.13  ? 542 ALA A CA  1 
ATOM   4176 C C   . ALA A 1 541 ? -6.426  -34.552 -1.610  1.00 75.37  ? 542 ALA A C   1 
ATOM   4177 O O   . ALA A 1 541 ? -7.345  -34.333 -0.814  1.00 76.22  ? 542 ALA A O   1 
ATOM   4178 C CB  . ALA A 1 541 ? -3.975  -34.821 -2.097  1.00 53.40  ? 542 ALA A CB  1 
ATOM   4179 N N   . GLU B 1 3   ? 3.962   -88.838 -54.551 1.00 56.88  ? 4   GLU B N   1 
ATOM   4180 C CA  . GLU B 1 3   ? 3.175   -87.917 -53.736 1.00 73.29  ? 4   GLU B CA  1 
ATOM   4181 C C   . GLU B 1 3   ? 2.517   -88.628 -52.535 1.00 70.84  ? 4   GLU B C   1 
ATOM   4182 O O   . GLU B 1 3   ? 1.930   -89.698 -52.689 1.00 70.47  ? 4   GLU B O   1 
ATOM   4183 C CB  . GLU B 1 3   ? 2.130   -87.216 -54.609 1.00 53.04  ? 4   GLU B CB  1 
ATOM   4184 C CG  . GLU B 1 3   ? 1.640   -85.876 -54.069 1.00 80.28  ? 4   GLU B CG  1 
ATOM   4185 C CD  . GLU B 1 3   ? 2.549   -84.686 -54.397 1.00 84.87  ? 4   GLU B CD  1 
ATOM   4186 O OE1 . GLU B 1 3   ? 3.616   -84.546 -53.753 1.00 76.71  ? 4   GLU B OE1 1 
ATOM   4187 O OE2 . GLU B 1 3   ? 2.178   -83.874 -55.282 1.00 61.55  ? 4   GLU B OE2 1 
ATOM   4188 N N   . ASP B 1 4   ? 2.632   -88.029 -51.346 1.00 68.98  ? 5   ASP B N   1 
ATOM   4189 C CA  . ASP B 1 4   ? 2.117   -88.614 -50.095 1.00 49.77  ? 5   ASP B CA  1 
ATOM   4190 C C   . ASP B 1 4   ? 0.771   -88.009 -49.712 1.00 50.19  ? 5   ASP B C   1 
ATOM   4191 O O   . ASP B 1 4   ? 0.684   -86.825 -49.394 1.00 52.44  ? 5   ASP B O   1 
ATOM   4192 C CB  . ASP B 1 4   ? 3.121   -88.398 -48.956 1.00 40.38  ? 5   ASP B CB  1 
ATOM   4193 C CG  . ASP B 1 4   ? 2.700   -89.067 -47.640 1.00 58.44  ? 5   ASP B CG  1 
ATOM   4194 O OD1 . ASP B 1 4   ? 1.508   -89.416 -47.471 1.00 54.25  ? 5   ASP B OD1 1 
ATOM   4195 O OD2 . ASP B 1 4   ? 3.576   -89.233 -46.754 1.00 45.52  ? 5   ASP B OD2 1 
ATOM   4196 N N   . ALA B 1 5   ? -0.264  -88.842 -49.705 1.00 56.23  ? 6   ALA B N   1 
ATOM   4197 C CA  . ALA B 1 5   ? -1.634  -88.398 -49.450 1.00 48.26  ? 6   ALA B CA  1 
ATOM   4198 C C   . ALA B 1 5   ? -1.807  -87.650 -48.123 1.00 56.22  ? 6   ALA B C   1 
ATOM   4199 O O   . ALA B 1 5   ? -2.608  -86.712 -48.032 1.00 50.47  ? 6   ALA B O   1 
ATOM   4200 C CB  . ALA B 1 5   ? -2.592  -89.584 -49.522 1.00 41.40  ? 6   ALA B CB  1 
ATOM   4201 N N   . GLU B 1 6   ? -1.057  -88.065 -47.103 1.00 53.45  ? 7   GLU B N   1 
ATOM   4202 C CA  . GLU B 1 6   ? -1.128  -87.424 -45.792 1.00 58.04  ? 7   GLU B CA  1 
ATOM   4203 C C   . GLU B 1 6   ? -0.698  -85.962 -45.855 1.00 53.35  ? 7   GLU B C   1 
ATOM   4204 O O   . GLU B 1 6   ? -1.226  -85.130 -45.123 1.00 42.33  ? 7   GLU B O   1 
ATOM   4205 C CB  . GLU B 1 6   ? -0.283  -88.181 -44.761 1.00 53.76  ? 7   GLU B CB  1 
ATOM   4206 C CG  . GLU B 1 6   ? -0.850  -89.545 -44.367 1.00 68.25  ? 7   GLU B CG  1 
ATOM   4207 C CD  . GLU B 1 6   ? -2.173  -89.451 -43.618 1.00 71.46  ? 7   GLU B CD  1 
ATOM   4208 O OE1 . GLU B 1 6   ? -2.291  -88.594 -42.720 1.00 74.38  ? 7   GLU B OE1 1 
ATOM   4209 O OE2 . GLU B 1 6   ? -3.097  -90.234 -43.926 1.00 72.85  ? 7   GLU B OE2 1 
ATOM   4210 N N   . LEU B 1 7   ? 0.242   -85.653 -46.747 1.00 44.37  ? 8   LEU B N   1 
ATOM   4211 C CA  . LEU B 1 7   ? 0.804   -84.310 -46.827 1.00 34.97  ? 8   LEU B CA  1 
ATOM   4212 C C   . LEU B 1 7   ? 0.080   -83.405 -47.818 1.00 34.88  ? 8   LEU B C   1 
ATOM   4213 O O   . LEU B 1 7   ? 0.548   -82.312 -48.117 1.00 35.25  ? 8   LEU B O   1 
ATOM   4214 C CB  . LEU B 1 7   ? 2.290   -84.375 -47.160 1.00 29.45  ? 8   LEU B CB  1 
ATOM   4215 C CG  . LEU B 1 7   ? 3.085   -85.260 -46.202 1.00 40.97  ? 8   LEU B CG  1 
ATOM   4216 C CD1 . LEU B 1 7   ? 4.541   -85.298 -46.625 1.00 33.58  ? 8   LEU B CD1 1 
ATOM   4217 C CD2 . LEU B 1 7   ? 2.940   -84.779 -44.741 1.00 36.39  ? 8   LEU B CD2 1 
ATOM   4218 N N   . LEU B 1 8   ? -1.065  -83.860 -48.315 1.00 32.60  ? 9   LEU B N   1 
ATOM   4219 C CA  . LEU B 1 8   ? -1.862  -83.066 -49.234 1.00 37.46  ? 9   LEU B CA  1 
ATOM   4220 C C   . LEU B 1 8   ? -3.227  -82.801 -48.640 1.00 37.76  ? 9   LEU B C   1 
ATOM   4221 O O   . LEU B 1 8   ? -3.897  -83.721 -48.175 1.00 42.26  ? 9   LEU B O   1 
ATOM   4222 C CB  . LEU B 1 8   ? -2.033  -83.786 -50.573 1.00 36.30  ? 9   LEU B CB  1 
ATOM   4223 C CG  . LEU B 1 8   ? -0.814  -83.925 -51.478 1.00 44.58  ? 9   LEU B CG  1 
ATOM   4224 C CD1 . LEU B 1 8   ? -1.229  -84.690 -52.718 1.00 41.94  ? 9   LEU B CD1 1 
ATOM   4225 C CD2 . LEU B 1 8   ? -0.274  -82.561 -51.860 1.00 38.31  ? 9   LEU B CD2 1 
ATOM   4226 N N   . VAL B 1 9   ? -3.642  -81.541 -48.677 1.00 31.03  ? 10  VAL B N   1 
ATOM   4227 C CA  . VAL B 1 9   ? -4.880  -81.117 -48.057 1.00 31.35  ? 10  VAL B CA  1 
ATOM   4228 C C   . VAL B 1 9   ? -5.489  -80.033 -48.913 1.00 30.02  ? 10  VAL B C   1 
ATOM   4229 O O   . VAL B 1 9   ? -4.772  -79.191 -49.458 1.00 32.86  ? 10  VAL B O   1 
ATOM   4230 C CB  . VAL B 1 9   ? -4.626  -80.535 -46.626 1.00 28.86  ? 10  VAL B CB  1 
ATOM   4231 C CG1 . VAL B 1 9   ? -5.855  -79.804 -46.091 1.00 29.63  ? 10  VAL B CG1 1 
ATOM   4232 C CG2 . VAL B 1 9   ? -4.220  -81.626 -45.673 1.00 34.86  ? 10  VAL B CG2 1 
ATOM   4233 N N   . THR B 1 10  ? -6.812  -80.052 -49.027 1.00 32.17  ? 11  THR B N   1 
ATOM   4234 C CA  . THR B 1 10  ? -7.533  -78.998 -49.718 1.00 41.41  ? 11  THR B CA  1 
ATOM   4235 C C   . THR B 1 10  ? -8.309  -78.167 -48.711 1.00 35.81  ? 11  THR B C   1 
ATOM   4236 O O   . THR B 1 10  ? -9.098  -78.697 -47.936 1.00 37.82  ? 11  THR B O   1 
ATOM   4237 C CB  . THR B 1 10  ? -8.500  -79.581 -50.777 1.00 41.05  ? 11  THR B CB  1 
ATOM   4238 O OG1 . THR B 1 10  ? -7.746  -80.280 -51.774 1.00 37.98  ? 11  THR B OG1 1 
ATOM   4239 C CG2 . THR B 1 10  ? -9.301  -78.477 -51.445 1.00 26.24  ? 11  THR B CG2 1 
ATOM   4240 N N   . VAL B 1 11  ? -8.066  -76.863 -48.719 1.00 36.46  ? 12  VAL B N   1 
ATOM   4241 C CA  . VAL B 1 11  ? -8.815  -75.936 -47.888 1.00 28.98  ? 12  VAL B CA  1 
ATOM   4242 C C   . VAL B 1 11  ? -9.609  -75.039 -48.815 1.00 39.31  ? 12  VAL B C   1 
ATOM   4243 O O   . VAL B 1 11  ? -9.396  -75.070 -50.029 1.00 43.45  ? 12  VAL B O   1 
ATOM   4244 C CB  . VAL B 1 11  ? -7.885  -75.074 -47.050 1.00 34.60  ? 12  VAL B CB  1 
ATOM   4245 C CG1 . VAL B 1 11  ? -7.147  -75.933 -46.029 1.00 27.99  ? 12  VAL B CG1 1 
ATOM   4246 C CG2 . VAL B 1 11  ? -6.908  -74.326 -47.959 1.00 24.88  ? 12  VAL B CG2 1 
ATOM   4247 N N   . ARG B 1 12  ? -10.504 -74.229 -48.257 1.00 34.13  ? 13  ARG B N   1 
ATOM   4248 C CA  . ARG B 1 12  ? -11.401 -73.421 -49.083 1.00 39.57  ? 13  ARG B CA  1 
ATOM   4249 C C   . ARG B 1 12  ? -10.708 -72.636 -50.200 1.00 40.91  ? 13  ARG B C   1 
ATOM   4250 O O   . ARG B 1 12  ? -11.292 -72.418 -51.257 1.00 46.01  ? 13  ARG B O   1 
ATOM   4251 C CB  . ARG B 1 12  ? -12.245 -72.477 -48.226 1.00 32.04  ? 13  ARG B CB  1 
ATOM   4252 C CG  . ARG B 1 12  ? -13.376 -73.169 -47.489 1.00 53.55  ? 13  ARG B CG  1 
ATOM   4253 C CD  . ARG B 1 12  ? -14.347 -72.163 -46.875 1.00 69.36  ? 13  ARG B CD  1 
ATOM   4254 N NE  . ARG B 1 12  ? -15.300 -72.813 -45.975 1.00 72.66  ? 13  ARG B NE  1 
ATOM   4255 C CZ  . ARG B 1 12  ? -16.361 -72.212 -45.442 1.00 79.42  ? 13  ARG B CZ  1 
ATOM   4256 N NH1 . ARG B 1 12  ? -16.620 -70.941 -45.723 1.00 84.90  ? 13  ARG B NH1 1 
ATOM   4257 N NH2 . ARG B 1 12  ? -17.171 -72.884 -44.632 1.00 71.28  ? 13  ARG B NH2 1 
ATOM   4258 N N   . GLY B 1 13  ? -9.461  -72.235 -49.972 1.00 37.91  ? 14  GLY B N   1 
ATOM   4259 C CA  . GLY B 1 13  ? -8.760  -71.376 -50.910 1.00 36.84  ? 14  GLY B CA  1 
ATOM   4260 C C   . GLY B 1 13  ? -8.026  -72.091 -52.036 1.00 40.77  ? 14  GLY B C   1 
ATOM   4261 O O   . GLY B 1 13  ? -7.624  -71.462 -53.018 1.00 36.56  ? 14  GLY B O   1 
ATOM   4262 N N   . GLY B 1 14  ? -7.838  -73.399 -51.893 1.00 35.22  ? 15  GLY B N   1 
ATOM   4263 C CA  . GLY B 1 14  ? -7.078  -74.170 -52.860 1.00 28.77  ? 15  GLY B CA  1 
ATOM   4264 C C   . GLY B 1 14  ? -6.259  -75.259 -52.207 1.00 32.29  ? 15  GLY B C   1 
ATOM   4265 O O   . GLY B 1 14  ? -6.418  -75.537 -51.019 1.00 41.09  ? 15  GLY B O   1 
ATOM   4266 N N   . ARG B 1 15  ? -5.361  -75.865 -52.972 1.00 34.16  ? 16  ARG B N   1 
ATOM   4267 C CA  . ARG B 1 15  ? -4.601  -77.024 -52.499 1.00 33.64  ? 16  ARG B CA  1 
ATOM   4268 C C   . ARG B 1 15  ? -3.293  -76.700 -51.777 1.00 28.78  ? 16  ARG B C   1 
ATOM   4269 O O   . ARG B 1 15  ? -2.602  -75.738 -52.120 1.00 34.54  ? 16  ARG B O   1 
ATOM   4270 C CB  . ARG B 1 15  ? -4.345  -77.992 -53.657 1.00 36.08  ? 16  ARG B CB  1 
ATOM   4271 C CG  . ARG B 1 15  ? -5.592  -78.749 -54.093 1.00 49.59  ? 16  ARG B CG  1 
ATOM   4272 C CD  . ARG B 1 15  ? -5.290  -79.721 -55.220 1.00 47.32  ? 16  ARG B CD  1 
ATOM   4273 N NE  . ARG B 1 15  ? -5.088  -79.017 -56.482 1.00 57.70  ? 16  ARG B NE  1 
ATOM   4274 C CZ  . ARG B 1 15  ? -4.214  -79.388 -57.413 1.00 65.35  ? 16  ARG B CZ  1 
ATOM   4275 N NH1 . ARG B 1 15  ? -3.452  -80.465 -57.222 1.00 49.70  ? 16  ARG B NH1 1 
ATOM   4276 N NH2 . ARG B 1 15  ? -4.101  -78.678 -58.532 1.00 46.94  ? 16  ARG B NH2 1 
ATOM   4277 N N   . LEU B 1 16  ? -2.959  -77.538 -50.796 1.00 25.81  ? 17  LEU B N   1 
ATOM   4278 C CA  . LEU B 1 16  ? -1.777  -77.373 -49.951 1.00 30.17  ? 17  LEU B CA  1 
ATOM   4279 C C   . LEU B 1 16  ? -0.946  -78.643 -49.905 1.00 30.41  ? 17  LEU B C   1 
ATOM   4280 O O   . LEU B 1 16  ? -1.474  -79.753 -49.937 1.00 35.58  ? 17  LEU B O   1 
ATOM   4281 C CB  . LEU B 1 16  ? -2.178  -77.029 -48.502 1.00 30.26  ? 17  LEU B CB  1 
ATOM   4282 C CG  . LEU B 1 16  ? -2.850  -75.687 -48.215 1.00 31.58  ? 17  LEU B CG  1 
ATOM   4283 C CD1 . LEU B 1 16  ? -3.230  -75.578 -46.747 1.00 33.45  ? 17  LEU B CD1 1 
ATOM   4284 C CD2 . LEU B 1 16  ? -1.933  -74.547 -48.614 1.00 26.15  ? 17  LEU B CD2 1 
ATOM   4285 N N   . ARG B 1 17  ? 0.360   -78.469 -49.784 1.00 28.57  ? 18  ARG B N   1 
ATOM   4286 C CA  . ARG B 1 17  ? 1.271   -79.588 -49.637 1.00 29.84  ? 18  ARG B CA  1 
ATOM   4287 C C   . ARG B 1 17  ? 2.096   -79.302 -48.392 1.00 35.02  ? 18  ARG B C   1 
ATOM   4288 O O   . ARG B 1 17  ? 2.659   -78.216 -48.249 1.00 30.90  ? 18  ARG B O   1 
ATOM   4289 C CB  . ARG B 1 17  ? 2.177   -79.696 -50.870 1.00 27.54  ? 18  ARG B CB  1 
ATOM   4290 C CG  . ARG B 1 17  ? 3.344   -80.651 -50.717 1.00 30.25  ? 18  ARG B CG  1 
ATOM   4291 C CD  . ARG B 1 17  ? 4.212   -80.675 -51.991 1.00 48.98  ? 18  ARG B CD  1 
ATOM   4292 N NE  . ARG B 1 17  ? 3.483   -81.127 -53.180 1.00 38.40  ? 18  ARG B NE  1 
ATOM   4293 C CZ  . ARG B 1 17  ? 3.201   -80.370 -54.246 1.00 45.99  ? 18  ARG B CZ  1 
ATOM   4294 N NH1 . ARG B 1 17  ? 3.590   -79.101 -54.306 1.00 39.79  ? 18  ARG B NH1 1 
ATOM   4295 N NH2 . ARG B 1 17  ? 2.532   -80.890 -55.269 1.00 44.69  ? 18  ARG B NH2 1 
ATOM   4296 N N   . GLY B 1 18  ? 2.159   -80.263 -47.480 1.00 31.73  ? 19  GLY B N   1 
ATOM   4297 C CA  . GLY B 1 18  ? 2.868   -80.046 -46.237 1.00 30.08  ? 19  GLY B CA  1 
ATOM   4298 C C   . GLY B 1 18  ? 4.130   -80.865 -46.164 1.00 33.10  ? 19  GLY B C   1 
ATOM   4299 O O   . GLY B 1 18  ? 4.661   -81.312 -47.171 1.00 36.89  ? 19  GLY B O   1 
ATOM   4300 N N   . ILE B 1 19  ? 4.603   -81.073 -44.949 1.00 31.86  ? 20  ILE B N   1 
ATOM   4301 C CA  . ILE B 1 19  ? 5.869   -81.733 -44.740 1.00 34.44  ? 20  ILE B CA  1 
ATOM   4302 C C   . ILE B 1 19  ? 5.691   -82.726 -43.583 1.00 39.83  ? 20  ILE B C   1 
ATOM   4303 O O   . ILE B 1 19  ? 4.789   -82.575 -42.759 1.00 39.76  ? 20  ILE B O   1 
ATOM   4304 C CB  . ILE B 1 19  ? 6.968   -80.662 -44.479 1.00 37.89  ? 20  ILE B CB  1 
ATOM   4305 C CG1 . ILE B 1 19  ? 8.372   -81.240 -44.631 1.00 56.86  ? 20  ILE B CG1 1 
ATOM   4306 C CG2 . ILE B 1 19  ? 6.786   -79.994 -43.107 1.00 40.47  ? 20  ILE B CG2 1 
ATOM   4307 C CD1 . ILE B 1 19  ? 9.478   -80.219 -44.358 1.00 48.99  ? 20  ILE B CD1 1 
ATOM   4308 N N   . ARG B 1 20  ? 6.514   -83.763 -43.540 1.00 45.20  ? 21  ARG B N   1 
ATOM   4309 C CA  . ARG B 1 20  ? 6.434   -84.746 -42.466 1.00 38.88  ? 21  ARG B CA  1 
ATOM   4310 C C   . ARG B 1 20  ? 7.571   -84.493 -41.489 1.00 45.96  ? 21  ARG B C   1 
ATOM   4311 O O   . ARG B 1 20  ? 8.734   -84.459 -41.886 1.00 42.75  ? 21  ARG B O   1 
ATOM   4312 C CB  . ARG B 1 20  ? 6.532   -86.152 -43.040 1.00 43.83  ? 21  ARG B CB  1 
ATOM   4313 C CG  . ARG B 1 20  ? 6.556   -87.279 -42.030 1.00 45.28  ? 21  ARG B CG  1 
ATOM   4314 C CD  . ARG B 1 20  ? 6.626   -88.602 -42.787 1.00 63.50  ? 21  ARG B CD  1 
ATOM   4315 N NE  . ARG B 1 20  ? 6.441   -89.778 -41.940 1.00 73.83  ? 21  ARG B NE  1 
ATOM   4316 C CZ  . ARG B 1 20  ? 7.437   -90.503 -41.441 1.00 73.32  ? 21  ARG B CZ  1 
ATOM   4317 N NH1 . ARG B 1 20  ? 8.696   -90.168 -41.697 1.00 81.18  ? 21  ARG B NH1 1 
ATOM   4318 N NH2 . ARG B 1 20  ? 7.175   -91.563 -40.683 1.00 67.57  ? 21  ARG B NH2 1 
ATOM   4319 N N   . LEU B 1 21  ? 7.232   -84.294 -40.218 1.00 40.87  ? 22  LEU B N   1 
ATOM   4320 C CA  . LEU B 1 21  ? 8.233   -83.988 -39.198 1.00 39.89  ? 22  LEU B CA  1 
ATOM   4321 C C   . LEU B 1 21  ? 8.560   -85.186 -38.325 1.00 35.78  ? 22  LEU B C   1 
ATOM   4322 O O   . LEU B 1 21  ? 7.663   -85.882 -37.847 1.00 41.24  ? 22  LEU B O   1 
ATOM   4323 C CB  . LEU B 1 21  ? 7.756   -82.854 -38.293 1.00 37.55  ? 22  LEU B CB  1 
ATOM   4324 C CG  . LEU B 1 21  ? 7.545   -81.475 -38.905 1.00 40.67  ? 22  LEU B CG  1 
ATOM   4325 C CD1 . LEU B 1 21  ? 7.209   -80.502 -37.796 1.00 46.52  ? 22  LEU B CD1 1 
ATOM   4326 C CD2 . LEU B 1 21  ? 8.788   -81.049 -39.659 1.00 27.94  ? 22  LEU B CD2 1 
ATOM   4327 N N   . LYS B 1 22  ? 9.850   -85.416 -38.111 1.00 41.57  ? 23  LYS B N   1 
ATOM   4328 C CA  . LYS B 1 22  ? 10.289  -86.382 -37.113 1.00 44.35  ? 23  LYS B CA  1 
ATOM   4329 C C   . LYS B 1 22  ? 10.111  -85.800 -35.715 1.00 42.79  ? 23  LYS B C   1 
ATOM   4330 O O   . LYS B 1 22  ? 10.466  -84.652 -35.462 1.00 45.35  ? 23  LYS B O   1 
ATOM   4331 C CB  . LYS B 1 22  ? 11.757  -86.756 -37.322 1.00 38.55  ? 23  LYS B CB  1 
ATOM   4332 C CG  . LYS B 1 22  ? 12.032  -87.588 -38.565 1.00 49.39  ? 23  LYS B CG  1 
ATOM   4333 C CD  . LYS B 1 22  ? 13.464  -88.120 -38.563 1.00 62.06  ? 23  LYS B CD  1 
ATOM   4334 C CE  . LYS B 1 22  ? 13.782  -88.937 -39.820 1.00 68.54  ? 23  LYS B CE  1 
ATOM   4335 N NZ  . LYS B 1 22  ? 14.245  -88.095 -40.966 1.00 63.75  ? 23  LYS B NZ  1 
ATOM   4336 N N   . THR B 1 23  ? 9.534   -86.586 -34.815 1.00 45.30  ? 24  THR B N   1 
ATOM   4337 C CA  . THR B 1 23  ? 9.543   -86.250 -33.395 1.00 56.54  ? 24  THR B CA  1 
ATOM   4338 C C   . THR B 1 23  ? 9.934   -87.498 -32.609 1.00 57.71  ? 24  THR B C   1 
ATOM   4339 O O   . THR B 1 23  ? 9.616   -88.614 -33.020 1.00 58.36  ? 24  THR B O   1 
ATOM   4340 C CB  . THR B 1 23  ? 8.161   -85.795 -32.878 1.00 46.51  ? 24  THR B CB  1 
ATOM   4341 O OG1 . THR B 1 23  ? 7.434   -86.940 -32.417 1.00 50.05  ? 24  THR B OG1 1 
ATOM   4342 C CG2 . THR B 1 23  ? 7.360   -85.065 -33.958 1.00 43.45  ? 24  THR B CG2 1 
ATOM   4343 N N   . PRO B 1 24  ? 10.619  -87.312 -31.471 1.00 60.96  ? 25  PRO B N   1 
ATOM   4344 C CA  . PRO B 1 24  ? 11.008  -88.380 -30.542 1.00 59.15  ? 25  PRO B CA  1 
ATOM   4345 C C   . PRO B 1 24  ? 9.978   -89.496 -30.378 1.00 51.11  ? 25  PRO B C   1 
ATOM   4346 O O   . PRO B 1 24  ? 10.374  -90.643 -30.211 1.00 68.56  ? 25  PRO B O   1 
ATOM   4347 C CB  . PRO B 1 24  ? 11.180  -87.626 -29.230 1.00 53.61  ? 25  PRO B CB  1 
ATOM   4348 C CG  . PRO B 1 24  ? 11.750  -86.313 -29.674 1.00 62.55  ? 25  PRO B CG  1 
ATOM   4349 C CD  . PRO B 1 24  ? 11.127  -86.003 -31.022 1.00 59.75  ? 25  PRO B CD  1 
ATOM   4350 N N   . GLY B 1 25  ? 8.691   -89.180 -30.452 1.00 52.93  ? 26  GLY B N   1 
ATOM   4351 C CA  . GLY B 1 25  ? 7.673   -90.200 -30.277 1.00 54.04  ? 26  GLY B CA  1 
ATOM   4352 C C   . GLY B 1 25  ? 6.932   -90.647 -31.530 1.00 61.12  ? 26  GLY B C   1 
ATOM   4353 O O   . GLY B 1 25  ? 5.938   -91.360 -31.428 1.00 67.27  ? 26  GLY B O   1 
ATOM   4354 N N   . GLY B 1 26  ? 7.397   -90.243 -32.709 1.00 55.25  ? 27  GLY B N   1 
ATOM   4355 C CA  . GLY B 1 26  ? 6.719   -90.615 -33.945 1.00 38.84  ? 27  GLY B CA  1 
ATOM   4356 C C   . GLY B 1 26  ? 6.416   -89.439 -34.865 1.00 49.03  ? 27  GLY B C   1 
ATOM   4357 O O   . GLY B 1 26  ? 6.538   -88.284 -34.465 1.00 51.76  ? 27  GLY B O   1 
ATOM   4358 N N   . PRO B 1 27  ? 6.007   -89.726 -36.109 1.00 46.99  ? 28  PRO B N   1 
ATOM   4359 C CA  . PRO B 1 27  ? 5.821   -88.670 -37.111 1.00 51.04  ? 28  PRO B CA  1 
ATOM   4360 C C   . PRO B 1 27  ? 4.623   -87.754 -36.850 1.00 42.24  ? 28  PRO B C   1 
ATOM   4361 O O   . PRO B 1 27  ? 3.607   -88.173 -36.292 1.00 42.96  ? 28  PRO B O   1 
ATOM   4362 C CB  . PRO B 1 27  ? 5.589   -89.461 -38.402 1.00 47.91  ? 28  PRO B CB  1 
ATOM   4363 C CG  . PRO B 1 27  ? 4.976   -90.741 -37.935 1.00 51.02  ? 28  PRO B CG  1 
ATOM   4364 C CD  . PRO B 1 27  ? 5.690   -91.059 -36.652 1.00 43.87  ? 28  PRO B CD  1 
ATOM   4365 N N   . VAL B 1 28  ? 4.760   -86.505 -37.284 1.00 34.41  ? 29  VAL B N   1 
ATOM   4366 C CA  . VAL B 1 28  ? 3.681   -85.529 -37.250 1.00 36.57  ? 29  VAL B CA  1 
ATOM   4367 C C   . VAL B 1 28  ? 3.608   -84.844 -38.625 1.00 34.41  ? 29  VAL B C   1 
ATOM   4368 O O   . VAL B 1 28  ? 4.635   -84.609 -39.252 1.00 37.18  ? 29  VAL B O   1 
ATOM   4369 C CB  . VAL B 1 28  ? 3.938   -84.477 -36.139 1.00 30.37  ? 29  VAL B CB  1 
ATOM   4370 C CG1 . VAL B 1 28  ? 3.024   -83.288 -36.294 1.00 32.74  ? 29  VAL B CG1 1 
ATOM   4371 C CG2 . VAL B 1 28  ? 3.799   -85.114 -34.749 1.00 30.98  ? 29  VAL B CG2 1 
ATOM   4372 N N   . SER B 1 29  ? 2.404   -84.546 -39.103 1.00 32.55  ? 30  SER B N   1 
ATOM   4373 C CA  . SER B 1 29  ? 2.251   -83.769 -40.333 1.00 33.60  ? 30  SER B CA  1 
ATOM   4374 C C   . SER B 1 29  ? 2.228   -82.272 -40.019 1.00 38.75  ? 30  SER B C   1 
ATOM   4375 O O   . SER B 1 29  ? 1.494   -81.825 -39.143 1.00 37.00  ? 30  SER B O   1 
ATOM   4376 C CB  . SER B 1 29  ? 0.965   -84.149 -41.065 1.00 34.74  ? 30  SER B CB  1 
ATOM   4377 O OG  . SER B 1 29  ? 0.976   -85.499 -41.490 1.00 44.68  ? 30  SER B OG  1 
ATOM   4378 N N   . ALA B 1 30  ? 3.031   -81.498 -40.736 1.00 31.21  ? 31  ALA B N   1 
ATOM   4379 C CA  . ALA B 1 30  ? 3.056   -80.058 -40.534 1.00 28.13  ? 31  ALA B CA  1 
ATOM   4380 C C   . ALA B 1 30  ? 2.755   -79.299 -41.831 1.00 33.95  ? 31  ALA B C   1 
ATOM   4381 O O   . ALA B 1 30  ? 3.288   -79.608 -42.894 1.00 35.30  ? 31  ALA B O   1 
ATOM   4382 C CB  . ALA B 1 30  ? 4.392   -79.623 -39.957 1.00 23.24  ? 31  ALA B CB  1 
ATOM   4383 N N   . PHE B 1 31  ? 1.884   -78.308 -41.721 1.00 32.19  ? 32  PHE B N   1 
ATOM   4384 C CA  . PHE B 1 31  ? 1.570   -77.419 -42.819 1.00 23.89  ? 32  PHE B CA  1 
ATOM   4385 C C   . PHE B 1 31  ? 1.954   -76.005 -42.383 1.00 35.12  ? 32  PHE B C   1 
ATOM   4386 O O   . PHE B 1 31  ? 1.188   -75.314 -41.712 1.00 35.47  ? 32  PHE B O   1 
ATOM   4387 C CB  . PHE B 1 31  ? 0.088   -77.539 -43.172 1.00 27.36  ? 32  PHE B CB  1 
ATOM   4388 C CG  . PHE B 1 31  ? -0.298  -78.916 -43.635 1.00 34.49  ? 32  PHE B CG  1 
ATOM   4389 C CD1 . PHE B 1 31  ? -0.600  -79.915 -42.716 1.00 31.10  ? 32  PHE B CD1 1 
ATOM   4390 C CD2 . PHE B 1 31  ? -0.321  -79.226 -44.990 1.00 38.09  ? 32  PHE B CD2 1 
ATOM   4391 C CE1 . PHE B 1 31  ? -0.933  -81.196 -43.136 1.00 33.68  ? 32  PHE B CE1 1 
ATOM   4392 C CE2 . PHE B 1 31  ? -0.655  -80.503 -45.426 1.00 33.96  ? 32  PHE B CE2 1 
ATOM   4393 C CZ  . PHE B 1 31  ? -0.962  -81.493 -44.494 1.00 43.38  ? 32  PHE B CZ  1 
ATOM   4394 N N   . LEU B 1 32  ? 3.165   -75.600 -42.755 1.00 26.51  ? 33  LEU B N   1 
ATOM   4395 C CA  . LEU B 1 32  ? 3.772   -74.375 -42.267 1.00 27.51  ? 33  LEU B CA  1 
ATOM   4396 C C   . LEU B 1 32  ? 3.771   -73.290 -43.322 1.00 28.41  ? 33  LEU B C   1 
ATOM   4397 O O   . LEU B 1 32  ? 4.207   -73.519 -44.436 1.00 35.60  ? 33  LEU B O   1 
ATOM   4398 C CB  . LEU B 1 32  ? 5.217   -74.658 -41.879 1.00 28.66  ? 33  LEU B CB  1 
ATOM   4399 C CG  . LEU B 1 32  ? 5.429   -75.831 -40.928 1.00 33.35  ? 33  LEU B CG  1 
ATOM   4400 C CD1 . LEU B 1 32  ? 6.897   -75.940 -40.599 1.00 26.45  ? 33  LEU B CD1 1 
ATOM   4401 C CD2 . LEU B 1 32  ? 4.601   -75.638 -39.665 1.00 24.34  ? 33  LEU B CD2 1 
ATOM   4402 N N   . GLY B 1 33  ? 3.314   -72.097 -42.969 1.00 29.59  ? 34  GLY B N   1 
ATOM   4403 C CA  . GLY B 1 33  ? 3.328   -70.995 -43.911 1.00 27.46  ? 34  GLY B CA  1 
ATOM   4404 C C   . GLY B 1 33  ? 2.137   -71.001 -44.855 1.00 32.12  ? 34  GLY B C   1 
ATOM   4405 O O   . GLY B 1 33  ? 2.287   -70.778 -46.055 1.00 30.65  ? 34  GLY B O   1 
ATOM   4406 N N   . ILE B 1 34  ? 0.950   -71.256 -44.310 1.00 30.48  ? 35  ILE B N   1 
ATOM   4407 C CA  . ILE B 1 34  ? -0.287  -71.148 -45.070 1.00 24.53  ? 35  ILE B CA  1 
ATOM   4408 C C   . ILE B 1 34  ? -0.789  -69.706 -45.100 1.00 26.14  ? 35  ILE B C   1 
ATOM   4409 O O   . ILE B 1 34  ? -1.057  -69.120 -44.059 1.00 34.68  ? 35  ILE B O   1 
ATOM   4410 C CB  . ILE B 1 34  ? -1.380  -72.018 -44.462 1.00 26.08  ? 35  ILE B CB  1 
ATOM   4411 C CG1 . ILE B 1 34  ? -0.893  -73.463 -44.323 1.00 27.12  ? 35  ILE B CG1 1 
ATOM   4412 C CG2 . ILE B 1 34  ? -2.639  -71.921 -45.293 1.00 21.76  ? 35  ILE B CG2 1 
ATOM   4413 C CD1 . ILE B 1 34  ? -1.819  -74.349 -43.508 1.00 24.59  ? 35  ILE B CD1 1 
ATOM   4414 N N   . PRO B 1 35  ? -0.915  -69.124 -46.302 1.00 34.95  ? 36  PRO B N   1 
ATOM   4415 C CA  . PRO B 1 35  ? -1.420  -67.747 -46.397 1.00 35.09  ? 36  PRO B CA  1 
ATOM   4416 C C   . PRO B 1 35  ? -2.892  -67.647 -45.974 1.00 32.26  ? 36  PRO B C   1 
ATOM   4417 O O   . PRO B 1 35  ? -3.716  -68.412 -46.465 1.00 33.54  ? 36  PRO B O   1 
ATOM   4418 C CB  . PRO B 1 35  ? -1.252  -67.413 -47.890 1.00 33.02  ? 36  PRO B CB  1 
ATOM   4419 C CG  . PRO B 1 35  ? -1.251  -68.751 -48.589 1.00 25.64  ? 36  PRO B CG  1 
ATOM   4420 C CD  . PRO B 1 35  ? -0.583  -69.697 -47.621 1.00 25.28  ? 36  PRO B CD  1 
ATOM   4421 N N   . PHE B 1 36  ? -3.226  -66.731 -45.068 1.00 27.53  ? 37  PHE B N   1 
ATOM   4422 C CA  . PHE B 1 36  ? -4.625  -66.615 -44.652 1.00 29.32  ? 37  PHE B CA  1 
ATOM   4423 C C   . PHE B 1 36  ? -5.196  -65.240 -44.942 1.00 28.11  ? 37  PHE B C   1 
ATOM   4424 O O   . PHE B 1 36  ? -6.404  -65.023 -44.863 1.00 32.06  ? 37  PHE B O   1 
ATOM   4425 C CB  . PHE B 1 36  ? -4.834  -67.035 -43.187 1.00 28.50  ? 37  PHE B CB  1 
ATOM   4426 C CG  . PHE B 1 36  ? -4.252  -66.082 -42.177 1.00 27.64  ? 37  PHE B CG  1 
ATOM   4427 C CD1 . PHE B 1 36  ? -4.997  -65.004 -41.705 1.00 26.27  ? 37  PHE B CD1 1 
ATOM   4428 C CD2 . PHE B 1 36  ? -2.975  -66.279 -41.679 1.00 25.55  ? 37  PHE B CD2 1 
ATOM   4429 C CE1 . PHE B 1 36  ? -4.467  -64.129 -40.769 1.00 29.41  ? 37  PHE B CE1 1 
ATOM   4430 C CE2 . PHE B 1 36  ? -2.433  -65.411 -40.743 1.00 31.65  ? 37  PHE B CE2 1 
ATOM   4431 C CZ  . PHE B 1 36  ? -3.185  -64.335 -40.277 1.00 29.71  ? 37  PHE B CZ  1 
ATOM   4432 N N   . ALA B 1 37  ? -4.314  -64.322 -45.309 1.00 27.13  ? 38  ALA B N   1 
ATOM   4433 C CA  . ALA B 1 37  ? -4.718  -62.993 -45.721 1.00 28.48  ? 38  ALA B CA  1 
ATOM   4434 C C   . ALA B 1 37  ? -3.936  -62.558 -46.966 1.00 38.80  ? 38  ALA B C   1 
ATOM   4435 O O   . ALA B 1 37  ? -2.854  -63.077 -47.241 1.00 30.43  ? 38  ALA B O   1 
ATOM   4436 C CB  . ALA B 1 37  ? -4.489  -62.007 -44.592 1.00 21.79  ? 38  ALA B CB  1 
ATOM   4437 N N   . GLU B 1 38  ? -4.497  -61.618 -47.722 1.00 33.97  ? 39  GLU B N   1 
ATOM   4438 C CA  . GLU B 1 38  ? -3.729  -60.910 -48.734 1.00 37.69  ? 39  GLU B CA  1 
ATOM   4439 C C   . GLU B 1 38  ? -2.634  -60.161 -48.000 1.00 35.29  ? 39  GLU B C   1 
ATOM   4440 O O   . GLU B 1 38  ? -2.870  -59.636 -46.914 1.00 41.29  ? 39  GLU B O   1 
ATOM   4441 C CB  . GLU B 1 38  ? -4.614  -59.920 -49.492 1.00 34.09  ? 39  GLU B CB  1 
ATOM   4442 C CG  . GLU B 1 38  ? -5.616  -60.587 -50.415 1.00 44.16  ? 39  GLU B CG  1 
ATOM   4443 C CD  . GLU B 1 38  ? -4.942  -61.444 -51.469 1.00 38.43  ? 39  GLU B CD  1 
ATOM   4444 O OE1 . GLU B 1 38  ? -3.934  -60.982 -52.045 1.00 47.75  ? 39  GLU B OE1 1 
ATOM   4445 O OE2 . GLU B 1 38  ? -5.408  -62.581 -51.711 1.00 40.35  ? 39  GLU B OE2 1 
ATOM   4446 N N   . PRO B 1 39  ? -1.427  -60.131 -48.575 1.00 35.48  ? 40  PRO B N   1 
ATOM   4447 C CA  . PRO B 1 39  ? -0.298  -59.438 -47.941 1.00 32.66  ? 40  PRO B CA  1 
ATOM   4448 C C   . PRO B 1 39  ? -0.616  -57.964 -47.651 1.00 35.21  ? 40  PRO B C   1 
ATOM   4449 O O   . PRO B 1 39  ? -0.947  -57.219 -48.564 1.00 31.92  ? 40  PRO B O   1 
ATOM   4450 C CB  . PRO B 1 39  ? 0.823   -59.571 -48.984 1.00 22.26  ? 40  PRO B CB  1 
ATOM   4451 C CG  . PRO B 1 39  ? 0.477   -60.806 -49.750 1.00 28.10  ? 40  PRO B CG  1 
ATOM   4452 C CD  . PRO B 1 39  ? -1.030  -60.850 -49.801 1.00 31.23  ? 40  PRO B CD  1 
ATOM   4453 N N   . PRO B 1 40  ? -0.522  -57.539 -46.380 1.00 37.54  ? 41  PRO B N   1 
ATOM   4454 C CA  . PRO B 1 40  ? -0.870  -56.148 -46.044 1.00 34.59  ? 41  PRO B CA  1 
ATOM   4455 C C   . PRO B 1 40  ? 0.191   -55.156 -46.533 1.00 43.02  ? 41  PRO B C   1 
ATOM   4456 O O   . PRO B 1 40  ? 0.760   -54.413 -45.727 1.00 38.10  ? 41  PRO B O   1 
ATOM   4457 C CB  . PRO B 1 40  ? -0.926  -56.146 -44.511 1.00 35.35  ? 41  PRO B CB  1 
ATOM   4458 C CG  . PRO B 1 40  ? -0.691  -57.545 -44.084 1.00 38.85  ? 41  PRO B CG  1 
ATOM   4459 C CD  . PRO B 1 40  ? -0.045  -58.284 -45.212 1.00 29.86  ? 41  PRO B CD  1 
ATOM   4460 N N   . MET B 1 41  ? 0.429   -55.143 -47.844 1.00 41.12  ? 42  MET B N   1 
ATOM   4461 C CA  . MET B 1 41  ? 1.519   -54.387 -48.449 1.00 41.12  ? 42  MET B CA  1 
ATOM   4462 C C   . MET B 1 41  ? 1.031   -53.054 -48.954 1.00 35.98  ? 42  MET B C   1 
ATOM   4463 O O   . MET B 1 41  ? -0.125  -52.932 -49.346 1.00 34.74  ? 42  MET B O   1 
ATOM   4464 C CB  . MET B 1 41  ? 2.053   -55.146 -49.667 1.00 57.48  ? 42  MET B CB  1 
ATOM   4465 C CG  . MET B 1 41  ? 2.579   -56.515 -49.373 1.00 47.07  ? 42  MET B CG  1 
ATOM   4466 S SD  . MET B 1 41  ? 4.132   -56.366 -48.517 1.00 64.10  ? 42  MET B SD  1 
ATOM   4467 C CE  . MET B 1 41  ? 5.113   -55.526 -49.759 1.00 69.21  ? 42  MET B CE  1 
ATOM   4468 N N   . GLY B 1 42  ? 1.931   -52.072 -48.975 1.00 37.12  ? 43  GLY B N   1 
ATOM   4469 C CA  . GLY B 1 42  ? 1.694   -50.800 -49.642 1.00 35.99  ? 43  GLY B CA  1 
ATOM   4470 C C   . GLY B 1 42  ? 0.433   -50.063 -49.235 1.00 41.79  ? 43  GLY B C   1 
ATOM   4471 O O   . GLY B 1 42  ? 0.374   -49.492 -48.146 1.00 41.37  ? 43  GLY B O   1 
ATOM   4472 N N   . PRO B 1 43  ? -0.577  -50.050 -50.122 1.00 43.76  ? 44  PRO B N   1 
ATOM   4473 C CA  . PRO B 1 43  ? -1.857  -49.411 -49.797 1.00 34.72  ? 44  PRO B CA  1 
ATOM   4474 C C   . PRO B 1 43  ? -2.605  -50.136 -48.679 1.00 42.52  ? 44  PRO B C   1 
ATOM   4475 O O   . PRO B 1 43  ? -3.431  -49.520 -48.003 1.00 38.40  ? 44  PRO B O   1 
ATOM   4476 C CB  . PRO B 1 43  ? -2.647  -49.496 -51.121 1.00 34.28  ? 44  PRO B CB  1 
ATOM   4477 C CG  . PRO B 1 43  ? -1.972  -50.557 -51.916 1.00 26.41  ? 44  PRO B CG  1 
ATOM   4478 C CD  . PRO B 1 43  ? -0.523  -50.502 -51.525 1.00 29.09  ? 44  PRO B CD  1 
ATOM   4479 N N   . ARG B 1 44  ? -2.320  -51.422 -48.489 1.00 38.75  ? 45  ARG B N   1 
ATOM   4480 C CA  . ARG B 1 44  ? -2.981  -52.200 -47.442 1.00 40.06  ? 45  ARG B CA  1 
ATOM   4481 C C   . ARG B 1 44  ? -2.310  -52.108 -46.059 1.00 39.84  ? 45  ARG B C   1 
ATOM   4482 O O   . ARG B 1 44  ? -2.766  -52.738 -45.102 1.00 33.26  ? 45  ARG B O   1 
ATOM   4483 C CB  . ARG B 1 44  ? -3.119  -53.661 -47.858 1.00 36.18  ? 45  ARG B CB  1 
ATOM   4484 C CG  . ARG B 1 44  ? -4.025  -53.909 -49.055 1.00 35.60  ? 45  ARG B CG  1 
ATOM   4485 C CD  . ARG B 1 44  ? -3.992  -55.399 -49.375 1.00 52.86  ? 45  ARG B CD  1 
ATOM   4486 N NE  . ARG B 1 44  ? -4.544  -55.745 -50.681 1.00 63.80  ? 45  ARG B NE  1 
ATOM   4487 C CZ  . ARG B 1 44  ? -5.802  -56.123 -50.876 1.00 69.40  ? 45  ARG B CZ  1 
ATOM   4488 N NH1 . ARG B 1 44  ? -6.646  -56.187 -49.849 1.00 64.83  ? 45  ARG B NH1 1 
ATOM   4489 N NH2 . ARG B 1 44  ? -6.219  -56.428 -52.097 1.00 62.30  ? 45  ARG B NH2 1 
ATOM   4490 N N   . ARG B 1 45  ? -1.237  -51.330 -45.949 1.00 36.67  ? 46  ARG B N   1 
ATOM   4491 C CA  . ARG B 1 45  ? -0.607  -51.106 -44.650 1.00 32.27  ? 46  ARG B CA  1 
ATOM   4492 C C   . ARG B 1 45  ? -1.578  -50.369 -43.703 1.00 32.37  ? 46  ARG B C   1 
ATOM   4493 O O   . ARG B 1 45  ? -2.231  -49.415 -44.109 1.00 38.29  ? 46  ARG B O   1 
ATOM   4494 C CB  . ARG B 1 45  ? 0.710   -50.334 -44.819 1.00 27.21  ? 46  ARG B CB  1 
ATOM   4495 C CG  . ARG B 1 45  ? 1.472   -50.111 -43.522 1.00 29.24  ? 46  ARG B CG  1 
ATOM   4496 C CD  . ARG B 1 45  ? 2.647   -49.146 -43.684 1.00 34.91  ? 46  ARG B CD  1 
ATOM   4497 N NE  . ARG B 1 45  ? 3.869   -49.775 -44.192 1.00 30.45  ? 46  ARG B NE  1 
ATOM   4498 C CZ  . ARG B 1 45  ? 4.990   -49.108 -44.454 1.00 32.90  ? 46  ARG B CZ  1 
ATOM   4499 N NH1 . ARG B 1 45  ? 5.041   -47.797 -44.261 1.00 27.45  ? 46  ARG B NH1 1 
ATOM   4500 N NH2 . ARG B 1 45  ? 6.063   -49.742 -44.904 1.00 29.37  ? 46  ARG B NH2 1 
ATOM   4501 N N   . PHE B 1 46  ? -1.660  -50.834 -42.455 1.00 35.44  ? 47  PHE B N   1 
ATOM   4502 C CA  . PHE B 1 46  ? -2.576  -50.322 -41.411 1.00 29.68  ? 47  PHE B CA  1 
ATOM   4503 C C   . PHE B 1 46  ? -4.044  -50.686 -41.608 1.00 32.73  ? 47  PHE B C   1 
ATOM   4504 O O   . PHE B 1 46  ? -4.873  -50.343 -40.772 1.00 36.20  ? 47  PHE B O   1 
ATOM   4505 C CB  . PHE B 1 46  ? -2.498  -48.803 -41.187 1.00 29.24  ? 47  PHE B CB  1 
ATOM   4506 C CG  . PHE B 1 46  ? -1.107  -48.250 -41.103 1.00 32.58  ? 47  PHE B CG  1 
ATOM   4507 C CD1 . PHE B 1 46  ? -0.278  -48.567 -40.042 1.00 22.87  ? 47  PHE B CD1 1 
ATOM   4508 C CD2 . PHE B 1 46  ? -0.644  -47.370 -42.075 1.00 27.16  ? 47  PHE B CD2 1 
ATOM   4509 C CE1 . PHE B 1 46  ? 1.007   -48.036 -39.959 1.00 25.87  ? 47  PHE B CE1 1 
ATOM   4510 C CE2 . PHE B 1 46  ? 0.632   -46.830 -41.999 1.00 29.49  ? 47  PHE B CE2 1 
ATOM   4511 C CZ  . PHE B 1 46  ? 1.461   -47.163 -40.939 1.00 30.46  ? 47  PHE B CZ  1 
ATOM   4512 N N   . LEU B 1 47  ? -4.377  -51.368 -42.696 1.00 26.59  ? 48  LEU B N   1 
ATOM   4513 C CA  . LEU B 1 47  ? -5.772  -51.717 -42.953 1.00 27.30  ? 48  LEU B CA  1 
ATOM   4514 C C   . LEU B 1 47  ? -6.105  -53.078 -42.368 1.00 30.25  ? 48  LEU B C   1 
ATOM   4515 O O   . LEU B 1 47  ? -5.213  -53.913 -42.187 1.00 30.11  ? 48  LEU B O   1 
ATOM   4516 C CB  . LEU B 1 47  ? -6.066  -51.734 -44.456 1.00 29.55  ? 48  LEU B CB  1 
ATOM   4517 C CG  . LEU B 1 47  ? -6.056  -50.410 -45.225 1.00 49.33  ? 48  LEU B CG  1 
ATOM   4518 C CD1 . LEU B 1 47  ? -6.431  -50.638 -46.694 1.00 25.58  ? 48  LEU B CD1 1 
ATOM   4519 C CD2 . LEU B 1 47  ? -6.994  -49.408 -44.574 1.00 36.31  ? 48  LEU B CD2 1 
ATOM   4520 N N   . PRO B 1 48  ? -7.395  -53.316 -42.081 1.00 26.58  ? 49  PRO B N   1 
ATOM   4521 C CA  . PRO B 1 48  ? -7.832  -54.647 -41.657 1.00 26.30  ? 49  PRO B CA  1 
ATOM   4522 C C   . PRO B 1 48  ? -7.405  -55.683 -42.685 1.00 32.82  ? 49  PRO B C   1 
ATOM   4523 O O   . PRO B 1 48  ? -7.312  -55.368 -43.868 1.00 39.18  ? 49  PRO B O   1 
ATOM   4524 C CB  . PRO B 1 48  ? -9.360  -54.521 -41.646 1.00 24.00  ? 49  PRO B CB  1 
ATOM   4525 C CG  . PRO B 1 48  ? -9.606  -53.088 -41.376 1.00 27.68  ? 49  PRO B CG  1 
ATOM   4526 C CD  . PRO B 1 48  ? -8.513  -52.358 -42.115 1.00 27.80  ? 49  PRO B CD  1 
ATOM   4527 N N   . PRO B 1 49  ? -7.141  -56.912 -42.242 1.00 35.28  ? 50  PRO B N   1 
ATOM   4528 C CA  . PRO B 1 49  ? -6.685  -57.925 -43.194 1.00 26.94  ? 50  PRO B CA  1 
ATOM   4529 C C   . PRO B 1 49  ? -7.809  -58.319 -44.166 1.00 34.25  ? 50  PRO B C   1 
ATOM   4530 O O   . PRO B 1 49  ? -8.970  -58.396 -43.762 1.00 39.31  ? 50  PRO B O   1 
ATOM   4531 C CB  . PRO B 1 49  ? -6.301  -59.095 -42.290 1.00 29.64  ? 50  PRO B CB  1 
ATOM   4532 C CG  . PRO B 1 49  ? -7.213  -58.940 -41.065 1.00 23.51  ? 50  PRO B CG  1 
ATOM   4533 C CD  . PRO B 1 49  ? -7.361  -57.450 -40.887 1.00 27.75  ? 50  PRO B CD  1 
ATOM   4534 N N   . GLU B 1 50  ? -7.466  -58.533 -45.434 1.00 32.59  ? 51  GLU B N   1 
ATOM   4535 C CA  . GLU B 1 50  ? -8.418  -59.058 -46.406 1.00 39.12  ? 51  GLU B CA  1 
ATOM   4536 C C   . GLU B 1 50  ? -8.154  -60.549 -46.502 1.00 36.34  ? 51  GLU B C   1 
ATOM   4537 O O   . GLU B 1 50  ? -7.005  -60.974 -46.453 1.00 34.90  ? 51  GLU B O   1 
ATOM   4538 C CB  . GLU B 1 50  ? -8.239  -58.404 -47.786 1.00 35.20  ? 51  GLU B CB  1 
ATOM   4539 C CG  . GLU B 1 50  ? -9.493  -58.488 -48.671 1.00 73.11  ? 51  GLU B CG  1 
ATOM   4540 C CD  . GLU B 1 50  ? -9.196  -58.619 -50.171 1.00 85.34  ? 51  GLU B CD  1 
ATOM   4541 O OE1 . GLU B 1 50  ? -8.739  -57.623 -50.778 1.00 78.61  ? 51  GLU B OE1 1 
ATOM   4542 O OE2 . GLU B 1 50  ? -9.436  -59.716 -50.744 1.00 63.20  ? 51  GLU B OE2 1 
ATOM   4543 N N   . PRO B 1 51  ? -9.214  -61.353 -46.612 1.00 36.18  ? 52  PRO B N   1 
ATOM   4544 C CA  . PRO B 1 51  ? -9.026  -62.798 -46.787 1.00 36.54  ? 52  PRO B CA  1 
ATOM   4545 C C   . PRO B 1 51  ? -8.180  -63.151 -48.023 1.00 42.18  ? 52  PRO B C   1 
ATOM   4546 O O   . PRO B 1 51  ? -8.270  -62.498 -49.073 1.00 33.92  ? 52  PRO B O   1 
ATOM   4547 C CB  . PRO B 1 51  ? -10.456 -63.312 -46.960 1.00 37.80  ? 52  PRO B CB  1 
ATOM   4548 C CG  . PRO B 1 51  ? -11.309 -62.296 -46.251 1.00 32.92  ? 52  PRO B CG  1 
ATOM   4549 C CD  . PRO B 1 51  ? -10.634 -60.983 -46.482 1.00 31.83  ? 52  PRO B CD  1 
ATOM   4550 N N   . LYS B 1 52  ? -7.350  -64.181 -47.880 1.00 34.44  ? 53  LYS B N   1 
ATOM   4551 C CA  . LYS B 1 52  ? -6.548  -64.681 -48.983 1.00 37.58  ? 53  LYS B CA  1 
ATOM   4552 C C   . LYS B 1 52  ? -7.435  -65.127 -50.156 1.00 35.85  ? 53  LYS B C   1 
ATOM   4553 O O   . LYS B 1 52  ? -8.305  -65.973 -49.998 1.00 31.64  ? 53  LYS B O   1 
ATOM   4554 C CB  . LYS B 1 52  ? -5.667  -65.830 -48.498 1.00 28.78  ? 53  LYS B CB  1 
ATOM   4555 C CG  . LYS B 1 52  ? -4.797  -66.471 -49.572 1.00 37.25  ? 53  LYS B CG  1 
ATOM   4556 C CD  . LYS B 1 52  ? -3.943  -65.433 -50.294 1.00 34.67  ? 53  LYS B CD  1 
ATOM   4557 C CE  . LYS B 1 52  ? -2.832  -66.096 -51.087 1.00 24.82  ? 53  LYS B CE  1 
ATOM   4558 N NZ  . LYS B 1 52  ? -1.824  -65.120 -51.618 1.00 39.59  ? 53  LYS B NZ  1 
ATOM   4559 N N   . GLN B 1 53  ? -7.224  -64.536 -51.326 1.00 32.76  ? 54  GLN B N   1 
ATOM   4560 C CA  . GLN B 1 53  ? -7.937  -64.961 -52.534 1.00 44.64  ? 54  GLN B CA  1 
ATOM   4561 C C   . GLN B 1 53  ? -7.582  -66.403 -52.909 1.00 31.71  ? 54  GLN B C   1 
ATOM   4562 O O   . GLN B 1 53  ? -6.431  -66.820 -52.762 1.00 34.59  ? 54  GLN B O   1 
ATOM   4563 C CB  . GLN B 1 53  ? -7.630  -64.013 -53.699 1.00 43.05  ? 54  GLN B CB  1 
ATOM   4564 C CG  . GLN B 1 53  ? -8.446  -62.724 -53.683 1.00 48.21  ? 54  GLN B CG  1 
ATOM   4565 C CD  . GLN B 1 53  ? -9.934  -62.986 -53.895 1.00 78.38  ? 54  GLN B CD  1 
ATOM   4566 O OE1 . GLN B 1 53  ? -10.694 -63.124 -52.932 1.00 67.17  ? 54  GLN B OE1 1 
ATOM   4567 N NE2 . GLN B 1 53  ? -10.354 -63.065 -55.161 1.00 70.80  ? 54  GLN B NE2 1 
ATOM   4568 N N   . PRO B 1 54  ? -8.570  -67.175 -53.383 1.00 36.79  ? 55  PRO B N   1 
ATOM   4569 C CA  . PRO B 1 54  ? -8.303  -68.567 -53.768 1.00 38.43  ? 55  PRO B CA  1 
ATOM   4570 C C   . PRO B 1 54  ? -7.222  -68.648 -54.843 1.00 44.50  ? 55  PRO B C   1 
ATOM   4571 O O   . PRO B 1 54  ? -7.063  -67.708 -55.619 1.00 31.34  ? 55  PRO B O   1 
ATOM   4572 C CB  . PRO B 1 54  ? -9.643  -69.038 -54.342 1.00 38.48  ? 55  PRO B CB  1 
ATOM   4573 C CG  . PRO B 1 54  ? -10.660 -68.125 -53.736 1.00 38.86  ? 55  PRO B CG  1 
ATOM   4574 C CD  . PRO B 1 54  ? -9.974  -66.796 -53.619 1.00 44.67  ? 55  PRO B CD  1 
ATOM   4575 N N   . TRP B 1 55  ? -6.481  -69.750 -54.865 1.00 35.78  ? 56  TRP B N   1 
ATOM   4576 C CA  . TRP B 1 55  ? -5.389  -69.933 -55.805 1.00 26.66  ? 56  TRP B CA  1 
ATOM   4577 C C   . TRP B 1 55  ? -5.535  -71.251 -56.573 1.00 40.03  ? 56  TRP B C   1 
ATOM   4578 O O   . TRP B 1 55  ? -6.140  -72.205 -56.080 1.00 36.72  ? 56  TRP B O   1 
ATOM   4579 C CB  . TRP B 1 55  ? -4.044  -69.933 -55.066 1.00 29.64  ? 56  TRP B CB  1 
ATOM   4580 C CG  . TRP B 1 55  ? -3.912  -71.064 -54.058 1.00 37.82  ? 56  TRP B CG  1 
ATOM   4581 C CD1 . TRP B 1 55  ? -3.444  -72.321 -54.293 1.00 33.30  ? 56  TRP B CD1 1 
ATOM   4582 C CD2 . TRP B 1 55  ? -4.267  -71.024 -52.667 1.00 28.59  ? 56  TRP B CD2 1 
ATOM   4583 N NE1 . TRP B 1 55  ? -3.484  -73.070 -53.136 1.00 36.91  ? 56  TRP B NE1 1 
ATOM   4584 C CE2 . TRP B 1 55  ? -3.986  -72.296 -52.126 1.00 32.24  ? 56  TRP B CE2 1 
ATOM   4585 C CE3 . TRP B 1 55  ? -4.789  -70.034 -51.827 1.00 36.34  ? 56  TRP B CE3 1 
ATOM   4586 C CZ2 . TRP B 1 55  ? -4.209  -72.605 -50.781 1.00 36.31  ? 56  TRP B CZ2 1 
ATOM   4587 C CZ3 . TRP B 1 55  ? -5.016  -70.347 -50.484 1.00 24.92  ? 56  TRP B CZ3 1 
ATOM   4588 C CH2 . TRP B 1 55  ? -4.720  -71.620 -49.981 1.00 25.18  ? 56  TRP B CH2 1 
ATOM   4589 N N   . SER B 1 56  ? -4.963  -71.305 -57.772 1.00 33.87  ? 57  SER B N   1 
ATOM   4590 C CA  . SER B 1 56  ? -4.929  -72.546 -58.539 1.00 47.93  ? 57  SER B CA  1 
ATOM   4591 C C   . SER B 1 56  ? -3.616  -73.243 -58.246 1.00 35.81  ? 57  SER B C   1 
ATOM   4592 O O   . SER B 1 56  ? -2.653  -72.607 -57.810 1.00 36.34  ? 57  SER B O   1 
ATOM   4593 C CB  . SER B 1 56  ? -5.033  -72.271 -60.043 1.00 30.26  ? 57  SER B CB  1 
ATOM   4594 O OG  . SER B 1 56  ? -3.790  -71.807 -60.539 1.00 44.41  ? 57  SER B OG  1 
ATOM   4595 N N   . GLY B 1 57  ? -3.570  -74.548 -58.484 1.00 31.64  ? 58  GLY B N   1 
ATOM   4596 C CA  . GLY B 1 57  ? -2.358  -75.301 -58.226 1.00 26.45  ? 58  GLY B CA  1 
ATOM   4597 C C   . GLY B 1 57  ? -2.166  -75.588 -56.747 1.00 40.48  ? 58  GLY B C   1 
ATOM   4598 O O   . GLY B 1 57  ? -3.105  -75.490 -55.951 1.00 34.61  ? 58  GLY B O   1 
ATOM   4599 N N   . VAL B 1 58  ? -0.939  -75.940 -56.384 1.00 30.08  ? 59  VAL B N   1 
ATOM   4600 C CA  . VAL B 1 58  ? -0.621  -76.357 -55.032 1.00 35.72  ? 59  VAL B CA  1 
ATOM   4601 C C   . VAL B 1 58  ? 0.371   -75.417 -54.350 1.00 41.50  ? 59  VAL B C   1 
ATOM   4602 O O   . VAL B 1 58  ? 1.489   -75.206 -54.834 1.00 33.61  ? 59  VAL B O   1 
ATOM   4603 C CB  . VAL B 1 58  ? -0.029  -77.766 -55.028 1.00 40.64  ? 59  VAL B CB  1 
ATOM   4604 C CG1 . VAL B 1 58  ? 0.120   -78.256 -53.598 1.00 43.18  ? 59  VAL B CG1 1 
ATOM   4605 C CG2 . VAL B 1 58  ? -0.909  -78.704 -55.842 1.00 28.05  ? 59  VAL B CG2 1 
ATOM   4606 N N   . VAL B 1 59  ? -0.044  -74.854 -53.220 1.00 38.54  ? 60  VAL B N   1 
ATOM   4607 C CA  . VAL B 1 59  ? 0.848   -74.039 -52.402 1.00 33.13  ? 60  VAL B CA  1 
ATOM   4608 C C   . VAL B 1 59  ? 1.661   -74.931 -51.479 1.00 30.00  ? 60  VAL B C   1 
ATOM   4609 O O   . VAL B 1 59  ? 1.101   -75.762 -50.758 1.00 38.99  ? 60  VAL B O   1 
ATOM   4610 C CB  . VAL B 1 59  ? 0.064   -73.008 -51.562 1.00 35.73  ? 60  VAL B CB  1 
ATOM   4611 C CG1 . VAL B 1 59  ? 0.878   -72.570 -50.341 1.00 30.11  ? 60  VAL B CG1 1 
ATOM   4612 C CG2 . VAL B 1 59  ? -0.325  -71.815 -52.423 1.00 30.81  ? 60  VAL B CG2 1 
ATOM   4613 N N   . ASP B 1 60  ? 2.980   -74.775 -51.513 1.00 26.75  ? 61  ASP B N   1 
ATOM   4614 C CA  . ASP B 1 60  ? 3.851   -75.507 -50.595 1.00 30.52  ? 61  ASP B CA  1 
ATOM   4615 C C   . ASP B 1 60  ? 3.859   -74.856 -49.215 1.00 34.99  ? 61  ASP B C   1 
ATOM   4616 O O   . ASP B 1 60  ? 4.419   -73.774 -49.036 1.00 29.66  ? 61  ASP B O   1 
ATOM   4617 C CB  . ASP B 1 60  ? 5.285   -75.598 -51.132 1.00 27.72  ? 61  ASP B CB  1 
ATOM   4618 C CG  . ASP B 1 60  ? 5.417   -76.603 -52.267 1.00 47.15  ? 61  ASP B CG  1 
ATOM   4619 O OD1 . ASP B 1 60  ? 5.532   -77.813 -51.982 1.00 42.01  ? 61  ASP B OD1 1 
ATOM   4620 O OD2 . ASP B 1 60  ? 5.401   -76.183 -53.447 1.00 49.47  ? 61  ASP B OD2 1 
ATOM   4621 N N   . ALA B 1 61  ? 3.230   -75.525 -48.251 1.00 31.95  ? 62  ALA B N   1 
ATOM   4622 C CA  . ALA B 1 61  ? 3.248   -75.095 -46.861 1.00 30.01  ? 62  ALA B CA  1 
ATOM   4623 C C   . ALA B 1 61  ? 4.317   -75.888 -46.139 1.00 31.87  ? 62  ALA B C   1 
ATOM   4624 O O   . ALA B 1 61  ? 4.010   -76.725 -45.291 1.00 28.70  ? 62  ALA B O   1 
ATOM   4625 C CB  . ALA B 1 61  ? 1.892   -75.332 -46.209 1.00 25.90  ? 62  ALA B CB  1 
ATOM   4626 N N   . THR B 1 62  ? 5.576   -75.626 -46.467 1.00 27.26  ? 63  THR B N   1 
ATOM   4627 C CA  . THR B 1 62  ? 6.637   -76.528 -46.056 1.00 27.68  ? 63  THR B CA  1 
ATOM   4628 C C   . THR B 1 62  ? 7.707   -75.879 -45.190 1.00 29.73  ? 63  THR B C   1 
ATOM   4629 O O   . THR B 1 62  ? 8.696   -76.527 -44.829 1.00 29.72  ? 63  THR B O   1 
ATOM   4630 C CB  . THR B 1 62  ? 7.310   -77.140 -47.293 1.00 30.98  ? 63  THR B CB  1 
ATOM   4631 O OG1 . THR B 1 62  ? 7.840   -76.085 -48.088 1.00 29.67  ? 63  THR B OG1 1 
ATOM   4632 C CG2 . THR B 1 62  ? 6.297   -77.930 -48.128 1.00 24.05  ? 63  THR B CG2 1 
ATOM   4633 N N   . THR B 1 63  ? 7.527   -74.602 -44.871 1.00 29.07  ? 64  THR B N   1 
ATOM   4634 C CA  . THR B 1 63  ? 8.435   -73.919 -43.948 1.00 29.88  ? 64  THR B CA  1 
ATOM   4635 C C   . THR B 1 63  ? 7.762   -72.668 -43.397 1.00 29.32  ? 64  THR B C   1 
ATOM   4636 O O   . THR B 1 63  ? 6.816   -72.156 -44.000 1.00 32.51  ? 64  THR B O   1 
ATOM   4637 C CB  . THR B 1 63  ? 9.775   -73.549 -44.629 1.00 30.81  ? 64  THR B CB  1 
ATOM   4638 O OG1 . THR B 1 63  ? 10.790  -73.381 -43.633 1.00 30.75  ? 64  THR B OG1 1 
ATOM   4639 C CG2 . THR B 1 63  ? 9.642   -72.263 -45.443 1.00 24.96  ? 64  THR B CG2 1 
ATOM   4640 N N   . PHE B 1 64  ? 8.225   -72.184 -42.247 1.00 24.15  ? 65  PHE B N   1 
ATOM   4641 C CA  . PHE B 1 64  ? 7.650   -70.971 -41.675 1.00 27.46  ? 65  PHE B CA  1 
ATOM   4642 C C   . PHE B 1 64  ? 7.914   -69.800 -42.613 1.00 34.04  ? 65  PHE B C   1 
ATOM   4643 O O   . PHE B 1 64  ? 9.004   -69.681 -43.176 1.00 26.22  ? 65  PHE B O   1 
ATOM   4644 C CB  . PHE B 1 64  ? 8.267   -70.643 -40.315 1.00 30.44  ? 65  PHE B CB  1 
ATOM   4645 C CG  . PHE B 1 64  ? 7.944   -71.628 -39.235 1.00 26.02  ? 65  PHE B CG  1 
ATOM   4646 C CD1 . PHE B 1 64  ? 6.647   -71.756 -38.755 1.00 23.71  ? 65  PHE B CD1 1 
ATOM   4647 C CD2 . PHE B 1 64  ? 8.949   -72.396 -38.665 1.00 27.35  ? 65  PHE B CD2 1 
ATOM   4648 C CE1 . PHE B 1 64  ? 6.355   -72.650 -37.748 1.00 30.62  ? 65  PHE B CE1 1 
ATOM   4649 C CE2 . PHE B 1 64  ? 8.666   -73.300 -37.659 1.00 24.92  ? 65  PHE B CE2 1 
ATOM   4650 C CZ  . PHE B 1 64  ? 7.366   -73.429 -37.195 1.00 29.16  ? 65  PHE B CZ  1 
ATOM   4651 N N   . GLN B 1 65  ? 6.922   -68.929 -42.759 1.00 32.22  ? 66  GLN B N   1 
ATOM   4652 C CA  . GLN B 1 65  ? 7.077   -67.726 -43.565 1.00 25.93  ? 66  GLN B CA  1 
ATOM   4653 C C   . GLN B 1 65  ? 7.728   -66.586 -42.787 1.00 27.75  ? 66  GLN B C   1 
ATOM   4654 O O   . GLN B 1 65  ? 8.170   -66.762 -41.650 1.00 27.34  ? 66  GLN B O   1 
ATOM   4655 C CB  . GLN B 1 65  ? 5.724   -67.282 -44.114 1.00 23.54  ? 66  GLN B CB  1 
ATOM   4656 C CG  . GLN B 1 65  ? 5.489   -67.691 -45.540 1.00 32.43  ? 66  GLN B CG  1 
ATOM   4657 C CD  . GLN B 1 65  ? 6.122   -66.719 -46.523 1.00 35.12  ? 66  GLN B CD  1 
ATOM   4658 O OE1 . GLN B 1 65  ? 6.883   -65.830 -46.137 1.00 35.65  ? 66  GLN B OE1 1 
ATOM   4659 N NE2 . GLN B 1 65  ? 5.792   -66.873 -47.799 1.00 35.85  ? 66  GLN B NE2 1 
ATOM   4660 N N   . SER B 1 66  ? 7.768   -65.412 -43.404 1.00 26.29  ? 67  SER B N   1 
ATOM   4661 C CA  . SER B 1 66  ? 8.474   -64.274 -42.823 1.00 28.97  ? 67  SER B CA  1 
ATOM   4662 C C   . SER B 1 66  ? 7.895   -63.806 -41.501 1.00 29.35  ? 67  SER B C   1 
ATOM   4663 O O   . SER B 1 66  ? 6.711   -63.964 -41.226 1.00 28.83  ? 67  SER B O   1 
ATOM   4664 C CB  . SER B 1 66  ? 8.501   -63.092 -43.796 1.00 24.17  ? 67  SER B CB  1 
ATOM   4665 O OG  . SER B 1 66  ? 9.095   -63.465 -45.023 1.00 36.43  ? 67  SER B OG  1 
ATOM   4666 N N   . VAL B 1 67  ? 8.761   -63.214 -40.697 1.00 29.55  ? 68  VAL B N   1 
ATOM   4667 C CA  . VAL B 1 67  ? 8.369   -62.549 -39.479 1.00 30.00  ? 68  VAL B CA  1 
ATOM   4668 C C   . VAL B 1 67  ? 7.852   -61.138 -39.801 1.00 34.89  ? 68  VAL B C   1 
ATOM   4669 O O   . VAL B 1 67  ? 8.462   -60.418 -40.595 1.00 32.67  ? 68  VAL B O   1 
ATOM   4670 C CB  . VAL B 1 67  ? 9.582   -62.467 -38.556 1.00 35.81  ? 68  VAL B CB  1 
ATOM   4671 C CG1 . VAL B 1 67  ? 9.293   -61.602 -37.368 1.00 32.80  ? 68  VAL B CG1 1 
ATOM   4672 C CG2 . VAL B 1 67  ? 10.009  -63.874 -38.132 1.00 30.89  ? 68  VAL B CG2 1 
ATOM   4673 N N   . CYS B 1 68  ? 6.724   -60.750 -39.206 1.00 25.14  ? 69  CYS B N   1 
ATOM   4674 C CA  . CYS B 1 68  ? 6.211   -59.393 -39.373 1.00 24.64  ? 69  CYS B CA  1 
ATOM   4675 C C   . CYS B 1 68  ? 7.260   -58.395 -38.902 1.00 28.33  ? 69  CYS B C   1 
ATOM   4676 O O   . CYS B 1 68  ? 8.021   -58.693 -37.983 1.00 33.61  ? 69  CYS B O   1 
ATOM   4677 C CB  . CYS B 1 68  ? 4.909   -59.205 -38.588 1.00 24.95  ? 69  CYS B CB  1 
ATOM   4678 S SG  . CYS B 1 68  ? 3.529   -60.259 -39.131 1.00 30.68  ? 69  CYS B SG  1 
ATOM   4679 N N   . TYR B 1 69  ? 7.312   -57.220 -39.527 1.00 25.57  ? 70  TYR B N   1 
ATOM   4680 C CA  . TYR B 1 69  ? 8.302   -56.209 -39.147 1.00 25.56  ? 70  TYR B CA  1 
ATOM   4681 C C   . TYR B 1 69  ? 8.237   -55.823 -37.674 1.00 27.56  ? 70  TYR B C   1 
ATOM   4682 O O   . TYR B 1 69  ? 7.160   -55.625 -37.112 1.00 27.08  ? 70  TYR B O   1 
ATOM   4683 C CB  . TYR B 1 69  ? 8.166   -54.954 -40.002 1.00 28.86  ? 70  TYR B CB  1 
ATOM   4684 C CG  . TYR B 1 69  ? 9.202   -54.856 -41.087 1.00 38.72  ? 70  TYR B CG  1 
ATOM   4685 C CD1 . TYR B 1 69  ? 8.907   -55.252 -42.389 1.00 33.26  ? 70  TYR B CD1 1 
ATOM   4686 C CD2 . TYR B 1 69  ? 10.476  -54.374 -40.816 1.00 32.76  ? 70  TYR B CD2 1 
ATOM   4687 C CE1 . TYR B 1 69  ? 9.841   -55.164 -43.384 1.00 30.71  ? 70  TYR B CE1 1 
ATOM   4688 C CE2 . TYR B 1 69  ? 11.422  -54.282 -41.814 1.00 34.34  ? 70  TYR B CE2 1 
ATOM   4689 C CZ  . TYR B 1 69  ? 11.096  -54.681 -43.100 1.00 30.80  ? 70  TYR B CZ  1 
ATOM   4690 O OH  . TYR B 1 69  ? 12.032  -54.600 -44.116 1.00 47.39  ? 70  TYR B OH  1 
ATOM   4691 N N   . GLN B 1 70  ? 9.402   -55.694 -37.060 1.00 25.23  ? 71  GLN B N   1 
ATOM   4692 C CA  . GLN B 1 70  ? 9.457   -55.465 -35.632 1.00 26.54  ? 71  GLN B CA  1 
ATOM   4693 C C   . GLN B 1 70  ? 10.861  -55.072 -35.208 1.00 35.80  ? 71  GLN B C   1 
ATOM   4694 O O   . GLN B 1 70  ? 11.840  -55.383 -35.885 1.00 37.77  ? 71  GLN B O   1 
ATOM   4695 C CB  . GLN B 1 70  ? 9.034   -56.737 -34.898 1.00 24.52  ? 71  GLN B CB  1 
ATOM   4696 C CG  . GLN B 1 70  ? 9.909   -57.957 -35.187 1.00 25.12  ? 71  GLN B CG  1 
ATOM   4697 C CD  . GLN B 1 70  ? 9.329   -59.230 -34.601 1.00 32.16  ? 71  GLN B CD  1 
ATOM   4698 O OE1 . GLN B 1 70  ? 9.857   -59.783 -33.633 1.00 30.83  ? 71  GLN B OE1 1 
ATOM   4699 N NE2 . GLN B 1 70  ? 8.225   -59.692 -35.173 1.00 26.78  ? 71  GLN B NE2 1 
ATOM   4700 N N   . TYR B 1 71  ? 10.950  -54.390 -34.075 1.00 35.11  ? 72  TYR B N   1 
ATOM   4701 C CA  . TYR B 1 71  ? 12.227  -54.049 -33.480 1.00 35.36  ? 72  TYR B CA  1 
ATOM   4702 C C   . TYR B 1 71  ? 12.958  -55.316 -33.029 1.00 39.74  ? 72  TYR B C   1 
ATOM   4703 O O   . TYR B 1 71  ? 12.346  -56.227 -32.471 1.00 40.36  ? 72  TYR B O   1 
ATOM   4704 C CB  . TYR B 1 71  ? 11.992  -53.111 -32.298 1.00 32.43  ? 72  TYR B CB  1 
ATOM   4705 C CG  . TYR B 1 71  ? 13.235  -52.793 -31.510 1.00 38.84  ? 72  TYR B CG  1 
ATOM   4706 C CD1 . TYR B 1 71  ? 14.108  -51.797 -31.929 1.00 30.99  ? 72  TYR B CD1 1 
ATOM   4707 C CD2 . TYR B 1 71  ? 13.534  -53.480 -30.337 1.00 34.63  ? 72  TYR B CD2 1 
ATOM   4708 C CE1 . TYR B 1 71  ? 15.251  -51.498 -31.212 1.00 38.61  ? 72  TYR B CE1 1 
ATOM   4709 C CE2 . TYR B 1 71  ? 14.679  -53.188 -29.609 1.00 44.05  ? 72  TYR B CE2 1 
ATOM   4710 C CZ  . TYR B 1 71  ? 15.534  -52.195 -30.052 1.00 46.15  ? 72  TYR B CZ  1 
ATOM   4711 O OH  . TYR B 1 71  ? 16.673  -51.899 -29.340 1.00 51.05  ? 72  TYR B OH  1 
ATOM   4712 N N   . VAL B 1 72  ? 14.265  -55.369 -33.269 1.00 37.15  ? 73  VAL B N   1 
ATOM   4713 C CA  . VAL B 1 72  ? 15.069  -56.535 -32.910 1.00 35.20  ? 73  VAL B CA  1 
ATOM   4714 C C   . VAL B 1 72  ? 15.963  -56.236 -31.716 1.00 40.07  ? 73  VAL B C   1 
ATOM   4715 O O   . VAL B 1 72  ? 16.814  -55.351 -31.774 1.00 52.37  ? 73  VAL B O   1 
ATOM   4716 C CB  . VAL B 1 72  ? 15.932  -57.007 -34.092 1.00 33.54  ? 73  VAL B CB  1 
ATOM   4717 C CG1 . VAL B 1 72  ? 16.881  -58.109 -33.656 1.00 34.05  ? 73  VAL B CG1 1 
ATOM   4718 C CG2 . VAL B 1 72  ? 15.045  -57.485 -35.217 1.00 28.58  ? 73  VAL B CG2 1 
ATOM   4719 N N   . ASP B 1 73  ? 15.769  -56.981 -30.635 1.00 41.36  ? 74  ASP B N   1 
ATOM   4720 C CA  . ASP B 1 73  ? 16.467  -56.701 -29.381 1.00 47.48  ? 74  ASP B CA  1 
ATOM   4721 C C   . ASP B 1 73  ? 17.970  -56.926 -29.485 1.00 49.68  ? 74  ASP B C   1 
ATOM   4722 O O   . ASP B 1 73  ? 18.422  -57.975 -29.961 1.00 48.38  ? 74  ASP B O   1 
ATOM   4723 C CB  . ASP B 1 73  ? 15.892  -57.544 -28.237 1.00 43.90  ? 74  ASP B CB  1 
ATOM   4724 C CG  . ASP B 1 73  ? 16.389  -57.091 -26.868 1.00 59.22  ? 74  ASP B CG  1 
ATOM   4725 O OD1 . ASP B 1 73  ? 17.033  -57.904 -26.174 1.00 46.30  ? 74  ASP B OD1 1 
ATOM   4726 O OD2 . ASP B 1 73  ? 16.134  -55.920 -26.493 1.00 65.22  ? 74  ASP B OD2 1 
ATOM   4727 N N   . THR B 1 74  ? 18.740  -55.938 -29.036 1.00 48.49  ? 75  THR B N   1 
ATOM   4728 C CA  . THR B 1 74  ? 20.199  -56.030 -29.090 1.00 53.69  ? 75  THR B CA  1 
ATOM   4729 C C   . THR B 1 74  ? 20.872  -55.701 -27.760 1.00 49.66  ? 75  THR B C   1 
ATOM   4730 O O   . THR B 1 74  ? 22.070  -55.424 -27.725 1.00 51.99  ? 75  THR B O   1 
ATOM   4731 C CB  . THR B 1 74  ? 20.788  -55.119 -30.186 1.00 59.81  ? 75  THR B CB  1 
ATOM   4732 O OG1 . THR B 1 74  ? 20.310  -53.782 -29.999 1.00 52.11  ? 75  THR B OG1 1 
ATOM   4733 C CG2 . THR B 1 74  ? 20.406  -55.624 -31.589 1.00 35.39  ? 75  THR B CG2 1 
ATOM   4734 N N   . LEU B 1 75  ? 20.105  -55.750 -26.672 1.00 50.09  ? 76  LEU B N   1 
ATOM   4735 C CA  . LEU B 1 75  ? 20.609  -55.384 -25.351 1.00 52.14  ? 76  LEU B CA  1 
ATOM   4736 C C   . LEU B 1 75  ? 21.729  -56.314 -24.891 1.00 63.06  ? 76  LEU B C   1 
ATOM   4737 O O   . LEU B 1 75  ? 22.717  -55.869 -24.297 1.00 59.22  ? 76  LEU B O   1 
ATOM   4738 C CB  . LEU B 1 75  ? 19.478  -55.368 -24.317 1.00 57.93  ? 76  LEU B CB  1 
ATOM   4739 C CG  . LEU B 1 75  ? 19.907  -55.011 -22.885 1.00 71.84  ? 76  LEU B CG  1 
ATOM   4740 C CD1 . LEU B 1 75  ? 20.448  -53.587 -22.815 1.00 61.54  ? 76  LEU B CD1 1 
ATOM   4741 C CD2 . LEU B 1 75  ? 18.773  -55.203 -21.885 1.00 60.80  ? 76  LEU B CD2 1 
ATOM   4742 N N   . TYR B 1 76  ? 21.569  -57.605 -25.159 1.00 49.77  ? 77  TYR B N   1 
ATOM   4743 C CA  . TYR B 1 76  ? 22.611  -58.574 -24.843 1.00 55.74  ? 77  TYR B CA  1 
ATOM   4744 C C   . TYR B 1 76  ? 22.875  -59.449 -26.066 1.00 56.26  ? 77  TYR B C   1 
ATOM   4745 O O   . TYR B 1 76  ? 22.412  -60.589 -26.126 1.00 53.31  ? 77  TYR B O   1 
ATOM   4746 C CB  . TYR B 1 76  ? 22.201  -59.446 -23.652 1.00 45.22  ? 77  TYR B CB  1 
ATOM   4747 C CG  . TYR B 1 76  ? 21.962  -58.693 -22.356 1.00 58.37  ? 77  TYR B CG  1 
ATOM   4748 C CD1 . TYR B 1 76  ? 23.005  -58.052 -21.700 1.00 56.96  ? 77  TYR B CD1 1 
ATOM   4749 C CD2 . TYR B 1 76  ? 20.695  -58.644 -21.777 1.00 57.34  ? 77  TYR B CD2 1 
ATOM   4750 C CE1 . TYR B 1 76  ? 22.797  -57.370 -20.509 1.00 56.74  ? 77  TYR B CE1 1 
ATOM   4751 C CE2 . TYR B 1 76  ? 20.474  -57.961 -20.586 1.00 60.07  ? 77  TYR B CE2 1 
ATOM   4752 C CZ  . TYR B 1 76  ? 21.532  -57.328 -19.952 1.00 67.76  ? 77  TYR B CZ  1 
ATOM   4753 O OH  . TYR B 1 76  ? 21.333  -56.654 -18.759 1.00 57.72  ? 77  TYR B OH  1 
ATOM   4754 N N   . PRO B 1 77  ? 23.622  -58.917 -27.048 1.00 60.77  ? 78  PRO B N   1 
ATOM   4755 C CA  . PRO B 1 77  ? 23.783  -59.606 -28.337 1.00 55.34  ? 78  PRO B CA  1 
ATOM   4756 C C   . PRO B 1 77  ? 24.439  -60.968 -28.164 1.00 57.21  ? 78  PRO B C   1 
ATOM   4757 O O   . PRO B 1 77  ? 25.429  -61.081 -27.441 1.00 60.29  ? 78  PRO B O   1 
ATOM   4758 C CB  . PRO B 1 77  ? 24.698  -58.665 -29.134 1.00 44.60  ? 78  PRO B CB  1 
ATOM   4759 C CG  . PRO B 1 77  ? 24.572  -57.334 -28.461 1.00 62.34  ? 78  PRO B CG  1 
ATOM   4760 C CD  . PRO B 1 77  ? 24.367  -57.648 -27.000 1.00 54.24  ? 78  PRO B CD  1 
ATOM   4761 N N   . GLY B 1 78  ? 23.873  -61.993 -28.795 1.00 52.25  ? 79  GLY B N   1 
ATOM   4762 C CA  . GLY B 1 78  ? 24.424  -63.335 -28.705 1.00 47.82  ? 79  GLY B CA  1 
ATOM   4763 C C   . GLY B 1 78  ? 23.960  -64.135 -27.502 1.00 54.57  ? 79  GLY B C   1 
ATOM   4764 O O   . GLY B 1 78  ? 24.109  -65.360 -27.477 1.00 56.75  ? 79  GLY B O   1 
ATOM   4765 N N   . PHE B 1 79  ? 23.404  -63.448 -26.503 1.00 48.68  ? 80  PHE B N   1 
ATOM   4766 C CA  . PHE B 1 79  ? 22.892  -64.098 -25.296 1.00 38.79  ? 80  PHE B CA  1 
ATOM   4767 C C   . PHE B 1 79  ? 21.643  -64.923 -25.628 1.00 44.47  ? 80  PHE B C   1 
ATOM   4768 O O   . PHE B 1 79  ? 20.713  -64.432 -26.268 1.00 47.34  ? 80  PHE B O   1 
ATOM   4769 C CB  . PHE B 1 79  ? 22.605  -63.038 -24.228 1.00 42.45  ? 80  PHE B CB  1 
ATOM   4770 C CG  . PHE B 1 79  ? 22.090  -63.586 -22.929 1.00 40.74  ? 80  PHE B CG  1 
ATOM   4771 C CD1 . PHE B 1 79  ? 22.837  -64.491 -22.191 1.00 40.83  ? 80  PHE B CD1 1 
ATOM   4772 C CD2 . PHE B 1 79  ? 20.869  -63.161 -22.421 1.00 42.62  ? 80  PHE B CD2 1 
ATOM   4773 C CE1 . PHE B 1 79  ? 22.369  -64.987 -20.981 1.00 42.74  ? 80  PHE B CE1 1 
ATOM   4774 C CE2 . PHE B 1 79  ? 20.392  -63.652 -21.210 1.00 46.91  ? 80  PHE B CE2 1 
ATOM   4775 C CZ  . PHE B 1 79  ? 21.144  -64.567 -20.489 1.00 43.99  ? 80  PHE B CZ  1 
ATOM   4776 N N   . GLU B 1 80  ? 21.636  -66.182 -25.211 1.00 38.54  ? 81  GLU B N   1 
ATOM   4777 C CA  . GLU B 1 80  ? 20.520  -67.080 -25.499 1.00 44.72  ? 81  GLU B CA  1 
ATOM   4778 C C   . GLU B 1 80  ? 19.175  -66.493 -25.057 1.00 48.34  ? 81  GLU B C   1 
ATOM   4779 O O   . GLU B 1 80  ? 18.173  -66.596 -25.770 1.00 44.82  ? 81  GLU B O   1 
ATOM   4780 C CB  . GLU B 1 80  ? 20.755  -68.448 -24.845 1.00 47.47  ? 81  GLU B CB  1 
ATOM   4781 C CG  . GLU B 1 80  ? 20.360  -69.638 -25.715 1.00 72.42  ? 81  GLU B CG  1 
ATOM   4782 C CD  . GLU B 1 80  ? 18.868  -69.905 -25.709 1.00 78.84  ? 81  GLU B CD  1 
ATOM   4783 O OE1 . GLU B 1 80  ? 18.257  -69.779 -24.625 1.00 82.95  ? 81  GLU B OE1 1 
ATOM   4784 O OE2 . GLU B 1 80  ? 18.310  -70.238 -26.783 1.00 72.55  ? 81  GLU B OE2 1 
ATOM   4785 N N   . GLY B 1 81  ? 19.167  -65.853 -23.891 1.00 45.88  ? 82  GLY B N   1 
ATOM   4786 C CA  . GLY B 1 81  ? 17.963  -65.245 -23.357 1.00 39.24  ? 82  GLY B CA  1 
ATOM   4787 C C   . GLY B 1 81  ? 17.369  -64.141 -24.217 1.00 38.08  ? 82  GLY B C   1 
ATOM   4788 O O   . GLY B 1 81  ? 16.184  -63.840 -24.107 1.00 44.90  ? 82  GLY B O   1 
ATOM   4789 N N   . THR B 1 82  ? 18.173  -63.523 -25.074 1.00 40.20  ? 83  THR B N   1 
ATOM   4790 C CA  . THR B 1 82  ? 17.608  -62.556 -26.006 1.00 41.85  ? 83  THR B CA  1 
ATOM   4791 C C   . THR B 1 82  ? 17.347  -63.173 -27.383 1.00 41.74  ? 83  THR B C   1 
ATOM   4792 O O   . THR B 1 82  ? 16.273  -62.984 -27.953 1.00 44.93  ? 83  THR B O   1 
ATOM   4793 C CB  . THR B 1 82  ? 18.467  -61.268 -26.149 1.00 45.53  ? 83  THR B CB  1 
ATOM   4794 O OG1 . THR B 1 82  ? 19.444  -61.438 -27.180 1.00 59.03  ? 83  THR B OG1 1 
ATOM   4795 C CG2 . THR B 1 82  ? 19.153  -60.922 -24.849 1.00 45.61  ? 83  THR B CG2 1 
ATOM   4796 N N   A GLU B 1 83  ? 18.322  -63.915 -27.904 0.31 38.08  ? 84  GLU B N   1 
ATOM   4797 N N   B GLU B 1 83  ? 18.317  -63.922 -27.898 0.69 37.92  ? 84  GLU B N   1 
ATOM   4798 C CA  A GLU B 1 83  ? 18.242  -64.440 -29.270 0.31 41.18  ? 84  GLU B CA  1 
ATOM   4799 C CA  B GLU B 1 83  ? 18.231  -64.446 -29.259 0.69 41.25  ? 84  GLU B CA  1 
ATOM   4800 C C   A GLU B 1 83  ? 17.127  -65.469 -29.491 0.31 37.41  ? 84  GLU B C   1 
ATOM   4801 C C   B GLU B 1 83  ? 17.073  -65.413 -29.477 0.69 37.45  ? 84  GLU B C   1 
ATOM   4802 O O   A GLU B 1 83  ? 16.692  -65.675 -30.623 0.31 34.71  ? 84  GLU B O   1 
ATOM   4803 O O   B GLU B 1 83  ? 16.550  -65.518 -30.584 0.69 34.44  ? 84  GLU B O   1 
ATOM   4804 C CB  A GLU B 1 83  ? 19.600  -64.991 -29.739 0.31 40.73  ? 84  GLU B CB  1 
ATOM   4805 C CB  B GLU B 1 83  ? 19.558  -65.083 -29.680 0.69 40.55  ? 84  GLU B CB  1 
ATOM   4806 C CG  A GLU B 1 83  ? 20.675  -63.915 -29.924 0.31 45.46  ? 84  GLU B CG  1 
ATOM   4807 C CG  B GLU B 1 83  ? 20.736  -64.115 -29.616 0.69 45.22  ? 84  GLU B CG  1 
ATOM   4808 C CD  A GLU B 1 83  ? 21.799  -64.332 -30.870 0.31 51.78  ? 84  GLU B CD  1 
ATOM   4809 C CD  B GLU B 1 83  ? 20.494  -62.831 -30.405 0.69 45.37  ? 84  GLU B CD  1 
ATOM   4810 O OE1 A GLU B 1 83  ? 21.972  -65.547 -31.110 0.31 50.34  ? 84  GLU B OE1 1 
ATOM   4811 O OE1 B GLU B 1 83  ? 19.794  -62.880 -31.443 0.69 45.28  ? 84  GLU B OE1 1 
ATOM   4812 O OE2 A GLU B 1 83  ? 22.510  -63.439 -31.380 0.31 51.23  ? 84  GLU B OE2 1 
ATOM   4813 O OE2 B GLU B 1 83  ? 21.009  -61.771 -29.986 0.69 46.19  ? 84  GLU B OE2 1 
ATOM   4814 N N   . MET B 1 84  ? 16.658  -66.104 -28.419 1.00 36.09  ? 85  MET B N   1 
ATOM   4815 C CA  . MET B 1 84  ? 15.559  -67.060 -28.538 1.00 25.16  ? 85  MET B CA  1 
ATOM   4816 C C   . MET B 1 84  ? 14.225  -66.396 -28.897 1.00 29.78  ? 85  MET B C   1 
ATOM   4817 O O   . MET B 1 84  ? 13.314  -67.065 -29.375 1.00 27.86  ? 85  MET B O   1 
ATOM   4818 C CB  . MET B 1 84  ? 15.397  -67.876 -27.260 1.00 33.16  ? 85  MET B CB  1 
ATOM   4819 C CG  . MET B 1 84  ? 14.834  -67.089 -26.087 1.00 29.43  ? 85  MET B CG  1 
ATOM   4820 S SD  . MET B 1 84  ? 14.562  -68.107 -24.624 1.00 35.55  ? 85  MET B SD  1 
ATOM   4821 C CE  . MET B 1 84  ? 13.054  -68.974 -25.037 1.00 26.33  ? 85  MET B CE  1 
ATOM   4822 N N   . TRP B 1 85  ? 14.115  -65.088 -28.667 1.00 29.52  ? 86  TRP B N   1 
ATOM   4823 C CA  . TRP B 1 85  ? 12.886  -64.348 -28.953 1.00 25.73  ? 86  TRP B CA  1 
ATOM   4824 C C   . TRP B 1 85  ? 12.971  -63.530 -30.243 1.00 30.63  ? 86  TRP B C   1 
ATOM   4825 O O   . TRP B 1 85  ? 11.953  -63.086 -30.779 1.00 29.77  ? 86  TRP B O   1 
ATOM   4826 C CB  . TRP B 1 85  ? 12.549  -63.409 -27.794 1.00 24.54  ? 86  TRP B CB  1 
ATOM   4827 C CG  . TRP B 1 85  ? 12.528  -64.066 -26.455 1.00 30.64  ? 86  TRP B CG  1 
ATOM   4828 C CD1 . TRP B 1 85  ? 13.459  -63.935 -25.461 1.00 32.67  ? 86  TRP B CD1 1 
ATOM   4829 C CD2 . TRP B 1 85  ? 11.527  -64.959 -25.950 1.00 28.40  ? 86  TRP B CD2 1 
ATOM   4830 N NE1 . TRP B 1 85  ? 13.100  -64.688 -24.375 1.00 24.47  ? 86  TRP B NE1 1 
ATOM   4831 C CE2 . TRP B 1 85  ? 11.915  -65.324 -24.645 1.00 32.85  ? 86  TRP B CE2 1 
ATOM   4832 C CE3 . TRP B 1 85  ? 10.340  -65.480 -26.473 1.00 25.57  ? 86  TRP B CE3 1 
ATOM   4833 C CZ2 . TRP B 1 85  ? 11.155  -66.189 -23.854 1.00 27.91  ? 86  TRP B CZ2 1 
ATOM   4834 C CZ3 . TRP B 1 85  ? 9.586   -66.339 -25.686 1.00 32.59  ? 86  TRP B CZ3 1 
ATOM   4835 C CH2 . TRP B 1 85  ? 9.999   -66.686 -24.391 1.00 27.53  ? 86  TRP B CH2 1 
ATOM   4836 N N   . ASN B 1 86  ? 14.190  -63.314 -30.720 1.00 25.69  ? 87  ASN B N   1 
ATOM   4837 C CA  . ASN B 1 86  ? 14.425  -62.559 -31.939 1.00 30.70  ? 87  ASN B CA  1 
ATOM   4838 C C   . ASN B 1 86  ? 13.991  -63.332 -33.193 1.00 33.14  ? 87  ASN B C   1 
ATOM   4839 O O   . ASN B 1 86  ? 13.963  -64.561 -33.191 1.00 28.56  ? 87  ASN B O   1 
ATOM   4840 C CB  . ASN B 1 86  ? 15.903  -62.165 -32.030 1.00 32.19  ? 87  ASN B CB  1 
ATOM   4841 C CG  . ASN B 1 86  ? 16.233  -60.944 -31.202 1.00 35.10  ? 87  ASN B CG  1 
ATOM   4842 O OD1 . ASN B 1 86  ? 15.354  -60.150 -30.864 1.00 40.70  ? 87  ASN B OD1 1 
ATOM   4843 N ND2 . ASN B 1 86  ? 17.510  -60.780 -30.875 1.00 36.50  ? 87  ASN B ND2 1 
ATOM   4844 N N   . PRO B 1 87  ? 13.641  -62.608 -34.266 1.00 28.32  ? 88  PRO B N   1 
ATOM   4845 C CA  . PRO B 1 87  ? 13.152  -63.244 -35.497 1.00 33.40  ? 88  PRO B CA  1 
ATOM   4846 C C   . PRO B 1 87  ? 14.104  -64.300 -36.069 1.00 33.15  ? 88  PRO B C   1 
ATOM   4847 O O   . PRO B 1 87  ? 15.315  -64.089 -36.123 1.00 24.92  ? 88  PRO B O   1 
ATOM   4848 C CB  . PRO B 1 87  ? 13.052  -62.070 -36.473 1.00 20.34  ? 88  PRO B CB  1 
ATOM   4849 C CG  . PRO B 1 87  ? 12.836  -60.890 -35.621 1.00 28.91  ? 88  PRO B CG  1 
ATOM   4850 C CD  . PRO B 1 87  ? 13.654  -61.140 -34.377 1.00 21.90  ? 88  PRO B CD  1 
ATOM   4851 N N   . ASN B 1 88  ? 13.548  -65.431 -36.487 1.00 28.04  ? 89  ASN B N   1 
ATOM   4852 C CA  . ASN B 1 88  ? 14.334  -66.471 -37.135 1.00 24.76  ? 89  ASN B CA  1 
ATOM   4853 C C   . ASN B 1 88  ? 13.942  -66.646 -38.600 1.00 30.77  ? 89  ASN B C   1 
ATOM   4854 O O   . ASN B 1 88  ? 14.170  -67.703 -39.186 1.00 33.88  ? 89  ASN B O   1 
ATOM   4855 C CB  . ASN B 1 88  ? 14.208  -67.800 -36.392 1.00 25.16  ? 89  ASN B CB  1 
ATOM   4856 C CG  . ASN B 1 88  ? 12.809  -68.356 -36.436 1.00 32.12  ? 89  ASN B CG  1 
ATOM   4857 O OD1 . ASN B 1 88  ? 11.845  -67.627 -36.687 1.00 30.08  ? 89  ASN B OD1 1 
ATOM   4858 N ND2 . ASN B 1 88  ? 12.682  -69.653 -36.181 1.00 33.45  ? 89  ASN B ND2 1 
ATOM   4859 N N   . ARG B 1 89  ? 13.319  -65.614 -39.164 1.00 25.32  ? 90  ARG B N   1 
ATOM   4860 C CA  . ARG B 1 89  ? 13.110  -65.492 -40.607 1.00 28.64  ? 90  ARG B CA  1 
ATOM   4861 C C   . ARG B 1 89  ? 13.278  -64.019 -40.899 1.00 33.97  ? 90  ARG B C   1 
ATOM   4862 O O   . ARG B 1 89  ? 13.320  -63.203 -39.972 1.00 33.65  ? 90  ARG B O   1 
ATOM   4863 C CB  . ARG B 1 89  ? 11.707  -65.921 -41.027 1.00 27.24  ? 90  ARG B CB  1 
ATOM   4864 C CG  . ARG B 1 89  ? 11.411  -67.401 -40.862 1.00 34.05  ? 90  ARG B CG  1 
ATOM   4865 C CD  . ARG B 1 89  ? 11.962  -68.184 -42.035 1.00 29.47  ? 90  ARG B CD  1 
ATOM   4866 N NE  . ARG B 1 89  ? 11.614  -69.599 -41.969 1.00 38.56  ? 90  ARG B NE  1 
ATOM   4867 C CZ  . ARG B 1 89  ? 12.208  -70.464 -41.156 1.00 35.78  ? 90  ARG B CZ  1 
ATOM   4868 N NH1 . ARG B 1 89  ? 13.164  -70.048 -40.337 1.00 33.54  ? 90  ARG B NH1 1 
ATOM   4869 N NH2 . ARG B 1 89  ? 11.837  -71.737 -41.150 1.00 35.55  ? 90  ARG B NH2 1 
ATOM   4870 N N   . GLU B 1 90  ? 13.382  -63.676 -42.175 1.00 28.42  ? 91  GLU B N   1 
ATOM   4871 C CA  . GLU B 1 90  ? 13.537  -62.286 -42.577 1.00 37.30  ? 91  GLU B CA  1 
ATOM   4872 C C   . GLU B 1 90  ? 12.286  -61.504 -42.202 1.00 32.63  ? 91  GLU B C   1 
ATOM   4873 O O   . GLU B 1 90  ? 11.186  -62.056 -42.159 1.00 31.60  ? 91  GLU B O   1 
ATOM   4874 C CB  . GLU B 1 90  ? 13.774  -62.186 -44.087 1.00 31.69  ? 91  GLU B CB  1 
ATOM   4875 C CG  . GLU B 1 90  ? 12.557  -62.535 -44.908 1.00 37.61  ? 91  GLU B CG  1 
ATOM   4876 C CD  . GLU B 1 90  ? 12.811  -62.474 -46.406 1.00 73.86  ? 91  GLU B CD  1 
ATOM   4877 O OE1 . GLU B 1 90  ? 13.704  -63.210 -46.887 1.00 72.07  ? 91  GLU B OE1 1 
ATOM   4878 O OE2 . GLU B 1 90  ? 12.115  -61.692 -47.098 1.00 58.70  ? 91  GLU B OE2 1 
ATOM   4879 N N   . LEU B 1 91  ? 12.464  -60.221 -41.919 1.00 28.43  ? 92  LEU B N   1 
ATOM   4880 C CA  . LEU B 1 91  ? 11.340  -59.340 -41.668 1.00 27.43  ? 92  LEU B CA  1 
ATOM   4881 C C   . LEU B 1 91  ? 10.660  -58.996 -42.983 1.00 34.46  ? 92  LEU B C   1 
ATOM   4882 O O   . LEU B 1 91  ? 11.314  -58.673 -43.963 1.00 32.76  ? 92  LEU B O   1 
ATOM   4883 C CB  . LEU B 1 91  ? 11.811  -58.051 -41.006 1.00 30.11  ? 92  LEU B CB  1 
ATOM   4884 C CG  . LEU B 1 91  ? 12.637  -58.220 -39.739 1.00 31.73  ? 92  LEU B CG  1 
ATOM   4885 C CD1 . LEU B 1 91  ? 12.858  -56.853 -39.082 1.00 24.70  ? 92  LEU B CD1 1 
ATOM   4886 C CD2 . LEU B 1 91  ? 11.914  -59.186 -38.816 1.00 27.75  ? 92  LEU B CD2 1 
ATOM   4887 N N   . SER B 1 92  ? 9.340   -59.056 -42.995 1.00 33.72  ? 93  SER B N   1 
ATOM   4888 C CA  . SER B 1 92  ? 8.582   -58.581 -44.131 1.00 29.42  ? 93  SER B CA  1 
ATOM   4889 C C   . SER B 1 92  ? 7.190   -58.133 -43.681 1.00 31.92  ? 93  SER B C   1 
ATOM   4890 O O   . SER B 1 92  ? 6.640   -58.671 -42.717 1.00 31.20  ? 93  SER B O   1 
ATOM   4891 C CB  . SER B 1 92  ? 8.462   -59.689 -45.173 1.00 25.94  ? 93  SER B CB  1 
ATOM   4892 O OG  . SER B 1 92  ? 7.550   -59.307 -46.182 1.00 31.22  ? 93  SER B OG  1 
ATOM   4893 N N   . GLU B 1 93  ? 6.618   -57.152 -44.372 1.00 31.36  ? 94  GLU B N   1 
ATOM   4894 C CA  . GLU B 1 93  ? 5.218   -56.813 -44.148 1.00 33.20  ? 94  GLU B CA  1 
ATOM   4895 C C   . GLU B 1 93  ? 4.332   -57.915 -44.710 1.00 31.06  ? 94  GLU B C   1 
ATOM   4896 O O   . GLU B 1 93  ? 3.179   -58.071 -44.301 1.00 30.65  ? 94  GLU B O   1 
ATOM   4897 C CB  . GLU B 1 93  ? 4.854   -55.475 -44.784 1.00 28.65  ? 94  GLU B CB  1 
ATOM   4898 C CG  . GLU B 1 93  ? 5.403   -54.264 -44.038 1.00 33.76  ? 94  GLU B CG  1 
ATOM   4899 C CD  . GLU B 1 93  ? 4.944   -52.958 -44.661 1.00 34.64  ? 94  GLU B CD  1 
ATOM   4900 O OE1 . GLU B 1 93  ? 3.860   -52.462 -44.291 1.00 37.11  ? 94  GLU B OE1 1 
ATOM   4901 O OE2 . GLU B 1 93  ? 5.659   -52.437 -45.540 1.00 43.99  ? 94  GLU B OE2 1 
ATOM   4902 N N   . ASP B 1 94  ? 4.877   -58.673 -45.657 1.00 28.83  ? 95  ASP B N   1 
ATOM   4903 C CA  . ASP B 1 94  ? 4.197   -59.852 -46.190 1.00 35.11  ? 95  ASP B CA  1 
ATOM   4904 C C   . ASP B 1 94  ? 4.386   -61.009 -45.207 1.00 36.53  ? 95  ASP B C   1 
ATOM   4905 O O   . ASP B 1 94  ? 5.245   -61.867 -45.414 1.00 31.47  ? 95  ASP B O   1 
ATOM   4906 C CB  . ASP B 1 94  ? 4.779   -60.200 -47.561 1.00 24.21  ? 95  ASP B CB  1 
ATOM   4907 C CG  . ASP B 1 94  ? 4.105   -61.400 -48.213 1.00 33.41  ? 95  ASP B CG  1 
ATOM   4908 O OD1 . ASP B 1 94  ? 3.065   -61.872 -47.719 1.00 36.94  ? 95  ASP B OD1 1 
ATOM   4909 O OD2 . ASP B 1 94  ? 4.621   -61.869 -49.246 1.00 49.42  ? 95  ASP B OD2 1 
ATOM   4910 N N   . CYS B 1 95  ? 3.588   -61.027 -44.138 1.00 31.31  ? 96  CYS B N   1 
ATOM   4911 C CA  . CYS B 1 95  ? 3.821   -61.965 -43.035 1.00 29.55  ? 96  CYS B CA  1 
ATOM   4912 C C   . CYS B 1 95  ? 2.595   -62.709 -42.539 1.00 26.73  ? 96  CYS B C   1 
ATOM   4913 O O   . CYS B 1 95  ? 2.689   -63.482 -41.593 1.00 31.81  ? 96  CYS B O   1 
ATOM   4914 C CB  . CYS B 1 95  ? 4.457   -61.242 -41.849 1.00 22.73  ? 96  CYS B CB  1 
ATOM   4915 S SG  . CYS B 1 95  ? 3.437   -59.901 -41.167 1.00 30.57  ? 96  CYS B SG  1 
ATOM   4916 N N   . LEU B 1 96  ? 1.445   -62.489 -43.163 1.00 28.32  ? 97  LEU B N   1 
ATOM   4917 C CA  . LEU B 1 96  ? 0.213   -63.088 -42.653 1.00 24.24  ? 97  LEU B CA  1 
ATOM   4918 C C   . LEU B 1 96  ? 0.009   -64.560 -43.034 1.00 25.10  ? 97  LEU B C   1 
ATOM   4919 O O   . LEU B 1 96  ? -0.802  -64.899 -43.902 1.00 31.61  ? 97  LEU B O   1 
ATOM   4920 C CB  . LEU B 1 96  ? -1.002  -62.212 -42.979 1.00 24.96  ? 97  LEU B CB  1 
ATOM   4921 C CG  . LEU B 1 96  ? -0.970  -60.865 -42.238 1.00 28.73  ? 97  LEU B CG  1 
ATOM   4922 C CD1 . LEU B 1 96  ? -2.268  -60.113 -42.423 1.00 26.80  ? 97  LEU B CD1 1 
ATOM   4923 C CD2 . LEU B 1 96  ? -0.672  -61.051 -40.730 1.00 22.81  ? 97  LEU B CD2 1 
ATOM   4924 N N   . TYR B 1 97  ? 0.757   -65.425 -42.352 1.00 26.12  ? 98  TYR B N   1 
ATOM   4925 C CA  . TYR B 1 97  ? 0.709   -66.867 -42.569 1.00 23.19  ? 98  TYR B CA  1 
ATOM   4926 C C   . TYR B 1 97  ? 0.442   -67.603 -41.252 1.00 29.66  ? 98  TYR B C   1 
ATOM   4927 O O   . TYR B 1 97  ? 0.834   -67.144 -40.180 1.00 28.29  ? 98  TYR B O   1 
ATOM   4928 C CB  . TYR B 1 97  ? 2.031   -67.347 -43.199 1.00 23.21  ? 98  TYR B CB  1 
ATOM   4929 C CG  . TYR B 1 97  ? 2.317   -66.665 -44.520 1.00 29.91  ? 98  TYR B CG  1 
ATOM   4930 C CD1 . TYR B 1 97  ? 1.934   -67.249 -45.723 1.00 34.29  ? 98  TYR B CD1 1 
ATOM   4931 C CD2 . TYR B 1 97  ? 2.929   -65.418 -44.560 1.00 25.90  ? 98  TYR B CD2 1 
ATOM   4932 C CE1 . TYR B 1 97  ? 2.170   -66.622 -46.925 1.00 31.78  ? 98  TYR B CE1 1 
ATOM   4933 C CE2 . TYR B 1 97  ? 3.165   -64.779 -45.749 1.00 30.46  ? 98  TYR B CE2 1 
ATOM   4934 C CZ  . TYR B 1 97  ? 2.786   -65.387 -46.931 1.00 40.53  ? 98  TYR B CZ  1 
ATOM   4935 O OH  . TYR B 1 97  ? 3.021   -64.752 -48.119 1.00 36.09  ? 98  TYR B OH  1 
ATOM   4936 N N   . LEU B 1 98  ? -0.239  -68.738 -41.336 1.00 24.84  ? 99  LEU B N   1 
ATOM   4937 C CA  . LEU B 1 98  ? -0.461  -69.567 -40.164 1.00 30.30  ? 99  LEU B CA  1 
ATOM   4938 C C   . LEU B 1 98  ? 0.062   -70.985 -40.384 1.00 32.24  ? 99  LEU B C   1 
ATOM   4939 O O   . LEU B 1 98  ? 0.390   -71.382 -41.506 1.00 29.03  ? 99  LEU B O   1 
ATOM   4940 C CB  . LEU B 1 98  ? -1.939  -69.559 -39.746 1.00 27.45  ? 99  LEU B CB  1 
ATOM   4941 C CG  . LEU B 1 98  ? -3.024  -70.032 -40.714 1.00 29.19  ? 99  LEU B CG  1 
ATOM   4942 C CD1 . LEU B 1 98  ? -3.057  -71.543 -40.838 1.00 27.29  ? 99  LEU B CD1 1 
ATOM   4943 C CD2 . LEU B 1 98  ? -4.381  -69.509 -40.268 1.00 28.53  ? 99  LEU B CD2 1 
ATOM   4944 N N   . ASN B 1 99  ? 0.122   -71.743 -39.298 1.00 30.59  ? 100 ASN B N   1 
ATOM   4945 C CA  . ASN B 1 99  ? 0.735   -73.058 -39.297 1.00 29.08  ? 100 ASN B CA  1 
ATOM   4946 C C   . ASN B 1 99  ? -0.206  -74.063 -38.677 1.00 28.37  ? 100 ASN B C   1 
ATOM   4947 O O   . ASN B 1 99  ? -0.843  -73.770 -37.676 1.00 30.37  ? 100 ASN B O   1 
ATOM   4948 C CB  . ASN B 1 99  ? 2.027   -73.011 -38.487 1.00 22.82  ? 100 ASN B CB  1 
ATOM   4949 C CG  . ASN B 1 99  ? 2.875   -71.794 -38.822 1.00 36.15  ? 100 ASN B CG  1 
ATOM   4950 O OD1 . ASN B 1 99  ? 3.373   -71.669 -39.936 1.00 30.36  ? 100 ASN B OD1 1 
ATOM   4951 N ND2 . ASN B 1 99  ? 3.043   -70.893 -37.854 1.00 29.61  ? 100 ASN B ND2 1 
ATOM   4952 N N   . VAL B 1 100 ? -0.304  -75.244 -39.273 1.00 27.58  ? 101 VAL B N   1 
ATOM   4953 C CA  . VAL B 1 100 ? -1.112  -76.315 -38.704 1.00 24.98  ? 101 VAL B CA  1 
ATOM   4954 C C   . VAL B 1 100 ? -0.232  -77.540 -38.511 1.00 33.84  ? 101 VAL B C   1 
ATOM   4955 O O   . VAL B 1 100 ? 0.467   -77.954 -39.437 1.00 35.50  ? 101 VAL B O   1 
ATOM   4956 C CB  . VAL B 1 100 ? -2.289  -76.695 -39.631 1.00 28.92  ? 101 VAL B CB  1 
ATOM   4957 C CG1 . VAL B 1 100 ? -3.124  -77.802 -39.017 1.00 22.63  ? 101 VAL B CG1 1 
ATOM   4958 C CG2 . VAL B 1 100 ? -3.145  -75.469 -39.954 1.00 22.04  ? 101 VAL B CG2 1 
ATOM   4959 N N   . TRP B 1 101 ? -0.243  -78.098 -37.305 1.00 28.98  ? 102 TRP B N   1 
ATOM   4960 C CA  . TRP B 1 101 ? 0.383   -79.386 -37.048 1.00 28.87  ? 102 TRP B CA  1 
ATOM   4961 C C   . TRP B 1 101 ? -0.720  -80.369 -36.721 1.00 36.15  ? 102 TRP B C   1 
ATOM   4962 O O   . TRP B 1 101 ? -1.621  -80.056 -35.936 1.00 34.74  ? 102 TRP B O   1 
ATOM   4963 C CB  . TRP B 1 101 ? 1.297   -79.345 -35.836 1.00 26.21  ? 102 TRP B CB  1 
ATOM   4964 C CG  . TRP B 1 101 ? 2.570   -78.603 -35.957 1.00 26.89  ? 102 TRP B CG  1 
ATOM   4965 C CD1 . TRP B 1 101 ? 3.808   -79.128 -36.209 1.00 24.21  ? 102 TRP B CD1 1 
ATOM   4966 C CD2 . TRP B 1 101 ? 2.760   -77.202 -35.750 1.00 29.52  ? 102 TRP B CD2 1 
ATOM   4967 N NE1 . TRP B 1 101 ? 4.755   -78.129 -36.192 1.00 32.00  ? 102 TRP B NE1 1 
ATOM   4968 C CE2 . TRP B 1 101 ? 4.135   -76.938 -35.912 1.00 30.63  ? 102 TRP B CE2 1 
ATOM   4969 C CE3 . TRP B 1 101 ? 1.895   -76.138 -35.459 1.00 23.05  ? 102 TRP B CE3 1 
ATOM   4970 C CZ2 . TRP B 1 101 ? 4.666   -75.658 -35.785 1.00 29.70  ? 102 TRP B CZ2 1 
ATOM   4971 C CZ3 . TRP B 1 101 ? 2.428   -74.867 -35.322 1.00 24.13  ? 102 TRP B CZ3 1 
ATOM   4972 C CH2 . TRP B 1 101 ? 3.801   -74.639 -35.488 1.00 26.92  ? 102 TRP B CH2 1 
ATOM   4973 N N   . THR B 1 102 ? -0.635  -81.564 -37.291 1.00 31.32  ? 103 THR B N   1 
ATOM   4974 C CA  . THR B 1 102 ? -1.657  -82.578 -37.083 1.00 27.94  ? 103 THR B CA  1 
ATOM   4975 C C   . THR B 1 102 ? -0.958  -83.917 -36.914 1.00 30.58  ? 103 THR B C   1 
ATOM   4976 O O   . THR B 1 102 ? 0.199   -84.063 -37.310 1.00 35.24  ? 103 THR B O   1 
ATOM   4977 C CB  . THR B 1 102 ? -2.650  -82.599 -38.261 1.00 35.70  ? 103 THR B CB  1 
ATOM   4978 O OG1 . THR B 1 102 ? -3.896  -83.171 -37.847 1.00 39.22  ? 103 THR B OG1 1 
ATOM   4979 C CG2 . THR B 1 102 ? -2.080  -83.383 -39.436 1.00 37.20  ? 103 THR B CG2 1 
ATOM   4980 N N   . PRO B 1 103 ? -1.626  -84.888 -36.272 1.00 37.49  ? 104 PRO B N   1 
ATOM   4981 C CA  . PRO B 1 103 ? -1.004  -86.211 -36.127 1.00 37.26  ? 104 PRO B CA  1 
ATOM   4982 C C   . PRO B 1 103 ? -0.812  -86.919 -37.469 1.00 43.81  ? 104 PRO B C   1 
ATOM   4983 O O   . PRO B 1 103 ? -1.503  -86.609 -38.444 1.00 42.33  ? 104 PRO B O   1 
ATOM   4984 C CB  . PRO B 1 103 ? -2.014  -86.975 -35.273 1.00 35.27  ? 104 PRO B CB  1 
ATOM   4985 C CG  . PRO B 1 103 ? -2.732  -85.917 -34.515 1.00 46.47  ? 104 PRO B CG  1 
ATOM   4986 C CD  . PRO B 1 103 ? -2.845  -84.763 -35.455 1.00 35.12  ? 104 PRO B CD  1 
ATOM   4987 N N   . TYR B 1 104 ? 0.135   -87.852 -37.505 1.00 53.87  ? 105 TYR B N   1 
ATOM   4988 C CA  . TYR B 1 104 ? 0.420   -88.647 -38.695 1.00 48.57  ? 105 TYR B CA  1 
ATOM   4989 C C   . TYR B 1 104 ? 0.272   -90.125 -38.341 1.00 53.13  ? 105 TYR B C   1 
ATOM   4990 O O   . TYR B 1 104 ? 1.064   -90.662 -37.569 1.00 58.15  ? 105 TYR B O   1 
ATOM   4991 C CB  . TYR B 1 104 ? 1.843   -88.370 -39.184 1.00 49.72  ? 105 TYR B CB  1 
ATOM   4992 C CG  . TYR B 1 104 ? 2.198   -88.950 -40.544 1.00 64.31  ? 105 TYR B CG  1 
ATOM   4993 C CD1 . TYR B 1 104 ? 2.340   -90.328 -40.733 1.00 61.31  ? 105 TYR B CD1 1 
ATOM   4994 C CD2 . TYR B 1 104 ? 2.435   -88.114 -41.632 1.00 59.81  ? 105 TYR B CD2 1 
ATOM   4995 C CE1 . TYR B 1 104 ? 2.679   -90.850 -41.975 1.00 53.15  ? 105 TYR B CE1 1 
ATOM   4996 C CE2 . TYR B 1 104 ? 2.774   -88.627 -42.874 1.00 59.24  ? 105 TYR B CE2 1 
ATOM   4997 C CZ  . TYR B 1 104 ? 2.895   -89.992 -43.041 1.00 62.02  ? 105 TYR B CZ  1 
ATOM   4998 O OH  . TYR B 1 104 ? 3.233   -90.489 -44.278 1.00 54.46  ? 105 TYR B OH  1 
ATOM   4999 N N   . PRO B 1 105 ? -0.725  -90.800 -38.930 1.00 52.70  ? 106 PRO B N   1 
ATOM   5000 C CA  . PRO B 1 105 ? -1.629  -90.258 -39.947 1.00 57.36  ? 106 PRO B CA  1 
ATOM   5001 C C   . PRO B 1 105 ? -2.736  -89.366 -39.387 1.00 48.95  ? 106 PRO B C   1 
ATOM   5002 O O   . PRO B 1 105 ? -3.036  -89.368 -38.189 1.00 55.72  ? 106 PRO B O   1 
ATOM   5003 C CB  . PRO B 1 105 ? -2.238  -91.516 -40.565 1.00 54.43  ? 106 PRO B CB  1 
ATOM   5004 C CG  . PRO B 1 105 ? -2.250  -92.488 -39.444 1.00 39.84  ? 106 PRO B CG  1 
ATOM   5005 C CD  . PRO B 1 105 ? -0.995  -92.223 -38.662 1.00 52.93  ? 106 PRO B CD  1 
ATOM   5006 N N   . ARG B 1 106 ? -3.332  -88.609 -40.297 1.00 45.49  ? 107 ARG B N   1 
ATOM   5007 C CA  . ARG B 1 106 ? -4.367  -87.642 -39.986 1.00 51.78  ? 107 ARG B CA  1 
ATOM   5008 C C   . ARG B 1 106 ? -5.505  -88.320 -39.226 1.00 51.64  ? 107 ARG B C   1 
ATOM   5009 O O   . ARG B 1 106 ? -5.918  -89.422 -39.578 1.00 56.63  ? 107 ARG B O   1 
ATOM   5010 C CB  . ARG B 1 106 ? -4.857  -87.030 -41.297 1.00 35.76  ? 107 ARG B CB  1 
ATOM   5011 C CG  . ARG B 1 106 ? -5.671  -85.778 -41.178 1.00 38.37  ? 107 ARG B CG  1 
ATOM   5012 C CD  . ARG B 1 106 ? -6.029  -85.251 -42.564 1.00 55.56  ? 107 ARG B CD  1 
ATOM   5013 N NE  . ARG B 1 106 ? -4.853  -85.152 -43.429 1.00 51.98  ? 107 ARG B NE  1 
ATOM   5014 C CZ  . ARG B 1 106 ? -4.904  -84.873 -44.729 1.00 58.72  ? 107 ARG B CZ  1 
ATOM   5015 N NH1 . ARG B 1 106 ? -6.077  -84.660 -45.316 1.00 50.69  ? 107 ARG B NH1 1 
ATOM   5016 N NH2 . ARG B 1 106 ? -3.786  -84.809 -45.446 1.00 44.88  ? 107 ARG B NH2 1 
ATOM   5017 N N   . PRO B 1 107 ? -5.987  -87.677 -38.154 1.00 59.08  ? 108 PRO B N   1 
ATOM   5018 C CA  . PRO B 1 107 ? -7.058  -88.231 -37.318 1.00 58.70  ? 108 PRO B CA  1 
ATOM   5019 C C   . PRO B 1 107 ? -8.264  -88.656 -38.140 1.00 57.94  ? 108 PRO B C   1 
ATOM   5020 O O   . PRO B 1 107 ? -8.521  -88.082 -39.201 1.00 61.27  ? 108 PRO B O   1 
ATOM   5021 C CB  . PRO B 1 107 ? -7.432  -87.053 -36.414 1.00 52.58  ? 108 PRO B CB  1 
ATOM   5022 C CG  . PRO B 1 107 ? -6.162  -86.293 -36.268 1.00 46.56  ? 108 PRO B CG  1 
ATOM   5023 C CD  . PRO B 1 107 ? -5.473  -86.404 -37.615 1.00 53.41  ? 108 PRO B CD  1 
ATOM   5024 N N   . THR B 1 108 ? -8.987  -89.658 -37.655 1.00 61.98  ? 109 THR B N   1 
ATOM   5025 C CA  . THR B 1 108 ? -10.147 -90.176 -38.371 1.00 72.37  ? 109 THR B CA  1 
ATOM   5026 C C   . THR B 1 108 ? -11.423 -89.520 -37.864 1.00 59.41  ? 109 THR B C   1 
ATOM   5027 O O   . THR B 1 108 ? -12.350 -89.264 -38.627 1.00 73.94  ? 109 THR B O   1 
ATOM   5028 C CB  . THR B 1 108 ? -10.253 -91.698 -38.225 1.00 73.59  ? 109 THR B CB  1 
ATOM   5029 O OG1 . THR B 1 108 ? -10.054 -92.054 -36.852 1.00 82.78  ? 109 THR B OG1 1 
ATOM   5030 C CG2 . THR B 1 108 ? -9.191  -92.381 -39.068 1.00 52.19  ? 109 THR B CG2 1 
ATOM   5031 N N   . SER B 1 109 ? -11.461 -89.241 -36.568 1.00 59.21  ? 110 SER B N   1 
ATOM   5032 C CA  . SER B 1 109 ? -12.579 -88.523 -35.979 1.00 60.26  ? 110 SER B CA  1 
ATOM   5033 C C   . SER B 1 109 ? -12.111 -87.125 -35.599 1.00 61.11  ? 110 SER B C   1 
ATOM   5034 O O   . SER B 1 109 ? -10.920 -86.922 -35.369 1.00 61.57  ? 110 SER B O   1 
ATOM   5035 C CB  . SER B 1 109 ? -13.107 -89.285 -34.761 1.00 53.43  ? 110 SER B CB  1 
ATOM   5036 O OG  . SER B 1 109 ? -12.056 -89.958 -34.093 1.00 61.40  ? 110 SER B OG  1 
ATOM   5037 N N   . PRO B 1 110 ? -13.040 -86.152 -35.556 1.00 59.41  ? 111 PRO B N   1 
ATOM   5038 C CA  . PRO B 1 110 ? -12.728 -84.759 -35.205 1.00 53.57  ? 111 PRO B CA  1 
ATOM   5039 C C   . PRO B 1 110 ? -11.933 -84.622 -33.904 1.00 55.80  ? 111 PRO B C   1 
ATOM   5040 O O   . PRO B 1 110 ? -12.333 -85.142 -32.863 1.00 55.32  ? 111 PRO B O   1 
ATOM   5041 C CB  . PRO B 1 110 ? -14.109 -84.127 -35.061 1.00 58.27  ? 111 PRO B CB  1 
ATOM   5042 C CG  . PRO B 1 110 ? -14.948 -84.891 -36.021 1.00 51.04  ? 111 PRO B CG  1 
ATOM   5043 C CD  . PRO B 1 110 ? -14.455 -86.308 -35.941 1.00 51.15  ? 111 PRO B CD  1 
ATOM   5044 N N   . THR B 1 111 ? -10.810 -83.914 -33.990 1.00 52.26  ? 112 THR B N   1 
ATOM   5045 C CA  . THR B 1 111 ? -9.838  -83.811 -32.906 1.00 53.53  ? 112 THR B CA  1 
ATOM   5046 C C   . THR B 1 111 ? -9.784  -82.377 -32.371 1.00 51.16  ? 112 THR B C   1 
ATOM   5047 O O   . THR B 1 111 ? -9.782  -81.426 -33.156 1.00 47.62  ? 112 THR B O   1 
ATOM   5048 C CB  . THR B 1 111 ? -8.431  -84.231 -33.408 1.00 46.56  ? 112 THR B CB  1 
ATOM   5049 O OG1 . THR B 1 111 ? -8.455  -85.604 -33.813 1.00 56.24  ? 112 THR B OG1 1 
ATOM   5050 C CG2 . THR B 1 111 ? -7.389  -84.064 -32.332 1.00 42.44  ? 112 THR B CG2 1 
ATOM   5051 N N   . PRO B 1 112 ? -9.760  -82.216 -31.034 1.00 43.68  ? 113 PRO B N   1 
ATOM   5052 C CA  . PRO B 1 112 ? -9.661  -80.891 -30.409 1.00 47.47  ? 113 PRO B CA  1 
ATOM   5053 C C   . PRO B 1 112 ? -8.454  -80.085 -30.897 1.00 39.77  ? 113 PRO B C   1 
ATOM   5054 O O   . PRO B 1 112 ? -7.371  -80.623 -31.171 1.00 27.95  ? 113 PRO B O   1 
ATOM   5055 C CB  . PRO B 1 112 ? -9.519  -81.213 -28.914 1.00 43.50  ? 113 PRO B CB  1 
ATOM   5056 C CG  . PRO B 1 112 ? -9.158  -82.670 -28.857 1.00 49.00  ? 113 PRO B CG  1 
ATOM   5057 C CD  . PRO B 1 112 ? -9.865  -83.276 -30.020 1.00 54.06  ? 113 PRO B CD  1 
ATOM   5058 N N   . VAL B 1 113 ? -8.660  -78.780 -30.997 1.00 29.69  ? 114 VAL B N   1 
ATOM   5059 C CA  . VAL B 1 113 ? -7.665  -77.893 -31.564 1.00 35.17  ? 114 VAL B CA  1 
ATOM   5060 C C   . VAL B 1 113 ? -7.147  -76.888 -30.549 1.00 35.34  ? 114 VAL B C   1 
ATOM   5061 O O   . VAL B 1 113 ? -7.927  -76.191 -29.894 1.00 31.47  ? 114 VAL B O   1 
ATOM   5062 C CB  . VAL B 1 113 ? -8.243  -77.111 -32.753 1.00 39.06  ? 114 VAL B CB  1 
ATOM   5063 C CG1 . VAL B 1 113 ? -7.134  -76.358 -33.469 1.00 31.11  ? 114 VAL B CG1 1 
ATOM   5064 C CG2 . VAL B 1 113 ? -8.962  -78.061 -33.707 1.00 36.61  ? 114 VAL B CG2 1 
ATOM   5065 N N   . LEU B 1 114 ? -5.824  -76.830 -30.428 1.00 30.49  ? 115 LEU B N   1 
ATOM   5066 C CA  . LEU B 1 114 ? -5.150  -75.758 -29.714 1.00 32.74  ? 115 LEU B CA  1 
ATOM   5067 C C   . LEU B 1 114 ? -4.680  -74.675 -30.695 1.00 35.13  ? 115 LEU B C   1 
ATOM   5068 O O   . LEU B 1 114 ? -4.003  -74.972 -31.685 1.00 31.48  ? 115 LEU B O   1 
ATOM   5069 C CB  . LEU B 1 114 ? -3.958  -76.325 -28.943 1.00 32.18  ? 115 LEU B CB  1 
ATOM   5070 C CG  . LEU B 1 114 ? -4.271  -77.095 -27.657 1.00 28.59  ? 115 LEU B CG  1 
ATOM   5071 C CD1 . LEU B 1 114 ? -3.043  -77.860 -27.211 1.00 35.85  ? 115 LEU B CD1 1 
ATOM   5072 C CD2 . LEU B 1 114 ? -4.701  -76.135 -26.578 1.00 30.29  ? 115 LEU B CD2 1 
ATOM   5073 N N   . VAL B 1 115 ? -5.051  -73.426 -30.433 1.00 30.10  ? 116 VAL B N   1 
ATOM   5074 C CA  . VAL B 1 115 ? -4.580  -72.309 -31.249 1.00 22.58  ? 116 VAL B CA  1 
ATOM   5075 C C   . VAL B 1 115 ? -3.664  -71.386 -30.439 1.00 32.47  ? 116 VAL B C   1 
ATOM   5076 O O   . VAL B 1 115 ? -4.116  -70.729 -29.503 1.00 29.97  ? 116 VAL B O   1 
ATOM   5077 C CB  . VAL B 1 115 ? -5.752  -71.489 -31.815 1.00 30.73  ? 116 VAL B CB  1 
ATOM   5078 C CG1 . VAL B 1 115 ? -5.239  -70.342 -32.690 1.00 24.92  ? 116 VAL B CG1 1 
ATOM   5079 C CG2 . VAL B 1 115 ? -6.692  -72.383 -32.607 1.00 25.33  ? 116 VAL B CG2 1 
ATOM   5080 N N   . TRP B 1 116 ? -2.382  -71.344 -30.806 1.00 24.81  ? 117 TRP B N   1 
ATOM   5081 C CA  . TRP B 1 116 ? -1.393  -70.523 -30.105 1.00 23.93  ? 117 TRP B CA  1 
ATOM   5082 C C   . TRP B 1 116 ? -1.305  -69.087 -30.601 1.00 26.52  ? 117 TRP B C   1 
ATOM   5083 O O   . TRP B 1 116 ? -1.294  -68.839 -31.806 1.00 32.84  ? 117 TRP B O   1 
ATOM   5084 C CB  . TRP B 1 116 ? -0.010  -71.163 -30.182 1.00 20.51  ? 117 TRP B CB  1 
ATOM   5085 C CG  . TRP B 1 116 ? 1.079   -70.336 -29.543 1.00 23.85  ? 117 TRP B CG  1 
ATOM   5086 C CD1 . TRP B 1 116 ? 2.087   -69.662 -30.184 1.00 27.10  ? 117 TRP B CD1 1 
ATOM   5087 C CD2 . TRP B 1 116 ? 1.283   -70.119 -28.139 1.00 24.50  ? 117 TRP B CD2 1 
ATOM   5088 N NE1 . TRP B 1 116 ? 2.900   -69.037 -29.266 1.00 28.27  ? 117 TRP B NE1 1 
ATOM   5089 C CE2 . TRP B 1 116 ? 2.430   -69.303 -28.004 1.00 30.09  ? 117 TRP B CE2 1 
ATOM   5090 C CE3 . TRP B 1 116 ? 0.603   -70.527 -26.985 1.00 27.63  ? 117 TRP B CE3 1 
ATOM   5091 C CZ2 . TRP B 1 116 ? 2.906   -68.883 -26.757 1.00 23.95  ? 117 TRP B CZ2 1 
ATOM   5092 C CZ3 . TRP B 1 116 ? 1.080   -70.115 -25.746 1.00 27.19  ? 117 TRP B CZ3 1 
ATOM   5093 C CH2 . TRP B 1 116 ? 2.221   -69.303 -25.644 1.00 30.93  ? 117 TRP B CH2 1 
ATOM   5094 N N   . ILE B 1 117 ? -1.239  -68.140 -29.667 1.00 28.26  ? 118 ILE B N   1 
ATOM   5095 C CA  . ILE B 1 117 ? -1.010  -66.739 -30.013 1.00 29.64  ? 118 ILE B CA  1 
ATOM   5096 C C   . ILE B 1 117 ? 0.205   -66.239 -29.264 1.00 27.97  ? 118 ILE B C   1 
ATOM   5097 O O   . ILE B 1 117 ? 0.147   -66.070 -28.048 1.00 29.59  ? 118 ILE B O   1 
ATOM   5098 C CB  . ILE B 1 117 ? -2.197  -65.834 -29.639 1.00 23.68  ? 118 ILE B CB  1 
ATOM   5099 C CG1 . ILE B 1 117 ? -3.477  -66.318 -30.311 1.00 25.31  ? 118 ILE B CG1 1 
ATOM   5100 C CG2 . ILE B 1 117 ? -1.909  -64.397 -30.042 1.00 21.55  ? 118 ILE B CG2 1 
ATOM   5101 C CD1 . ILE B 1 117 ? -4.655  -65.429 -30.037 1.00 24.45  ? 118 ILE B CD1 1 
ATOM   5102 N N   . TYR B 1 118 ? 1.305   -66.001 -29.973 1.00 24.50  ? 119 TYR B N   1 
ATOM   5103 C CA  . TYR B 1 118 ? 2.534   -65.568 -29.313 1.00 21.39  ? 119 TYR B CA  1 
ATOM   5104 C C   . TYR B 1 118 ? 2.420   -64.184 -28.699 1.00 22.34  ? 119 TYR B C   1 
ATOM   5105 O O   . TYR B 1 118 ? 1.593   -63.370 -29.125 1.00 23.05  ? 119 TYR B O   1 
ATOM   5106 C CB  . TYR B 1 118 ? 3.709   -65.571 -30.285 1.00 24.17  ? 119 TYR B CB  1 
ATOM   5107 C CG  . TYR B 1 118 ? 3.549   -64.689 -31.512 1.00 19.18  ? 119 TYR B CG  1 
ATOM   5108 C CD1 . TYR B 1 118 ? 3.686   -63.300 -31.431 1.00 22.23  ? 119 TYR B CD1 1 
ATOM   5109 C CD2 . TYR B 1 118 ? 3.316   -65.251 -32.762 1.00 26.10  ? 119 TYR B CD2 1 
ATOM   5110 C CE1 . TYR B 1 118 ? 3.558   -62.499 -32.556 1.00 21.54  ? 119 TYR B CE1 1 
ATOM   5111 C CE2 . TYR B 1 118 ? 3.188   -64.457 -33.907 1.00 23.47  ? 119 TYR B CE2 1 
ATOM   5112 C CZ  . TYR B 1 118 ? 3.314   -63.084 -33.795 1.00 27.14  ? 119 TYR B CZ  1 
ATOM   5113 O OH  . TYR B 1 118 ? 3.185   -62.302 -34.919 1.00 28.20  ? 119 TYR B OH  1 
ATOM   5114 N N   . GLY B 1 119 ? 3.285   -63.918 -27.721 1.00 25.47  ? 120 GLY B N   1 
ATOM   5115 C CA  . GLY B 1 119 ? 3.454   -62.585 -27.168 1.00 25.91  ? 120 GLY B CA  1 
ATOM   5116 C C   . GLY B 1 119 ? 4.679   -61.866 -27.719 1.00 26.95  ? 120 GLY B C   1 
ATOM   5117 O O   . GLY B 1 119 ? 5.280   -62.301 -28.706 1.00 32.17  ? 120 GLY B O   1 
ATOM   5118 N N   . GLY B 1 120 ? 5.048   -60.759 -27.078 1.00 30.85  ? 121 GLY B N   1 
ATOM   5119 C CA  . GLY B 1 120 ? 6.152   -59.927 -27.524 1.00 25.22  ? 121 GLY B CA  1 
ATOM   5120 C C   . GLY B 1 120 ? 5.824   -58.453 -27.333 1.00 33.83  ? 121 GLY B C   1 
ATOM   5121 O O   . GLY B 1 120 ? 6.282   -57.593 -28.096 1.00 25.43  ? 121 GLY B O   1 
ATOM   5122 N N   . GLY B 1 121 ? 5.012   -58.165 -26.318 1.00 28.57  ? 122 GLY B N   1 
ATOM   5123 C CA  . GLY B 1 121 ? 4.662   -56.800 -25.963 1.00 31.98  ? 122 GLY B CA  1 
ATOM   5124 C C   . GLY B 1 121 ? 3.865   -56.062 -27.025 1.00 28.22  ? 122 GLY B C   1 
ATOM   5125 O O   . GLY B 1 121 ? 3.828   -54.832 -27.036 1.00 28.72  ? 122 GLY B O   1 
ATOM   5126 N N   . PHE B 1 122 ? 3.233   -56.825 -27.912 1.00 26.99  ? 123 PHE B N   1 
ATOM   5127 C CA  . PHE B 1 122 ? 2.497   -56.298 -29.058 1.00 22.16  ? 123 PHE B CA  1 
ATOM   5128 C C   . PHE B 1 122 ? 3.396   -55.621 -30.111 1.00 28.94  ? 123 PHE B C   1 
ATOM   5129 O O   . PHE B 1 122 ? 2.899   -55.075 -31.091 1.00 26.03  ? 123 PHE B O   1 
ATOM   5130 C CB  . PHE B 1 122 ? 1.364   -55.362 -28.626 1.00 20.71  ? 123 PHE B CB  1 
ATOM   5131 C CG  . PHE B 1 122 ? 0.165   -56.077 -28.059 1.00 25.41  ? 123 PHE B CG  1 
ATOM   5132 C CD1 . PHE B 1 122 ? -0.621  -56.874 -28.863 1.00 21.07  ? 123 PHE B CD1 1 
ATOM   5133 C CD2 . PHE B 1 122 ? -0.179  -55.938 -26.717 1.00 23.58  ? 123 PHE B CD2 1 
ATOM   5134 C CE1 . PHE B 1 122 ? -1.717  -57.538 -28.346 1.00 19.35  ? 123 PHE B CE1 1 
ATOM   5135 C CE2 . PHE B 1 122 ? -1.276  -56.590 -26.196 1.00 20.77  ? 123 PHE B CE2 1 
ATOM   5136 C CZ  . PHE B 1 122 ? -2.045  -57.394 -27.009 1.00 26.99  ? 123 PHE B CZ  1 
ATOM   5137 N N   . TYR B 1 123 ? 4.712   -55.670 -29.917 1.00 27.01  ? 124 TYR B N   1 
ATOM   5138 C CA  . TYR B 1 123 ? 5.633   -55.050 -30.867 1.00 32.49  ? 124 TYR B CA  1 
ATOM   5139 C C   . TYR B 1 123 ? 6.631   -56.023 -31.498 1.00 30.63  ? 124 TYR B C   1 
ATOM   5140 O O   . TYR B 1 123 ? 7.416   -55.631 -32.355 1.00 26.46  ? 124 TYR B O   1 
ATOM   5141 C CB  . TYR B 1 123 ? 6.393   -53.884 -30.224 1.00 23.57  ? 124 TYR B CB  1 
ATOM   5142 C CG  . TYR B 1 123 ? 7.474   -54.285 -29.233 1.00 31.74  ? 124 TYR B CG  1 
ATOM   5143 C CD1 . TYR B 1 123 ? 8.756   -54.613 -29.661 1.00 27.96  ? 124 TYR B CD1 1 
ATOM   5144 C CD2 . TYR B 1 123 ? 7.223   -54.286 -27.865 1.00 27.98  ? 124 TYR B CD2 1 
ATOM   5145 C CE1 . TYR B 1 123 ? 9.745   -54.963 -28.762 1.00 26.25  ? 124 TYR B CE1 1 
ATOM   5146 C CE2 . TYR B 1 123 ? 8.210   -54.632 -26.954 1.00 29.22  ? 124 TYR B CE2 1 
ATOM   5147 C CZ  . TYR B 1 123 ? 9.468   -54.967 -27.408 1.00 33.48  ? 124 TYR B CZ  1 
ATOM   5148 O OH  . TYR B 1 123 ? 10.449  -55.312 -26.507 1.00 25.68  ? 124 TYR B OH  1 
ATOM   5149 N N   . SER B 1 124 ? 6.621   -57.273 -31.051 1.00 23.18  ? 125 SER B N   1 
ATOM   5150 C CA  . SER B 1 124 ? 7.555   -58.266 -31.559 1.00 22.87  ? 125 SER B CA  1 
ATOM   5151 C C   . SER B 1 124 ? 6.933   -59.635 -31.440 1.00 24.03  ? 125 SER B C   1 
ATOM   5152 O O   . SER B 1 124 ? 5.794   -59.761 -30.996 1.00 26.87  ? 125 SER B O   1 
ATOM   5153 C CB  . SER B 1 124 ? 8.862   -58.244 -30.771 1.00 21.93  ? 125 SER B CB  1 
ATOM   5154 O OG  . SER B 1 124 ? 8.625   -58.508 -29.403 1.00 24.49  ? 125 SER B OG  1 
ATOM   5155 N N   . GLY B 1 125 ? 7.691   -60.655 -31.827 1.00 20.68  ? 126 GLY B N   1 
ATOM   5156 C CA  . GLY B 1 125 ? 7.231   -62.029 -31.773 1.00 17.98  ? 126 GLY B CA  1 
ATOM   5157 C C   . GLY B 1 125 ? 6.989   -62.639 -33.139 1.00 29.46  ? 126 GLY B C   1 
ATOM   5158 O O   . GLY B 1 125 ? 6.941   -61.934 -34.159 1.00 26.27  ? 126 GLY B O   1 
ATOM   5159 N N   . ALA B 1 126 ? 6.818   -63.959 -33.155 1.00 32.83  ? 127 ALA B N   1 
ATOM   5160 C CA  . ALA B 1 126 ? 6.606   -64.699 -34.398 1.00 30.04  ? 127 ALA B CA  1 
ATOM   5161 C C   . ALA B 1 126 ? 6.202   -66.130 -34.074 1.00 30.98  ? 127 ALA B C   1 
ATOM   5162 O O   . ALA B 1 126 ? 6.636   -66.694 -33.066 1.00 26.88  ? 127 ALA B O   1 
ATOM   5163 C CB  . ALA B 1 126 ? 7.873   -64.684 -35.248 1.00 21.90  ? 127 ALA B CB  1 
ATOM   5164 N N   . SER B 1 127 ? 5.381   -66.733 -34.924 1.00 27.13  ? 128 SER B N   1 
ATOM   5165 C CA  . SER B 1 127 ? 4.953   -68.103 -34.665 1.00 23.31  ? 128 SER B CA  1 
ATOM   5166 C C   . SER B 1 127 ? 6.034   -69.115 -35.037 1.00 29.74  ? 128 SER B C   1 
ATOM   5167 O O   . SER B 1 127 ? 5.899   -70.307 -34.765 1.00 28.04  ? 128 SER B O   1 
ATOM   5168 C CB  . SER B 1 127 ? 3.658   -68.410 -35.405 1.00 21.98  ? 128 SER B CB  1 
ATOM   5169 O OG  . SER B 1 127 ? 3.868   -68.406 -36.807 1.00 28.54  ? 128 SER B OG  1 
ATOM   5170 N N   . SER B 1 128 ? 7.112   -68.634 -35.648 1.00 28.08  ? 129 SER B N   1 
ATOM   5171 C CA  . SER B 1 128 ? 8.153   -69.515 -36.173 1.00 27.62  ? 129 SER B CA  1 
ATOM   5172 C C   . SER B 1 128 ? 9.244   -69.854 -35.164 1.00 34.03  ? 129 SER B C   1 
ATOM   5173 O O   . SER B 1 128 ? 10.076  -70.722 -35.434 1.00 26.30  ? 129 SER B O   1 
ATOM   5174 C CB  . SER B 1 128 ? 8.802   -68.889 -37.397 1.00 21.58  ? 129 SER B CB  1 
ATOM   5175 O OG  . SER B 1 128 ? 9.328   -67.617 -37.084 1.00 27.08  ? 129 SER B OG  1 
ATOM   5176 N N   . LEU B 1 129 ? 9.244   -69.168 -34.022 1.00 24.90  ? 130 LEU B N   1 
ATOM   5177 C CA  . LEU B 1 129 ? 10.274  -69.367 -33.007 1.00 28.98  ? 130 LEU B CA  1 
ATOM   5178 C C   . LEU B 1 129 ? 10.377  -70.828 -32.570 1.00 29.22  ? 130 LEU B C   1 
ATOM   5179 O O   . LEU B 1 129 ? 9.369   -71.532 -32.495 1.00 31.53  ? 130 LEU B O   1 
ATOM   5180 C CB  . LEU B 1 129 ? 10.010  -68.477 -31.791 1.00 28.51  ? 130 LEU B CB  1 
ATOM   5181 C CG  . LEU B 1 129 ? 9.943   -66.962 -32.015 1.00 32.55  ? 130 LEU B CG  1 
ATOM   5182 C CD1 . LEU B 1 129 ? 9.882   -66.230 -30.672 1.00 28.22  ? 130 LEU B CD1 1 
ATOM   5183 C CD2 . LEU B 1 129 ? 11.106  -66.458 -32.858 1.00 23.86  ? 130 LEU B CD2 1 
ATOM   5184 N N   . ASP B 1 130 ? 11.598  -71.274 -32.290 1.00 29.96  ? 131 ASP B N   1 
ATOM   5185 C CA  . ASP B 1 130 ? 11.852  -72.657 -31.878 1.00 36.64  ? 131 ASP B CA  1 
ATOM   5186 C C   . ASP B 1 130 ? 11.025  -73.048 -30.675 1.00 29.43  ? 131 ASP B C   1 
ATOM   5187 O O   . ASP B 1 130 ? 10.536  -74.167 -30.587 1.00 35.10  ? 131 ASP B O   1 
ATOM   5188 C CB  . ASP B 1 130 ? 13.332  -72.871 -31.547 1.00 31.37  ? 131 ASP B CB  1 
ATOM   5189 C CG  . ASP B 1 130 ? 14.213  -72.820 -32.773 1.00 37.12  ? 131 ASP B CG  1 
ATOM   5190 O OD1 . ASP B 1 130 ? 13.673  -72.956 -33.891 1.00 43.26  ? 131 ASP B OD1 1 
ATOM   5191 O OD2 . ASP B 1 130 ? 15.439  -72.646 -32.625 1.00 49.69  ? 131 ASP B OD2 1 
ATOM   5192 N N   . VAL B 1 131 ? 10.860  -72.105 -29.758 1.00 30.58  ? 132 VAL B N   1 
ATOM   5193 C CA  . VAL B 1 131 ? 10.153  -72.359 -28.514 1.00 32.08  ? 132 VAL B CA  1 
ATOM   5194 C C   . VAL B 1 131 ? 8.641   -72.580 -28.712 1.00 30.35  ? 132 VAL B C   1 
ATOM   5195 O O   . VAL B 1 131 ? 7.973   -73.091 -27.823 1.00 32.77  ? 132 VAL B O   1 
ATOM   5196 C CB  . VAL B 1 131 ? 10.440  -71.223 -27.495 1.00 36.78  ? 132 VAL B CB  1 
ATOM   5197 C CG1 . VAL B 1 131 ? 9.858   -69.895 -27.982 1.00 30.29  ? 132 VAL B CG1 1 
ATOM   5198 C CG2 . VAL B 1 131 ? 9.918   -71.577 -26.124 1.00 27.15  ? 132 VAL B CG2 1 
ATOM   5199 N N   . TYR B 1 132 ? 8.106   -72.215 -29.878 1.00 36.20  ? 133 TYR B N   1 
ATOM   5200 C CA  . TYR B 1 132 ? 6.679   -72.431 -30.166 1.00 33.89  ? 133 TYR B CA  1 
ATOM   5201 C C   . TYR B 1 132 ? 6.450   -73.626 -31.091 1.00 33.52  ? 133 TYR B C   1 
ATOM   5202 O O   . TYR B 1 132 ? 5.350   -73.810 -31.618 1.00 28.67  ? 133 TYR B O   1 
ATOM   5203 C CB  . TYR B 1 132 ? 6.036   -71.185 -30.795 1.00 29.66  ? 133 TYR B CB  1 
ATOM   5204 C CG  . TYR B 1 132 ? 6.211   -69.911 -29.994 1.00 32.10  ? 133 TYR B CG  1 
ATOM   5205 C CD1 . TYR B 1 132 ? 6.230   -69.932 -28.606 1.00 26.83  ? 133 TYR B CD1 1 
ATOM   5206 C CD2 . TYR B 1 132 ? 6.368   -68.689 -30.631 1.00 33.23  ? 133 TYR B CD2 1 
ATOM   5207 C CE1 . TYR B 1 132 ? 6.393   -68.766 -27.881 1.00 29.80  ? 133 TYR B CE1 1 
ATOM   5208 C CE2 . TYR B 1 132 ? 6.542   -67.523 -29.914 1.00 21.95  ? 133 TYR B CE2 1 
ATOM   5209 C CZ  . TYR B 1 132 ? 6.548   -67.566 -28.547 1.00 28.30  ? 133 TYR B CZ  1 
ATOM   5210 O OH  . TYR B 1 132 ? 6.711   -66.401 -27.846 1.00 26.40  ? 133 TYR B OH  1 
ATOM   5211 N N   . ASP B 1 133 ? 7.491   -74.427 -31.294 1.00 33.05  ? 134 ASP B N   1 
ATOM   5212 C CA  . ASP B 1 133 ? 7.395   -75.623 -32.122 1.00 31.61  ? 134 ASP B CA  1 
ATOM   5213 C C   . ASP B 1 133 ? 6.280   -76.555 -31.634 1.00 34.64  ? 134 ASP B C   1 
ATOM   5214 O O   . ASP B 1 133 ? 6.370   -77.140 -30.554 1.00 32.92  ? 134 ASP B O   1 
ATOM   5215 C CB  . ASP B 1 133 ? 8.734   -76.365 -32.116 1.00 33.47  ? 134 ASP B CB  1 
ATOM   5216 C CG  . ASP B 1 133 ? 8.787   -77.506 -33.134 1.00 42.68  ? 134 ASP B CG  1 
ATOM   5217 O OD1 . ASP B 1 133 ? 7.725   -77.926 -33.657 1.00 33.44  ? 134 ASP B OD1 1 
ATOM   5218 O OD2 . ASP B 1 133 ? 9.907   -77.990 -33.402 1.00 37.04  ? 134 ASP B OD2 1 
ATOM   5219 N N   . GLY B 1 134 ? 5.248   -76.713 -32.451 1.00 32.42  ? 135 GLY B N   1 
ATOM   5220 C CA  . GLY B 1 134 ? 4.094   -77.504 -32.071 1.00 31.50  ? 135 GLY B CA  1 
ATOM   5221 C C   . GLY B 1 134 ? 4.197   -79.013 -32.244 1.00 34.30  ? 135 GLY B C   1 
ATOM   5222 O O   . GLY B 1 134 ? 3.238   -79.728 -31.954 1.00 35.50  ? 135 GLY B O   1 
ATOM   5223 N N   . ARG B 1 135 ? 5.340   -79.515 -32.701 1.00 29.62  ? 136 ARG B N   1 
ATOM   5224 C CA  . ARG B 1 135 ? 5.431   -80.943 -33.018 1.00 34.51  ? 136 ARG B CA  1 
ATOM   5225 C C   . ARG B 1 135 ? 5.275   -81.829 -31.777 1.00 33.61  ? 136 ARG B C   1 
ATOM   5226 O O   . ARG B 1 135 ? 4.627   -82.874 -31.835 1.00 34.73  ? 136 ARG B O   1 
ATOM   5227 C CB  . ARG B 1 135 ? 6.720   -81.278 -33.779 1.00 28.18  ? 136 ARG B CB  1 
ATOM   5228 C CG  . ARG B 1 135 ? 7.959   -81.398 -32.910 1.00 43.92  ? 136 ARG B CG  1 
ATOM   5229 C CD  . ARG B 1 135 ? 9.185   -81.697 -33.736 1.00 33.20  ? 136 ARG B CD  1 
ATOM   5230 N NE  . ARG B 1 135 ? 9.577   -80.541 -34.530 1.00 40.13  ? 136 ARG B NE  1 
ATOM   5231 C CZ  . ARG B 1 135 ? 10.338  -80.603 -35.619 1.00 46.52  ? 136 ARG B CZ  1 
ATOM   5232 N NH1 . ARG B 1 135 ? 10.798  -81.770 -36.057 1.00 38.09  ? 136 ARG B NH1 1 
ATOM   5233 N NH2 . ARG B 1 135 ? 10.640  -79.495 -36.274 1.00 43.03  ? 136 ARG B NH2 1 
ATOM   5234 N N   . PHE B 1 136 ? 5.835   -81.398 -30.650 1.00 30.00  ? 137 PHE B N   1 
ATOM   5235 C CA  . PHE B 1 136 ? 5.847   -82.241 -29.451 1.00 38.81  ? 137 PHE B CA  1 
ATOM   5236 C C   . PHE B 1 136 ? 4.469   -82.364 -28.804 1.00 29.13  ? 137 PHE B C   1 
ATOM   5237 O O   . PHE B 1 136 ? 4.045   -83.456 -28.429 1.00 31.31  ? 137 PHE B O   1 
ATOM   5238 C CB  . PHE B 1 136 ? 6.876   -81.737 -28.459 1.00 23.86  ? 137 PHE B CB  1 
ATOM   5239 C CG  . PHE B 1 136 ? 8.226   -81.516 -29.064 1.00 28.13  ? 137 PHE B CG  1 
ATOM   5240 C CD1 . PHE B 1 136 ? 8.653   -80.238 -29.384 1.00 29.20  ? 137 PHE B CD1 1 
ATOM   5241 C CD2 . PHE B 1 136 ? 9.066   -82.590 -29.335 1.00 33.90  ? 137 PHE B CD2 1 
ATOM   5242 C CE1 . PHE B 1 136 ? 9.907   -80.027 -29.958 1.00 39.59  ? 137 PHE B CE1 1 
ATOM   5243 C CE2 . PHE B 1 136 ? 10.326  -82.391 -29.905 1.00 33.47  ? 137 PHE B CE2 1 
ATOM   5244 C CZ  . PHE B 1 136 ? 10.746  -81.106 -30.215 1.00 33.67  ? 137 PHE B CZ  1 
ATOM   5245 N N   . LEU B 1 137 ? 3.764   -81.244 -28.713 1.00 29.64  ? 138 LEU B N   1 
ATOM   5246 C CA  . LEU B 1 137 ? 2.401   -81.232 -28.218 1.00 32.68  ? 138 LEU B CA  1 
ATOM   5247 C C   . LEU B 1 137 ? 1.513   -82.133 -29.050 1.00 36.25  ? 138 LEU B C   1 
ATOM   5248 O O   . LEU B 1 137 ? 0.716   -82.904 -28.509 1.00 37.21  ? 138 LEU B O   1 
ATOM   5249 C CB  . LEU B 1 137 ? 1.842   -79.814 -28.267 1.00 33.66  ? 138 LEU B CB  1 
ATOM   5250 C CG  . LEU B 1 137 ? 1.548   -79.141 -26.938 1.00 36.13  ? 138 LEU B CG  1 
ATOM   5251 C CD1 . LEU B 1 137 ? 1.075   -77.721 -27.181 1.00 29.57  ? 138 LEU B CD1 1 
ATOM   5252 C CD2 . LEU B 1 137 ? 0.522   -79.947 -26.171 1.00 40.33  ? 138 LEU B CD2 1 
ATOM   5253 N N   . VAL B 1 138 ? 1.636   -82.022 -30.371 1.00 32.44  ? 139 VAL B N   1 
ATOM   5254 C CA  . VAL B 1 138 ? 0.750   -82.761 -31.263 1.00 33.87  ? 139 VAL B CA  1 
ATOM   5255 C C   . VAL B 1 138 ? 1.023   -84.252 -31.143 1.00 31.94  ? 139 VAL B C   1 
ATOM   5256 O O   . VAL B 1 138 ? 0.104   -85.062 -31.066 1.00 31.98  ? 139 VAL B O   1 
ATOM   5257 C CB  . VAL B 1 138 ? 0.872   -82.269 -32.712 1.00 40.62  ? 139 VAL B CB  1 
ATOM   5258 C CG1 . VAL B 1 138 ? 0.239   -83.265 -33.686 1.00 27.13  ? 139 VAL B CG1 1 
ATOM   5259 C CG2 . VAL B 1 138 ? 0.224   -80.895 -32.829 1.00 33.27  ? 139 VAL B CG2 1 
ATOM   5260 N N   . GLN B 1 139 ? 2.298   -84.599 -31.071 1.00 32.73  ? 140 GLN B N   1 
ATOM   5261 C CA  . GLN B 1 139 ? 2.697   -85.984 -30.895 1.00 37.19  ? 140 GLN B CA  1 
ATOM   5262 C C   . GLN B 1 139 ? 2.281   -86.567 -29.529 1.00 46.71  ? 140 GLN B C   1 
ATOM   5263 O O   . GLN B 1 139 ? 1.666   -87.634 -29.470 1.00 38.85  ? 140 GLN B O   1 
ATOM   5264 C CB  . GLN B 1 139 ? 4.206   -86.114 -31.105 1.00 36.09  ? 140 GLN B CB  1 
ATOM   5265 C CG  . GLN B 1 139 ? 4.634   -87.507 -31.514 1.00 59.44  ? 140 GLN B CG  1 
ATOM   5266 C CD  . GLN B 1 139 ? 4.748   -88.442 -30.336 1.00 64.97  ? 140 GLN B CD  1 
ATOM   5267 O OE1 . GLN B 1 139 ? 5.313   -88.081 -29.302 1.00 67.54  ? 140 GLN B OE1 1 
ATOM   5268 N NE2 . GLN B 1 139 ? 4.198   -89.648 -30.477 1.00 61.79  ? 140 GLN B NE2 1 
ATOM   5269 N N   . ALA B 1 140 ? 2.614   -85.878 -28.437 1.00 38.36  ? 141 ALA B N   1 
ATOM   5270 C CA  . ALA B 1 140 ? 2.308   -86.391 -27.095 1.00 29.14  ? 141 ALA B CA  1 
ATOM   5271 C C   . ALA B 1 140 ? 0.815   -86.527 -26.827 1.00 31.97  ? 141 ALA B C   1 
ATOM   5272 O O   . ALA B 1 140 ? 0.385   -87.483 -26.189 1.00 44.39  ? 141 ALA B O   1 
ATOM   5273 C CB  . ALA B 1 140 ? 2.951   -85.520 -26.017 1.00 31.51  ? 141 ALA B CB  1 
ATOM   5274 N N   . GLU B 1 141 ? 0.019   -85.586 -27.324 1.00 33.61  ? 142 GLU B N   1 
ATOM   5275 C CA  . GLU B 1 141 ? -1.369  -85.480 -26.880 1.00 28.10  ? 142 GLU B CA  1 
ATOM   5276 C C   . GLU B 1 141 ? -2.429  -85.632 -27.965 1.00 37.59  ? 142 GLU B C   1 
ATOM   5277 O O   . GLU B 1 141 ? -3.625  -85.554 -27.674 1.00 38.40  ? 142 GLU B O   1 
ATOM   5278 C CB  . GLU B 1 141 ? -1.571  -84.158 -26.135 1.00 28.87  ? 142 GLU B CB  1 
ATOM   5279 C CG  . GLU B 1 141 ? -0.774  -84.069 -24.846 1.00 35.94  ? 142 GLU B CG  1 
ATOM   5280 C CD  . GLU B 1 141 ? -1.205  -85.119 -23.832 1.00 36.99  ? 142 GLU B CD  1 
ATOM   5281 O OE1 . GLU B 1 141 ? -2.404  -85.489 -23.831 1.00 36.44  ? 142 GLU B OE1 1 
ATOM   5282 O OE2 . GLU B 1 141 ? -0.347  -85.577 -23.045 1.00 36.32  ? 142 GLU B OE2 1 
ATOM   5283 N N   . ARG B 1 142 ? -1.987  -85.840 -29.205 1.00 40.72  ? 143 ARG B N   1 
ATOM   5284 C CA  . ARG B 1 142 ? -2.881  -86.058 -30.344 1.00 37.98  ? 143 ARG B CA  1 
ATOM   5285 C C   . ARG B 1 142 ? -3.963  -84.996 -30.458 1.00 32.78  ? 143 ARG B C   1 
ATOM   5286 O O   . ARG B 1 142 ? -5.142  -85.306 -30.563 1.00 47.78  ? 143 ARG B O   1 
ATOM   5287 C CB  . ARG B 1 142 ? -3.522  -87.451 -30.299 1.00 40.36  ? 143 ARG B CB  1 
ATOM   5288 C CG  . ARG B 1 142 ? -2.534  -88.597 -30.125 1.00 47.74  ? 143 ARG B CG  1 
ATOM   5289 C CD  . ARG B 1 142 ? -1.580  -88.722 -31.301 1.00 71.22  ? 143 ARG B CD  1 
ATOM   5290 N NE  . ARG B 1 142 ? -0.530  -89.702 -31.035 1.00 73.70  ? 143 ARG B NE  1 
ATOM   5291 C CZ  . ARG B 1 142 ? 0.483   -89.960 -31.857 1.00 76.00  ? 143 ARG B CZ  1 
ATOM   5292 N NH1 . ARG B 1 142 ? 0.590   -89.313 -33.013 1.00 81.92  ? 143 ARG B NH1 1 
ATOM   5293 N NH2 . ARG B 1 142 ? 1.393   -90.866 -31.519 1.00 77.42  ? 143 ARG B NH2 1 
ATOM   5294 N N   . THR B 1 143 ? -3.553  -83.741 -30.416 1.00 34.18  ? 144 THR B N   1 
ATOM   5295 C CA  . THR B 1 143 ? -4.435  -82.643 -30.769 1.00 37.64  ? 144 THR B CA  1 
ATOM   5296 C C   . THR B 1 143 ? -3.968  -82.058 -32.098 1.00 36.16  ? 144 THR B C   1 
ATOM   5297 O O   . THR B 1 143 ? -2.900  -82.407 -32.603 1.00 35.52  ? 144 THR B O   1 
ATOM   5298 C CB  . THR B 1 143 ? -4.358  -81.539 -29.723 1.00 35.52  ? 144 THR B CB  1 
ATOM   5299 O OG1 . THR B 1 143 ? -2.987  -81.158 -29.559 1.00 37.26  ? 144 THR B OG1 1 
ATOM   5300 C CG2 . THR B 1 143 ? -4.888  -82.040 -28.390 1.00 41.96  ? 144 THR B CG2 1 
ATOM   5301 N N   . VAL B 1 144 ? -4.769  -81.169 -32.665 1.00 35.58  ? 145 VAL B N   1 
ATOM   5302 C CA  . VAL B 1 144 ? -4.299  -80.340 -33.759 1.00 32.99  ? 145 VAL B CA  1 
ATOM   5303 C C   . VAL B 1 144 ? -3.829  -79.020 -33.161 1.00 34.68  ? 145 VAL B C   1 
ATOM   5304 O O   . VAL B 1 144 ? -4.506  -78.446 -32.310 1.00 37.91  ? 145 VAL B O   1 
ATOM   5305 C CB  . VAL B 1 144 ? -5.399  -80.082 -34.800 1.00 36.95  ? 145 VAL B CB  1 
ATOM   5306 C CG1 . VAL B 1 144 ? -4.909  -79.107 -35.861 1.00 34.54  ? 145 VAL B CG1 1 
ATOM   5307 C CG2 . VAL B 1 144 ? -5.829  -81.385 -35.443 1.00 35.65  ? 145 VAL B CG2 1 
ATOM   5308 N N   . LEU B 1 145 ? -2.659  -78.553 -33.585 1.00 30.94  ? 146 LEU B N   1 
ATOM   5309 C CA  . LEU B 1 145 ? -2.145  -77.269 -33.135 1.00 26.00  ? 146 LEU B CA  1 
ATOM   5310 C C   . LEU B 1 145 ? -2.040  -76.280 -34.299 1.00 32.84  ? 146 LEU B C   1 
ATOM   5311 O O   . LEU B 1 145 ? -1.499  -76.599 -35.354 1.00 33.99  ? 146 LEU B O   1 
ATOM   5312 C CB  . LEU B 1 145 ? -0.793  -77.460 -32.462 1.00 29.11  ? 146 LEU B CB  1 
ATOM   5313 C CG  . LEU B 1 145 ? -0.053  -76.268 -31.857 1.00 39.04  ? 146 LEU B CG  1 
ATOM   5314 C CD1 . LEU B 1 145 ? -0.997  -75.304 -31.213 1.00 43.65  ? 146 LEU B CD1 1 
ATOM   5315 C CD2 . LEU B 1 145 ? 0.895   -76.781 -30.801 1.00 53.43  ? 146 LEU B CD2 1 
ATOM   5316 N N   . VAL B 1 146 ? -2.586  -75.087 -34.097 1.00 30.65  ? 147 VAL B N   1 
ATOM   5317 C CA  . VAL B 1 146 ? -2.508  -74.011 -35.072 1.00 26.54  ? 147 VAL B CA  1 
ATOM   5318 C C   . VAL B 1 146 ? -1.848  -72.804 -34.430 1.00 33.63  ? 147 VAL B C   1 
ATOM   5319 O O   . VAL B 1 146 ? -2.118  -72.496 -33.272 1.00 31.36  ? 147 VAL B O   1 
ATOM   5320 C CB  . VAL B 1 146 ? -3.911  -73.580 -35.552 1.00 29.04  ? 147 VAL B CB  1 
ATOM   5321 C CG1 . VAL B 1 146 ? -3.799  -72.544 -36.652 1.00 23.77  ? 147 VAL B CG1 1 
ATOM   5322 C CG2 . VAL B 1 146 ? -4.688  -74.774 -36.046 1.00 27.31  ? 147 VAL B CG2 1 
ATOM   5323 N N   . SER B 1 147 ? -0.970  -72.124 -35.161 1.00 29.77  ? 148 SER B N   1 
ATOM   5324 C CA  . SER B 1 147 ? -0.475  -70.836 -34.694 1.00 25.67  ? 148 SER B CA  1 
ATOM   5325 C C   . SER B 1 147 ? -0.445  -69.874 -35.860 1.00 30.70  ? 148 SER B C   1 
ATOM   5326 O O   . SER B 1 147 ? -0.300  -70.296 -37.003 1.00 35.11  ? 148 SER B O   1 
ATOM   5327 C CB  . SER B 1 147 ? 0.897   -70.951 -34.011 1.00 33.93  ? 148 SER B CB  1 
ATOM   5328 O OG  . SER B 1 147 ? 1.941   -71.277 -34.911 1.00 25.80  ? 148 SER B OG  1 
ATOM   5329 N N   . MET B 1 148 ? -0.614  -68.584 -35.589 1.00 31.46  ? 149 MET B N   1 
ATOM   5330 C CA  . MET B 1 148 ? -0.594  -67.613 -36.675 1.00 23.49  ? 149 MET B CA  1 
ATOM   5331 C C   . MET B 1 148 ? 0.388   -66.489 -36.411 1.00 32.12  ? 149 MET B C   1 
ATOM   5332 O O   . MET B 1 148 ? 0.776   -66.230 -35.262 1.00 28.12  ? 149 MET B O   1 
ATOM   5333 C CB  . MET B 1 148 ? -1.992  -67.032 -36.932 1.00 22.49  ? 149 MET B CB  1 
ATOM   5334 C CG  . MET B 1 148 ? -2.359  -65.824 -36.069 1.00 28.26  ? 149 MET B CG  1 
ATOM   5335 S SD  . MET B 1 148 ? -2.454  -66.215 -34.304 1.00 31.45  ? 149 MET B SD  1 
ATOM   5336 C CE  . MET B 1 148 ? -3.795  -67.401 -34.283 1.00 21.80  ? 149 MET B CE  1 
ATOM   5337 N N   . ASN B 1 149 ? 0.804   -65.839 -37.492 1.00 25.45  ? 150 ASN B N   1 
ATOM   5338 C CA  . ASN B 1 149 ? 1.472   -64.552 -37.393 1.00 25.93  ? 150 ASN B CA  1 
ATOM   5339 C C   . ASN B 1 149 ? 0.435   -63.437 -37.433 1.00 26.15  ? 150 ASN B C   1 
ATOM   5340 O O   . ASN B 1 149 ? -0.613  -63.564 -38.062 1.00 28.32  ? 150 ASN B O   1 
ATOM   5341 C CB  . ASN B 1 149 ? 2.485   -64.372 -38.518 1.00 25.55  ? 150 ASN B CB  1 
ATOM   5342 C CG  . ASN B 1 149 ? 3.825   -64.969 -38.187 1.00 27.19  ? 150 ASN B CG  1 
ATOM   5343 O OD1 . ASN B 1 149 ? 3.975   -65.678 -37.197 1.00 32.14  ? 150 ASN B OD1 1 
ATOM   5344 N ND2 . ASN B 1 149 ? 4.815   -64.683 -39.015 1.00 30.91  ? 150 ASN B ND2 1 
ATOM   5345 N N   . TYR B 1 150 ? 0.718   -62.349 -36.738 1.00 23.53  ? 151 TYR B N   1 
ATOM   5346 C CA  . TYR B 1 150 ? -0.176  -61.208 -36.761 1.00 20.72  ? 151 TYR B CA  1 
ATOM   5347 C C   . TYR B 1 150 ? 0.710   -59.979 -36.682 1.00 19.27  ? 151 TYR B C   1 
ATOM   5348 O O   . TYR B 1 150 ? 1.804   -60.026 -36.107 1.00 23.34  ? 151 TYR B O   1 
ATOM   5349 C CB  . TYR B 1 150 ? -1.193  -61.274 -35.603 1.00 27.41  ? 151 TYR B CB  1 
ATOM   5350 C CG  . TYR B 1 150 ? -0.585  -61.224 -34.217 1.00 15.73  ? 151 TYR B CG  1 
ATOM   5351 C CD1 . TYR B 1 150 ? -0.262  -62.381 -33.534 1.00 20.07  ? 151 TYR B CD1 1 
ATOM   5352 C CD2 . TYR B 1 150 ? -0.323  -60.011 -33.598 1.00 22.89  ? 151 TYR B CD2 1 
ATOM   5353 C CE1 . TYR B 1 150 ? 0.312   -62.330 -32.258 1.00 21.30  ? 151 TYR B CE1 1 
ATOM   5354 C CE2 . TYR B 1 150 ? 0.231   -59.951 -32.325 1.00 22.61  ? 151 TYR B CE2 1 
ATOM   5355 C CZ  . TYR B 1 150 ? 0.549   -61.109 -31.661 1.00 22.31  ? 151 TYR B CZ  1 
ATOM   5356 O OH  . TYR B 1 150 ? 1.117   -61.038 -30.400 1.00 27.34  ? 151 TYR B OH  1 
ATOM   5357 N N   . ARG B 1 151 ? 0.259   -58.890 -37.284 1.00 25.15  ? 152 ARG B N   1 
ATOM   5358 C CA  . ARG B 1 151 ? 1.062   -57.681 -37.337 1.00 26.30  ? 152 ARG B CA  1 
ATOM   5359 C C   . ARG B 1 151 ? 1.267   -57.094 -35.948 1.00 29.74  ? 152 ARG B C   1 
ATOM   5360 O O   . ARG B 1 151 ? 0.350   -57.070 -35.122 1.00 27.98  ? 152 ARG B O   1 
ATOM   5361 C CB  . ARG B 1 151 ? 0.420   -56.662 -38.272 1.00 28.63  ? 152 ARG B CB  1 
ATOM   5362 C CG  . ARG B 1 151 ? 0.549   -57.005 -39.753 1.00 22.31  ? 152 ARG B CG  1 
ATOM   5363 C CD  . ARG B 1 151 ? -0.317  -56.063 -40.590 1.00 22.92  ? 152 ARG B CD  1 
ATOM   5364 N NE  . ARG B 1 151 ? -1.715  -56.484 -40.608 1.00 27.10  ? 152 ARG B NE  1 
ATOM   5365 C CZ  . ARG B 1 151 ? -2.702  -55.776 -41.146 1.00 29.91  ? 152 ARG B CZ  1 
ATOM   5366 N NH1 . ARG B 1 151 ? -2.442  -54.598 -41.700 1.00 24.98  ? 152 ARG B NH1 1 
ATOM   5367 N NH2 . ARG B 1 151 ? -3.949  -56.240 -41.121 1.00 24.25  ? 152 ARG B NH2 1 
ATOM   5368 N N   . VAL B 1 152 ? 2.486   -56.633 -35.698 1.00 24.46  ? 153 VAL B N   1 
ATOM   5369 C CA  . VAL B 1 152 ? 2.850   -56.049 -34.418 1.00 20.61  ? 153 VAL B CA  1 
ATOM   5370 C C   . VAL B 1 152 ? 3.364   -54.629 -34.627 1.00 30.46  ? 153 VAL B C   1 
ATOM   5371 O O   . VAL B 1 152 ? 3.519   -54.181 -35.770 1.00 28.16  ? 153 VAL B O   1 
ATOM   5372 C CB  . VAL B 1 152 ? 3.960   -56.871 -33.752 1.00 28.39  ? 153 VAL B CB  1 
ATOM   5373 C CG1 . VAL B 1 152 ? 3.429   -58.238 -33.318 1.00 27.70  ? 153 VAL B CG1 1 
ATOM   5374 C CG2 . VAL B 1 152 ? 5.131   -57.029 -34.711 1.00 23.79  ? 153 VAL B CG2 1 
ATOM   5375 N N   . GLY B 1 153 ? 3.640   -53.925 -33.530 1.00 24.51  ? 154 GLY B N   1 
ATOM   5376 C CA  . GLY B 1 153 ? 4.140   -52.561 -33.613 1.00 28.70  ? 154 GLY B CA  1 
ATOM   5377 C C   . GLY B 1 153 ? 3.171   -51.653 -34.352 1.00 25.86  ? 154 GLY B C   1 
ATOM   5378 O O   . GLY B 1 153 ? 1.965   -51.904 -34.366 1.00 29.53  ? 154 GLY B O   1 
ATOM   5379 N N   . ALA B 1 154 ? 3.682   -50.597 -34.972 1.00 27.59  ? 155 ALA B N   1 
ATOM   5380 C CA  . ALA B 1 154 ? 2.804   -49.684 -35.697 1.00 30.39  ? 155 ALA B CA  1 
ATOM   5381 C C   . ALA B 1 154 ? 1.990   -50.410 -36.776 1.00 30.50  ? 155 ALA B C   1 
ATOM   5382 O O   . ALA B 1 154 ? 0.829   -50.084 -37.002 1.00 32.07  ? 155 ALA B O   1 
ATOM   5383 C CB  . ALA B 1 154 ? 3.594   -48.536 -36.298 1.00 22.53  ? 155 ALA B CB  1 
ATOM   5384 N N   . PHE B 1 155 ? 2.584   -51.415 -37.409 1.00 22.65  ? 156 PHE B N   1 
ATOM   5385 C CA  . PHE B 1 155 ? 1.915   -52.114 -38.508 1.00 27.55  ? 156 PHE B CA  1 
ATOM   5386 C C   . PHE B 1 155 ? 0.651   -52.829 -38.062 1.00 27.66  ? 156 PHE B C   1 
ATOM   5387 O O   . PHE B 1 155 ? -0.259  -53.072 -38.861 1.00 28.46  ? 156 PHE B O   1 
ATOM   5388 C CB  . PHE B 1 155 ? 2.885   -53.096 -39.165 1.00 28.99  ? 156 PHE B CB  1 
ATOM   5389 C CG  . PHE B 1 155 ? 4.195   -52.472 -39.527 1.00 31.39  ? 156 PHE B CG  1 
ATOM   5390 C CD1 . PHE B 1 155 ? 5.249   -52.474 -38.628 1.00 27.75  ? 156 PHE B CD1 1 
ATOM   5391 C CD2 . PHE B 1 155 ? 4.360   -51.844 -40.749 1.00 29.93  ? 156 PHE B CD2 1 
ATOM   5392 C CE1 . PHE B 1 155 ? 6.450   -51.873 -38.955 1.00 31.78  ? 156 PHE B CE1 1 
ATOM   5393 C CE2 . PHE B 1 155 ? 5.557   -51.252 -41.081 1.00 28.57  ? 156 PHE B CE2 1 
ATOM   5394 C CZ  . PHE B 1 155 ? 6.600   -51.262 -40.183 1.00 29.93  ? 156 PHE B CZ  1 
ATOM   5395 N N   . GLY B 1 156 ? 0.588   -53.149 -36.776 1.00 30.30  ? 157 GLY B N   1 
ATOM   5396 C CA  . GLY B 1 156 ? -0.538  -53.884 -36.237 1.00 26.99  ? 157 GLY B CA  1 
ATOM   5397 C C   . GLY B 1 156 ? -1.455  -53.055 -35.364 1.00 27.83  ? 157 GLY B C   1 
ATOM   5398 O O   . GLY B 1 156 ? -2.643  -53.362 -35.250 1.00 27.96  ? 157 GLY B O   1 
ATOM   5399 N N   . PHE B 1 157 ? -0.919  -51.998 -34.759 1.00 20.60  ? 158 PHE B N   1 
ATOM   5400 C CA  . PHE B 1 157 ? -1.638  -51.330 -33.675 1.00 31.81  ? 158 PHE B CA  1 
ATOM   5401 C C   . PHE B 1 157 ? -1.537  -49.818 -33.656 1.00 31.73  ? 158 PHE B C   1 
ATOM   5402 O O   . PHE B 1 157 ? -1.954  -49.185 -32.683 1.00 34.32  ? 158 PHE B O   1 
ATOM   5403 C CB  . PHE B 1 157 ? -1.218  -51.913 -32.314 1.00 21.24  ? 158 PHE B CB  1 
ATOM   5404 C CG  . PHE B 1 157 ? -1.497  -53.376 -32.200 1.00 21.00  ? 158 PHE B CG  1 
ATOM   5405 C CD1 . PHE B 1 157 ? -0.484  -54.303 -32.366 1.00 19.96  ? 158 PHE B CD1 1 
ATOM   5406 C CD2 . PHE B 1 157 ? -2.788  -53.829 -31.993 1.00 23.04  ? 158 PHE B CD2 1 
ATOM   5407 C CE1 . PHE B 1 157 ? -0.745  -55.658 -32.291 1.00 24.93  ? 158 PHE B CE1 1 
ATOM   5408 C CE2 . PHE B 1 157 ? -3.060  -55.180 -31.920 1.00 24.29  ? 158 PHE B CE2 1 
ATOM   5409 C CZ  . PHE B 1 157 ? -2.035  -56.098 -32.072 1.00 26.79  ? 158 PHE B CZ  1 
ATOM   5410 N N   . LEU B 1 158 ? -0.982  -49.233 -34.711 1.00 26.35  ? 159 LEU B N   1 
ATOM   5411 C CA  . LEU B 1 158 ? -1.016  -47.786 -34.819 1.00 28.80  ? 159 LEU B CA  1 
ATOM   5412 C C   . LEU B 1 158 ? -2.458  -47.426 -35.115 1.00 35.58  ? 159 LEU B C   1 
ATOM   5413 O O   . LEU B 1 158 ? -3.103  -48.037 -35.973 1.00 28.32  ? 159 LEU B O   1 
ATOM   5414 C CB  . LEU B 1 158 ? -0.070  -47.259 -35.896 1.00 32.69  ? 159 LEU B CB  1 
ATOM   5415 C CG  . LEU B 1 158 ? -0.081  -45.747 -36.163 1.00 41.23  ? 159 LEU B CG  1 
ATOM   5416 C CD1 . LEU B 1 158 ? 1.310   -45.255 -36.543 1.00 26.98  ? 159 LEU B CD1 1 
ATOM   5417 C CD2 . LEU B 1 158 ? -1.081  -45.390 -37.258 1.00 25.33  ? 159 LEU B CD2 1 
ATOM   5418 N N   . ALA B 1 159 ? -2.977  -46.449 -34.385 1.00 30.90  ? 160 ALA B N   1 
ATOM   5419 C CA  . ALA B 1 159 ? -4.379  -46.103 -34.524 1.00 34.74  ? 160 ALA B CA  1 
ATOM   5420 C C   . ALA B 1 159 ? -4.563  -44.605 -34.645 1.00 34.36  ? 160 ALA B C   1 
ATOM   5421 O O   . ALA B 1 159 ? -3.992  -43.833 -33.882 1.00 33.86  ? 160 ALA B O   1 
ATOM   5422 C CB  . ALA B 1 159 ? -5.176  -46.645 -33.336 1.00 25.16  ? 160 ALA B CB  1 
ATOM   5423 N N   . LEU B 1 160 ? -5.345  -44.199 -35.631 1.00 38.09  ? 161 LEU B N   1 
ATOM   5424 C CA  . LEU B 1 160 ? -5.897  -42.856 -35.652 1.00 35.57  ? 161 LEU B CA  1 
ATOM   5425 C C   . LEU B 1 160 ? -7.390  -43.094 -35.559 1.00 33.59  ? 161 LEU B C   1 
ATOM   5426 O O   . LEU B 1 160 ? -8.066  -43.248 -36.569 1.00 35.62  ? 161 LEU B O   1 
ATOM   5427 C CB  . LEU B 1 160 ? -5.515  -42.132 -36.936 1.00 33.54  ? 161 LEU B CB  1 
ATOM   5428 C CG  . LEU B 1 160 ? -4.013  -41.855 -37.039 1.00 33.05  ? 161 LEU B CG  1 
ATOM   5429 C CD1 . LEU B 1 160 ? -3.665  -41.404 -38.428 1.00 37.40  ? 161 LEU B CD1 1 
ATOM   5430 C CD2 . LEU B 1 160 ? -3.600  -40.799 -36.021 1.00 25.75  ? 161 LEU B CD2 1 
ATOM   5431 N N   . PRO B 1 161 ? -7.897  -43.186 -34.326 1.00 32.74  ? 162 PRO B N   1 
ATOM   5432 C CA  . PRO B 1 161 ? -9.272  -43.638 -34.100 1.00 36.56  ? 162 PRO B CA  1 
ATOM   5433 C C   . PRO B 1 161 ? -10.245 -42.771 -34.879 1.00 39.84  ? 162 PRO B C   1 
ATOM   5434 O O   . PRO B 1 161 ? -10.033 -41.560 -34.973 1.00 37.23  ? 162 PRO B O   1 
ATOM   5435 C CB  . PRO B 1 161 ? -9.448  -43.473 -32.588 1.00 41.69  ? 162 PRO B CB  1 
ATOM   5436 C CG  . PRO B 1 161 ? -8.050  -43.589 -32.043 1.00 35.22  ? 162 PRO B CG  1 
ATOM   5437 C CD  . PRO B 1 161 ? -7.175  -42.933 -33.066 1.00 27.71  ? 162 PRO B CD  1 
ATOM   5438 N N   . GLY B 1 162 ? -11.260 -43.395 -35.469 1.00 37.69  ? 163 GLY B N   1 
ATOM   5439 C CA  . GLY B 1 162 ? -12.177 -42.692 -36.344 1.00 39.98  ? 163 GLY B CA  1 
ATOM   5440 C C   . GLY B 1 162 ? -11.881 -42.890 -37.825 1.00 42.80  ? 163 GLY B C   1 
ATOM   5441 O O   . GLY B 1 162 ? -12.795 -43.142 -38.616 1.00 46.70  ? 163 GLY B O   1 
ATOM   5442 N N   . SER B 1 163 ? -10.608 -42.777 -38.203 1.00 37.01  ? 164 SER B N   1 
ATOM   5443 C CA  . SER B 1 163 ? -10.197 -42.894 -39.607 1.00 36.83  ? 164 SER B CA  1 
ATOM   5444 C C   . SER B 1 163 ? -10.436 -44.280 -40.192 1.00 39.71  ? 164 SER B C   1 
ATOM   5445 O O   . SER B 1 163 ? -10.405 -45.288 -39.480 1.00 41.12  ? 164 SER B O   1 
ATOM   5446 C CB  . SER B 1 163 ? -8.717  -42.564 -39.762 1.00 37.75  ? 164 SER B CB  1 
ATOM   5447 O OG  . SER B 1 163 ? -7.923  -43.661 -39.345 1.00 44.40  ? 164 SER B OG  1 
ATOM   5448 N N   . ARG B 1 164 ? -10.656 -44.323 -41.500 1.00 51.29  ? 165 ARG B N   1 
ATOM   5449 C CA  . ARG B 1 164 ? -10.807 -45.585 -42.206 1.00 50.31  ? 165 ARG B CA  1 
ATOM   5450 C C   . ARG B 1 164 ? -9.439  -46.122 -42.588 1.00 37.62  ? 165 ARG B C   1 
ATOM   5451 O O   . ARG B 1 164 ? -9.272  -47.324 -42.785 1.00 39.08  ? 165 ARG B O   1 
ATOM   5452 C CB  . ARG B 1 164 ? -11.659 -45.406 -43.468 1.00 63.49  ? 165 ARG B CB  1 
ATOM   5453 C CG  . ARG B 1 164 ? -13.068 -44.879 -43.208 1.00 91.73  ? 165 ARG B CG  1 
ATOM   5454 C CD  . ARG B 1 164 ? -13.814 -45.732 -42.184 1.00 83.96  ? 165 ARG B CD  1 
ATOM   5455 N NE  . ARG B 1 164 ? -13.944 -47.125 -42.609 1.00 102.16 ? 165 ARG B NE  1 
ATOM   5456 C CZ  . ARG B 1 164 ? -14.999 -47.616 -43.251 1.00 103.08 ? 165 ARG B CZ  1 
ATOM   5457 N NH1 . ARG B 1 164 ? -16.024 -46.828 -43.543 1.00 95.89  ? 165 ARG B NH1 1 
ATOM   5458 N NH2 . ARG B 1 164 ? -15.029 -48.897 -43.598 1.00 99.42  ? 165 ARG B NH2 1 
ATOM   5459 N N   . GLU B 1 165 ? -8.462  -45.223 -42.675 1.00 35.46  ? 166 GLU B N   1 
ATOM   5460 C CA  . GLU B 1 165 ? -7.140  -45.569 -43.198 1.00 37.72  ? 166 GLU B CA  1 
ATOM   5461 C C   . GLU B 1 165 ? -6.169  -46.159 -42.165 1.00 43.99  ? 166 GLU B C   1 
ATOM   5462 O O   . GLU B 1 165 ? -5.202  -46.817 -42.535 1.00 42.32  ? 166 GLU B O   1 
ATOM   5463 C CB  . GLU B 1 165 ? -6.507  -44.359 -43.893 1.00 35.46  ? 166 GLU B CB  1 
ATOM   5464 C CG  . GLU B 1 165 ? -7.333  -43.800 -45.059 1.00 48.06  ? 166 GLU B CG  1 
ATOM   5465 C CD  . GLU B 1 165 ? -7.580  -44.820 -46.182 1.00 67.67  ? 166 GLU B CD  1 
ATOM   5466 O OE1 . GLU B 1 165 ? -6.801  -45.796 -46.317 1.00 60.13  ? 166 GLU B OE1 1 
ATOM   5467 O OE2 . GLU B 1 165 ? -8.562  -44.640 -46.937 1.00 79.34  ? 166 GLU B OE2 1 
ATOM   5468 N N   . ALA B 1 166 ? -6.417  -45.912 -40.882 1.00 37.66  ? 167 ALA B N   1 
ATOM   5469 C CA  . ALA B 1 166 ? -5.636  -46.536 -39.810 1.00 37.53  ? 167 ALA B CA  1 
ATOM   5470 C C   . ALA B 1 166 ? -6.493  -46.694 -38.563 1.00 34.61  ? 167 ALA B C   1 
ATOM   5471 O O   . ALA B 1 166 ? -6.261  -46.023 -37.562 1.00 33.02  ? 167 ALA B O   1 
ATOM   5472 C CB  . ALA B 1 166 ? -4.397  -45.715 -39.498 1.00 32.99  ? 167 ALA B CB  1 
ATOM   5473 N N   . PRO B 1 167 ? -7.492  -47.586 -38.626 1.00 37.16  ? 168 PRO B N   1 
ATOM   5474 C CA  . PRO B 1 167 ? -8.502  -47.723 -37.571 1.00 29.11  ? 168 PRO B CA  1 
ATOM   5475 C C   . PRO B 1 167 ? -7.969  -48.310 -36.264 1.00 35.42  ? 168 PRO B C   1 
ATOM   5476 O O   . PRO B 1 167 ? -8.621  -48.188 -35.224 1.00 38.31  ? 168 PRO B O   1 
ATOM   5477 C CB  . PRO B 1 167 ? -9.534  -48.668 -38.205 1.00 26.26  ? 168 PRO B CB  1 
ATOM   5478 C CG  . PRO B 1 167 ? -8.748  -49.478 -39.177 1.00 26.80  ? 168 PRO B CG  1 
ATOM   5479 C CD  . PRO B 1 167 ? -7.731  -48.519 -39.742 1.00 29.53  ? 168 PRO B CD  1 
ATOM   5480 N N   . GLY B 1 168 ? -6.798  -48.935 -36.316 1.00 41.36  ? 169 GLY B N   1 
ATOM   5481 C CA  . GLY B 1 168 ? -6.233  -49.589 -35.148 1.00 26.90  ? 169 GLY B CA  1 
ATOM   5482 C C   . GLY B 1 168 ? -6.730  -51.014 -34.973 1.00 33.86  ? 169 GLY B C   1 
ATOM   5483 O O   . GLY B 1 168 ? -7.697  -51.437 -35.615 1.00 33.75  ? 169 GLY B O   1 
ATOM   5484 N N   . ASN B 1 169 ? -6.045  -51.754 -34.108 1.00 29.91  ? 170 ASN B N   1 
ATOM   5485 C CA  . ASN B 1 169 ? -6.404  -53.124 -33.777 1.00 27.98  ? 170 ASN B CA  1 
ATOM   5486 C C   . ASN B 1 169 ? -6.331  -54.120 -34.940 1.00 30.39  ? 170 ASN B C   1 
ATOM   5487 O O   . ASN B 1 169 ? -6.870  -55.222 -34.835 1.00 30.21  ? 170 ASN B O   1 
ATOM   5488 C CB  . ASN B 1 169 ? -7.790  -53.182 -33.111 1.00 28.39  ? 170 ASN B CB  1 
ATOM   5489 C CG  . ASN B 1 169 ? -7.830  -52.453 -31.759 1.00 35.37  ? 170 ASN B CG  1 
ATOM   5490 O OD1 . ASN B 1 169 ? -6.804  -52.257 -31.114 1.00 30.12  ? 170 ASN B OD1 1 
ATOM   5491 N ND2 . ASN B 1 169 ? -9.023  -52.043 -31.341 1.00 32.38  ? 170 ASN B ND2 1 
ATOM   5492 N N   . VAL B 1 170 ? -5.663  -53.759 -36.036 1.00 25.34  ? 171 VAL B N   1 
ATOM   5493 C CA  . VAL B 1 170 ? -5.622  -54.669 -37.183 1.00 26.16  ? 171 VAL B CA  1 
ATOM   5494 C C   . VAL B 1 170 ? -4.862  -55.963 -36.847 1.00 26.66  ? 171 VAL B C   1 
ATOM   5495 O O   . VAL B 1 170 ? -5.212  -57.046 -37.326 1.00 23.42  ? 171 VAL B O   1 
ATOM   5496 C CB  . VAL B 1 170 ? -5.130  -53.985 -38.497 1.00 27.22  ? 171 VAL B CB  1 
ATOM   5497 C CG1 . VAL B 1 170 ? -5.967  -52.747 -38.781 1.00 24.02  ? 171 VAL B CG1 1 
ATOM   5498 C CG2 . VAL B 1 170 ? -3.646  -53.621 -38.427 1.00 26.13  ? 171 VAL B CG2 1 
ATOM   5499 N N   . GLY B 1 171 ? -3.860  -55.856 -35.980 1.00 25.21  ? 172 GLY B N   1 
ATOM   5500 C CA  . GLY B 1 171 ? -3.204  -57.039 -35.449 1.00 24.24  ? 172 GLY B CA  1 
ATOM   5501 C C   . GLY B 1 171 ? -4.164  -58.014 -34.779 1.00 29.00  ? 172 GLY B C   1 
ATOM   5502 O O   . GLY B 1 171 ? -4.016  -59.234 -34.913 1.00 28.65  ? 172 GLY B O   1 
ATOM   5503 N N   . LEU B 1 172 ? -5.152  -57.488 -34.058 1.00 21.15  ? 173 LEU B N   1 
ATOM   5504 C CA  . LEU B 1 172 ? -6.145  -58.348 -33.418 1.00 27.55  ? 173 LEU B CA  1 
ATOM   5505 C C   . LEU B 1 172 ? -7.058  -58.919 -34.492 1.00 26.75  ? 173 LEU B C   1 
ATOM   5506 O O   . LEU B 1 172 ? -7.502  -60.071 -34.405 1.00 26.02  ? 173 LEU B O   1 
ATOM   5507 C CB  . LEU B 1 172 ? -6.966  -57.593 -32.356 1.00 25.08  ? 173 LEU B CB  1 
ATOM   5508 C CG  . LEU B 1 172 ? -6.319  -57.276 -31.004 1.00 27.70  ? 173 LEU B CG  1 
ATOM   5509 C CD1 . LEU B 1 172 ? -7.246  -56.416 -30.121 1.00 23.27  ? 173 LEU B CD1 1 
ATOM   5510 C CD2 . LEU B 1 172 ? -5.952  -58.556 -30.285 1.00 25.34  ? 173 LEU B CD2 1 
ATOM   5511 N N   . LEU B 1 173 ? -7.336  -58.113 -35.512 1.00 21.45  ? 174 LEU B N   1 
ATOM   5512 C CA  . LEU B 1 173 ? -8.141  -58.581 -36.648 1.00 25.92  ? 174 LEU B CA  1 
ATOM   5513 C C   . LEU B 1 173 ? -7.426  -59.669 -37.443 1.00 23.38  ? 174 LEU B C   1 
ATOM   5514 O O   . LEU B 1 173 ? -8.069  -60.591 -37.945 1.00 27.68  ? 174 LEU B O   1 
ATOM   5515 C CB  . LEU B 1 173 ? -8.551  -57.421 -37.553 1.00 21.73  ? 174 LEU B CB  1 
ATOM   5516 C CG  . LEU B 1 173 ? -9.570  -56.459 -36.925 1.00 32.69  ? 174 LEU B CG  1 
ATOM   5517 C CD1 . LEU B 1 173 ? -9.980  -55.375 -37.903 1.00 21.11  ? 174 LEU B CD1 1 
ATOM   5518 C CD2 . LEU B 1 173 ? -10.786 -57.220 -36.437 1.00 20.95  ? 174 LEU B CD2 1 
ATOM   5519 N N   . ASP B 1 174 ? -6.099  -59.570 -37.538 1.00 26.12  ? 175 ASP B N   1 
ATOM   5520 C CA  . ASP B 1 174 ? -5.290  -60.643 -38.122 1.00 25.08  ? 175 ASP B CA  1 
ATOM   5521 C C   . ASP B 1 174 ? -5.552  -61.938 -37.359 1.00 30.16  ? 175 ASP B C   1 
ATOM   5522 O O   . ASP B 1 174 ? -5.789  -63.002 -37.951 1.00 26.45  ? 175 ASP B O   1 
ATOM   5523 C CB  . ASP B 1 174 ? -3.790  -60.322 -38.046 1.00 23.94  ? 175 ASP B CB  1 
ATOM   5524 C CG  . ASP B 1 174 ? -3.386  -59.146 -38.914 1.00 31.15  ? 175 ASP B CG  1 
ATOM   5525 O OD1 . ASP B 1 174 ? -4.173  -58.753 -39.806 1.00 28.27  ? 175 ASP B OD1 1 
ATOM   5526 O OD2 . ASP B 1 174 ? -2.268  -58.619 -38.702 1.00 27.23  ? 175 ASP B OD2 1 
ATOM   5527 N N   . GLN B 1 175 ? -5.518  -61.837 -36.033 1.00 28.49  ? 176 GLN B N   1 
ATOM   5528 C CA  . GLN B 1 175 ? -5.765  -62.991 -35.185 1.00 25.71  ? 176 GLN B CA  1 
ATOM   5529 C C   . GLN B 1 175 ? -7.171  -63.540 -35.403 1.00 21.12  ? 176 GLN B C   1 
ATOM   5530 O O   . GLN B 1 175 ? -7.352  -64.757 -35.551 1.00 25.09  ? 176 GLN B O   1 
ATOM   5531 C CB  . GLN B 1 175 ? -5.561  -62.640 -33.716 1.00 29.09  ? 176 GLN B CB  1 
ATOM   5532 C CG  . GLN B 1 175 ? -4.155  -62.246 -33.350 1.00 24.64  ? 176 GLN B CG  1 
ATOM   5533 C CD  . GLN B 1 175 ? -4.086  -61.753 -31.907 1.00 25.53  ? 176 GLN B CD  1 
ATOM   5534 O OE1 . GLN B 1 175 ? -5.043  -61.911 -31.157 1.00 27.14  ? 176 GLN B OE1 1 
ATOM   5535 N NE2 . GLN B 1 175 ? -2.964  -61.144 -31.525 1.00 17.51  ? 176 GLN B NE2 1 
ATOM   5536 N N   . ARG B 1 176 ? -8.159  -62.649 -35.434 1.00 24.29  ? 177 ARG B N   1 
ATOM   5537 C CA  . ARG B 1 176 ? -9.543  -63.059 -35.698 1.00 30.46  ? 177 ARG B CA  1 
ATOM   5538 C C   . ARG B 1 176 ? -9.676  -63.806 -37.026 1.00 30.23  ? 177 ARG B C   1 
ATOM   5539 O O   . ARG B 1 176 ? -10.356 -64.845 -37.102 1.00 28.53  ? 177 ARG B O   1 
ATOM   5540 C CB  . ARG B 1 176 ? -10.493 -61.857 -35.691 1.00 28.11  ? 177 ARG B CB  1 
ATOM   5541 C CG  . ARG B 1 176 ? -11.945 -62.233 -35.981 1.00 33.76  ? 177 ARG B CG  1 
ATOM   5542 C CD  . ARG B 1 176 ? -12.869 -61.044 -35.816 1.00 34.25  ? 177 ARG B CD  1 
ATOM   5543 N NE  . ARG B 1 176 ? -13.084 -60.709 -34.409 1.00 36.41  ? 177 ARG B NE  1 
ATOM   5544 C CZ  . ARG B 1 176 ? -13.561 -59.538 -33.988 1.00 39.88  ? 177 ARG B CZ  1 
ATOM   5545 N NH1 . ARG B 1 176 ? -13.867 -58.589 -34.862 1.00 36.74  ? 177 ARG B NH1 1 
ATOM   5546 N NH2 . ARG B 1 176 ? -13.725 -59.312 -32.691 1.00 40.43  ? 177 ARG B NH2 1 
ATOM   5547 N N   . LEU B 1 177 ? -9.026  -63.280 -38.065 1.00 29.93  ? 178 LEU B N   1 
ATOM   5548 C CA  . LEU B 1 177 ? -9.123  -63.871 -39.403 1.00 24.96  ? 178 LEU B CA  1 
ATOM   5549 C C   . LEU B 1 177 ? -8.598  -65.302 -39.369 1.00 28.49  ? 178 LEU B C   1 
ATOM   5550 O O   . LEU B 1 177 ? -9.224  -66.221 -39.908 1.00 26.06  ? 178 LEU B O   1 
ATOM   5551 C CB  . LEU B 1 177 ? -8.374  -63.019 -40.432 1.00 24.25  ? 178 LEU B CB  1 
ATOM   5552 C CG  . LEU B 1 177 ? -8.448  -63.472 -41.893 1.00 39.13  ? 178 LEU B CG  1 
ATOM   5553 C CD1 . LEU B 1 177 ? -9.898  -63.604 -42.325 1.00 28.81  ? 178 LEU B CD1 1 
ATOM   5554 C CD2 . LEU B 1 177 ? -7.687  -62.517 -42.823 1.00 25.50  ? 178 LEU B CD2 1 
ATOM   5555 N N   . ALA B 1 178 ? -7.470  -65.494 -38.690 1.00 24.43  ? 179 ALA B N   1 
ATOM   5556 C CA  . ALA B 1 178 ? -6.911  -66.828 -38.517 1.00 28.32  ? 179 ALA B CA  1 
ATOM   5557 C C   . ALA B 1 178 ? -7.892  -67.775 -37.819 1.00 35.38  ? 179 ALA B C   1 
ATOM   5558 O O   . ALA B 1 178 ? -8.030  -68.935 -38.221 1.00 33.35  ? 179 ALA B O   1 
ATOM   5559 C CB  . ALA B 1 178 ? -5.590  -66.760 -37.758 1.00 26.21  ? 179 ALA B CB  1 
ATOM   5560 N N   . LEU B 1 179 ? -8.574  -67.274 -36.787 1.00 25.62  ? 180 LEU B N   1 
ATOM   5561 C CA  . LEU B 1 179 ? -9.570  -68.063 -36.065 1.00 32.77  ? 180 LEU B CA  1 
ATOM   5562 C C   . LEU B 1 179 ? -10.734 -68.432 -36.982 1.00 30.08  ? 180 LEU B C   1 
ATOM   5563 O O   . LEU B 1 179 ? -11.199 -69.571 -36.973 1.00 31.34  ? 180 LEU B O   1 
ATOM   5564 C CB  . LEU B 1 179 ? -10.071 -67.315 -34.813 1.00 26.94  ? 180 LEU B CB  1 
ATOM   5565 C CG  . LEU B 1 179 ? -9.009  -67.049 -33.740 1.00 28.62  ? 180 LEU B CG  1 
ATOM   5566 C CD1 . LEU B 1 179 ? -9.585  -66.398 -32.483 1.00 30.69  ? 180 LEU B CD1 1 
ATOM   5567 C CD2 . LEU B 1 179 ? -8.302  -68.339 -33.400 1.00 29.04  ? 180 LEU B CD2 1 
ATOM   5568 N N   . GLN B 1 180 ? -11.205 -67.466 -37.767 1.00 28.07  ? 181 GLN B N   1 
ATOM   5569 C CA  . GLN B 1 180 ? -12.197 -67.746 -38.813 1.00 35.89  ? 181 GLN B CA  1 
ATOM   5570 C C   . GLN B 1 180 ? -11.698 -68.802 -39.800 1.00 32.42  ? 181 GLN B C   1 
ATOM   5571 O O   . GLN B 1 180 ? -12.444 -69.702 -40.190 1.00 31.92  ? 181 GLN B O   1 
ATOM   5572 C CB  . GLN B 1 180 ? -12.591 -66.465 -39.555 1.00 30.95  ? 181 GLN B CB  1 
ATOM   5573 C CG  . GLN B 1 180 ? -13.448 -65.539 -38.714 1.00 41.41  ? 181 GLN B CG  1 
ATOM   5574 C CD  . GLN B 1 180 ? -13.568 -64.149 -39.302 1.00 50.05  ? 181 GLN B CD  1 
ATOM   5575 O OE1 . GLN B 1 180 ? -12.795 -63.762 -40.178 1.00 47.15  ? 181 GLN B OE1 1 
ATOM   5576 N NE2 . GLN B 1 180 ? -14.539 -63.386 -38.815 1.00 47.80  ? 181 GLN B NE2 1 
ATOM   5577 N N   . TRP B 1 181 ? -10.429 -68.700 -40.182 1.00 26.02  ? 182 TRP B N   1 
ATOM   5578 C CA  . TRP B 1 181 ? -9.820  -69.690 -41.067 1.00 31.42  ? 182 TRP B CA  1 
ATOM   5579 C C   . TRP B 1 181 ? -9.870  -71.073 -40.428 1.00 37.20  ? 182 TRP B C   1 
ATOM   5580 O O   . TRP B 1 181 ? -10.172 -72.067 -41.101 1.00 32.12  ? 182 TRP B O   1 
ATOM   5581 C CB  . TRP B 1 181 ? -8.371  -69.303 -41.379 1.00 33.20  ? 182 TRP B CB  1 
ATOM   5582 C CG  . TRP B 1 181 ? -7.698  -70.180 -42.385 1.00 33.92  ? 182 TRP B CG  1 
ATOM   5583 C CD1 . TRP B 1 181 ? -7.562  -69.937 -43.726 1.00 30.30  ? 182 TRP B CD1 1 
ATOM   5584 C CD2 . TRP B 1 181 ? -7.051  -71.435 -42.137 1.00 29.47  ? 182 TRP B CD2 1 
ATOM   5585 N NE1 . TRP B 1 181 ? -6.877  -70.963 -44.322 1.00 30.83  ? 182 TRP B NE1 1 
ATOM   5586 C CE2 . TRP B 1 181 ? -6.555  -71.899 -43.375 1.00 31.98  ? 182 TRP B CE2 1 
ATOM   5587 C CE3 . TRP B 1 181 ? -6.842  -72.211 -40.989 1.00 26.45  ? 182 TRP B CE3 1 
ATOM   5588 C CZ2 . TRP B 1 181 ? -5.859  -73.105 -43.500 1.00 31.11  ? 182 TRP B CZ2 1 
ATOM   5589 C CZ3 . TRP B 1 181 ? -6.158  -73.416 -41.115 1.00 31.39  ? 182 TRP B CZ3 1 
ATOM   5590 C CH2 . TRP B 1 181 ? -5.678  -73.852 -42.366 1.00 28.42  ? 182 TRP B CH2 1 
ATOM   5591 N N   . VAL B 1 182 ? -9.569  -71.130 -39.129 1.00 31.50  ? 183 VAL B N   1 
ATOM   5592 C CA  . VAL B 1 182 ? -9.623  -72.384 -38.373 1.00 27.57  ? 183 VAL B CA  1 
ATOM   5593 C C   . VAL B 1 182 ? -11.030 -72.996 -38.420 1.00 30.40  ? 183 VAL B C   1 
ATOM   5594 O O   . VAL B 1 182 ? -11.191 -74.193 -38.657 1.00 34.29  ? 183 VAL B O   1 
ATOM   5595 C CB  . VAL B 1 182 ? -9.148  -72.192 -36.899 1.00 34.26  ? 183 VAL B CB  1 
ATOM   5596 C CG1 . VAL B 1 182 ? -9.485  -73.416 -36.042 1.00 27.85  ? 183 VAL B CG1 1 
ATOM   5597 C CG2 . VAL B 1 182 ? -7.653  -71.898 -36.856 1.00 30.36  ? 183 VAL B CG2 1 
ATOM   5598 N N   . GLN B 1 183 ? -12.047 -72.166 -38.221 1.00 34.44  ? 184 GLN B N   1 
ATOM   5599 C CA  . GLN B 1 183 ? -13.427 -72.637 -38.287 1.00 35.49  ? 184 GLN B CA  1 
ATOM   5600 C C   . GLN B 1 183 ? -13.749 -73.227 -39.653 1.00 39.34  ? 184 GLN B C   1 
ATOM   5601 O O   . GLN B 1 183 ? -14.280 -74.333 -39.757 1.00 38.29  ? 184 GLN B O   1 
ATOM   5602 C CB  . GLN B 1 183 ? -14.403 -71.505 -37.959 1.00 34.46  ? 184 GLN B CB  1 
ATOM   5603 C CG  . GLN B 1 183 ? -14.495 -71.193 -36.477 1.00 36.71  ? 184 GLN B CG  1 
ATOM   5604 C CD  . GLN B 1 183 ? -14.949 -72.394 -35.665 1.00 43.57  ? 184 GLN B CD  1 
ATOM   5605 O OE1 . GLN B 1 183 ? -16.013 -72.965 -35.919 1.00 41.95  ? 184 GLN B OE1 1 
ATOM   5606 N NE2 . GLN B 1 183 ? -14.138 -72.791 -34.692 1.00 38.00  ? 184 GLN B NE2 1 
ATOM   5607 N N   . GLU B 1 184 ? -13.412 -72.491 -40.704 1.00 36.93  ? 185 GLU B N   1 
ATOM   5608 C CA  . GLU B 1 184 ? -13.719 -72.935 -42.059 1.00 43.68  ? 185 GLU B CA  1 
ATOM   5609 C C   . GLU B 1 184 ? -12.879 -74.123 -42.535 1.00 35.47  ? 185 GLU B C   1 
ATOM   5610 O O   . GLU B 1 184 ? -13.357 -74.932 -43.319 1.00 38.01  ? 185 GLU B O   1 
ATOM   5611 C CB  . GLU B 1 184 ? -13.603 -71.768 -43.035 1.00 38.55  ? 185 GLU B CB  1 
ATOM   5612 C CG  . GLU B 1 184 ? -14.545 -70.623 -42.687 1.00 48.57  ? 185 GLU B CG  1 
ATOM   5613 C CD  . GLU B 1 184 ? -14.544 -69.512 -43.722 1.00 69.12  ? 185 GLU B CD  1 
ATOM   5614 O OE1 . GLU B 1 184 ? -13.858 -69.655 -44.760 1.00 77.42  ? 185 GLU B OE1 1 
ATOM   5615 O OE2 . GLU B 1 184 ? -15.235 -68.493 -43.494 1.00 72.23  ? 185 GLU B OE2 1 
ATOM   5616 N N   . ASN B 1 185 ? -11.653 -74.255 -42.029 1.00 35.09  ? 186 ASN B N   1 
ATOM   5617 C CA  . ASN B 1 185 ? -10.689 -75.179 -42.633 1.00 26.72  ? 186 ASN B CA  1 
ATOM   5618 C C   . ASN B 1 185 ? -10.060 -76.274 -41.774 1.00 36.11  ? 186 ASN B C   1 
ATOM   5619 O O   . ASN B 1 185 ? -9.471  -77.199 -42.326 1.00 39.50  ? 186 ASN B O   1 
ATOM   5620 C CB  . ASN B 1 185 ? -9.568  -74.389 -43.318 1.00 25.93  ? 186 ASN B CB  1 
ATOM   5621 C CG  . ASN B 1 185 ? -10.079 -73.522 -44.452 1.00 31.82  ? 186 ASN B CG  1 
ATOM   5622 O OD1 . ASN B 1 185 ? -10.566 -74.029 -45.464 1.00 33.25  ? 186 ASN B OD1 1 
ATOM   5623 N ND2 . ASN B 1 185 ? -9.966  -72.212 -44.293 1.00 29.03  ? 186 ASN B ND2 1 
ATOM   5624 N N   . VAL B 1 186 ? -10.164 -76.189 -40.447 1.00 32.67  ? 187 VAL B N   1 
ATOM   5625 C CA  . VAL B 1 186 ? -9.394  -77.100 -39.602 1.00 28.77  ? 187 VAL B CA  1 
ATOM   5626 C C   . VAL B 1 186 ? -9.864  -78.550 -39.742 1.00 33.13  ? 187 VAL B C   1 
ATOM   5627 O O   . VAL B 1 186 ? -9.094  -79.488 -39.494 1.00 34.12  ? 187 VAL B O   1 
ATOM   5628 C CB  . VAL B 1 186 ? -9.354  -76.655 -38.094 1.00 34.69  ? 187 VAL B CB  1 
ATOM   5629 C CG1 . VAL B 1 186 ? -10.633 -77.046 -37.362 1.00 31.05  ? 187 VAL B CG1 1 
ATOM   5630 C CG2 . VAL B 1 186 ? -8.149  -77.264 -37.378 1.00 26.07  ? 187 VAL B CG2 1 
ATOM   5631 N N   . ALA B 1 187 ? -11.119 -78.734 -40.149 1.00 32.31  ? 188 ALA B N   1 
ATOM   5632 C CA  . ALA B 1 187 ? -11.674 -80.085 -40.294 1.00 37.99  ? 188 ALA B CA  1 
ATOM   5633 C C   . ALA B 1 187 ? -10.932 -80.862 -41.369 1.00 31.44  ? 188 ALA B C   1 
ATOM   5634 O O   . ALA B 1 187 ? -10.716 -82.066 -41.240 1.00 33.79  ? 188 ALA B O   1 
ATOM   5635 C CB  . ALA B 1 187 ? -13.162 -80.039 -40.590 1.00 27.02  ? 188 ALA B CB  1 
ATOM   5636 N N   . ALA B 1 188 ? -10.505 -80.156 -42.411 1.00 31.45  ? 189 ALA B N   1 
ATOM   5637 C CA  . ALA B 1 188 ? -9.705  -80.768 -43.469 1.00 36.24  ? 189 ALA B CA  1 
ATOM   5638 C C   . ALA B 1 188 ? -8.407  -81.393 -42.948 1.00 35.25  ? 189 ALA B C   1 
ATOM   5639 O O   . ALA B 1 188 ? -7.821  -82.246 -43.608 1.00 38.13  ? 189 ALA B O   1 
ATOM   5640 C CB  . ALA B 1 188 ? -9.416  -79.758 -44.578 1.00 29.43  ? 189 ALA B CB  1 
ATOM   5641 N N   . PHE B 1 189 ? -7.966  -80.982 -41.763 1.00 36.78  ? 190 PHE B N   1 
ATOM   5642 C CA  . PHE B 1 189 ? -6.753  -81.545 -41.165 1.00 32.57  ? 190 PHE B CA  1 
ATOM   5643 C C   . PHE B 1 189 ? -7.076  -82.565 -40.082 1.00 38.20  ? 190 PHE B C   1 
ATOM   5644 O O   . PHE B 1 189 ? -6.173  -83.102 -39.438 1.00 43.02  ? 190 PHE B O   1 
ATOM   5645 C CB  . PHE B 1 189 ? -5.864  -80.441 -40.582 1.00 37.52  ? 190 PHE B CB  1 
ATOM   5646 C CG  . PHE B 1 189 ? -5.439  -79.401 -41.590 1.00 39.90  ? 190 PHE B CG  1 
ATOM   5647 C CD1 . PHE B 1 189 ? -6.286  -78.359 -41.930 1.00 39.33  ? 190 PHE B CD1 1 
ATOM   5648 C CD2 . PHE B 1 189 ? -4.193  -79.464 -42.185 1.00 33.05  ? 190 PHE B CD2 1 
ATOM   5649 C CE1 . PHE B 1 189 ? -5.901  -77.411 -42.846 1.00 33.33  ? 190 PHE B CE1 1 
ATOM   5650 C CE2 . PHE B 1 189 ? -3.805  -78.522 -43.095 1.00 25.24  ? 190 PHE B CE2 1 
ATOM   5651 C CZ  . PHE B 1 189 ? -4.657  -77.490 -43.428 1.00 30.89  ? 190 PHE B CZ  1 
ATOM   5652 N N   . GLY B 1 190 ? -8.362  -82.831 -39.878 1.00 35.80  ? 191 GLY B N   1 
ATOM   5653 C CA  . GLY B 1 190 ? -8.781  -83.767 -38.846 1.00 39.69  ? 191 GLY B CA  1 
ATOM   5654 C C   . GLY B 1 190 ? -9.196  -83.072 -37.560 1.00 42.46  ? 191 GLY B C   1 
ATOM   5655 O O   . GLY B 1 190 ? -9.523  -83.716 -36.566 1.00 48.91  ? 191 GLY B O   1 
ATOM   5656 N N   . GLY B 1 191 ? -9.190  -81.745 -37.586 1.00 42.81  ? 192 GLY B N   1 
ATOM   5657 C CA  . GLY B 1 191 ? -9.523  -80.956 -36.417 1.00 37.04  ? 192 GLY B CA  1 
ATOM   5658 C C   . GLY B 1 191 ? -11.011 -80.723 -36.229 1.00 45.13  ? 192 GLY B C   1 
ATOM   5659 O O   . GLY B 1 191 ? -11.794 -80.756 -37.181 1.00 43.41  ? 192 GLY B O   1 
ATOM   5660 N N   . ASP B 1 192 ? -11.394 -80.480 -34.980 1.00 48.46  ? 193 ASP B N   1 
ATOM   5661 C CA  . ASP B 1 192 ? -12.780 -80.262 -34.609 1.00 36.42  ? 193 ASP B CA  1 
ATOM   5662 C C   . ASP B 1 192 ? -13.049 -78.778 -34.397 1.00 34.86  ? 193 ASP B C   1 
ATOM   5663 O O   . ASP B 1 192 ? -12.654 -78.217 -33.378 1.00 41.42  ? 193 ASP B O   1 
ATOM   5664 C CB  . ASP B 1 192 ? -13.066 -81.011 -33.310 1.00 41.51  ? 193 ASP B CB  1 
ATOM   5665 C CG  . ASP B 1 192 ? -14.535 -81.013 -32.944 1.00 42.26  ? 193 ASP B CG  1 
ATOM   5666 O OD1 . ASP B 1 192 ? -15.323 -80.268 -33.570 1.00 38.57  ? 193 ASP B OD1 1 
ATOM   5667 O OD2 . ASP B 1 192 ? -14.899 -81.766 -32.020 1.00 40.01  ? 193 ASP B OD2 1 
ATOM   5668 N N   . PRO B 1 193 ? -13.744 -78.136 -35.348 1.00 34.20  ? 194 PRO B N   1 
ATOM   5669 C CA  . PRO B 1 193 ? -14.066 -76.708 -35.187 1.00 40.35  ? 194 PRO B CA  1 
ATOM   5670 C C   . PRO B 1 193 ? -14.982 -76.403 -33.996 1.00 47.21  ? 194 PRO B C   1 
ATOM   5671 O O   . PRO B 1 193 ? -15.127 -75.231 -33.645 1.00 38.74  ? 194 PRO B O   1 
ATOM   5672 C CB  . PRO B 1 193 ? -14.754 -76.334 -36.513 1.00 34.29  ? 194 PRO B CB  1 
ATOM   5673 C CG  . PRO B 1 193 ? -15.088 -77.636 -37.179 1.00 28.82  ? 194 PRO B CG  1 
ATOM   5674 C CD  . PRO B 1 193 ? -14.089 -78.640 -36.688 1.00 35.96  ? 194 PRO B CD  1 
ATOM   5675 N N   . THR B 1 194 ? -15.575 -77.429 -33.388 1.00 42.46  ? 195 THR B N   1 
ATOM   5676 C CA  . THR B 1 194 ? -16.444 -77.237 -32.227 1.00 43.89  ? 195 THR B CA  1 
ATOM   5677 C C   . THR B 1 194 ? -15.690 -77.408 -30.907 1.00 45.55  ? 195 THR B C   1 
ATOM   5678 O O   . THR B 1 194 ? -16.260 -77.215 -29.831 1.00 49.70  ? 195 THR B O   1 
ATOM   5679 C CB  . THR B 1 194 ? -17.665 -78.193 -32.241 1.00 41.98  ? 195 THR B CB  1 
ATOM   5680 O OG1 . THR B 1 194 ? -17.213 -79.552 -32.161 1.00 43.06  ? 195 THR B OG1 1 
ATOM   5681 C CG2 . THR B 1 194 ? -18.483 -78.006 -33.511 1.00 36.39  ? 195 THR B CG2 1 
ATOM   5682 N N   . SER B 1 195 ? -14.413 -77.768 -30.983 1.00 41.42  ? 196 SER B N   1 
ATOM   5683 C CA  . SER B 1 195 ? -13.578 -77.812 -29.785 1.00 40.03  ? 196 SER B CA  1 
ATOM   5684 C C   . SER B 1 195 ? -12.268 -77.067 -30.021 1.00 38.06  ? 196 SER B C   1 
ATOM   5685 O O   . SER B 1 195 ? -11.226 -77.676 -30.275 1.00 35.92  ? 196 SER B O   1 
ATOM   5686 C CB  . SER B 1 195 ? -13.300 -79.253 -29.346 1.00 45.31  ? 196 SER B CB  1 
ATOM   5687 O OG  . SER B 1 195 ? -12.587 -79.283 -28.110 1.00 42.15  ? 196 SER B OG  1 
ATOM   5688 N N   . VAL B 1 196 ? -12.327 -75.744 -29.940 1.00 34.15  ? 197 VAL B N   1 
ATOM   5689 C CA  . VAL B 1 196 ? -11.148 -74.922 -30.162 1.00 32.58  ? 197 VAL B CA  1 
ATOM   5690 C C   . VAL B 1 196 ? -10.741 -74.163 -28.903 1.00 38.62  ? 197 VAL B C   1 
ATOM   5691 O O   . VAL B 1 196 ? -11.529 -73.392 -28.337 1.00 30.09  ? 197 VAL B O   1 
ATOM   5692 C CB  . VAL B 1 196 ? -11.375 -73.923 -31.314 1.00 37.94  ? 197 VAL B CB  1 
ATOM   5693 C CG1 . VAL B 1 196 ? -10.200 -72.964 -31.413 1.00 29.81  ? 197 VAL B CG1 1 
ATOM   5694 C CG2 . VAL B 1 196 ? -11.595 -74.671 -32.629 1.00 27.40  ? 197 VAL B CG2 1 
ATOM   5695 N N   . THR B 1 197 ? -9.499  -74.381 -28.478 1.00 33.82  ? 198 THR B N   1 
ATOM   5696 C CA  . THR B 1 197 ? -8.972  -73.757 -27.272 1.00 28.14  ? 198 THR B CA  1 
ATOM   5697 C C   . THR B 1 197 ? -7.864  -72.766 -27.617 1.00 30.84  ? 198 THR B C   1 
ATOM   5698 O O   . THR B 1 197 ? -6.811  -73.154 -28.118 1.00 34.88  ? 198 THR B O   1 
ATOM   5699 C CB  . THR B 1 197 ? -8.413  -74.822 -26.302 1.00 33.74  ? 198 THR B CB  1 
ATOM   5700 O OG1 . THR B 1 197 ? -9.455  -75.732 -25.925 1.00 33.06  ? 198 THR B OG1 1 
ATOM   5701 C CG2 . THR B 1 197 ? -7.838  -74.170 -25.059 1.00 25.65  ? 198 THR B CG2 1 
ATOM   5702 N N   . LEU B 1 198 ? -8.099  -71.484 -27.363 1.00 27.94  ? 199 LEU B N   1 
ATOM   5703 C CA  . LEU B 1 198 ? -7.054  -70.491 -27.562 1.00 28.80  ? 199 LEU B CA  1 
ATOM   5704 C C   . LEU B 1 198 ? -6.078  -70.540 -26.408 1.00 29.20  ? 199 LEU B C   1 
ATOM   5705 O O   . LEU B 1 198 ? -6.477  -70.702 -25.268 1.00 34.21  ? 199 LEU B O   1 
ATOM   5706 C CB  . LEU B 1 198 ? -7.634  -69.090 -27.596 1.00 29.17  ? 199 LEU B CB  1 
ATOM   5707 C CG  . LEU B 1 198 ? -8.617  -68.727 -28.685 1.00 28.08  ? 199 LEU B CG  1 
ATOM   5708 C CD1 . LEU B 1 198 ? -8.841  -67.228 -28.625 1.00 29.79  ? 199 LEU B CD1 1 
ATOM   5709 C CD2 . LEU B 1 198 ? -8.031  -69.138 -30.017 1.00 37.26  ? 199 LEU B CD2 1 
ATOM   5710 N N   . PHE B 1 199 ? -4.795  -70.406 -26.701 1.00 28.02  ? 200 PHE B N   1 
ATOM   5711 C CA  . PHE B 1 199 ? -3.830  -70.142 -25.651 1.00 25.19  ? 200 PHE B CA  1 
ATOM   5712 C C   . PHE B 1 199 ? -2.742  -69.194 -26.119 1.00 27.22  ? 200 PHE B C   1 
ATOM   5713 O O   . PHE B 1 199 ? -2.391  -69.166 -27.300 1.00 29.33  ? 200 PHE B O   1 
ATOM   5714 C CB  . PHE B 1 199 ? -3.292  -71.425 -24.972 1.00 25.07  ? 200 PHE B CB  1 
ATOM   5715 C CG  . PHE B 1 199 ? -2.382  -72.291 -25.821 1.00 30.55  ? 200 PHE B CG  1 
ATOM   5716 C CD1 . PHE B 1 199 ? -2.662  -72.569 -27.151 1.00 27.34  ? 200 PHE B CD1 1 
ATOM   5717 C CD2 . PHE B 1 199 ? -1.246  -72.865 -25.249 1.00 27.14  ? 200 PHE B CD2 1 
ATOM   5718 C CE1 . PHE B 1 199 ? -1.819  -73.394 -27.894 1.00 26.25  ? 200 PHE B CE1 1 
ATOM   5719 C CE2 . PHE B 1 199 ? -0.395  -73.685 -25.987 1.00 31.16  ? 200 PHE B CE2 1 
ATOM   5720 C CZ  . PHE B 1 199 ? -0.684  -73.952 -27.313 1.00 26.38  ? 200 PHE B CZ  1 
ATOM   5721 N N   . GLY B 1 200 ? -2.242  -68.398 -25.184 1.00 23.65  ? 201 GLY B N   1 
ATOM   5722 C CA  . GLY B 1 200 ? -1.227  -67.406 -25.460 1.00 19.71  ? 201 GLY B CA  1 
ATOM   5723 C C   . GLY B 1 200 ? -0.535  -66.971 -24.180 1.00 29.92  ? 201 GLY B C   1 
ATOM   5724 O O   . GLY B 1 200 ? -1.034  -67.187 -23.073 1.00 24.92  ? 201 GLY B O   1 
ATOM   5725 N N   . GLU B 1 201 ? 0.624   -66.350 -24.327 1.00 24.34  ? 202 GLU B N   1 
ATOM   5726 C CA  . GLU B 1 201 ? 1.405   -65.949 -23.177 1.00 25.75  ? 202 GLU B CA  1 
ATOM   5727 C C   . GLU B 1 201 ? 1.722   -64.472 -23.322 1.00 29.39  ? 202 GLU B C   1 
ATOM   5728 O O   . GLU B 1 201 ? 1.980   -64.002 -24.433 1.00 23.87  ? 202 GLU B O   1 
ATOM   5729 C CB  . GLU B 1 201 ? 2.675   -66.804 -23.078 1.00 24.93  ? 202 GLU B CB  1 
ATOM   5730 C CG  . GLU B 1 201 ? 3.563   -66.524 -21.890 1.00 24.86  ? 202 GLU B CG  1 
ATOM   5731 C CD  . GLU B 1 201 ? 4.584   -65.431 -22.165 1.00 38.54  ? 202 GLU B CD  1 
ATOM   5732 O OE1 . GLU B 1 201 ? 4.691   -64.994 -23.330 1.00 28.59  ? 202 GLU B OE1 1 
ATOM   5733 O OE2 . GLU B 1 201 ? 5.273   -65.001 -21.210 1.00 32.94  ? 202 GLU B OE2 1 
ATOM   5734 N N   . SER B 1 202 ? 1.669   -63.752 -22.199 1.00 30.88  ? 203 SER B N   1 
ATOM   5735 C CA  . SER B 1 202 ? 1.941   -62.315 -22.149 1.00 24.20  ? 203 SER B CA  1 
ATOM   5736 C C   . SER B 1 202 ? 1.001   -61.538 -23.075 1.00 22.86  ? 203 SER B C   1 
ATOM   5737 O O   . SER B 1 202 ? -0.214  -61.632 -22.939 1.00 25.27  ? 203 SER B O   1 
ATOM   5738 C CB  . SER B 1 202 ? 3.406   -62.049 -22.494 1.00 26.38  ? 203 SER B CB  1 
ATOM   5739 O OG  . SER B 1 202 ? 3.856   -60.830 -21.935 1.00 28.43  ? 203 SER B OG  1 
ATOM   5740 N N   . ALA B 1 203 ? 1.558   -60.787 -24.024 1.00 27.65  ? 204 ALA B N   1 
ATOM   5741 C CA  . ALA B 1 203 ? 0.732   -60.104 -25.032 1.00 29.76  ? 204 ALA B CA  1 
ATOM   5742 C C   . ALA B 1 203 ? -0.214  -61.061 -25.758 1.00 24.71  ? 204 ALA B C   1 
ATOM   5743 O O   . ALA B 1 203 ? -1.329  -60.682 -26.133 1.00 26.34  ? 204 ALA B O   1 
ATOM   5744 C CB  . ALA B 1 203 ? 1.595   -59.354 -26.035 1.00 27.05  ? 204 ALA B CB  1 
ATOM   5745 N N   . GLY B 1 204 ? 0.226   -62.302 -25.946 1.00 24.61  ? 205 GLY B N   1 
ATOM   5746 C CA  . GLY B 1 204 ? -0.630  -63.328 -26.518 1.00 20.21  ? 205 GLY B CA  1 
ATOM   5747 C C   . GLY B 1 204 ? -1.768  -63.711 -25.581 1.00 31.99  ? 205 GLY B C   1 
ATOM   5748 O O   . GLY B 1 204 ? -2.880  -64.010 -26.029 1.00 25.74  ? 205 GLY B O   1 
ATOM   5749 N N   . ALA B 1 205 ? -1.485  -63.704 -24.277 1.00 26.11  ? 206 ALA B N   1 
ATOM   5750 C CA  . ALA B 1 205 ? -2.506  -63.971 -23.269 1.00 27.71  ? 206 ALA B CA  1 
ATOM   5751 C C   . ALA B 1 205 ? -3.507  -62.822 -23.233 1.00 27.47  ? 206 ALA B C   1 
ATOM   5752 O O   . ALA B 1 205 ? -4.725  -63.038 -23.222 1.00 25.29  ? 206 ALA B O   1 
ATOM   5753 C CB  . ALA B 1 205 ? -1.871  -64.171 -21.890 1.00 23.68  ? 206 ALA B CB  1 
ATOM   5754 N N   . ALA B 1 206 ? -2.990  -61.599 -23.222 1.00 20.28  ? 207 ALA B N   1 
ATOM   5755 C CA  . ALA B 1 206 ? -3.850  -60.430 -23.309 1.00 25.27  ? 207 ALA B CA  1 
ATOM   5756 C C   . ALA B 1 206 ? -4.718  -60.459 -24.583 1.00 32.39  ? 207 ALA B C   1 
ATOM   5757 O O   . ALA B 1 206 ? -5.894  -60.084 -24.534 1.00 39.01  ? 207 ALA B O   1 
ATOM   5758 C CB  . ALA B 1 206 ? -3.026  -59.157 -23.234 1.00 20.64  ? 207 ALA B CB  1 
ATOM   5759 N N   . SER B 1 207 ? -4.156  -60.919 -25.707 1.00 24.75  ? 208 SER B N   1 
ATOM   5760 C CA  . SER B 1 207 ? -4.936  -61.040 -26.948 1.00 27.36  ? 208 SER B CA  1 
ATOM   5761 C C   . SER B 1 207 ? -6.074  -62.035 -26.767 1.00 25.74  ? 208 SER B C   1 
ATOM   5762 O O   . SER B 1 207 ? -7.214  -61.769 -27.156 1.00 22.23  ? 208 SER B O   1 
ATOM   5763 C CB  . SER B 1 207 ? -4.066  -61.475 -28.145 1.00 23.75  ? 208 SER B CB  1 
ATOM   5764 O OG  . SER B 1 207 ? -3.105  -60.497 -28.507 1.00 23.77  ? 208 SER B OG  1 
ATOM   5765 N N   . VAL B 1 208 ? -5.755  -63.194 -26.197 1.00 20.59  ? 209 VAL B N   1 
ATOM   5766 C CA  . VAL B 1 208 ? -6.769  -64.209 -25.933 1.00 26.10  ? 209 VAL B CA  1 
ATOM   5767 C C   . VAL B 1 208 ? -7.935  -63.606 -25.158 1.00 31.12  ? 209 VAL B C   1 
ATOM   5768 O O   . VAL B 1 208 ? -9.099  -63.769 -25.533 1.00 32.64  ? 209 VAL B O   1 
ATOM   5769 C CB  . VAL B 1 208 ? -6.198  -65.384 -25.124 1.00 25.84  ? 209 VAL B CB  1 
ATOM   5770 C CG1 . VAL B 1 208 ? -7.322  -66.288 -24.625 1.00 27.71  ? 209 VAL B CG1 1 
ATOM   5771 C CG2 . VAL B 1 208 ? -5.218  -66.172 -25.962 1.00 23.40  ? 209 VAL B CG2 1 
ATOM   5772 N N   . GLY B 1 209 ? -7.605  -62.886 -24.089 1.00 27.18  ? 210 GLY B N   1 
ATOM   5773 C CA  . GLY B 1 209 ? -8.598  -62.229 -23.263 1.00 31.19  ? 210 GLY B CA  1 
ATOM   5774 C C   . GLY B 1 209 ? -9.436  -61.242 -24.046 1.00 30.16  ? 210 GLY B C   1 
ATOM   5775 O O   . GLY B 1 209 ? -10.646 -61.143 -23.835 1.00 31.31  ? 210 GLY B O   1 
ATOM   5776 N N   . MET B 1 210 ? -8.809  -60.521 -24.968 1.00 30.63  ? 211 MET B N   1 
ATOM   5777 C CA  . MET B 1 210 ? -9.564  -59.597 -25.806 1.00 28.97  ? 211 MET B CA  1 
ATOM   5778 C C   . MET B 1 210 ? -10.535 -60.298 -26.743 1.00 28.80  ? 211 MET B C   1 
ATOM   5779 O O   . MET B 1 210 ? -11.609 -59.773 -27.004 1.00 32.61  ? 211 MET B O   1 
ATOM   5780 C CB  . MET B 1 210 ? -8.643  -58.638 -26.546 1.00 27.92  ? 211 MET B CB  1 
ATOM   5781 C CG  . MET B 1 210 ? -8.007  -57.652 -25.602 1.00 20.15  ? 211 MET B CG  1 
ATOM   5782 S SD  . MET B 1 210 ? -6.775  -56.627 -26.361 1.00 35.80  ? 211 MET B SD  1 
ATOM   5783 C CE  . MET B 1 210 ? -5.733  -56.251 -24.948 1.00 25.86  ? 211 MET B CE  1 
ATOM   5784 N N   . HIS B 1 211 ? -10.181 -61.489 -27.223 1.00 27.84  ? 212 HIS B N   1 
ATOM   5785 C CA  . HIS B 1 211 ? -11.125 -62.269 -28.030 1.00 28.89  ? 212 HIS B CA  1 
ATOM   5786 C C   . HIS B 1 211 ? -12.301 -62.748 -27.175 1.00 34.15  ? 212 HIS B C   1 
ATOM   5787 O O   . HIS B 1 211 ? -13.427 -62.823 -27.657 1.00 32.82  ? 212 HIS B O   1 
ATOM   5788 C CB  . HIS B 1 211 ? -10.441 -63.447 -28.751 1.00 25.18  ? 212 HIS B CB  1 
ATOM   5789 C CG  . HIS B 1 211 ? -9.454  -63.017 -29.794 1.00 36.17  ? 212 HIS B CG  1 
ATOM   5790 N ND1 . HIS B 1 211 ? -9.834  -62.404 -30.970 1.00 28.82  ? 212 HIS B ND1 1 
ATOM   5791 C CD2 . HIS B 1 211 ? -8.102  -63.090 -29.826 1.00 23.55  ? 212 HIS B CD2 1 
ATOM   5792 C CE1 . HIS B 1 211 ? -8.758  -62.116 -31.680 1.00 28.63  ? 212 HIS B CE1 1 
ATOM   5793 N NE2 . HIS B 1 211 ? -7.694  -62.521 -31.008 1.00 28.90  ? 212 HIS B NE2 1 
ATOM   5794 N N   . LEU B 1 212 ? -12.031 -63.069 -25.911 1.00 30.28  ? 213 LEU B N   1 
ATOM   5795 C CA  . LEU B 1 212 ? -13.090 -63.361 -24.945 1.00 31.65  ? 213 LEU B CA  1 
ATOM   5796 C C   . LEU B 1 212 ? -14.083 -62.202 -24.806 1.00 34.64  ? 213 LEU B C   1 
ATOM   5797 O O   . LEU B 1 212 ? -15.289 -62.415 -24.718 1.00 38.80  ? 213 LEU B O   1 
ATOM   5798 C CB  . LEU B 1 212 ? -12.493 -63.673 -23.571 1.00 34.59  ? 213 LEU B CB  1 
ATOM   5799 C CG  . LEU B 1 212 ? -12.000 -65.100 -23.351 1.00 42.81  ? 213 LEU B CG  1 
ATOM   5800 C CD1 . LEU B 1 212 ? -11.392 -65.222 -21.979 1.00 34.72  ? 213 LEU B CD1 1 
ATOM   5801 C CD2 . LEU B 1 212 ? -13.141 -66.086 -23.513 1.00 37.80  ? 213 LEU B CD2 1 
ATOM   5802 N N   . LEU B 1 213 ? -13.570 -60.976 -24.808 1.00 35.18  ? 214 LEU B N   1 
ATOM   5803 C CA  . LEU B 1 213 ? -14.385 -59.801 -24.508 1.00 26.00  ? 214 LEU B CA  1 
ATOM   5804 C C   . LEU B 1 213 ? -14.960 -59.137 -25.752 1.00 32.05  ? 214 LEU B C   1 
ATOM   5805 O O   . LEU B 1 213 ? -15.585 -58.086 -25.663 1.00 39.93  ? 214 LEU B O   1 
ATOM   5806 C CB  . LEU B 1 213 ? -13.562 -58.789 -23.714 1.00 24.85  ? 214 LEU B CB  1 
ATOM   5807 C CG  . LEU B 1 213 ? -12.949 -59.391 -22.446 1.00 28.14  ? 214 LEU B CG  1 
ATOM   5808 C CD1 . LEU B 1 213 ? -12.088 -58.387 -21.713 1.00 26.98  ? 214 LEU B CD1 1 
ATOM   5809 C CD2 . LEU B 1 213 ? -14.053 -59.925 -21.548 1.00 25.42  ? 214 LEU B CD2 1 
ATOM   5810 N N   . SER B 1 214 ? -14.747 -59.750 -26.910 1.00 32.69  ? 215 SER B N   1 
ATOM   5811 C CA  . SER B 1 214 ? -15.226 -59.188 -28.174 1.00 37.04  ? 215 SER B CA  1 
ATOM   5812 C C   . SER B 1 214 ? -16.116 -60.213 -28.862 1.00 39.07  ? 215 SER B C   1 
ATOM   5813 O O   . SER B 1 214 ? -15.626 -61.243 -29.328 1.00 39.32  ? 215 SER B O   1 
ATOM   5814 C CB  . SER B 1 214 ? -14.044 -58.824 -29.078 1.00 32.57  ? 215 SER B CB  1 
ATOM   5815 O OG  . SER B 1 214 ? -14.474 -58.272 -30.309 1.00 39.72  ? 215 SER B OG  1 
ATOM   5816 N N   . PRO B 1 215 ? -17.432 -59.949 -28.904 1.00 43.11  ? 216 PRO B N   1 
ATOM   5817 C CA  . PRO B 1 215 ? -18.407 -60.933 -29.403 1.00 42.16  ? 216 PRO B CA  1 
ATOM   5818 C C   . PRO B 1 215 ? -18.099 -61.576 -30.771 1.00 39.51  ? 216 PRO B C   1 
ATOM   5819 O O   . PRO B 1 215 ? -18.213 -62.798 -30.860 1.00 38.80  ? 216 PRO B O   1 
ATOM   5820 C CB  . PRO B 1 215 ? -19.728 -60.152 -29.410 1.00 33.27  ? 216 PRO B CB  1 
ATOM   5821 C CG  . PRO B 1 215 ? -19.555 -59.165 -28.297 1.00 34.73  ? 216 PRO B CG  1 
ATOM   5822 C CD  . PRO B 1 215 ? -18.094 -58.753 -28.352 1.00 45.98  ? 216 PRO B CD  1 
ATOM   5823 N N   . PRO B 1 216 ? -17.692 -60.798 -31.796 1.00 32.13  ? 217 PRO B N   1 
ATOM   5824 C CA  . PRO B 1 216 ? -17.412 -61.486 -33.070 1.00 33.32  ? 217 PRO B CA  1 
ATOM   5825 C C   . PRO B 1 216 ? -16.287 -62.522 -32.971 1.00 39.66  ? 217 PRO B C   1 
ATOM   5826 O O   . PRO B 1 216 ? -16.297 -63.487 -33.735 1.00 41.34  ? 217 PRO B O   1 
ATOM   5827 C CB  . PRO B 1 216 ? -16.997 -60.351 -34.011 1.00 28.84  ? 217 PRO B CB  1 
ATOM   5828 C CG  . PRO B 1 216 ? -17.562 -59.111 -33.401 1.00 33.55  ? 217 PRO B CG  1 
ATOM   5829 C CD  . PRO B 1 216 ? -17.504 -59.342 -31.910 1.00 35.16  ? 217 PRO B CD  1 
ATOM   5830 N N   . SER B 1 217 ? -15.340 -62.337 -32.053 1.00 33.66  ? 218 SER B N   1 
ATOM   5831 C CA  . SER B 1 217 ? -14.288 -63.336 -31.841 1.00 32.86  ? 218 SER B CA  1 
ATOM   5832 C C   . SER B 1 217 ? -14.810 -64.509 -31.033 1.00 37.28  ? 218 SER B C   1 
ATOM   5833 O O   . SER B 1 217 ? -14.442 -65.656 -31.271 1.00 39.39  ? 218 SER B O   1 
ATOM   5834 C CB  . SER B 1 217 ? -13.075 -62.740 -31.118 1.00 30.80  ? 218 SER B CB  1 
ATOM   5835 O OG  . SER B 1 217 ? -12.366 -61.808 -31.923 1.00 30.42  ? 218 SER B OG  1 
ATOM   5836 N N   . ARG B 1 218 ? -15.682 -64.203 -30.081 1.00 51.56  ? 219 ARG B N   1 
ATOM   5837 C CA  . ARG B 1 218 ? -16.062 -65.143 -29.028 1.00 46.61  ? 219 ARG B CA  1 
ATOM   5838 C C   . ARG B 1 218 ? -16.737 -66.409 -29.574 1.00 38.74  ? 219 ARG B C   1 
ATOM   5839 O O   . ARG B 1 218 ? -16.651 -67.483 -28.972 1.00 44.75  ? 219 ARG B O   1 
ATOM   5840 C CB  . ARG B 1 218 ? -16.920 -64.422 -27.964 1.00 41.14  ? 219 ARG B CB  1 
ATOM   5841 C CG  . ARG B 1 218 ? -17.346 -65.275 -26.782 1.00 44.48  ? 219 ARG B CG  1 
ATOM   5842 C CD  . ARG B 1 218 ? -16.167 -65.882 -26.032 1.00 39.12  ? 219 ARG B CD  1 
ATOM   5843 N NE  . ARG B 1 218 ? -16.619 -66.848 -25.032 1.00 50.46  ? 219 ARG B NE  1 
ATOM   5844 C CZ  . ARG B 1 218 ? -16.666 -68.166 -25.222 1.00 47.70  ? 219 ARG B CZ  1 
ATOM   5845 N NH1 . ARG B 1 218 ? -16.275 -68.693 -26.372 1.00 45.03  ? 219 ARG B NH1 1 
ATOM   5846 N NH2 . ARG B 1 218 ? -17.100 -68.963 -24.254 1.00 47.73  ? 219 ARG B NH2 1 
ATOM   5847 N N   . GLY B 1 219 ? -17.381 -66.292 -30.728 1.00 38.04  ? 220 GLY B N   1 
ATOM   5848 C CA  . GLY B 1 219 ? -17.995 -67.449 -31.361 1.00 34.69  ? 220 GLY B CA  1 
ATOM   5849 C C   . GLY B 1 219 ? -17.043 -68.395 -32.087 1.00 42.76  ? 220 GLY B C   1 
ATOM   5850 O O   . GLY B 1 219 ? -17.472 -69.429 -32.595 1.00 41.76  ? 220 GLY B O   1 
ATOM   5851 N N   . LEU B 1 220 ? -15.752 -68.064 -32.129 1.00 37.08  ? 221 LEU B N   1 
ATOM   5852 C CA  . LEU B 1 220 ? -14.786 -68.856 -32.899 1.00 38.37  ? 221 LEU B CA  1 
ATOM   5853 C C   . LEU B 1 220 ? -13.945 -69.811 -32.039 1.00 41.37  ? 221 LEU B C   1 
ATOM   5854 O O   . LEU B 1 220 ? -13.111 -70.544 -32.557 1.00 41.22  ? 221 LEU B O   1 
ATOM   5855 C CB  . LEU B 1 220 ? -13.865 -67.935 -33.708 1.00 26.28  ? 221 LEU B CB  1 
ATOM   5856 C CG  . LEU B 1 220 ? -14.574 -66.767 -34.398 1.00 34.04  ? 221 LEU B CG  1 
ATOM   5857 C CD1 . LEU B 1 220 ? -13.595 -65.692 -34.815 1.00 30.20  ? 221 LEU B CD1 1 
ATOM   5858 C CD2 . LEU B 1 220 ? -15.363 -67.261 -35.594 1.00 22.39  ? 221 LEU B CD2 1 
ATOM   5859 N N   . PHE B 1 221 ? -14.148 -69.789 -30.726 1.00 35.87  ? 222 PHE B N   1 
ATOM   5860 C CA  . PHE B 1 221 ? -13.470 -70.742 -29.843 1.00 36.52  ? 222 PHE B CA  1 
ATOM   5861 C C   . PHE B 1 221 ? -14.354 -71.068 -28.647 1.00 33.54  ? 222 PHE B C   1 
ATOM   5862 O O   . PHE B 1 221 ? -15.422 -70.472 -28.482 1.00 33.49  ? 222 PHE B O   1 
ATOM   5863 C CB  . PHE B 1 221 ? -12.101 -70.216 -29.389 1.00 34.36  ? 222 PHE B CB  1 
ATOM   5864 C CG  . PHE B 1 221 ? -12.169 -68.943 -28.589 1.00 32.96  ? 222 PHE B CG  1 
ATOM   5865 C CD1 . PHE B 1 221 ? -12.374 -67.722 -29.215 1.00 28.53  ? 222 PHE B CD1 1 
ATOM   5866 C CD2 . PHE B 1 221 ? -12.024 -68.971 -27.208 1.00 31.77  ? 222 PHE B CD2 1 
ATOM   5867 C CE1 . PHE B 1 221 ? -12.442 -66.546 -28.484 1.00 32.76  ? 222 PHE B CE1 1 
ATOM   5868 C CE2 . PHE B 1 221 ? -12.082 -67.803 -26.469 1.00 33.22  ? 222 PHE B CE2 1 
ATOM   5869 C CZ  . PHE B 1 221 ? -12.292 -66.585 -27.108 1.00 34.01  ? 222 PHE B CZ  1 
ATOM   5870 N N   . HIS B 1 222 ? -13.908 -72.006 -27.816 1.00 29.68  ? 223 HIS B N   1 
ATOM   5871 C CA  . HIS B 1 222 ? -14.740 -72.508 -26.719 1.00 43.37  ? 223 HIS B CA  1 
ATOM   5872 C C   . HIS B 1 222 ? -14.093 -72.413 -25.342 1.00 35.06  ? 223 HIS B C   1 
ATOM   5873 O O   . HIS B 1 222 ? -14.778 -72.357 -24.327 1.00 41.53  ? 223 HIS B O   1 
ATOM   5874 C CB  . HIS B 1 222 ? -15.162 -73.949 -27.017 1.00 36.85  ? 223 HIS B CB  1 
ATOM   5875 C CG  . HIS B 1 222 ? -15.719 -74.112 -28.389 1.00 49.07  ? 223 HIS B CG  1 
ATOM   5876 N ND1 . HIS B 1 222 ? -14.916 -74.290 -29.495 1.00 48.48  ? 223 HIS B ND1 1 
ATOM   5877 C CD2 . HIS B 1 222 ? -16.990 -74.046 -28.849 1.00 41.18  ? 223 HIS B CD2 1 
ATOM   5878 C CE1 . HIS B 1 222 ? -15.672 -74.348 -30.575 1.00 38.73  ? 223 HIS B CE1 1 
ATOM   5879 N NE2 . HIS B 1 222 ? -16.934 -74.214 -30.209 1.00 48.81  ? 223 HIS B NE2 1 
ATOM   5880 N N   . ARG B 1 223 ? -12.770 -72.419 -25.314 1.00 39.02  ? 224 ARG B N   1 
ATOM   5881 C CA  . ARG B 1 223 ? -12.035 -72.333 -24.066 1.00 34.62  ? 224 ARG B CA  1 
ATOM   5882 C C   . ARG B 1 223 ? -10.821 -71.446 -24.261 1.00 32.60  ? 224 ARG B C   1 
ATOM   5883 O O   . ARG B 1 223 ? -10.399 -71.192 -25.393 1.00 38.20  ? 224 ARG B O   1 
ATOM   5884 C CB  . ARG B 1 223 ? -11.584 -73.719 -23.609 1.00 31.34  ? 224 ARG B CB  1 
ATOM   5885 C CG  . ARG B 1 223 ? -12.711 -74.674 -23.328 1.00 39.26  ? 224 ARG B CG  1 
ATOM   5886 C CD  . ARG B 1 223 ? -12.189 -76.070 -23.117 1.00 34.69  ? 224 ARG B CD  1 
ATOM   5887 N NE  . ARG B 1 223 ? -13.217 -77.055 -23.422 1.00 48.20  ? 224 ARG B NE  1 
ATOM   5888 C CZ  . ARG B 1 223 ? -13.464 -77.516 -24.643 1.00 53.68  ? 224 ARG B CZ  1 
ATOM   5889 N NH1 . ARG B 1 223 ? -12.760 -77.081 -25.676 1.00 55.25  ? 224 ARG B NH1 1 
ATOM   5890 N NH2 . ARG B 1 223 ? -14.418 -78.416 -24.835 1.00 77.11  ? 224 ARG B NH2 1 
ATOM   5891 N N   . ALA B 1 224 ? -10.249 -70.998 -23.152 1.00 33.64  ? 225 ALA B N   1 
ATOM   5892 C CA  . ALA B 1 224 ? -9.146  -70.062 -23.193 1.00 28.61  ? 225 ALA B CA  1 
ATOM   5893 C C   . ALA B 1 224 ? -8.097  -70.392 -22.146 1.00 33.30  ? 225 ALA B C   1 
ATOM   5894 O O   . ALA B 1 224 ? -8.431  -70.844 -21.049 1.00 34.55  ? 225 ALA B O   1 
ATOM   5895 C CB  . ALA B 1 224 ? -9.663  -68.649 -22.999 1.00 33.00  ? 225 ALA B CB  1 
ATOM   5896 N N   . VAL B 1 225 ? -6.830  -70.168 -22.502 1.00 28.36  ? 226 VAL B N   1 
ATOM   5897 C CA  . VAL B 1 225 ? -5.702  -70.294 -21.583 1.00 24.47  ? 226 VAL B CA  1 
ATOM   5898 C C   . VAL B 1 225 ? -4.889  -68.998 -21.634 1.00 29.21  ? 226 VAL B C   1 
ATOM   5899 O O   . VAL B 1 225 ? -4.427  -68.594 -22.696 1.00 33.72  ? 226 VAL B O   1 
ATOM   5900 C CB  . VAL B 1 225 ? -4.803  -71.489 -21.951 1.00 29.26  ? 226 VAL B CB  1 
ATOM   5901 C CG1 . VAL B 1 225 ? -3.586  -71.568 -21.041 1.00 26.41  ? 226 VAL B CG1 1 
ATOM   5902 C CG2 . VAL B 1 225 ? -5.592  -72.794 -21.924 1.00 28.98  ? 226 VAL B CG2 1 
ATOM   5903 N N   . LEU B 1 226 ? -4.739  -68.328 -20.494 1.00 31.96  ? 227 LEU B N   1 
ATOM   5904 C CA  . LEU B 1 226 ? -3.989  -67.076 -20.443 1.00 24.61  ? 227 LEU B CA  1 
ATOM   5905 C C   . LEU B 1 226 ? -2.768  -67.228 -19.562 1.00 30.06  ? 227 LEU B C   1 
ATOM   5906 O O   . LEU B 1 226 ? -2.885  -67.311 -18.342 1.00 27.50  ? 227 LEU B O   1 
ATOM   5907 C CB  . LEU B 1 226 ? -4.855  -65.931 -19.923 1.00 22.91  ? 227 LEU B CB  1 
ATOM   5908 C CG  . LEU B 1 226 ? -6.013  -65.510 -20.820 1.00 26.50  ? 227 LEU B CG  1 
ATOM   5909 C CD1 . LEU B 1 226 ? -7.206  -66.428 -20.672 1.00 26.82  ? 227 LEU B CD1 1 
ATOM   5910 C CD2 . LEU B 1 226 ? -6.386  -64.076 -20.526 1.00 23.99  ? 227 LEU B CD2 1 
ATOM   5911 N N   . GLN B 1 227 ? -1.594  -67.268 -20.184 1.00 29.27  ? 228 GLN B N   1 
ATOM   5912 C CA  . GLN B 1 227 ? -0.354  -67.461 -19.447 1.00 26.21  ? 228 GLN B CA  1 
ATOM   5913 C C   . GLN B 1 227 ? 0.352   -66.129 -19.221 1.00 29.41  ? 228 GLN B C   1 
ATOM   5914 O O   . GLN B 1 227 ? 0.778   -65.486 -20.175 1.00 26.79  ? 228 GLN B O   1 
ATOM   5915 C CB  . GLN B 1 227 ? 0.562   -68.450 -20.186 1.00 27.32  ? 228 GLN B CB  1 
ATOM   5916 C CG  . GLN B 1 227 ? -0.089  -69.818 -20.455 1.00 28.67  ? 228 GLN B CG  1 
ATOM   5917 C CD  . GLN B 1 227 ? 0.694   -70.680 -21.448 1.00 40.28  ? 228 GLN B CD  1 
ATOM   5918 O OE1 . GLN B 1 227 ? 0.112   -71.507 -22.153 1.00 34.05  ? 228 GLN B OE1 1 
ATOM   5919 N NE2 . GLN B 1 227 ? 2.014   -70.499 -21.498 1.00 29.60  ? 228 GLN B NE2 1 
ATOM   5920 N N   . SER B 1 228 ? 0.462   -65.711 -17.961 1.00 25.32  ? 229 SER B N   1 
ATOM   5921 C CA  . SER B 1 228 ? 1.220   -64.506 -17.613 1.00 24.90  ? 229 SER B CA  1 
ATOM   5922 C C   . SER B 1 228 ? 0.750   -63.259 -18.361 1.00 27.39  ? 229 SER B C   1 
ATOM   5923 O O   . SER B 1 228 ? 1.571   -62.452 -18.808 1.00 24.78  ? 229 SER B O   1 
ATOM   5924 C CB  . SER B 1 228 ? 2.712   -64.700 -17.901 1.00 24.57  ? 229 SER B CB  1 
ATOM   5925 O OG  . SER B 1 228 ? 3.236   -65.817 -17.221 1.00 27.58  ? 229 SER B OG  1 
ATOM   5926 N N   . GLY B 1 229 ? -0.558  -63.100 -18.514 1.00 22.67  ? 230 GLY B N   1 
ATOM   5927 C CA  . GLY B 1 229 ? -1.075  -61.939 -19.215 1.00 22.00  ? 230 GLY B CA  1 
ATOM   5928 C C   . GLY B 1 229 ? -2.582  -61.879 -19.129 1.00 20.75  ? 230 GLY B C   1 
ATOM   5929 O O   . GLY B 1 229 ? -3.236  -62.898 -18.951 1.00 23.57  ? 230 GLY B O   1 
ATOM   5930 N N   . ALA B 1 230 ? -3.126  -60.677 -19.261 1.00 20.54  ? 231 ALA B N   1 
ATOM   5931 C CA  . ALA B 1 230 ? -4.545  -60.441 -19.085 1.00 21.84  ? 231 ALA B CA  1 
ATOM   5932 C C   . ALA B 1 230 ? -4.879  -59.217 -19.900 1.00 24.83  ? 231 ALA B C   1 
ATOM   5933 O O   . ALA B 1 230 ? -4.061  -58.304 -19.983 1.00 26.25  ? 231 ALA B O   1 
ATOM   5934 C CB  . ALA B 1 230 ? -4.850  -60.188 -17.609 1.00 25.47  ? 231 ALA B CB  1 
ATOM   5935 N N   . PRO B 1 231 ? -6.083  -59.178 -20.497 1.00 28.51  ? 232 PRO B N   1 
ATOM   5936 C CA  . PRO B 1 231 ? -6.452  -58.037 -21.341 1.00 26.89  ? 232 PRO B CA  1 
ATOM   5937 C C   . PRO B 1 231 ? -6.564  -56.750 -20.537 1.00 36.85  ? 232 PRO B C   1 
ATOM   5938 O O   . PRO B 1 231 ? -6.403  -55.674 -21.117 1.00 30.89  ? 232 PRO B O   1 
ATOM   5939 C CB  . PRO B 1 231 ? -7.821  -58.441 -21.907 1.00 27.27  ? 232 PRO B CB  1 
ATOM   5940 C CG  . PRO B 1 231 ? -8.366  -59.421 -20.920 1.00 24.65  ? 232 PRO B CG  1 
ATOM   5941 C CD  . PRO B 1 231 ? -7.158  -60.182 -20.434 1.00 32.91  ? 232 PRO B CD  1 
ATOM   5942 N N   . ASN B 1 232 ? -6.809  -56.867 -19.230 1.00 32.20  ? 233 ASN B N   1 
ATOM   5943 C CA  . ASN B 1 232 ? -6.952  -55.709 -18.342 1.00 29.17  ? 233 ASN B CA  1 
ATOM   5944 C C   . ASN B 1 232 ? -5.652  -55.142 -17.753 1.00 32.04  ? 233 ASN B C   1 
ATOM   5945 O O   . ASN B 1 232 ? -5.674  -54.152 -17.020 1.00 34.45  ? 233 ASN B O   1 
ATOM   5946 C CB  . ASN B 1 232 ? -7.934  -56.031 -17.211 1.00 31.76  ? 233 ASN B CB  1 
ATOM   5947 C CG  . ASN B 1 232 ? -7.656  -57.372 -16.570 1.00 31.89  ? 233 ASN B CG  1 
ATOM   5948 O OD1 . ASN B 1 232 ? -7.491  -58.375 -17.263 1.00 32.86  ? 233 ASN B OD1 1 
ATOM   5949 N ND2 . ASN B 1 232 ? -7.582  -57.397 -15.241 1.00 29.06  ? 233 ASN B ND2 1 
ATOM   5950 N N   . GLY B 1 233 ? -4.516  -55.749 -18.057 1.00 30.31  ? 234 GLY B N   1 
ATOM   5951 C CA  . GLY B 1 233 ? -3.253  -55.131 -17.668 1.00 50.86  ? 234 GLY B CA  1 
ATOM   5952 C C   . GLY B 1 233 ? -3.069  -53.697 -18.179 1.00 53.09  ? 234 GLY B C   1 
ATOM   5953 O O   . GLY B 1 233 ? -3.411  -53.406 -19.331 1.00 47.59  ? 234 GLY B O   1 
ATOM   5954 N N   . PRO B 1 234 ? -2.495  -52.805 -17.341 1.00 34.34  ? 235 PRO B N   1 
ATOM   5955 C CA  . PRO B 1 234 ? -2.255  -51.385 -17.645 1.00 28.27  ? 235 PRO B CA  1 
ATOM   5956 C C   . PRO B 1 234 ? -1.310  -51.113 -18.840 1.00 33.66  ? 235 PRO B C   1 
ATOM   5957 O O   . PRO B 1 234 ? -1.062  -49.949 -19.176 1.00 33.46  ? 235 PRO B O   1 
ATOM   5958 C CB  . PRO B 1 234 ? -1.604  -50.867 -16.360 1.00 25.16  ? 235 PRO B CB  1 
ATOM   5959 C CG  . PRO B 1 234 ? -0.901  -52.046 -15.811 1.00 32.39  ? 235 PRO B CG  1 
ATOM   5960 C CD  . PRO B 1 234 ? -1.805  -53.213 -16.103 1.00 29.01  ? 235 PRO B CD  1 
ATOM   5961 N N   . TRP B 1 235 ? -0.795  -52.163 -19.472 1.00 29.45  ? 236 TRP B N   1 
ATOM   5962 C CA  . TRP B 1 235 ? 0.107   -52.007 -20.617 1.00 27.95  ? 236 TRP B CA  1 
ATOM   5963 C C   . TRP B 1 235 ? -0.545  -52.476 -21.914 1.00 24.94  ? 236 TRP B C   1 
ATOM   5964 O O   . TRP B 1 235 ? -0.096  -52.125 -23.006 1.00 30.78  ? 236 TRP B O   1 
ATOM   5965 C CB  . TRP B 1 235 ? 1.388   -52.812 -20.386 1.00 17.27  ? 236 TRP B CB  1 
ATOM   5966 C CG  . TRP B 1 235 ? 1.102   -54.240 -20.023 1.00 27.16  ? 236 TRP B CG  1 
ATOM   5967 C CD1 . TRP B 1 235 ? 0.895   -54.735 -18.772 1.00 31.23  ? 236 TRP B CD1 1 
ATOM   5968 C CD2 . TRP B 1 235 ? 0.963   -55.353 -20.919 1.00 28.95  ? 236 TRP B CD2 1 
ATOM   5969 N NE1 . TRP B 1 235 ? 0.652   -56.084 -18.826 1.00 28.41  ? 236 TRP B NE1 1 
ATOM   5970 C CE2 . TRP B 1 235 ? 0.683   -56.490 -20.132 1.00 28.81  ? 236 TRP B CE2 1 
ATOM   5971 C CE3 . TRP B 1 235 ? 1.054   -55.501 -22.306 1.00 28.74  ? 236 TRP B CE3 1 
ATOM   5972 C CZ2 . TRP B 1 235 ? 0.501   -57.753 -20.680 1.00 25.78  ? 236 TRP B CZ2 1 
ATOM   5973 C CZ3 . TRP B 1 235 ? 0.862   -56.761 -22.851 1.00 27.53  ? 236 TRP B CZ3 1 
ATOM   5974 C CH2 . TRP B 1 235 ? 0.597   -57.869 -22.041 1.00 35.46  ? 236 TRP B CH2 1 
ATOM   5975 N N   . ALA B 1 236 ? -1.603  -53.274 -21.779 1.00 25.61  ? 237 ALA B N   1 
ATOM   5976 C CA  . ALA B 1 236 ? -2.166  -54.032 -22.896 1.00 31.92  ? 237 ALA B CA  1 
ATOM   5977 C C   . ALA B 1 236 ? -3.131  -53.241 -23.767 1.00 30.22  ? 237 ALA B C   1 
ATOM   5978 O O   . ALA B 1 236 ? -3.361  -53.594 -24.927 1.00 34.15  ? 237 ALA B O   1 
ATOM   5979 C CB  . ALA B 1 236 ? -2.823  -55.321 -22.405 1.00 23.72  ? 237 ALA B CB  1 
ATOM   5980 N N   . THR B 1 237 ? -3.690  -52.172 -23.223 1.00 21.70  ? 238 THR B N   1 
ATOM   5981 C CA  . THR B 1 237 ? -4.544  -51.310 -24.029 1.00 25.09  ? 238 THR B CA  1 
ATOM   5982 C C   . THR B 1 237 ? -4.200  -49.865 -23.795 1.00 31.15  ? 238 THR B C   1 
ATOM   5983 O O   . THR B 1 237 ? -3.534  -49.518 -22.819 1.00 24.74  ? 238 THR B O   1 
ATOM   5984 C CB  . THR B 1 237 ? -6.020  -51.483 -23.710 1.00 29.51  ? 238 THR B CB  1 
ATOM   5985 O OG1 . THR B 1 237 ? -6.228  -51.229 -22.311 1.00 31.90  ? 238 THR B OG1 1 
ATOM   5986 C CG2 . THR B 1 237 ? -6.474  -52.891 -24.056 1.00 25.57  ? 238 THR B CG2 1 
ATOM   5987 N N   . VAL B 1 238 ? -4.669  -49.026 -24.707 1.00 26.29  ? 239 VAL B N   1 
ATOM   5988 C CA  . VAL B 1 238 ? -4.441  -47.597 -24.633 1.00 19.69  ? 239 VAL B CA  1 
ATOM   5989 C C   . VAL B 1 238 ? -5.774  -46.925 -25.017 1.00 30.72  ? 239 VAL B C   1 
ATOM   5990 O O   . VAL B 1 238 ? -6.578  -47.510 -25.752 1.00 30.01  ? 239 VAL B O   1 
ATOM   5991 C CB  . VAL B 1 238 ? -3.274  -47.204 -25.569 1.00 33.64  ? 239 VAL B CB  1 
ATOM   5992 C CG1 . VAL B 1 238 ? -3.714  -47.219 -27.056 1.00 22.87  ? 239 VAL B CG1 1 
ATOM   5993 C CG2 . VAL B 1 238 ? -2.700  -45.878 -25.185 1.00 33.13  ? 239 VAL B CG2 1 
ATOM   5994 N N   . GLY B 1 239 ? -6.039  -45.733 -24.484 1.00 27.58  ? 240 GLY B N   1 
ATOM   5995 C CA  . GLY B 1 239 ? -7.249  -45.002 -24.837 1.00 23.19  ? 240 GLY B CA  1 
ATOM   5996 C C   . GLY B 1 239 ? -7.136  -44.371 -26.228 1.00 40.60  ? 240 GLY B C   1 
ATOM   5997 O O   . GLY B 1 239 ? -6.053  -44.343 -26.823 1.00 27.98  ? 240 GLY B O   1 
ATOM   5998 N N   . MET B 1 240 ? -8.249  -43.853 -26.744 1.00 35.89  ? 241 MET B N   1 
ATOM   5999 C CA  . MET B 1 240 ? -8.292  -43.319 -28.107 1.00 36.80  ? 241 MET B CA  1 
ATOM   6000 C C   . MET B 1 240 ? -7.373  -42.120 -28.312 1.00 38.53  ? 241 MET B C   1 
ATOM   6001 O O   . MET B 1 240 ? -6.685  -42.023 -29.328 1.00 35.91  ? 241 MET B O   1 
ATOM   6002 C CB  . MET B 1 240 ? -9.722  -42.943 -28.498 1.00 33.02  ? 241 MET B CB  1 
ATOM   6003 C CG  . MET B 1 240 ? -10.526 -44.069 -29.124 1.00 41.14  ? 241 MET B CG  1 
ATOM   6004 S SD  . MET B 1 240 ? -12.266 -43.628 -29.326 1.00 52.48  ? 241 MET B SD  1 
ATOM   6005 C CE  . MET B 1 240 ? -12.732 -43.355 -27.624 1.00 60.87  ? 241 MET B CE  1 
ATOM   6006 N N   . GLY B 1 241 ? -7.371  -41.205 -27.352 1.00 29.74  ? 242 GLY B N   1 
ATOM   6007 C CA  . GLY B 1 241 ? -6.593  -39.991 -27.479 1.00 25.88  ? 242 GLY B CA  1 
ATOM   6008 C C   . GLY B 1 241 ? -5.106  -40.248 -27.355 1.00 37.77  ? 242 GLY B C   1 
ATOM   6009 O O   . GLY B 1 241 ? -4.299  -39.637 -28.054 1.00 30.69  ? 242 GLY B O   1 
ATOM   6010 N N   . GLU B 1 242 ? -4.733  -41.153 -26.455 1.00 38.18  ? 243 GLU B N   1 
ATOM   6011 C CA  . GLU B 1 242 ? -3.328  -41.491 -26.299 1.00 35.15  ? 243 GLU B CA  1 
ATOM   6012 C C   . GLU B 1 242 ? -2.815  -42.273 -27.522 1.00 36.56  ? 243 GLU B C   1 
ATOM   6013 O O   . GLU B 1 242 ? -1.664  -42.116 -27.929 1.00 30.88  ? 243 GLU B O   1 
ATOM   6014 C CB  . GLU B 1 242 ? -3.086  -42.238 -24.984 1.00 33.39  ? 243 GLU B CB  1 
ATOM   6015 C CG  . GLU B 1 242 ? -1.633  -42.620 -24.707 1.00 29.03  ? 243 GLU B CG  1 
ATOM   6016 C CD  . GLU B 1 242 ? -0.688  -41.440 -24.671 1.00 34.54  ? 243 GLU B CD  1 
ATOM   6017 O OE1 . GLU B 1 242 ? -1.162  -40.289 -24.531 1.00 48.37  ? 243 GLU B OE1 1 
ATOM   6018 O OE2 . GLU B 1 242 ? 0.539   -41.669 -24.775 1.00 36.93  ? 243 GLU B OE2 1 
ATOM   6019 N N   . ALA B 1 243 ? -3.675  -43.089 -28.124 1.00 28.03  ? 244 ALA B N   1 
ATOM   6020 C CA  . ALA B 1 243 ? -3.301  -43.778 -29.359 1.00 28.92  ? 244 ALA B CA  1 
ATOM   6021 C C   . ALA B 1 243 ? -3.069  -42.772 -30.489 1.00 37.98  ? 244 ALA B C   1 
ATOM   6022 O O   . ALA B 1 243 ? -2.101  -42.885 -31.245 1.00 38.74  ? 244 ALA B O   1 
ATOM   6023 C CB  . ALA B 1 243 ? -4.356  -44.800 -29.754 1.00 23.58  ? 244 ALA B CB  1 
ATOM   6024 N N   . ARG B 1 244 ? -3.953  -41.782 -30.594 1.00 35.94  ? 245 ARG B N   1 
ATOM   6025 C CA  . ARG B 1 244 ? -3.812  -40.749 -31.609 1.00 33.72  ? 245 ARG B CA  1 
ATOM   6026 C C   . ARG B 1 244 ? -2.548  -39.931 -31.386 1.00 35.44  ? 245 ARG B C   1 
ATOM   6027 O O   . ARG B 1 244 ? -1.853  -39.568 -32.335 1.00 33.00  ? 245 ARG B O   1 
ATOM   6028 C CB  . ARG B 1 244 ? -5.031  -39.829 -31.624 1.00 33.68  ? 245 ARG B CB  1 
ATOM   6029 C CG  . ARG B 1 244 ? -4.849  -38.613 -32.518 1.00 34.67  ? 245 ARG B CG  1 
ATOM   6030 C CD  . ARG B 1 244 ? -6.172  -37.938 -32.849 1.00 33.38  ? 245 ARG B CD  1 
ATOM   6031 N NE  . ARG B 1 244 ? -7.053  -38.789 -33.647 1.00 32.64  ? 245 ARG B NE  1 
ATOM   6032 C CZ  . ARG B 1 244 ? -7.008  -38.881 -34.977 1.00 39.04  ? 245 ARG B CZ  1 
ATOM   6033 N NH1 . ARG B 1 244 ? -6.115  -38.184 -35.674 1.00 23.96  ? 245 ARG B NH1 1 
ATOM   6034 N NH2 . ARG B 1 244 ? -7.855  -39.680 -35.610 1.00 37.44  ? 245 ARG B NH2 1 
ATOM   6035 N N   . ARG B 1 245 ? -2.251  -39.645 -30.125 1.00 33.11  ? 246 ARG B N   1 
ATOM   6036 C CA  . ARG B 1 245 ? -1.070  -38.857 -29.794 1.00 33.21  ? 246 ARG B CA  1 
ATOM   6037 C C   . ARG B 1 245 ? 0.199   -39.572 -30.242 1.00 35.21  ? 246 ARG B C   1 
ATOM   6038 O O   . ARG B 1 245 ? 1.109   -38.949 -30.788 1.00 34.52  ? 246 ARG B O   1 
ATOM   6039 C CB  . ARG B 1 245 ? -0.998  -38.573 -28.285 1.00 32.46  ? 246 ARG B CB  1 
ATOM   6040 C CG  . ARG B 1 245 ? 0.131   -37.621 -27.916 1.00 28.43  ? 246 ARG B CG  1 
ATOM   6041 C CD  . ARG B 1 245 ? 0.415   -37.591 -26.417 1.00 38.23  ? 246 ARG B CD  1 
ATOM   6042 N NE  . ARG B 1 245 ? 1.007   -38.834 -25.926 1.00 45.30  ? 246 ARG B NE  1 
ATOM   6043 C CZ  . ARG B 1 245 ? 2.256   -39.234 -26.171 1.00 46.73  ? 246 ARG B CZ  1 
ATOM   6044 N NH1 . ARG B 1 245 ? 3.072   -38.501 -26.925 1.00 37.58  ? 246 ARG B NH1 1 
ATOM   6045 N NH2 . ARG B 1 245 ? 2.689   -40.382 -25.666 1.00 35.71  ? 246 ARG B NH2 1 
ATOM   6046 N N   . ARG B 1 246 ? 0.244   -40.882 -30.002 1.00 33.52  ? 247 ARG B N   1 
ATOM   6047 C CA  . ARG B 1 246 ? 1.395   -41.708 -30.354 1.00 32.14  ? 247 ARG B CA  1 
ATOM   6048 C C   . ARG B 1 246 ? 1.556   -41.886 -31.875 1.00 34.96  ? 247 ARG B C   1 
ATOM   6049 O O   . ARG B 1 246 ? 2.668   -41.803 -32.402 1.00 32.99  ? 247 ARG B O   1 
ATOM   6050 C CB  . ARG B 1 246 ? 1.299   -43.067 -29.657 1.00 31.03  ? 247 ARG B CB  1 
ATOM   6051 C CG  . ARG B 1 246 ? 1.535   -42.999 -28.150 1.00 29.53  ? 247 ARG B CG  1 
ATOM   6052 C CD  . ARG B 1 246 ? 1.326   -44.350 -27.499 1.00 29.09  ? 247 ARG B CD  1 
ATOM   6053 N NE  . ARG B 1 246 ? 1.315   -44.274 -26.040 1.00 33.22  ? 247 ARG B NE  1 
ATOM   6054 C CZ  . ARG B 1 246 ? 1.269   -45.336 -25.239 1.00 32.87  ? 247 ARG B CZ  1 
ATOM   6055 N NH1 . ARG B 1 246 ? 1.241   -46.559 -25.758 1.00 31.95  ? 247 ARG B NH1 1 
ATOM   6056 N NH2 . ARG B 1 246 ? 1.257   -45.182 -23.920 1.00 30.84  ? 247 ARG B NH2 1 
ATOM   6057 N N   . ALA B 1 247 ? 0.446   -42.126 -32.565 1.00 28.19  ? 248 ALA B N   1 
ATOM   6058 C CA  . ALA B 1 247 ? 0.443   -42.257 -34.015 1.00 31.40  ? 248 ALA B CA  1 
ATOM   6059 C C   . ALA B 1 247 ? 1.006   -40.993 -34.616 1.00 37.25  ? 248 ALA B C   1 
ATOM   6060 O O   . ALA B 1 247 ? 1.911   -41.033 -35.451 1.00 30.61  ? 248 ALA B O   1 
ATOM   6061 C CB  . ALA B 1 247 ? -0.969  -42.483 -34.521 1.00 21.88  ? 248 ALA B CB  1 
ATOM   6062 N N   . THR B 1 248 ? 0.471   -39.870 -34.149 1.00 38.20  ? 249 THR B N   1 
ATOM   6063 C CA  . THR B 1 248 ? 0.805   -38.553 -34.674 1.00 38.14  ? 249 THR B CA  1 
ATOM   6064 C C   . THR B 1 248 ? 2.262   -38.196 -34.392 1.00 39.18  ? 249 THR B C   1 
ATOM   6065 O O   . THR B 1 248 ? 2.947   -37.600 -35.224 1.00 45.76  ? 249 THR B O   1 
ATOM   6066 C CB  . THR B 1 248 ? -0.146  -37.488 -34.085 1.00 35.81  ? 249 THR B CB  1 
ATOM   6067 O OG1 . THR B 1 248 ? -1.487  -37.763 -34.515 1.00 37.83  ? 249 THR B OG1 1 
ATOM   6068 C CG2 . THR B 1 248 ? 0.243   -36.098 -34.528 1.00 33.41  ? 249 THR B CG2 1 
ATOM   6069 N N   . GLN B 1 249 ? 2.739   -38.587 -33.220 1.00 36.40  ? 250 GLN B N   1 
ATOM   6070 C CA  . GLN B 1 249 ? 4.131   -38.361 -32.862 1.00 38.70  ? 250 GLN B CA  1 
ATOM   6071 C C   . GLN B 1 249 ? 5.081   -39.172 -33.751 1.00 41.72  ? 250 GLN B C   1 
ATOM   6072 O O   . GLN B 1 249 ? 6.148   -38.693 -34.124 1.00 37.73  ? 250 GLN B O   1 
ATOM   6073 C CB  . GLN B 1 249 ? 4.349   -38.689 -31.391 1.00 37.74  ? 250 GLN B CB  1 
ATOM   6074 C CG  . GLN B 1 249 ? 5.799   -38.847 -30.971 1.00 51.73  ? 250 GLN B CG  1 
ATOM   6075 C CD  . GLN B 1 249 ? 6.484   -37.532 -30.698 1.00 56.95  ? 250 GLN B CD  1 
ATOM   6076 O OE1 . GLN B 1 249 ? 6.226   -36.526 -31.363 1.00 52.58  ? 250 GLN B OE1 1 
ATOM   6077 N NE2 . GLN B 1 249 ? 7.367   -37.530 -29.705 1.00 60.82  ? 250 GLN B NE2 1 
ATOM   6078 N N   . LEU B 1 250 ? 4.689   -40.396 -34.090 1.00 36.05  ? 251 LEU B N   1 
ATOM   6079 C CA  . LEU B 1 250 ? 5.503   -41.236 -34.955 1.00 35.10  ? 251 LEU B CA  1 
ATOM   6080 C C   . LEU B 1 250 ? 5.576   -40.611 -36.344 1.00 39.43  ? 251 LEU B C   1 
ATOM   6081 O O   . LEU B 1 250 ? 6.655   -40.480 -36.916 1.00 36.23  ? 251 LEU B O   1 
ATOM   6082 C CB  . LEU B 1 250 ? 4.921   -42.646 -35.053 1.00 35.08  ? 251 LEU B CB  1 
ATOM   6083 C CG  . LEU B 1 250 ? 5.674   -43.600 -35.981 1.00 38.34  ? 251 LEU B CG  1 
ATOM   6084 C CD1 . LEU B 1 250 ? 7.036   -43.922 -35.407 1.00 28.23  ? 251 LEU B CD1 1 
ATOM   6085 C CD2 . LEU B 1 250 ? 4.883   -44.873 -36.247 1.00 30.80  ? 251 LEU B CD2 1 
ATOM   6086 N N   . ALA B 1 251 ? 4.418   -40.224 -36.873 1.00 35.20  ? 252 ALA B N   1 
ATOM   6087 C CA  . ALA B 1 251 ? 4.338   -39.588 -38.181 1.00 43.37  ? 252 ALA B CA  1 
ATOM   6088 C C   . ALA B 1 251 ? 5.253   -38.376 -38.205 1.00 44.48  ? 252 ALA B C   1 
ATOM   6089 O O   . ALA B 1 251 ? 6.058   -38.206 -39.122 1.00 41.22  ? 252 ALA B O   1 
ATOM   6090 C CB  . ALA B 1 251 ? 2.904   -39.189 -38.491 1.00 38.76  ? 252 ALA B CB  1 
ATOM   6091 N N   . HIS B 1 252 ? 5.149   -37.558 -37.165 1.00 43.56  ? 253 HIS B N   1 
ATOM   6092 C CA  . HIS B 1 252 ? 5.988   -36.381 -37.044 1.00 43.64  ? 253 HIS B CA  1 
ATOM   6093 C C   . HIS B 1 252 ? 7.473   -36.741 -37.064 1.00 40.10  ? 253 HIS B C   1 
ATOM   6094 O O   . HIS B 1 252 ? 8.269   -36.071 -37.717 1.00 49.96  ? 253 HIS B O   1 
ATOM   6095 C CB  . HIS B 1 252 ? 5.647   -35.608 -35.770 1.00 45.18  ? 253 HIS B CB  1 
ATOM   6096 C CG  . HIS B 1 252 ? 6.521   -34.415 -35.542 1.00 54.90  ? 253 HIS B CG  1 
ATOM   6097 N ND1 . HIS B 1 252 ? 6.292   -33.197 -36.149 1.00 55.98  ? 253 HIS B ND1 1 
ATOM   6098 C CD2 . HIS B 1 252 ? 7.633   -34.255 -34.786 1.00 57.72  ? 253 HIS B CD2 1 
ATOM   6099 C CE1 . HIS B 1 252 ? 7.221   -32.338 -35.770 1.00 59.90  ? 253 HIS B CE1 1 
ATOM   6100 N NE2 . HIS B 1 252 ? 8.048   -32.955 -34.944 1.00 68.22  ? 253 HIS B NE2 1 
ATOM   6101 N N   . LEU B 1 253 ? 7.840   -37.803 -36.354 1.00 45.36  ? 254 LEU B N   1 
ATOM   6102 C CA  . LEU B 1 253 ? 9.237   -38.226 -36.276 1.00 40.18  ? 254 LEU B CA  1 
ATOM   6103 C C   . LEU B 1 253 ? 9.815   -38.694 -37.620 1.00 48.00  ? 254 LEU B C   1 
ATOM   6104 O O   . LEU B 1 253 ? 11.025  -38.636 -37.833 1.00 44.33  ? 254 LEU B O   1 
ATOM   6105 C CB  . LEU B 1 253 ? 9.413   -39.314 -35.220 1.00 38.45  ? 254 LEU B CB  1 
ATOM   6106 C CG  . LEU B 1 253 ? 9.380   -38.855 -33.758 1.00 44.87  ? 254 LEU B CG  1 
ATOM   6107 C CD1 . LEU B 1 253 ? 9.386   -40.050 -32.820 1.00 39.27  ? 254 LEU B CD1 1 
ATOM   6108 C CD2 . LEU B 1 253 ? 10.551  -37.949 -33.463 1.00 34.31  ? 254 LEU B CD2 1 
ATOM   6109 N N   . VAL B 1 254 ? 8.952   -39.149 -38.525 1.00 37.15  ? 255 VAL B N   1 
ATOM   6110 C CA  . VAL B 1 254 ? 9.413   -39.644 -39.814 1.00 41.94  ? 255 VAL B CA  1 
ATOM   6111 C C   . VAL B 1 254 ? 9.020   -38.718 -40.972 1.00 43.93  ? 255 VAL B C   1 
ATOM   6112 O O   . VAL B 1 254 ? 9.034   -39.126 -42.126 1.00 45.23  ? 255 VAL B O   1 
ATOM   6113 C CB  . VAL B 1 254 ? 8.922   -41.087 -40.078 1.00 33.62  ? 255 VAL B CB  1 
ATOM   6114 C CG1 . VAL B 1 254 ? 9.390   -42.013 -38.966 1.00 35.68  ? 255 VAL B CG1 1 
ATOM   6115 C CG2 . VAL B 1 254 ? 7.408   -41.134 -40.205 1.00 37.57  ? 255 VAL B CG2 1 
ATOM   6116 N N   . GLY B 1 255 ? 8.660   -37.477 -40.647 1.00 44.76  ? 256 GLY B N   1 
ATOM   6117 C CA  . GLY B 1 255 ? 8.379   -36.465 -41.650 1.00 36.69  ? 256 GLY B CA  1 
ATOM   6118 C C   . GLY B 1 255 ? 6.959   -36.394 -42.193 1.00 49.17  ? 256 GLY B C   1 
ATOM   6119 O O   . GLY B 1 255 ? 6.750   -35.992 -43.336 1.00 61.13  ? 256 GLY B O   1 
ATOM   6120 N N   . CYS B 1 256 ? 5.976   -36.770 -41.388 1.00 41.28  ? 257 CYS B N   1 
ATOM   6121 C CA  . CYS B 1 256 ? 4.583   -36.708 -41.824 1.00 47.92  ? 257 CYS B CA  1 
ATOM   6122 C C   . CYS B 1 256 ? 3.728   -35.893 -40.853 1.00 60.31  ? 257 CYS B C   1 
ATOM   6123 O O   . CYS B 1 256 ? 3.742   -36.141 -39.652 1.00 65.73  ? 257 CYS B O   1 
ATOM   6124 C CB  . CYS B 1 256 ? 3.989   -38.110 -41.967 1.00 36.21  ? 257 CYS B CB  1 
ATOM   6125 S SG  . CYS B 1 256 ? 4.971   -39.245 -42.947 1.00 50.00  ? 257 CYS B SG  1 
ATOM   6126 N N   . PRO B 1 257 ? 2.981   -34.910 -41.374 1.00 79.91  ? 258 PRO B N   1 
ATOM   6127 C CA  . PRO B 1 257 ? 3.038   -34.532 -42.786 1.00 75.73  ? 258 PRO B CA  1 
ATOM   6128 C C   . PRO B 1 257 ? 4.188   -33.549 -42.963 1.00 82.87  ? 258 PRO B C   1 
ATOM   6129 O O   . PRO B 1 257 ? 4.705   -33.053 -41.953 1.00 69.45  ? 258 PRO B O   1 
ATOM   6130 C CB  . PRO B 1 257 ? 1.696   -33.837 -42.999 1.00 69.95  ? 258 PRO B CB  1 
ATOM   6131 C CG  . PRO B 1 257 ? 1.425   -33.186 -41.676 1.00 73.16  ? 258 PRO B CG  1 
ATOM   6132 C CD  . PRO B 1 257 ? 1.988   -34.113 -40.628 1.00 60.50  ? 258 PRO B CD  1 
ATOM   6133 N N   . PRO B 1 258 ? 4.604   -33.296 -44.215 1.00 86.06  ? 259 PRO B N   1 
ATOM   6134 C CA  . PRO B 1 258 ? 5.662   -32.314 -44.488 1.00 78.98  ? 259 PRO B CA  1 
ATOM   6135 C C   . PRO B 1 258 ? 5.185   -30.887 -44.228 1.00 69.62  ? 259 PRO B C   1 
ATOM   6136 O O   . PRO B 1 258 ? 5.611   -30.272 -43.249 1.00 70.08  ? 259 PRO B O   1 
ATOM   6137 C CB  . PRO B 1 258 ? 5.946   -32.510 -45.985 1.00 72.25  ? 259 PRO B CB  1 
ATOM   6138 C CG  . PRO B 1 258 ? 5.404   -33.869 -46.314 1.00 78.74  ? 259 PRO B CG  1 
ATOM   6139 C CD  . PRO B 1 258 ? 4.210   -34.033 -45.428 1.00 78.58  ? 259 PRO B CD  1 
ATOM   6140 N N   . THR B 1 261 ? 2.570   -31.968 -38.331 1.00 68.52  ? 262 THR B N   1 
ATOM   6141 C CA  . THR B 1 261 ? 1.845   -32.655 -37.260 1.00 82.00  ? 262 THR B CA  1 
ATOM   6142 C C   . THR B 1 261 ? 0.338   -32.696 -37.514 1.00 59.88  ? 262 THR B C   1 
ATOM   6143 O O   . THR B 1 261 ? -0.292  -31.666 -37.753 1.00 73.25  ? 262 THR B O   1 
ATOM   6144 C CB  . THR B 1 261 ? 2.116   -32.007 -35.878 1.00 79.49  ? 262 THR B CB  1 
ATOM   6145 O OG1 . THR B 1 261 ? 3.481   -32.229 -35.502 1.00 75.75  ? 262 THR B OG1 1 
ATOM   6146 C CG2 . THR B 1 261 ? 1.201   -32.599 -34.805 1.00 65.97  ? 262 THR B CG2 1 
ATOM   6147 N N   . GLY B 1 262 ? -0.232  -33.895 -37.469 1.00 58.85  ? 263 GLY B N   1 
ATOM   6148 C CA  . GLY B 1 262 ? -1.668  -34.061 -37.610 1.00 59.21  ? 263 GLY B CA  1 
ATOM   6149 C C   . GLY B 1 262 ? -2.184  -33.677 -38.983 1.00 65.60  ? 263 GLY B C   1 
ATOM   6150 O O   . GLY B 1 262 ? -1.518  -33.914 -39.993 1.00 65.87  ? 263 GLY B O   1 
ATOM   6151 N N   . GLY B 1 263 ? -3.373  -33.079 -39.019 1.00 67.01  ? 264 GLY B N   1 
ATOM   6152 C CA  . GLY B 1 263 ? -4.007  -32.693 -40.269 1.00 61.71  ? 264 GLY B CA  1 
ATOM   6153 C C   . GLY B 1 263 ? -5.001  -33.738 -40.743 1.00 60.02  ? 264 GLY B C   1 
ATOM   6154 O O   . GLY B 1 263 ? -5.548  -34.484 -39.929 1.00 55.50  ? 264 GLY B O   1 
ATOM   6155 N N   . ASN B 1 264 ? -5.243  -33.772 -42.053 1.00 49.71  ? 265 ASN B N   1 
ATOM   6156 C CA  . ASN B 1 264 ? -6.076  -34.794 -42.684 1.00 48.49  ? 265 ASN B CA  1 
ATOM   6157 C C   . ASN B 1 264 ? -5.543  -36.175 -42.310 1.00 49.84  ? 265 ASN B C   1 
ATOM   6158 O O   . ASN B 1 264 ? -4.377  -36.478 -42.581 1.00 46.40  ? 265 ASN B O   1 
ATOM   6159 C CB  . ASN B 1 264 ? -6.026  -34.613 -44.216 1.00 53.36  ? 265 ASN B CB  1 
ATOM   6160 C CG  . ASN B 1 264 ? -7.202  -35.267 -44.940 1.00 63.03  ? 265 ASN B CG  1 
ATOM   6161 O OD1 . ASN B 1 264 ? -7.708  -36.314 -44.519 1.00 60.00  ? 265 ASN B OD1 1 
ATOM   6162 N ND2 . ASN B 1 264 ? -7.644  -34.637 -46.043 1.00 74.61  ? 265 ASN B ND2 1 
ATOM   6163 N N   . ASP B 1 265 ? -6.371  -37.005 -41.676 1.00 35.31  ? 266 ASP B N   1 
ATOM   6164 C CA  . ASP B 1 265 ? -5.935  -38.360 -41.344 1.00 35.30  ? 266 ASP B CA  1 
ATOM   6165 C C   . ASP B 1 265 ? -5.546  -39.129 -42.614 1.00 42.84  ? 266 ASP B C   1 
ATOM   6166 O O   . ASP B 1 265 ? -4.488  -39.760 -42.667 1.00 38.35  ? 266 ASP B O   1 
ATOM   6167 C CB  . ASP B 1 265 ? -7.010  -39.125 -40.566 1.00 31.13  ? 266 ASP B CB  1 
ATOM   6168 C CG  . ASP B 1 265 ? -6.884  -38.963 -39.038 1.00 44.32  ? 266 ASP B CG  1 
ATOM   6169 O OD1 . ASP B 1 265 ? -5.835  -38.492 -38.539 1.00 36.36  ? 266 ASP B OD1 1 
ATOM   6170 O OD2 . ASP B 1 265 ? -7.850  -39.326 -38.329 1.00 42.30  ? 266 ASP B OD2 1 
ATOM   6171 N N   . THR B 1 266 ? -6.398  -39.056 -43.635 1.00 51.98  ? 267 THR B N   1 
ATOM   6172 C CA  . THR B 1 266 ? -6.151  -39.725 -44.913 1.00 42.15  ? 267 THR B CA  1 
ATOM   6173 C C   . THR B 1 266 ? -4.780  -39.370 -45.480 1.00 40.48  ? 267 THR B C   1 
ATOM   6174 O O   . THR B 1 266 ? -4.031  -40.241 -45.931 1.00 43.06  ? 267 THR B O   1 
ATOM   6175 C CB  . THR B 1 266 ? -7.236  -39.384 -45.950 1.00 41.48  ? 267 THR B CB  1 
ATOM   6176 O OG1 . THR B 1 266 ? -8.473  -39.997 -45.568 1.00 40.53  ? 267 THR B OG1 1 
ATOM   6177 C CG2 . THR B 1 266 ? -6.844  -39.905 -47.333 1.00 39.68  ? 267 THR B CG2 1 
ATOM   6178 N N   . GLU B 1 267 ? -4.444  -38.090 -45.427 1.00 40.83  ? 268 GLU B N   1 
ATOM   6179 C CA  . GLU B 1 267 ? -3.174  -37.623 -45.955 1.00 40.16  ? 268 GLU B CA  1 
ATOM   6180 C C   . GLU B 1 267 ? -2.003  -38.062 -45.079 1.00 42.44  ? 268 GLU B C   1 
ATOM   6181 O O   . GLU B 1 267 ? -0.958  -38.464 -45.589 1.00 42.87  ? 268 GLU B O   1 
ATOM   6182 C CB  . GLU B 1 267 ? -3.194  -36.102 -46.107 1.00 50.50  ? 268 GLU B CB  1 
ATOM   6183 C CG  . GLU B 1 267 ? -1.868  -35.502 -46.539 1.00 73.04  ? 268 GLU B CG  1 
ATOM   6184 C CD  . GLU B 1 267 ? -1.680  -34.087 -46.023 1.00 99.93  ? 268 GLU B CD  1 
ATOM   6185 O OE1 . GLU B 1 267 ? -2.696  -33.433 -45.699 1.00 105.50 ? 268 GLU B OE1 1 
ATOM   6186 O OE2 . GLU B 1 267 ? -0.516  -33.634 -45.930 1.00 100.35 ? 268 GLU B OE2 1 
ATOM   6187 N N   . LEU B 1 268 ? -2.176  -37.985 -43.761 1.00 52.19  ? 269 LEU B N   1 
ATOM   6188 C CA  . LEU B 1 268 ? -1.120  -38.383 -42.831 1.00 38.83  ? 269 LEU B CA  1 
ATOM   6189 C C   . LEU B 1 268 ? -0.798  -39.865 -42.994 1.00 36.64  ? 269 LEU B C   1 
ATOM   6190 O O   . LEU B 1 268 ? 0.367   -40.259 -43.019 1.00 35.41  ? 269 LEU B O   1 
ATOM   6191 C CB  . LEU B 1 268 ? -1.513  -38.069 -41.387 1.00 40.00  ? 269 LEU B CB  1 
ATOM   6192 C CG  . LEU B 1 268 ? -0.444  -38.294 -40.316 1.00 44.89  ? 269 LEU B CG  1 
ATOM   6193 C CD1 . LEU B 1 268 ? -0.579  -37.264 -39.230 1.00 56.35  ? 269 LEU B CD1 1 
ATOM   6194 C CD2 . LEU B 1 268 ? -0.578  -39.673 -39.721 1.00 44.17  ? 269 LEU B CD2 1 
ATOM   6195 N N   . VAL B 1 269 ? -1.830  -40.687 -43.129 1.00 27.49  ? 270 VAL B N   1 
ATOM   6196 C CA  . VAL B 1 269 ? -1.599  -42.111 -43.289 1.00 39.25  ? 270 VAL B CA  1 
ATOM   6197 C C   . VAL B 1 269 ? -0.931  -42.397 -44.635 1.00 44.58  ? 270 VAL B C   1 
ATOM   6198 O O   . VAL B 1 269 ? -0.016  -43.220 -44.721 1.00 47.00  ? 270 VAL B O   1 
ATOM   6199 C CB  . VAL B 1 269 ? -2.891  -42.930 -43.104 1.00 38.81  ? 270 VAL B CB  1 
ATOM   6200 C CG1 . VAL B 1 269 ? -2.637  -44.391 -43.412 1.00 36.52  ? 270 VAL B CG1 1 
ATOM   6201 C CG2 . VAL B 1 269 ? -3.403  -42.779 -41.671 1.00 44.16  ? 270 VAL B CG2 1 
ATOM   6202 N N   . ALA B 1 270 ? -1.365  -41.695 -45.676 1.00 41.37  ? 271 ALA B N   1 
ATOM   6203 C CA  . ALA B 1 270 ? -0.770  -41.869 -47.000 1.00 37.03  ? 271 ALA B CA  1 
ATOM   6204 C C   . ALA B 1 270 ? 0.723   -41.571 -46.972 1.00 32.35  ? 271 ALA B C   1 
ATOM   6205 O O   . ALA B 1 270 ? 1.508   -42.290 -47.576 1.00 41.97  ? 271 ALA B O   1 
ATOM   6206 C CB  . ALA B 1 270 ? -1.466  -41.006 -48.021 1.00 32.09  ? 271 ALA B CB  1 
ATOM   6207 N N   . CYS B 1 271 ? 1.116   -40.525 -46.252 1.00 37.99  ? 272 CYS B N   1 
ATOM   6208 C CA  . CYS B 1 271 ? 2.534   -40.224 -46.089 1.00 32.19  ? 272 CYS B CA  1 
ATOM   6209 C C   . CYS B 1 271 ? 3.268   -41.321 -45.291 1.00 48.10  ? 272 CYS B C   1 
ATOM   6210 O O   . CYS B 1 271 ? 4.399   -41.674 -45.632 1.00 47.90  ? 272 CYS B O   1 
ATOM   6211 C CB  . CYS B 1 271 ? 2.745   -38.831 -45.471 1.00 31.73  ? 272 CYS B CB  1 
ATOM   6212 S SG  . CYS B 1 271 ? 4.415   -38.549 -44.806 1.00 68.63  ? 272 CYS B SG  1 
ATOM   6213 N N   . LEU B 1 272 ? 2.635   -41.864 -44.248 1.00 38.99  ? 273 LEU B N   1 
ATOM   6214 C CA  . LEU B 1 272 ? 3.237   -42.976 -43.502 1.00 41.98  ? 273 LEU B CA  1 
ATOM   6215 C C   . LEU B 1 272 ? 3.407   -44.193 -44.406 1.00 40.74  ? 273 LEU B C   1 
ATOM   6216 O O   . LEU B 1 272 ? 4.402   -44.912 -44.314 1.00 35.77  ? 273 LEU B O   1 
ATOM   6217 C CB  . LEU B 1 272 ? 2.406   -43.361 -42.268 1.00 32.27  ? 273 LEU B CB  1 
ATOM   6218 C CG  . LEU B 1 272 ? 2.511   -42.498 -41.014 1.00 33.64  ? 273 LEU B CG  1 
ATOM   6219 C CD1 . LEU B 1 272 ? 1.432   -42.908 -40.030 1.00 44.22  ? 273 LEU B CD1 1 
ATOM   6220 C CD2 . LEU B 1 272 ? 3.884   -42.609 -40.372 1.00 31.51  ? 273 LEU B CD2 1 
ATOM   6221 N N   . ARG B 1 273 ? 2.444   -44.410 -45.296 1.00 34.14  ? 274 ARG B N   1 
ATOM   6222 C CA  . ARG B 1 273 ? 2.499   -45.566 -46.189 1.00 45.57  ? 274 ARG B CA  1 
ATOM   6223 C C   . ARG B 1 273 ? 3.674   -45.536 -47.164 1.00 41.99  ? 274 ARG B C   1 
ATOM   6224 O O   . ARG B 1 273 ? 4.008   -46.564 -47.747 1.00 37.00  ? 274 ARG B O   1 
ATOM   6225 C CB  . ARG B 1 273 ? 1.171   -45.778 -46.932 1.00 24.96  ? 274 ARG B CB  1 
ATOM   6226 C CG  . ARG B 1 273 ? 0.081   -46.335 -46.021 1.00 38.28  ? 274 ARG B CG  1 
ATOM   6227 C CD  . ARG B 1 273 ? -1.072  -46.942 -46.787 1.00 27.54  ? 274 ARG B CD  1 
ATOM   6228 N NE  . ARG B 1 273 ? -2.233  -46.068 -46.783 1.00 49.42  ? 274 ARG B NE  1 
ATOM   6229 C CZ  . ARG B 1 273 ? -3.368  -46.322 -46.137 1.00 56.06  ? 274 ARG B CZ  1 
ATOM   6230 N NH1 . ARG B 1 273 ? -3.516  -47.442 -45.437 1.00 44.62  ? 274 ARG B NH1 1 
ATOM   6231 N NH2 . ARG B 1 273 ? -4.365  -45.452 -46.199 1.00 55.43  ? 274 ARG B NH2 1 
ATOM   6232 N N   . THR B 1 274 ? 4.312   -44.375 -47.318 1.00 37.12  ? 275 THR B N   1 
ATOM   6233 C CA  . THR B 1 274 ? 5.429   -44.250 -48.252 1.00 43.78  ? 275 THR B CA  1 
ATOM   6234 C C   . THR B 1 274 ? 6.759   -44.456 -47.554 1.00 41.83  ? 275 THR B C   1 
ATOM   6235 O O   . THR B 1 274 ? 7.799   -44.541 -48.201 1.00 49.74  ? 275 THR B O   1 
ATOM   6236 C CB  . THR B 1 274 ? 5.464   -42.874 -48.959 1.00 36.74  ? 275 THR B CB  1 
ATOM   6237 O OG1 . THR B 1 274 ? 5.999   -41.875 -48.074 1.00 34.59  ? 275 THR B OG1 1 
ATOM   6238 C CG2 . THR B 1 274 ? 4.075   -42.475 -49.434 1.00 29.33  ? 275 THR B CG2 1 
ATOM   6239 N N   . ARG B 1 275 ? 6.724   -44.522 -46.229 1.00 42.26  ? 276 ARG B N   1 
ATOM   6240 C CA  . ARG B 1 275 ? 7.934   -44.721 -45.440 1.00 38.87  ? 276 ARG B CA  1 
ATOM   6241 C C   . ARG B 1 275 ? 8.336   -46.193 -45.414 1.00 39.00  ? 276 ARG B C   1 
ATOM   6242 O O   . ARG B 1 275 ? 7.488   -47.074 -45.244 1.00 37.05  ? 276 ARG B O   1 
ATOM   6243 C CB  . ARG B 1 275 ? 7.718   -44.204 -44.018 1.00 41.84  ? 276 ARG B CB  1 
ATOM   6244 C CG  . ARG B 1 275 ? 7.489   -42.698 -43.946 1.00 45.64  ? 276 ARG B CG  1 
ATOM   6245 C CD  . ARG B 1 275 ? 8.770   -41.957 -44.286 1.00 37.40  ? 276 ARG B CD  1 
ATOM   6246 N NE  . ARG B 1 275 ? 8.628   -40.503 -44.261 1.00 46.64  ? 276 ARG B NE  1 
ATOM   6247 C CZ  . ARG B 1 275 ? 8.071   -39.773 -45.229 1.00 49.14  ? 276 ARG B CZ  1 
ATOM   6248 N NH1 . ARG B 1 275 ? 7.556   -40.347 -46.316 1.00 44.20  ? 276 ARG B NH1 1 
ATOM   6249 N NH2 . ARG B 1 275 ? 8.013   -38.457 -45.097 1.00 38.54  ? 276 ARG B NH2 1 
ATOM   6250 N N   . PRO B 1 276 ? 9.633   -46.468 -45.597 1.00 42.47  ? 277 PRO B N   1 
ATOM   6251 C CA  . PRO B 1 276 ? 10.087  -47.860 -45.524 1.00 35.51  ? 277 PRO B CA  1 
ATOM   6252 C C   . PRO B 1 276 ? 9.765   -48.431 -44.144 1.00 43.63  ? 277 PRO B C   1 
ATOM   6253 O O   . PRO B 1 276 ? 9.915   -47.721 -43.137 1.00 32.67  ? 277 PRO B O   1 
ATOM   6254 C CB  . PRO B 1 276 ? 11.608  -47.747 -45.701 1.00 41.24  ? 277 PRO B CB  1 
ATOM   6255 C CG  . PRO B 1 276 ? 11.841  -46.401 -46.325 1.00 39.46  ? 277 PRO B CG  1 
ATOM   6256 C CD  . PRO B 1 276 ? 10.746  -45.523 -45.794 1.00 45.02  ? 277 PRO B CD  1 
ATOM   6257 N N   . ALA B 1 277 ? 9.316   -49.683 -44.110 1.00 34.66  ? 278 ALA B N   1 
ATOM   6258 C CA  . ALA B 1 277 ? 8.982   -50.362 -42.861 1.00 35.85  ? 278 ALA B CA  1 
ATOM   6259 C C   . ALA B 1 277 ? 10.030  -50.151 -41.772 1.00 37.31  ? 278 ALA B C   1 
ATOM   6260 O O   . ALA B 1 277 ? 9.696   -49.781 -40.637 1.00 35.43  ? 278 ALA B O   1 
ATOM   6261 C CB  . ALA B 1 277 ? 8.765   -51.840 -43.110 1.00 34.17  ? 278 ALA B CB  1 
ATOM   6262 N N   . GLN B 1 278 ? 11.297  -50.353 -42.122 1.00 35.48  ? 279 GLN B N   1 
ATOM   6263 C CA  . GLN B 1 278 ? 12.372  -50.252 -41.136 1.00 37.04  ? 279 GLN B CA  1 
ATOM   6264 C C   . GLN B 1 278 ? 12.453  -48.854 -40.528 1.00 37.67  ? 279 GLN B C   1 
ATOM   6265 O O   . GLN B 1 278 ? 12.829  -48.700 -39.372 1.00 42.33  ? 279 GLN B O   1 
ATOM   6266 C CB  . GLN B 1 278 ? 13.717  -50.654 -41.749 1.00 31.51  ? 279 GLN B CB  1 
ATOM   6267 C CG  . GLN B 1 278 ? 14.823  -50.836 -40.721 1.00 35.95  ? 279 GLN B CG  1 
ATOM   6268 C CD  . GLN B 1 278 ? 14.537  -51.965 -39.730 1.00 45.88  ? 279 GLN B CD  1 
ATOM   6269 O OE1 . GLN B 1 278 ? 14.216  -53.088 -40.125 1.00 43.47  ? 279 GLN B OE1 1 
ATOM   6270 N NE2 . GLN B 1 278 ? 14.649  -51.663 -38.435 1.00 33.30  ? 279 GLN B NE2 1 
ATOM   6271 N N   . VAL B 1 279 ? 12.090  -47.838 -41.304 1.00 34.88  ? 280 VAL B N   1 
ATOM   6272 C CA  . VAL B 1 279 ? 12.116  -46.466 -40.799 1.00 41.17  ? 280 VAL B CA  1 
ATOM   6273 C C   . VAL B 1 279 ? 11.111  -46.272 -39.659 1.00 41.22  ? 280 VAL B C   1 
ATOM   6274 O O   . VAL B 1 279 ? 11.427  -45.645 -38.639 1.00 36.60  ? 280 VAL B O   1 
ATOM   6275 C CB  . VAL B 1 279 ? 11.854  -45.439 -41.922 1.00 40.90  ? 280 VAL B CB  1 
ATOM   6276 C CG1 . VAL B 1 279 ? 11.568  -44.066 -41.345 1.00 31.87  ? 280 VAL B CG1 1 
ATOM   6277 C CG2 . VAL B 1 279 ? 13.036  -45.383 -42.864 1.00 42.39  ? 280 VAL B CG2 1 
ATOM   6278 N N   . LEU B 1 280 ? 9.906   -46.811 -39.828 1.00 28.65  ? 281 LEU B N   1 
ATOM   6279 C CA  . LEU B 1 280 ? 8.917   -46.747 -38.758 1.00 37.51  ? 281 LEU B CA  1 
ATOM   6280 C C   . LEU B 1 280 ? 9.446   -47.459 -37.505 1.00 32.36  ? 281 LEU B C   1 
ATOM   6281 O O   . LEU B 1 280 ? 9.433   -46.896 -36.407 1.00 37.42  ? 281 LEU B O   1 
ATOM   6282 C CB  . LEU B 1 280 ? 7.587   -47.348 -39.206 1.00 25.66  ? 281 LEU B CB  1 
ATOM   6283 C CG  . LEU B 1 280 ? 6.915   -46.697 -40.404 1.00 28.44  ? 281 LEU B CG  1 
ATOM   6284 C CD1 . LEU B 1 280 ? 5.517   -47.248 -40.576 1.00 33.00  ? 281 LEU B CD1 1 
ATOM   6285 C CD2 . LEU B 1 280 ? 6.885   -45.184 -40.266 1.00 25.42  ? 281 LEU B CD2 1 
ATOM   6286 N N   . VAL B 1 281 ? 9.941   -48.681 -37.691 1.00 33.31  ? 282 VAL B N   1 
ATOM   6287 C CA  . VAL B 1 281 ? 10.493  -49.483 -36.601 1.00 36.52  ? 282 VAL B CA  1 
ATOM   6288 C C   . VAL B 1 281 ? 11.595  -48.763 -35.831 1.00 38.46  ? 282 VAL B C   1 
ATOM   6289 O O   . VAL B 1 281 ? 11.658  -48.839 -34.606 1.00 44.82  ? 282 VAL B O   1 
ATOM   6290 C CB  . VAL B 1 281 ? 11.023  -50.835 -37.122 1.00 34.29  ? 282 VAL B CB  1 
ATOM   6291 C CG1 . VAL B 1 281 ? 11.785  -51.565 -36.043 1.00 29.74  ? 282 VAL B CG1 1 
ATOM   6292 C CG2 . VAL B 1 281 ? 9.868   -51.690 -37.621 1.00 29.56  ? 282 VAL B CG2 1 
ATOM   6293 N N   . ASN B 1 282 ? 12.456  -48.053 -36.546 1.00 47.83  ? 283 ASN B N   1 
ATOM   6294 C CA  . ASN B 1 282 ? 13.570  -47.360 -35.907 1.00 34.96  ? 283 ASN B CA  1 
ATOM   6295 C C   . ASN B 1 282 ? 13.146  -46.233 -34.983 1.00 38.15  ? 283 ASN B C   1 
ATOM   6296 O O   . ASN B 1 282 ? 13.907  -45.849 -34.100 1.00 33.57  ? 283 ASN B O   1 
ATOM   6297 C CB  . ASN B 1 282 ? 14.555  -46.832 -36.952 1.00 32.24  ? 283 ASN B CB  1 
ATOM   6298 C CG  . ASN B 1 282 ? 15.195  -47.948 -37.757 1.00 48.67  ? 283 ASN B CG  1 
ATOM   6299 O OD1 . ASN B 1 282 ? 15.422  -49.050 -37.247 1.00 40.37  ? 283 ASN B OD1 1 
ATOM   6300 N ND2 . ASN B 1 282 ? 15.467  -47.678 -39.029 1.00 44.84  ? 283 ASN B ND2 1 
ATOM   6301 N N   . HIS B 1 283 ? 11.942  -45.698 -35.181 1.00 37.77  ? 284 HIS B N   1 
ATOM   6302 C CA  . HIS B 1 283 ? 11.474  -44.579 -34.358 1.00 38.73  ? 284 HIS B CA  1 
ATOM   6303 C C   . HIS B 1 283 ? 10.416  -44.985 -33.339 1.00 46.26  ? 284 HIS B C   1 
ATOM   6304 O O   . HIS B 1 283 ? 9.982   -44.168 -32.533 1.00 44.22  ? 284 HIS B O   1 
ATOM   6305 C CB  . HIS B 1 283 ? 10.925  -43.449 -35.229 1.00 32.29  ? 284 HIS B CB  1 
ATOM   6306 C CG  . HIS B 1 283 ? 11.958  -42.794 -36.093 1.00 50.30  ? 284 HIS B CG  1 
ATOM   6307 N ND1 . HIS B 1 283 ? 12.261  -43.242 -37.363 1.00 46.47  ? 284 HIS B ND1 1 
ATOM   6308 C CD2 . HIS B 1 283 ? 12.760  -41.726 -35.868 1.00 36.12  ? 284 HIS B CD2 1 
ATOM   6309 C CE1 . HIS B 1 283 ? 13.202  -42.475 -37.884 1.00 40.75  ? 284 HIS B CE1 1 
ATOM   6310 N NE2 . HIS B 1 283 ? 13.522  -41.548 -36.998 1.00 52.08  ? 284 HIS B NE2 1 
ATOM   6311 N N   . GLU B 1 284 ? 10.016  -46.251 -33.382 1.00 43.21  ? 285 GLU B N   1 
ATOM   6312 C CA  . GLU B 1 284 ? 8.920   -46.767 -32.572 1.00 46.07  ? 285 GLU B CA  1 
ATOM   6313 C C   . GLU B 1 284 ? 9.023   -46.424 -31.081 1.00 48.55  ? 285 GLU B C   1 
ATOM   6314 O O   . GLU B 1 284 ? 8.060   -45.951 -30.471 1.00 45.98  ? 285 GLU B O   1 
ATOM   6315 C CB  . GLU B 1 284 ? 8.841   -48.279 -32.743 1.00 50.06  ? 285 GLU B CB  1 
ATOM   6316 C CG  . GLU B 1 284 ? 7.596   -48.898 -32.160 1.00 61.92  ? 285 GLU B CG  1 
ATOM   6317 C CD  . GLU B 1 284 ? 7.747   -50.386 -31.958 1.00 63.12  ? 285 GLU B CD  1 
ATOM   6318 O OE1 . GLU B 1 284 ? 7.817   -51.114 -32.973 1.00 43.56  ? 285 GLU B OE1 1 
ATOM   6319 O OE2 . GLU B 1 284 ? 7.810   -50.818 -30.783 1.00 60.23  ? 285 GLU B OE2 1 
ATOM   6320 N N   . TRP B 1 285 ? 10.195  -46.646 -30.503 1.00 46.21  ? 286 TRP B N   1 
ATOM   6321 C CA  . TRP B 1 285 ? 10.379  -46.452 -29.069 1.00 58.27  ? 286 TRP B CA  1 
ATOM   6322 C C   . TRP B 1 285 ? 10.275  -45.000 -28.614 1.00 55.87  ? 286 TRP B C   1 
ATOM   6323 O O   . TRP B 1 285 ? 10.013  -44.731 -27.443 1.00 57.89  ? 286 TRP B O   1 
ATOM   6324 C CB  . TRP B 1 285 ? 11.707  -47.056 -28.621 1.00 47.20  ? 286 TRP B CB  1 
ATOM   6325 C CG  . TRP B 1 285 ? 11.647  -48.555 -28.523 1.00 70.12  ? 286 TRP B CG  1 
ATOM   6326 C CD1 . TRP B 1 285 ? 12.223  -49.460 -29.370 1.00 55.33  ? 286 TRP B CD1 1 
ATOM   6327 C CD2 . TRP B 1 285 ? 10.949  -49.322 -27.531 1.00 72.00  ? 286 TRP B CD2 1 
ATOM   6328 N NE1 . TRP B 1 285 ? 11.939  -50.742 -28.958 1.00 58.13  ? 286 TRP B NE1 1 
ATOM   6329 C CE2 . TRP B 1 285 ? 11.160  -50.685 -27.832 1.00 63.69  ? 286 TRP B CE2 1 
ATOM   6330 C CE3 . TRP B 1 285 ? 10.174  -48.987 -26.412 1.00 62.64  ? 286 TRP B CE3 1 
ATOM   6331 C CZ2 . TRP B 1 285 ? 10.623  -51.713 -27.057 1.00 59.44  ? 286 TRP B CZ2 1 
ATOM   6332 C CZ3 . TRP B 1 285 ? 9.639   -50.011 -25.642 1.00 59.14  ? 286 TRP B CZ3 1 
ATOM   6333 C CH2 . TRP B 1 285 ? 9.868   -51.357 -25.968 1.00 62.99  ? 286 TRP B CH2 1 
ATOM   6334 N N   . HIS B 1 286 ? 10.444  -44.075 -29.553 1.00 51.84  ? 287 HIS B N   1 
ATOM   6335 C CA  . HIS B 1 286 ? 10.554  -42.659 -29.234 1.00 45.62  ? 287 HIS B CA  1 
ATOM   6336 C C   . HIS B 1 286 ? 9.220   -41.953 -29.011 1.00 46.14  ? 287 HIS B C   1 
ATOM   6337 O O   . HIS B 1 286 ? 9.201   -40.760 -28.734 1.00 60.85  ? 287 HIS B O   1 
ATOM   6338 C CB  . HIS B 1 286 ? 11.345  -41.936 -30.329 1.00 54.73  ? 287 HIS B CB  1 
ATOM   6339 C CG  . HIS B 1 286 ? 12.705  -42.514 -30.571 1.00 64.84  ? 287 HIS B CG  1 
ATOM   6340 N ND1 . HIS B 1 286 ? 13.441  -43.127 -29.578 1.00 77.78  ? 287 HIS B ND1 1 
ATOM   6341 C CD2 . HIS B 1 286 ? 13.461  -42.581 -31.693 1.00 63.81  ? 287 HIS B CD2 1 
ATOM   6342 C CE1 . HIS B 1 286 ? 14.592  -43.542 -30.076 1.00 64.61  ? 287 HIS B CE1 1 
ATOM   6343 N NE2 . HIS B 1 286 ? 14.628  -43.225 -31.359 1.00 72.56  ? 287 HIS B NE2 1 
ATOM   6344 N N   . VAL B 1 287 ? 8.104   -42.666 -29.115 1.00 47.06  ? 288 VAL B N   1 
ATOM   6345 C CA  . VAL B 1 287 ? 6.808   -42.004 -28.945 1.00 41.61  ? 288 VAL B CA  1 
ATOM   6346 C C   . VAL B 1 287 ? 6.194   -42.158 -27.552 1.00 49.11  ? 288 VAL B C   1 
ATOM   6347 O O   . VAL B 1 287 ? 5.166   -41.542 -27.257 1.00 47.01  ? 288 VAL B O   1 
ATOM   6348 C CB  . VAL B 1 287 ? 5.772   -42.433 -30.021 1.00 43.23  ? 288 VAL B CB  1 
ATOM   6349 C CG1 . VAL B 1 287 ? 6.401   -42.414 -31.410 1.00 46.81  ? 288 VAL B CG1 1 
ATOM   6350 C CG2 . VAL B 1 287 ? 5.199   -43.798 -29.711 1.00 29.26  ? 288 VAL B CG2 1 
ATOM   6351 N N   . LEU B 1 288 ? 6.812   -42.972 -26.700 1.00 51.83  ? 289 LEU B N   1 
ATOM   6352 C CA  . LEU B 1 288 ? 6.296   -43.174 -25.343 1.00 53.71  ? 289 LEU B CA  1 
ATOM   6353 C C   . LEU B 1 288 ? 6.444   -41.909 -24.501 1.00 62.31  ? 289 LEU B C   1 
ATOM   6354 O O   . LEU B 1 288 ? 7.493   -41.259 -24.536 1.00 55.44  ? 289 LEU B O   1 
ATOM   6355 C CB  . LEU B 1 288 ? 6.995   -44.347 -24.655 1.00 45.57  ? 289 LEU B CB  1 
ATOM   6356 C CG  . LEU B 1 288 ? 6.517   -45.738 -25.063 1.00 43.55  ? 289 LEU B CG  1 
ATOM   6357 C CD1 . LEU B 1 288 ? 7.367   -46.818 -24.400 1.00 40.17  ? 289 LEU B CD1 1 
ATOM   6358 C CD2 . LEU B 1 288 ? 5.047   -45.907 -24.728 1.00 31.06  ? 289 LEU B CD2 1 
ATOM   6359 N N   . PRO B 1 289 ? 5.392   -41.570 -23.730 1.00 65.71  ? 290 PRO B N   1 
ATOM   6360 C CA  . PRO B 1 289 ? 5.291   -40.330 -22.945 1.00 65.42  ? 290 PRO B CA  1 
ATOM   6361 C C   . PRO B 1 289 ? 6.390   -40.150 -21.887 1.00 69.08  ? 290 PRO B C   1 
ATOM   6362 O O   . PRO B 1 289 ? 6.919   -39.045 -21.766 1.00 79.84  ? 290 PRO B O   1 
ATOM   6363 C CB  . PRO B 1 289 ? 3.905   -40.434 -22.289 1.00 57.17  ? 290 PRO B CB  1 
ATOM   6364 C CG  . PRO B 1 289 ? 3.573   -41.887 -22.303 1.00 54.97  ? 290 PRO B CG  1 
ATOM   6365 C CD  . PRO B 1 289 ? 4.203   -42.426 -23.556 1.00 61.04  ? 290 PRO B CD  1 
ATOM   6366 N N   . GLN B 1 290 ? 6.727   -41.199 -21.142 1.00 59.59  ? 291 GLN B N   1 
ATOM   6367 C CA  . GLN B 1 290 ? 7.812   -41.109 -20.159 1.00 73.38  ? 291 GLN B CA  1 
ATOM   6368 C C   . GLN B 1 290 ? 8.702   -42.353 -20.183 1.00 65.73  ? 291 GLN B C   1 
ATOM   6369 O O   . GLN B 1 290 ? 8.353   -43.363 -20.800 1.00 60.50  ? 291 GLN B O   1 
ATOM   6370 C CB  . GLN B 1 290 ? 7.269   -40.860 -18.738 1.00 62.88  ? 291 GLN B CB  1 
ATOM   6371 C CG  . GLN B 1 290 ? 6.664   -42.085 -18.051 1.00 67.77  ? 291 GLN B CG  1 
ATOM   6372 C CD  . GLN B 1 290 ? 6.645   -41.975 -16.513 1.00 91.27  ? 291 GLN B CD  1 
ATOM   6373 O OE1 . GLN B 1 290 ? 5.735   -41.372 -15.929 1.00 84.82  ? 291 GLN B OE1 1 
ATOM   6374 N NE2 . GLN B 1 290 ? 7.645   -42.576 -15.858 1.00 63.22  ? 291 GLN B NE2 1 
ATOM   6375 N N   . GLU B 1 291 ? 9.853   -42.270 -19.519 1.00 64.12  ? 292 GLU B N   1 
ATOM   6376 C CA  . GLU B 1 291 ? 10.739  -43.423 -19.378 1.00 65.74  ? 292 GLU B CA  1 
ATOM   6377 C C   . GLU B 1 291 ? 10.110  -44.466 -18.462 1.00 60.95  ? 292 GLU B C   1 
ATOM   6378 O O   . GLU B 1 291 ? 9.624   -44.142 -17.378 1.00 55.66  ? 292 GLU B O   1 
ATOM   6379 C CB  . GLU B 1 291 ? 12.115  -43.004 -18.854 1.00 72.63  ? 292 GLU B CB  1 
ATOM   6380 C CG  . GLU B 1 291 ? 12.998  -42.346 -19.908 1.00 92.98  ? 292 GLU B CG  1 
ATOM   6381 C CD  . GLU B 1 291 ? 13.222  -43.227 -21.134 1.00 89.41  ? 292 GLU B CD  1 
ATOM   6382 O OE1 . GLU B 1 291 ? 13.251  -44.473 -20.993 1.00 83.91  ? 292 GLU B OE1 1 
ATOM   6383 O OE2 . GLU B 1 291 ? 13.368  -42.669 -22.242 1.00 91.16  ? 292 GLU B OE2 1 
ATOM   6384 N N   . SER B 1 292 ? 10.129  -45.720 -18.898 1.00 43.45  ? 293 SER B N   1 
ATOM   6385 C CA  . SER B 1 292 ? 9.353   -46.750 -18.235 1.00 39.76  ? 293 SER B CA  1 
ATOM   6386 C C   . SER B 1 292 ? 9.866   -48.151 -18.527 1.00 38.76  ? 293 SER B C   1 
ATOM   6387 O O   . SER B 1 292 ? 10.724  -48.353 -19.381 1.00 46.57  ? 293 SER B O   1 
ATOM   6388 C CB  . SER B 1 292 ? 7.897   -46.652 -18.689 1.00 39.64  ? 293 SER B CB  1 
ATOM   6389 O OG  . SER B 1 292 ? 7.812   -46.790 -20.098 1.00 41.75  ? 293 SER B OG  1 
ATOM   6390 N N   . VAL B 1 293 ? 9.329   -49.117 -17.795 1.00 38.74  ? 294 VAL B N   1 
ATOM   6391 C CA  . VAL B 1 293 ? 9.477   -50.524 -18.139 1.00 29.65  ? 294 VAL B CA  1 
ATOM   6392 C C   . VAL B 1 293 ? 8.063   -51.073 -18.283 1.00 37.58  ? 294 VAL B C   1 
ATOM   6393 O O   . VAL B 1 293 ? 7.111   -50.508 -17.727 1.00 36.57  ? 294 VAL B O   1 
ATOM   6394 C CB  . VAL B 1 293 ? 10.250  -51.309 -17.057 1.00 42.88  ? 294 VAL B CB  1 
ATOM   6395 C CG1 . VAL B 1 293 ? 11.692  -50.807 -16.959 1.00 40.25  ? 294 VAL B CG1 1 
ATOM   6396 C CG2 . VAL B 1 293 ? 9.554   -51.193 -15.713 1.00 32.49  ? 294 VAL B CG2 1 
ATOM   6397 N N   . PHE B 1 294 ? 7.919   -52.145 -19.054 1.00 25.84  ? 295 PHE B N   1 
ATOM   6398 C CA  . PHE B 1 294 ? 6.615   -52.758 -19.269 1.00 33.15  ? 295 PHE B CA  1 
ATOM   6399 C C   . PHE B 1 294 ? 5.597   -51.782 -19.900 1.00 31.10  ? 295 PHE B C   1 
ATOM   6400 O O   . PHE B 1 294 ? 4.404   -51.850 -19.616 1.00 33.53  ? 295 PHE B O   1 
ATOM   6401 C CB  . PHE B 1 294 ? 6.091   -53.354 -17.945 1.00 30.77  ? 295 PHE B CB  1 
ATOM   6402 C CG  . PHE B 1 294 ? 5.507   -54.735 -18.087 1.00 28.98  ? 295 PHE B CG  1 
ATOM   6403 C CD1 . PHE B 1 294 ? 4.550   -55.004 -19.058 1.00 30.51  ? 295 PHE B CD1 1 
ATOM   6404 C CD2 . PHE B 1 294 ? 5.927   -55.766 -17.258 1.00 26.72  ? 295 PHE B CD2 1 
ATOM   6405 C CE1 . PHE B 1 294 ? 4.007   -56.269 -19.189 1.00 22.75  ? 295 PHE B CE1 1 
ATOM   6406 C CE2 . PHE B 1 294 ? 5.392   -57.039 -17.385 1.00 28.45  ? 295 PHE B CE2 1 
ATOM   6407 C CZ  . PHE B 1 294 ? 4.437   -57.294 -18.353 1.00 28.46  ? 295 PHE B CZ  1 
ATOM   6408 N N   . ARG B 1 295 ? 6.075   -50.867 -20.744 1.00 24.18  ? 296 ARG B N   1 
ATOM   6409 C CA  . ARG B 1 295 ? 5.177   -50.033 -21.551 1.00 25.98  ? 296 ARG B CA  1 
ATOM   6410 C C   . ARG B 1 295 ? 5.589   -50.065 -23.017 1.00 31.31  ? 296 ARG B C   1 
ATOM   6411 O O   . ARG B 1 295 ? 6.765   -49.941 -23.356 1.00 32.71  ? 296 ARG B O   1 
ATOM   6412 C CB  . ARG B 1 295 ? 5.136   -48.587 -21.056 1.00 26.41  ? 296 ARG B CB  1 
ATOM   6413 C CG  . ARG B 1 295 ? 4.525   -48.409 -19.677 1.00 32.42  ? 296 ARG B CG  1 
ATOM   6414 C CD  . ARG B 1 295 ? 3.055   -48.822 -19.643 1.00 31.79  ? 296 ARG B CD  1 
ATOM   6415 N NE  . ARG B 1 295 ? 2.474   -48.554 -18.328 1.00 35.89  ? 296 ARG B NE  1 
ATOM   6416 C CZ  . ARG B 1 295 ? 2.465   -49.423 -17.316 1.00 38.03  ? 296 ARG B CZ  1 
ATOM   6417 N NH1 . ARG B 1 295 ? 2.997   -50.629 -17.462 1.00 28.85  ? 296 ARG B NH1 1 
ATOM   6418 N NH2 . ARG B 1 295 ? 1.919   -49.085 -16.154 1.00 41.52  ? 296 ARG B NH2 1 
ATOM   6419 N N   . PHE B 1 296 ? 4.608   -50.225 -23.891 1.00 32.22  ? 297 PHE B N   1 
ATOM   6420 C CA  . PHE B 1 296 ? 4.888   -50.412 -25.302 1.00 27.41  ? 297 PHE B CA  1 
ATOM   6421 C C   . PHE B 1 296 ? 4.031   -49.458 -26.129 1.00 31.61  ? 297 PHE B C   1 
ATOM   6422 O O   . PHE B 1 296 ? 2.877   -49.197 -25.797 1.00 37.14  ? 297 PHE B O   1 
ATOM   6423 C CB  . PHE B 1 296 ? 4.657   -51.877 -25.665 1.00 25.47  ? 297 PHE B CB  1 
ATOM   6424 C CG  . PHE B 1 296 ? 5.137   -52.830 -24.599 1.00 28.28  ? 297 PHE B CG  1 
ATOM   6425 C CD1 . PHE B 1 296 ? 6.492   -53.035 -24.396 1.00 31.66  ? 297 PHE B CD1 1 
ATOM   6426 C CD2 . PHE B 1 296 ? 4.235   -53.493 -23.776 1.00 26.60  ? 297 PHE B CD2 1 
ATOM   6427 C CE1 . PHE B 1 296 ? 6.941   -53.897 -23.394 1.00 28.85  ? 297 PHE B CE1 1 
ATOM   6428 C CE2 . PHE B 1 296 ? 4.674   -54.361 -22.792 1.00 25.43  ? 297 PHE B CE2 1 
ATOM   6429 C CZ  . PHE B 1 296 ? 6.031   -54.559 -22.601 1.00 27.86  ? 297 PHE B CZ  1 
ATOM   6430 N N   . SER B 1 297 ? 4.614   -48.935 -27.201 1.00 30.59  ? 298 SER B N   1 
ATOM   6431 C CA  . SER B 1 297 ? 4.057   -47.786 -27.909 1.00 32.02  ? 298 SER B CA  1 
ATOM   6432 C C   . SER B 1 297 ? 2.727   -48.064 -28.590 1.00 33.56  ? 298 SER B C   1 
ATOM   6433 O O   . SER B 1 297 ? 1.788   -47.277 -28.482 1.00 33.82  ? 298 SER B O   1 
ATOM   6434 C CB  . SER B 1 297 ? 5.071   -47.270 -28.932 1.00 36.97  ? 298 SER B CB  1 
ATOM   6435 O OG  . SER B 1 297 ? 6.272   -46.870 -28.289 1.00 38.24  ? 298 SER B OG  1 
ATOM   6436 N N   . PHE B 1 298 ? 2.649   -49.186 -29.292 1.00 25.69  ? 299 PHE B N   1 
ATOM   6437 C CA  . PHE B 1 298 ? 1.472   -49.498 -30.080 1.00 29.27  ? 299 PHE B CA  1 
ATOM   6438 C C   . PHE B 1 298 ? 0.841   -50.803 -29.627 1.00 29.57  ? 299 PHE B C   1 
ATOM   6439 O O   . PHE B 1 298 ? 1.405   -51.890 -29.809 1.00 32.45  ? 299 PHE B O   1 
ATOM   6440 C CB  . PHE B 1 298 ? 1.815   -49.506 -31.584 1.00 28.73  ? 299 PHE B CB  1 
ATOM   6441 C CG  . PHE B 1 298 ? 2.371   -48.201 -32.067 1.00 27.70  ? 299 PHE B CG  1 
ATOM   6442 C CD1 . PHE B 1 298 ? 1.539   -47.099 -32.235 1.00 29.89  ? 299 PHE B CD1 1 
ATOM   6443 C CD2 . PHE B 1 298 ? 3.729   -48.059 -32.326 1.00 33.61  ? 299 PHE B CD2 1 
ATOM   6444 C CE1 . PHE B 1 298 ? 2.053   -45.879 -32.663 1.00 24.65  ? 299 PHE B CE1 1 
ATOM   6445 C CE2 . PHE B 1 298 ? 4.255   -46.839 -32.753 1.00 27.09  ? 299 PHE B CE2 1 
ATOM   6446 C CZ  . PHE B 1 298 ? 3.418   -45.749 -32.919 1.00 29.73  ? 299 PHE B CZ  1 
ATOM   6447 N N   . VAL B 1 299 ? -0.336  -50.677 -29.023 1.00 24.79  ? 300 VAL B N   1 
ATOM   6448 C CA  . VAL B 1 299 ? -1.030  -51.798 -28.398 1.00 22.08  ? 300 VAL B CA  1 
ATOM   6449 C C   . VAL B 1 299 ? -2.504  -51.650 -28.753 1.00 22.71  ? 300 VAL B C   1 
ATOM   6450 O O   . VAL B 1 299 ? -2.889  -50.625 -29.324 1.00 24.08  ? 300 VAL B O   1 
ATOM   6451 C CB  . VAL B 1 299 ? -0.807  -51.805 -26.849 1.00 25.76  ? 300 VAL B CB  1 
ATOM   6452 C CG1 . VAL B 1 299 ? 0.672   -52.015 -26.517 1.00 21.83  ? 300 VAL B CG1 1 
ATOM   6453 C CG2 . VAL B 1 299 ? -1.320  -50.511 -26.204 1.00 22.02  ? 300 VAL B CG2 1 
ATOM   6454 N N   . PRO B 1 300 ? -3.329  -52.671 -28.460 1.00 21.70  ? 301 PRO B N   1 
ATOM   6455 C CA  . PRO B 1 300 ? -4.766  -52.519 -28.731 1.00 25.49  ? 301 PRO B CA  1 
ATOM   6456 C C   . PRO B 1 300 ? -5.371  -51.227 -28.157 1.00 31.09  ? 301 PRO B C   1 
ATOM   6457 O O   . PRO B 1 300 ? -5.000  -50.778 -27.070 1.00 28.63  ? 301 PRO B O   1 
ATOM   6458 C CB  . PRO B 1 300 ? -5.368  -53.746 -28.057 1.00 21.12  ? 301 PRO B CB  1 
ATOM   6459 C CG  . PRO B 1 300 ? -4.308  -54.790 -28.241 1.00 20.21  ? 301 PRO B CG  1 
ATOM   6460 C CD  . PRO B 1 300 ? -2.995  -54.055 -28.075 1.00 18.20  ? 301 PRO B CD  1 
ATOM   6461 N N   . VAL B 1 301 ? -6.268  -50.617 -28.922 1.00 29.43  ? 302 VAL B N   1 
ATOM   6462 C CA  . VAL B 1 301 ? -6.898  -49.364 -28.534 1.00 26.67  ? 302 VAL B CA  1 
ATOM   6463 C C   . VAL B 1 301 ? -8.354  -49.616 -28.154 1.00 34.47  ? 302 VAL B C   1 
ATOM   6464 O O   . VAL B 1 301 ? -9.050  -50.391 -28.815 1.00 31.16  ? 302 VAL B O   1 
ATOM   6465 C CB  . VAL B 1 301 ? -6.805  -48.309 -29.677 1.00 30.10  ? 302 VAL B CB  1 
ATOM   6466 C CG1 . VAL B 1 301 ? -7.436  -48.839 -30.974 1.00 21.58  ? 302 VAL B CG1 1 
ATOM   6467 C CG2 . VAL B 1 301 ? -7.454  -46.999 -29.260 1.00 34.89  ? 302 VAL B CG2 1 
ATOM   6468 N N   . VAL B 1 302 ? -8.806  -48.990 -27.070 1.00 34.94  ? 303 VAL B N   1 
ATOM   6469 C CA  . VAL B 1 302 ? -10.213 -49.068 -26.691 1.00 30.94  ? 303 VAL B CA  1 
ATOM   6470 C C   . VAL B 1 302 ? -10.972 -47.991 -27.453 1.00 36.89  ? 303 VAL B C   1 
ATOM   6471 O O   . VAL B 1 302 ? -10.939 -46.821 -27.070 1.00 38.20  ? 303 VAL B O   1 
ATOM   6472 C CB  . VAL B 1 302 ? -10.421 -48.853 -25.175 1.00 32.81  ? 303 VAL B CB  1 
ATOM   6473 C CG1 . VAL B 1 302 ? -11.887 -49.071 -24.812 1.00 24.32  ? 303 VAL B CG1 1 
ATOM   6474 C CG2 . VAL B 1 302 ? -9.530  -49.787 -24.381 1.00 23.00  ? 303 VAL B CG2 1 
ATOM   6475 N N   . ASP B 1 303 ? -11.647 -48.381 -28.530 1.00 28.55  ? 304 ASP B N   1 
ATOM   6476 C CA  . ASP B 1 303 ? -12.285 -47.406 -29.409 1.00 36.32  ? 304 ASP B CA  1 
ATOM   6477 C C   . ASP B 1 303 ? -13.778 -47.674 -29.640 1.00 37.84  ? 304 ASP B C   1 
ATOM   6478 O O   . ASP B 1 303 ? -14.409 -47.023 -30.468 1.00 50.41  ? 304 ASP B O   1 
ATOM   6479 C CB  . ASP B 1 303 ? -11.537 -47.318 -30.748 1.00 36.97  ? 304 ASP B CB  1 
ATOM   6480 C CG  . ASP B 1 303 ? -11.752 -48.542 -31.629 1.00 37.08  ? 304 ASP B CG  1 
ATOM   6481 O OD1 . ASP B 1 303 ? -12.173 -49.603 -31.112 1.00 42.89  ? 304 ASP B OD1 1 
ATOM   6482 O OD2 . ASP B 1 303 ? -11.491 -48.447 -32.849 1.00 60.89  ? 304 ASP B OD2 1 
ATOM   6483 N N   . GLY B 1 304 ? -14.333 -48.636 -28.915 1.00 39.65  ? 305 GLY B N   1 
ATOM   6484 C CA  . GLY B 1 304 ? -15.749 -48.929 -29.016 1.00 41.28  ? 305 GLY B CA  1 
ATOM   6485 C C   . GLY B 1 304 ? -16.057 -50.005 -30.037 1.00 48.06  ? 305 GLY B C   1 
ATOM   6486 O O   . GLY B 1 304 ? -17.168 -50.537 -30.077 1.00 47.62  ? 305 GLY B O   1 
ATOM   6487 N N   . ASP B 1 305 ? -15.074 -50.342 -30.863 1.00 36.78  ? 306 ASP B N   1 
ATOM   6488 C CA  . ASP B 1 305 ? -15.308 -51.309 -31.927 1.00 38.75  ? 306 ASP B CA  1 
ATOM   6489 C C   . ASP B 1 305 ? -14.935 -52.736 -31.508 1.00 44.83  ? 306 ASP B C   1 
ATOM   6490 O O   . ASP B 1 305 ? -15.792 -53.483 -31.033 1.00 38.64  ? 306 ASP B O   1 
ATOM   6491 C CB  . ASP B 1 305 ? -14.587 -50.890 -33.210 1.00 39.48  ? 306 ASP B CB  1 
ATOM   6492 C CG  . ASP B 1 305 ? -15.038 -51.686 -34.407 1.00 45.14  ? 306 ASP B CG  1 
ATOM   6493 O OD1 . ASP B 1 305 ? -15.971 -52.501 -34.249 1.00 49.28  ? 306 ASP B OD1 1 
ATOM   6494 O OD2 . ASP B 1 305 ? -14.471 -51.491 -35.505 1.00 55.71  ? 306 ASP B OD2 1 
ATOM   6495 N N   . PHE B 1 306 ? -13.670 -53.116 -31.683 1.00 39.18  ? 307 PHE B N   1 
ATOM   6496 C CA  . PHE B 1 306 ? -13.229 -54.444 -31.263 1.00 28.36  ? 307 PHE B CA  1 
ATOM   6497 C C   . PHE B 1 306 ? -13.540 -54.647 -29.776 1.00 32.59  ? 307 PHE B C   1 
ATOM   6498 O O   . PHE B 1 306 ? -14.041 -55.696 -29.380 1.00 31.05  ? 307 PHE B O   1 
ATOM   6499 C CB  . PHE B 1 306 ? -11.731 -54.652 -31.549 1.00 24.22  ? 307 PHE B CB  1 
ATOM   6500 C CG  . PHE B 1 306 ? -11.288 -56.091 -31.451 1.00 30.52  ? 307 PHE B CG  1 
ATOM   6501 C CD1 . PHE B 1 306 ? -11.078 -56.688 -30.218 1.00 30.62  ? 307 PHE B CD1 1 
ATOM   6502 C CD2 . PHE B 1 306 ? -11.090 -56.849 -32.594 1.00 31.37  ? 307 PHE B CD2 1 
ATOM   6503 C CE1 . PHE B 1 306 ? -10.682 -58.015 -30.125 1.00 28.76  ? 307 PHE B CE1 1 
ATOM   6504 C CE2 . PHE B 1 306 ? -10.693 -58.179 -32.508 1.00 32.41  ? 307 PHE B CE2 1 
ATOM   6505 C CZ  . PHE B 1 306 ? -10.485 -58.760 -31.272 1.00 31.57  ? 307 PHE B CZ  1 
ATOM   6506 N N   . LEU B 1 307 ? -13.229 -53.627 -28.976 1.00 28.15  ? 308 LEU B N   1 
ATOM   6507 C CA  . LEU B 1 307 ? -13.556 -53.573 -27.548 1.00 43.60  ? 308 LEU B CA  1 
ATOM   6508 C C   . LEU B 1 307 ? -14.573 -52.462 -27.307 1.00 42.83  ? 308 LEU B C   1 
ATOM   6509 O O   . LEU B 1 307 ? -14.257 -51.282 -27.492 1.00 38.74  ? 308 LEU B O   1 
ATOM   6510 C CB  . LEU B 1 307 ? -12.303 -53.253 -26.729 1.00 34.05  ? 308 LEU B CB  1 
ATOM   6511 C CG  . LEU B 1 307 ? -11.137 -54.236 -26.823 1.00 38.70  ? 308 LEU B CG  1 
ATOM   6512 C CD1 . LEU B 1 307 ? -9.894  -53.624 -26.206 1.00 27.67  ? 308 LEU B CD1 1 
ATOM   6513 C CD2 . LEU B 1 307 ? -11.500 -55.564 -26.156 1.00 31.44  ? 308 LEU B CD2 1 
ATOM   6514 N N   . SER B 1 308 ? -15.782 -52.826 -26.889 1.00 41.25  ? 309 SER B N   1 
ATOM   6515 C CA  . SER B 1 308 ? -16.850 -51.839 -26.694 1.00 43.85  ? 309 SER B CA  1 
ATOM   6516 C C   . SER B 1 308 ? -16.585 -50.897 -25.509 1.00 40.41  ? 309 SER B C   1 
ATOM   6517 O O   . SER B 1 308 ? -17.075 -49.773 -25.477 1.00 54.01  ? 309 SER B O   1 
ATOM   6518 C CB  . SER B 1 308 ? -18.203 -52.536 -26.546 1.00 42.78  ? 309 SER B CB  1 
ATOM   6519 O OG  . SER B 1 308 ? -18.228 -53.363 -25.395 1.00 55.35  ? 309 SER B OG  1 
ATOM   6520 N N   . ASP B 1 309 ? -15.788 -51.366 -24.557 1.00 41.08  ? 310 ASP B N   1 
ATOM   6521 C CA  . ASP B 1 309 ? -15.406 -50.598 -23.378 1.00 50.92  ? 310 ASP B CA  1 
ATOM   6522 C C   . ASP B 1 309 ? -14.043 -51.139 -22.944 1.00 46.52  ? 310 ASP B C   1 
ATOM   6523 O O   . ASP B 1 309 ? -13.513 -52.052 -23.582 1.00 41.04  ? 310 ASP B O   1 
ATOM   6524 C CB  . ASP B 1 309 ? -16.442 -50.797 -22.260 1.00 45.32  ? 310 ASP B CB  1 
ATOM   6525 C CG  . ASP B 1 309 ? -16.422 -49.677 -21.210 1.00 45.16  ? 310 ASP B CG  1 
ATOM   6526 O OD1 . ASP B 1 309 ? -15.348 -49.113 -20.915 1.00 47.28  ? 310 ASP B OD1 1 
ATOM   6527 O OD2 . ASP B 1 309 ? -17.500 -49.366 -20.665 1.00 60.34  ? 310 ASP B OD2 1 
ATOM   6528 N N   . THR B 1 310 ? -13.480 -50.590 -21.867 1.00 37.70  ? 311 THR B N   1 
ATOM   6529 C CA  . THR B 1 310 ? -12.219 -51.087 -21.339 1.00 29.46  ? 311 THR B CA  1 
ATOM   6530 C C   . THR B 1 310 ? -12.387 -52.556 -20.969 1.00 36.49  ? 311 THR B C   1 
ATOM   6531 O O   . THR B 1 310 ? -13.489 -52.990 -20.609 1.00 37.21  ? 311 THR B O   1 
ATOM   6532 C CB  . THR B 1 310 ? -11.761 -50.290 -20.097 1.00 42.61  ? 311 THR B CB  1 
ATOM   6533 O OG1 . THR B 1 310 ? -12.447 -50.766 -18.931 1.00 43.06  ? 311 THR B OG1 1 
ATOM   6534 C CG2 . THR B 1 310 ? -12.030 -48.810 -20.279 1.00 31.11  ? 311 THR B CG2 1 
ATOM   6535 N N   . PRO B 1 311 ? -11.304 -53.335 -21.081 1.00 28.64  ? 312 PRO B N   1 
ATOM   6536 C CA  . PRO B 1 311 ? -11.389 -54.750 -20.706 1.00 32.25  ? 312 PRO B CA  1 
ATOM   6537 C C   . PRO B 1 311 ? -11.798 -54.913 -19.234 1.00 42.18  ? 312 PRO B C   1 
ATOM   6538 O O   . PRO B 1 311 ? -12.493 -55.864 -18.882 1.00 40.18  ? 312 PRO B O   1 
ATOM   6539 C CB  . PRO B 1 311 ? -9.959  -55.266 -20.931 1.00 29.42  ? 312 PRO B CB  1 
ATOM   6540 C CG  . PRO B 1 311 ? -9.330  -54.296 -21.865 1.00 32.30  ? 312 PRO B CG  1 
ATOM   6541 C CD  . PRO B 1 311 ? -9.980  -52.969 -21.616 1.00 35.04  ? 312 PRO B CD  1 
ATOM   6542 N N   . GLU B 1 312 ? -11.372 -53.987 -18.385 1.00 40.61  ? 313 GLU B N   1 
ATOM   6543 C CA  . GLU B 1 312 ? -11.763 -54.018 -16.982 1.00 43.80  ? 313 GLU B CA  1 
ATOM   6544 C C   . GLU B 1 312 ? -13.288 -53.979 -16.841 1.00 51.43  ? 313 GLU B C   1 
ATOM   6545 O O   . GLU B 1 312 ? -13.877 -54.844 -16.190 1.00 40.41  ? 313 GLU B O   1 
ATOM   6546 C CB  . GLU B 1 312 ? -11.112 -52.862 -16.230 1.00 45.12  ? 313 GLU B CB  1 
ATOM   6547 C CG  . GLU B 1 312 ? -10.998 -53.074 -14.733 1.00 72.59  ? 313 GLU B CG  1 
ATOM   6548 C CD  . GLU B 1 312 ? -12.113 -52.389 -13.967 1.00 92.24  ? 313 GLU B CD  1 
ATOM   6549 O OE1 . GLU B 1 312 ? -12.828 -51.557 -14.578 1.00 84.54  ? 313 GLU B OE1 1 
ATOM   6550 O OE2 . GLU B 1 312 ? -12.272 -52.685 -12.758 1.00 85.51  ? 313 GLU B OE2 1 
ATOM   6551 N N   . ALA B 1 313 ? -13.924 -52.996 -17.477 1.00 41.68  ? 314 ALA B N   1 
ATOM   6552 C CA  . ALA B 1 313 ? -15.385 -52.891 -17.471 1.00 34.04  ? 314 ALA B CA  1 
ATOM   6553 C C   . ALA B 1 313 ? -16.081 -54.128 -18.056 1.00 45.43  ? 314 ALA B C   1 
ATOM   6554 O O   . ALA B 1 313 ? -17.068 -54.612 -17.502 1.00 53.64  ? 314 ALA B O   1 
ATOM   6555 C CB  . ALA B 1 313 ? -15.825 -51.645 -18.230 1.00 36.64  ? 314 ALA B CB  1 
ATOM   6556 N N   . LEU B 1 314 ? -15.575 -54.627 -19.181 1.00 41.79  ? 315 LEU B N   1 
ATOM   6557 C CA  . LEU B 1 314 ? -16.202 -55.757 -19.875 1.00 45.42  ? 315 LEU B CA  1 
ATOM   6558 C C   . LEU B 1 314 ? -16.106 -57.037 -19.061 1.00 38.09  ? 315 LEU B C   1 
ATOM   6559 O O   . LEU B 1 314 ? -17.010 -57.871 -19.076 1.00 46.82  ? 315 LEU B O   1 
ATOM   6560 C CB  . LEU B 1 314 ? -15.577 -55.964 -21.258 1.00 35.68  ? 315 LEU B CB  1 
ATOM   6561 C CG  . LEU B 1 314 ? -15.892 -54.879 -22.288 1.00 46.39  ? 315 LEU B CG  1 
ATOM   6562 C CD1 . LEU B 1 314 ? -14.983 -55.009 -23.497 1.00 38.20  ? 315 LEU B CD1 1 
ATOM   6563 C CD2 . LEU B 1 314 ? -17.347 -54.976 -22.707 1.00 35.87  ? 315 LEU B CD2 1 
ATOM   6564 N N   . ILE B 1 315 ? -14.988 -57.189 -18.369 1.00 39.49  ? 316 ILE B N   1 
ATOM   6565 C CA  . ILE B 1 315 ? -14.795 -58.290 -17.446 1.00 47.40  ? 316 ILE B CA  1 
ATOM   6566 C C   . ILE B 1 315 ? -15.796 -58.159 -16.297 1.00 52.87  ? 316 ILE B C   1 
ATOM   6567 O O   . ILE B 1 315 ? -16.555 -59.087 -16.015 1.00 49.46  ? 316 ILE B O   1 
ATOM   6568 C CB  . ILE B 1 315 ? -13.355 -58.292 -16.904 1.00 42.77  ? 316 ILE B CB  1 
ATOM   6569 C CG1 . ILE B 1 315 ? -12.403 -58.873 -17.947 1.00 40.99  ? 316 ILE B CG1 1 
ATOM   6570 C CG2 . ILE B 1 315 ? -13.253 -59.100 -15.630 1.00 44.66  ? 316 ILE B CG2 1 
ATOM   6571 C CD1 . ILE B 1 315 ? -10.961 -58.468 -17.733 1.00 37.02  ? 316 ILE B CD1 1 
ATOM   6572 N N   . ASN B 1 316 ? -15.814 -56.991 -15.659 1.00 52.09  ? 317 ASN B N   1 
ATOM   6573 C CA  . ASN B 1 316 ? -16.698 -56.749 -14.517 1.00 57.97  ? 317 ASN B CA  1 
ATOM   6574 C C   . ASN B 1 316 ? -18.183 -56.934 -14.821 1.00 58.54  ? 317 ASN B C   1 
ATOM   6575 O O   . ASN B 1 316 ? -18.950 -57.338 -13.950 1.00 59.53  ? 317 ASN B O   1 
ATOM   6576 C CB  . ASN B 1 316 ? -16.469 -55.354 -13.939 1.00 37.90  ? 317 ASN B CB  1 
ATOM   6577 C CG  . ASN B 1 316 ? -15.137 -55.228 -13.237 1.00 53.24  ? 317 ASN B CG  1 
ATOM   6578 O OD1 . ASN B 1 316 ? -14.553 -56.221 -12.797 1.00 67.83  ? 317 ASN B OD1 1 
ATOM   6579 N ND2 . ASN B 1 316 ? -14.646 -54.000 -13.122 1.00 51.74  ? 317 ASN B ND2 1 
ATOM   6580 N N   . ALA B 1 317 ? -18.572 -56.661 -16.062 1.00 50.90  ? 318 ALA B N   1 
ATOM   6581 C CA  . ALA B 1 317 ? -19.981 -56.631 -16.438 1.00 52.97  ? 318 ALA B CA  1 
ATOM   6582 C C   . ALA B 1 317 ? -20.370 -57.728 -17.413 1.00 60.63  ? 318 ALA B C   1 
ATOM   6583 O O   . ALA B 1 317 ? -21.254 -57.529 -18.242 1.00 69.96  ? 318 ALA B O   1 
ATOM   6584 C CB  . ALA B 1 317 ? -20.311 -55.282 -17.052 1.00 42.96  ? 318 ALA B CB  1 
ATOM   6585 N N   . GLY B 1 318 ? -19.718 -58.879 -17.333 1.00 53.30  ? 319 GLY B N   1 
ATOM   6586 C CA  . GLY B 1 318 ? -19.952 -59.911 -18.327 1.00 40.93  ? 319 GLY B CA  1 
ATOM   6587 C C   . GLY B 1 318 ? -20.511 -61.192 -17.745 1.00 51.45  ? 319 GLY B C   1 
ATOM   6588 O O   . GLY B 1 318 ? -20.280 -61.515 -16.579 1.00 44.61  ? 319 GLY B O   1 
ATOM   6589 N N   . ASP B 1 319 ? -21.257 -61.920 -18.565 1.00 51.19  ? 320 ASP B N   1 
ATOM   6590 C CA  . ASP B 1 319 ? -21.772 -63.222 -18.184 1.00 48.34  ? 320 ASP B CA  1 
ATOM   6591 C C   . ASP B 1 319 ? -20.877 -64.278 -18.816 1.00 55.46  ? 320 ASP B C   1 
ATOM   6592 O O   . ASP B 1 319 ? -20.793 -64.384 -20.045 1.00 42.24  ? 320 ASP B O   1 
ATOM   6593 C CB  . ASP B 1 319 ? -23.212 -63.392 -18.673 1.00 45.32  ? 320 ASP B CB  1 
ATOM   6594 C CG  . ASP B 1 319 ? -23.910 -64.585 -18.040 1.00 62.69  ? 320 ASP B CG  1 
ATOM   6595 O OD1 . ASP B 1 319 ? -23.225 -65.563 -17.660 1.00 58.28  ? 320 ASP B OD1 1 
ATOM   6596 O OD2 . ASP B 1 319 ? -25.153 -64.540 -17.920 1.00 79.72  ? 320 ASP B OD2 1 
ATOM   6597 N N   . PHE B 1 320 ? -20.220 -65.068 -17.976 1.00 48.34  ? 321 PHE B N   1 
ATOM   6598 C CA  . PHE B 1 320 ? -19.230 -66.017 -18.461 1.00 38.23  ? 321 PHE B CA  1 
ATOM   6599 C C   . PHE B 1 320 ? -19.618 -67.471 -18.199 1.00 48.30  ? 321 PHE B C   1 
ATOM   6600 O O   . PHE B 1 320 ? -18.761 -68.358 -18.176 1.00 47.13  ? 321 PHE B O   1 
ATOM   6601 C CB  . PHE B 1 320 ? -17.856 -65.692 -17.858 1.00 43.53  ? 321 PHE B CB  1 
ATOM   6602 C CG  . PHE B 1 320 ? -17.315 -64.347 -18.277 1.00 47.24  ? 321 PHE B CG  1 
ATOM   6603 C CD1 . PHE B 1 320 ? -16.803 -64.153 -19.559 1.00 37.15  ? 321 PHE B CD1 1 
ATOM   6604 C CD2 . PHE B 1 320 ? -17.321 -63.276 -17.395 1.00 35.83  ? 321 PHE B CD2 1 
ATOM   6605 C CE1 . PHE B 1 320 ? -16.304 -62.908 -19.948 1.00 34.41  ? 321 PHE B CE1 1 
ATOM   6606 C CE2 . PHE B 1 320 ? -16.827 -62.026 -17.780 1.00 38.99  ? 321 PHE B CE2 1 
ATOM   6607 C CZ  . PHE B 1 320 ? -16.317 -61.845 -19.059 1.00 38.63  ? 321 PHE B CZ  1 
ATOM   6608 N N   . HIS B 1 321 ? -20.911 -67.717 -18.008 1.00 49.24  ? 322 HIS B N   1 
ATOM   6609 C CA  . HIS B 1 321 ? -21.394 -69.086 -17.868 1.00 47.56  ? 322 HIS B CA  1 
ATOM   6610 C C   . HIS B 1 321 ? -21.099 -69.894 -19.129 1.00 46.12  ? 322 HIS B C   1 
ATOM   6611 O O   . HIS B 1 321 ? -21.281 -69.407 -20.244 1.00 43.88  ? 322 HIS B O   1 
ATOM   6612 C CB  . HIS B 1 321 ? -22.892 -69.105 -17.555 1.00 51.99  ? 322 HIS B CB  1 
ATOM   6613 C CG  . HIS B 1 321 ? -23.210 -68.804 -16.122 1.00 55.07  ? 322 HIS B CG  1 
ATOM   6614 N ND1 . HIS B 1 321 ? -23.604 -67.555 -15.691 1.00 52.55  ? 322 HIS B ND1 1 
ATOM   6615 C CD2 . HIS B 1 321 ? -23.173 -69.589 -15.019 1.00 44.88  ? 322 HIS B CD2 1 
ATOM   6616 C CE1 . HIS B 1 321 ? -23.798 -67.584 -14.383 1.00 54.42  ? 322 HIS B CE1 1 
ATOM   6617 N NE2 . HIS B 1 321 ? -23.543 -68.805 -13.951 1.00 53.22  ? 322 HIS B NE2 1 
ATOM   6618 N N   . GLY B 1 322 ? -20.626 -71.125 -18.945 1.00 64.77  ? 323 GLY B N   1 
ATOM   6619 C CA  . GLY B 1 322 ? -20.335 -72.011 -20.062 1.00 53.29  ? 323 GLY B CA  1 
ATOM   6620 C C   . GLY B 1 322 ? -18.909 -71.885 -20.574 1.00 61.45  ? 323 GLY B C   1 
ATOM   6621 O O   . GLY B 1 322 ? -18.519 -72.544 -21.539 1.00 62.00  ? 323 GLY B O   1 
ATOM   6622 N N   . LEU B 1 323 ? -18.131 -71.029 -19.920 1.00 56.91  ? 324 LEU B N   1 
ATOM   6623 C CA  . LEU B 1 323 ? -16.750 -70.786 -20.299 1.00 46.08  ? 324 LEU B CA  1 
ATOM   6624 C C   . LEU B 1 323 ? -15.791 -71.446 -19.314 1.00 50.77  ? 324 LEU B C   1 
ATOM   6625 O O   . LEU B 1 323 ? -15.960 -71.320 -18.100 1.00 52.64  ? 324 LEU B O   1 
ATOM   6626 C CB  . LEU B 1 323 ? -16.487 -69.284 -20.337 1.00 40.76  ? 324 LEU B CB  1 
ATOM   6627 C CG  . LEU B 1 323 ? -15.042 -68.858 -20.583 1.00 37.02  ? 324 LEU B CG  1 
ATOM   6628 C CD1 . LEU B 1 323 ? -14.654 -69.138 -22.026 1.00 35.62  ? 324 LEU B CD1 1 
ATOM   6629 C CD2 . LEU B 1 323 ? -14.862 -67.391 -20.251 1.00 29.05  ? 324 LEU B CD2 1 
ATOM   6630 N N   . GLN B 1 324 ? -14.801 -72.169 -19.831 1.00 42.79  ? 325 GLN B N   1 
ATOM   6631 C CA  . GLN B 1 324 ? -13.714 -72.662 -18.988 1.00 35.74  ? 325 GLN B CA  1 
ATOM   6632 C C   . GLN B 1 324 ? -12.421 -71.954 -19.371 1.00 44.20  ? 325 GLN B C   1 
ATOM   6633 O O   . GLN B 1 324 ? -12.119 -71.765 -20.552 1.00 41.35  ? 325 GLN B O   1 
ATOM   6634 C CB  . GLN B 1 324 ? -13.529 -74.175 -19.091 1.00 39.09  ? 325 GLN B CB  1 
ATOM   6635 C CG  . GLN B 1 324 ? -14.759 -74.991 -18.780 1.00 43.11  ? 325 GLN B CG  1 
ATOM   6636 C CD  . GLN B 1 324 ? -15.584 -75.251 -20.014 1.00 55.65  ? 325 GLN B CD  1 
ATOM   6637 O OE1 . GLN B 1 324 ? -15.068 -75.235 -21.133 1.00 48.74  ? 325 GLN B OE1 1 
ATOM   6638 N NE2 . GLN B 1 324 ? -16.876 -75.478 -19.823 1.00 65.64  ? 325 GLN B NE2 1 
ATOM   6639 N N   . VAL B 1 325 ? -11.665 -71.550 -18.361 1.00 34.96  ? 326 VAL B N   1 
ATOM   6640 C CA  . VAL B 1 325 ? -10.451 -70.780 -18.563 1.00 32.60  ? 326 VAL B CA  1 
ATOM   6641 C C   . VAL B 1 325 ? -9.365  -71.310 -17.639 1.00 32.42  ? 326 VAL B C   1 
ATOM   6642 O O   . VAL B 1 325 ? -9.625  -71.610 -16.480 1.00 40.79  ? 326 VAL B O   1 
ATOM   6643 C CB  . VAL B 1 325 ? -10.691 -69.284 -18.270 1.00 35.65  ? 326 VAL B CB  1 
ATOM   6644 C CG1 . VAL B 1 325 ? -9.437  -68.511 -18.444 1.00 47.49  ? 326 VAL B CG1 1 
ATOM   6645 C CG2 . VAL B 1 325 ? -11.732 -68.725 -19.197 1.00 42.78  ? 326 VAL B CG2 1 
ATOM   6646 N N   . LEU B 1 326 ? -8.157  -71.446 -18.169 1.00 28.76  ? 327 LEU B N   1 
ATOM   6647 C CA  . LEU B 1 326 ? -6.982  -71.775 -17.377 1.00 24.20  ? 327 LEU B CA  1 
ATOM   6648 C C   . LEU B 1 326 ? -6.066  -70.553 -17.403 1.00 32.03  ? 327 LEU B C   1 
ATOM   6649 O O   . LEU B 1 326 ? -5.821  -69.987 -18.469 1.00 34.42  ? 327 LEU B O   1 
ATOM   6650 C CB  . LEU B 1 326 ? -6.284  -72.991 -17.977 1.00 28.33  ? 327 LEU B CB  1 
ATOM   6651 C CG  . LEU B 1 326 ? -4.920  -73.431 -17.457 1.00 35.41  ? 327 LEU B CG  1 
ATOM   6652 C CD1 . LEU B 1 326 ? -4.994  -73.731 -15.996 1.00 42.73  ? 327 LEU B CD1 1 
ATOM   6653 C CD2 . LEU B 1 326 ? -4.483  -74.663 -18.208 1.00 40.81  ? 327 LEU B CD2 1 
ATOM   6654 N N   . VAL B 1 327 ? -5.603  -70.114 -16.232 1.00 33.85  ? 328 VAL B N   1 
ATOM   6655 C CA  . VAL B 1 327 ? -4.795  -68.897 -16.119 1.00 26.33  ? 328 VAL B CA  1 
ATOM   6656 C C   . VAL B 1 327 ? -3.653  -69.118 -15.147 1.00 30.78  ? 328 VAL B C   1 
ATOM   6657 O O   . VAL B 1 327 ? -3.725  -69.997 -14.288 1.00 28.82  ? 328 VAL B O   1 
ATOM   6658 C CB  . VAL B 1 327 ? -5.619  -67.692 -15.616 1.00 32.25  ? 328 VAL B CB  1 
ATOM   6659 C CG1 . VAL B 1 327 ? -6.794  -67.432 -16.525 1.00 20.41  ? 328 VAL B CG1 1 
ATOM   6660 C CG2 . VAL B 1 327 ? -6.091  -67.925 -14.178 1.00 30.19  ? 328 VAL B CG2 1 
ATOM   6661 N N   . GLY B 1 328 ? -2.599  -68.319 -15.265 1.00 26.66  ? 329 GLY B N   1 
ATOM   6662 C CA  . GLY B 1 328 ? -1.450  -68.520 -14.402 1.00 20.53  ? 329 GLY B CA  1 
ATOM   6663 C C   . GLY B 1 328 ? -0.347  -67.511 -14.604 1.00 25.14  ? 329 GLY B C   1 
ATOM   6664 O O   . GLY B 1 328 ? -0.421  -66.650 -15.472 1.00 28.80  ? 329 GLY B O   1 
ATOM   6665 N N   . VAL B 1 329 ? 0.685   -67.626 -13.783 1.00 25.69  ? 330 VAL B N   1 
ATOM   6666 C CA  . VAL B 1 329 ? 1.802   -66.705 -13.801 1.00 23.81  ? 330 VAL B CA  1 
ATOM   6667 C C   . VAL B 1 329 ? 3.049   -67.517 -13.477 1.00 32.51  ? 330 VAL B C   1 
ATOM   6668 O O   . VAL B 1 329 ? 2.932   -68.633 -12.965 1.00 33.29  ? 330 VAL B O   1 
ATOM   6669 C CB  . VAL B 1 329 ? 1.618   -65.603 -12.729 1.00 30.10  ? 330 VAL B CB  1 
ATOM   6670 C CG1 . VAL B 1 329 ? 0.408   -64.731 -13.047 1.00 21.41  ? 330 VAL B CG1 1 
ATOM   6671 C CG2 . VAL B 1 329 ? 1.478   -66.220 -11.325 1.00 22.73  ? 330 VAL B CG2 1 
ATOM   6672 N N   . VAL B 1 330 ? 4.231   -66.980 -13.781 1.00 26.84  ? 331 VAL B N   1 
ATOM   6673 C CA  . VAL B 1 330 ? 5.479   -67.588 -13.314 1.00 24.56  ? 331 VAL B CA  1 
ATOM   6674 C C   . VAL B 1 330 ? 5.817   -67.036 -11.917 1.00 36.24  ? 331 VAL B C   1 
ATOM   6675 O O   . VAL B 1 330 ? 5.160   -66.108 -11.441 1.00 27.49  ? 331 VAL B O   1 
ATOM   6676 C CB  . VAL B 1 330 ? 6.647   -67.316 -14.276 1.00 27.86  ? 331 VAL B CB  1 
ATOM   6677 C CG1 . VAL B 1 330 ? 6.361   -67.911 -15.649 1.00 24.83  ? 331 VAL B CG1 1 
ATOM   6678 C CG2 . VAL B 1 330 ? 6.918   -65.818 -14.380 1.00 22.49  ? 331 VAL B CG2 1 
ATOM   6679 N N   . LYS B 1 331 ? 6.837   -67.591 -11.264 1.00 27.57  ? 332 LYS B N   1 
ATOM   6680 C CA  . LYS B 1 331 ? 7.127   -67.196 -9.896  1.00 29.23  ? 332 LYS B CA  1 
ATOM   6681 C C   . LYS B 1 331 ? 7.633   -65.754 -9.808  1.00 34.76  ? 332 LYS B C   1 
ATOM   6682 O O   . LYS B 1 331 ? 7.309   -65.033 -8.870  1.00 36.03  ? 332 LYS B O   1 
ATOM   6683 C CB  . LYS B 1 331 ? 8.103   -68.168 -9.207  1.00 36.56  ? 332 LYS B CB  1 
ATOM   6684 C CG  . LYS B 1 331 ? 8.372   -67.815 -7.726  1.00 37.74  ? 332 LYS B CG  1 
ATOM   6685 C CD  . LYS B 1 331 ? 9.063   -68.932 -6.903  1.00 47.63  ? 332 LYS B CD  1 
ATOM   6686 C CE  . LYS B 1 331 ? 10.501  -69.207 -7.358  1.00 63.25  ? 332 LYS B CE  1 
ATOM   6687 N NZ  . LYS B 1 331 ? 11.441  -68.051 -7.170  1.00 52.41  ? 332 LYS B NZ  1 
ATOM   6688 N N   . ASP B 1 332 ? 8.412   -65.332 -10.793 1.00 30.04  ? 333 ASP B N   1 
ATOM   6689 C CA  . ASP B 1 332 ? 9.023   -64.004 -10.758 1.00 25.37  ? 333 ASP B CA  1 
ATOM   6690 C C   . ASP B 1 332 ? 8.678   -63.168 -11.997 1.00 32.42  ? 333 ASP B C   1 
ATOM   6691 O O   . ASP B 1 332 ? 9.506   -62.974 -12.882 1.00 29.41  ? 333 ASP B O   1 
ATOM   6692 C CB  . ASP B 1 332 ? 10.533  -64.145 -10.598 1.00 29.62  ? 333 ASP B CB  1 
ATOM   6693 C CG  . ASP B 1 332 ? 10.910  -64.858 -9.307  1.00 42.45  ? 333 ASP B CG  1 
ATOM   6694 O OD1 . ASP B 1 332 ? 10.925  -64.192 -8.248  1.00 48.45  ? 333 ASP B OD1 1 
ATOM   6695 O OD2 . ASP B 1 332 ? 11.171  -66.083 -9.346  1.00 42.31  ? 333 ASP B OD2 1 
ATOM   6696 N N   . GLU B 1 333 ? 7.448   -62.673 -12.041 1.00 28.97  ? 334 GLU B N   1 
ATOM   6697 C CA  . GLU B 1 333 ? 6.925   -61.984 -13.214 1.00 30.13  ? 334 GLU B CA  1 
ATOM   6698 C C   . GLU B 1 333 ? 7.680   -60.708 -13.560 1.00 33.90  ? 334 GLU B C   1 
ATOM   6699 O O   . GLU B 1 333 ? 7.776   -60.332 -14.730 1.00 25.43  ? 334 GLU B O   1 
ATOM   6700 C CB  . GLU B 1 333 ? 5.434   -61.681 -13.023 1.00 24.32  ? 334 GLU B CB  1 
ATOM   6701 C CG  . GLU B 1 333 ? 4.543   -62.914 -13.090 1.00 22.25  ? 334 GLU B CG  1 
ATOM   6702 C CD  . GLU B 1 333 ? 4.413   -63.444 -14.523 1.00 39.79  ? 334 GLU B CD  1 
ATOM   6703 O OE1 . GLU B 1 333 ? 4.932   -62.787 -15.454 1.00 32.39  ? 334 GLU B OE1 1 
ATOM   6704 O OE2 . GLU B 1 333 ? 3.795   -64.513 -14.729 1.00 32.57  ? 334 GLU B OE2 1 
ATOM   6705 N N   . GLY B 1 334 ? 8.226   -60.047 -12.545 1.00 27.95  ? 335 GLY B N   1 
ATOM   6706 C CA  . GLY B 1 334 ? 8.813   -58.735 -12.746 1.00 25.10  ? 335 GLY B CA  1 
ATOM   6707 C C   . GLY B 1 334 ? 10.299  -58.662 -13.044 1.00 30.15  ? 335 GLY B C   1 
ATOM   6708 O O   . GLY B 1 334 ? 10.760  -57.687 -13.630 1.00 28.80  ? 335 GLY B O   1 
ATOM   6709 N N   . SER B 1 335 ? 11.055  -59.679 -12.643 1.00 33.77  ? 336 SER B N   1 
ATOM   6710 C CA  . SER B 1 335 ? 12.516  -59.620 -12.736 1.00 31.60  ? 336 SER B CA  1 
ATOM   6711 C C   . SER B 1 335 ? 13.065  -59.334 -14.146 1.00 34.12  ? 336 SER B C   1 
ATOM   6712 O O   . SER B 1 335 ? 13.977  -58.527 -14.310 1.00 30.62  ? 336 SER B O   1 
ATOM   6713 C CB  . SER B 1 335 ? 13.137  -60.898 -12.180 1.00 31.17  ? 336 SER B CB  1 
ATOM   6714 O OG  . SER B 1 335 ? 12.776  -62.021 -12.959 1.00 38.73  ? 336 SER B OG  1 
ATOM   6715 N N   . TYR B 1 336 ? 12.514  -59.991 -15.159 1.00 32.00  ? 337 TYR B N   1 
ATOM   6716 C CA  . TYR B 1 336 ? 13.010  -59.815 -16.521 1.00 31.19  ? 337 TYR B CA  1 
ATOM   6717 C C   . TYR B 1 336 ? 12.964  -58.358 -16.953 1.00 30.52  ? 337 TYR B C   1 
ATOM   6718 O O   . TYR B 1 336 ? 13.866  -57.873 -17.622 1.00 31.50  ? 337 TYR B O   1 
ATOM   6719 C CB  . TYR B 1 336 ? 12.221  -60.680 -17.501 1.00 34.29  ? 337 TYR B CB  1 
ATOM   6720 C CG  . TYR B 1 336 ? 12.508  -60.369 -18.946 1.00 27.41  ? 337 TYR B CG  1 
ATOM   6721 C CD1 . TYR B 1 336 ? 13.697  -60.762 -19.538 1.00 37.15  ? 337 TYR B CD1 1 
ATOM   6722 C CD2 . TYR B 1 336 ? 11.586  -59.676 -19.723 1.00 39.22  ? 337 TYR B CD2 1 
ATOM   6723 C CE1 . TYR B 1 336 ? 13.959  -60.483 -20.869 1.00 35.09  ? 337 TYR B CE1 1 
ATOM   6724 C CE2 . TYR B 1 336 ? 11.840  -59.383 -21.049 1.00 34.30  ? 337 TYR B CE2 1 
ATOM   6725 C CZ  . TYR B 1 336 ? 13.028  -59.792 -21.620 1.00 44.06  ? 337 TYR B CZ  1 
ATOM   6726 O OH  . TYR B 1 336 ? 13.281  -59.510 -22.946 1.00 42.99  ? 337 TYR B OH  1 
ATOM   6727 N N   . PHE B 1 337 ? 11.924  -57.653 -16.533 1.00 32.74  ? 338 PHE B N   1 
ATOM   6728 C CA  . PHE B 1 337 ? 11.700  -56.290 -16.989 1.00 32.01  ? 338 PHE B CA  1 
ATOM   6729 C C   . PHE B 1 337 ? 12.604  -55.254 -16.336 1.00 36.64  ? 338 PHE B C   1 
ATOM   6730 O O   . PHE B 1 337 ? 12.819  -54.175 -16.889 1.00 36.30  ? 338 PHE B O   1 
ATOM   6731 C CB  . PHE B 1 337 ? 10.220  -55.946 -16.861 1.00 27.13  ? 338 PHE B CB  1 
ATOM   6732 C CG  . PHE B 1 337 ? 9.351   -56.832 -17.699 1.00 30.34  ? 338 PHE B CG  1 
ATOM   6733 C CD1 . PHE B 1 337 ? 8.817   -58.002 -17.173 1.00 24.77  ? 338 PHE B CD1 1 
ATOM   6734 C CD2 . PHE B 1 337 ? 9.131   -56.539 -19.036 1.00 27.31  ? 338 PHE B CD2 1 
ATOM   6735 C CE1 . PHE B 1 337 ? 8.043   -58.839 -17.954 1.00 27.11  ? 338 PHE B CE1 1 
ATOM   6736 C CE2 . PHE B 1 337 ? 8.357   -57.375 -19.838 1.00 28.51  ? 338 PHE B CE2 1 
ATOM   6737 C CZ  . PHE B 1 337 ? 7.813   -58.525 -19.297 1.00 31.82  ? 338 PHE B CZ  1 
ATOM   6738 N N   . LEU B 1 338 ? 13.173  -55.601 -15.186 1.00 28.99  ? 339 LEU B N   1 
ATOM   6739 C CA  . LEU B 1 338 ? 14.034  -54.675 -14.463 1.00 39.83  ? 339 LEU B CA  1 
ATOM   6740 C C   . LEU B 1 338 ? 15.386  -54.459 -15.144 1.00 41.31  ? 339 LEU B C   1 
ATOM   6741 O O   . LEU B 1 338 ? 15.961  -53.380 -15.050 1.00 38.60  ? 339 LEU B O   1 
ATOM   6742 C CB  . LEU B 1 338 ? 14.224  -55.132 -13.015 1.00 41.63  ? 339 LEU B CB  1 
ATOM   6743 C CG  . LEU B 1 338 ? 12.911  -55.213 -12.233 1.00 41.39  ? 339 LEU B CG  1 
ATOM   6744 C CD1 . LEU B 1 338 ? 13.173  -55.560 -10.776 1.00 36.74  ? 339 LEU B CD1 1 
ATOM   6745 C CD2 . LEU B 1 338 ? 12.145  -53.902 -12.359 1.00 32.02  ? 339 LEU B CD2 1 
ATOM   6746 N N   . VAL B 1 339 ? 15.889  -55.476 -15.836 1.00 32.77  ? 340 VAL B N   1 
ATOM   6747 C CA  . VAL B 1 339 ? 17.165  -55.336 -16.529 1.00 43.46  ? 340 VAL B CA  1 
ATOM   6748 C C   . VAL B 1 339 ? 17.006  -54.654 -17.887 1.00 46.70  ? 340 VAL B C   1 
ATOM   6749 O O   . VAL B 1 339 ? 17.940  -54.608 -18.674 1.00 55.06  ? 340 VAL B O   1 
ATOM   6750 C CB  . VAL B 1 339 ? 17.867  -56.684 -16.711 1.00 47.22  ? 340 VAL B CB  1 
ATOM   6751 C CG1 . VAL B 1 339 ? 18.024  -57.366 -15.366 1.00 42.92  ? 340 VAL B CG1 1 
ATOM   6752 C CG2 . VAL B 1 339 ? 17.090  -57.558 -17.678 1.00 52.74  ? 340 VAL B CG2 1 
ATOM   6753 N N   . TYR B 1 340 ? 15.821  -54.116 -18.148 1.00 54.34  ? 341 TYR B N   1 
ATOM   6754 C CA  . TYR B 1 340 ? 15.580  -53.345 -19.361 1.00 47.95  ? 341 TYR B CA  1 
ATOM   6755 C C   . TYR B 1 340 ? 15.210  -51.895 -19.071 1.00 59.16  ? 341 TYR B C   1 
ATOM   6756 O O   . TYR B 1 340 ? 14.377  -51.324 -19.776 1.00 66.22  ? 341 TYR B O   1 
ATOM   6757 C CB  . TYR B 1 340 ? 14.471  -53.987 -20.196 1.00 43.49  ? 341 TYR B CB  1 
ATOM   6758 C CG  . TYR B 1 340 ? 14.935  -55.170 -21.005 1.00 55.14  ? 341 TYR B CG  1 
ATOM   6759 C CD1 . TYR B 1 340 ? 15.211  -55.043 -22.364 1.00 52.45  ? 341 TYR B CD1 1 
ATOM   6760 C CD2 . TYR B 1 340 ? 15.107  -56.414 -20.411 1.00 44.47  ? 341 TYR B CD2 1 
ATOM   6761 C CE1 . TYR B 1 340 ? 15.644  -56.129 -23.113 1.00 53.46  ? 341 TYR B CE1 1 
ATOM   6762 C CE2 . TYR B 1 340 ? 15.544  -57.506 -21.147 1.00 54.25  ? 341 TYR B CE2 1 
ATOM   6763 C CZ  . TYR B 1 340 ? 15.813  -57.359 -22.497 1.00 59.00  ? 341 TYR B CZ  1 
ATOM   6764 O OH  . TYR B 1 340 ? 16.249  -58.446 -23.223 1.00 64.52  ? 341 TYR B OH  1 
ATOM   6765 N N   . GLY B 1 341 ? 15.807  -51.293 -18.042 1.00 53.39  ? 342 GLY B N   1 
ATOM   6766 C CA  . GLY B 1 341 ? 15.565  -49.879 -17.806 1.00 48.64  ? 342 GLY B CA  1 
ATOM   6767 C C   . GLY B 1 341 ? 15.710  -49.361 -16.393 1.00 53.49  ? 342 GLY B C   1 
ATOM   6768 O O   . GLY B 1 341 ? 16.232  -48.264 -16.191 1.00 68.47  ? 342 GLY B O   1 
ATOM   6769 N N   . ALA B 1 342 ? 15.236  -50.134 -15.420 1.00 56.77  ? 343 ALA B N   1 
ATOM   6770 C CA  . ALA B 1 342 ? 15.296  -49.737 -14.011 1.00 50.11  ? 343 ALA B CA  1 
ATOM   6771 C C   . ALA B 1 342 ? 16.732  -49.473 -13.538 1.00 56.54  ? 343 ALA B C   1 
ATOM   6772 O O   . ALA B 1 342 ? 17.639  -50.275 -13.800 1.00 51.24  ? 343 ALA B O   1 
ATOM   6773 C CB  . ALA B 1 342 ? 14.627  -50.787 -13.133 1.00 33.85  ? 343 ALA B CB  1 
ATOM   6774 N N   . PRO B 1 343 ? 16.941  -48.339 -12.843 1.00 57.20  ? 344 PRO B N   1 
ATOM   6775 C CA  . PRO B 1 343 ? 18.271  -47.926 -12.376 1.00 50.41  ? 344 PRO B CA  1 
ATOM   6776 C C   . PRO B 1 343 ? 18.897  -48.947 -11.445 1.00 44.99  ? 344 PRO B C   1 
ATOM   6777 O O   . PRO B 1 343 ? 18.227  -49.411 -10.526 1.00 40.70  ? 344 PRO B O   1 
ATOM   6778 C CB  . PRO B 1 343 ? 17.990  -46.623 -11.612 1.00 45.31  ? 344 PRO B CB  1 
ATOM   6779 C CG  . PRO B 1 343 ? 16.525  -46.645 -11.313 1.00 45.52  ? 344 PRO B CG  1 
ATOM   6780 C CD  . PRO B 1 343 ? 15.901  -47.367 -12.468 1.00 45.80  ? 344 PRO B CD  1 
ATOM   6781 N N   . GLY B 1 344 ? 20.155  -49.303 -11.702 1.00 51.32  ? 345 GLY B N   1 
ATOM   6782 C CA  . GLY B 1 344 ? 20.895  -50.212 -10.843 1.00 51.75  ? 345 GLY B CA  1 
ATOM   6783 C C   . GLY B 1 344 ? 20.800  -51.680 -11.224 1.00 49.04  ? 345 GLY B C   1 
ATOM   6784 O O   . GLY B 1 344 ? 21.364  -52.542 -10.546 1.00 48.89  ? 345 GLY B O   1 
ATOM   6785 N N   . PHE B 1 345 ? 20.103  -51.972 -12.318 1.00 52.74  ? 346 PHE B N   1 
ATOM   6786 C CA  . PHE B 1 345 ? 19.824  -53.359 -12.688 1.00 45.74  ? 346 PHE B CA  1 
ATOM   6787 C C   . PHE B 1 345 ? 20.645  -53.891 -13.869 1.00 46.04  ? 346 PHE B C   1 
ATOM   6788 O O   . PHE B 1 345 ? 20.864  -53.193 -14.863 1.00 61.75  ? 346 PHE B O   1 
ATOM   6789 C CB  . PHE B 1 345 ? 18.330  -53.544 -12.963 1.00 47.89  ? 346 PHE B CB  1 
ATOM   6790 C CG  . PHE B 1 345 ? 17.501  -53.712 -11.725 1.00 44.55  ? 346 PHE B CG  1 
ATOM   6791 C CD1 . PHE B 1 345 ? 17.257  -54.976 -11.206 1.00 41.09  ? 346 PHE B CD1 1 
ATOM   6792 C CD2 . PHE B 1 345 ? 16.959  -52.609 -11.081 1.00 48.28  ? 346 PHE B CD2 1 
ATOM   6793 C CE1 . PHE B 1 345 ? 16.493  -55.139 -10.066 1.00 38.53  ? 346 PHE B CE1 1 
ATOM   6794 C CE2 . PHE B 1 345 ? 16.190  -52.763 -9.934  1.00 42.01  ? 346 PHE B CE2 1 
ATOM   6795 C CZ  . PHE B 1 345 ? 15.956  -54.028 -9.427  1.00 38.33  ? 346 PHE B CZ  1 
ATOM   6796 N N   . SER B 1 346 ? 21.078  -55.143 -13.745 1.00 48.92  ? 347 SER B N   1 
ATOM   6797 C CA  . SER B 1 346 ? 21.799  -55.840 -14.804 1.00 48.31  ? 347 SER B CA  1 
ATOM   6798 C C   . SER B 1 346 ? 21.679  -57.349 -14.624 1.00 46.62  ? 347 SER B C   1 
ATOM   6799 O O   . SER B 1 346 ? 21.665  -57.847 -13.497 1.00 49.72  ? 347 SER B O   1 
ATOM   6800 C CB  . SER B 1 346 ? 23.277  -55.445 -14.791 1.00 51.77  ? 347 SER B CB  1 
ATOM   6801 O OG  . SER B 1 346 ? 24.022  -56.210 -15.727 1.00 64.66  ? 347 SER B OG  1 
ATOM   6802 N N   . LYS B 1 347 ? 21.606  -58.081 -15.732 1.00 42.16  ? 348 LYS B N   1 
ATOM   6803 C CA  . LYS B 1 347 ? 21.670  -59.538 -15.672 1.00 48.34  ? 348 LYS B CA  1 
ATOM   6804 C C   . LYS B 1 347 ? 23.072  -59.987 -15.249 1.00 47.47  ? 348 LYS B C   1 
ATOM   6805 O O   . LYS B 1 347 ? 23.278  -61.135 -14.856 1.00 48.91  ? 348 LYS B O   1 
ATOM   6806 C CB  . LYS B 1 347 ? 21.314  -60.160 -17.031 1.00 47.75  ? 348 LYS B CB  1 
ATOM   6807 C CG  . LYS B 1 347 ? 22.479  -60.235 -18.014 1.00 42.02  ? 348 LYS B CG  1 
ATOM   6808 C CD  . LYS B 1 347 ? 22.064  -60.884 -19.332 1.00 60.75  ? 348 LYS B CD  1 
ATOM   6809 C CE  . LYS B 1 347 ? 23.272  -61.246 -20.201 1.00 42.61  ? 348 LYS B CE  1 
ATOM   6810 N NZ  . LYS B 1 347 ? 24.125  -62.281 -19.540 1.00 49.16  ? 348 LYS B NZ  1 
ATOM   6811 N N   . ASP B 1 348 ? 24.033  -59.070 -15.325 1.00 45.82  ? 349 ASP B N   1 
ATOM   6812 C CA  . ASP B 1 348 ? 25.438  -59.420 -15.133 1.00 54.64  ? 349 ASP B CA  1 
ATOM   6813 C C   . ASP B 1 348 ? 25.994  -59.117 -13.740 1.00 58.10  ? 349 ASP B C   1 
ATOM   6814 O O   . ASP B 1 348 ? 27.099  -59.544 -13.412 1.00 71.46  ? 349 ASP B O   1 
ATOM   6815 C CB  . ASP B 1 348 ? 26.304  -58.805 -16.240 1.00 50.64  ? 349 ASP B CB  1 
ATOM   6816 C CG  . ASP B 1 348 ? 26.066  -59.465 -17.592 1.00 53.22  ? 349 ASP B CG  1 
ATOM   6817 O OD1 . ASP B 1 348 ? 26.008  -60.716 -17.640 1.00 49.29  ? 349 ASP B OD1 1 
ATOM   6818 O OD2 . ASP B 1 348 ? 25.909  -58.738 -18.597 1.00 48.74  ? 349 ASP B OD2 1 
ATOM   6819 N N   . ASN B 1 349 ? 25.239  -58.384 -12.925 1.00 55.68  ? 350 ASN B N   1 
ATOM   6820 C CA  . ASN B 1 349 ? 25.539  -58.312 -11.492 1.00 51.03  ? 350 ASN B CA  1 
ATOM   6821 C C   . ASN B 1 349 ? 24.322  -58.642 -10.628 1.00 59.24  ? 350 ASN B C   1 
ATOM   6822 O O   . ASN B 1 349 ? 23.265  -59.016 -11.140 1.00 53.79  ? 350 ASN B O   1 
ATOM   6823 C CB  . ASN B 1 349 ? 26.227  -56.991 -11.070 1.00 44.33  ? 350 ASN B CB  1 
ATOM   6824 C CG  . ASN B 1 349 ? 25.358  -55.753 -11.279 1.00 56.51  ? 350 ASN B CG  1 
ATOM   6825 O OD1 . ASN B 1 349 ? 24.156  -55.759 -11.007 1.00 52.93  ? 350 ASN B OD1 1 
ATOM   6826 N ND2 . ASN B 1 349 ? 25.986  -54.673 -11.756 1.00 63.02  ? 350 ASN B ND2 1 
ATOM   6827 N N   . GLU B 1 350 ? 24.480  -58.508 -9.318  1.00 53.62  ? 351 GLU B N   1 
ATOM   6828 C CA  . GLU B 1 350 ? 23.450  -58.933 -8.389  1.00 42.97  ? 351 GLU B CA  1 
ATOM   6829 C C   . GLU B 1 350 ? 22.255  -57.985 -8.360  1.00 49.45  ? 351 GLU B C   1 
ATOM   6830 O O   . GLU B 1 350 ? 21.228  -58.301 -7.757  1.00 49.72  ? 351 GLU B O   1 
ATOM   6831 C CB  . GLU B 1 350 ? 24.041  -59.098 -6.985  1.00 48.88  ? 351 GLU B CB  1 
ATOM   6832 C CG  . GLU B 1 350 ? 24.759  -60.416 -6.777  1.00 53.21  ? 351 GLU B CG  1 
ATOM   6833 C CD  . GLU B 1 350 ? 23.832  -61.601 -6.985  1.00 76.49  ? 351 GLU B CD  1 
ATOM   6834 O OE1 . GLU B 1 350 ? 23.816  -62.156 -8.112  1.00 56.84  ? 351 GLU B OE1 1 
ATOM   6835 O OE2 . GLU B 1 350 ? 23.110  -61.961 -6.022  1.00 70.17  ? 351 GLU B OE2 1 
ATOM   6836 N N   . SER B 1 351 ? 22.391  -56.835 -9.017  1.00 39.13  ? 352 SER B N   1 
ATOM   6837 C CA  . SER B 1 351 ? 21.353  -55.805 -9.011  1.00 45.29  ? 352 SER B CA  1 
ATOM   6838 C C   . SER B 1 351 ? 20.852  -55.472 -7.598  1.00 45.54  ? 352 SER B C   1 
ATOM   6839 O O   . SER B 1 351 ? 19.650  -55.305 -7.373  1.00 43.92  ? 352 SER B O   1 
ATOM   6840 C CB  . SER B 1 351 ? 20.186  -56.211 -9.905  1.00 39.46  ? 352 SER B CB  1 
ATOM   6841 O OG  . SER B 1 351 ? 20.590  -56.290 -11.252 1.00 43.32  ? 352 SER B OG  1 
ATOM   6842 N N   . LEU B 1 352 ? 21.787  -55.384 -6.657  1.00 43.59  ? 353 LEU B N   1 
ATOM   6843 C CA  . LEU B 1 352 ? 21.489  -55.044 -5.267  1.00 43.33  ? 353 LEU B CA  1 
ATOM   6844 C C   . LEU B 1 352 ? 21.337  -53.537 -5.098  1.00 36.38  ? 353 LEU B C   1 
ATOM   6845 O O   . LEU B 1 352 ? 22.270  -52.859 -4.687  1.00 48.21  ? 353 LEU B O   1 
ATOM   6846 C CB  . LEU B 1 352 ? 22.611  -55.547 -4.364  1.00 29.75  ? 353 LEU B CB  1 
ATOM   6847 C CG  . LEU B 1 352 ? 22.713  -57.065 -4.245  1.00 41.23  ? 353 LEU B CG  1 
ATOM   6848 C CD1 . LEU B 1 352 ? 23.962  -57.471 -3.471  1.00 40.59  ? 353 LEU B CD1 1 
ATOM   6849 C CD2 . LEU B 1 352 ? 21.469  -57.615 -3.575  1.00 37.06  ? 353 LEU B CD2 1 
ATOM   6850 N N   . ILE B 1 353 ? 20.150  -53.024 -5.397  1.00 36.81  ? 354 ILE B N   1 
ATOM   6851 C CA  . ILE B 1 353 ? 19.909  -51.585 -5.451  1.00 37.52  ? 354 ILE B CA  1 
ATOM   6852 C C   . ILE B 1 353 ? 19.803  -50.882 -4.088  1.00 36.79  ? 354 ILE B C   1 
ATOM   6853 O O   . ILE B 1 353 ? 19.574  -51.501 -3.048  1.00 33.77  ? 354 ILE B O   1 
ATOM   6854 C CB  . ILE B 1 353 ? 18.635  -51.285 -6.261  1.00 45.20  ? 354 ILE B CB  1 
ATOM   6855 C CG1 . ILE B 1 353 ? 17.434  -52.004 -5.628  1.00 32.99  ? 354 ILE B CG1 1 
ATOM   6856 C CG2 . ILE B 1 353 ? 18.829  -51.723 -7.700  1.00 38.25  ? 354 ILE B CG2 1 
ATOM   6857 C CD1 . ILE B 1 353 ? 16.101  -51.615 -6.199  1.00 34.54  ? 354 ILE B CD1 1 
ATOM   6858 N N   . SER B 1 354 ? 19.978  -49.567 -4.127  1.00 39.96  ? 355 SER B N   1 
ATOM   6859 C CA  . SER B 1 354 ? 19.866  -48.722 -2.955  1.00 36.00  ? 355 SER B CA  1 
ATOM   6860 C C   . SER B 1 354 ? 18.434  -48.223 -2.838  1.00 47.15  ? 355 SER B C   1 
ATOM   6861 O O   . SER B 1 354 ? 17.625  -48.398 -3.760  1.00 40.39  ? 355 SER B O   1 
ATOM   6862 C CB  . SER B 1 354 ? 20.804  -47.522 -3.088  1.00 28.78  ? 355 SER B CB  1 
ATOM   6863 O OG  . SER B 1 354 ? 20.391  -46.664 -4.141  1.00 40.20  ? 355 SER B OG  1 
ATOM   6864 N N   . ARG B 1 355 ? 18.134  -47.581 -1.713  1.00 31.28  ? 356 ARG B N   1 
ATOM   6865 C CA  . ARG B 1 355 ? 16.804  -47.059 -1.455  1.00 33.14  ? 356 ARG B CA  1 
ATOM   6866 C C   . ARG B 1 355 ? 16.459  -45.995 -2.491  1.00 38.38  ? 356 ARG B C   1 
ATOM   6867 O O   . ARG B 1 355 ? 15.356  -45.978 -3.032  1.00 43.26  ? 356 ARG B O   1 
ATOM   6868 C CB  . ARG B 1 355 ? 16.724  -46.491 -0.040  1.00 34.91  ? 356 ARG B CB  1 
ATOM   6869 C CG  . ARG B 1 355 ? 15.390  -45.870 0.320   1.00 40.22  ? 356 ARG B CG  1 
ATOM   6870 C CD  . ARG B 1 355 ? 14.400  -46.917 0.765   1.00 44.71  ? 356 ARG B CD  1 
ATOM   6871 N NE  . ARG B 1 355 ? 13.103  -46.337 1.089   1.00 46.75  ? 356 ARG B NE  1 
ATOM   6872 C CZ  . ARG B 1 355 ? 11.990  -47.047 1.230   1.00 39.88  ? 356 ARG B CZ  1 
ATOM   6873 N NH1 . ARG B 1 355 ? 12.023  -48.364 1.079   1.00 31.78  ? 356 ARG B NH1 1 
ATOM   6874 N NH2 . ARG B 1 355 ? 10.845  -46.442 1.507   1.00 34.24  ? 356 ARG B NH2 1 
ATOM   6875 N N   . ALA B 1 356 ? 17.416  -45.126 -2.789  1.00 41.03  ? 357 ALA B N   1 
ATOM   6876 C CA  . ALA B 1 356 ? 17.184  -44.076 -3.772  1.00 40.62  ? 357 ALA B CA  1 
ATOM   6877 C C   . ALA B 1 356 ? 16.902  -44.669 -5.148  1.00 38.58  ? 357 ALA B C   1 
ATOM   6878 O O   . ALA B 1 356 ? 16.051  -44.169 -5.886  1.00 44.38  ? 357 ALA B O   1 
ATOM   6879 C CB  . ALA B 1 356 ? 18.362  -43.124 -3.824  1.00 30.09  ? 357 ALA B CB  1 
ATOM   6880 N N   . GLU B 1 357 ? 17.606  -45.744 -5.485  1.00 38.28  ? 358 GLU B N   1 
ATOM   6881 C CA  . GLU B 1 357 ? 17.386  -46.415 -6.761  1.00 40.08  ? 358 GLU B CA  1 
ATOM   6882 C C   . GLU B 1 357 ? 16.027  -47.122 -6.796  1.00 41.34  ? 358 GLU B C   1 
ATOM   6883 O O   . GLU B 1 357 ? 15.375  -47.180 -7.840  1.00 37.87  ? 358 GLU B O   1 
ATOM   6884 C CB  . GLU B 1 357 ? 18.508  -47.415 -7.044  1.00 44.36  ? 358 GLU B CB  1 
ATOM   6885 C CG  . GLU B 1 357 ? 19.873  -46.787 -7.245  1.00 47.45  ? 358 GLU B CG  1 
ATOM   6886 C CD  . GLU B 1 357 ? 20.944  -47.821 -7.557  1.00 58.87  ? 358 GLU B CD  1 
ATOM   6887 O OE1 . GLU B 1 357 ? 21.077  -48.808 -6.791  1.00 43.09  ? 358 GLU B OE1 1 
ATOM   6888 O OE2 . GLU B 1 357 ? 21.644  -47.649 -8.580  1.00 53.62  ? 358 GLU B OE2 1 
ATOM   6889 N N   . PHE B 1 358 ? 15.617  -47.663 -5.651  1.00 43.05  ? 359 PHE B N   1 
ATOM   6890 C CA  . PHE B 1 358 ? 14.306  -48.286 -5.503  1.00 34.40  ? 359 PHE B CA  1 
ATOM   6891 C C   . PHE B 1 358 ? 13.197  -47.280 -5.762  1.00 36.69  ? 359 PHE B C   1 
ATOM   6892 O O   . PHE B 1 358 ? 12.284  -47.550 -6.538  1.00 33.40  ? 359 PHE B O   1 
ATOM   6893 C CB  . PHE B 1 358 ? 14.141  -48.865 -4.096  1.00 32.48  ? 359 PHE B CB  1 
ATOM   6894 C CG  . PHE B 1 358 ? 12.737  -49.319 -3.780  1.00 37.39  ? 359 PHE B CG  1 
ATOM   6895 C CD1 . PHE B 1 358 ? 12.263  -50.537 -4.252  1.00 34.20  ? 359 PHE B CD1 1 
ATOM   6896 C CD2 . PHE B 1 358 ? 11.896  -48.537 -2.997  1.00 34.56  ? 359 PHE B CD2 1 
ATOM   6897 C CE1 . PHE B 1 358 ? 10.973  -50.961 -3.958  1.00 29.72  ? 359 PHE B CE1 1 
ATOM   6898 C CE2 . PHE B 1 358 ? 10.609  -48.955 -2.693  1.00 34.63  ? 359 PHE B CE2 1 
ATOM   6899 C CZ  . PHE B 1 358 ? 10.145  -50.168 -3.170  1.00 34.46  ? 359 PHE B CZ  1 
ATOM   6900 N N   . LEU B 1 359 ? 13.275  -46.126 -5.101  1.00 32.13  ? 360 LEU B N   1 
ATOM   6901 C CA  . LEU B 1 359 ? 12.268  -45.082 -5.260  1.00 31.09  ? 360 LEU B CA  1 
ATOM   6902 C C   . LEU B 1 359 ? 12.219  -44.590 -6.688  1.00 37.50  ? 360 LEU B C   1 
ATOM   6903 O O   . LEU B 1 359 ? 11.148  -44.282 -7.208  1.00 48.21  ? 360 LEU B O   1 
ATOM   6904 C CB  . LEU B 1 359 ? 12.543  -43.904 -4.330  1.00 32.40  ? 360 LEU B CB  1 
ATOM   6905 C CG  . LEU B 1 359 ? 12.551  -44.272 -2.849  1.00 37.43  ? 360 LEU B CG  1 
ATOM   6906 C CD1 . LEU B 1 359 ? 12.970  -43.080 -2.002  1.00 30.94  ? 360 LEU B CD1 1 
ATOM   6907 C CD2 . LEU B 1 359 ? 11.186  -44.810 -2.429  1.00 36.72  ? 360 LEU B CD2 1 
ATOM   6908 N N   . ALA B 1 360 ? 13.382  -44.516 -7.322  1.00 42.47  ? 361 ALA B N   1 
ATOM   6909 C CA  . ALA B 1 360 ? 13.452  -44.085 -8.707  1.00 36.68  ? 361 ALA B CA  1 
ATOM   6910 C C   . ALA B 1 360 ? 12.806  -45.142 -9.582  1.00 44.51  ? 361 ALA B C   1 
ATOM   6911 O O   . ALA B 1 360 ? 12.113  -44.823 -10.544 1.00 46.91  ? 361 ALA B O   1 
ATOM   6912 C CB  . ALA B 1 360 ? 14.891  -43.861 -9.121  1.00 40.03  ? 361 ALA B CB  1 
ATOM   6913 N N   . GLY B 1 361 ? 13.038  -46.403 -9.234  1.00 40.93  ? 362 GLY B N   1 
ATOM   6914 C CA  . GLY B 1 361 ? 12.501  -47.520 -9.988  1.00 31.61  ? 362 GLY B CA  1 
ATOM   6915 C C   . GLY B 1 361 ? 10.990  -47.558 -9.939  1.00 34.23  ? 362 GLY B C   1 
ATOM   6916 O O   . GLY B 1 361 ? 10.341  -47.915 -10.919 1.00 37.14  ? 362 GLY B O   1 
ATOM   6917 N N   . VAL B 1 362 ? 10.425  -47.178 -8.798  1.00 34.07  ? 363 VAL B N   1 
ATOM   6918 C CA  . VAL B 1 362 ? 8.979   -47.153 -8.642  1.00 30.96  ? 363 VAL B CA  1 
ATOM   6919 C C   . VAL B 1 362 ? 8.321   -46.256 -9.700  1.00 33.50  ? 363 VAL B C   1 
ATOM   6920 O O   . VAL B 1 362 ? 7.294   -46.627 -10.273 1.00 35.76  ? 363 VAL B O   1 
ATOM   6921 C CB  . VAL B 1 362 ? 8.569   -46.752 -7.198  1.00 34.78  ? 363 VAL B CB  1 
ATOM   6922 C CG1 . VAL B 1 362 ? 7.099   -46.321 -7.125  1.00 24.83  ? 363 VAL B CG1 1 
ATOM   6923 C CG2 . VAL B 1 362 ? 8.830   -47.899 -6.250  1.00 24.12  ? 363 VAL B CG2 1 
ATOM   6924 N N   . ARG B 1 363 ? 8.928   -45.100 -9.975  1.00 28.41  ? 364 ARG B N   1 
ATOM   6925 C CA  . ARG B 1 363 ? 8.406   -44.171 -10.994 1.00 43.38  ? 364 ARG B CA  1 
ATOM   6926 C C   . ARG B 1 363 ? 8.533   -44.720 -12.419 1.00 40.39  ? 364 ARG B C   1 
ATOM   6927 O O   . ARG B 1 363 ? 7.713   -44.421 -13.282 1.00 42.23  ? 364 ARG B O   1 
ATOM   6928 C CB  . ARG B 1 363 ? 9.096   -42.801 -10.923 1.00 39.60  ? 364 ARG B CB  1 
ATOM   6929 C CG  . ARG B 1 363 ? 9.084   -42.133 -9.557  1.00 34.31  ? 364 ARG B CG  1 
ATOM   6930 C CD  . ARG B 1 363 ? 7.732   -42.269 -8.868  1.00 47.80  ? 364 ARG B CD  1 
ATOM   6931 N NE  . ARG B 1 363 ? 6.619   -41.662 -9.602  1.00 55.22  ? 364 ARG B NE  1 
ATOM   6932 C CZ  . ARG B 1 363 ? 6.119   -40.454 -9.344  1.00 58.35  ? 364 ARG B CZ  1 
ATOM   6933 N NH1 . ARG B 1 363 ? 6.647   -39.702 -8.383  1.00 40.30  ? 364 ARG B NH1 1 
ATOM   6934 N NH2 . ARG B 1 363 ? 5.093   -39.996 -10.052 1.00 44.01  ? 364 ARG B NH2 1 
ATOM   6935 N N   . VAL B 1 364 ? 9.577   -45.506 -12.654 1.00 33.47  ? 365 VAL B N   1 
ATOM   6936 C CA  . VAL B 1 364 ? 9.792   -46.170 -13.932 1.00 45.12  ? 365 VAL B CA  1 
ATOM   6937 C C   . VAL B 1 364 ? 8.822   -47.337 -14.092 1.00 39.66  ? 365 VAL B C   1 
ATOM   6938 O O   . VAL B 1 364 ? 8.231   -47.527 -15.156 1.00 37.59  ? 365 VAL B O   1 
ATOM   6939 C CB  . VAL B 1 364 ? 11.238  -46.709 -14.022 1.00 43.04  ? 365 VAL B CB  1 
ATOM   6940 C CG1 . VAL B 1 364 ? 11.414  -47.591 -15.237 1.00 44.80  ? 365 VAL B CG1 1 
ATOM   6941 C CG2 . VAL B 1 364 ? 12.223  -45.562 -14.037 1.00 42.38  ? 365 VAL B CG2 1 
ATOM   6942 N N   . GLY B 1 365 ? 8.666   -48.113 -13.021 1.00 33.95  ? 366 GLY B N   1 
ATOM   6943 C CA  . GLY B 1 365 ? 7.816   -49.292 -13.027 1.00 31.37  ? 366 GLY B CA  1 
ATOM   6944 C C   . GLY B 1 365 ? 6.336   -48.970 -12.962 1.00 35.39  ? 366 GLY B C   1 
ATOM   6945 O O   . GLY B 1 365 ? 5.492   -49.738 -13.424 1.00 35.44  ? 366 GLY B O   1 
ATOM   6946 N N   . VAL B 1 366 ? 6.009   -47.826 -12.377 1.00 33.71  ? 367 VAL B N   1 
ATOM   6947 C CA  . VAL B 1 366 ? 4.618   -47.401 -12.313 1.00 34.82  ? 367 VAL B CA  1 
ATOM   6948 C C   . VAL B 1 366 ? 4.513   -46.014 -12.935 1.00 33.28  ? 367 VAL B C   1 
ATOM   6949 O O   . VAL B 1 366 ? 4.279   -45.029 -12.236 1.00 33.73  ? 367 VAL B O   1 
ATOM   6950 C CB  . VAL B 1 366 ? 4.091   -47.407 -10.854 1.00 31.16  ? 367 VAL B CB  1 
ATOM   6951 C CG1 . VAL B 1 366 ? 2.584   -47.275 -10.828 1.00 24.33  ? 367 VAL B CG1 1 
ATOM   6952 C CG2 . VAL B 1 366 ? 4.497   -48.697 -10.165 1.00 26.34  ? 367 VAL B CG2 1 
ATOM   6953 N N   . PRO B 1 367 ? 4.690   -45.934 -14.266 1.00 36.73  ? 368 PRO B N   1 
ATOM   6954 C CA  . PRO B 1 367 ? 4.780   -44.633 -14.931 1.00 29.51  ? 368 PRO B CA  1 
ATOM   6955 C C   . PRO B 1 367 ? 3.429   -43.926 -15.016 1.00 38.18  ? 368 PRO B C   1 
ATOM   6956 O O   . PRO B 1 367 ? 2.374   -44.578 -15.023 1.00 37.12  ? 368 PRO B O   1 
ATOM   6957 C CB  . PRO B 1 367 ? 5.281   -44.999 -16.325 1.00 37.89  ? 368 PRO B CB  1 
ATOM   6958 C CG  . PRO B 1 367 ? 4.707   -46.354 -16.568 1.00 40.66  ? 368 PRO B CG  1 
ATOM   6959 C CD  . PRO B 1 367 ? 4.752   -47.049 -15.230 1.00 33.87  ? 368 PRO B CD  1 
ATOM   6960 N N   . GLN B 1 368 ? 3.480   -42.597 -15.057 1.00 35.98  ? 369 GLN B N   1 
ATOM   6961 C CA  . GLN B 1 368 ? 2.299   -41.763 -15.267 1.00 45.64  ? 369 GLN B CA  1 
ATOM   6962 C C   . GLN B 1 368 ? 1.203   -41.938 -14.216 1.00 49.25  ? 369 GLN B C   1 
ATOM   6963 O O   . GLN B 1 368 ? 0.023   -42.065 -14.549 1.00 44.97  ? 369 GLN B O   1 
ATOM   6964 C CB  . GLN B 1 368 ? 1.734   -41.991 -16.668 1.00 51.49  ? 369 GLN B CB  1 
ATOM   6965 C CG  . GLN B 1 368 ? 2.762   -41.790 -17.766 1.00 59.00  ? 369 GLN B CG  1 
ATOM   6966 C CD  . GLN B 1 368 ? 2.367   -40.691 -18.723 1.00 73.59  ? 369 GLN B CD  1 
ATOM   6967 O OE1 . GLN B 1 368 ? 1.332   -40.776 -19.390 1.00 63.53  ? 369 GLN B OE1 1 
ATOM   6968 N NE2 . GLN B 1 368 ? 3.184   -39.642 -18.791 1.00 78.61  ? 369 GLN B NE2 1 
ATOM   6969 N N   . VAL B 1 369 ? 1.598   -41.953 -12.947 1.00 50.56  ? 370 VAL B N   1 
ATOM   6970 C CA  . VAL B 1 369 ? 0.639   -41.853 -11.853 1.00 39.96  ? 370 VAL B CA  1 
ATOM   6971 C C   . VAL B 1 369 ? 1.073   -40.695 -10.962 1.00 35.01  ? 370 VAL B C   1 
ATOM   6972 O O   . VAL B 1 369 ? 2.236   -40.286 -10.988 1.00 40.05  ? 370 VAL B O   1 
ATOM   6973 C CB  . VAL B 1 369 ? 0.528   -43.159 -11.040 1.00 35.58  ? 370 VAL B CB  1 
ATOM   6974 C CG1 . VAL B 1 369 ? 0.122   -44.306 -11.934 1.00 31.50  ? 370 VAL B CG1 1 
ATOM   6975 C CG2 . VAL B 1 369 ? 1.843   -43.477 -10.347 1.00 37.85  ? 370 VAL B CG2 1 
ATOM   6976 N N   . SER B 1 370 ? 0.136   -40.154 -10.191 1.00 38.54  ? 371 SER B N   1 
ATOM   6977 C CA  . SER B 1 370 ? 0.433   -39.053 -9.278  1.00 34.65  ? 371 SER B CA  1 
ATOM   6978 C C   . SER B 1 370 ? 1.505   -39.425 -8.260  1.00 39.46  ? 371 SER B C   1 
ATOM   6979 O O   . SER B 1 370 ? 1.727   -40.607 -7.978  1.00 38.58  ? 371 SER B O   1 
ATOM   6980 C CB  . SER B 1 370 ? -0.836  -38.631 -8.545  1.00 36.48  ? 371 SER B CB  1 
ATOM   6981 O OG  . SER B 1 370 ? -1.340  -39.690 -7.746  1.00 39.43  ? 371 SER B OG  1 
ATOM   6982 N N   . ASP B 1 371 ? 2.167   -38.414 -7.708  1.00 37.87  ? 372 ASP B N   1 
ATOM   6983 C CA  . ASP B 1 371 ? 3.123   -38.634 -6.627  1.00 43.84  ? 372 ASP B CA  1 
ATOM   6984 C C   . ASP B 1 371 ? 2.482   -39.398 -5.467  1.00 39.68  ? 372 ASP B C   1 
ATOM   6985 O O   . ASP B 1 371 ? 3.102   -40.284 -4.883  1.00 38.21  ? 372 ASP B O   1 
ATOM   6986 C CB  . ASP B 1 371 ? 3.694   -37.309 -6.131  1.00 39.63  ? 372 ASP B CB  1 
ATOM   6987 C CG  . ASP B 1 371 ? 4.398   -36.536 -7.224  1.00 53.14  ? 372 ASP B CG  1 
ATOM   6988 O OD1 . ASP B 1 371 ? 4.898   -37.171 -8.180  1.00 58.22  ? 372 ASP B OD1 1 
ATOM   6989 O OD2 . ASP B 1 371 ? 4.448   -35.292 -7.130  1.00 75.55  ? 372 ASP B OD2 1 
ATOM   6990 N N   . LEU B 1 372 ? 1.235   -39.068 -5.155  1.00 28.91  ? 373 LEU B N   1 
ATOM   6991 C CA  . LEU B 1 372 ? 0.533   -39.729 -4.063  1.00 38.98  ? 373 LEU B CA  1 
ATOM   6992 C C   . LEU B 1 372 ? 0.415   -41.222 -4.353  1.00 41.77  ? 373 LEU B C   1 
ATOM   6993 O O   . LEU B 1 372 ? 0.648   -42.062 -3.470  1.00 32.23  ? 373 LEU B O   1 
ATOM   6994 C CB  . LEU B 1 372 ? -0.852  -39.107 -3.836  1.00 25.82  ? 373 LEU B CB  1 
ATOM   6995 C CG  . LEU B 1 372 ? -1.686  -39.781 -2.743  1.00 43.57  ? 373 LEU B CG  1 
ATOM   6996 C CD1 . LEU B 1 372 ? -1.137  -39.470 -1.334  1.00 33.85  ? 373 LEU B CD1 1 
ATOM   6997 C CD2 . LEU B 1 372 ? -3.155  -39.400 -2.869  1.00 35.96  ? 373 LEU B CD2 1 
ATOM   6998 N N   . ALA B 1 373 ? 0.072   -41.540 -5.601  1.00 33.25  ? 374 ALA B N   1 
ATOM   6999 C CA  . ALA B 1 373 ? -0.060  -42.927 -6.046  1.00 29.25  ? 374 ALA B CA  1 
ATOM   7000 C C   . ALA B 1 373 ? 1.266   -43.640 -5.853  1.00 25.58  ? 374 ALA B C   1 
ATOM   7001 O O   . ALA B 1 373 ? 1.313   -44.745 -5.315  1.00 30.44  ? 374 ALA B O   1 
ATOM   7002 C CB  . ALA B 1 373 ? -0.490  -42.983 -7.504  1.00 35.70  ? 374 ALA B CB  1 
ATOM   7003 N N   . ALA B 1 374 ? 2.342   -42.979 -6.267  1.00 22.80  ? 375 ALA B N   1 
ATOM   7004 C CA  . ALA B 1 374 ? 3.692   -43.497 -6.078  1.00 26.93  ? 375 ALA B CA  1 
ATOM   7005 C C   . ALA B 1 374 ? 3.997   -43.722 -4.593  1.00 39.20  ? 375 ALA B C   1 
ATOM   7006 O O   . ALA B 1 374 ? 4.606   -44.730 -4.221  1.00 37.15  ? 375 ALA B O   1 
ATOM   7007 C CB  . ALA B 1 374 ? 4.707   -42.552 -6.697  1.00 25.39  ? 375 ALA B CB  1 
ATOM   7008 N N   . GLU B 1 375 ? 3.558   -42.793 -3.744  1.00 36.58  ? 376 GLU B N   1 
ATOM   7009 C CA  . GLU B 1 375 ? 3.785   -42.920 -2.311  1.00 32.50  ? 376 GLU B CA  1 
ATOM   7010 C C   . GLU B 1 375 ? 3.054   -44.148 -1.780  1.00 35.14  ? 376 GLU B C   1 
ATOM   7011 O O   . GLU B 1 375 ? 3.592   -44.892 -0.960  1.00 34.10  ? 376 GLU B O   1 
ATOM   7012 C CB  . GLU B 1 375 ? 3.335   -41.661 -1.565  1.00 41.67  ? 376 GLU B CB  1 
ATOM   7013 C CG  . GLU B 1 375 ? 4.072   -40.384 -1.956  1.00 42.89  ? 376 GLU B CG  1 
ATOM   7014 C CD  . GLU B 1 375 ? 5.507   -40.313 -1.439  1.00 62.90  ? 376 GLU B CD  1 
ATOM   7015 O OE1 . GLU B 1 375 ? 5.979   -41.271 -0.781  1.00 56.81  ? 376 GLU B OE1 1 
ATOM   7016 O OE2 . GLU B 1 375 ? 6.166   -39.280 -1.689  1.00 66.63  ? 376 GLU B OE2 1 
ATOM   7017 N N   . ALA B 1 376 ? 1.838   -44.372 -2.266  1.00 30.37  ? 377 ALA B N   1 
ATOM   7018 C CA  . ALA B 1 376 ? 1.074   -45.549 -1.863  1.00 27.88  ? 377 ALA B CA  1 
ATOM   7019 C C   . ALA B 1 376 ? 1.794   -46.845 -2.230  1.00 32.73  ? 377 ALA B C   1 
ATOM   7020 O O   . ALA B 1 376 ? 1.791   -47.807 -1.451  1.00 34.91  ? 377 ALA B O   1 
ATOM   7021 C CB  . ALA B 1 376 ? -0.311  -45.524 -2.467  1.00 26.72  ? 377 ALA B CB  1 
ATOM   7022 N N   . VAL B 1 377 ? 2.421   -46.866 -3.405  1.00 30.20  ? 378 VAL B N   1 
ATOM   7023 C CA  . VAL B 1 377 ? 3.186   -48.032 -3.822  1.00 31.77  ? 378 VAL B CA  1 
ATOM   7024 C C   . VAL B 1 377 ? 4.390   -48.246 -2.904  1.00 27.85  ? 378 VAL B C   1 
ATOM   7025 O O   . VAL B 1 377 ? 4.680   -49.369 -2.493  1.00 26.03  ? 378 VAL B O   1 
ATOM   7026 C CB  . VAL B 1 377 ? 3.684   -47.918 -5.283  1.00 27.06  ? 378 VAL B CB  1 
ATOM   7027 C CG1 . VAL B 1 377 ? 4.601   -49.093 -5.611  1.00 18.68  ? 378 VAL B CG1 1 
ATOM   7028 C CG2 . VAL B 1 377 ? 2.511   -47.865 -6.240  1.00 19.35  ? 378 VAL B CG2 1 
ATOM   7029 N N   . VAL B 1 378 ? 5.091   -47.160 -2.593  1.00 30.42  ? 379 VAL B N   1 
ATOM   7030 C CA  . VAL B 1 378 ? 6.255   -47.230 -1.716  1.00 33.76  ? 379 VAL B CA  1 
ATOM   7031 C C   . VAL B 1 378 ? 5.871   -47.721 -0.323  1.00 32.33  ? 379 VAL B C   1 
ATOM   7032 O O   . VAL B 1 378 ? 6.565   -48.547 0.261   1.00 32.42  ? 379 VAL B O   1 
ATOM   7033 C CB  . VAL B 1 378 ? 6.985   -45.880 -1.639  1.00 34.90  ? 379 VAL B CB  1 
ATOM   7034 C CG1 . VAL B 1 378 ? 8.057   -45.925 -0.587  1.00 30.37  ? 379 VAL B CG1 1 
ATOM   7035 C CG2 . VAL B 1 378 ? 7.584   -45.534 -3.003  1.00 31.85  ? 379 VAL B CG2 1 
ATOM   7036 N N   . LEU B 1 379 ? 4.741   -47.237 0.183   1.00 30.53  ? 380 LEU B N   1 
ATOM   7037 C CA  . LEU B 1 379 ? 4.228   -47.675 1.472   1.00 30.03  ? 380 LEU B CA  1 
ATOM   7038 C C   . LEU B 1 379 ? 4.003   -49.178 1.539   1.00 35.68  ? 380 LEU B C   1 
ATOM   7039 O O   . LEU B 1 379 ? 4.403   -49.828 2.503   1.00 33.71  ? 380 LEU B O   1 
ATOM   7040 C CB  . LEU B 1 379 ? 2.906   -46.983 1.803   1.00 29.42  ? 380 LEU B CB  1 
ATOM   7041 C CG  . LEU B 1 379 ? 2.232   -47.552 3.056   1.00 31.36  ? 380 LEU B CG  1 
ATOM   7042 C CD1 . LEU B 1 379 ? 2.988   -47.135 4.318   1.00 25.05  ? 380 LEU B CD1 1 
ATOM   7043 C CD2 . LEU B 1 379 ? 0.769   -47.145 3.136   1.00 33.94  ? 380 LEU B CD2 1 
ATOM   7044 N N   A HIS B 1 380 ? 3.367   -49.735 0.513   0.50 33.21  ? 381 HIS B N   1 
ATOM   7045 N N   B HIS B 1 380 ? 3.355   -49.722 0.515   0.50 33.21  ? 381 HIS B N   1 
ATOM   7046 C CA  A HIS B 1 380 ? 2.962   -51.137 0.559   0.50 32.42  ? 381 HIS B CA  1 
ATOM   7047 C CA  B HIS B 1 380 ? 2.968   -51.125 0.527   0.50 32.43  ? 381 HIS B CA  1 
ATOM   7048 C C   A HIS B 1 380 ? 4.074   -52.115 0.189   0.50 29.26  ? 381 HIS B C   1 
ATOM   7049 C C   B HIS B 1 380 ? 4.192   -52.024 0.402   0.50 29.35  ? 381 HIS B C   1 
ATOM   7050 O O   A HIS B 1 380 ? 3.974   -53.303 0.481   0.50 34.81  ? 381 HIS B O   1 
ATOM   7051 O O   B HIS B 1 380 ? 4.297   -53.043 1.084   0.50 31.79  ? 381 HIS B O   1 
ATOM   7052 C CB  A HIS B 1 380 ? 1.715   -51.380 -0.301  0.50 34.25  ? 381 HIS B CB  1 
ATOM   7053 C CB  B HIS B 1 380 ? 1.970   -51.414 -0.601  0.50 33.42  ? 381 HIS B CB  1 
ATOM   7054 C CG  A HIS B 1 380 ? 0.473   -50.740 0.243   0.50 38.91  ? 381 HIS B CG  1 
ATOM   7055 C CG  B HIS B 1 380 ? 1.153   -52.651 -0.387  0.50 30.67  ? 381 HIS B CG  1 
ATOM   7056 N ND1 A HIS B 1 380 ? -0.002  -49.527 -0.210  0.50 36.09  ? 381 HIS B ND1 1 
ATOM   7057 N ND1 B HIS B 1 380 ? -0.157  -52.618 0.042   0.50 29.13  ? 381 HIS B ND1 1 
ATOM   7058 C CD2 A HIS B 1 380 ? -0.384  -51.143 1.212   0.50 29.89  ? 381 HIS B CD2 1 
ATOM   7059 C CD2 B HIS B 1 380 ? 1.464   -53.959 -0.541  0.50 33.85  ? 381 HIS B CD2 1 
ATOM   7060 C CE1 A HIS B 1 380 ? -1.102  -49.213 0.451   0.50 33.67  ? 381 HIS B CE1 1 
ATOM   7061 C CE1 B HIS B 1 380 ? -0.619  -53.853 0.139   0.50 30.18  ? 381 HIS B CE1 1 
ATOM   7062 N NE2 A HIS B 1 380 ? -1.354  -50.176 1.321   0.50 35.52  ? 381 HIS B NE2 1 
ATOM   7063 N NE2 B HIS B 1 380 ? 0.348   -54.687 -0.204  0.50 32.99  ? 381 HIS B NE2 1 
ATOM   7064 N N   . TYR B 1 381 ? 5.132   -51.622 -0.446  1.00 26.67  ? 382 TYR B N   1 
ATOM   7065 C CA  . TYR B 1 381 ? 6.253   -52.490 -0.815  1.00 25.12  ? 382 TYR B CA  1 
ATOM   7066 C C   . TYR B 1 381 ? 7.523   -52.270 0.004   1.00 27.07  ? 382 TYR B C   1 
ATOM   7067 O O   . TYR B 1 381 ? 8.510   -52.986 -0.159  1.00 35.12  ? 382 TYR B O   1 
ATOM   7068 C CB  . TYR B 1 381 ? 6.536   -52.403 -2.324  1.00 22.76  ? 382 TYR B CB  1 
ATOM   7069 C CG  . TYR B 1 381 ? 5.491   -53.130 -3.129  1.00 28.66  ? 382 TYR B CG  1 
ATOM   7070 C CD1 . TYR B 1 381 ? 5.695   -54.444 -3.545  1.00 23.56  ? 382 TYR B CD1 1 
ATOM   7071 C CD2 . TYR B 1 381 ? 4.278   -52.518 -3.441  1.00 24.75  ? 382 TYR B CD2 1 
ATOM   7072 C CE1 . TYR B 1 381 ? 4.728   -55.122 -4.273  1.00 23.38  ? 382 TYR B CE1 1 
ATOM   7073 C CE2 . TYR B 1 381 ? 3.305   -53.187 -4.167  1.00 25.65  ? 382 TYR B CE2 1 
ATOM   7074 C CZ  . TYR B 1 381 ? 3.533   -54.485 -4.574  1.00 23.85  ? 382 TYR B CZ  1 
ATOM   7075 O OH  . TYR B 1 381 ? 2.565   -55.146 -5.278  1.00 25.80  ? 382 TYR B OH  1 
ATOM   7076 N N   . THR B 1 382 ? 7.504   -51.284 0.887   1.00 27.75  ? 383 THR B N   1 
ATOM   7077 C CA  . THR B 1 382 ? 8.618   -51.105 1.808   1.00 32.92  ? 383 THR B CA  1 
ATOM   7078 C C   . THR B 1 382 ? 8.424   -51.985 3.041   1.00 28.73  ? 383 THR B C   1 
ATOM   7079 O O   . THR B 1 382 ? 7.316   -52.077 3.567   1.00 29.80  ? 383 THR B O   1 
ATOM   7080 C CB  . THR B 1 382 ? 8.748   -49.635 2.226   1.00 33.01  ? 383 THR B CB  1 
ATOM   7081 O OG1 . THR B 1 382 ? 9.152   -48.856 1.087   1.00 32.03  ? 383 THR B OG1 1 
ATOM   7082 C CG2 . THR B 1 382 ? 9.769   -49.479 3.346   1.00 28.04  ? 383 THR B CG2 1 
ATOM   7083 N N   . ASP B 1 383 ? 9.479   -52.670 3.468   1.00 26.75  ? 384 ASP B N   1 
ATOM   7084 C CA  . ASP B 1 383 ? 9.479   -53.319 4.779   1.00 29.07  ? 384 ASP B CA  1 
ATOM   7085 C C   . ASP B 1 383 ? 10.068  -52.308 5.754   1.00 31.51  ? 384 ASP B C   1 
ATOM   7086 O O   . ASP B 1 383 ? 11.252  -51.975 5.678   1.00 26.99  ? 384 ASP B O   1 
ATOM   7087 C CB  . ASP B 1 383 ? 10.337  -54.586 4.771   1.00 32.47  ? 384 ASP B CB  1 
ATOM   7088 C CG  . ASP B 1 383 ? 10.375  -55.293 6.137   1.00 40.44  ? 384 ASP B CG  1 
ATOM   7089 O OD1 . ASP B 1 383 ? 10.024  -54.678 7.169   1.00 36.71  ? 384 ASP B OD1 1 
ATOM   7090 O OD2 . ASP B 1 383 ? 10.767  -56.478 6.181   1.00 41.39  ? 384 ASP B OD2 1 
ATOM   7091 N N   . TRP B 1 384 ? 9.253   -51.832 6.683   1.00 32.63  ? 385 TRP B N   1 
ATOM   7092 C CA  . TRP B 1 384 ? 9.673   -50.706 7.514   1.00 36.33  ? 385 TRP B CA  1 
ATOM   7093 C C   . TRP B 1 384 ? 10.567  -51.082 8.691   1.00 34.25  ? 385 TRP B C   1 
ATOM   7094 O O   . TRP B 1 384 ? 11.030  -50.211 9.434   1.00 33.45  ? 385 TRP B O   1 
ATOM   7095 C CB  . TRP B 1 384 ? 8.469   -49.873 7.934   1.00 29.93  ? 385 TRP B CB  1 
ATOM   7096 C CG  . TRP B 1 384 ? 7.801   -49.290 6.739   1.00 32.94  ? 385 TRP B CG  1 
ATOM   7097 C CD1 . TRP B 1 384 ? 6.729   -49.803 6.060   1.00 28.96  ? 385 TRP B CD1 1 
ATOM   7098 C CD2 . TRP B 1 384 ? 8.186   -48.104 6.044   1.00 30.91  ? 385 TRP B CD2 1 
ATOM   7099 N NE1 . TRP B 1 384 ? 6.410   -48.992 4.996   1.00 32.05  ? 385 TRP B NE1 1 
ATOM   7100 C CE2 . TRP B 1 384 ? 7.287   -47.939 4.966   1.00 31.43  ? 385 TRP B CE2 1 
ATOM   7101 C CE3 . TRP B 1 384 ? 9.194   -47.156 6.234   1.00 26.89  ? 385 TRP B CE3 1 
ATOM   7102 C CZ2 . TRP B 1 384 ? 7.374   -46.870 4.081   1.00 30.76  ? 385 TRP B CZ2 1 
ATOM   7103 C CZ3 . TRP B 1 384 ? 9.274   -46.094 5.359   1.00 31.82  ? 385 TRP B CZ3 1 
ATOM   7104 C CH2 . TRP B 1 384 ? 8.370   -45.958 4.294   1.00 32.37  ? 385 TRP B CH2 1 
ATOM   7105 N N   . LEU B 1 385 ? 10.829  -52.378 8.830   1.00 34.08  ? 386 LEU B N   1 
ATOM   7106 C CA  . LEU B 1 385 ? 11.867  -52.864 9.735   1.00 34.55  ? 386 LEU B CA  1 
ATOM   7107 C C   . LEU B 1 385 ? 13.219  -52.986 9.027   1.00 40.01  ? 386 LEU B C   1 
ATOM   7108 O O   . LEU B 1 385 ? 14.256  -53.172 9.672   1.00 38.44  ? 386 LEU B O   1 
ATOM   7109 C CB  . LEU B 1 385 ? 11.467  -54.215 10.315  1.00 36.51  ? 386 LEU B CB  1 
ATOM   7110 C CG  . LEU B 1 385 ? 10.366  -54.098 11.364  1.00 44.05  ? 386 LEU B CG  1 
ATOM   7111 C CD1 . LEU B 1 385 ? 9.994   -55.465 11.917  1.00 34.93  ? 386 LEU B CD1 1 
ATOM   7112 C CD2 . LEU B 1 385 ? 10.825  -53.162 12.465  1.00 40.88  ? 386 LEU B CD2 1 
ATOM   7113 N N   . HIS B 1 386 ? 13.189  -52.895 7.697   1.00 35.66  ? 387 HIS B N   1 
ATOM   7114 C CA  . HIS B 1 386 ? 14.385  -52.989 6.861   1.00 35.27  ? 387 HIS B CA  1 
ATOM   7115 C C   . HIS B 1 386 ? 14.202  -52.126 5.613   1.00 41.53  ? 387 HIS B C   1 
ATOM   7116 O O   . HIS B 1 386 ? 14.186  -52.651 4.507   1.00 33.04  ? 387 HIS B O   1 
ATOM   7117 C CB  . HIS B 1 386 ? 14.616  -54.437 6.407   1.00 32.23  ? 387 HIS B CB  1 
ATOM   7118 C CG  . HIS B 1 386 ? 14.652  -55.433 7.527   1.00 35.55  ? 387 HIS B CG  1 
ATOM   7119 N ND1 . HIS B 1 386 ? 15.792  -55.695 8.256   1.00 40.75  ? 387 HIS B ND1 1 
ATOM   7120 C CD2 . HIS B 1 386 ? 13.691  -56.242 8.032   1.00 32.56  ? 387 HIS B CD2 1 
ATOM   7121 C CE1 . HIS B 1 386 ? 15.530  -56.616 9.167   1.00 32.84  ? 387 HIS B CE1 1 
ATOM   7122 N NE2 . HIS B 1 386 ? 14.261  -56.964 9.052   1.00 41.83  ? 387 HIS B NE2 1 
ATOM   7123 N N   . PRO B 1 387 ? 14.051  -50.802 5.781   1.00 48.00  ? 388 PRO B N   1 
ATOM   7124 C CA  . PRO B 1 387 ? 13.696  -49.987 4.609   1.00 27.61  ? 388 PRO B CA  1 
ATOM   7125 C C   . PRO B 1 387 ? 14.801  -49.878 3.569   1.00 38.96  ? 388 PRO B C   1 
ATOM   7126 O O   . PRO B 1 387 ? 14.520  -49.478 2.438   1.00 40.88  ? 388 PRO B O   1 
ATOM   7127 C CB  . PRO B 1 387 ? 13.423  -48.604 5.211   1.00 34.81  ? 388 PRO B CB  1 
ATOM   7128 C CG  . PRO B 1 387 ? 14.237  -48.581 6.486   1.00 32.24  ? 388 PRO B CG  1 
ATOM   7129 C CD  . PRO B 1 387 ? 14.163  -49.990 7.010   1.00 26.57  ? 388 PRO B CD  1 
ATOM   7130 N N   . GLU B 1 388 ? 16.030  -50.231 3.927   1.00 42.56  ? 389 GLU B N   1 
ATOM   7131 C CA  . GLU B 1 388 ? 17.155  -49.955 3.035   1.00 37.23  ? 389 GLU B CA  1 
ATOM   7132 C C   . GLU B 1 388 ? 17.982  -51.165 2.645   1.00 33.94  ? 389 GLU B C   1 
ATOM   7133 O O   . GLU B 1 388 ? 19.016  -51.026 2.006   1.00 40.49  ? 389 GLU B O   1 
ATOM   7134 C CB  . GLU B 1 388 ? 18.042  -48.863 3.630   1.00 32.97  ? 389 GLU B CB  1 
ATOM   7135 C CG  . GLU B 1 388 ? 17.298  -47.549 3.757   1.00 43.38  ? 389 GLU B CG  1 
ATOM   7136 C CD  . GLU B 1 388 ? 18.183  -46.421 4.182   1.00 60.87  ? 389 GLU B CD  1 
ATOM   7137 O OE1 . GLU B 1 388 ? 18.154  -46.071 5.382   1.00 78.86  ? 389 GLU B OE1 1 
ATOM   7138 O OE2 . GLU B 1 388 ? 18.906  -45.884 3.314   1.00 79.75  ? 389 GLU B OE2 1 
ATOM   7139 N N   . ASP B 1 389 ? 17.519  -52.351 3.013   1.00 31.50  ? 390 ASP B N   1 
ATOM   7140 C CA  . ASP B 1 389 ? 18.213  -53.573 2.643   1.00 35.14  ? 390 ASP B CA  1 
ATOM   7141 C C   . ASP B 1 389 ? 18.183  -53.791 1.118   1.00 34.61  ? 390 ASP B C   1 
ATOM   7142 O O   . ASP B 1 389 ? 17.118  -53.963 0.532   1.00 36.17  ? 390 ASP B O   1 
ATOM   7143 C CB  . ASP B 1 389 ? 17.573  -54.757 3.357   1.00 25.83  ? 390 ASP B CB  1 
ATOM   7144 C CG  . ASP B 1 389 ? 18.246  -56.061 3.016   1.00 43.24  ? 390 ASP B CG  1 
ATOM   7145 O OD1 . ASP B 1 389 ? 19.446  -56.023 2.679   1.00 47.91  ? 390 ASP B OD1 1 
ATOM   7146 O OD2 . ASP B 1 389 ? 17.589  -57.120 3.085   1.00 50.06  ? 390 ASP B OD2 1 
ATOM   7147 N N   . PRO B 1 390 ? 19.355  -53.789 0.476   1.00 42.12  ? 391 PRO B N   1 
ATOM   7148 C CA  . PRO B 1 390 ? 19.412  -53.888 -0.993  1.00 41.42  ? 391 PRO B CA  1 
ATOM   7149 C C   . PRO B 1 390 ? 18.722  -55.126 -1.573  1.00 34.05  ? 391 PRO B C   1 
ATOM   7150 O O   . PRO B 1 390 ? 17.980  -54.986 -2.539  1.00 37.12  ? 391 PRO B O   1 
ATOM   7151 C CB  . PRO B 1 390 ? 20.915  -53.913 -1.288  1.00 44.35  ? 391 PRO B CB  1 
ATOM   7152 C CG  . PRO B 1 390 ? 21.542  -53.219 -0.091  1.00 37.78  ? 391 PRO B CG  1 
ATOM   7153 C CD  . PRO B 1 390 ? 20.692  -53.629 1.076   1.00 37.66  ? 391 PRO B CD  1 
ATOM   7154 N N   . ALA B 1 391 ? 18.939  -56.302 -0.999  1.00 32.62  ? 392 ALA B N   1 
ATOM   7155 C CA  . ALA B 1 391 ? 18.312  -57.510 -1.533  1.00 38.45  ? 392 ALA B CA  1 
ATOM   7156 C C   . ALA B 1 391 ? 16.793  -57.462 -1.429  1.00 36.24  ? 392 ALA B C   1 
ATOM   7157 O O   . ALA B 1 391 ? 16.097  -57.860 -2.361  1.00 43.90  ? 392 ALA B O   1 
ATOM   7158 C CB  . ALA B 1 391 ? 18.854  -58.763 -0.857  1.00 31.61  ? 392 ALA B CB  1 
ATOM   7159 N N   . ARG B 1 392 ? 16.282  -56.971 -0.302  1.00 39.87  ? 393 ARG B N   1 
ATOM   7160 C CA  . ARG B 1 392 ? 14.839  -56.813 -0.121  1.00 35.24  ? 393 ARG B CA  1 
ATOM   7161 C C   . ARG B 1 392 ? 14.254  -55.807 -1.109  1.00 34.01  ? 393 ARG B C   1 
ATOM   7162 O O   . ARG B 1 392 ? 13.169  -56.022 -1.643  1.00 32.38  ? 393 ARG B O   1 
ATOM   7163 C CB  . ARG B 1 392 ? 14.498  -56.396 1.313   1.00 28.38  ? 393 ARG B CB  1 
ATOM   7164 C CG  . ARG B 1 392 ? 14.460  -57.554 2.310   1.00 30.40  ? 393 ARG B CG  1 
ATOM   7165 C CD  . ARG B 1 392 ? 14.036  -57.047 3.681   1.00 36.98  ? 393 ARG B CD  1 
ATOM   7166 N NE  . ARG B 1 392 ? 13.905  -58.110 4.671   1.00 44.41  ? 393 ARG B NE  1 
ATOM   7167 C CZ  . ARG B 1 392 ? 14.905  -58.543 5.432   1.00 40.30  ? 393 ARG B CZ  1 
ATOM   7168 N NH1 . ARG B 1 392 ? 16.113  -58.012 5.311   1.00 38.56  ? 393 ARG B NH1 1 
ATOM   7169 N NH2 . ARG B 1 392 ? 14.698  -59.507 6.312   1.00 44.25  ? 393 ARG B NH2 1 
ATOM   7170 N N   . LEU B 1 393 ? 14.977  -54.714 -1.335  1.00 25.18  ? 394 LEU B N   1 
ATOM   7171 C CA  . LEU B 1 393 ? 14.574  -53.685 -2.286  1.00 29.01  ? 394 LEU B CA  1 
ATOM   7172 C C   . LEU B 1 393 ? 14.488  -54.217 -3.720  1.00 37.03  ? 394 LEU B C   1 
ATOM   7173 O O   . LEU B 1 393 ? 13.533  -53.930 -4.443  1.00 32.56  ? 394 LEU B O   1 
ATOM   7174 C CB  . LEU B 1 393 ? 15.544  -52.507 -2.221  1.00 31.74  ? 394 LEU B CB  1 
ATOM   7175 C CG  . LEU B 1 393 ? 15.470  -51.665 -0.942  1.00 36.32  ? 394 LEU B CG  1 
ATOM   7176 C CD1 . LEU B 1 393 ? 16.675  -50.751 -0.833  1.00 34.25  ? 394 LEU B CD1 1 
ATOM   7177 C CD2 . LEU B 1 393 ? 14.189  -50.847 -0.920  1.00 29.80  ? 394 LEU B CD2 1 
ATOM   7178 N N   . ARG B 1 394 ? 15.487  -54.996 -4.118  1.00 36.79  ? 395 ARG B N   1 
ATOM   7179 C CA  . ARG B 1 394 ? 15.498  -55.647 -5.422  1.00 32.96  ? 395 ARG B CA  1 
ATOM   7180 C C   . ARG B 1 394 ? 14.277  -56.547 -5.604  1.00 30.15  ? 395 ARG B C   1 
ATOM   7181 O O   . ARG B 1 394 ? 13.595  -56.476 -6.622  1.00 30.31  ? 395 ARG B O   1 
ATOM   7182 C CB  . ARG B 1 394 ? 16.779  -56.461 -5.590  1.00 31.23  ? 395 ARG B CB  1 
ATOM   7183 C CG  . ARG B 1 394 ? 16.920  -57.150 -6.931  1.00 32.49  ? 395 ARG B CG  1 
ATOM   7184 C CD  . ARG B 1 394 ? 18.114  -58.082 -6.926  1.00 38.35  ? 395 ARG B CD  1 
ATOM   7185 N NE  . ARG B 1 394 ? 17.939  -59.168 -5.970  1.00 36.45  ? 395 ARG B NE  1 
ATOM   7186 C CZ  . ARG B 1 394 ? 18.926  -59.932 -5.521  1.00 41.27  ? 395 ARG B CZ  1 
ATOM   7187 N NH1 . ARG B 1 394 ? 20.165  -59.727 -5.934  1.00 45.56  ? 395 ARG B NH1 1 
ATOM   7188 N NH2 . ARG B 1 394 ? 18.677  -60.896 -4.649  1.00 40.96  ? 395 ARG B NH2 1 
ATOM   7189 N N   A GLU B 1 395 ? 14.010  -57.392 -4.614  0.56 34.74  ? 396 GLU B N   1 
ATOM   7190 N N   B GLU B 1 395 ? 14.009  -57.383 -4.604  0.44 34.72  ? 396 GLU B N   1 
ATOM   7191 C CA  A GLU B 1 395 ? 12.850  -58.277 -4.653  0.56 35.59  ? 396 GLU B CA  1 
ATOM   7192 C CA  B GLU B 1 395 ? 12.855  -58.279 -4.625  0.44 35.54  ? 396 GLU B CA  1 
ATOM   7193 C C   A GLU B 1 395 ? 11.546  -57.476 -4.697  0.56 34.21  ? 396 GLU B C   1 
ATOM   7194 C C   B GLU B 1 395 ? 11.548  -57.487 -4.679  0.44 34.20  ? 396 GLU B C   1 
ATOM   7195 O O   A GLU B 1 395 ? 10.600  -57.844 -5.393  0.56 35.28  ? 396 GLU B O   1 
ATOM   7196 O O   B GLU B 1 395 ? 10.601  -57.874 -5.364  0.44 35.25  ? 396 GLU B O   1 
ATOM   7197 C CB  A GLU B 1 395 ? 12.857  -59.222 -3.448  0.56 31.18  ? 396 GLU B CB  1 
ATOM   7198 C CB  B GLU B 1 395 ? 12.868  -59.202 -3.398  0.44 31.26  ? 396 GLU B CB  1 
ATOM   7199 C CG  A GLU B 1 395 ? 13.227  -60.670 -3.753  0.56 32.74  ? 396 GLU B CG  1 
ATOM   7200 C CG  B GLU B 1 395 ? 11.749  -60.240 -3.376  0.44 31.84  ? 396 GLU B CG  1 
ATOM   7201 C CD  A GLU B 1 395 ? 14.664  -60.838 -4.230  0.56 45.27  ? 396 GLU B CD  1 
ATOM   7202 C CD  B GLU B 1 395 ? 11.485  -60.825 -1.989  0.44 38.93  ? 396 GLU B CD  1 
ATOM   7203 O OE1 A GLU B 1 395 ? 14.937  -60.588 -5.432  0.56 46.30  ? 396 GLU B OE1 1 
ATOM   7204 O OE1 B GLU B 1 395 ? 12.208  -60.481 -1.023  0.44 29.47  ? 396 GLU B OE1 1 
ATOM   7205 O OE2 A GLU B 1 395 ? 15.517  -61.231 -3.403  0.56 34.03  ? 396 GLU B OE2 1 
ATOM   7206 O OE2 B GLU B 1 395 ? 10.537  -61.629 -1.870  0.44 34.94  ? 396 GLU B OE2 1 
ATOM   7207 N N   . ALA B 1 396 ? 11.512  -56.368 -3.965  1.00 29.56  ? 397 ALA B N   1 
ATOM   7208 C CA  . ALA B 1 396 ? 10.314  -55.541 -3.890  1.00 31.01  ? 397 ALA B CA  1 
ATOM   7209 C C   . ALA B 1 396 ? 9.999   -54.841 -5.216  1.00 30.49  ? 397 ALA B C   1 
ATOM   7210 O O   . ALA B 1 396 ? 8.850   -54.818 -5.647  1.00 32.79  ? 397 ALA B O   1 
ATOM   7211 C CB  . ALA B 1 396 ? 10.437  -54.529 -2.760  1.00 24.83  ? 397 ALA B CB  1 
ATOM   7212 N N   . LEU B 1 397 ? 11.011  -54.269 -5.857  1.00 25.24  ? 398 LEU B N   1 
ATOM   7213 C CA  . LEU B 1 397 ? 10.805  -53.636 -7.154  1.00 34.81  ? 398 LEU B CA  1 
ATOM   7214 C C   . LEU B 1 397 ? 10.320  -54.668 -8.167  1.00 34.18  ? 398 LEU B C   1 
ATOM   7215 O O   . LEU B 1 397 ? 9.418   -54.393 -8.955  1.00 32.65  ? 398 LEU B O   1 
ATOM   7216 C CB  . LEU B 1 397 ? 12.071  -52.943 -7.665  1.00 29.61  ? 398 LEU B CB  1 
ATOM   7217 C CG  . LEU B 1 397 ? 11.765  -51.982 -8.811  1.00 32.87  ? 398 LEU B CG  1 
ATOM   7218 C CD1 . LEU B 1 397 ? 10.731  -50.954 -8.358  1.00 33.80  ? 398 LEU B CD1 1 
ATOM   7219 C CD2 . LEU B 1 397 ? 13.020  -51.298 -9.311  1.00 25.75  ? 398 LEU B CD2 1 
ATOM   7220 N N   . SER B 1 398 ? 10.904  -55.859 -8.122  1.00 27.81  ? 399 SER B N   1 
ATOM   7221 C CA  . SER B 1 398 ? 10.455  -56.951 -8.976  1.00 34.82  ? 399 SER B CA  1 
ATOM   7222 C C   . SER B 1 398 ? 8.968   -57.259 -8.743  1.00 30.02  ? 399 SER B C   1 
ATOM   7223 O O   . SER B 1 398 ? 8.203   -57.416 -9.698  1.00 34.50  ? 399 SER B O   1 
ATOM   7224 C CB  . SER B 1 398 ? 11.336  -58.195 -8.778  1.00 29.82  ? 399 SER B CB  1 
ATOM   7225 O OG  . SER B 1 398 ? 10.808  -59.329 -9.447  1.00 36.17  ? 399 SER B OG  1 
ATOM   7226 N N   . ASP B 1 399 ? 8.563   -57.323 -7.481  1.00 22.99  ? 400 ASP B N   1 
ATOM   7227 C CA  . ASP B 1 399 ? 7.158   -57.538 -7.132  1.00 24.87  ? 400 ASP B CA  1 
ATOM   7228 C C   . ASP B 1 399 ? 6.278   -56.385 -7.599  1.00 24.31  ? 400 ASP B C   1 
ATOM   7229 O O   . ASP B 1 399 ? 5.195   -56.607 -8.125  1.00 27.06  ? 400 ASP B O   1 
ATOM   7230 C CB  . ASP B 1 399 ? 6.978   -57.738 -5.618  1.00 29.20  ? 400 ASP B CB  1 
ATOM   7231 C CG  . ASP B 1 399 ? 7.577   -59.051 -5.119  1.00 39.11  ? 400 ASP B CG  1 
ATOM   7232 O OD1 . ASP B 1 399 ? 7.705   -59.998 -5.933  1.00 44.08  ? 400 ASP B OD1 1 
ATOM   7233 O OD2 . ASP B 1 399 ? 7.915   -59.131 -3.910  1.00 51.33  ? 400 ASP B OD2 1 
ATOM   7234 N N   . VAL B 1 400 ? 6.735   -55.153 -7.408  1.00 23.91  ? 401 VAL B N   1 
ATOM   7235 C CA  . VAL B 1 400 ? 5.976   -54.004 -7.886  1.00 26.56  ? 401 VAL B CA  1 
ATOM   7236 C C   . VAL B 1 400 ? 5.674   -54.143 -9.376  1.00 30.08  ? 401 VAL B C   1 
ATOM   7237 O O   . VAL B 1 400 ? 4.512   -54.120 -9.797  1.00 25.23  ? 401 VAL B O   1 
ATOM   7238 C CB  . VAL B 1 400 ? 6.735   -52.686 -7.658  1.00 33.13  ? 401 VAL B CB  1 
ATOM   7239 C CG1 . VAL B 1 400 ? 6.057   -51.552 -8.403  1.00 21.84  ? 401 VAL B CG1 1 
ATOM   7240 C CG2 . VAL B 1 400 ? 6.823   -52.375 -6.171  1.00 27.09  ? 401 VAL B CG2 1 
ATOM   7241 N N   . VAL B 1 401 ? 6.724   -54.320 -10.171 1.00 30.73  ? 402 VAL B N   1 
ATOM   7242 C CA  . VAL B 1 401 ? 6.564   -54.415 -11.611 1.00 27.57  ? 402 VAL B CA  1 
ATOM   7243 C C   . VAL B 1 401 ? 5.729   -55.636 -11.982 1.00 28.63  ? 402 VAL B C   1 
ATOM   7244 O O   . VAL B 1 401 ? 4.807   -55.543 -12.785 1.00 26.07  ? 402 VAL B O   1 
ATOM   7245 C CB  . VAL B 1 401 ? 7.916   -54.460 -12.315 1.00 30.78  ? 402 VAL B CB  1 
ATOM   7246 C CG1 . VAL B 1 401 ? 7.728   -54.718 -13.806 1.00 20.77  ? 402 VAL B CG1 1 
ATOM   7247 C CG2 . VAL B 1 401 ? 8.651   -53.167 -12.079 1.00 25.45  ? 402 VAL B CG2 1 
ATOM   7248 N N   . GLY B 1 402 ? 6.031   -56.774 -11.368 1.00 28.97  ? 403 GLY B N   1 
ATOM   7249 C CA  . GLY B 1 402 ? 5.307   -57.998 -11.662 1.00 25.14  ? 403 GLY B CA  1 
ATOM   7250 C C   . GLY B 1 402 ? 3.852   -57.991 -11.237 1.00 32.21  ? 403 GLY B C   1 
ATOM   7251 O O   . GLY B 1 402 ? 2.997   -58.458 -11.988 1.00 26.94  ? 403 GLY B O   1 
ATOM   7252 N N   . ASP B 1 403 ? 3.565   -57.476 -10.037 1.00 28.96  ? 404 ASP B N   1 
ATOM   7253 C CA  . ASP B 1 403 ? 2.190   -57.429 -9.526  1.00 25.92  ? 404 ASP B CA  1 
ATOM   7254 C C   . ASP B 1 403 ? 1.310   -56.516 -10.366 1.00 29.09  ? 404 ASP B C   1 
ATOM   7255 O O   . ASP B 1 403 ? 0.211   -56.893 -10.771 1.00 30.64  ? 404 ASP B O   1 
ATOM   7256 C CB  . ASP B 1 403 ? 2.149   -56.947 -8.067  1.00 27.66  ? 404 ASP B CB  1 
ATOM   7257 C CG  . ASP B 1 403 ? 2.793   -57.933 -7.106  1.00 30.38  ? 404 ASP B CG  1 
ATOM   7258 O OD1 . ASP B 1 403 ? 3.008   -59.095 -7.508  1.00 35.21  ? 404 ASP B OD1 1 
ATOM   7259 O OD2 . ASP B 1 403 ? 3.092   -57.549 -5.957  1.00 31.35  ? 404 ASP B OD2 1 
ATOM   7260 N N   . HIS B 1 404 ? 1.811   -55.307 -10.595 1.00 26.21  ? 405 HIS B N   1 
ATOM   7261 C CA  . HIS B 1 404 ? 1.112   -54.255 -11.322 1.00 27.61  ? 405 HIS B CA  1 
ATOM   7262 C C   . HIS B 1 404 ? 0.765   -54.668 -12.757 1.00 28.52  ? 405 HIS B C   1 
ATOM   7263 O O   . HIS B 1 404 ? -0.362  -54.475 -13.225 1.00 25.77  ? 405 HIS B O   1 
ATOM   7264 C CB  . HIS B 1 404 ? 2.004   -53.014 -11.340 1.00 25.33  ? 405 HIS B CB  1 
ATOM   7265 C CG  . HIS B 1 404 ? 1.439   -51.854 -12.097 1.00 32.65  ? 405 HIS B CG  1 
ATOM   7266 N ND1 . HIS B 1 404 ? 0.139   -51.423 -11.947 1.00 32.57  ? 405 HIS B ND1 1 
ATOM   7267 C CD2 . HIS B 1 404 ? 2.013   -51.013 -12.992 1.00 31.93  ? 405 HIS B CD2 1 
ATOM   7268 C CE1 . HIS B 1 404 ? -0.064  -50.367 -12.712 1.00 24.26  ? 405 HIS B CE1 1 
ATOM   7269 N NE2 . HIS B 1 404 ? 1.056   -50.101 -13.361 1.00 36.88  ? 405 HIS B NE2 1 
ATOM   7270 N N   . ASN B 1 405 ? 1.734   -55.250 -13.447 1.00 23.37  ? 406 ASN B N   1 
ATOM   7271 C CA  . ASN B 1 405 ? 1.570   -55.566 -14.861 1.00 23.51  ? 406 ASN B CA  1 
ATOM   7272 C C   . ASN B 1 405 ? 0.980   -56.945 -15.169 1.00 26.34  ? 406 ASN B C   1 
ATOM   7273 O O   . ASN B 1 405 ? 0.326   -57.112 -16.183 1.00 29.25  ? 406 ASN B O   1 
ATOM   7274 C CB  . ASN B 1 405 ? 2.898   -55.379 -15.588 1.00 21.38  ? 406 ASN B CB  1 
ATOM   7275 C CG  . ASN B 1 405 ? 3.329   -53.929 -15.625 1.00 27.16  ? 406 ASN B CG  1 
ATOM   7276 O OD1 . ASN B 1 405 ? 2.705   -53.109 -16.290 1.00 29.48  ? 406 ASN B OD1 1 
ATOM   7277 N ND2 . ASN B 1 405 ? 4.402   -53.605 -14.914 1.00 25.43  ? 406 ASN B ND2 1 
ATOM   7278 N N   . VAL B 1 406 ? 1.200   -57.927 -14.296 1.00 22.91  ? 407 VAL B N   1 
ATOM   7279 C CA  . VAL B 1 406 ? 0.817   -59.301 -14.609 1.00 21.63  ? 407 VAL B CA  1 
ATOM   7280 C C   . VAL B 1 406 ? -0.033  -60.000 -13.546 1.00 27.89  ? 407 VAL B C   1 
ATOM   7281 O O   . VAL B 1 406 ? -1.185  -60.348 -13.816 1.00 28.33  ? 407 VAL B O   1 
ATOM   7282 C CB  . VAL B 1 406 ? 2.052   -60.185 -14.906 1.00 23.52  ? 407 VAL B CB  1 
ATOM   7283 C CG1 . VAL B 1 406 ? 1.621   -61.595 -15.259 1.00 21.66  ? 407 VAL B CG1 1 
ATOM   7284 C CG2 . VAL B 1 406 ? 2.869   -59.590 -16.021 1.00 23.56  ? 407 VAL B CG2 1 
ATOM   7285 N N   . VAL B 1 407 ? 0.533   -60.224 -12.357 1.00 25.15  ? 408 VAL B N   1 
ATOM   7286 C CA  . VAL B 1 407 ? -0.151  -61.018 -11.335 1.00 29.54  ? 408 VAL B CA  1 
ATOM   7287 C C   . VAL B 1 407 ? -1.513  -60.449 -10.946 1.00 29.53  ? 408 VAL B C   1 
ATOM   7288 O O   . VAL B 1 407 ? -2.516  -61.165 -10.926 1.00 34.18  ? 408 VAL B O   1 
ATOM   7289 C CB  . VAL B 1 407 ? 0.674   -61.212 -10.035 1.00 35.48  ? 408 VAL B CB  1 
ATOM   7290 C CG1 . VAL B 1 407 ? -0.055  -62.180 -9.122  1.00 22.12  ? 408 VAL B CG1 1 
ATOM   7291 C CG2 . VAL B 1 407 ? 2.073   -61.733 -10.330 1.00 21.46  ? 408 VAL B CG2 1 
ATOM   7292 N N   . CYS B 1 408 ? -1.565  -59.163 -10.638 1.00 25.36  ? 409 CYS B N   1 
ATOM   7293 C CA  . CYS B 1 408 ? -2.841  -58.590 -10.224 1.00 21.70  ? 409 CYS B CA  1 
ATOM   7294 C C   . CYS B 1 408 ? -3.894  -58.487 -11.362 1.00 29.95  ? 409 CYS B C   1 
ATOM   7295 O O   . CYS B 1 408 ? -5.058  -58.836 -11.149 1.00 28.49  ? 409 CYS B O   1 
ATOM   7296 C CB  . CYS B 1 408 ? -2.632  -57.290 -9.439  1.00 29.24  ? 409 CYS B CB  1 
ATOM   7297 S SG  . CYS B 1 408 ? -1.598  -57.545 -7.937  1.00 31.36  ? 409 CYS B SG  1 
ATOM   7298 N N   . PRO B 1 409 ? -3.492  -58.054 -12.578 1.00 26.27  ? 410 PRO B N   1 
ATOM   7299 C CA  . PRO B 1 409 ? -4.458  -58.158 -13.688 1.00 29.59  ? 410 PRO B CA  1 
ATOM   7300 C C   . PRO B 1 409 ? -4.995  -59.579 -13.912 1.00 25.49  ? 410 PRO B C   1 
ATOM   7301 O O   . PRO B 1 409 ? -6.199  -59.739 -14.107 1.00 23.76  ? 410 PRO B O   1 
ATOM   7302 C CB  . PRO B 1 409 ? -3.647  -57.695 -14.902 1.00 24.99  ? 410 PRO B CB  1 
ATOM   7303 C CG  . PRO B 1 409 ? -2.660  -56.727 -14.321 1.00 27.42  ? 410 PRO B CG  1 
ATOM   7304 C CD  . PRO B 1 409 ? -2.280  -57.315 -12.980 1.00 25.82  ? 410 PRO B CD  1 
ATOM   7305 N N   . VAL B 1 410 ? -4.127  -60.587 -13.870 1.00 23.38  ? 411 VAL B N   1 
ATOM   7306 C CA  . VAL B 1 410 ? -4.571  -61.978 -13.971 1.00 18.54  ? 411 VAL B CA  1 
ATOM   7307 C C   . VAL B 1 410 ? -5.525  -62.358 -12.828 1.00 34.25  ? 411 VAL B C   1 
ATOM   7308 O O   . VAL B 1 410 ? -6.555  -63.005 -13.063 1.00 32.21  ? 411 VAL B O   1 
ATOM   7309 C CB  . VAL B 1 410 ? -3.372  -62.964 -14.001 1.00 25.15  ? 411 VAL B CB  1 
ATOM   7310 C CG1 . VAL B 1 410 ? -3.850  -64.403 -13.861 1.00 21.98  ? 411 VAL B CG1 1 
ATOM   7311 C CG2 . VAL B 1 410 ? -2.572  -62.796 -15.293 1.00 25.87  ? 411 VAL B CG2 1 
ATOM   7312 N N   . ALA B 1 411 ? -5.192  -61.948 -11.599 1.00 25.10  ? 412 ALA B N   1 
ATOM   7313 C CA  . ALA B 1 411 ? -6.029  -62.267 -10.434 1.00 29.60  ? 412 ALA B CA  1 
ATOM   7314 C C   . ALA B 1 411 ? -7.419  -61.630 -10.529 1.00 33.26  ? 412 ALA B C   1 
ATOM   7315 O O   . ALA B 1 411 ? -8.429  -62.285 -10.251 1.00 24.37  ? 412 ALA B O   1 
ATOM   7316 C CB  . ALA B 1 411 ? -5.339  -61.861 -9.119  1.00 30.49  ? 412 ALA B CB  1 
ATOM   7317 N N   . GLN B 1 412 ? -7.478  -60.365 -10.933 1.00 24.48  ? 413 GLN B N   1 
ATOM   7318 C CA  . GLN B 1 412 ? -8.778  -59.739 -11.129 1.00 23.44  ? 413 GLN B CA  1 
ATOM   7319 C C   . GLN B 1 412 ? -9.617  -60.470 -12.174 1.00 36.92  ? 413 GLN B C   1 
ATOM   7320 O O   . GLN B 1 412 ? -10.819 -60.668 -11.979 1.00 39.76  ? 413 GLN B O   1 
ATOM   7321 C CB  . GLN B 1 412 ? -8.663  -58.267 -11.513 1.00 26.90  ? 413 GLN B CB  1 
ATOM   7322 C CG  . GLN B 1 412 ? -10.041 -57.651 -11.725 1.00 29.14  ? 413 GLN B CG  1 
ATOM   7323 C CD  . GLN B 1 412 ? -10.027 -56.149 -11.782 1.00 53.56  ? 413 GLN B CD  1 
ATOM   7324 O OE1 . GLN B 1 412 ? -8.967  -55.523 -11.787 1.00 57.00  ? 413 GLN B OE1 1 
ATOM   7325 N NE2 . GLN B 1 412 ? -11.215 -55.552 -11.829 1.00 71.02  ? 413 GLN B NE2 1 
ATOM   7326 N N   . LEU B 1 413 ? -8.980  -60.862 -13.277 1.00 30.69  ? 414 LEU B N   1 
ATOM   7327 C CA  . LEU B 1 413 ? -9.660  -61.600 -14.338 1.00 33.36  ? 414 LEU B CA  1 
ATOM   7328 C C   . LEU B 1 413 ? -10.168 -62.934 -13.804 1.00 29.96  ? 414 LEU B C   1 
ATOM   7329 O O   . LEU B 1 413 ? -11.336 -63.262 -13.955 1.00 30.10  ? 414 LEU B O   1 
ATOM   7330 C CB  . LEU B 1 413 ? -8.713  -61.855 -15.520 1.00 27.94  ? 414 LEU B CB  1 
ATOM   7331 C CG  . LEU B 1 413 ? -9.255  -62.711 -16.670 1.00 32.29  ? 414 LEU B CG  1 
ATOM   7332 C CD1 . LEU B 1 413 ? -10.245 -61.919 -17.488 1.00 36.22  ? 414 LEU B CD1 1 
ATOM   7333 C CD2 . LEU B 1 413 ? -8.138  -63.170 -17.554 1.00 42.66  ? 414 LEU B CD2 1 
ATOM   7334 N N   . ALA B 1 414 ? -9.277  -63.703 -13.190 1.00 19.09  ? 415 ALA B N   1 
ATOM   7335 C CA  . ALA B 1 414 ? -9.640  -64.999 -12.643 1.00 29.51  ? 415 ALA B CA  1 
ATOM   7336 C C   . ALA B 1 414 ? -10.799 -64.868 -11.655 1.00 41.41  ? 415 ALA B C   1 
ATOM   7337 O O   . ALA B 1 414 ? -11.781 -65.615 -11.728 1.00 34.33  ? 415 ALA B O   1 
ATOM   7338 C CB  . ALA B 1 414 ? -8.434  -65.634 -11.955 1.00 24.20  ? 415 ALA B CB  1 
ATOM   7339 N N   . GLY B 1 415 ? -10.683 -63.906 -10.742 1.00 33.05  ? 416 GLY B N   1 
ATOM   7340 C CA  . GLY B 1 415 ? -11.686 -63.707 -9.712  1.00 33.96  ? 416 GLY B CA  1 
ATOM   7341 C C   . GLY B 1 415 ? -13.041 -63.318 -10.261 1.00 33.61  ? 416 GLY B C   1 
ATOM   7342 O O   . GLY B 1 415 ? -14.068 -63.874 -9.865  1.00 38.70  ? 416 GLY B O   1 
ATOM   7343 N N   . ARG B 1 416 ? -13.046 -62.365 -11.182 1.00 28.18  ? 417 ARG B N   1 
ATOM   7344 C CA  . ARG B 1 416 ? -14.289 -61.907 -11.783 1.00 34.68  ? 417 ARG B CA  1 
ATOM   7345 C C   . ARG B 1 416 ? -14.953 -62.946 -12.681 1.00 42.38  ? 417 ARG B C   1 
ATOM   7346 O O   . ARG B 1 416 ? -16.180 -63.079 -12.674 1.00 49.50  ? 417 ARG B O   1 
ATOM   7347 C CB  . ARG B 1 416 ? -14.067 -60.609 -12.550 1.00 36.91  ? 417 ARG B CB  1 
ATOM   7348 C CG  . ARG B 1 416 ? -13.969 -59.395 -11.651 1.00 42.00  ? 417 ARG B CG  1 
ATOM   7349 C CD  . ARG B 1 416 ? -15.117 -59.405 -10.646 1.00 48.34  ? 417 ARG B CD  1 
ATOM   7350 N NE  . ARG B 1 416 ? -15.359 -58.091 -10.061 1.00 53.59  ? 417 ARG B NE  1 
ATOM   7351 C CZ  . ARG B 1 416 ? -16.343 -57.278 -10.429 1.00 52.27  ? 417 ARG B CZ  1 
ATOM   7352 N NH1 . ARG B 1 416 ? -17.195 -57.641 -11.381 1.00 52.02  ? 417 ARG B NH1 1 
ATOM   7353 N NH2 . ARG B 1 416 ? -16.481 -56.101 -9.836  1.00 61.58  ? 417 ARG B NH2 1 
ATOM   7354 N N   . LEU B 1 417 ? -14.156 -63.677 -13.456 1.00 37.07  ? 418 LEU B N   1 
ATOM   7355 C CA  . LEU B 1 417 ? -14.714 -64.718 -14.319 1.00 38.24  ? 418 LEU B CA  1 
ATOM   7356 C C   . LEU B 1 417 ? -15.353 -65.805 -13.462 1.00 41.67  ? 418 LEU B C   1 
ATOM   7357 O O   . LEU B 1 417 ? -16.466 -66.249 -13.752 1.00 39.56  ? 418 LEU B O   1 
ATOM   7358 C CB  . LEU B 1 417 ? -13.658 -65.337 -15.254 1.00 36.16  ? 418 LEU B CB  1 
ATOM   7359 C CG  . LEU B 1 417 ? -12.951 -64.487 -16.325 1.00 39.66  ? 418 LEU B CG  1 
ATOM   7360 C CD1 . LEU B 1 417 ? -12.340 -65.375 -17.385 1.00 30.53  ? 418 LEU B CD1 1 
ATOM   7361 C CD2 . LEU B 1 417 ? -13.856 -63.461 -16.947 1.00 29.72  ? 418 LEU B CD2 1 
ATOM   7362 N N   . ALA B 1 418 ? -14.647 -66.234 -12.413 1.00 31.63  ? 419 ALA B N   1 
ATOM   7363 C CA  . ALA B 1 418 ? -15.189 -67.230 -11.486 1.00 38.52  ? 419 ALA B CA  1 
ATOM   7364 C C   . ALA B 1 418 ? -16.525 -66.782 -10.900 1.00 35.62  ? 419 ALA B C   1 
ATOM   7365 O O   . ALA B 1 418 ? -17.523 -67.495 -10.991 1.00 45.75  ? 419 ALA B O   1 
ATOM   7366 C CB  . ALA B 1 418 ? -14.205 -67.530 -10.372 1.00 27.47  ? 419 ALA B CB  1 
ATOM   7367 N N   . ALA B 1 419 ? -16.541 -65.590 -10.316 1.00 35.29  ? 420 ALA B N   1 
ATOM   7368 C CA  . ALA B 1 419 ? -17.746 -65.065 -9.682  1.00 36.37  ? 420 ALA B CA  1 
ATOM   7369 C C   . ALA B 1 419 ? -18.895 -64.892 -10.669 1.00 44.90  ? 420 ALA B C   1 
ATOM   7370 O O   . ALA B 1 419 ? -20.052 -64.844 -10.270 1.00 47.63  ? 420 ALA B O   1 
ATOM   7371 C CB  . ALA B 1 419 ? -17.450 -63.749 -8.996  1.00 24.54  ? 420 ALA B CB  1 
ATOM   7372 N N   . GLN B 1 420 ? -18.585 -64.799 -11.956 1.00 43.62  ? 421 GLN B N   1 
ATOM   7373 C CA  . GLN B 1 420 ? -19.630 -64.540 -12.935 1.00 33.69  ? 421 GLN B CA  1 
ATOM   7374 C C   . GLN B 1 420 ? -19.905 -65.697 -13.882 1.00 40.23  ? 421 GLN B C   1 
ATOM   7375 O O   . GLN B 1 420 ? -20.404 -65.493 -14.989 1.00 44.72  ? 421 GLN B O   1 
ATOM   7376 C CB  . GLN B 1 420 ? -19.344 -63.248 -13.690 1.00 36.78  ? 421 GLN B CB  1 
ATOM   7377 C CG  . GLN B 1 420 ? -19.374 -62.048 -12.766 1.00 39.38  ? 421 GLN B CG  1 
ATOM   7378 C CD  . GLN B 1 420 ? -18.497 -60.917 -13.245 1.00 49.77  ? 421 GLN B CD  1 
ATOM   7379 O OE1 . GLN B 1 420 ? -17.955 -60.155 -12.443 1.00 49.36  ? 421 GLN B OE1 1 
ATOM   7380 N NE2 . GLN B 1 420 ? -18.352 -60.799 -14.557 1.00 44.28  ? 421 GLN B NE2 1 
ATOM   7381 N N   . GLY B 1 421 ? -19.592 -66.912 -13.440 1.00 37.55  ? 422 GLY B N   1 
ATOM   7382 C CA  . GLY B 1 421 ? -20.068 -68.098 -14.131 1.00 45.98  ? 422 GLY B CA  1 
ATOM   7383 C C   . GLY B 1 421 ? -19.056 -69.017 -14.786 1.00 55.22  ? 422 GLY B C   1 
ATOM   7384 O O   . GLY B 1 421 ? -19.411 -70.110 -15.224 1.00 60.71  ? 422 GLY B O   1 
ATOM   7385 N N   . ALA B 1 422 ? -17.800 -68.595 -14.868 1.00 42.95  ? 423 ALA B N   1 
ATOM   7386 C CA  . ALA B 1 422 ? -16.804 -69.401 -15.562 1.00 45.93  ? 423 ALA B CA  1 
ATOM   7387 C C   . ALA B 1 422 ? -16.164 -70.398 -14.625 1.00 38.61  ? 423 ALA B C   1 
ATOM   7388 O O   . ALA B 1 422 ? -15.948 -70.097 -13.455 1.00 47.11  ? 423 ALA B O   1 
ATOM   7389 C CB  . ALA B 1 422 ? -15.735 -68.510 -16.180 1.00 46.71  ? 423 ALA B CB  1 
ATOM   7390 N N   . ARG B 1 423 ? -15.852 -71.585 -15.128 1.00 35.52  ? 424 ARG B N   1 
ATOM   7391 C CA  . ARG B 1 423 ? -14.976 -72.476 -14.377 1.00 42.23  ? 424 ARG B CA  1 
ATOM   7392 C C   . ARG B 1 423 ? -13.534 -72.055 -14.654 1.00 44.15  ? 424 ARG B C   1 
ATOM   7393 O O   . ARG B 1 423 ? -13.090 -72.057 -15.799 1.00 39.91  ? 424 ARG B O   1 
ATOM   7394 C CB  . ARG B 1 423 ? -15.202 -73.946 -14.744 1.00 34.59  ? 424 ARG B CB  1 
ATOM   7395 C CG  . ARG B 1 423 ? -14.552 -74.917 -13.745 1.00 54.59  ? 424 ARG B CG  1 
ATOM   7396 C CD  . ARG B 1 423 ? -15.257 -76.279 -13.680 1.00 62.28  ? 424 ARG B CD  1 
ATOM   7397 N NE  . ARG B 1 423 ? -14.889 -77.165 -14.788 1.00 75.25  ? 424 ARG B NE  1 
ATOM   7398 C CZ  . ARG B 1 423 ? -15.648 -77.392 -15.862 1.00 81.92  ? 424 ARG B CZ  1 
ATOM   7399 N NH1 . ARG B 1 423 ? -16.832 -76.800 -15.985 1.00 83.62  ? 424 ARG B NH1 1 
ATOM   7400 N NH2 . ARG B 1 423 ? -15.226 -78.219 -16.816 1.00 58.21  ? 424 ARG B NH2 1 
ATOM   7401 N N   . VAL B 1 424 ? -12.815 -71.676 -13.606 1.00 36.60  ? 425 VAL B N   1 
ATOM   7402 C CA  . VAL B 1 424 ? -11.463 -71.152 -13.749 1.00 31.35  ? 425 VAL B CA  1 
ATOM   7403 C C   . VAL B 1 424 ? -10.470 -72.057 -13.047 1.00 28.98  ? 425 VAL B C   1 
ATOM   7404 O O   . VAL B 1 424 ? -10.754 -72.568 -11.971 1.00 41.26  ? 425 VAL B O   1 
ATOM   7405 C CB  . VAL B 1 424 ? -11.349 -69.733 -13.142 1.00 27.91  ? 425 VAL B CB  1 
ATOM   7406 C CG1 . VAL B 1 424 ? -9.956  -69.169 -13.337 1.00 27.87  ? 425 VAL B CG1 1 
ATOM   7407 C CG2 . VAL B 1 424 ? -12.383 -68.800 -13.751 1.00 22.37  ? 425 VAL B CG2 1 
ATOM   7408 N N   . TYR B 1 425 ? -9.313  -72.272 -13.665 1.00 31.24  ? 426 TYR B N   1 
ATOM   7409 C CA  . TYR B 1 425 ? -8.200  -72.961 -13.020 1.00 26.45  ? 426 TYR B CA  1 
ATOM   7410 C C   . TYR B 1 425 ? -6.974  -72.057 -13.058 1.00 36.17  ? 426 TYR B C   1 
ATOM   7411 O O   . TYR B 1 425 ? -6.719  -71.388 -14.063 1.00 35.10  ? 426 TYR B O   1 
ATOM   7412 C CB  . TYR B 1 425 ? -7.900  -74.292 -13.705 1.00 32.66  ? 426 TYR B CB  1 
ATOM   7413 C CG  . TYR B 1 425 ? -9.048  -75.270 -13.650 1.00 38.15  ? 426 TYR B CG  1 
ATOM   7414 C CD1 . TYR B 1 425 ? -9.154  -76.189 -12.609 1.00 34.84  ? 426 TYR B CD1 1 
ATOM   7415 C CD2 . TYR B 1 425 ? -10.029 -75.276 -14.635 1.00 33.20  ? 426 TYR B CD2 1 
ATOM   7416 C CE1 . TYR B 1 425 ? -10.203 -77.089 -12.555 1.00 36.22  ? 426 TYR B CE1 1 
ATOM   7417 C CE2 . TYR B 1 425 ? -11.085 -76.173 -14.588 1.00 41.69  ? 426 TYR B CE2 1 
ATOM   7418 C CZ  . TYR B 1 425 ? -11.165 -77.076 -13.543 1.00 41.61  ? 426 TYR B CZ  1 
ATOM   7419 O OH  . TYR B 1 425 ? -12.210 -77.964 -13.486 1.00 42.30  ? 426 TYR B OH  1 
ATOM   7420 N N   . ALA B 1 426 ? -6.222  -72.030 -11.962 1.00 31.42  ? 427 ALA B N   1 
ATOM   7421 C CA  . ALA B 1 426 ? -5.103  -71.107 -11.827 1.00 26.88  ? 427 ALA B CA  1 
ATOM   7422 C C   . ALA B 1 426 ? -3.847  -71.822 -11.372 1.00 28.48  ? 427 ALA B C   1 
ATOM   7423 O O   . ALA B 1 426 ? -3.912  -72.795 -10.628 1.00 33.59  ? 427 ALA B O   1 
ATOM   7424 C CB  . ALA B 1 426 ? -5.454  -69.991 -10.864 1.00 29.53  ? 427 ALA B CB  1 
ATOM   7425 N N   . TYR B 1 427 ? -2.697  -71.338 -11.816 1.00 22.87  ? 428 TYR B N   1 
ATOM   7426 C CA  . TYR B 1 427 ? -1.447  -72.003 -11.494 1.00 28.10  ? 428 TYR B CA  1 
ATOM   7427 C C   . TYR B 1 427 ? -0.392  -70.957 -11.228 1.00 32.62  ? 428 TYR B C   1 
ATOM   7428 O O   . TYR B 1 427 ? -0.531  -69.809 -11.643 1.00 28.04  ? 428 TYR B O   1 
ATOM   7429 C CB  . TYR B 1 427 ? -0.977  -72.922 -12.643 1.00 33.64  ? 428 TYR B CB  1 
ATOM   7430 C CG  . TYR B 1 427 ? -0.561  -72.177 -13.908 1.00 36.29  ? 428 TYR B CG  1 
ATOM   7431 C CD1 . TYR B 1 427 ? 0.709   -71.621 -14.034 1.00 30.37  ? 428 TYR B CD1 1 
ATOM   7432 C CD2 . TYR B 1 427 ? -1.444  -72.031 -14.970 1.00 26.22  ? 428 TYR B CD2 1 
ATOM   7433 C CE1 . TYR B 1 427 ? 1.074   -70.928 -15.167 1.00 33.68  ? 428 TYR B CE1 1 
ATOM   7434 C CE2 . TYR B 1 427 ? -1.080  -71.352 -16.122 1.00 30.74  ? 428 TYR B CE2 1 
ATOM   7435 C CZ  . TYR B 1 427 ? 0.177   -70.802 -16.212 1.00 34.05  ? 428 TYR B CZ  1 
ATOM   7436 O OH  . TYR B 1 427 ? 0.537   -70.112 -17.343 1.00 32.35  ? 428 TYR B OH  1 
ATOM   7437 N N   . VAL B 1 428 ? 0.666   -71.369 -10.543 1.00 25.89  ? 429 VAL B N   1 
ATOM   7438 C CA  . VAL B 1 428 ? 1.882   -70.595 -10.480 1.00 25.62  ? 429 VAL B CA  1 
ATOM   7439 C C   . VAL B 1 428 ? 2.993   -71.539 -10.908 1.00 32.71  ? 429 VAL B C   1 
ATOM   7440 O O   . VAL B 1 428 ? 3.098   -72.655 -10.404 1.00 35.06  ? 429 VAL B O   1 
ATOM   7441 C CB  . VAL B 1 428 ? 2.113   -70.005 -9.069  1.00 33.05  ? 429 VAL B CB  1 
ATOM   7442 C CG1 . VAL B 1 428 ? 3.451   -69.293 -8.997  1.00 27.02  ? 429 VAL B CG1 1 
ATOM   7443 C CG2 . VAL B 1 428 ? 1.000   -69.021 -8.747  1.00 33.74  ? 429 VAL B CG2 1 
ATOM   7444 N N   . PHE B 1 429 ? 3.787   -71.109 -11.880 1.00 33.98  ? 430 PHE B N   1 
ATOM   7445 C CA  . PHE B 1 429 ? 4.817   -71.956 -12.452 1.00 25.73  ? 430 PHE B CA  1 
ATOM   7446 C C   . PHE B 1 429 ? 6.116   -71.657 -11.743 1.00 29.25  ? 430 PHE B C   1 
ATOM   7447 O O   . PHE B 1 429 ? 6.600   -70.528 -11.787 1.00 28.33  ? 430 PHE B O   1 
ATOM   7448 C CB  . PHE B 1 429 ? 4.956   -71.692 -13.956 1.00 27.66  ? 430 PHE B CB  1 
ATOM   7449 C CG  . PHE B 1 429 ? 5.969   -72.569 -14.626 1.00 26.10  ? 430 PHE B CG  1 
ATOM   7450 C CD1 . PHE B 1 429 ? 5.596   -73.795 -15.157 1.00 33.60  ? 430 PHE B CD1 1 
ATOM   7451 C CD2 . PHE B 1 429 ? 7.297   -72.176 -14.721 1.00 28.54  ? 430 PHE B CD2 1 
ATOM   7452 C CE1 . PHE B 1 429 ? 6.528   -74.617 -15.776 1.00 28.79  ? 430 PHE B CE1 1 
ATOM   7453 C CE2 . PHE B 1 429 ? 8.237   -72.989 -15.341 1.00 31.73  ? 430 PHE B CE2 1 
ATOM   7454 C CZ  . PHE B 1 429 ? 7.851   -74.214 -15.864 1.00 33.46  ? 430 PHE B CZ  1 
ATOM   7455 N N   . GLU B 1 430 ? 6.685   -72.661 -11.087 1.00 29.59  ? 431 GLU B N   1 
ATOM   7456 C CA  . GLU B 1 430 ? 7.759   -72.396 -10.136 1.00 35.71  ? 431 GLU B CA  1 
ATOM   7457 C C   . GLU B 1 430 ? 9.048   -73.103 -10.462 1.00 39.20  ? 431 GLU B C   1 
ATOM   7458 O O   . GLU B 1 430 ? 10.007  -73.031 -9.698  1.00 37.48  ? 431 GLU B O   1 
ATOM   7459 C CB  . GLU B 1 430 ? 7.325   -72.761 -8.723  1.00 32.09  ? 431 GLU B CB  1 
ATOM   7460 C CG  . GLU B 1 430 ? 6.125   -71.969 -8.256  1.00 41.65  ? 431 GLU B CG  1 
ATOM   7461 C CD  . GLU B 1 430 ? 5.963   -72.000 -6.751  1.00 50.26  ? 431 GLU B CD  1 
ATOM   7462 O OE1 . GLU B 1 430 ? 6.217   -73.068 -6.143  1.00 55.49  ? 431 GLU B OE1 1 
ATOM   7463 O OE2 . GLU B 1 430 ? 5.591   -70.952 -6.182  1.00 46.05  ? 431 GLU B OE2 1 
ATOM   7464 N N   . HIS B 1 431 ? 9.080   -73.783 -11.600 1.00 37.94  ? 432 HIS B N   1 
ATOM   7465 C CA  . HIS B 1 431 ? 10.300  -74.462 -11.993 1.00 35.00  ? 432 HIS B CA  1 
ATOM   7466 C C   . HIS B 1 431 ? 11.239  -73.554 -12.789 1.00 38.36  ? 432 HIS B C   1 
ATOM   7467 O O   . HIS B 1 431 ? 10.851  -72.922 -13.771 1.00 41.18  ? 432 HIS B O   1 
ATOM   7468 C CB  . HIS B 1 431 ? 10.009  -75.754 -12.763 1.00 23.89  ? 432 HIS B CB  1 
ATOM   7469 C CG  . HIS B 1 431 ? 11.245  -76.418 -13.284 1.00 42.22  ? 432 HIS B CG  1 
ATOM   7470 N ND1 . HIS B 1 431 ? 12.221  -76.925 -12.453 1.00 33.70  ? 432 HIS B ND1 1 
ATOM   7471 C CD2 . HIS B 1 431 ? 11.686  -76.621 -14.549 1.00 40.71  ? 432 HIS B CD2 1 
ATOM   7472 C CE1 . HIS B 1 431 ? 13.202  -77.423 -13.182 1.00 34.33  ? 432 HIS B CE1 1 
ATOM   7473 N NE2 . HIS B 1 431 ? 12.901  -77.254 -14.457 1.00 39.20  ? 432 HIS B NE2 1 
ATOM   7474 N N   . ARG B 1 432 ? 12.483  -73.492 -12.344 1.00 33.98  ? 433 ARG B N   1 
ATOM   7475 C CA  . ARG B 1 432 ? 13.500  -72.749 -13.058 1.00 39.19  ? 433 ARG B CA  1 
ATOM   7476 C C   . ARG B 1 432 ? 14.307  -73.737 -13.888 1.00 38.71  ? 433 ARG B C   1 
ATOM   7477 O O   . ARG B 1 432 ? 14.970  -74.621 -13.344 1.00 46.33  ? 433 ARG B O   1 
ATOM   7478 C CB  . ARG B 1 432 ? 14.401  -72.007 -12.075 1.00 33.01  ? 433 ARG B CB  1 
ATOM   7479 C CG  . ARG B 1 432 ? 15.597  -71.375 -12.730 1.00 40.62  ? 433 ARG B CG  1 
ATOM   7480 C CD  . ARG B 1 432 ? 16.418  -70.598 -11.730 1.00 34.01  ? 433 ARG B CD  1 
ATOM   7481 N NE  . ARG B 1 432 ? 17.683  -70.198 -12.333 1.00 42.47  ? 433 ARG B NE  1 
ATOM   7482 C CZ  . ARG B 1 432 ? 17.980  -68.961 -12.713 1.00 49.85  ? 433 ARG B CZ  1 
ATOM   7483 N NH1 . ARG B 1 432 ? 17.106  -67.967 -12.544 1.00 35.23  ? 433 ARG B NH1 1 
ATOM   7484 N NH2 . ARG B 1 432 ? 19.166  -68.720 -13.254 1.00 45.73  ? 433 ARG B NH2 1 
ATOM   7485 N N   . ALA B 1 433 ? 14.228  -73.590 -15.206 1.00 37.95  ? 434 ALA B N   1 
ATOM   7486 C CA  . ALA B 1 433 ? 14.835  -74.539 -16.130 1.00 40.67  ? 434 ALA B CA  1 
ATOM   7487 C C   . ALA B 1 433 ? 16.331  -74.714 -15.880 1.00 44.22  ? 434 ALA B C   1 
ATOM   7488 O O   . ALA B 1 433 ? 17.064  -73.735 -15.715 1.00 46.04  ? 434 ALA B O   1 
ATOM   7489 C CB  . ALA B 1 433 ? 14.584  -74.102 -17.569 1.00 33.39  ? 434 ALA B CB  1 
ATOM   7490 N N   . SER B 1 434 ? 16.777  -75.967 -15.856 1.00 34.57  ? 435 SER B N   1 
ATOM   7491 C CA  . SER B 1 434 ? 18.198  -76.280 -15.712 1.00 35.93  ? 435 SER B CA  1 
ATOM   7492 C C   . SER B 1 434 ? 19.043  -75.560 -16.767 1.00 36.86  ? 435 SER B C   1 
ATOM   7493 O O   . SER B 1 434 ? 20.226  -75.325 -16.552 1.00 45.62  ? 435 SER B O   1 
ATOM   7494 C CB  . SER B 1 434 ? 18.424  -77.793 -15.811 1.00 36.16  ? 435 SER B CB  1 
ATOM   7495 O OG  . SER B 1 434 ? 18.101  -78.277 -17.111 1.00 43.04  ? 435 SER B OG  1 
ATOM   7496 N N   . THR B 1 435 ? 18.429  -75.200 -17.895 1.00 42.14  ? 436 THR B N   1 
ATOM   7497 C CA  . THR B 1 435 ? 19.150  -74.574 -19.009 1.00 41.14  ? 436 THR B CA  1 
ATOM   7498 C C   . THR B 1 435 ? 19.078  -73.045 -19.004 1.00 46.49  ? 436 THR B C   1 
ATOM   7499 O O   . THR B 1 435 ? 19.625  -72.391 -19.894 1.00 46.31  ? 436 THR B O   1 
ATOM   7500 C CB  . THR B 1 435 ? 18.616  -75.055 -20.360 1.00 30.23  ? 436 THR B CB  1 
ATOM   7501 O OG1 . THR B 1 435 ? 17.233  -74.702 -20.466 1.00 43.84  ? 436 THR B OG1 1 
ATOM   7502 C CG2 . THR B 1 435 ? 18.764  -76.573 -20.497 1.00 36.86  ? 436 THR B CG2 1 
ATOM   7503 N N   . LEU B 1 436 ? 18.408  -72.480 -18.004 1.00 39.81  ? 437 LEU B N   1 
ATOM   7504 C CA  . LEU B 1 436 ? 18.211  -71.037 -17.942 1.00 45.17  ? 437 LEU B CA  1 
ATOM   7505 C C   . LEU B 1 436 ? 19.544  -70.306 -17.812 1.00 47.59  ? 437 LEU B C   1 
ATOM   7506 O O   . LEU B 1 436 ? 20.380  -70.670 -16.985 1.00 44.55  ? 437 LEU B O   1 
ATOM   7507 C CB  . LEU B 1 436 ? 17.278  -70.668 -16.784 1.00 36.66  ? 437 LEU B CB  1 
ATOM   7508 C CG  . LEU B 1 436 ? 16.474  -69.382 -16.969 1.00 37.22  ? 437 LEU B CG  1 
ATOM   7509 C CD1 . LEU B 1 436 ? 15.524  -69.538 -18.122 1.00 38.75  ? 437 LEU B CD1 1 
ATOM   7510 C CD2 . LEU B 1 436 ? 15.707  -69.033 -15.710 1.00 44.82  ? 437 LEU B CD2 1 
ATOM   7511 N N   . SER B 1 437 ? 19.726  -69.273 -18.632 1.00 45.14  ? 438 SER B N   1 
ATOM   7512 C CA  . SER B 1 437 ? 20.976  -68.518 -18.673 1.00 51.40  ? 438 SER B CA  1 
ATOM   7513 C C   . SER B 1 437 ? 20.929  -67.164 -17.935 1.00 53.87  ? 438 SER B C   1 
ATOM   7514 O O   . SER B 1 437 ? 21.960  -66.505 -17.779 1.00 54.91  ? 438 SER B O   1 
ATOM   7515 C CB  . SER B 1 437 ? 21.417  -68.322 -20.129 1.00 52.99  ? 438 SER B CB  1 
ATOM   7516 O OG  . SER B 1 437 ? 20.314  -67.967 -20.955 1.00 62.60  ? 438 SER B OG  1 
ATOM   7517 N N   . TRP B 1 438 ? 19.741  -66.747 -17.496 1.00 47.84  ? 439 TRP B N   1 
ATOM   7518 C CA  . TRP B 1 438 ? 19.605  -65.536 -16.681 1.00 46.63  ? 439 TRP B CA  1 
ATOM   7519 C C   . TRP B 1 438 ? 20.137  -65.828 -15.288 1.00 40.56  ? 439 TRP B C   1 
ATOM   7520 O O   . TRP B 1 438 ? 20.049  -66.961 -14.833 1.00 39.49  ? 439 TRP B O   1 
ATOM   7521 C CB  . TRP B 1 438 ? 18.141  -65.090 -16.591 1.00 40.73  ? 439 TRP B CB  1 
ATOM   7522 C CG  . TRP B 1 438 ? 17.553  -64.695 -17.900 1.00 34.87  ? 439 TRP B CG  1 
ATOM   7523 C CD1 . TRP B 1 438 ? 16.753  -65.453 -18.697 1.00 40.04  ? 439 TRP B CD1 1 
ATOM   7524 C CD2 . TRP B 1 438 ? 17.724  -63.441 -18.576 1.00 35.64  ? 439 TRP B CD2 1 
ATOM   7525 N NE1 . TRP B 1 438 ? 16.409  -64.753 -19.829 1.00 36.58  ? 439 TRP B NE1 1 
ATOM   7526 C CE2 . TRP B 1 438 ? 16.991  -63.514 -19.779 1.00 39.39  ? 439 TRP B CE2 1 
ATOM   7527 C CE3 . TRP B 1 438 ? 18.418  -62.264 -18.277 1.00 34.84  ? 439 TRP B CE3 1 
ATOM   7528 C CZ2 . TRP B 1 438 ? 16.938  -62.454 -20.689 1.00 34.48  ? 439 TRP B CZ2 1 
ATOM   7529 C CZ3 . TRP B 1 438 ? 18.368  -61.215 -19.176 1.00 33.15  ? 439 TRP B CZ3 1 
ATOM   7530 C CH2 . TRP B 1 438 ? 17.632  -61.316 -20.371 1.00 49.20  ? 439 TRP B CH2 1 
ATOM   7531 N N   . PRO B 1 439 ? 20.690  -64.808 -14.607 1.00 40.46  ? 440 PRO B N   1 
ATOM   7532 C CA  . PRO B 1 439 ? 21.236  -64.973 -13.253 1.00 39.98  ? 440 PRO B CA  1 
ATOM   7533 C C   . PRO B 1 439 ? 20.221  -65.528 -12.257 1.00 44.24  ? 440 PRO B C   1 
ATOM   7534 O O   . PRO B 1 439 ? 19.007  -65.426 -12.459 1.00 41.14  ? 440 PRO B O   1 
ATOM   7535 C CB  . PRO B 1 439 ? 21.633  -63.548 -12.860 1.00 37.41  ? 440 PRO B CB  1 
ATOM   7536 C CG  . PRO B 1 439 ? 20.859  -62.668 -13.777 1.00 46.39  ? 440 PRO B CG  1 
ATOM   7537 C CD  . PRO B 1 439 ? 20.793  -63.414 -15.060 1.00 44.27  ? 440 PRO B CD  1 
ATOM   7538 N N   . LEU B 1 440 ? 20.732  -66.119 -11.185 1.00 46.39  ? 441 LEU B N   1 
ATOM   7539 C CA  . LEU B 1 440 ? 19.899  -66.821 -10.223 1.00 39.28  ? 441 LEU B CA  1 
ATOM   7540 C C   . LEU B 1 440 ? 18.897  -65.898 -9.538  1.00 43.43  ? 441 LEU B C   1 
ATOM   7541 O O   . LEU B 1 440 ? 17.792  -66.323 -9.199  1.00 45.13  ? 441 LEU B O   1 
ATOM   7542 C CB  . LEU B 1 440 ? 20.772  -67.504 -9.176  1.00 52.04  ? 441 LEU B CB  1 
ATOM   7543 C CG  . LEU B 1 440 ? 20.437  -68.961 -8.863  1.00 60.54  ? 441 LEU B CG  1 
ATOM   7544 C CD1 . LEU B 1 440 ? 20.966  -69.885 -9.959  1.00 51.78  ? 441 LEU B CD1 1 
ATOM   7545 C CD2 . LEU B 1 440 ? 20.994  -69.347 -7.504  1.00 59.38  ? 441 LEU B CD2 1 
ATOM   7546 N N   . TRP B 1 441 ? 19.274  -64.637 -9.343  1.00 37.91  ? 442 TRP B N   1 
ATOM   7547 C CA  . TRP B 1 441 ? 18.406  -63.709 -8.620  1.00 43.12  ? 442 TRP B CA  1 
ATOM   7548 C C   . TRP B 1 441 ? 17.083  -63.430 -9.344  1.00 43.64  ? 442 TRP B C   1 
ATOM   7549 O O   . TRP B 1 441 ? 16.122  -62.994 -8.718  1.00 46.41  ? 442 TRP B O   1 
ATOM   7550 C CB  . TRP B 1 441 ? 19.128  -62.392 -8.267  1.00 41.21  ? 442 TRP B CB  1 
ATOM   7551 C CG  . TRP B 1 441 ? 19.442  -61.500 -9.437  1.00 40.38  ? 442 TRP B CG  1 
ATOM   7552 C CD1 . TRP B 1 441 ? 20.634  -61.402 -10.089 1.00 43.23  ? 442 TRP B CD1 1 
ATOM   7553 C CD2 . TRP B 1 441 ? 18.552  -60.572 -10.086 1.00 44.66  ? 442 TRP B CD2 1 
ATOM   7554 N NE1 . TRP B 1 441 ? 20.545  -60.480 -11.107 1.00 48.91  ? 442 TRP B NE1 1 
ATOM   7555 C CE2 . TRP B 1 441 ? 19.279  -59.957 -11.130 1.00 31.09  ? 442 TRP B CE2 1 
ATOM   7556 C CE3 . TRP B 1 441 ? 17.215  -60.204 -9.888  1.00 41.25  ? 442 TRP B CE3 1 
ATOM   7557 C CZ2 . TRP B 1 441 ? 18.713  -59.003 -11.983 1.00 33.82  ? 442 TRP B CZ2 1 
ATOM   7558 C CZ3 . TRP B 1 441 ? 16.651  -59.245 -10.740 1.00 39.26  ? 442 TRP B CZ3 1 
ATOM   7559 C CH2 . TRP B 1 441 ? 17.404  -58.659 -11.771 1.00 37.97  ? 442 TRP B CH2 1 
ATOM   7560 N N   . MET B 1 442 ? 17.031  -63.679 -10.652 1.00 39.52  ? 443 MET B N   1 
ATOM   7561 C CA  . MET B 1 442 ? 15.809  -63.418 -11.413 1.00 31.01  ? 443 MET B CA  1 
ATOM   7562 C C   . MET B 1 442 ? 14.749  -64.497 -11.202 1.00 35.76  ? 443 MET B C   1 
ATOM   7563 O O   . MET B 1 442 ? 13.602  -64.330 -11.620 1.00 34.50  ? 443 MET B O   1 
ATOM   7564 C CB  . MET B 1 442 ? 16.101  -63.265 -12.906 1.00 32.76  ? 443 MET B CB  1 
ATOM   7565 C CG  . MET B 1 442 ? 16.810  -61.973 -13.301 1.00 43.29  ? 443 MET B CG  1 
ATOM   7566 S SD  . MET B 1 442 ? 17.169  -61.937 -15.078 1.00 46.98  ? 443 MET B SD  1 
ATOM   7567 C CE  . MET B 1 442 ? 16.323  -60.471 -15.603 1.00 45.68  ? 443 MET B CE  1 
ATOM   7568 N N   . GLY B 1 443 ? 15.129  -65.596 -10.550 1.00 36.08  ? 444 GLY B N   1 
ATOM   7569 C CA  . GLY B 1 443 ? 14.200  -66.682 -10.276 1.00 25.20  ? 444 GLY B CA  1 
ATOM   7570 C C   . GLY B 1 443 ? 13.647  -67.304 -11.551 1.00 40.24  ? 444 GLY B C   1 
ATOM   7571 O O   . GLY B 1 443 ? 14.403  -67.659 -12.458 1.00 33.05  ? 444 GLY B O   1 
ATOM   7572 N N   . VAL B 1 444 ? 12.326  -67.439 -11.618 1.00 28.89  ? 445 VAL B N   1 
ATOM   7573 C CA  . VAL B 1 444 ? 11.663  -67.954 -12.809 1.00 34.74  ? 445 VAL B CA  1 
ATOM   7574 C C   . VAL B 1 444 ? 11.010  -66.797 -13.563 1.00 34.48  ? 445 VAL B C   1 
ATOM   7575 O O   . VAL B 1 444 ? 9.891   -66.404 -13.243 1.00 31.95  ? 445 VAL B O   1 
ATOM   7576 C CB  . VAL B 1 444 ? 10.584  -68.978 -12.433 1.00 29.64  ? 445 VAL B CB  1 
ATOM   7577 C CG1 . VAL B 1 444 ? 10.058  -69.671 -13.676 1.00 33.12  ? 445 VAL B CG1 1 
ATOM   7578 C CG2 . VAL B 1 444 ? 11.151  -70.001 -11.447 1.00 31.18  ? 445 VAL B CG2 1 
ATOM   7579 N N   . PRO B 1 445 ? 11.704  -66.246 -14.572 1.00 31.08  ? 446 PRO B N   1 
ATOM   7580 C CA  . PRO B 1 445 ? 11.246  -64.977 -15.149 1.00 33.35  ? 446 PRO B CA  1 
ATOM   7581 C C   . PRO B 1 445 ? 10.127  -65.140 -16.161 1.00 29.80  ? 446 PRO B C   1 
ATOM   7582 O O   . PRO B 1 445 ? 9.787   -66.244 -16.591 1.00 27.78  ? 446 PRO B O   1 
ATOM   7583 C CB  . PRO B 1 445 ? 12.500  -64.425 -15.856 1.00 28.68  ? 446 PRO B CB  1 
ATOM   7584 C CG  . PRO B 1 445 ? 13.634  -65.371 -15.486 1.00 30.42  ? 446 PRO B CG  1 
ATOM   7585 C CD  . PRO B 1 445 ? 12.974  -66.680 -15.167 1.00 31.90  ? 446 PRO B CD  1 
ATOM   7586 N N   . HIS B 1 446 ? 9.561   -64.001 -16.526 1.00 24.97  ? 447 HIS B N   1 
ATOM   7587 C CA  . HIS B 1 446 ? 8.502   -63.917 -17.515 1.00 28.32  ? 447 HIS B CA  1 
ATOM   7588 C C   . HIS B 1 446 ? 8.869   -64.657 -18.809 1.00 31.90  ? 447 HIS B C   1 
ATOM   7589 O O   . HIS B 1 446 ? 9.914   -64.410 -19.411 1.00 26.88  ? 447 HIS B O   1 
ATOM   7590 C CB  . HIS B 1 446 ? 8.250   -62.441 -17.812 1.00 33.20  ? 447 HIS B CB  1 
ATOM   7591 C CG  . HIS B 1 446 ? 6.956   -62.169 -18.505 1.00 32.07  ? 447 HIS B CG  1 
ATOM   7592 N ND1 . HIS B 1 446 ? 5.734   -62.421 -17.922 1.00 30.75  ? 447 HIS B ND1 1 
ATOM   7593 C CD2 . HIS B 1 446 ? 6.693   -61.653 -19.727 1.00 24.07  ? 447 HIS B CD2 1 
ATOM   7594 C CE1 . HIS B 1 446 ? 4.772   -62.076 -18.758 1.00 32.35  ? 447 HIS B CE1 1 
ATOM   7595 N NE2 . HIS B 1 446 ? 5.329   -61.600 -19.857 1.00 30.86  ? 447 HIS B NE2 1 
ATOM   7596 N N   . GLY B 1 447 ? 8.011   -65.586 -19.213 1.00 29.95  ? 448 GLY B N   1 
ATOM   7597 C CA  . GLY B 1 447 ? 8.172   -66.268 -20.477 1.00 25.41  ? 448 GLY B CA  1 
ATOM   7598 C C   . GLY B 1 447 ? 8.815   -67.638 -20.426 1.00 34.14  ? 448 GLY B C   1 
ATOM   7599 O O   . GLY B 1 447 ? 8.913   -68.314 -21.445 1.00 32.66  ? 448 GLY B O   1 
ATOM   7600 N N   . TYR B 1 448 ? 9.248   -68.069 -19.250 1.00 32.81  ? 449 TYR B N   1 
ATOM   7601 C CA  . TYR B 1 448 ? 10.061  -69.277 -19.199 1.00 28.62  ? 449 TYR B CA  1 
ATOM   7602 C C   . TYR B 1 448 ? 9.346   -70.563 -18.805 1.00 26.91  ? 449 TYR B C   1 
ATOM   7603 O O   . TYR B 1 448 ? 9.980   -71.586 -18.563 1.00 33.25  ? 449 TYR B O   1 
ATOM   7604 C CB  . TYR B 1 448 ? 11.361  -69.023 -18.433 1.00 26.39  ? 449 TYR B CB  1 
ATOM   7605 C CG  . TYR B 1 448 ? 12.243  -68.153 -19.285 1.00 33.73  ? 449 TYR B CG  1 
ATOM   7606 C CD1 . TYR B 1 448 ? 13.006  -68.707 -20.309 1.00 30.98  ? 449 TYR B CD1 1 
ATOM   7607 C CD2 . TYR B 1 448 ? 12.243  -66.769 -19.138 1.00 33.51  ? 449 TYR B CD2 1 
ATOM   7608 C CE1 . TYR B 1 448 ? 13.793  -67.915 -21.127 1.00 32.51  ? 449 TYR B CE1 1 
ATOM   7609 C CE2 . TYR B 1 448 ? 13.030  -65.963 -19.951 1.00 32.12  ? 449 TYR B CE2 1 
ATOM   7610 C CZ  . TYR B 1 448 ? 13.798  -66.549 -20.950 1.00 39.93  ? 449 TYR B CZ  1 
ATOM   7611 O OH  . TYR B 1 448 ? 14.576  -65.770 -21.767 1.00 39.56  ? 449 TYR B OH  1 
ATOM   7612 N N   . GLU B 1 449 ? 8.021   -70.513 -18.785 1.00 26.11  ? 450 GLU B N   1 
ATOM   7613 C CA  . GLU B 1 449 ? 7.227   -71.728 -18.688 1.00 28.37  ? 450 GLU B CA  1 
ATOM   7614 C C   . GLU B 1 449 ? 6.877   -72.262 -20.082 1.00 30.02  ? 450 GLU B C   1 
ATOM   7615 O O   . GLU B 1 449 ? 6.511   -73.427 -20.220 1.00 33.24  ? 450 GLU B O   1 
ATOM   7616 C CB  . GLU B 1 449 ? 5.936   -71.468 -17.909 1.00 22.36  ? 450 GLU B CB  1 
ATOM   7617 C CG  . GLU B 1 449 ? 4.756   -71.000 -18.759 1.00 27.93  ? 450 GLU B CG  1 
ATOM   7618 C CD  . GLU B 1 449 ? 4.836   -69.533 -19.204 1.00 35.36  ? 450 GLU B CD  1 
ATOM   7619 O OE1 . GLU B 1 449 ? 5.935   -68.928 -19.171 1.00 31.47  ? 450 GLU B OE1 1 
ATOM   7620 O OE2 . GLU B 1 449 ? 3.774   -68.984 -19.578 1.00 31.62  ? 450 GLU B OE2 1 
ATOM   7621 N N   . ILE B 1 450 ? 6.982   -71.414 -21.108 1.00 29.37  ? 451 ILE B N   1 
ATOM   7622 C CA  . ILE B 1 450 ? 6.467   -71.754 -22.447 1.00 30.35  ? 451 ILE B CA  1 
ATOM   7623 C C   . ILE B 1 450 ? 7.126   -73.001 -23.005 1.00 29.45  ? 451 ILE B C   1 
ATOM   7624 O O   . ILE B 1 450 ? 6.443   -73.902 -23.494 1.00 31.70  ? 451 ILE B O   1 
ATOM   7625 C CB  . ILE B 1 450 ? 6.655   -70.608 -23.467 1.00 26.80  ? 451 ILE B CB  1 
ATOM   7626 C CG1 . ILE B 1 450 ? 5.816   -69.393 -23.081 1.00 31.91  ? 451 ILE B CG1 1 
ATOM   7627 C CG2 . ILE B 1 450 ? 6.253   -71.058 -24.845 1.00 28.55  ? 451 ILE B CG2 1 
ATOM   7628 C CD1 . ILE B 1 450 ? 6.198   -68.153 -23.838 1.00 28.41  ? 451 ILE B CD1 1 
ATOM   7629 N N   . GLU B 1 451 ? 8.455   -73.047 -22.915 1.00 24.80  ? 452 GLU B N   1 
ATOM   7630 C CA  . GLU B 1 451 ? 9.230   -74.167 -23.433 1.00 31.58  ? 452 GLU B CA  1 
ATOM   7631 C C   . GLU B 1 451 ? 8.775   -75.506 -22.840 1.00 32.16  ? 452 GLU B C   1 
ATOM   7632 O O   . GLU B 1 451 ? 8.830   -76.541 -23.505 1.00 32.23  ? 452 GLU B O   1 
ATOM   7633 C CB  . GLU B 1 451 ? 10.732  -73.936 -23.220 1.00 32.75  ? 452 GLU B CB  1 
ATOM   7634 C CG  . GLU B 1 451 ? 11.164  -73.736 -21.748 1.00 33.57  ? 452 GLU B CG  1 
ATOM   7635 C CD  . GLU B 1 451 ? 12.524  -73.033 -21.637 1.00 45.53  ? 452 GLU B CD  1 
ATOM   7636 O OE1 . GLU B 1 451 ? 13.517  -73.661 -21.201 1.00 38.92  ? 452 GLU B OE1 1 
ATOM   7637 O OE2 . GLU B 1 451 ? 12.603  -71.840 -21.999 1.00 44.91  ? 452 GLU B OE2 1 
ATOM   7638 N N   . PHE B 1 452 ? 8.287   -75.469 -21.605 1.00 26.33  ? 453 PHE B N   1 
ATOM   7639 C CA  . PHE B 1 452 ? 7.768   -76.660 -20.949 1.00 25.16  ? 453 PHE B CA  1 
ATOM   7640 C C   . PHE B 1 452 ? 6.378   -77.030 -21.440 1.00 28.88  ? 453 PHE B C   1 
ATOM   7641 O O   . PHE B 1 452 ? 6.092   -78.209 -21.628 1.00 30.26  ? 453 PHE B O   1 
ATOM   7642 C CB  . PHE B 1 452 ? 7.793   -76.500 -19.413 1.00 31.30  ? 453 PHE B CB  1 
ATOM   7643 C CG  . PHE B 1 452 ? 9.177   -76.559 -18.842 1.00 38.92  ? 453 PHE B CG  1 
ATOM   7644 C CD1 . PHE B 1 452 ? 9.915   -75.400 -18.656 1.00 27.61  ? 453 PHE B CD1 1 
ATOM   7645 C CD2 . PHE B 1 452 ? 9.762   -77.781 -18.539 1.00 32.48  ? 453 PHE B CD2 1 
ATOM   7646 C CE1 . PHE B 1 452 ? 11.204  -75.459 -18.168 1.00 35.46  ? 453 PHE B CE1 1 
ATOM   7647 C CE2 . PHE B 1 452 ? 11.052  -77.843 -18.047 1.00 34.20  ? 453 PHE B CE2 1 
ATOM   7648 C CZ  . PHE B 1 452 ? 11.775  -76.686 -17.861 1.00 30.45  ? 453 PHE B CZ  1 
ATOM   7649 N N   . ILE B 1 453 ? 5.517   -76.030 -21.637 1.00 28.20  ? 454 ILE B N   1 
ATOM   7650 C CA  . ILE B 1 453 ? 4.162   -76.271 -22.142 1.00 28.23  ? 454 ILE B CA  1 
ATOM   7651 C C   . ILE B 1 453 ? 4.197   -76.845 -23.567 1.00 38.36  ? 454 ILE B C   1 
ATOM   7652 O O   . ILE B 1 453 ? 3.329   -77.632 -23.957 1.00 32.19  ? 454 ILE B O   1 
ATOM   7653 C CB  . ILE B 1 453 ? 3.302   -74.982 -22.153 1.00 30.52  ? 454 ILE B CB  1 
ATOM   7654 C CG1 . ILE B 1 453 ? 3.316   -74.287 -20.784 1.00 29.91  ? 454 ILE B CG1 1 
ATOM   7655 C CG2 . ILE B 1 453 ? 1.865   -75.292 -22.558 1.00 29.26  ? 454 ILE B CG2 1 
ATOM   7656 C CD1 . ILE B 1 453 ? 2.782   -75.142 -19.680 1.00 33.51  ? 454 ILE B CD1 1 
ATOM   7657 N N   . PHE B 1 454 ? 5.209   -76.456 -24.340 1.00 29.29  ? 455 PHE B N   1 
ATOM   7658 C CA  . PHE B 1 454 ? 5.317   -76.914 -25.720 1.00 35.34  ? 455 PHE B CA  1 
ATOM   7659 C C   . PHE B 1 454 ? 6.120   -78.207 -25.826 1.00 38.21  ? 455 PHE B C   1 
ATOM   7660 O O   . PHE B 1 454 ? 6.259   -78.762 -26.910 1.00 34.13  ? 455 PHE B O   1 
ATOM   7661 C CB  . PHE B 1 454 ? 5.909   -75.820 -26.626 1.00 25.90  ? 455 PHE B CB  1 
ATOM   7662 C CG  . PHE B 1 454 ? 4.879   -74.890 -27.197 1.00 32.09  ? 455 PHE B CG  1 
ATOM   7663 C CD1 . PHE B 1 454 ? 4.415   -73.809 -26.463 1.00 22.00  ? 455 PHE B CD1 1 
ATOM   7664 C CD2 . PHE B 1 454 ? 4.368   -75.097 -28.472 1.00 26.34  ? 455 PHE B CD2 1 
ATOM   7665 C CE1 . PHE B 1 454 ? 3.450   -72.951 -26.995 1.00 32.90  ? 455 PHE B CE1 1 
ATOM   7666 C CE2 . PHE B 1 454 ? 3.409   -74.254 -29.001 1.00 27.57  ? 455 PHE B CE2 1 
ATOM   7667 C CZ  . PHE B 1 454 ? 2.944   -73.177 -28.262 1.00 31.72  ? 455 PHE B CZ  1 
ATOM   7668 N N   . GLY B 1 455 ? 6.662   -78.671 -24.703 1.00 33.43  ? 456 GLY B N   1 
ATOM   7669 C CA  . GLY B 1 455 ? 7.367   -79.942 -24.682 1.00 30.78  ? 456 GLY B CA  1 
ATOM   7670 C C   . GLY B 1 455 ? 8.765   -79.896 -25.274 1.00 37.05  ? 456 GLY B C   1 
ATOM   7671 O O   . GLY B 1 455 ? 9.353   -80.934 -25.601 1.00 33.73  ? 456 GLY B O   1 
ATOM   7672 N N   . ILE B 1 456 ? 9.303   -78.691 -25.413 1.00 29.93  ? 457 ILE B N   1 
ATOM   7673 C CA  . ILE B 1 456 ? 10.674  -78.500 -25.883 1.00 28.62  ? 457 ILE B CA  1 
ATOM   7674 C C   . ILE B 1 456 ? 11.732  -79.395 -25.198 1.00 35.05  ? 457 ILE B C   1 
ATOM   7675 O O   . ILE B 1 456 ? 12.686  -79.812 -25.848 1.00 36.19  ? 457 ILE B O   1 
ATOM   7676 C CB  . ILE B 1 456 ? 11.080  -77.000 -25.807 1.00 38.54  ? 457 ILE B CB  1 
ATOM   7677 C CG1 . ILE B 1 456 ? 10.077  -76.146 -26.587 1.00 32.86  ? 457 ILE B CG1 1 
ATOM   7678 C CG2 . ILE B 1 456 ? 12.495  -76.772 -26.323 1.00 32.43  ? 457 ILE B CG2 1 
ATOM   7679 C CD1 . ILE B 1 456 ? 9.887   -76.602 -28.020 1.00 31.20  ? 457 ILE B CD1 1 
ATOM   7680 N N   . PRO B 1 457 ? 11.573  -79.703 -23.891 1.00 35.06  ? 458 PRO B N   1 
ATOM   7681 C CA  . PRO B 1 457 ? 12.570  -80.620 -23.320 1.00 37.08  ? 458 PRO B CA  1 
ATOM   7682 C C   . PRO B 1 457 ? 12.670  -82.005 -23.984 1.00 39.37  ? 458 PRO B C   1 
ATOM   7683 O O   . PRO B 1 457 ? 13.703  -82.657 -23.832 1.00 37.27  ? 458 PRO B O   1 
ATOM   7684 C CB  . PRO B 1 457 ? 12.129  -80.750 -21.855 1.00 35.03  ? 458 PRO B CB  1 
ATOM   7685 C CG  . PRO B 1 457 ? 11.490  -79.450 -21.559 1.00 35.91  ? 458 PRO B CG  1 
ATOM   7686 C CD  . PRO B 1 457 ? 10.780  -79.048 -22.830 1.00 28.00  ? 458 PRO B CD  1 
ATOM   7687 N N   . LEU B 1 458 ? 11.641  -82.442 -24.704 1.00 33.96  ? 459 LEU B N   1 
ATOM   7688 C CA  . LEU B 1 458 ? 11.722  -83.715 -25.420 1.00 38.75  ? 459 LEU B CA  1 
ATOM   7689 C C   . LEU B 1 458 ? 12.651  -83.656 -26.635 1.00 37.38  ? 459 LEU B C   1 
ATOM   7690 O O   . LEU B 1 458 ? 12.987  -84.686 -27.218 1.00 43.79  ? 459 LEU B O   1 
ATOM   7691 C CB  . LEU B 1 458 ? 10.339  -84.186 -25.861 1.00 36.13  ? 459 LEU B CB  1 
ATOM   7692 C CG  . LEU B 1 458 ? 9.314   -84.296 -24.746 1.00 36.76  ? 459 LEU B CG  1 
ATOM   7693 C CD1 . LEU B 1 458 ? 8.028   -84.871 -25.298 1.00 32.87  ? 459 LEU B CD1 1 
ATOM   7694 C CD2 . LEU B 1 458 ? 9.866   -85.149 -23.632 1.00 33.69  ? 459 LEU B CD2 1 
ATOM   7695 N N   . ASP B 1 459 ? 13.059  -82.452 -27.017 1.00 42.20  ? 460 ASP B N   1 
ATOM   7696 C CA  . ASP B 1 459 ? 13.926  -82.266 -28.177 1.00 48.03  ? 460 ASP B CA  1 
ATOM   7697 C C   . ASP B 1 459 ? 15.302  -82.859 -27.874 1.00 52.73  ? 460 ASP B C   1 
ATOM   7698 O O   . ASP B 1 459 ? 16.033  -82.343 -27.028 1.00 48.32  ? 460 ASP B O   1 
ATOM   7699 C CB  . ASP B 1 459 ? 14.034  -80.774 -28.499 1.00 51.75  ? 460 ASP B CB  1 
ATOM   7700 C CG  . ASP B 1 459 ? 14.766  -80.488 -29.802 1.00 44.05  ? 460 ASP B CG  1 
ATOM   7701 O OD1 . ASP B 1 459 ? 15.579  -81.320 -30.252 1.00 48.62  ? 460 ASP B OD1 1 
ATOM   7702 O OD2 . ASP B 1 459 ? 14.536  -79.395 -30.360 1.00 58.83  ? 460 ASP B OD2 1 
ATOM   7703 N N   . PRO B 1 460 ? 15.665  -83.936 -28.583 1.00 54.77  ? 461 PRO B N   1 
ATOM   7704 C CA  . PRO B 1 460 ? 16.878  -84.713 -28.301 1.00 52.12  ? 461 PRO B CA  1 
ATOM   7705 C C   . PRO B 1 460 ? 18.147  -83.862 -28.332 1.00 55.59  ? 461 PRO B C   1 
ATOM   7706 O O   . PRO B 1 460 ? 19.093  -84.153 -27.601 1.00 64.47  ? 461 PRO B O   1 
ATOM   7707 C CB  . PRO B 1 460 ? 16.908  -85.739 -29.437 1.00 53.16  ? 461 PRO B CB  1 
ATOM   7708 C CG  . PRO B 1 460 ? 15.509  -85.798 -29.951 1.00 66.66  ? 461 PRO B CG  1 
ATOM   7709 C CD  . PRO B 1 460 ? 14.964  -84.420 -29.783 1.00 55.40  ? 461 PRO B CD  1 
ATOM   7710 N N   . SER B 1 461 ? 18.153  -82.817 -29.155 1.00 52.18  ? 462 SER B N   1 
ATOM   7711 C CA  . SER B 1 461 ? 19.333  -81.977 -29.338 1.00 45.23  ? 462 SER B CA  1 
ATOM   7712 C C   . SER B 1 461 ? 19.533  -81.009 -28.183 1.00 51.89  ? 462 SER B C   1 
ATOM   7713 O O   . SER B 1 461 ? 20.539  -80.305 -28.113 1.00 57.38  ? 462 SER B O   1 
ATOM   7714 C CB  . SER B 1 461 ? 19.214  -81.188 -30.638 1.00 48.63  ? 462 SER B CB  1 
ATOM   7715 O OG  . SER B 1 461 ? 18.103  -80.312 -30.583 1.00 57.24  ? 462 SER B OG  1 
ATOM   7716 N N   . ARG B 1 462 ? 18.563  -80.962 -27.280 1.00 56.42  ? 463 ARG B N   1 
ATOM   7717 C CA  . ARG B 1 462 ? 18.658  -80.081 -26.126 1.00 58.77  ? 463 ARG B CA  1 
ATOM   7718 C C   . ARG B 1 462 ? 19.029  -80.854 -24.857 1.00 62.52  ? 463 ARG B C   1 
ATOM   7719 O O   . ARG B 1 462 ? 18.921  -82.082 -24.818 1.00 61.34  ? 463 ARG B O   1 
ATOM   7720 C CB  . ARG B 1 462 ? 17.369  -79.282 -25.971 1.00 46.82  ? 463 ARG B CB  1 
ATOM   7721 C CG  . ARG B 1 462 ? 17.255  -78.221 -27.031 1.00 40.76  ? 463 ARG B CG  1 
ATOM   7722 C CD  . ARG B 1 462 ? 15.890  -77.591 -27.070 1.00 45.98  ? 463 ARG B CD  1 
ATOM   7723 N NE  . ARG B 1 462 ? 15.744  -76.774 -28.268 1.00 57.77  ? 463 ARG B NE  1 
ATOM   7724 C CZ  . ARG B 1 462 ? 15.965  -75.466 -28.316 1.00 64.78  ? 463 ARG B CZ  1 
ATOM   7725 N NH1 . ARG B 1 462 ? 16.330  -74.812 -27.219 1.00 70.32  ? 463 ARG B NH1 1 
ATOM   7726 N NH2 . ARG B 1 462 ? 15.812  -74.813 -29.462 1.00 63.89  ? 463 ARG B NH2 1 
ATOM   7727 N N   . ASN B 1 463 ? 19.483  -80.137 -23.832 1.00 49.37  ? 464 ASN B N   1 
ATOM   7728 C CA  . ASN B 1 463 ? 20.123  -80.782 -22.689 1.00 49.74  ? 464 ASN B CA  1 
ATOM   7729 C C   . ASN B 1 463 ? 19.340  -80.676 -21.389 1.00 37.04  ? 464 ASN B C   1 
ATOM   7730 O O   . ASN B 1 463 ? 19.915  -80.434 -20.336 1.00 46.59  ? 464 ASN B O   1 
ATOM   7731 C CB  . ASN B 1 463 ? 21.543  -80.239 -22.497 1.00 52.85  ? 464 ASN B CB  1 
ATOM   7732 C CG  . ASN B 1 463 ? 22.412  -80.443 -23.723 1.00 62.37  ? 464 ASN B CG  1 
ATOM   7733 O OD1 . ASN B 1 463 ? 22.416  -81.521 -24.318 1.00 70.33  ? 464 ASN B OD1 1 
ATOM   7734 N ND2 . ASN B 1 463 ? 23.143  -79.402 -24.117 1.00 65.91  ? 464 ASN B ND2 1 
ATOM   7735 N N   . TYR B 1 464 ? 18.030  -80.875 -21.470 1.00 39.18  ? 465 TYR B N   1 
ATOM   7736 C CA  . TYR B 1 464 ? 17.175  -80.878 -20.289 1.00 41.77  ? 465 TYR B CA  1 
ATOM   7737 C C   . TYR B 1 464 ? 17.371  -82.168 -19.490 1.00 41.77  ? 465 TYR B C   1 
ATOM   7738 O O   . TYR B 1 464 ? 17.663  -83.218 -20.061 1.00 42.89  ? 465 TYR B O   1 
ATOM   7739 C CB  . TYR B 1 464 ? 15.703  -80.728 -20.697 1.00 38.10  ? 465 TYR B CB  1 
ATOM   7740 C CG  . TYR B 1 464 ? 15.334  -79.344 -21.193 1.00 47.22  ? 465 TYR B CG  1 
ATOM   7741 C CD1 . TYR B 1 464 ? 15.486  -78.997 -22.530 1.00 40.19  ? 465 TYR B CD1 1 
ATOM   7742 C CD2 . TYR B 1 464 ? 14.835  -78.382 -20.320 1.00 41.81  ? 465 TYR B CD2 1 
ATOM   7743 C CE1 . TYR B 1 464 ? 15.150  -77.738 -22.985 1.00 39.11  ? 465 TYR B CE1 1 
ATOM   7744 C CE2 . TYR B 1 464 ? 14.499  -77.117 -20.764 1.00 36.51  ? 465 TYR B CE2 1 
ATOM   7745 C CZ  . TYR B 1 464 ? 14.655  -76.800 -22.097 1.00 46.08  ? 465 TYR B CZ  1 
ATOM   7746 O OH  . TYR B 1 464 ? 14.320  -75.539 -22.540 1.00 39.11  ? 465 TYR B OH  1 
ATOM   7747 N N   . THR B 1 465 ? 17.212  -82.092 -18.172 1.00 34.29  ? 466 THR B N   1 
ATOM   7748 C CA  . THR B 1 465 ? 17.264  -83.287 -17.335 1.00 32.58  ? 466 THR B CA  1 
ATOM   7749 C C   . THR B 1 465 ? 16.096  -84.212 -17.669 1.00 37.65  ? 466 THR B C   1 
ATOM   7750 O O   . THR B 1 465 ? 15.103  -83.792 -18.272 1.00 38.05  ? 466 THR B O   1 
ATOM   7751 C CB  . THR B 1 465 ? 17.173  -82.943 -15.832 1.00 35.12  ? 466 THR B CB  1 
ATOM   7752 O OG1 . THR B 1 465 ? 15.851  -82.478 -15.527 1.00 36.50  ? 466 THR B OG1 1 
ATOM   7753 C CG2 . THR B 1 465 ? 18.186  -81.883 -15.454 1.00 27.70  ? 466 THR B CG2 1 
ATOM   7754 N N   . ALA B 1 466 ? 16.210  -85.469 -17.265 1.00 32.01  ? 467 ALA B N   1 
ATOM   7755 C CA  . ALA B 1 466 ? 15.128  -86.421 -17.462 1.00 36.14  ? 467 ALA B CA  1 
ATOM   7756 C C   . ALA B 1 466 ? 13.868  -86.008 -16.697 1.00 41.26  ? 467 ALA B C   1 
ATOM   7757 O O   . ALA B 1 466 ? 12.753  -86.212 -17.185 1.00 44.03  ? 467 ALA B O   1 
ATOM   7758 C CB  . ALA B 1 466 ? 15.569  -87.810 -17.055 1.00 40.76  ? 467 ALA B CB  1 
ATOM   7759 N N   . GLU B 1 467 ? 14.047  -85.432 -15.505 1.00 36.44  ? 468 GLU B N   1 
ATOM   7760 C CA  . GLU B 1 467 ? 12.920  -84.970 -14.684 1.00 36.90  ? 468 GLU B CA  1 
ATOM   7761 C C   . GLU B 1 467 ? 12.144  -83.881 -15.403 1.00 38.43  ? 468 GLU B C   1 
ATOM   7762 O O   . GLU B 1 467 ? 10.912  -83.822 -15.341 1.00 34.41  ? 468 GLU B O   1 
ATOM   7763 C CB  . GLU B 1 467 ? 13.418  -84.352 -13.383 1.00 44.97  ? 468 GLU B CB  1 
ATOM   7764 C CG  . GLU B 1 467 ? 14.049  -85.274 -12.380 1.00 43.58  ? 468 GLU B CG  1 
ATOM   7765 C CD  . GLU B 1 467 ? 14.601  -84.480 -11.209 1.00 82.11  ? 468 GLU B CD  1 
ATOM   7766 O OE1 . GLU B 1 467 ? 15.562  -83.705 -11.425 1.00 82.36  ? 468 GLU B OE1 1 
ATOM   7767 O OE2 . GLU B 1 467 ? 14.057  -84.596 -10.087 1.00 70.27  ? 468 GLU B OE2 1 
ATOM   7768 N N   . GLU B 1 468 ? 12.886  -82.988 -16.051 1.00 30.70  ? 469 GLU B N   1 
ATOM   7769 C CA  . GLU B 1 468 ? 12.279  -81.918 -16.826 1.00 34.95  ? 469 GLU B CA  1 
ATOM   7770 C C   . GLU B 1 468 ? 11.468  -82.475 -17.992 1.00 37.89  ? 469 GLU B C   1 
ATOM   7771 O O   . GLU B 1 468 ? 10.455  -81.884 -18.387 1.00 34.08  ? 469 GLU B O   1 
ATOM   7772 C CB  . GLU B 1 468 ? 13.339  -80.922 -17.295 1.00 33.62  ? 469 GLU B CB  1 
ATOM   7773 C CG  . GLU B 1 468 ? 13.895  -80.081 -16.140 1.00 29.04  ? 469 GLU B CG  1 
ATOM   7774 C CD  . GLU B 1 468 ? 15.065  -79.210 -16.547 1.00 36.68  ? 469 GLU B CD  1 
ATOM   7775 O OE1 . GLU B 1 468 ? 15.975  -79.714 -17.236 1.00 36.71  ? 469 GLU B OE1 1 
ATOM   7776 O OE2 . GLU B 1 468 ? 15.079  -78.017 -16.171 1.00 40.26  ? 469 GLU B OE2 1 
ATOM   7777 N N   . LYS B 1 469 ? 11.884  -83.626 -18.521 1.00 27.54  ? 470 LYS B N   1 
ATOM   7778 C CA  . LYS B 1 469 ? 11.119  -84.255 -19.599 1.00 34.98  ? 470 LYS B CA  1 
ATOM   7779 C C   . LYS B 1 469 ? 9.815   -84.805 -19.048 1.00 29.96  ? 470 LYS B C   1 
ATOM   7780 O O   . LYS B 1 469 ? 8.760   -84.690 -19.677 1.00 31.45  ? 470 LYS B O   1 
ATOM   7781 C CB  . LYS B 1 469 ? 11.934  -85.346 -20.303 1.00 37.19  ? 470 LYS B CB  1 
ATOM   7782 C CG  . LYS B 1 469 ? 13.079  -84.782 -21.129 1.00 38.21  ? 470 LYS B CG  1 
ATOM   7783 C CD  . LYS B 1 469 ? 14.117  -85.827 -21.499 1.00 30.34  ? 470 LYS B CD  1 
ATOM   7784 C CE  . LYS B 1 469 ? 15.342  -85.146 -22.074 1.00 31.69  ? 470 LYS B CE  1 
ATOM   7785 N NZ  . LYS B 1 469 ? 16.400  -86.083 -22.491 1.00 39.40  ? 470 LYS B NZ  1 
ATOM   7786 N N   . ILE B 1 470 ? 9.887   -85.387 -17.856 1.00 33.43  ? 471 ILE B N   1 
ATOM   7787 C CA  . ILE B 1 470 ? 8.693   -85.901 -17.192 1.00 34.84  ? 471 ILE B CA  1 
ATOM   7788 C C   . ILE B 1 470 ? 7.727   -84.750 -16.896 1.00 36.18  ? 471 ILE B C   1 
ATOM   7789 O O   . ILE B 1 470 ? 6.518   -84.850 -17.152 1.00 38.92  ? 471 ILE B O   1 
ATOM   7790 C CB  . ILE B 1 470 ? 9.054   -86.662 -15.889 1.00 36.18  ? 471 ILE B CB  1 
ATOM   7791 C CG1 . ILE B 1 470 ? 9.864   -87.920 -16.210 1.00 35.00  ? 471 ILE B CG1 1 
ATOM   7792 C CG2 . ILE B 1 470 ? 7.804   -87.031 -15.123 1.00 24.76  ? 471 ILE B CG2 1 
ATOM   7793 C CD1 . ILE B 1 470 ? 9.098   -88.946 -17.047 1.00 44.86  ? 471 ILE B CD1 1 
ATOM   7794 N N   . PHE B 1 471 ? 8.282   -83.656 -16.375 1.00 31.50  ? 472 PHE B N   1 
ATOM   7795 C CA  . PHE B 1 471 ? 7.529   -82.435 -16.076 1.00 34.75  ? 472 PHE B CA  1 
ATOM   7796 C C   . PHE B 1 471 ? 6.827   -81.866 -17.318 1.00 30.94  ? 472 PHE B C   1 
ATOM   7797 O O   . PHE B 1 471 ? 5.636   -81.543 -17.283 1.00 30.91  ? 472 PHE B O   1 
ATOM   7798 C CB  . PHE B 1 471 ? 8.484   -81.392 -15.488 1.00 40.45  ? 472 PHE B CB  1 
ATOM   7799 C CG  . PHE B 1 471 ? 7.805   -80.146 -14.993 1.00 37.22  ? 472 PHE B CG  1 
ATOM   7800 C CD1 . PHE B 1 471 ? 6.598   -80.216 -14.314 1.00 31.12  ? 472 PHE B CD1 1 
ATOM   7801 C CD2 . PHE B 1 471 ? 8.396   -78.904 -15.176 1.00 34.00  ? 472 PHE B CD2 1 
ATOM   7802 C CE1 . PHE B 1 471 ? 5.980   -79.067 -13.849 1.00 32.31  ? 472 PHE B CE1 1 
ATOM   7803 C CE2 . PHE B 1 471 ? 7.782   -77.751 -14.715 1.00 34.43  ? 472 PHE B CE2 1 
ATOM   7804 C CZ  . PHE B 1 471 ? 6.573   -77.836 -14.045 1.00 32.13  ? 472 PHE B CZ  1 
ATOM   7805 N N   . ALA B 1 472 ? 7.570   -81.749 -18.413 1.00 26.31  ? 473 ALA B N   1 
ATOM   7806 C CA  . ALA B 1 472 ? 7.001   -81.265 -19.671 1.00 29.18  ? 473 ALA B CA  1 
ATOM   7807 C C   . ALA B 1 472 ? 5.809   -82.113 -20.101 1.00 29.33  ? 473 ALA B C   1 
ATOM   7808 O O   . ALA B 1 472 ? 4.772   -81.582 -20.502 1.00 31.07  ? 473 ALA B O   1 
ATOM   7809 C CB  . ALA B 1 472 ? 8.061   -81.232 -20.762 1.00 31.49  ? 473 ALA B CB  1 
ATOM   7810 N N   . GLN B 1 473 ? 5.944   -83.432 -19.984 1.00 30.04  ? 474 GLN B N   1 
ATOM   7811 C CA  . GLN B 1 473 ? 4.846   -84.335 -20.333 1.00 37.04  ? 474 GLN B CA  1 
ATOM   7812 C C   . GLN B 1 473 ? 3.629   -84.132 -19.436 1.00 37.00  ? 474 GLN B C   1 
ATOM   7813 O O   . GLN B 1 473 ? 2.486   -84.201 -19.911 1.00 38.84  ? 474 GLN B O   1 
ATOM   7814 C CB  . GLN B 1 473 ? 5.310   -85.795 -20.308 1.00 30.01  ? 474 GLN B CB  1 
ATOM   7815 C CG  . GLN B 1 473 ? 6.393   -86.075 -21.328 1.00 39.32  ? 474 GLN B CG  1 
ATOM   7816 C CD  . GLN B 1 473 ? 6.831   -87.525 -21.354 1.00 47.70  ? 474 GLN B CD  1 
ATOM   7817 O OE1 . GLN B 1 473 ? 7.244   -88.083 -20.337 1.00 49.85  ? 474 GLN B OE1 1 
ATOM   7818 N NE2 . GLN B 1 473 ? 6.750   -88.141 -22.526 1.00 53.36  ? 474 GLN B NE2 1 
ATOM   7819 N N   . ARG B 1 474 ? 3.881   -83.887 -18.144 1.00 33.71  ? 475 ARG B N   1 
ATOM   7820 C CA  . ARG B 1 474 ? 2.819   -83.588 -17.183 1.00 31.53  ? 475 ARG B CA  1 
ATOM   7821 C C   . ARG B 1 474 ? 2.070   -82.336 -17.607 1.00 26.82  ? 475 ARG B C   1 
ATOM   7822 O O   . ARG B 1 474 ? 0.839   -82.331 -17.678 1.00 29.86  ? 475 ARG B O   1 
ATOM   7823 C CB  . ARG B 1 474 ? 3.379   -83.380 -15.763 1.00 30.12  ? 475 ARG B CB  1 
ATOM   7824 C CG  . ARG B 1 474 ? 3.406   -84.616 -14.875 1.00 44.70  ? 475 ARG B CG  1 
ATOM   7825 C CD  . ARG B 1 474 ? 3.878   -84.287 -13.440 1.00 47.32  ? 475 ARG B CD  1 
ATOM   7826 N NE  . ARG B 1 474 ? 3.003   -83.316 -12.789 1.00 36.73  ? 475 ARG B NE  1 
ATOM   7827 C CZ  . ARG B 1 474 ? 3.426   -82.303 -12.033 1.00 37.34  ? 475 ARG B CZ  1 
ATOM   7828 N NH1 . ARG B 1 474 ? 4.723   -82.114 -11.816 1.00 27.61  ? 475 ARG B NH1 1 
ATOM   7829 N NH2 . ARG B 1 474 ? 2.544   -81.470 -11.497 1.00 28.35  ? 475 ARG B NH2 1 
ATOM   7830 N N   . LEU B 1 475 ? 2.819   -81.271 -17.879 1.00 28.16  ? 476 LEU B N   1 
ATOM   7831 C CA  . LEU B 1 475 ? 2.211   -80.002 -18.273 1.00 29.32  ? 476 LEU B CA  1 
ATOM   7832 C C   . LEU B 1 475 ? 1.398   -80.116 -19.557 1.00 28.42  ? 476 LEU B C   1 
ATOM   7833 O O   . LEU B 1 475 ? 0.271   -79.621 -19.616 1.00 33.30  ? 476 LEU B O   1 
ATOM   7834 C CB  . LEU B 1 475 ? 3.263   -78.899 -18.398 1.00 24.41  ? 476 LEU B CB  1 
ATOM   7835 C CG  . LEU B 1 475 ? 3.934   -78.532 -17.073 1.00 31.13  ? 476 LEU B CG  1 
ATOM   7836 C CD1 . LEU B 1 475 ? 4.846   -77.342 -17.231 1.00 39.05  ? 476 LEU B CD1 1 
ATOM   7837 C CD2 . LEU B 1 475 ? 2.894   -78.271 -15.989 1.00 36.14  ? 476 LEU B CD2 1 
ATOM   7838 N N   . MET B 1 476 ? 1.960   -80.772 -20.574 1.00 23.02  ? 477 MET B N   1 
ATOM   7839 C CA  . MET B 1 476 ? 1.262   -80.928 -21.852 1.00 29.46  ? 477 MET B CA  1 
ATOM   7840 C C   . MET B 1 476 ? -0.061  -81.651 -21.633 1.00 40.01  ? 477 MET B C   1 
ATOM   7841 O O   . MET B 1 476 ? -1.093  -81.302 -22.234 1.00 29.24  ? 477 MET B O   1 
ATOM   7842 C CB  . MET B 1 476 ? 2.120   -81.703 -22.859 1.00 31.43  ? 477 MET B CB  1 
ATOM   7843 C CG  . MET B 1 476 ? 3.360   -80.955 -23.341 1.00 36.99  ? 477 MET B CG  1 
ATOM   7844 S SD  . MET B 1 476 ? 4.137   -81.720 -24.785 1.00 43.95  ? 477 MET B SD  1 
ATOM   7845 C CE  . MET B 1 476 ? 5.113   -83.000 -24.004 1.00 42.32  ? 477 MET B CE  1 
ATOM   7846 N N   . ARG B 1 477 ? -0.018  -82.650 -20.749 1.00 36.94  ? 478 ARG B N   1 
ATOM   7847 C CA  . ARG B 1 477 ? -1.199  -83.426 -20.381 1.00 34.05  ? 478 ARG B CA  1 
ATOM   7848 C C   . ARG B 1 477 ? -2.287  -82.548 -19.735 1.00 34.61  ? 478 ARG B C   1 
ATOM   7849 O O   . ARG B 1 477 ? -3.464  -82.634 -20.112 1.00 29.58  ? 478 ARG B O   1 
ATOM   7850 C CB  . ARG B 1 477 ? -0.800  -84.601 -19.473 1.00 35.10  ? 478 ARG B CB  1 
ATOM   7851 C CG  . ARG B 1 477 ? -1.977  -85.398 -18.916 1.00 32.34  ? 478 ARG B CG  1 
ATOM   7852 C CD  . ARG B 1 477 ? -2.884  -85.947 -20.026 1.00 48.89  ? 478 ARG B CD  1 
ATOM   7853 N NE  . ARG B 1 477 ? -2.141  -86.776 -20.971 1.00 47.07  ? 478 ARG B NE  1 
ATOM   7854 C CZ  . ARG B 1 477 ? -1.812  -88.045 -20.751 1.00 53.91  ? 478 ARG B CZ  1 
ATOM   7855 N NH1 . ARG B 1 477 ? -2.171  -88.631 -19.619 1.00 49.98  ? 478 ARG B NH1 1 
ATOM   7856 N NH2 . ARG B 1 477 ? -1.128  -88.730 -21.660 1.00 52.21  ? 478 ARG B NH2 1 
ATOM   7857 N N   . TYR B 1 478 ? -1.896  -81.696 -18.782 1.00 32.31  ? 479 TYR B N   1 
ATOM   7858 C CA  . TYR B 1 478 ? -2.843  -80.743 -18.180 1.00 32.43  ? 479 TYR B CA  1 
ATOM   7859 C C   . TYR B 1 478 ? -3.467  -79.849 -19.249 1.00 32.63  ? 479 TYR B C   1 
ATOM   7860 O O   . TYR B 1 478 ? -4.697  -79.725 -19.333 1.00 31.28  ? 479 TYR B O   1 
ATOM   7861 C CB  . TYR B 1 478 ? -2.167  -79.835 -17.148 1.00 36.38  ? 479 TYR B CB  1 
ATOM   7862 C CG  . TYR B 1 478 ? -1.672  -80.487 -15.875 1.00 32.17  ? 479 TYR B CG  1 
ATOM   7863 C CD1 . TYR B 1 478 ? -2.438  -81.415 -15.183 1.00 37.07  ? 479 TYR B CD1 1 
ATOM   7864 C CD2 . TYR B 1 478 ? -0.434  -80.148 -15.358 1.00 31.33  ? 479 TYR B CD2 1 
ATOM   7865 C CE1 . TYR B 1 478 ? -1.968  -81.988 -14.005 1.00 33.70  ? 479 TYR B CE1 1 
ATOM   7866 C CE2 . TYR B 1 478 ? 0.041   -80.711 -14.201 1.00 35.27  ? 479 TYR B CE2 1 
ATOM   7867 C CZ  . TYR B 1 478 ? -0.722  -81.628 -13.527 1.00 36.55  ? 479 TYR B CZ  1 
ATOM   7868 O OH  . TYR B 1 478 ? -0.212  -82.171 -12.374 1.00 33.77  ? 479 TYR B OH  1 
ATOM   7869 N N   . TRP B 1 479 ? -2.613  -79.208 -20.051 1.00 31.76  ? 480 TRP B N   1 
ATOM   7870 C CA  . TRP B 1 479 ? -3.088  -78.331 -21.127 1.00 32.84  ? 480 TRP B CA  1 
ATOM   7871 C C   . TRP B 1 479 ? -4.036  -79.053 -22.076 1.00 29.46  ? 480 TRP B C   1 
ATOM   7872 O O   . TRP B 1 479 ? -5.100  -78.528 -22.415 1.00 30.15  ? 480 TRP B O   1 
ATOM   7873 C CB  . TRP B 1 479 ? -1.922  -77.706 -21.901 1.00 26.96  ? 480 TRP B CB  1 
ATOM   7874 C CG  . TRP B 1 479 ? -1.558  -76.304 -21.438 1.00 35.03  ? 480 TRP B CG  1 
ATOM   7875 C CD1 . TRP B 1 479 ? -1.568  -75.163 -22.192 1.00 33.34  ? 480 TRP B CD1 1 
ATOM   7876 C CD2 . TRP B 1 479 ? -1.141  -75.907 -20.119 1.00 31.32  ? 480 TRP B CD2 1 
ATOM   7877 N NE1 . TRP B 1 479 ? -1.180  -74.084 -21.430 1.00 29.19  ? 480 TRP B NE1 1 
ATOM   7878 C CE2 . TRP B 1 479 ? -0.915  -74.512 -20.155 1.00 32.00  ? 480 TRP B CE2 1 
ATOM   7879 C CE3 . TRP B 1 479 ? -0.936  -76.595 -18.911 1.00 33.02  ? 480 TRP B CE3 1 
ATOM   7880 C CZ2 . TRP B 1 479 ? -0.495  -73.791 -19.024 1.00 31.53  ? 480 TRP B CZ2 1 
ATOM   7881 C CZ3 . TRP B 1 479 ? -0.513  -75.878 -17.792 1.00 30.78  ? 480 TRP B CZ3 1 
ATOM   7882 C CH2 . TRP B 1 479 ? -0.301  -74.491 -17.857 1.00 29.21  ? 480 TRP B CH2 1 
ATOM   7883 N N   . ALA B 1 480 ? -3.670  -80.266 -22.485 1.00 30.29  ? 481 ALA B N   1 
ATOM   7884 C CA  . ALA B 1 480 ? -4.499  -80.998 -23.449 1.00 36.33  ? 481 ALA B CA  1 
ATOM   7885 C C   . ALA B 1 480 ? -5.782  -81.514 -22.804 1.00 36.23  ? 481 ALA B C   1 
ATOM   7886 O O   . ALA B 1 480 ? -6.840  -81.524 -23.440 1.00 35.32  ? 481 ALA B O   1 
ATOM   7887 C CB  . ALA B 1 480 ? -3.720  -82.134 -24.096 1.00 28.53  ? 481 ALA B CB  1 
ATOM   7888 N N   . ASN B 1 481 ? -5.690  -81.938 -21.544 1.00 35.20  ? 482 ASN B N   1 
ATOM   7889 C CA  . ASN B 1 481 ? -6.890  -82.315 -20.800 1.00 34.51  ? 482 ASN B CA  1 
ATOM   7890 C C   . ASN B 1 481 ? -7.844  -81.134 -20.726 1.00 34.67  ? 482 ASN B C   1 
ATOM   7891 O O   . ASN B 1 481 ? -9.050  -81.281 -20.939 1.00 35.84  ? 482 ASN B O   1 
ATOM   7892 C CB  . ASN B 1 481 ? -6.554  -82.813 -19.393 1.00 39.23  ? 482 ASN B CB  1 
ATOM   7893 C CG  . ASN B 1 481 ? -6.047  -84.241 -19.380 1.00 37.07  ? 482 ASN B CG  1 
ATOM   7894 O OD1 . ASN B 1 481 ? -6.227  -84.989 -20.338 1.00 46.55  ? 482 ASN B OD1 1 
ATOM   7895 N ND2 . ASN B 1 481 ? -5.414  -84.627 -18.284 1.00 40.88  ? 482 ASN B ND2 1 
ATOM   7896 N N   . PHE B 1 482 ? -7.295  -79.955 -20.444 1.00 31.60  ? 483 PHE B N   1 
ATOM   7897 C CA  . PHE B 1 482 ? -8.107  -78.755 -20.419 1.00 32.34  ? 483 PHE B CA  1 
ATOM   7898 C C   . PHE B 1 482 ? -8.717  -78.486 -21.798 1.00 36.33  ? 483 PHE B C   1 
ATOM   7899 O O   . PHE B 1 482 ? -9.909  -78.196 -21.907 1.00 38.71  ? 483 PHE B O   1 
ATOM   7900 C CB  . PHE B 1 482 ? -7.317  -77.534 -19.921 1.00 27.65  ? 483 PHE B CB  1 
ATOM   7901 C CG  . PHE B 1 482 ? -8.124  -76.266 -19.953 1.00 42.08  ? 483 PHE B CG  1 
ATOM   7902 C CD1 . PHE B 1 482 ? -9.065  -76.003 -18.964 1.00 29.83  ? 483 PHE B CD1 1 
ATOM   7903 C CD2 . PHE B 1 482 ? -7.986  -75.359 -20.998 1.00 27.76  ? 483 PHE B CD2 1 
ATOM   7904 C CE1 . PHE B 1 482 ? -9.833  -74.849 -19.003 1.00 33.35  ? 483 PHE B CE1 1 
ATOM   7905 C CE2 . PHE B 1 482 ? -8.752  -74.198 -21.035 1.00 31.31  ? 483 PHE B CE2 1 
ATOM   7906 C CZ  . PHE B 1 482 ? -9.680  -73.946 -20.037 1.00 30.12  ? 483 PHE B CZ  1 
ATOM   7907 N N   . ALA B 1 483 ? -7.901  -78.597 -22.846 1.00 34.58  ? 484 ALA B N   1 
ATOM   7908 C CA  . ALA B 1 483 ? -8.377  -78.391 -24.217 1.00 33.02  ? 484 ALA B CA  1 
ATOM   7909 C C   . ALA B 1 483 ? -9.518  -79.346 -24.539 1.00 34.26  ? 484 ALA B C   1 
ATOM   7910 O O   . ALA B 1 483 ? -10.565 -78.928 -25.026 1.00 31.98  ? 484 ALA B O   1 
ATOM   7911 C CB  . ALA B 1 483 ? -7.240  -78.566 -25.216 1.00 28.24  ? 484 ALA B CB  1 
ATOM   7912 N N   . ARG B 1 484 ? -9.318  -80.626 -24.232 1.00 29.90  ? 485 ARG B N   1 
ATOM   7913 C CA  . ARG B 1 484 ? -10.328 -81.652 -24.504 1.00 40.07  ? 485 ARG B CA  1 
ATOM   7914 C C   . ARG B 1 484 ? -11.610 -81.500 -23.681 1.00 42.50  ? 485 ARG B C   1 
ATOM   7915 O O   . ARG B 1 484 ? -12.705 -81.480 -24.241 1.00 47.07  ? 485 ARG B O   1 
ATOM   7916 C CB  . ARG B 1 484 ? -9.750  -83.056 -24.294 1.00 30.12  ? 485 ARG B CB  1 
ATOM   7917 C CG  . ARG B 1 484 ? -8.727  -83.459 -25.328 1.00 31.26  ? 485 ARG B CG  1 
ATOM   7918 C CD  . ARG B 1 484 ? -8.238  -84.870 -25.090 1.00 24.06  ? 485 ARG B CD  1 
ATOM   7919 N NE  . ARG B 1 484 ? -7.279  -84.943 -24.002 1.00 33.31  ? 485 ARG B NE  1 
ATOM   7920 C CZ  . ARG B 1 484 ? -5.965  -84.993 -24.170 1.00 33.03  ? 485 ARG B CZ  1 
ATOM   7921 N NH1 . ARG B 1 484 ? -5.455  -84.980 -25.391 1.00 34.96  ? 485 ARG B NH1 1 
ATOM   7922 N NH2 . ARG B 1 484 ? -5.160  -85.060 -23.115 1.00 34.34  ? 485 ARG B NH2 1 
ATOM   7923 N N   . THR B 1 485 ? -11.471 -81.378 -22.362 1.00 40.20  ? 486 THR B N   1 
ATOM   7924 C CA  . THR B 1 485 ? -12.614 -81.516 -21.457 1.00 42.17  ? 486 THR B CA  1 
ATOM   7925 C C   . THR B 1 485 ? -12.988 -80.254 -20.693 1.00 46.94  ? 486 THR B C   1 
ATOM   7926 O O   . THR B 1 485 ? -14.060 -80.190 -20.105 1.00 43.09  ? 486 THR B O   1 
ATOM   7927 C CB  . THR B 1 485 ? -12.337 -82.572 -20.391 1.00 36.21  ? 486 THR B CB  1 
ATOM   7928 O OG1 . THR B 1 485 ? -11.452 -82.019 -19.411 1.00 39.81  ? 486 THR B OG1 1 
ATOM   7929 C CG2 . THR B 1 485 ? -11.705 -83.820 -21.007 1.00 31.53  ? 486 THR B CG2 1 
ATOM   7930 N N   . GLY B 1 486 ? -12.107 -79.261 -20.682 1.00 49.04  ? 487 GLY B N   1 
ATOM   7931 C CA  . GLY B 1 486 ? -12.364 -78.043 -19.935 1.00 33.84  ? 487 GLY B CA  1 
ATOM   7932 C C   . GLY B 1 486 ? -11.876 -78.179 -18.504 1.00 46.26  ? 487 GLY B C   1 
ATOM   7933 O O   . GLY B 1 486 ? -12.196 -77.361 -17.643 1.00 39.15  ? 487 GLY B O   1 
ATOM   7934 N N   . ASP B 1 487 ? -11.077 -79.216 -18.267 1.00 40.75  ? 488 ASP B N   1 
ATOM   7935 C CA  . ASP B 1 487 ? -10.626 -79.584 -16.934 1.00 34.50  ? 488 ASP B CA  1 
ATOM   7936 C C   . ASP B 1 487 ? -9.263  -80.248 -17.084 1.00 35.02  ? 488 ASP B C   1 
ATOM   7937 O O   . ASP B 1 487 ? -9.137  -81.260 -17.766 1.00 37.99  ? 488 ASP B O   1 
ATOM   7938 C CB  . ASP B 1 487 ? -11.640 -80.562 -16.326 1.00 48.34  ? 488 ASP B CB  1 
ATOM   7939 C CG  . ASP B 1 487 ? -11.351 -80.915 -14.865 1.00 41.51  ? 488 ASP B CG  1 
ATOM   7940 O OD1 . ASP B 1 487 ? -10.176 -80.918 -14.434 1.00 42.91  ? 488 ASP B OD1 1 
ATOM   7941 O OD2 . ASP B 1 487 ? -12.328 -81.225 -14.150 1.00 47.00  ? 488 ASP B OD2 1 
ATOM   7942 N N   . PRO B 1 488 ? -8.233  -79.682 -16.442 1.00 37.74  ? 489 PRO B N   1 
ATOM   7943 C CA  . PRO B 1 488 ? -6.877  -80.229 -16.589 1.00 34.42  ? 489 PRO B CA  1 
ATOM   7944 C C   . PRO B 1 488 ? -6.695  -81.565 -15.884 1.00 37.08  ? 489 PRO B C   1 
ATOM   7945 O O   . PRO B 1 488 ? -5.709  -82.257 -16.148 1.00 34.04  ? 489 PRO B O   1 
ATOM   7946 C CB  . PRO B 1 488 ? -5.991  -79.166 -15.919 1.00 33.08  ? 489 PRO B CB  1 
ATOM   7947 C CG  . PRO B 1 488 ? -6.906  -78.491 -14.927 1.00 36.36  ? 489 PRO B CG  1 
ATOM   7948 C CD  . PRO B 1 488 ? -8.259  -78.465 -15.609 1.00 35.20  ? 489 PRO B CD  1 
ATOM   7949 N N   . ASN B 1 489 ? -7.615  -81.915 -14.989 1.00 35.68  ? 490 ASN B N   1 
ATOM   7950 C CA  . ASN B 1 489 ? -7.484  -83.155 -14.222 1.00 38.68  ? 490 ASN B CA  1 
ATOM   7951 C C   . ASN B 1 489 ? -7.725  -84.407 -15.052 1.00 52.62  ? 490 ASN B C   1 
ATOM   7952 O O   . ASN B 1 489 ? -8.547  -84.405 -15.979 1.00 46.74  ? 490 ASN B O   1 
ATOM   7953 C CB  . ASN B 1 489 ? -8.443  -83.160 -13.037 1.00 39.50  ? 490 ASN B CB  1 
ATOM   7954 C CG  . ASN B 1 489 ? -8.113  -82.100 -12.028 1.00 41.70  ? 490 ASN B CG  1 
ATOM   7955 O OD1 . ASN B 1 489 ? -7.115  -82.202 -11.315 1.00 37.33  ? 490 ASN B OD1 1 
ATOM   7956 N ND2 . ASN B 1 489 ? -8.953  -81.067 -11.956 1.00 30.43  ? 490 ASN B ND2 1 
ATOM   7957 N N   . GLU B 1 490 ? -7.024  -85.478 -14.691 1.00 57.73  ? 491 GLU B N   1 
ATOM   7958 C CA  . GLU B 1 490 ? -7.101  -86.744 -15.417 1.00 79.64  ? 491 GLU B CA  1 
ATOM   7959 C C   . GLU B 1 490 ? -8.467  -87.426 -15.319 1.00 90.96  ? 491 GLU B C   1 
ATOM   7960 O O   . GLU B 1 490 ? -8.888  -87.816 -14.222 1.00 86.67  ? 491 GLU B O   1 
ATOM   7961 C CB  . GLU B 1 490 ? -5.994  -87.699 -14.954 1.00 76.54  ? 491 GLU B CB  1 
ATOM   7962 C CG  . GLU B 1 490 ? -4.610  -87.376 -15.519 1.00 81.58  ? 491 GLU B CG  1 
ATOM   7963 C CD  . GLU B 1 490 ? -4.446  -87.775 -16.988 1.00 79.03  ? 491 GLU B CD  1 
ATOM   7964 O OE1 . GLU B 1 490 ? -5.461  -87.978 -17.694 1.00 72.09  ? 491 GLU B OE1 1 
ATOM   7965 O OE2 . GLU B 1 490 ? -3.288  -87.895 -17.439 1.00 78.77  ? 491 GLU B OE2 1 
ATOM   7966 N N   . PRO B 1 491 ? -9.158  -87.560 -16.474 1.00 85.44  ? 492 PRO B N   1 
ATOM   7967 C CA  . PRO B 1 491 ? -10.468 -88.208 -16.607 1.00 85.87  ? 492 PRO B CA  1 
ATOM   7968 C C   . PRO B 1 491 ? -10.576 -89.506 -15.805 1.00 94.80  ? 492 PRO B C   1 
ATOM   7969 O O   . PRO B 1 491 ? -11.122 -89.493 -14.699 1.00 80.77  ? 492 PRO B O   1 
ATOM   7970 C CB  . PRO B 1 491 ? -10.547 -88.520 -18.105 1.00 88.67  ? 492 PRO B CB  1 
ATOM   7971 C CG  . PRO B 1 491 ? -9.625  -87.534 -18.774 1.00 71.45  ? 492 PRO B CG  1 
ATOM   7972 C CD  . PRO B 1 491 ? -8.750  -86.903 -17.732 1.00 72.93  ? 492 PRO B CD  1 
ATOM   7973 N N   . PRO B 1 494 ? -6.553  -90.142 -10.756 1.00 108.17 ? 495 PRO B N   1 
ATOM   7974 C CA  . PRO B 1 494 ? -6.932  -91.165 -9.768  1.00 111.69 ? 495 PRO B CA  1 
ATOM   7975 C C   . PRO B 1 494 ? -6.488  -90.809 -8.342  1.00 101.98 ? 495 PRO B C   1 
ATOM   7976 O O   . PRO B 1 494 ? -7.139  -89.996 -7.681  1.00 87.66  ? 495 PRO B O   1 
ATOM   7977 C CB  . PRO B 1 494 ? -6.205  -92.423 -10.267 1.00 102.03 ? 495 PRO B CB  1 
ATOM   7978 C CG  . PRO B 1 494 ? -5.092  -91.911 -11.136 1.00 99.92  ? 495 PRO B CG  1 
ATOM   7979 C CD  . PRO B 1 494 ? -5.622  -90.663 -11.773 1.00 92.29  ? 495 PRO B CD  1 
ATOM   7980 N N   . LYS B 1 495 ? -5.399  -91.422 -7.879  1.00 105.56 ? 496 LYS B N   1 
ATOM   7981 C CA  . LYS B 1 495 ? -4.810  -91.091 -6.583  1.00 101.77 ? 496 LYS B CA  1 
ATOM   7982 C C   . LYS B 1 495 ? -3.942  -89.845 -6.717  1.00 102.14 ? 496 LYS B C   1 
ATOM   7983 O O   . LYS B 1 495 ? -3.477  -89.285 -5.719  1.00 90.69  ? 496 LYS B O   1 
ATOM   7984 C CB  . LYS B 1 495 ? -3.964  -92.252 -6.057  1.00 108.17 ? 496 LYS B CB  1 
ATOM   7985 C CG  . LYS B 1 495 ? -4.729  -93.548 -5.849  1.00 110.59 ? 496 LYS B CG  1 
ATOM   7986 C CD  . LYS B 1 495 ? -3.796  -94.681 -5.445  1.00 111.29 ? 496 LYS B CD  1 
ATOM   7987 C CE  . LYS B 1 495 ? -2.726  -94.933 -6.501  1.00 114.95 ? 496 LYS B CE  1 
ATOM   7988 N NZ  . LYS B 1 495 ? -3.296  -95.382 -7.803  1.00 106.66 ? 496 LYS B NZ  1 
ATOM   7989 N N   . ALA B 1 496 ? -3.724  -89.436 -7.967  1.00 112.55 ? 497 ALA B N   1 
ATOM   7990 C CA  . ALA B 1 496 ? -2.998  -88.212 -8.298  1.00 101.00 ? 497 ALA B CA  1 
ATOM   7991 C C   . ALA B 1 496 ? -3.753  -86.987 -7.780  1.00 84.68  ? 497 ALA B C   1 
ATOM   7992 O O   . ALA B 1 496 ? -4.983  -86.919 -7.898  1.00 75.22  ? 497 ALA B O   1 
ATOM   7993 C CB  . ALA B 1 496 ? -2.786  -88.118 -9.809  1.00 80.40  ? 497 ALA B CB  1 
ATOM   7994 N N   . PRO B 1 497 ? -3.016  -86.011 -7.215  1.00 78.86  ? 498 PRO B N   1 
ATOM   7995 C CA  . PRO B 1 497 ? -3.625  -84.874 -6.507  1.00 75.39  ? 498 PRO B CA  1 
ATOM   7996 C C   . PRO B 1 497 ? -4.455  -83.994 -7.438  1.00 61.35  ? 498 PRO B C   1 
ATOM   7997 O O   . PRO B 1 497 ? -4.051  -83.729 -8.571  1.00 63.26  ? 498 PRO B O   1 
ATOM   7998 C CB  . PRO B 1 497 ? -2.417  -84.110 -5.958  1.00 70.94  ? 498 PRO B CB  1 
ATOM   7999 C CG  . PRO B 1 497 ? -1.300  -84.459 -6.889  1.00 69.55  ? 498 PRO B CG  1 
ATOM   8000 C CD  . PRO B 1 497 ? -1.553  -85.869 -7.343  1.00 64.23  ? 498 PRO B CD  1 
ATOM   8001 N N   . GLN B 1 498 ? -5.619  -83.565 -6.964  1.00 57.24  ? 499 GLN B N   1 
ATOM   8002 C CA  . GLN B 1 498 ? -6.557  -82.842 -7.809  1.00 49.92  ? 499 GLN B CA  1 
ATOM   8003 C C   . GLN B 1 498 ? -6.256  -81.352 -7.875  1.00 54.96  ? 499 GLN B C   1 
ATOM   8004 O O   . GLN B 1 498 ? -5.853  -80.744 -6.887  1.00 42.70  ? 499 GLN B O   1 
ATOM   8005 C CB  . GLN B 1 498 ? -8.002  -83.070 -7.346  1.00 46.64  ? 499 GLN B CB  1 
ATOM   8006 C CG  . GLN B 1 498 ? -8.554  -84.445 -7.705  1.00 55.47  ? 499 GLN B CG  1 
ATOM   8007 C CD  . GLN B 1 498 ? -8.407  -84.770 -9.192  1.00 68.89  ? 499 GLN B CD  1 
ATOM   8008 O OE1 . GLN B 1 498 ? -9.199  -84.315 -10.023 1.00 54.36  ? 499 GLN B OE1 1 
ATOM   8009 N NE2 . GLN B 1 498 ? -7.392  -85.564 -9.528  1.00 48.67  ? 499 GLN B NE2 1 
ATOM   8010 N N   . TRP B 1 499 ? -6.455  -80.781 -9.059  1.00 47.53  ? 500 TRP B N   1 
ATOM   8011 C CA  . TRP B 1 499 ? -6.325  -79.353 -9.287  1.00 35.10  ? 500 TRP B CA  1 
ATOM   8012 C C   . TRP B 1 499 ? -7.721  -78.732 -9.146  1.00 37.93  ? 500 TRP B C   1 
ATOM   8013 O O   . TRP B 1 499 ? -8.573  -78.898 -10.015 1.00 40.28  ? 500 TRP B O   1 
ATOM   8014 C CB  . TRP B 1 499 ? -5.743  -79.139 -10.690 1.00 46.78  ? 500 TRP B CB  1 
ATOM   8015 C CG  . TRP B 1 499 ? -5.430  -77.723 -11.107 1.00 45.29  ? 500 TRP B CG  1 
ATOM   8016 C CD1 . TRP B 1 499 ? -5.941  -76.566 -10.586 1.00 35.90  ? 500 TRP B CD1 1 
ATOM   8017 C CD2 . TRP B 1 499 ? -4.537  -77.329 -12.157 1.00 43.28  ? 500 TRP B CD2 1 
ATOM   8018 N NE1 . TRP B 1 499 ? -5.418  -75.479 -11.245 1.00 40.03  ? 500 TRP B NE1 1 
ATOM   8019 C CE2 . TRP B 1 499 ? -4.551  -75.920 -12.212 1.00 43.54  ? 500 TRP B CE2 1 
ATOM   8020 C CE3 . TRP B 1 499 ? -3.725  -78.032 -13.056 1.00 32.77  ? 500 TRP B CE3 1 
ATOM   8021 C CZ2 . TRP B 1 499 ? -3.778  -75.201 -13.125 1.00 41.15  ? 500 TRP B CZ2 1 
ATOM   8022 C CZ3 . TRP B 1 499 ? -2.958  -77.319 -13.960 1.00 35.42  ? 500 TRP B CZ3 1 
ATOM   8023 C CH2 . TRP B 1 499 ? -2.990  -75.917 -13.988 1.00 43.64  ? 500 TRP B CH2 1 
ATOM   8024 N N   . PRO B 1 500 ? -7.968  -78.027 -8.033  1.00 35.51  ? 501 PRO B N   1 
ATOM   8025 C CA  . PRO B 1 500 ? -9.307  -77.489 -7.770  1.00 35.11  ? 501 PRO B CA  1 
ATOM   8026 C C   . PRO B 1 500 ? -9.565  -76.207 -8.538  1.00 32.53  ? 501 PRO B C   1 
ATOM   8027 O O   . PRO B 1 500 ? -8.621  -75.480 -8.827  1.00 34.74  ? 501 PRO B O   1 
ATOM   8028 C CB  . PRO B 1 500 ? -9.265  -77.184 -6.266  1.00 25.25  ? 501 PRO B CB  1 
ATOM   8029 C CG  . PRO B 1 500 ? -7.850  -76.874 -6.000  1.00 36.40  ? 501 PRO B CG  1 
ATOM   8030 C CD  . PRO B 1 500 ? -7.031  -77.741 -6.933  1.00 34.18  ? 501 PRO B CD  1 
ATOM   8031 N N   . PRO B 1 501 ? -10.833 -75.925 -8.856  1.00 29.77  ? 502 PRO B N   1 
ATOM   8032 C CA  . PRO B 1 501 ? -11.157 -74.637 -9.473  1.00 34.68  ? 502 PRO B CA  1 
ATOM   8033 C C   . PRO B 1 501 ? -10.764 -73.446 -8.604  1.00 38.12  ? 502 PRO B C   1 
ATOM   8034 O O   . PRO B 1 501 ? -10.787 -73.521 -7.373  1.00 38.89  ? 502 PRO B O   1 
ATOM   8035 C CB  . PRO B 1 501 ? -12.679 -74.703 -9.643  1.00 31.14  ? 502 PRO B CB  1 
ATOM   8036 C CG  . PRO B 1 501 ? -12.953 -76.170 -9.824  1.00 30.05  ? 502 PRO B CG  1 
ATOM   8037 C CD  . PRO B 1 501 ? -11.965 -76.867 -8.910  1.00 27.26  ? 502 PRO B CD  1 
ATOM   8038 N N   . TYR B 1 502 ? -10.383 -72.357 -9.263  1.00 40.18  ? 503 TYR B N   1 
ATOM   8039 C CA  . TYR B 1 502 ? -10.154 -71.091 -8.599  1.00 34.76  ? 503 TYR B CA  1 
ATOM   8040 C C   . TYR B 1 502 ? -11.495 -70.390 -8.407  1.00 38.79  ? 503 TYR B C   1 
ATOM   8041 O O   . TYR B 1 502 ? -12.320 -70.350 -9.321  1.00 40.98  ? 503 TYR B O   1 
ATOM   8042 C CB  . TYR B 1 502 ? -9.226  -70.216 -9.441  1.00 35.56  ? 503 TYR B CB  1 
ATOM   8043 C CG  . TYR B 1 502 ? -8.894  -68.884 -8.811  1.00 23.88  ? 503 TYR B CG  1 
ATOM   8044 C CD1 . TYR B 1 502 ? -9.722  -67.785 -8.995  1.00 23.72  ? 503 TYR B CD1 1 
ATOM   8045 C CD2 . TYR B 1 502 ? -7.751  -68.726 -8.025  1.00 21.69  ? 503 TYR B CD2 1 
ATOM   8046 C CE1 . TYR B 1 502 ? -9.431  -66.559 -8.413  1.00 27.71  ? 503 TYR B CE1 1 
ATOM   8047 C CE2 . TYR B 1 502 ? -7.445  -67.496 -7.445  1.00 27.41  ? 503 TYR B CE2 1 
ATOM   8048 C CZ  . TYR B 1 502 ? -8.296  -66.417 -7.644  1.00 28.15  ? 503 TYR B CZ  1 
ATOM   8049 O OH  . TYR B 1 502 ? -8.016  -65.190 -7.086  1.00 31.61  ? 503 TYR B OH  1 
ATOM   8050 N N   . THR B 1 503 ? -11.699 -69.827 -7.217  1.00 35.42  ? 504 THR B N   1 
ATOM   8051 C CA  . THR B 1 503 ? -12.941 -69.120 -6.886  1.00 43.54  ? 504 THR B CA  1 
ATOM   8052 C C   . THR B 1 503 ? -12.604 -67.806 -6.194  1.00 35.02  ? 504 THR B C   1 
ATOM   8053 O O   . THR B 1 503 ? -11.540 -67.676 -5.594  1.00 39.71  ? 504 THR B O   1 
ATOM   8054 C CB  . THR B 1 503 ? -13.826 -69.954 -5.942  1.00 40.04  ? 504 THR B CB  1 
ATOM   8055 O OG1 . THR B 1 503 ? -13.065 -70.313 -4.777  1.00 38.51  ? 504 THR B OG1 1 
ATOM   8056 C CG2 . THR B 1 503 ? -14.303 -71.223 -6.641  1.00 35.83  ? 504 THR B CG2 1 
ATOM   8057 N N   . ALA B 1 504 ? -13.506 -66.835 -6.272  1.00 32.28  ? 505 ALA B N   1 
ATOM   8058 C CA  . ALA B 1 504 ? -13.245 -65.528 -5.678  1.00 30.10  ? 505 ALA B CA  1 
ATOM   8059 C C   . ALA B 1 504 ? -13.030 -65.593 -4.154  1.00 34.82  ? 505 ALA B C   1 
ATOM   8060 O O   . ALA B 1 504 ? -12.320 -64.759 -3.592  1.00 41.24  ? 505 ALA B O   1 
ATOM   8061 C CB  . ALA B 1 504 ? -14.359 -64.546 -6.031  1.00 29.68  ? 505 ALA B CB  1 
ATOM   8062 N N   . GLY B 1 505 ? -13.612 -66.591 -3.493  1.00 38.98  ? 506 GLY B N   1 
ATOM   8063 C CA  . GLY B 1 505 ? -13.469 -66.729 -2.044  1.00 25.88  ? 506 GLY B CA  1 
ATOM   8064 C C   . GLY B 1 505 ? -12.262 -67.539 -1.612  1.00 30.59  ? 506 GLY B C   1 
ATOM   8065 O O   . GLY B 1 505 ? -11.332 -67.010 -1.011  1.00 44.23  ? 506 GLY B O   1 
ATOM   8066 N N   . ALA B 1 506 ? -12.262 -68.831 -1.915  1.00 32.04  ? 507 ALA B N   1 
ATOM   8067 C CA  . ALA B 1 506 ? -11.124 -69.677 -1.556  1.00 28.48  ? 507 ALA B CA  1 
ATOM   8068 C C   . ALA B 1 506 ? -9.837  -69.332 -2.333  1.00 40.37  ? 507 ALA B C   1 
ATOM   8069 O O   . ALA B 1 506 ? -8.731  -69.516 -1.810  1.00 33.68  ? 507 ALA B O   1 
ATOM   8070 C CB  . ALA B 1 506 ? -11.483 -71.154 -1.728  1.00 25.61  ? 507 ALA B CB  1 
ATOM   8071 N N   . GLN B 1 507 ? -9.983  -68.850 -3.573  1.00 29.71  ? 508 GLN B N   1 
ATOM   8072 C CA  . GLN B 1 507 ? -8.838  -68.393 -4.372  1.00 31.43  ? 508 GLN B CA  1 
ATOM   8073 C C   . GLN B 1 507 ? -7.724  -69.441 -4.476  1.00 27.87  ? 508 GLN B C   1 
ATOM   8074 O O   . GLN B 1 507 ? -6.537  -69.123 -4.339  1.00 31.37  ? 508 GLN B O   1 
ATOM   8075 C CB  . GLN B 1 507 ? -8.266  -67.083 -3.802  1.00 36.07  ? 508 GLN B CB  1 
ATOM   8076 C CG  . GLN B 1 507 ? -9.275  -65.935 -3.666  1.00 34.31  ? 508 GLN B CG  1 
ATOM   8077 C CD  . GLN B 1 507 ? -8.767  -64.814 -2.751  1.00 41.75  ? 508 GLN B CD  1 
ATOM   8078 O OE1 . GLN B 1 507 ? -7.622  -64.377 -2.858  1.00 43.54  ? 508 GLN B OE1 1 
ATOM   8079 N NE2 . GLN B 1 507 ? -9.618  -64.363 -1.840  1.00 41.04  ? 508 GLN B NE2 1 
ATOM   8080 N N   . GLN B 1 508 ? -8.104  -70.692 -4.697  1.00 24.94  ? 509 GLN B N   1 
ATOM   8081 C CA  . GLN B 1 508 ? -7.118  -71.769 -4.777  1.00 33.98  ? 509 GLN B CA  1 
ATOM   8082 C C   . GLN B 1 508 ? -6.430  -71.878 -6.146  1.00 30.44  ? 509 GLN B C   1 
ATOM   8083 O O   . GLN B 1 508 ? -7.058  -71.691 -7.191  1.00 33.87  ? 509 GLN B O   1 
ATOM   8084 C CB  . GLN B 1 508 ? -7.770  -73.101 -4.428  1.00 34.47  ? 509 GLN B CB  1 
ATOM   8085 C CG  . GLN B 1 508 ? -8.487  -73.101 -3.102  1.00 41.56  ? 509 GLN B CG  1 
ATOM   8086 C CD  . GLN B 1 508 ? -9.342  -74.328 -2.925  1.00 36.96  ? 509 GLN B CD  1 
ATOM   8087 O OE1 . GLN B 1 508 ? -10.505 -74.360 -3.346  1.00 44.26  ? 509 GLN B OE1 1 
ATOM   8088 N NE2 . GLN B 1 508 ? -8.769  -75.357 -2.318  1.00 35.13  ? 509 GLN B NE2 1 
ATOM   8089 N N   . TYR B 1 509 ? -5.139  -72.196 -6.118  1.00 31.65  ? 510 TYR B N   1 
ATOM   8090 C CA  . TYR B 1 509 ? -4.350  -72.414 -7.325  1.00 36.25  ? 510 TYR B CA  1 
ATOM   8091 C C   . TYR B 1 509 ? -3.293  -73.468 -7.010  1.00 34.00  ? 510 TYR B C   1 
ATOM   8092 O O   . TYR B 1 509 ? -3.074  -73.798 -5.844  1.00 34.13  ? 510 TYR B O   1 
ATOM   8093 C CB  . TYR B 1 509 ? -3.678  -71.110 -7.769  1.00 31.07  ? 510 TYR B CB  1 
ATOM   8094 C CG  . TYR B 1 509 ? -2.624  -70.603 -6.806  1.00 32.94  ? 510 TYR B CG  1 
ATOM   8095 C CD1 . TYR B 1 509 ? -2.957  -69.757 -5.749  1.00 29.07  ? 510 TYR B CD1 1 
ATOM   8096 C CD2 . TYR B 1 509 ? -1.291  -70.974 -6.954  1.00 31.16  ? 510 TYR B CD2 1 
ATOM   8097 C CE1 . TYR B 1 509 ? -1.981  -69.293 -4.867  1.00 26.83  ? 510 TYR B CE1 1 
ATOM   8098 C CE2 . TYR B 1 509 ? -0.322  -70.527 -6.080  1.00 34.14  ? 510 TYR B CE2 1 
ATOM   8099 C CZ  . TYR B 1 509 ? -0.664  -69.681 -5.042  1.00 36.46  ? 510 TYR B CZ  1 
ATOM   8100 O OH  . TYR B 1 509 ? 0.332   -69.253 -4.185  1.00 38.68  ? 510 TYR B OH  1 
ATOM   8101 N N   . VAL B 1 510 ? -2.633  -73.994 -8.036  1.00 30.63  ? 511 VAL B N   1 
ATOM   8102 C CA  . VAL B 1 510 ? -1.584  -74.989 -7.815  1.00 28.07  ? 511 VAL B CA  1 
ATOM   8103 C C   . VAL B 1 510 ? -0.199  -74.498 -8.228  1.00 31.96  ? 511 VAL B C   1 
ATOM   8104 O O   . VAL B 1 510 ? -0.055  -73.678 -9.138  1.00 34.34  ? 511 VAL B O   1 
ATOM   8105 C CB  . VAL B 1 510 ? -1.889  -76.316 -8.539  1.00 34.41  ? 511 VAL B CB  1 
ATOM   8106 C CG1 . VAL B 1 510 ? -3.214  -76.894 -8.045  1.00 30.54  ? 511 VAL B CG1 1 
ATOM   8107 C CG2 . VAL B 1 510 ? -1.921  -76.108 -10.054 1.00 24.10  ? 511 VAL B CG2 1 
ATOM   8108 N N   . SER B 1 511 ? 0.817   -74.998 -7.535  1.00 29.61  ? 512 SER B N   1 
ATOM   8109 C CA  . SER B 1 511 ? 2.194   -74.792 -7.934  1.00 32.55  ? 512 SER B CA  1 
ATOM   8110 C C   . SER B 1 511 ? 2.553   -75.828 -8.999  1.00 39.41  ? 512 SER B C   1 
ATOM   8111 O O   . SER B 1 511 ? 2.251   -77.015 -8.861  1.00 33.01  ? 512 SER B O   1 
ATOM   8112 C CB  . SER B 1 511 ? 3.126   -74.932 -6.733  1.00 36.90  ? 512 SER B CB  1 
ATOM   8113 O OG  . SER B 1 511 ? 3.033   -76.231 -6.177  1.00 54.50  ? 512 SER B OG  1 
ATOM   8114 N N   . LEU B 1 512 ? 3.169   -75.371 -10.079 1.00 34.03  ? 513 LEU B N   1 
ATOM   8115 C CA  . LEU B 1 512 ? 3.664   -76.279 -11.097 1.00 27.69  ? 513 LEU B CA  1 
ATOM   8116 C C   . LEU B 1 512 ? 5.174   -76.308 -11.008 1.00 29.67  ? 513 LEU B C   1 
ATOM   8117 O O   . LEU B 1 512 ? 5.845   -75.309 -11.295 1.00 30.33  ? 513 LEU B O   1 
ATOM   8118 C CB  . LEU B 1 512 ? 3.235   -75.813 -12.479 1.00 28.51  ? 513 LEU B CB  1 
ATOM   8119 C CG  . LEU B 1 512 ? 1.733   -75.828 -12.732 1.00 30.91  ? 513 LEU B CG  1 
ATOM   8120 C CD1 . LEU B 1 512 ? 1.432   -75.239 -14.100 1.00 26.00  ? 513 LEU B CD1 1 
ATOM   8121 C CD2 . LEU B 1 512 ? 1.200   -77.243 -12.616 1.00 23.16  ? 513 LEU B CD2 1 
ATOM   8122 N N   . ASP B 1 513 ? 5.702   -77.448 -10.576 1.00 26.54  ? 514 ASP B N   1 
ATOM   8123 C CA  . ASP B 1 513 ? 7.140   -77.698 -10.594 1.00 35.34  ? 514 ASP B CA  1 
ATOM   8124 C C   . ASP B 1 513 ? 7.393   -79.208 -10.588 1.00 31.81  ? 514 ASP B C   1 
ATOM   8125 O O   . ASP B 1 513 ? 6.474   -79.989 -10.836 1.00 29.56  ? 514 ASP B O   1 
ATOM   8126 C CB  . ASP B 1 513 ? 7.871   -76.974 -9.442  1.00 40.75  ? 514 ASP B CB  1 
ATOM   8127 C CG  . ASP B 1 513 ? 7.327   -77.334 -8.054  1.00 50.31  ? 514 ASP B CG  1 
ATOM   8128 O OD1 . ASP B 1 513 ? 6.469   -78.235 -7.937  1.00 50.77  ? 514 ASP B OD1 1 
ATOM   8129 O OD2 . ASP B 1 513 ? 7.776   -76.713 -7.062  1.00 68.54  ? 514 ASP B OD2 1 
ATOM   8130 N N   . LEU B 1 514 ? 8.627   -79.609 -10.298 1.00 33.67  ? 515 LEU B N   1 
ATOM   8131 C CA  . LEU B 1 514 ? 9.007   -81.021 -10.295 1.00 41.20  ? 515 LEU B CA  1 
ATOM   8132 C C   . LEU B 1 514 ? 8.269   -81.864 -9.246  1.00 44.03  ? 515 LEU B C   1 
ATOM   8133 O O   . LEU B 1 514 ? 8.072   -83.061 -9.447  1.00 50.79  ? 515 LEU B O   1 
ATOM   8134 C CB  . LEU B 1 514 ? 10.525  -81.172 -10.125 1.00 30.59  ? 515 LEU B CB  1 
ATOM   8135 C CG  . LEU B 1 514 ? 11.393  -80.416 -11.134 1.00 40.08  ? 515 LEU B CG  1 
ATOM   8136 C CD1 . LEU B 1 514 ? 12.873  -80.721 -10.914 1.00 25.26  ? 515 LEU B CD1 1 
ATOM   8137 C CD2 . LEU B 1 514 ? 10.978  -80.738 -12.573 1.00 29.40  ? 515 LEU B CD2 1 
ATOM   8138 N N   . ARG B 1 515 ? 7.872   -81.245 -8.134  1.00 41.35  ? 516 ARG B N   1 
ATOM   8139 C CA  . ARG B 1 515 ? 7.097   -81.925 -7.093  1.00 40.47  ? 516 ARG B CA  1 
ATOM   8140 C C   . ARG B 1 515 ? 5.660   -82.063 -7.574  1.00 39.06  ? 516 ARG B C   1 
ATOM   8141 O O   . ARG B 1 515 ? 5.272   -81.389 -8.521  1.00 40.78  ? 516 ARG B O   1 
ATOM   8142 C CB  . ARG B 1 515 ? 7.120   -81.113 -5.791  1.00 36.02  ? 516 ARG B CB  1 
ATOM   8143 C CG  . ARG B 1 515 ? 8.509   -80.848 -5.223  1.00 40.96  ? 516 ARG B CG  1 
ATOM   8144 C CD  . ARG B 1 515 ? 8.463   -79.813 -4.092  1.00 57.20  ? 516 ARG B CD  1 
ATOM   8145 N NE  . ARG B 1 515 ? 7.822   -78.565 -4.514  1.00 75.35  ? 516 ARG B NE  1 
ATOM   8146 C CZ  . ARG B 1 515 ? 6.663   -78.109 -4.039  1.00 74.39  ? 516 ARG B CZ  1 
ATOM   8147 N NH1 . ARG B 1 515 ? 6.007   -78.790 -3.105  1.00 62.93  ? 516 ARG B NH1 1 
ATOM   8148 N NH2 . ARG B 1 515 ? 6.160   -76.965 -4.494  1.00 62.87  ? 516 ARG B NH2 1 
ATOM   8149 N N   . PRO B 1 516 ? 4.854   -82.926 -6.925  1.00 48.42  ? 517 PRO B N   1 
ATOM   8150 C CA  . PRO B 1 516 ? 3.442   -83.009 -7.332  1.00 35.79  ? 517 PRO B CA  1 
ATOM   8151 C C   . PRO B 1 516 ? 2.669   -81.726 -7.024  1.00 43.91  ? 517 PRO B C   1 
ATOM   8152 O O   . PRO B 1 516 ? 3.193   -80.843 -6.338  1.00 44.47  ? 517 PRO B O   1 
ATOM   8153 C CB  . PRO B 1 516 ? 2.896   -84.167 -6.483  1.00 40.49  ? 517 PRO B CB  1 
ATOM   8154 C CG  . PRO B 1 516 ? 4.107   -84.971 -6.111  1.00 34.43  ? 517 PRO B CG  1 
ATOM   8155 C CD  . PRO B 1 516 ? 5.204   -83.962 -5.936  1.00 38.77  ? 517 PRO B CD  1 
ATOM   8156 N N   . LEU B 1 517 ? 1.441   -81.634 -7.530  1.00 40.77  ? 518 LEU B N   1 
ATOM   8157 C CA  . LEU B 1 517 ? 0.584   -80.476 -7.288  1.00 39.82  ? 518 LEU B CA  1 
ATOM   8158 C C   . LEU B 1 517 ? 0.445   -80.182 -5.809  1.00 50.11  ? 518 LEU B C   1 
ATOM   8159 O O   . LEU B 1 517 ? 0.102   -81.064 -5.024  1.00 45.38  ? 518 LEU B O   1 
ATOM   8160 C CB  . LEU B 1 517 ? -0.821  -80.691 -7.861  1.00 34.59  ? 518 LEU B CB  1 
ATOM   8161 C CG  . LEU B 1 517 ? -0.991  -80.725 -9.373  1.00 41.13  ? 518 LEU B CG  1 
ATOM   8162 C CD1 . LEU B 1 517 ? -2.462  -80.563 -9.728  1.00 41.99  ? 518 LEU B CD1 1 
ATOM   8163 C CD2 . LEU B 1 517 ? -0.136  -79.649 -10.020 1.00 38.88  ? 518 LEU B CD2 1 
ATOM   8164 N N   . GLU B 1 518 ? 0.708   -78.935 -5.441  1.00 48.05  ? 519 GLU B N   1 
ATOM   8165 C CA  . GLU B 1 518 ? 0.430   -78.451 -4.099  1.00 47.06  ? 519 GLU B CA  1 
ATOM   8166 C C   . GLU B 1 518 ? -0.592  -77.329 -4.216  1.00 43.52  ? 519 GLU B C   1 
ATOM   8167 O O   . GLU B 1 518 ? -0.409  -76.408 -5.007  1.00 38.55  ? 519 GLU B O   1 
ATOM   8168 C CB  . GLU B 1 518 ? 1.713   -77.958 -3.433  1.00 33.84  ? 519 GLU B CB  1 
ATOM   8169 C CG  . GLU B 1 518 ? 1.491   -77.186 -2.147  1.00 57.74  ? 519 GLU B CG  1 
ATOM   8170 C CD  . GLU B 1 518 ? 2.770   -76.548 -1.619  1.00 69.33  ? 519 GLU B CD  1 
ATOM   8171 O OE1 . GLU B 1 518 ? 3.826   -76.704 -2.270  1.00 79.04  ? 519 GLU B OE1 1 
ATOM   8172 O OE2 . GLU B 1 518 ? 2.717   -75.889 -0.557  1.00 77.42  ? 519 GLU B OE2 1 
ATOM   8173 N N   . VAL B 1 519 ? -1.681  -77.419 -3.455  1.00 48.06  ? 520 VAL B N   1 
ATOM   8174 C CA  . VAL B 1 519 ? -2.731  -76.402 -3.503  1.00 38.60  ? 520 VAL B CA  1 
ATOM   8175 C C   . VAL B 1 519 ? -2.418  -75.256 -2.545  1.00 41.62  ? 520 VAL B C   1 
ATOM   8176 O O   . VAL B 1 519 ? -2.027  -75.486 -1.402  1.00 49.47  ? 520 VAL B O   1 
ATOM   8177 C CB  . VAL B 1 519 ? -4.112  -76.996 -3.177  1.00 35.64  ? 520 VAL B CB  1 
ATOM   8178 C CG1 . VAL B 1 519 ? -5.191  -75.927 -3.244  1.00 30.63  ? 520 VAL B CG1 1 
ATOM   8179 C CG2 . VAL B 1 519 ? -4.435  -78.123 -4.144  1.00 36.52  ? 520 VAL B CG2 1 
ATOM   8180 N N   . ARG B 1 520 ? -2.570  -74.024 -3.027  1.00 36.50  ? 521 ARG B N   1 
ATOM   8181 C CA  . ARG B 1 520 ? -2.327  -72.835 -2.216  1.00 27.67  ? 521 ARG B CA  1 
ATOM   8182 C C   . ARG B 1 520 ? -3.461  -71.835 -2.369  1.00 32.74  ? 521 ARG B C   1 
ATOM   8183 O O   . ARG B 1 520 ? -4.344  -72.025 -3.204  1.00 37.48  ? 521 ARG B O   1 
ATOM   8184 C CB  . ARG B 1 520 ? -0.998  -72.187 -2.582  1.00 29.98  ? 521 ARG B CB  1 
ATOM   8185 C CG  . ARG B 1 520 ? 0.189   -73.118 -2.441  1.00 30.72  ? 521 ARG B CG  1 
ATOM   8186 C CD  . ARG B 1 520 ? 1.445   -72.417 -2.894  1.00 41.06  ? 521 ARG B CD  1 
ATOM   8187 N NE  . ARG B 1 520 ? 2.601   -73.304 -2.918  1.00 41.32  ? 521 ARG B NE  1 
ATOM   8188 C CZ  . ARG B 1 520 ? 3.738   -73.011 -3.541  1.00 42.49  ? 521 ARG B CZ  1 
ATOM   8189 N NH1 . ARG B 1 520 ? 3.855   -71.861 -4.195  1.00 46.28  ? 521 ARG B NH1 1 
ATOM   8190 N NH2 . ARG B 1 520 ? 4.756   -73.862 -3.515  1.00 48.04  ? 521 ARG B NH2 1 
ATOM   8191 N N   . ARG B 1 521 ? -3.442  -70.775 -1.559  1.00 28.73  ? 522 ARG B N   1 
ATOM   8192 C CA  . ARG B 1 521 ? -4.521  -69.786 -1.566  1.00 28.90  ? 522 ARG B CA  1 
ATOM   8193 C C   . ARG B 1 521 ? -4.028  -68.373 -1.850  1.00 38.60  ? 522 ARG B C   1 
ATOM   8194 O O   . ARG B 1 521 ? -3.003  -67.942 -1.309  1.00 34.45  ? 522 ARG B O   1 
ATOM   8195 C CB  . ARG B 1 521 ? -5.282  -69.787 -0.234  1.00 40.95  ? 522 ARG B CB  1 
ATOM   8196 C CG  . ARG B 1 521 ? -6.118  -71.021 0.022   1.00 37.16  ? 522 ARG B CG  1 
ATOM   8197 C CD  . ARG B 1 521 ? -7.125  -70.787 1.145   1.00 35.23  ? 522 ARG B CD  1 
ATOM   8198 N NE  . ARG B 1 521 ? -8.107  -69.769 0.775   1.00 33.93  ? 522 ARG B NE  1 
ATOM   8199 C CZ  . ARG B 1 521 ? -8.463  -68.745 1.547   1.00 42.54  ? 522 ARG B CZ  1 
ATOM   8200 N NH1 . ARG B 1 521 ? -7.930  -68.599 2.757   1.00 45.58  ? 522 ARG B NH1 1 
ATOM   8201 N NH2 . ARG B 1 521 ? -9.359  -67.868 1.111   1.00 32.89  ? 522 ARG B NH2 1 
ATOM   8202 N N   . GLY B 1 522 ? -4.772  -67.658 -2.694  1.00 31.82  ? 523 GLY B N   1 
ATOM   8203 C CA  . GLY B 1 522 ? -4.482  -66.267 -2.988  1.00 37.04  ? 523 GLY B CA  1 
ATOM   8204 C C   . GLY B 1 522 ? -3.334  -66.020 -3.958  1.00 38.86  ? 523 GLY B C   1 
ATOM   8205 O O   . GLY B 1 522 ? -2.198  -66.418 -3.707  1.00 40.67  ? 523 GLY B O   1 
ATOM   8206 N N   . LEU B 1 523 ? -3.636  -65.355 -5.071  1.00 31.37  ? 524 LEU B N   1 
ATOM   8207 C CA  . LEU B 1 523 ? -2.607  -64.881 -5.993  1.00 33.84  ? 524 LEU B CA  1 
ATOM   8208 C C   . LEU B 1 523 ? -2.121  -63.512 -5.525  1.00 34.42  ? 524 LEU B C   1 
ATOM   8209 O O   . LEU B 1 523 ? -2.640  -62.477 -5.969  1.00 29.43  ? 524 LEU B O   1 
ATOM   8210 C CB  . LEU B 1 523 ? -3.171  -64.786 -7.414  1.00 32.52  ? 524 LEU B CB  1 
ATOM   8211 C CG  . LEU B 1 523 ? -3.687  -66.107 -7.983  1.00 32.75  ? 524 LEU B CG  1 
ATOM   8212 C CD1 . LEU B 1 523 ? -4.449  -65.887 -9.275  1.00 28.76  ? 524 LEU B CD1 1 
ATOM   8213 C CD2 . LEU B 1 523 ? -2.532  -67.059 -8.203  1.00 31.13  ? 524 LEU B CD2 1 
ATOM   8214 N N   A ARG B 1 524 ? -1.134  -63.499 -4.631  0.54 37.43  ? 525 ARG B N   1 
ATOM   8215 N N   B ARG B 1 524 ? -1.141  -63.533 -4.622  0.46 37.40  ? 525 ARG B N   1 
ATOM   8216 C CA  A ARG B 1 524 ? -0.640  -62.253 -4.041  0.54 35.22  ? 525 ARG B CA  1 
ATOM   8217 C CA  B ARG B 1 524 ? -0.633  -62.333 -3.958  0.46 35.19  ? 525 ARG B CA  1 
ATOM   8218 C C   A ARG B 1 524 ? -1.802  -61.402 -3.523  0.54 31.60  ? 525 ARG B C   1 
ATOM   8219 C C   B ARG B 1 524 ? -1.781  -61.428 -3.515  0.46 31.61  ? 525 ARG B C   1 
ATOM   8220 O O   A ARG B 1 524 ? -1.892  -60.208 -3.830  0.54 34.05  ? 525 ARG B O   1 
ATOM   8221 O O   B ARG B 1 524 ? -1.838  -60.241 -3.855  0.46 34.08  ? 525 ARG B O   1 
ATOM   8222 C CB  A ARG B 1 524 ? 0.165   -61.455 -5.075  0.54 34.55  ? 525 ARG B CB  1 
ATOM   8223 C CB  B ARG B 1 524 ? 0.372   -61.612 -4.858  0.46 34.37  ? 525 ARG B CB  1 
ATOM   8224 C CG  A ARG B 1 524 ? 1.331   -62.209 -5.708  0.54 34.02  ? 525 ARG B CG  1 
ATOM   8225 C CG  B ARG B 1 524 ? 1.569   -62.491 -5.200  0.46 32.05  ? 525 ARG B CG  1 
ATOM   8226 C CD  A ARG B 1 524 ? 2.598   -62.073 -4.887  0.54 32.73  ? 525 ARG B CD  1 
ATOM   8227 C CD  B ARG B 1 524 ? 2.565   -61.820 -6.133  0.46 27.00  ? 525 ARG B CD  1 
ATOM   8228 N NE  A ARG B 1 524 ? 3.009   -60.680 -4.742  0.54 38.59  ? 525 ARG B NE  1 
ATOM   8229 N NE  B ARG B 1 524 ? 3.740   -62.664 -6.338  0.46 27.04  ? 525 ARG B NE  1 
ATOM   8230 C CZ  A ARG B 1 524 ? 3.808   -60.236 -3.777  0.54 32.79  ? 525 ARG B CZ  1 
ATOM   8231 C CZ  B ARG B 1 524 ? 4.987   -62.210 -6.396  0.46 29.25  ? 525 ARG B CZ  1 
ATOM   8232 N NH1 A ARG B 1 524 ? 4.282   -61.080 -2.869  0.54 25.82  ? 525 ARG B NH1 1 
ATOM   8233 N NH1 B ARG B 1 524 ? 5.224   -60.912 -6.273  0.46 30.57  ? 525 ARG B NH1 1 
ATOM   8234 N NH2 A ARG B 1 524 ? 4.125   -58.951 -3.718  0.54 17.50  ? 525 ARG B NH2 1 
ATOM   8235 N NH2 B ARG B 1 524 ? 5.997   -63.054 -6.578  0.46 24.44  ? 525 ARG B NH2 1 
ATOM   8236 N N   . ALA B 1 525 ? -2.702  -62.024 -2.764  1.00 28.78  ? 526 ALA B N   1 
ATOM   8237 C CA  . ALA B 1 525 ? -3.957  -61.375 -2.367  1.00 29.71  ? 526 ALA B CA  1 
ATOM   8238 C C   . ALA B 1 525 ? -3.817  -60.006 -1.700  1.00 35.71  ? 526 ALA B C   1 
ATOM   8239 O O   . ALA B 1 525 ? -4.531  -59.066 -2.064  1.00 36.11  ? 526 ALA B O   1 
ATOM   8240 C CB  . ALA B 1 525 ? -4.785  -62.311 -1.500  1.00 31.57  ? 526 ALA B CB  1 
ATOM   8241 N N   . GLN B 1 526 ? -2.895  -59.886 -0.747  1.00 27.73  ? 527 GLN B N   1 
ATOM   8242 C CA  . GLN B 1 526 ? -2.694  -58.610 -0.067  1.00 30.97  ? 527 GLN B CA  1 
ATOM   8243 C C   . GLN B 1 526 ? -2.206  -57.551 -1.039  1.00 28.47  ? 527 GLN B C   1 
ATOM   8244 O O   . GLN B 1 526 ? -2.716  -56.433 -1.050  1.00 38.50  ? 527 GLN B O   1 
ATOM   8245 C CB  . GLN B 1 526 ? -1.717  -58.743 1.106   1.00 28.35  ? 527 GLN B CB  1 
ATOM   8246 C CG  . GLN B 1 526 ? -2.185  -59.692 2.183   1.00 26.16  ? 527 GLN B CG  1 
ATOM   8247 C CD  . GLN B 1 526 ? -3.496  -59.260 2.818   1.00 37.45  ? 527 GLN B CD  1 
ATOM   8248 O OE1 . GLN B 1 526 ? -4.492  -59.978 2.750   1.00 40.93  ? 527 GLN B OE1 1 
ATOM   8249 N NE2 . GLN B 1 526 ? -3.497  -58.089 3.456   1.00 33.74  ? 527 GLN B NE2 1 
ATOM   8250 N N   . ALA B 1 527 ? -1.218  -57.906 -1.854  1.00 33.05  ? 528 ALA B N   1 
ATOM   8251 C CA  . ALA B 1 527 ? -0.713  -56.993 -2.878  1.00 32.54  ? 528 ALA B CA  1 
ATOM   8252 C C   . ALA B 1 527 ? -1.799  -56.616 -3.876  1.00 30.30  ? 528 ALA B C   1 
ATOM   8253 O O   . ALA B 1 527 ? -1.994  -55.445 -4.183  1.00 37.21  ? 528 ALA B O   1 
ATOM   8254 C CB  . ALA B 1 527 ? 0.483   -57.601 -3.608  1.00 38.14  ? 528 ALA B CB  1 
ATOM   8255 N N   . CYS B 1 528 ? -2.524  -57.608 -4.373  1.00 28.20  ? 529 CYS B N   1 
ATOM   8256 C CA  . CYS B 1 528 ? -3.487  -57.339 -5.436  1.00 27.37  ? 529 CYS B CA  1 
ATOM   8257 C C   . CYS B 1 528 ? -4.728  -56.562 -4.994  1.00 32.96  ? 529 CYS B C   1 
ATOM   8258 O O   . CYS B 1 528 ? -5.411  -55.952 -5.829  1.00 28.62  ? 529 CYS B O   1 
ATOM   8259 C CB  . CYS B 1 528 ? -3.840  -58.628 -6.178  1.00 32.69  ? 529 CYS B CB  1 
ATOM   8260 S SG  . CYS B 1 528 ? -2.406  -59.229 -7.124  1.00 33.06  ? 529 CYS B SG  1 
ATOM   8261 N N   . ALA B 1 529 ? -5.010  -56.571 -3.690  1.00 25.53  ? 530 ALA B N   1 
ATOM   8262 C CA  . ALA B 1 529 ? -6.082  -55.748 -3.143  1.00 22.32  ? 530 ALA B CA  1 
ATOM   8263 C C   . ALA B 1 529 ? -5.678  -54.294 -3.306  1.00 27.71  ? 530 ALA B C   1 
ATOM   8264 O O   . ALA B 1 529 ? -6.500  -53.434 -3.637  1.00 26.45  ? 530 ALA B O   1 
ATOM   8265 C CB  . ALA B 1 529 ? -6.310  -56.072 -1.676  1.00 27.80  ? 530 ALA B CB  1 
ATOM   8266 N N   . PHE B 1 530 ? -4.396  -54.020 -3.094  1.00 21.61  ? 531 PHE B N   1 
ATOM   8267 C CA  . PHE B 1 530 ? -3.896  -52.678 -3.320  1.00 22.93  ? 531 PHE B CA  1 
ATOM   8268 C C   . PHE B 1 530 ? -4.113  -52.267 -4.777  1.00 33.57  ? 531 PHE B C   1 
ATOM   8269 O O   . PHE B 1 530 ? -4.734  -51.236 -5.043  1.00 30.23  ? 531 PHE B O   1 
ATOM   8270 C CB  . PHE B 1 530 ? -2.420  -52.556 -2.937  1.00 25.68  ? 531 PHE B CB  1 
ATOM   8271 C CG  . PHE B 1 530 ? -1.773  -51.297 -3.444  1.00 29.94  ? 531 PHE B CG  1 
ATOM   8272 C CD1 . PHE B 1 530 ? -1.988  -50.087 -2.808  1.00 33.79  ? 531 PHE B CD1 1 
ATOM   8273 C CD2 . PHE B 1 530 ? -0.967  -51.322 -4.571  1.00 30.03  ? 531 PHE B CD2 1 
ATOM   8274 C CE1 . PHE B 1 530 ? -1.408  -48.914 -3.276  1.00 32.98  ? 531 PHE B CE1 1 
ATOM   8275 C CE2 . PHE B 1 530 ? -0.383  -50.157 -5.043  1.00 40.69  ? 531 PHE B CE2 1 
ATOM   8276 C CZ  . PHE B 1 530 ? -0.605  -48.950 -4.391  1.00 39.06  ? 531 PHE B CZ  1 
ATOM   8277 N N   . TRP B 1 531 ? -3.631  -53.087 -5.714  1.00 22.70  ? 532 TRP B N   1 
ATOM   8278 C CA  . TRP B 1 531 ? -3.673  -52.713 -7.132  1.00 32.42  ? 532 TRP B CA  1 
ATOM   8279 C C   . TRP B 1 531 ? -5.079  -52.723 -7.711  1.00 30.54  ? 532 TRP B C   1 
ATOM   8280 O O   . TRP B 1 531 ? -5.434  -51.831 -8.478  1.00 28.08  ? 532 TRP B O   1 
ATOM   8281 C CB  . TRP B 1 531 ? -2.762  -53.606 -7.978  1.00 26.04  ? 532 TRP B CB  1 
ATOM   8282 C CG  . TRP B 1 531 ? -1.314  -53.461 -7.666  1.00 27.92  ? 532 TRP B CG  1 
ATOM   8283 C CD1 . TRP B 1 531 ? -0.536  -54.333 -6.962  1.00 23.78  ? 532 TRP B CD1 1 
ATOM   8284 C CD2 . TRP B 1 531 ? -0.459  -52.367 -8.035  1.00 22.72  ? 532 TRP B CD2 1 
ATOM   8285 N NE1 . TRP B 1 531 ? 0.750   -53.859 -6.881  1.00 24.37  ? 532 TRP B NE1 1 
ATOM   8286 C CE2 . TRP B 1 531 ? 0.825   -52.655 -7.535  1.00 25.08  ? 532 TRP B CE2 1 
ATOM   8287 C CE3 . TRP B 1 531 ? -0.655  -51.180 -8.747  1.00 19.04  ? 532 TRP B CE3 1 
ATOM   8288 C CZ2 . TRP B 1 531 ? 1.909   -51.791 -7.714  1.00 25.52  ? 532 TRP B CZ2 1 
ATOM   8289 C CZ3 . TRP B 1 531 ? 0.424   -50.329 -8.926  1.00 26.88  ? 532 TRP B CZ3 1 
ATOM   8290 C CH2 . TRP B 1 531 ? 1.688   -50.639 -8.411  1.00 23.95  ? 532 TRP B CH2 1 
ATOM   8291 N N   . ASN B 1 532 ? -5.881  -53.720 -7.337  1.00 25.20  ? 533 ASN B N   1 
ATOM   8292 C CA  . ASN B 1 532 ? -7.213  -53.880 -7.930  1.00 26.34  ? 533 ASN B CA  1 
ATOM   8293 C C   . ASN B 1 532 ? -8.358  -53.165 -7.210  1.00 35.15  ? 533 ASN B C   1 
ATOM   8294 O O   . ASN B 1 532 ? -9.370  -52.841 -7.826  1.00 28.79  ? 533 ASN B O   1 
ATOM   8295 C CB  . ASN B 1 532 ? -7.566  -55.367 -8.092  1.00 32.14  ? 533 ASN B CB  1 
ATOM   8296 C CG  . ASN B 1 532 ? -6.543  -56.125 -8.910  1.00 29.83  ? 533 ASN B CG  1 
ATOM   8297 O OD1 . ASN B 1 532 ? -5.834  -55.539 -9.717  1.00 39.36  ? 533 ASN B OD1 1 
ATOM   8298 N ND2 . ASN B 1 532 ? -6.459  -57.437 -8.700  1.00 27.63  ? 533 ASN B ND2 1 
ATOM   8299 N N   . ARG B 1 533 ? -8.224  -52.938 -5.907  1.00 31.91  ? 534 ARG B N   1 
ATOM   8300 C CA  . ARG B 1 533 ? -9.329  -52.345 -5.158  1.00 34.49  ? 534 ARG B CA  1 
ATOM   8301 C C   . ARG B 1 533 ? -9.064  -50.918 -4.715  1.00 38.53  ? 534 ARG B C   1 
ATOM   8302 O O   . ARG B 1 533 ? -9.910  -50.046 -4.884  1.00 44.64  ? 534 ARG B O   1 
ATOM   8303 C CB  . ARG B 1 533 ? -9.677  -53.195 -3.946  1.00 33.01  ? 534 ARG B CB  1 
ATOM   8304 C CG  . ARG B 1 533 ? -9.954  -54.633 -4.287  1.00 26.21  ? 534 ARG B CG  1 
ATOM   8305 C CD  . ARG B 1 533 ? -10.199 -55.415 -3.033  1.00 30.76  ? 534 ARG B CD  1 
ATOM   8306 N NE  . ARG B 1 533 ? -10.338 -56.834 -3.316  1.00 40.20  ? 534 ARG B NE  1 
ATOM   8307 C CZ  . ARG B 1 533 ? -11.504 -57.426 -3.530  1.00 47.11  ? 534 ARG B CZ  1 
ATOM   8308 N NH1 . ARG B 1 533 ? -12.617 -56.701 -3.484  1.00 35.03  ? 534 ARG B NH1 1 
ATOM   8309 N NH2 . ARG B 1 533 ? -11.555 -58.732 -3.784  1.00 31.45  ? 534 ARG B NH2 1 
ATOM   8310 N N   . PHE B 1 534 ? -7.894  -50.671 -4.145  1.00 35.55  ? 535 PHE B N   1 
ATOM   8311 C CA  . PHE B 1 534 ? -7.641  -49.353 -3.597  1.00 35.05  ? 535 PHE B CA  1 
ATOM   8312 C C   . PHE B 1 534 ? -7.116  -48.337 -4.593  1.00 32.31  ? 535 PHE B C   1 
ATOM   8313 O O   . PHE B 1 534 ? -7.685  -47.256 -4.731  1.00 36.64  ? 535 PHE B O   1 
ATOM   8314 C CB  . PHE B 1 534 ? -6.714  -49.398 -2.379  1.00 29.65  ? 535 PHE B CB  1 
ATOM   8315 C CG  . PHE B 1 534 ? -6.389  -48.039 -1.853  1.00 28.13  ? 535 PHE B CG  1 
ATOM   8316 C CD1 . PHE B 1 534 ? -7.348  -47.312 -1.157  1.00 30.72  ? 535 PHE B CD1 1 
ATOM   8317 C CD2 . PHE B 1 534 ? -5.147  -47.464 -2.085  1.00 30.26  ? 535 PHE B CD2 1 
ATOM   8318 C CE1 . PHE B 1 534 ? -7.068  -46.037 -0.681  1.00 31.11  ? 535 PHE B CE1 1 
ATOM   8319 C CE2 . PHE B 1 534 ? -4.851  -46.188 -1.605  1.00 35.37  ? 535 PHE B CE2 1 
ATOM   8320 C CZ  . PHE B 1 534 ? -5.813  -45.474 -0.905  1.00 38.36  ? 535 PHE B CZ  1 
ATOM   8321 N N   . LEU B 1 535 ? -6.008  -48.673 -5.246  1.00 30.86  ? 536 LEU B N   1 
ATOM   8322 C CA  . LEU B 1 535 ? -5.343  -47.751 -6.165  1.00 39.79  ? 536 LEU B CA  1 
ATOM   8323 C C   . LEU B 1 535 ? -6.269  -47.091 -7.192  1.00 37.14  ? 536 LEU B C   1 
ATOM   8324 O O   . LEU B 1 535 ? -6.171  -45.882 -7.416  1.00 35.93  ? 536 LEU B O   1 
ATOM   8325 C CB  . LEU B 1 535 ? -4.156  -48.416 -6.872  1.00 44.97  ? 536 LEU B CB  1 
ATOM   8326 C CG  . LEU B 1 535 ? -3.258  -47.387 -7.563  1.00 46.97  ? 536 LEU B CG  1 
ATOM   8327 C CD1 . LEU B 1 535 ? -2.638  -46.462 -6.521  1.00 54.04  ? 536 LEU B CD1 1 
ATOM   8328 C CD2 . LEU B 1 535 ? -2.187  -48.056 -8.380  1.00 39.16  ? 536 LEU B CD2 1 
ATOM   8329 N N   . PRO B 1 536 ? -7.177  -47.865 -7.809  1.00 37.95  ? 537 PRO B N   1 
ATOM   8330 C CA  . PRO B 1 536 ? -8.074  -47.183 -8.754  1.00 39.91  ? 537 PRO B CA  1 
ATOM   8331 C C   . PRO B 1 536 ? -8.936  -46.097 -8.101  1.00 46.80  ? 537 PRO B C   1 
ATOM   8332 O O   . PRO B 1 536 ? -9.228  -45.100 -8.767  1.00 45.87  ? 537 PRO B O   1 
ATOM   8333 C CB  . PRO B 1 536 ? -8.954  -48.319 -9.281  1.00 32.04  ? 537 PRO B CB  1 
ATOM   8334 C CG  . PRO B 1 536 ? -8.104  -49.543 -9.137  1.00 36.91  ? 537 PRO B CG  1 
ATOM   8335 C CD  . PRO B 1 536 ? -7.340  -49.330 -7.859  1.00 36.69  ? 537 PRO B CD  1 
ATOM   8336 N N   . LYS B 1 537 ? -9.322  -46.279 -6.835  1.00 45.25  ? 538 LYS B N   1 
ATOM   8337 C CA  . LYS B 1 537 ? -10.086 -45.257 -6.101  1.00 39.25  ? 538 LYS B CA  1 
ATOM   8338 C C   . LYS B 1 537 ? -9.240  -44.018 -5.853  1.00 38.60  ? 538 LYS B C   1 
ATOM   8339 O O   . LYS B 1 537 ? -9.728  -42.888 -5.905  1.00 49.86  ? 538 LYS B O   1 
ATOM   8340 C CB  . LYS B 1 537 ? -10.597 -45.799 -4.770  1.00 41.64  ? 538 LYS B CB  1 
ATOM   8341 C CG  . LYS B 1 537 ? -11.740 -46.792 -4.889  1.00 40.60  ? 538 LYS B CG  1 
ATOM   8342 C CD  . LYS B 1 537 ? -12.042 -47.415 -3.532  1.00 44.10  ? 538 LYS B CD  1 
ATOM   8343 C CE  . LYS B 1 537 ? -13.319 -48.241 -3.567  1.00 60.62  ? 538 LYS B CE  1 
ATOM   8344 N NZ  . LYS B 1 537 ? -13.187 -49.477 -4.382  1.00 49.55  ? 538 LYS B NZ  1 
ATOM   8345 N N   . LEU B 1 538 ? -7.962  -44.241 -5.590  1.00 44.17  ? 539 LEU B N   1 
ATOM   8346 C CA  . LEU B 1 538 ? -7.033  -43.146 -5.364  1.00 56.65  ? 539 LEU B CA  1 
ATOM   8347 C C   . LEU B 1 538 ? -6.836  -42.331 -6.634  1.00 46.46  ? 539 LEU B C   1 
ATOM   8348 O O   . LEU B 1 538 ? -6.761  -41.106 -6.575  1.00 54.41  ? 539 LEU B O   1 
ATOM   8349 C CB  . LEU B 1 538 ? -5.692  -43.675 -4.843  1.00 42.56  ? 539 LEU B CB  1 
ATOM   8350 C CG  . LEU B 1 538 ? -4.632  -42.653 -4.440  1.00 37.18  ? 539 LEU B CG  1 
ATOM   8351 C CD1 . LEU B 1 538 ? -3.722  -43.267 -3.410  1.00 32.05  ? 539 LEU B CD1 1 
ATOM   8352 C CD2 . LEU B 1 538 ? -3.815  -42.205 -5.639  1.00 40.84  ? 539 LEU B CD2 1 
ATOM   8353 N N   . LEU B 1 539 ? -6.733  -43.011 -7.773  1.00 48.51  ? 540 LEU B N   1 
ATOM   8354 C CA  . LEU B 1 539 ? -6.532  -42.337 -9.060  1.00 58.66  ? 540 LEU B CA  1 
ATOM   8355 C C   . LEU B 1 539 ? -7.742  -41.497 -9.500  1.00 62.03  ? 540 LEU B C   1 
ATOM   8356 O O   . LEU B 1 539 ? -7.582  -40.504 -10.206 1.00 67.37  ? 540 LEU B O   1 
ATOM   8357 C CB  . LEU B 1 539 ? -6.148  -43.344 -10.155 1.00 55.26  ? 540 LEU B CB  1 
ATOM   8358 C CG  . LEU B 1 539 ? -4.791  -44.044 -9.996  1.00 54.23  ? 540 LEU B CG  1 
ATOM   8359 C CD1 . LEU B 1 539 ? -4.643  -45.171 -10.998 1.00 42.40  ? 540 LEU B CD1 1 
ATOM   8360 C CD2 . LEU B 1 539 ? -3.628  -43.068 -10.118 1.00 40.12  ? 540 LEU B CD2 1 
ATOM   8361 N N   . SER B 1 540 ? -8.943  -41.896 -9.080  1.00 65.32  ? 541 SER B N   1 
ATOM   8362 C CA  . SER B 1 540 ? -10.167 -41.142 -9.372  1.00 60.85  ? 541 SER B CA  1 
ATOM   8363 C C   . SER B 1 540 ? -10.288 -39.874 -8.524  1.00 74.70  ? 541 SER B C   1 
ATOM   8364 O O   . SER B 1 540 ? -10.919 -38.902 -8.935  1.00 76.42  ? 541 SER B O   1 
ATOM   8365 C CB  . SER B 1 540 ? -11.404 -42.010 -9.135  1.00 47.65  ? 541 SER B CB  1 
ATOM   8366 O OG  . SER B 1 540 ? -11.342 -43.203 -9.890  1.00 66.39  ? 541 SER B OG  1 
ATOM   8367 N N   . ALA B 1 541 ? -9.698  -39.899 -7.332  1.00 81.34  ? 542 ALA B N   1 
ATOM   8368 C CA  . ALA B 1 541 ? -9.774  -38.773 -6.409  1.00 71.24  ? 542 ALA B CA  1 
ATOM   8369 C C   . ALA B 1 541 ? -8.473  -37.967 -6.383  1.00 75.98  ? 542 ALA B C   1 
ATOM   8370 O O   . ALA B 1 541 ? -7.864  -37.705 -7.426  1.00 73.56  ? 542 ALA B O   1 
ATOM   8371 C CB  . ALA B 1 541 ? -10.124 -39.265 -5.015  1.00 58.34  ? 542 ALA B CB  1 
HETATM 8372 C C1  . NAG C 2 .   ? -22.960 -58.751 21.551  1.00 50.04  ? 1   NAG C C1  1 
HETATM 8373 C C2  . NAG C 2 .   ? -23.780 -59.186 20.320  1.00 61.10  ? 1   NAG C C2  1 
HETATM 8374 C C3  . NAG C 2 .   ? -24.397 -58.050 19.494  1.00 61.16  ? 1   NAG C C3  1 
HETATM 8375 C C4  . NAG C 2 .   ? -24.861 -56.858 20.323  1.00 67.58  ? 1   NAG C C4  1 
HETATM 8376 C C5  . NAG C 2 .   ? -23.808 -56.534 21.382  1.00 65.59  ? 1   NAG C C5  1 
HETATM 8377 C C6  . NAG C 2 .   ? -24.220 -55.360 22.269  1.00 69.70  ? 1   NAG C C6  1 
HETATM 8378 C C7  . NAG C 2 .   ? -22.842 -61.273 19.490  1.00 82.32  ? 1   NAG C C7  1 
HETATM 8379 C C8  . NAG C 2 .   ? -24.124 -62.023 19.736  1.00 56.59  ? 1   NAG C C8  1 
HETATM 8380 N N2  . NAG C 2 .   ? -22.934 -59.948 19.421  1.00 75.64  ? 1   NAG C N2  1 
HETATM 8381 O O3  . NAG C 2 .   ? -25.476 -58.545 18.727  1.00 63.08  ? 1   NAG C O3  1 
HETATM 8382 O O4  . NAG C 2 .   ? -25.057 -55.767 19.445  1.00 70.38  ? 1   NAG C O4  1 
HETATM 8383 O O5  . NAG C 2 .   ? -23.596 -57.667 22.194  1.00 52.80  ? 1   NAG C O5  1 
HETATM 8384 O O6  . NAG C 2 .   ? -25.593 -55.487 22.579  1.00 85.77  ? 1   NAG C O6  1 
HETATM 8385 O O7  . NAG C 2 .   ? -21.763 -61.861 19.364  1.00 73.43  ? 1   NAG C O7  1 
HETATM 8386 C C1  . NAG C 2 .   ? -26.448 -55.272 19.476  1.00 89.94  ? 2   NAG C C1  1 
HETATM 8387 C C2  . NAG C 2 .   ? -26.478 -53.826 18.973  1.00 93.80  ? 2   NAG C C2  1 
HETATM 8388 C C3  . NAG C 2 .   ? -27.891 -53.242 18.904  1.00 106.11 ? 2   NAG C C3  1 
HETATM 8389 C C4  . NAG C 2 .   ? -28.865 -54.228 18.262  1.00 113.94 ? 2   NAG C C4  1 
HETATM 8390 C C5  . NAG C 2 .   ? -28.699 -55.598 18.919  1.00 113.81 ? 2   NAG C C5  1 
HETATM 8391 C C6  . NAG C 2 .   ? -29.675 -56.632 18.373  1.00 103.16 ? 2   NAG C C6  1 
HETATM 8392 C C7  . NAG C 2 .   ? -24.473 -52.540 19.338  1.00 79.77  ? 2   NAG C C7  1 
HETATM 8393 C C8  . NAG C 2 .   ? -23.411 -52.219 20.351  1.00 67.83  ? 2   NAG C C8  1 
HETATM 8394 N N2  . NAG C 2 .   ? -25.626 -53.004 19.809  1.00 83.86  ? 2   NAG C N2  1 
HETATM 8395 O O3  . NAG C 2 .   ? -27.871 -52.031 18.176  1.00 111.98 ? 2   NAG C O3  1 
HETATM 8396 O O4  . NAG C 2 .   ? -30.199 -53.770 18.398  1.00 96.35  ? 2   NAG C O4  1 
HETATM 8397 O O5  . NAG C 2 .   ? -27.370 -56.061 18.753  1.00 102.34 ? 2   NAG C O5  1 
HETATM 8398 O O6  . NAG C 2 .   ? -29.572 -57.793 19.166  1.00 91.80  ? 2   NAG C O6  1 
HETATM 8399 O O7  . NAG C 2 .   ? -24.270 -52.380 18.134  1.00 70.03  ? 2   NAG C O7  1 
HETATM 8400 C C1  . FUC C 2 .   ? -25.845 -55.518 24.015  1.00 79.35  ? 3   FUC C C1  1 
HETATM 8401 C C2  . FUC C 2 .   ? -27.366 -55.568 24.201  1.00 82.14  ? 3   FUC C C2  1 
HETATM 8402 C C3  . FUC C 2 .   ? -27.880 -56.967 23.861  1.00 79.76  ? 3   FUC C C3  1 
HETATM 8403 C C4  . FUC C 2 .   ? -27.228 -57.962 24.816  1.00 89.41  ? 3   FUC C C4  1 
HETATM 8404 C C5  . FUC C 2 .   ? -25.713 -57.922 24.585  1.00 82.62  ? 3   FUC C C5  1 
HETATM 8405 C C6  . FUC C 2 .   ? -24.918 -58.842 25.530  1.00 50.92  ? 3   FUC C C6  1 
HETATM 8406 O O2  . FUC C 2 .   ? -28.020 -54.581 23.413  1.00 79.61  ? 3   FUC C O2  1 
HETATM 8407 O O3  . FUC C 2 .   ? -29.289 -57.050 24.033  1.00 91.92  ? 3   FUC C O3  1 
HETATM 8408 O O4  . FUC C 2 .   ? -27.515 -57.592 26.163  1.00 84.35  ? 3   FUC C O4  1 
HETATM 8409 O O5  . FUC C 2 .   ? -25.170 -56.564 24.719  1.00 77.19  ? 3   FUC C O5  1 
HETATM 8410 C C1  . NAG D 2 .   ? 25.107  -53.525 -11.965 1.00 60.89  ? 1   NAG D C1  1 
HETATM 8411 C C2  . NAG D 2 .   ? 25.840  -52.438 -11.175 1.00 64.71  ? 1   NAG D C2  1 
HETATM 8412 C C3  . NAG D 2 .   ? 25.284  -51.043 -11.448 1.00 62.36  ? 1   NAG D C3  1 
HETATM 8413 C C4  . NAG D 2 .   ? 25.211  -50.761 -12.945 1.00 75.12  ? 1   NAG D C4  1 
HETATM 8414 C C5  . NAG D 2 .   ? 24.450  -51.912 -13.614 1.00 72.75  ? 1   NAG D C5  1 
HETATM 8415 C C6  . NAG D 2 .   ? 24.332  -51.748 -15.128 1.00 67.05  ? 1   NAG D C6  1 
HETATM 8416 C C7  . NAG D 2 .   ? 26.908  -53.010 -9.064  1.00 74.49  ? 1   NAG D C7  1 
HETATM 8417 C C8  . NAG D 2 .   ? 28.220  -53.016 -9.802  1.00 66.95  ? 1   NAG D C8  1 
HETATM 8418 N N2  . NAG D 2 .   ? 25.800  -52.731 -9.756  1.00 62.14  ? 1   NAG D N2  1 
HETATM 8419 O O3  . NAG D 2 .   ? 26.071  -50.076 -10.789 1.00 72.21  ? 1   NAG D O3  1 
HETATM 8420 O O4  . NAG D 2 .   ? 24.574  -49.506 -13.128 1.00 86.27  ? 1   NAG D O4  1 
HETATM 8421 O O5  . NAG D 2 .   ? 25.059  -53.162 -13.332 1.00 67.25  ? 1   NAG D O5  1 
HETATM 8422 O O6  . NAG D 2 .   ? 25.545  -51.234 -15.641 1.00 96.12  ? 1   NAG D O6  1 
HETATM 8423 O O7  . NAG D 2 .   ? 26.883  -53.260 -7.860  1.00 74.18  ? 1   NAG D O7  1 
HETATM 8424 C C1  . NAG D 2 .   ? 25.370  -48.546 -13.972 1.00 95.93  ? 2   NAG D C1  1 
HETATM 8425 C C2  . NAG D 2 .   ? 24.410  -47.611 -14.708 1.00 100.20 ? 2   NAG D C2  1 
HETATM 8426 C C3  . NAG D 2 .   ? 25.159  -46.693 -15.673 1.00 103.66 ? 2   NAG D C3  1 
HETATM 8427 C C4  . NAG D 2 .   ? 26.281  -45.974 -14.934 1.00 114.14 ? 2   NAG D C4  1 
HETATM 8428 C C5  . NAG D 2 .   ? 27.128  -46.931 -14.091 1.00 106.73 ? 2   NAG D C5  1 
HETATM 8429 C C6  . NAG D 2 .   ? 28.065  -46.123 -13.201 1.00 105.07 ? 2   NAG D C6  1 
HETATM 8430 C C7  . NAG D 2 .   ? 22.136  -48.394 -14.815 1.00 74.61  ? 2   NAG D C7  1 
HETATM 8431 C C8  . NAG D 2 .   ? 21.038  -49.034 -15.609 1.00 64.67  ? 2   NAG D C8  1 
HETATM 8432 N N2  . NAG D 2 .   ? 23.349  -48.357 -15.366 1.00 80.22  ? 2   NAG D N2  1 
HETATM 8433 O O3  . NAG D 2 .   ? 24.279  -45.724 -16.203 1.00 83.04  ? 2   NAG D O3  1 
HETATM 8434 O O4  . NAG D 2 .   ? 27.096  -45.282 -15.858 1.00 106.87 ? 2   NAG D O4  1 
HETATM 8435 O O5  . NAG D 2 .   ? 26.334  -47.781 -13.272 1.00 110.06 ? 2   NAG D O5  1 
HETATM 8436 O O6  . NAG D 2 .   ? 28.623  -46.966 -12.218 1.00 105.02 ? 2   NAG D O6  1 
HETATM 8437 O O7  . NAG D 2 .   ? 21.900  -47.933 -13.697 1.00 76.45  ? 2   NAG D O7  1 
HETATM 8438 C C1  . FUC D 2 .   ? 26.135  -52.089 -16.682 1.00 94.81  ? 3   FUC D C1  1 
HETATM 8439 C C2  . FUC D 2 .   ? 27.452  -51.437 -17.089 1.00 102.77 ? 3   FUC D C2  1 
HETATM 8440 C C3  . FUC D 2 .   ? 28.476  -51.603 -15.966 1.00 102.58 ? 3   FUC D C3  1 
HETATM 8441 C C4  . FUC D 2 .   ? 28.728  -53.102 -15.738 1.00 98.67  ? 3   FUC D C4  1 
HETATM 8442 C C5  . FUC D 2 .   ? 27.388  -53.807 -15.410 1.00 82.98  ? 3   FUC D C5  1 
HETATM 8443 C C6  . FUC D 2 .   ? 27.483  -55.338 -15.400 1.00 66.41  ? 3   FUC D C6  1 
HETATM 8444 O O2  . FUC D 2 .   ? 27.270  -50.067 -17.400 1.00 98.74  ? 3   FUC D O2  1 
HETATM 8445 O O3  . FUC D 2 .   ? 29.719  -50.991 -16.314 1.00 105.89 ? 3   FUC D O3  1 
HETATM 8446 O O4  . FUC D 2 .   ? 29.312  -53.689 -16.896 1.00 83.06  ? 3   FUC D O4  1 
HETATM 8447 O O5  . FUC D 2 .   ? 26.304  -53.462 -16.335 1.00 75.26  ? 3   FUC D O5  1 
HETATM 8448 C C1  . GNT E 3 .   ? -9.699  -43.408 32.409  1.00 20.40  ? 604 GNT A C1  1 
HETATM 8449 C C2  . GNT E 3 .   ? -8.507  -43.160 32.941  1.00 21.93  ? 604 GNT A C2  1 
HETATM 8450 C C3  . GNT E 3 .   ? -7.215  -43.789 32.476  1.00 23.70  ? 604 GNT A C3  1 
HETATM 8451 C C4  . GNT E 3 .   ? -7.514  -45.109 31.773  1.00 21.77  ? 604 GNT A C4  1 
HETATM 8452 C C41 . GNT E 3 .   ? -8.619  -44.981 30.730  1.00 22.55  ? 604 GNT A C41 1 
HETATM 8453 C C42 . GNT E 3 .   ? -9.929  -44.333 31.223  1.00 32.17  ? 604 GNT A C42 1 
HETATM 8454 O O5  . GNT E 3 .   ? -8.185  -44.221 29.590  1.00 28.03  ? 604 GNT A O5  1 
HETATM 8455 C C6  . GNT E 3 .   ? -9.318  -42.630 27.930  1.00 27.43  ? 604 GNT A C6  1 
HETATM 8456 C C7  . GNT E 3 .   ? -10.507 -41.913 27.733  1.00 30.13  ? 604 GNT A C7  1 
HETATM 8457 C C8  . GNT E 3 .   ? -11.572 -41.940 28.650  1.00 29.09  ? 604 GNT A C8  1 
HETATM 8458 C C9  . GNT E 3 .   ? -12.684 -42.710 30.808  1.00 29.70  ? 604 GNT A C9  1 
HETATM 8459 N N10 . GNT E 3 .   ? -13.118 -44.101 31.054  1.00 37.02  ? 604 GNT A N10 1 
HETATM 8460 C C11 . GNT E 3 .   ? -12.266 -44.748 32.058  1.00 32.34  ? 604 GNT A C11 1 
HETATM 8461 C C12 . GNT E 3 .   ? -11.018 -45.381 31.457  1.00 30.72  ? 604 GNT A C12 1 
HETATM 8462 C C13 . GNT E 3 .   ? -9.200  -43.430 29.152  1.00 22.24  ? 604 GNT A C13 1 
HETATM 8463 C C14 . GNT E 3 .   ? -10.299 -43.463 30.083  1.00 24.79  ? 604 GNT A C14 1 
HETATM 8464 C C15 . GNT E 3 .   ? -11.526 -42.683 29.834  1.00 27.64  ? 604 GNT A C15 1 
HETATM 8465 C C16 . GNT E 3 .   ? -8.343  -41.670 25.966  1.00 24.48  ? 604 GNT A C16 1 
HETATM 8466 O O17 . GNT E 3 .   ? -8.284  -42.603 27.037  1.00 28.67  ? 604 GNT A O17 1 
HETATM 8467 O O18 . GNT E 3 .   ? -6.491  -42.885 31.619  1.00 28.38  ? 604 GNT A O18 1 
HETATM 8468 C C19 . GNT E 3 .   ? -14.493 -44.084 31.584  1.00 29.30  ? 604 GNT A C19 1 
HETATM 8469 C C1  . EDO F 4 .   ? -9.435  -58.843 9.443   1.00 28.90  ? 605 EDO A C1  1 
HETATM 8470 O O1  . EDO F 4 .   ? -8.132  -58.323 9.150   1.00 32.43  ? 605 EDO A O1  1 
HETATM 8471 C C2  . EDO F 4 .   ? -10.275 -58.898 8.175   1.00 43.35  ? 605 EDO A C2  1 
HETATM 8472 O O2  . EDO F 4 .   ? -9.725  -59.827 7.238   1.00 32.53  ? 605 EDO A O2  1 
HETATM 8473 C C1  . EDO G 4 .   ? 8.419   -47.070 11.300  0.98 34.40  ? 606 EDO A C1  1 
HETATM 8474 O O1  . EDO G 4 .   ? 9.543   -46.312 10.834  0.98 34.78  ? 606 EDO A O1  1 
HETATM 8475 C C2  . EDO G 4 .   ? 7.216   -46.850 10.387  0.98 29.51  ? 606 EDO A C2  1 
HETATM 8476 O O2  . EDO G 4 .   ? 6.867   -45.458 10.343  0.98 32.77  ? 606 EDO A O2  1 
HETATM 8477 C C1  . NAG H 5 .   ? -7.989  -35.594 -47.160 1.00 71.47  ? 604 NAG B C1  1 
HETATM 8478 C C2  . NAG H 5 .   ? -9.492  -35.452 -47.412 1.00 74.26  ? 604 NAG B C2  1 
HETATM 8479 C C3  . NAG H 5 .   ? -9.946  -36.296 -48.605 1.00 80.97  ? 604 NAG B C3  1 
HETATM 8480 C C4  . NAG H 5 .   ? -9.056  -36.048 -49.822 1.00 101.74 ? 604 NAG B C4  1 
HETATM 8481 C C5  . NAG H 5 .   ? -7.602  -36.309 -49.421 1.00 94.98  ? 604 NAG B C5  1 
HETATM 8482 C C6  . NAG H 5 .   ? -6.622  -36.261 -50.606 1.00 65.34  ? 604 NAG B C6  1 
HETATM 8483 C C7  . NAG H 5 .   ? -10.768 -34.960 -45.384 1.00 82.68  ? 604 NAG B C7  1 
HETATM 8484 C C8  . NAG H 5 .   ? -11.634 -35.527 -44.292 1.00 73.01  ? 604 NAG B C8  1 
HETATM 8485 N N2  . NAG H 5 .   ? -10.214 -35.844 -46.214 1.00 70.77  ? 604 NAG B N2  1 
HETATM 8486 O O3  . NAG H 5 .   ? -11.295 -36.031 -48.919 1.00 82.85  ? 604 NAG B O3  1 
HETATM 8487 O O4  . NAG H 5 .   ? -9.448  -36.878 -50.899 1.00 101.01 ? 604 NAG B O4  1 
HETATM 8488 O O5  . NAG H 5 .   ? -7.224  -35.434 -48.355 1.00 88.52  ? 604 NAG B O5  1 
HETATM 8489 O O6  . NAG H 5 .   ? -7.169  -35.586 -51.721 1.00 78.00  ? 604 NAG B O6  1 
HETATM 8490 O O7  . NAG H 5 .   ? -10.596 -33.741 -45.476 1.00 75.08  ? 604 NAG B O7  1 
HETATM 8491 C C1  . GNT I 3 .   ? 8.962   -62.011 -25.794 1.00 26.82  ? 605 GNT B C1  1 
HETATM 8492 C C2  . GNT I 3 .   ? 8.012   -62.939 -25.973 1.00 23.98  ? 605 GNT B C2  1 
HETATM 8493 C C3  . GNT I 3 .   ? 7.317   -63.656 -24.828 1.00 32.02  ? 605 GNT B C3  1 
HETATM 8494 C C4  . GNT I 3 .   ? 8.220   -63.664 -23.601 1.00 23.10  ? 605 GNT B C4  1 
HETATM 8495 C C41 . GNT I 3 .   ? 8.705   -62.254 -23.281 1.00 29.87  ? 605 GNT B C41 1 
HETATM 8496 C C42 . GNT I 3 .   ? 9.437   -61.518 -24.438 1.00 31.71  ? 605 GNT B C42 1 
HETATM 8497 O O5  . GNT I 3 .   ? 7.590   -61.431 -22.888 1.00 30.49  ? 605 GNT B O5  1 
HETATM 8498 C C6  . GNT I 3 .   ? 7.080   -58.921 -22.998 1.00 33.16  ? 605 GNT B C6  1 
HETATM 8499 C C7  . GNT I 3 .   ? 7.512   -57.742 -23.603 1.00 31.93  ? 605 GNT B C7  1 
HETATM 8500 C C8  . GNT I 3 .   ? 8.589   -57.711 -24.508 1.00 33.27  ? 605 GNT B C8  1 
HETATM 8501 C C9  . GNT I 3 .   ? 10.458  -58.770 -25.850 1.00 33.05  ? 605 GNT B C9  1 
HETATM 8502 N N10 . GNT I 3 .   ? 11.675  -59.348 -25.253 1.00 34.90  ? 605 GNT B N10 1 
HETATM 8503 C C11 . GNT I 3 .   ? 11.689  -60.813 -25.424 1.00 31.87  ? 605 GNT B C11 1 
HETATM 8504 C C12 . GNT I 3 .   ? 10.967  -61.556 -24.304 1.00 26.04  ? 605 GNT B C12 1 
HETATM 8505 C C13 . GNT I 3 .   ? 7.790   -60.165 -23.338 1.00 28.37  ? 605 GNT B C13 1 
HETATM 8506 C C14 . GNT I 3 .   ? 8.902   -60.136 -24.265 1.00 29.76  ? 605 GNT B C14 1 
HETATM 8507 C C15 . GNT I 3 .   ? 9.304   -58.853 -24.880 1.00 34.07  ? 605 GNT B C15 1 
HETATM 8508 C C16 . GNT I 3 .   ? 5.200   -57.817 -21.956 1.00 34.92  ? 605 GNT B C16 1 
HETATM 8509 O O17 . GNT I 3 .   ? 6.034   -58.954 -22.119 1.00 36.16  ? 605 GNT B O17 1 
HETATM 8510 O O18 . GNT I 3 .   ? 6.060   -63.046 -24.498 1.00 31.73  ? 605 GNT B O18 1 
HETATM 8511 C C19 . GNT I 3 .   ? 12.827  -58.770 -25.964 1.00 31.14  ? 605 GNT B C19 1 
HETATM 8512 C C1  . EDO J 4 .   ? 12.737  -53.081 1.650   0.91 34.65  ? 606 EDO B C1  1 
HETATM 8513 O O1  . EDO J 4 .   ? 11.992  -52.409 2.678   0.91 29.26  ? 606 EDO B O1  1 
HETATM 8514 C C2  . EDO J 4 .   ? 11.803  -53.381 0.484   0.91 35.43  ? 606 EDO B C2  1 
HETATM 8515 O O2  . EDO J 4 .   ? 10.696  -54.143 0.990   0.91 33.70  ? 606 EDO B O2  1 
HETATM 8516 N N   . NO3 K 6 .   ? -9.185  -39.759 -31.225 0.73 36.58  ? 607 NO3 B N   1 
HETATM 8517 O O1  . NO3 K 6 .   ? -10.549 -40.007 -31.423 0.73 53.43  ? 607 NO3 B O1  1 
HETATM 8518 O O2  . NO3 K 6 .   ? -8.732  -39.119 -30.068 0.73 40.86  ? 607 NO3 B O2  1 
HETATM 8519 O O3  . NO3 K 6 .   ? -8.268  -40.146 -32.198 0.73 39.20  ? 607 NO3 B O3  1 
HETATM 8520 N N   . NO3 L 6 .   ? -8.194  -59.870 -3.445  0.83 41.45  ? 608 NO3 B N   1 
HETATM 8521 O O1  . NO3 L 6 .   ? -8.404  -58.593 -4.004  0.83 31.19  ? 608 NO3 B O1  1 
HETATM 8522 O O2  . NO3 L 6 .   ? -6.923  -60.213 -2.988  0.83 46.25  ? 608 NO3 B O2  1 
HETATM 8523 O O3  . NO3 L 6 .   ? -9.226  -60.816 -3.328  0.83 28.70  ? 608 NO3 B O3  1 
HETATM 8524 O O1  . PE8 M 7 .   ? -18.779 -45.033 -34.125 0.98 76.13  ? 609 PE8 B O1  1 
HETATM 8525 C C2  . PE8 M 7 .   ? -18.920 -44.177 -33.047 0.98 81.44  ? 609 PE8 B C2  1 
HETATM 8526 C C3  . PE8 M 7 .   ? -17.794 -43.242 -32.742 0.98 74.70  ? 609 PE8 B C3  1 
HETATM 8527 O O4  . PE8 M 7 .   ? -17.086 -43.445 -31.570 0.98 86.86  ? 609 PE8 B O4  1 
HETATM 8528 C C5  . PE8 M 7 .   ? -15.849 -42.853 -31.374 0.98 67.77  ? 609 PE8 B C5  1 
HETATM 8529 C C6  . PE8 M 7 .   ? -14.707 -43.199 -32.281 0.98 62.47  ? 609 PE8 B C6  1 
HETATM 8530 O O7  . PE8 M 7 .   ? -14.831 -44.273 -33.142 0.98 71.69  ? 609 PE8 B O7  1 
HETATM 8531 C C8  . PE8 M 7 .   ? -13.768 -45.119 -33.395 0.98 54.77  ? 609 PE8 B C8  1 
HETATM 8532 C C9  . PE8 M 7 .   ? -13.953 -46.182 -34.430 0.98 60.07  ? 609 PE8 B C9  1 
HETATM 8533 O O10 . PE8 M 7 .   ? -14.915 -47.147 -34.206 0.98 67.94  ? 609 PE8 B O10 1 
HETATM 8534 C C11 . PE8 M 7 .   ? -15.750 -47.566 -35.227 0.98 61.37  ? 609 PE8 B C11 1 
HETATM 8535 C C12 . PE8 M 7 .   ? -16.861 -48.511 -34.888 0.98 60.88  ? 609 PE8 B C12 1 
HETATM 8536 O O13 . PE8 M 7 .   ? -17.821 -48.105 -33.979 0.98 71.56  ? 609 PE8 B O13 1 
HETATM 8537 C C14 . PE8 M 7 .   ? -18.360 -49.014 -33.087 0.98 64.78  ? 609 PE8 B C14 1 
HETATM 8538 C C15 . PE8 M 7 .   ? -19.397 -48.535 -32.117 0.98 69.27  ? 609 PE8 B C15 1 
HETATM 8539 O O16 . PE8 M 7 .   ? -19.060 -47.525 -31.233 0.98 74.19  ? 609 PE8 B O16 1 
HETATM 8540 C C17 . PE8 M 7 .   ? -19.541 -47.527 -29.935 0.98 57.99  ? 609 PE8 B C17 1 
HETATM 8541 C C18 . PE8 M 7 .   ? -18.686 -46.906 -28.874 0.98 69.01  ? 609 PE8 B C18 1 
HETATM 8542 O O19 . PE8 M 7 .   ? -18.012 -45.728 -29.161 0.98 75.87  ? 609 PE8 B O19 1 
HETATM 8543 C C20 . PE8 M 7 .   ? -16.860 -45.380 -28.474 0.98 59.49  ? 609 PE8 B C20 1 
HETATM 8544 C C21 . PE8 M 7 .   ? -16.783 -45.665 -27.007 0.98 73.57  ? 609 PE8 B C21 1 
HETATM 8545 O O22 . PE8 M 7 .   ? -15.541 -45.827 -26.415 0.98 63.10  ? 609 PE8 B O22 1 
HETATM 8546 C C23 . PE8 M 7 .   ? -15.436 -46.540 -25.239 0.98 49.63  ? 609 PE8 B C23 1 
HETATM 8547 C C24 . PE8 M 7 .   ? -16.675 -46.727 -24.427 0.98 58.06  ? 609 PE8 B C24 1 
HETATM 8548 O O25 . PE8 M 7 .   ? -16.566 -46.676 -23.050 0.98 68.73  ? 609 PE8 B O25 1 
HETATM 8549 O O   . HOH N 8 .   ? -8.101  -36.446 31.927  1.00 19.79  ? 701 HOH A O   1 
HETATM 8550 O O   . HOH N 8 .   ? -7.753  -51.045 25.150  0.98 24.07  ? 702 HOH A O   1 
HETATM 8551 O O   . HOH N 8 .   ? -13.308 -29.014 47.942  1.00 27.87  ? 703 HOH A O   1 
HETATM 8552 O O   . HOH N 8 .   ? 1.442   -48.058 28.959  1.00 23.98  ? 704 HOH A O   1 
HETATM 8553 O O   . HOH N 8 .   ? -12.475 -39.755 38.503  0.90 24.63  ? 705 HOH A O   1 
HETATM 8554 O O   . HOH N 8 .   ? -12.794 -23.480 35.145  1.00 28.08  ? 706 HOH A O   1 
HETATM 8555 O O   . HOH N 8 .   ? -4.366  -42.150 34.036  0.98 21.49  ? 707 HOH A O   1 
HETATM 8556 O O   . HOH N 8 .   ? -2.585  -36.464 38.699  1.00 20.04  ? 708 HOH A O   1 
HETATM 8557 O O   . HOH N 8 .   ? -2.683  -33.713 18.908  0.87 23.23  ? 709 HOH A O   1 
HETATM 8558 O O   . HOH N 8 .   ? 13.558  -49.385 24.278  1.00 26.73  ? 710 HOH A O   1 
HETATM 8559 O O   . HOH N 8 .   ? 17.311  -43.287 22.019  1.00 29.60  ? 711 HOH A O   1 
HETATM 8560 O O   . HOH N 8 .   ? 16.713  -49.265 19.220  1.00 36.44  ? 712 HOH A O   1 
HETATM 8561 O O   . HOH N 8 .   ? 9.035   -45.092 54.237  1.00 31.90  ? 713 HOH A O   1 
HETATM 8562 O O   . HOH N 8 .   ? -10.164 -34.249 39.298  1.00 25.32  ? 714 HOH A O   1 
HETATM 8563 O O   . HOH N 8 .   ? -15.924 -40.537 21.424  1.00 45.46  ? 715 HOH A O   1 
HETATM 8564 O O   . HOH N 8 .   ? -0.692  -62.284 30.873  1.00 35.25  ? 716 HOH A O   1 
HETATM 8565 O O   . HOH N 8 .   ? -13.820 -25.169 23.312  0.94 25.34  ? 717 HOH A O   1 
HETATM 8566 O O   . HOH N 8 .   ? -16.143 -35.568 25.527  1.00 43.66  ? 718 HOH A O   1 
HETATM 8567 O O   . HOH N 8 .   ? -7.612  -19.918 40.599  1.00 33.38  ? 719 HOH A O   1 
HETATM 8568 O O   . HOH N 8 .   ? -15.540 -39.844 35.861  1.00 29.57  ? 720 HOH A O   1 
HETATM 8569 O O   . HOH N 8 .   ? -8.425  -25.836 25.573  0.94 31.18  ? 721 HOH A O   1 
HETATM 8570 O O   . HOH N 8 .   ? -10.791 -35.319 21.038  0.95 27.05  ? 722 HOH A O   1 
HETATM 8571 O O   . HOH N 8 .   ? -21.448 -35.879 36.731  1.00 34.06  ? 723 HOH A O   1 
HETATM 8572 O O   . HOH N 8 .   ? -10.778 -45.591 43.256  1.00 32.03  ? 724 HOH A O   1 
HETATM 8573 O O   . HOH N 8 .   ? -11.264 -23.774 49.624  1.00 33.28  ? 725 HOH A O   1 
HETATM 8574 O O   . HOH N 8 .   ? 6.476   -47.643 14.386  1.00 32.10  ? 726 HOH A O   1 
HETATM 8575 O O   . HOH N 8 .   ? 8.407   -29.197 39.415  1.00 27.99  ? 727 HOH A O   1 
HETATM 8576 O O   . HOH N 8 .   ? -19.019 -20.078 37.158  0.95 32.59  ? 728 HOH A O   1 
HETATM 8577 O O   . HOH N 8 .   ? 4.932   -24.375 22.423  1.00 34.86  ? 729 HOH A O   1 
HETATM 8578 O O   . HOH N 8 .   ? -13.683 -63.282 25.929  1.00 44.15  ? 730 HOH A O   1 
HETATM 8579 O O   . HOH N 8 .   ? -9.166  -46.935 41.413  1.00 30.10  ? 731 HOH A O   1 
HETATM 8580 O O   . HOH N 8 .   ? -4.439  -42.027 44.921  0.88 27.22  ? 732 HOH A O   1 
HETATM 8581 O O   . HOH N 8 .   ? -21.896 -24.358 17.312  1.00 43.29  ? 733 HOH A O   1 
HETATM 8582 O O   . HOH N 8 .   ? 0.065   -23.631 48.569  1.00 35.22  ? 734 HOH A O   1 
HETATM 8583 O O   . HOH N 8 .   ? -20.479 -50.332 21.446  1.00 47.66  ? 735 HOH A O   1 
HETATM 8584 O O   . HOH N 8 .   ? 2.751   -57.242 21.475  1.00 42.89  ? 736 HOH A O   1 
HETATM 8585 O O   . HOH N 8 .   ? 9.352   -60.631 28.240  0.93 45.29  ? 737 HOH A O   1 
HETATM 8586 O O   . HOH N 8 .   ? -29.749 -17.927 30.952  1.00 49.07  ? 738 HOH A O   1 
HETATM 8587 O O   . HOH N 8 .   ? -21.790 -26.455 15.570  1.00 52.03  ? 739 HOH A O   1 
HETATM 8588 O O   . HOH N 8 .   ? -10.699 -54.885 36.786  1.00 55.45  ? 740 HOH A O   1 
HETATM 8589 O O   . HOH N 8 .   ? -21.976 -14.463 35.044  1.00 40.97  ? 741 HOH A O   1 
HETATM 8590 O O   . HOH N 8 .   ? 5.353   -22.435 60.597  1.00 56.93  ? 742 HOH A O   1 
HETATM 8591 O O   . HOH N 8 .   ? 6.596   -22.731 16.694  1.00 53.81  ? 743 HOH A O   1 
HETATM 8592 O O   . HOH N 8 .   ? -1.270  -40.165 61.245  1.00 39.83  ? 744 HOH A O   1 
HETATM 8593 O O   . HOH N 8 .   ? 8.142   -53.444 47.654  1.00 38.60  ? 745 HOH A O   1 
HETATM 8594 O O   . HOH N 8 .   ? 18.919  -45.690 40.321  1.00 41.93  ? 746 HOH A O   1 
HETATM 8595 O O   . HOH N 8 .   ? -14.779 -41.262 8.691   1.00 41.23  ? 747 HOH A O   1 
HETATM 8596 O O   . HOH N 8 .   ? -18.507 -41.944 41.274  0.79 27.14  ? 748 HOH A O   1 
HETATM 8597 O O   . HOH N 8 .   ? -9.072  -19.362 37.976  0.95 35.65  ? 749 HOH A O   1 
HETATM 8598 O O   . HOH N 8 .   ? 4.091   -19.167 22.560  1.00 45.94  ? 750 HOH A O   1 
HETATM 8599 O O   . HOH N 8 .   ? -8.984  -23.308 13.041  1.00 48.44  ? 751 HOH A O   1 
HETATM 8600 O O   . HOH N 8 .   ? -13.666 -64.055 28.854  0.95 42.83  ? 752 HOH A O   1 
HETATM 8601 O O   . HOH N 8 .   ? -10.410 -21.332 29.081  1.00 35.06  ? 753 HOH A O   1 
HETATM 8602 O O   . HOH N 8 .   ? -8.147  -39.996 51.965  1.00 46.93  ? 754 HOH A O   1 
HETATM 8603 O O   . HOH N 8 .   ? -13.636 -64.699 5.430   1.00 37.31  ? 755 HOH A O   1 
HETATM 8604 O O   . HOH N 8 .   ? -5.874  -57.087 18.343  1.00 53.03  ? 756 HOH A O   1 
HETATM 8605 O O   . HOH N 8 .   ? -17.751 -52.292 14.776  1.00 39.87  ? 757 HOH A O   1 
HETATM 8606 O O   . HOH N 8 .   ? -7.709  -18.602 49.639  1.00 43.78  ? 758 HOH A O   1 
HETATM 8607 O O   . HOH N 8 .   ? -6.576  -60.127 10.273  1.00 33.92  ? 759 HOH A O   1 
HETATM 8608 O O   . HOH N 8 .   ? -10.327 -61.280 -0.873  1.00 38.30  ? 760 HOH A O   1 
HETATM 8609 O O   . HOH N 8 .   ? 17.367  -42.557 16.307  1.00 38.70  ? 761 HOH A O   1 
HETATM 8610 O O   . HOH N 8 .   ? -6.052  -18.006 56.753  1.00 49.87  ? 762 HOH A O   1 
HETATM 8611 O O   . HOH N 8 .   ? -5.488  -45.506 53.704  1.00 50.39  ? 763 HOH A O   1 
HETATM 8612 O O   . HOH N 8 .   ? -15.745 -35.872 49.361  1.00 38.28  ? 764 HOH A O   1 
HETATM 8613 O O   . HOH N 8 .   ? 16.099  -60.290 23.938  1.00 47.04  ? 765 HOH A O   1 
HETATM 8614 O O   . HOH N 8 .   ? 2.360   -26.815 62.845  1.00 46.56  ? 766 HOH A O   1 
HETATM 8615 O O   . HOH N 8 .   ? -2.888  -33.999 6.084   1.00 62.40  ? 767 HOH A O   1 
HETATM 8616 O O   . HOH N 8 .   ? -19.981 -48.622 6.450   1.00 51.62  ? 768 HOH A O   1 
HETATM 8617 O O   . HOH N 8 .   ? 17.869  -36.417 44.257  1.00 54.09  ? 769 HOH A O   1 
HETATM 8618 O O   . HOH N 8 .   ? -30.464 -28.529 25.234  1.00 30.88  ? 770 HOH A O   1 
HETATM 8619 O O   . HOH N 8 .   ? -19.704 -39.378 41.226  0.86 37.39  ? 771 HOH A O   1 
HETATM 8620 O O   . HOH N 8 .   ? 9.276   -58.530 31.218  1.00 32.31  ? 772 HOH A O   1 
HETATM 8621 O O   . HOH N 8 .   ? -10.452 -41.755 35.867  0.93 20.56  ? 773 HOH A O   1 
HETATM 8622 O O   . HOH N 8 .   ? -2.003  -52.360 20.933  1.00 31.25  ? 774 HOH A O   1 
HETATM 8623 O O   . HOH N 8 .   ? 6.762   -53.883 13.799  1.00 40.39  ? 775 HOH A O   1 
HETATM 8624 O O   . HOH N 8 .   ? -2.346  -41.720 13.924  1.00 30.82  ? 776 HOH A O   1 
HETATM 8625 O O   . HOH N 8 .   ? -9.692  -35.908 44.294  0.95 33.89  ? 777 HOH A O   1 
HETATM 8626 O O   . HOH N 8 .   ? 11.385  -27.074 46.858  1.00 32.42  ? 778 HOH A O   1 
HETATM 8627 O O   . HOH N 8 .   ? -17.416 -30.502 30.639  1.00 43.50  ? 779 HOH A O   1 
HETATM 8628 O O   . HOH N 8 .   ? -22.350 -37.493 34.939  1.00 36.18  ? 780 HOH A O   1 
HETATM 8629 O O   . HOH N 8 .   ? 2.572   -27.473 60.460  1.00 35.57  ? 781 HOH A O   1 
HETATM 8630 O O   . HOH N 8 .   ? 5.192   -27.226 60.220  1.00 35.18  ? 782 HOH A O   1 
HETATM 8631 O O   . HOH N 8 .   ? -17.712 -40.349 8.866   1.00 57.72  ? 783 HOH A O   1 
HETATM 8632 O O   . HOH N 8 .   ? -2.145  -29.905 63.694  1.00 55.32  ? 784 HOH A O   1 
HETATM 8633 O O   . HOH N 8 .   ? -16.547 -58.519 31.992  1.00 39.26  ? 785 HOH A O   1 
HETATM 8634 O O   . HOH N 8 .   ? -3.120  -21.428 25.186  1.00 43.53  ? 786 HOH A O   1 
HETATM 8635 O O   . HOH N 8 .   ? 13.009  -51.710 46.619  0.86 24.46  ? 787 HOH A O   1 
HETATM 8636 O O   . HOH N 8 .   ? -13.148 -26.417 38.507  0.95 26.24  ? 788 HOH A O   1 
HETATM 8637 O O   . HOH N 8 .   ? -8.486  -23.891 48.508  0.80 34.48  ? 789 HOH A O   1 
HETATM 8638 O O   . HOH N 8 .   ? -14.360 -26.256 12.612  1.00 37.13  ? 790 HOH A O   1 
HETATM 8639 O O   . HOH N 8 .   ? -16.051 -24.864 12.807  1.00 54.83  ? 791 HOH A O   1 
HETATM 8640 O O   . HOH N 8 .   ? -7.590  -29.455 52.198  0.85 28.95  ? 792 HOH A O   1 
HETATM 8641 O O   . HOH N 8 .   ? -2.502  -42.241 61.245  0.95 43.79  ? 793 HOH A O   1 
HETATM 8642 O O   . HOH N 8 .   ? -19.478 -15.225 20.183  1.00 55.56  ? 794 HOH A O   1 
HETATM 8643 O O   . HOH N 8 .   ? -14.446 -51.185 1.555   1.00 46.75  ? 795 HOH A O   1 
HETATM 8644 O O   . HOH N 8 .   ? 3.373   -50.138 57.605  0.75 32.25  ? 796 HOH A O   1 
HETATM 8645 O O   . HOH N 8 .   ? 5.585   -62.508 46.181  1.00 46.14  ? 797 HOH A O   1 
HETATM 8646 O O   . HOH N 8 .   ? -27.503 -28.370 18.647  1.00 52.71  ? 798 HOH A O   1 
HETATM 8647 O O   . HOH N 8 .   ? 2.371   -46.490 44.828  0.97 22.14  ? 799 HOH A O   1 
HETATM 8648 O O   . HOH N 8 .   ? 8.790   -48.601 15.420  1.00 31.03  ? 800 HOH A O   1 
HETATM 8649 O O   . HOH N 8 .   ? -19.095 -43.397 21.878  1.00 42.43  ? 801 HOH A O   1 
HETATM 8650 O O   . HOH N 8 .   ? -19.235 -40.666 20.987  1.00 58.75  ? 802 HOH A O   1 
HETATM 8651 O O   . HOH N 8 .   ? -7.841  -40.913 36.111  1.00 21.88  ? 803 HOH A O   1 
HETATM 8652 O O   . HOH N 8 .   ? -12.032 -34.176 27.162  1.00 21.58  ? 804 HOH A O   1 
HETATM 8653 O O   . HOH N 8 .   ? -2.323  -47.719 29.526  1.00 25.48  ? 805 HOH A O   1 
HETATM 8654 O O   . HOH N 8 .   ? -2.275  -39.892 43.061  1.00 27.48  ? 806 HOH A O   1 
HETATM 8655 O O   . HOH N 8 .   ? -16.477 -34.309 32.080  1.00 23.85  ? 807 HOH A O   1 
HETATM 8656 O O   . HOH N 8 .   ? -16.335 -31.829 33.067  1.00 28.54  ? 808 HOH A O   1 
HETATM 8657 O O   . HOH N 8 .   ? -7.409  -25.021 45.976  0.99 23.26  ? 809 HOH A O   1 
HETATM 8658 O O   . HOH N 8 .   ? -14.101 -24.302 37.398  0.99 27.60  ? 810 HOH A O   1 
HETATM 8659 O O   . HOH N 8 .   ? -4.225  -50.329 36.305  0.94 26.32  ? 811 HOH A O   1 
HETATM 8660 O O   . HOH N 8 .   ? -1.760  -23.284 22.584  1.00 38.83  ? 812 HOH A O   1 
HETATM 8661 O O   . HOH N 8 .   ? 0.053   -40.956 14.503  1.00 33.87  ? 813 HOH A O   1 
HETATM 8662 O O   . HOH N 8 .   ? -14.482 -33.049 26.844  1.00 34.23  ? 814 HOH A O   1 
HETATM 8663 O O   . HOH N 8 .   ? -12.284 -41.649 33.836  1.00 26.32  ? 815 HOH A O   1 
HETATM 8664 O O   . HOH N 8 .   ? -20.333 -45.879 10.758  1.00 41.31  ? 816 HOH A O   1 
HETATM 8665 O O   . HOH N 8 .   ? 13.079  -55.701 41.969  1.00 43.00  ? 817 HOH A O   1 
HETATM 8666 O O   . HOH N 8 .   ? 11.370  -58.285 41.612  1.00 34.83  ? 818 HOH A O   1 
HETATM 8667 O O   . HOH N 8 .   ? -2.898  -42.877 49.935  1.00 40.42  ? 819 HOH A O   1 
HETATM 8668 O O   . HOH N 8 .   ? -14.919 -42.337 34.519  1.00 26.34  ? 820 HOH A O   1 
HETATM 8669 O O   . HOH N 8 .   ? -5.347  -52.908 19.896  1.00 35.27  ? 821 HOH A O   1 
HETATM 8670 O O   . HOH N 8 .   ? -3.533  -51.160 18.738  0.95 36.09  ? 822 HOH A O   1 
HETATM 8671 O O   . HOH N 8 .   ? -7.408  -56.590 20.892  1.00 41.32  ? 823 HOH A O   1 
HETATM 8672 O O   . HOH N 8 .   ? -6.897  -22.711 53.221  1.00 48.31  ? 824 HOH A O   1 
HETATM 8673 O O   . HOH N 8 .   ? -7.238  -59.681 12.991  0.95 38.26  ? 825 HOH A O   1 
HETATM 8674 O O   . HOH N 8 .   ? -14.433 -53.807 1.607   1.00 40.64  ? 826 HOH A O   1 
HETATM 8675 O O   . HOH N 8 .   ? 11.044  -46.400 52.441  0.87 37.92  ? 827 HOH A O   1 
HETATM 8676 O O   . HOH N 8 .   ? -13.347 -30.285 35.791  1.00 28.30  ? 828 HOH A O   1 
HETATM 8677 O O   . HOH N 8 .   ? 10.533  -52.026 43.620  1.00 27.71  ? 829 HOH A O   1 
HETATM 8678 O O   . HOH N 8 .   ? -6.414  -34.167 46.933  1.00 34.71  ? 830 HOH A O   1 
HETATM 8679 O O   . HOH N 8 .   ? -0.269  -21.385 58.303  1.00 47.17  ? 831 HOH A O   1 
HETATM 8680 O O   . HOH N 8 .   ? -3.200  -56.242 32.960  0.97 39.47  ? 832 HOH A O   1 
HETATM 8681 O O   . HOH N 8 .   ? -11.476 -34.005 18.835  1.00 28.99  ? 833 HOH A O   1 
HETATM 8682 O O   . HOH N 8 .   ? -10.928 -27.299 23.532  1.00 28.50  ? 834 HOH A O   1 
HETATM 8683 O O   . HOH N 8 .   ? -13.166 -27.835 22.137  0.90 30.36  ? 835 HOH A O   1 
HETATM 8684 O O   . HOH N 8 .   ? 7.349   -55.884 16.669  1.00 32.44  ? 836 HOH A O   1 
HETATM 8685 O O   . HOH N 8 .   ? -2.429  -58.517 46.124  1.00 37.00  ? 837 HOH A O   1 
HETATM 8686 O O   . HOH N 8 .   ? 0.355   -21.646 35.456  1.00 38.98  ? 838 HOH A O   1 
HETATM 8687 O O   . HOH N 8 .   ? 2.522   -22.997 49.500  1.00 35.17  ? 839 HOH A O   1 
HETATM 8688 O O   . HOH N 8 .   ? -7.664  -55.195 37.798  1.00 42.53  ? 840 HOH A O   1 
HETATM 8689 O O   . HOH N 8 .   ? 12.199  -44.834 56.425  0.99 32.62  ? 841 HOH A O   1 
HETATM 8690 O O   . HOH N 8 .   ? 12.894  -37.788 39.294  0.81 30.96  ? 842 HOH A O   1 
HETATM 8691 O O   . HOH N 8 .   ? -9.562  -25.480 44.384  0.98 30.27  ? 843 HOH A O   1 
HETATM 8692 O O   . HOH N 8 .   ? 12.614  -49.513 50.873  1.00 40.99  ? 844 HOH A O   1 
HETATM 8693 O O   . HOH N 8 .   ? -5.452  -24.038 15.276  1.00 40.48  ? 845 HOH A O   1 
HETATM 8694 O O   . HOH N 8 .   ? -7.364  -62.506 33.690  1.00 44.95  ? 846 HOH A O   1 
HETATM 8695 O O   . HOH N 8 .   ? 4.671   -52.515 4.468   1.00 33.12  ? 847 HOH A O   1 
HETATM 8696 O O   . HOH N 8 .   ? 2.075   -20.144 32.281  0.99 44.71  ? 848 HOH A O   1 
HETATM 8697 O O   . HOH N 8 .   ? -7.974  -43.879 47.220  1.00 32.87  ? 849 HOH A O   1 
HETATM 8698 O O   . HOH N 8 .   ? -2.627  -46.690 56.622  1.00 42.57  ? 850 HOH A O   1 
HETATM 8699 O O   . HOH N 8 .   ? -15.744 -21.906 14.478  1.00 48.85  ? 851 HOH A O   1 
HETATM 8700 O O   . HOH N 8 .   ? -14.580 -43.871 22.951  1.00 44.81  ? 852 HOH A O   1 
HETATM 8701 O O   . HOH N 8 .   ? -22.287 -31.622 16.985  1.00 51.46  ? 853 HOH A O   1 
HETATM 8702 O O   . HOH N 8 .   ? 10.374  -23.148 32.909  0.88 51.13  ? 854 HOH A O   1 
HETATM 8703 O O   . HOH N 8 .   ? 6.706   -21.464 34.387  1.00 46.48  ? 855 HOH A O   1 
HETATM 8704 O O   . HOH N 8 .   ? 0.549   -18.233 56.047  0.87 38.06  ? 856 HOH A O   1 
HETATM 8705 O O   . HOH N 8 .   ? 9.867   -44.670 15.258  0.96 34.94  ? 857 HOH A O   1 
HETATM 8706 O O   . HOH N 8 .   ? -4.297  -67.641 5.873   1.00 46.39  ? 858 HOH A O   1 
HETATM 8707 O O   . HOH N 8 .   ? -3.795  -64.896 6.321   1.00 53.08  ? 859 HOH A O   1 
HETATM 8708 O O   . HOH N 8 .   ? -7.019  -40.936 29.351  0.78 24.69  ? 860 HOH A O   1 
HETATM 8709 O O   . HOH N 8 .   ? -14.201 -28.666 38.085  1.00 34.11  ? 861 HOH A O   1 
HETATM 8710 O O   . HOH N 8 .   ? -15.372 -45.436 34.303  1.00 40.34  ? 862 HOH A O   1 
HETATM 8711 O O   . HOH N 8 .   ? -13.033 -44.935 41.767  0.93 32.03  ? 863 HOH A O   1 
HETATM 8712 O O   . HOH N 8 .   ? 6.244   -45.119 13.201  1.00 37.94  ? 864 HOH A O   1 
HETATM 8713 O O   . HOH N 8 .   ? -5.606  -62.289 9.537   1.00 38.41  ? 865 HOH A O   1 
HETATM 8714 O O   . HOH N 8 .   ? 11.026  -53.415 46.095  1.00 33.15  ? 866 HOH A O   1 
HETATM 8715 O O   . HOH N 8 .   ? 7.099   -38.975 9.402   1.00 49.39  ? 867 HOH A O   1 
HETATM 8716 O O   . HOH N 8 .   ? 1.342   -38.384 15.011  1.00 38.80  ? 868 HOH A O   1 
HETATM 8717 O O   . HOH N 8 .   ? -4.727  -48.799 47.054  1.00 44.16  ? 869 HOH A O   1 
HETATM 8718 O O   . HOH N 8 .   ? -21.801 -43.390 30.843  1.00 48.72  ? 870 HOH A O   1 
HETATM 8719 O O   . HOH N 8 .   ? -15.972 -47.850 5.743   1.00 47.53  ? 871 HOH A O   1 
HETATM 8720 O O   . HOH N 8 .   ? 0.112   -21.384 47.098  1.00 38.78  ? 872 HOH A O   1 
HETATM 8721 O O   . HOH N 8 .   ? -27.522 -32.695 24.885  1.00 53.54  ? 873 HOH A O   1 
HETATM 8722 O O   . HOH N 8 .   ? -16.423 -41.015 32.741  1.00 32.30  ? 874 HOH A O   1 
HETATM 8723 O O   . HOH N 8 .   ? 18.768  -40.973 20.182  0.85 36.69  ? 875 HOH A O   1 
HETATM 8724 O O   . HOH N 8 .   ? -22.264 -25.946 40.384  1.00 32.33  ? 876 HOH A O   1 
HETATM 8725 O O   . HOH N 8 .   ? -23.536 -28.368 39.910  1.00 38.91  ? 877 HOH A O   1 
HETATM 8726 O O   . HOH N 8 .   ? 19.867  -36.705 25.374  1.00 39.94  ? 878 HOH A O   1 
HETATM 8727 O O   . HOH N 8 .   ? -5.899  -18.331 52.006  1.00 51.59  ? 879 HOH A O   1 
HETATM 8728 O O   . HOH N 8 .   ? -9.860  -42.926 49.551  1.00 44.89  ? 880 HOH A O   1 
HETATM 8729 O O   . HOH N 8 .   ? -18.272 -13.723 33.530  1.00 43.96  ? 881 HOH A O   1 
HETATM 8730 O O   . HOH N 8 .   ? -10.254 -66.708 13.459  1.00 46.07  ? 882 HOH A O   1 
HETATM 8731 O O   . HOH N 8 .   ? -20.601 -35.433 43.961  1.00 36.85  ? 883 HOH A O   1 
HETATM 8732 O O   . HOH N 8 .   ? -18.642 -38.538 43.708  1.00 39.84  ? 884 HOH A O   1 
HETATM 8733 O O   . HOH N 8 .   ? -18.209 -40.975 45.551  1.00 52.33  ? 885 HOH A O   1 
HETATM 8734 O O   . HOH N 8 .   ? 22.597  -51.178 29.454  1.00 49.77  ? 886 HOH A O   1 
HETATM 8735 O O   . HOH N 8 .   ? 20.841  -47.606 28.378  1.00 46.16  ? 887 HOH A O   1 
HETATM 8736 O O   . HOH N 8 .   ? -7.522  -27.895 56.846  0.86 38.27  ? 888 HOH A O   1 
HETATM 8737 O O   . HOH N 8 .   ? -9.983  -26.174 13.720  1.00 38.01  ? 889 HOH A O   1 
HETATM 8738 O O   . HOH N 8 .   ? -10.175 -50.786 -0.594  1.00 39.23  ? 890 HOH A O   1 
HETATM 8739 O O   . HOH N 8 .   ? -14.488 -43.814 26.816  1.00 47.04  ? 891 HOH A O   1 
HETATM 8740 O O   . HOH N 8 .   ? -16.949 -41.908 30.357  1.00 38.61  ? 892 HOH A O   1 
HETATM 8741 O O   . HOH N 8 .   ? 7.652   -42.308 12.799  1.00 41.01  ? 893 HOH A O   1 
HETATM 8742 O O   . HOH N 8 .   ? 7.921   -39.163 11.207  1.00 57.54  ? 894 HOH A O   1 
HETATM 8743 O O   . HOH N 8 .   ? -13.560 -17.134 42.701  1.00 42.35  ? 895 HOH A O   1 
HETATM 8744 O O   . HOH N 8 .   ? 2.359   -53.870 12.044  1.00 41.58  ? 896 HOH A O   1 
HETATM 8745 O O   . HOH N 8 .   ? 7.831   -43.052 64.994  1.00 38.42  ? 897 HOH A O   1 
HETATM 8746 O O   . HOH N 8 .   ? -8.928  -37.616 0.380   1.00 51.04  ? 898 HOH A O   1 
HETATM 8747 O O   . HOH N 8 .   ? 8.926   -60.949 36.902  1.00 47.01  ? 899 HOH A O   1 
HETATM 8748 O O   . HOH N 8 .   ? -18.263 -26.785 42.971  1.00 32.24  ? 900 HOH A O   1 
HETATM 8749 O O   . HOH N 8 .   ? -7.033  -40.731 54.574  1.00 44.22  ? 901 HOH A O   1 
HETATM 8750 O O   . HOH N 8 .   ? 15.480  -43.027 45.191  1.00 47.27  ? 902 HOH A O   1 
HETATM 8751 O O   . HOH N 8 .   ? 2.484   -66.786 41.412  1.00 51.24  ? 903 HOH A O   1 
HETATM 8752 O O   . HOH N 8 .   ? -11.384 -36.385 14.411  1.00 50.83  ? 904 HOH A O   1 
HETATM 8753 O O   . HOH O 8 .   ? 3.998   -71.748 -33.495 1.00 28.28  ? 701 HOH B O   1 
HETATM 8754 O O   . HOH O 8 .   ? 3.410   -59.439 -29.491 1.00 22.57  ? 702 HOH B O   1 
HETATM 8755 O O   . HOH O 8 .   ? 10.168  -61.767 -15.172 1.00 25.91  ? 703 HOH B O   1 
HETATM 8756 O O   . HOH O 8 .   ? -1.414  -45.372 -32.347 1.00 29.97  ? 704 HOH B O   1 
HETATM 8757 O O   . HOH O 8 .   ? 10.372  -62.549 -33.230 1.00 27.46  ? 705 HOH B O   1 
HETATM 8758 O O   . HOH O 8 .   ? 4.591   -65.842 -26.211 1.00 26.38  ? 706 HOH B O   1 
HETATM 8759 O O   . HOH O 8 .   ? -10.705 -71.987 -5.102  1.00 38.97  ? 707 HOH B O   1 
HETATM 8760 O O   . HOH O 8 .   ? 9.461   -62.997 -29.429 1.00 27.64  ? 708 HOH B O   1 
HETATM 8761 O O   . HOH O 8 .   ? 4.534   -69.442 -41.140 1.00 28.33  ? 709 HOH B O   1 
HETATM 8762 O O   . HOH O 8 .   ? 12.702  -59.714 -29.514 1.00 34.21  ? 710 HOH B O   1 
HETATM 8763 O O   . HOH O 8 .   ? 16.291  -81.963 -23.841 1.00 36.17  ? 711 HOH B O   1 
HETATM 8764 O O   . HOH O 8 .   ? 5.631   -62.082 -36.630 1.00 32.65  ? 712 HOH B O   1 
HETATM 8765 O O   . HOH O 8 .   ? -7.111  -73.276 -9.494  0.91 30.67  ? 713 HOH B O   1 
HETATM 8766 O O   . HOH O 8 .   ? 8.780   -50.026 -21.482 0.95 41.81  ? 714 HOH B O   1 
HETATM 8767 O O   . HOH O 8 .   ? 15.569  -49.363 -9.726  1.00 40.25  ? 715 HOH B O   1 
HETATM 8768 O O   . HOH O 8 .   ? 9.844   -65.182 -5.659  1.00 47.35  ? 716 HOH B O   1 
HETATM 8769 O O   . HOH O 8 .   ? -0.007  -64.346 -49.388 1.00 32.33  ? 717 HOH B O   1 
HETATM 8770 O O   . HOH O 8 .   ? 16.902  -61.844 -35.587 1.00 38.20  ? 718 HOH B O   1 
HETATM 8771 O O   . HOH O 8 .   ? -14.279 -71.410 -11.015 1.00 33.43  ? 719 HOH B O   1 
HETATM 8772 O O   . HOH O 8 .   ? -9.903  -77.886 -27.849 0.95 34.05  ? 720 HOH B O   1 
HETATM 8773 O O   . HOH O 8 .   ? -4.350  -50.378 -32.033 1.00 30.33  ? 721 HOH B O   1 
HETATM 8774 O O   . HOH O 8 .   ? -8.389  -71.087 -47.458 1.00 37.90  ? 722 HOH B O   1 
HETATM 8775 O O   . HOH O 8 .   ? 23.372  -52.552 -8.606  1.00 52.00  ? 723 HOH B O   1 
HETATM 8776 O O   . HOH O 8 .   ? 10.441  -60.901 -6.131  0.97 49.90  ? 724 HOH B O   1 
HETATM 8777 O O   . HOH O 8 .   ? -4.905  -57.736 -46.170 1.00 36.74  ? 725 HOH B O   1 
HETATM 8778 O O   . HOH O 8 .   ? -10.673 -44.723 -25.456 1.00 38.11  ? 726 HOH B O   1 
HETATM 8779 O O   . HOH O 8 .   ? 12.061  -51.663 -44.748 1.00 42.61  ? 727 HOH B O   1 
HETATM 8780 O O   . HOH O 8 .   ? 15.080  -41.667 -5.755  0.96 36.33  ? 728 HOH B O   1 
HETATM 8781 O O   . HOH O 8 .   ? 12.872  -69.823 -29.680 1.00 34.51  ? 729 HOH B O   1 
HETATM 8782 O O   . HOH O 8 .   ? 7.057   -52.946 -35.719 1.00 33.03  ? 730 HOH B O   1 
HETATM 8783 O O   . HOH O 8 .   ? 13.235  -74.414 -9.736  1.00 46.90  ? 731 HOH B O   1 
HETATM 8784 O O   . HOH O 8 .   ? 23.606  -66.334 -11.357 1.00 50.12  ? 732 HOH B O   1 
HETATM 8785 O O   . HOH O 8 .   ? -8.460  -65.197 -56.789 1.00 47.91  ? 733 HOH B O   1 
HETATM 8786 O O   . HOH O 8 .   ? -16.283 -63.106 -36.820 0.99 42.17  ? 734 HOH B O   1 
HETATM 8787 O O   . HOH O 8 .   ? 1.712   -36.037 -31.027 1.00 44.62  ? 735 HOH B O   1 
HETATM 8788 O O   . HOH O 8 .   ? 8.343   -60.501 -9.690  1.00 33.54  ? 736 HOH B O   1 
HETATM 8789 O O   . HOH O 8 .   ? 3.638   -79.577 -9.673  0.92 38.63  ? 737 HOH B O   1 
HETATM 8790 O O   . HOH O 8 .   ? 10.103  -70.853 -22.500 0.93 32.97  ? 738 HOH B O   1 
HETATM 8791 O O   . HOH O 8 .   ? -17.148 -60.615 -37.587 1.00 46.23  ? 739 HOH B O   1 
HETATM 8792 O O   . HOH O 8 .   ? 22.484  -66.902 -28.922 0.99 58.44  ? 740 HOH B O   1 
HETATM 8793 O O   . HOH O 8 .   ? -6.050  -64.274 -5.133  1.00 37.71  ? 741 HOH B O   1 
HETATM 8794 O O   . HOH O 8 .   ? -0.120  -52.941 -41.664 0.88 26.12  ? 742 HOH B O   1 
HETATM 8795 O O   . HOH O 8 .   ? -4.723  -49.485 -38.028 0.92 27.79  ? 743 HOH B O   1 
HETATM 8796 O O   . HOH O 8 .   ? 12.192  -59.062 -32.299 1.00 32.68  ? 744 HOH B O   1 
HETATM 8797 O O   . HOH O 8 .   ? -1.946  -79.869 -1.586  1.00 43.27  ? 745 HOH B O   1 
HETATM 8798 O O   . HOH O 8 .   ? -8.891  -52.247 -18.198 1.00 48.69  ? 746 HOH B O   1 
HETATM 8799 O O   . HOH O 8 .   ? 2.905   -35.805 -28.526 1.00 54.63  ? 747 HOH B O   1 
HETATM 8800 O O   . HOH O 8 .   ? 8.086   -84.468 -45.889 1.00 43.75  ? 748 HOH B O   1 
HETATM 8801 O O   . HOH O 8 .   ? 4.735   -87.421 -17.024 1.00 40.12  ? 749 HOH B O   1 
HETATM 8802 O O   . HOH O 8 .   ? 21.119  -57.223 0.814   0.91 48.26  ? 750 HOH B O   1 
HETATM 8803 O O   . HOH O 8 .   ? -12.354 -75.060 -5.845  1.00 43.00  ? 751 HOH B O   1 
HETATM 8804 O O   . HOH O 8 .   ? -18.987 -57.910 -21.013 1.00 44.15  ? 752 HOH B O   1 
HETATM 8805 O O   . HOH O 8 .   ? 13.794  -57.115 -44.302 1.00 43.47  ? 753 HOH B O   1 
HETATM 8806 O O   . HOH O 8 .   ? 1.598   -36.006 -8.634  1.00 48.25  ? 754 HOH B O   1 
HETATM 8807 O O   . HOH O 8 .   ? 12.206  -59.838 7.105   0.96 50.38  ? 755 HOH B O   1 
HETATM 8808 O O   . HOH O 8 .   ? -12.459 -50.224 -7.106  1.00 53.22  ? 756 HOH B O   1 
HETATM 8809 O O   . HOH O 8 .   ? 4.147   -81.615 -3.529  1.00 51.45  ? 757 HOH B O   1 
HETATM 8810 O O   . HOH O 8 .   ? -5.854  -52.946 -20.451 1.00 35.14  ? 758 HOH B O   1 
HETATM 8811 O O   . HOH O 8 .   ? 4.572   -55.980 -37.867 1.00 23.90  ? 759 HOH B O   1 
HETATM 8812 O O   . HOH O 8 .   ? 17.239  -51.436 6.263   1.00 34.45  ? 760 HOH B O   1 
HETATM 8813 O O   . HOH O 8 .   ? 10.237  -60.503 -28.711 0.93 24.44  ? 761 HOH B O   1 
HETATM 8814 O O   . HOH O 8 .   ? -0.732  -46.103 -29.696 1.00 30.93  ? 762 HOH B O   1 
HETATM 8815 O O   . HOH O 8 .   ? 4.322   -71.223 -47.700 1.00 29.97  ? 763 HOH B O   1 
HETATM 8816 O O   . HOH O 8 .   ? 9.453   -51.346 -46.538 1.00 31.34  ? 764 HOH B O   1 
HETATM 8817 O O   . HOH O 8 .   ? 4.437   -68.879 -49.242 1.00 29.67  ? 765 HOH B O   1 
HETATM 8818 O O   . HOH O 8 .   ? 1.607   -45.847 -18.251 1.00 48.01  ? 766 HOH B O   1 
HETATM 8819 O O   . HOH O 8 .   ? 7.542   -50.076 -28.123 1.00 36.73  ? 767 HOH B O   1 
HETATM 8820 O O   . HOH O 8 .   ? -13.648 -81.331 -26.847 1.00 42.40  ? 768 HOH B O   1 
HETATM 8821 O O   . HOH O 8 .   ? 13.025  -42.534 -12.011 0.98 49.73  ? 769 HOH B O   1 
HETATM 8822 O O   . HOH O 8 .   ? 22.986  -63.955 -17.627 1.00 46.30  ? 770 HOH B O   1 
HETATM 8823 O O   . HOH O 8 .   ? 4.921   -42.359 -12.062 1.00 45.97  ? 771 HOH B O   1 
HETATM 8824 O O   . HOH O 8 .   ? 5.678   -62.974 -9.544  1.00 31.11  ? 772 HOH B O   1 
HETATM 8825 O O   . HOH O 8 .   ? 17.682  -69.438 -21.574 1.00 56.81  ? 773 HOH B O   1 
HETATM 8826 O O   . HOH O 8 .   ? -18.712 -52.754 -30.513 1.00 40.34  ? 774 HOH B O   1 
HETATM 8827 O O   . HOH O 8 .   ? 1.897   -54.059 -43.194 0.98 32.96  ? 775 HOH B O   1 
HETATM 8828 O O   . HOH O 8 .   ? -4.511  -55.072 -45.022 0.80 35.41  ? 776 HOH B O   1 
HETATM 8829 O O   . HOH O 8 .   ? 9.661   -42.212 -24.972 1.00 59.01  ? 777 HOH B O   1 
HETATM 8830 O O   . HOH O 8 .   ? -16.204 -55.632 -26.849 1.00 42.12  ? 778 HOH B O   1 
HETATM 8831 O O   . HOH O 8 .   ? 10.351  -58.180 8.338   1.00 51.01  ? 779 HOH B O   1 
HETATM 8832 O O   . HOH O 8 .   ? 10.734  -83.621 -45.362 1.00 46.88  ? 780 HOH B O   1 
HETATM 8833 O O   . HOH O 8 .   ? -18.525 -74.071 -17.356 1.00 53.68  ? 781 HOH B O   1 
HETATM 8834 O O   . HOH O 8 .   ? -5.092  -39.182 -23.773 1.00 43.27  ? 782 HOH B O   1 
HETATM 8835 O O   . HOH O 8 .   ? 18.863  -77.633 -30.222 1.00 56.60  ? 783 HOH B O   1 
HETATM 8836 O O   . HOH O 8 .   ? -1.987  -69.669 -58.345 1.00 47.37  ? 784 HOH B O   1 
HETATM 8837 O O   . HOH O 8 .   ? 8.790   -42.132 -0.219  1.00 51.79  ? 785 HOH B O   1 
HETATM 8838 O O   . HOH O 8 .   ? -8.854  -66.471 -44.987 0.92 36.91  ? 786 HOH B O   1 
HETATM 8839 O O   . HOH O 8 .   ? 0.228   -43.248 -21.420 1.00 43.82  ? 787 HOH B O   1 
HETATM 8840 O O   . HOH O 8 .   ? 2.826   -66.363 -50.455 1.00 45.37  ? 788 HOH B O   1 
HETATM 8841 O O   . HOH O 8 .   ? 13.038  -55.318 -27.189 1.00 39.14  ? 789 HOH B O   1 
HETATM 8842 O O   . HOH O 8 .   ? -12.307 -49.014 -16.745 0.89 46.60  ? 790 HOH B O   1 
HETATM 8843 O O   . HOH O 8 .   ? -12.825 -78.256 -43.617 1.00 50.37  ? 791 HOH B O   1 
HETATM 8844 O O   . HOH O 8 .   ? 23.647  -55.856 0.156   0.95 51.04  ? 792 HOH B O   1 
HETATM 8845 O O   . HOH O 8 .   ? -16.709 -46.345 -32.080 1.00 43.31  ? 793 HOH B O   1 
HETATM 8846 O O   . HOH O 8 .   ? 7.156   -64.242 -29.408 1.00 23.04  ? 794 HOH B O   1 
HETATM 8847 O O   . HOH O 8 .   ? 2.553   -68.544 -17.190 1.00 26.60  ? 795 HOH B O   1 
HETATM 8848 O O   . HOH O 8 .   ? 13.068  -48.625 -20.928 1.00 46.21  ? 796 HOH B O   1 
HETATM 8849 O O   . HOH O 8 .   ? 0.802   -67.297 -32.660 0.99 18.66  ? 797 HOH B O   1 
HETATM 8850 O O   . HOH O 8 .   ? 1.952   -50.190 -23.426 1.00 24.96  ? 798 HOH B O   1 
HETATM 8851 O O   . HOH O 8 .   ? 8.011   -77.552 -36.543 1.00 34.75  ? 799 HOH B O   1 
HETATM 8852 O O   . HOH O 8 .   ? 8.422   -53.411 -33.189 1.00 36.39  ? 800 HOH B O   1 
HETATM 8853 O O   . HOH O 8 .   ? 6.888   -50.280 -34.990 1.00 37.33  ? 801 HOH B O   1 
HETATM 8854 O O   . HOH O 8 .   ? 5.327   -66.446 -18.820 1.00 29.41  ? 802 HOH B O   1 
HETATM 8855 O O   . HOH O 8 .   ? 3.716   -52.702 -28.850 1.00 27.29  ? 803 HOH B O   1 
HETATM 8856 O O   . HOH O 8 .   ? 5.308   -60.389 -9.244  1.00 35.85  ? 804 HOH B O   1 
HETATM 8857 O O   . HOH O 8 .   ? 7.546   -66.423 -38.976 1.00 32.49  ? 805 HOH B O   1 
HETATM 8858 O O   . HOH O 8 .   ? -2.233  -48.025 -30.233 1.00 26.76  ? 806 HOH B O   1 
HETATM 8859 O O   . HOH O 8 .   ? 12.880  -61.553 -8.350  1.00 44.07  ? 807 HOH B O   1 
HETATM 8860 O O   . HOH O 8 .   ? 2.595   -56.470 -0.611  1.00 41.28  ? 808 HOH B O   1 
HETATM 8861 O O   . HOH O 8 .   ? -11.786 -51.207 -29.542 1.00 38.17  ? 809 HOH B O   1 
HETATM 8862 O O   . HOH O 8 .   ? -11.378 -51.703 -32.803 1.00 43.04  ? 810 HOH B O   1 
HETATM 8863 O O   . HOH O 8 .   ? -1.433  -48.150 -21.697 1.00 26.25  ? 811 HOH B O   1 
HETATM 8864 O O   . HOH O 8 .   ? 0.885   -47.844 -22.796 1.00 24.40  ? 812 HOH B O   1 
HETATM 8865 O O   . HOH O 8 .   ? 10.222  -43.661 1.737   1.00 42.23  ? 813 HOH B O   1 
HETATM 8866 O O   . HOH O 8 .   ? 0.911   -46.628 -14.768 1.00 40.11  ? 814 HOH B O   1 
HETATM 8867 O O   . HOH O 8 .   ? 7.869   -53.398 -46.950 1.00 30.05  ? 815 HOH B O   1 
HETATM 8868 O O   . HOH O 8 .   ? 7.927   -55.951 -46.626 1.00 33.05  ? 816 HOH B O   1 
HETATM 8869 O O   . HOH O 8 .   ? -4.856  -54.909 -12.053 1.00 29.51  ? 817 HOH B O   1 
HETATM 8870 O O   . HOH O 8 .   ? -10.631 -49.717 -42.567 1.00 38.20  ? 818 HOH B O   1 
HETATM 8871 O O   . HOH O 8 .   ? 7.156   -63.186 -46.912 0.90 38.60  ? 819 HOH B O   1 
HETATM 8872 O O   . HOH O 8 .   ? 15.109  -59.062 -42.338 1.00 39.35  ? 820 HOH B O   1 
HETATM 8873 O O   . HOH O 8 .   ? -1.813  -64.507 -1.264  1.00 39.53  ? 821 HOH B O   1 
HETATM 8874 O O   . HOH O 8 .   ? -0.458  -67.389 -1.917  1.00 33.41  ? 822 HOH B O   1 
HETATM 8875 O O   . HOH O 8 .   ? -2.483  -53.431 -11.696 1.00 32.10  ? 823 HOH B O   1 
HETATM 8876 O O   . HOH O 8 .   ? -13.332 -76.920 -40.168 1.00 35.34  ? 824 HOH B O   1 
HETATM 8877 O O   . HOH O 8 .   ? 2.057   -85.296 -22.527 1.00 29.87  ? 825 HOH B O   1 
HETATM 8878 O O   . HOH O 8 .   ? 7.569   -72.732 -34.069 0.87 29.14  ? 826 HOH B O   1 
HETATM 8879 O O   . HOH O 8 .   ? 5.566   -51.203 -15.338 0.92 31.34  ? 827 HOH B O   1 
HETATM 8880 O O   . HOH O 8 .   ? 6.758   -70.971 -46.580 0.94 28.76  ? 828 HOH B O   1 
HETATM 8881 O O   . HOH O 8 .   ? -5.493  -74.818 -55.789 1.00 29.50  ? 829 HOH B O   1 
HETATM 8882 O O   . HOH O 8 .   ? 15.143  -60.500 -27.255 1.00 47.96  ? 830 HOH B O   1 
HETATM 8883 O O   . HOH O 8 .   ? 13.776  -69.608 -32.471 0.93 30.15  ? 831 HOH B O   1 
HETATM 8884 O O   . HOH O 8 .   ? -11.628 -71.124 -34.695 0.79 26.74  ? 832 HOH B O   1 
HETATM 8885 O O   . HOH O 8 .   ? 16.625  -85.754 -14.053 1.00 44.17  ? 833 HOH B O   1 
HETATM 8886 O O   . HOH O 8 .   ? 6.273   -64.839 -50.017 1.00 43.68  ? 834 HOH B O   1 
HETATM 8887 O O   . HOH O 8 .   ? 11.236  -57.799 -0.645  1.00 34.45  ? 835 HOH B O   1 
HETATM 8888 O O   . HOH O 8 .   ? 14.820  -67.086 -32.233 0.77 27.80  ? 836 HOH B O   1 
HETATM 8889 O O   . HOH O 8 .   ? 14.224  -54.201 -37.011 1.00 34.43  ? 837 HOH B O   1 
HETATM 8890 O O   . HOH O 8 .   ? -16.048 -78.162 -27.126 1.00 44.23  ? 838 HOH B O   1 
HETATM 8891 O O   . HOH O 8 .   ? -4.184  -44.662 -22.480 1.00 34.41  ? 839 HOH B O   1 
HETATM 8892 O O   . HOH O 8 .   ? 0.431   -60.724 -1.154  1.00 38.41  ? 840 HOH B O   1 
HETATM 8893 O O   . HOH O 8 .   ? 19.708  -44.878 -1.180  1.00 47.69  ? 841 HOH B O   1 
HETATM 8894 O O   . HOH O 8 .   ? -8.784  -36.259 -41.605 1.00 46.79  ? 842 HOH B O   1 
HETATM 8895 O O   . HOH O 8 .   ? 18.207  -51.351 -16.599 1.00 58.08  ? 843 HOH B O   1 
HETATM 8896 O O   . HOH O 8 .   ? 10.950  -77.517 -9.309  1.00 44.62  ? 844 HOH B O   1 
HETATM 8897 O O   . HOH O 8 .   ? 4.711   -50.764 -30.200 1.00 31.62  ? 845 HOH B O   1 
HETATM 8898 O O   . HOH O 8 .   ? 4.700   -60.198 -24.472 1.00 30.41  ? 846 HOH B O   1 
HETATM 8899 O O   . HOH O 8 .   ? 2.889   -48.913 -47.254 0.93 32.18  ? 847 HOH B O   1 
HETATM 8900 O O   . HOH O 8 .   ? 4.186   -51.369 -47.595 1.00 36.23  ? 848 HOH B O   1 
HETATM 8901 O O   . HOH O 8 .   ? 12.825  -56.914 -29.481 1.00 34.40  ? 849 HOH B O   1 
HETATM 8902 O O   . HOH O 8 .   ? 2.776   -56.241 -42.071 0.95 27.01  ? 850 HOH B O   1 
HETATM 8903 O O   . HOH O 8 .   ? 5.074   -56.002 -40.569 1.00 27.69  ? 851 HOH B O   1 
HETATM 8904 O O   . HOH O 8 .   ? 10.939  -56.577 1.711   0.99 35.55  ? 852 HOH B O   1 
HETATM 8905 O O   . HOH O 8 .   ? 4.990   -78.835 -29.119 0.88 31.73  ? 853 HOH B O   1 
HETATM 8906 O O   . HOH O 8 .   ? -5.162  -61.670 -5.622  1.00 30.93  ? 854 HOH B O   1 
HETATM 8907 O O   . HOH O 8 .   ? -7.111  -59.568 -6.435  1.00 38.82  ? 855 HOH B O   1 
HETATM 8908 O O   . HOH O 8 .   ? 11.611  -72.971 -35.233 0.98 33.86  ? 856 HOH B O   1 
HETATM 8909 O O   . HOH O 8 .   ? 2.215   -87.509 -18.084 1.00 44.45  ? 857 HOH B O   1 
HETATM 8910 O O   . HOH O 8 .   ? -6.823  -54.655 -13.629 1.00 37.39  ? 858 HOH B O   1 
HETATM 8911 O O   . HOH O 8 .   ? -13.141 -83.177 -30.800 1.00 47.51  ? 859 HOH B O   1 
HETATM 8912 O O   . HOH O 8 .   ? -9.475  -63.066 -7.355  1.00 38.78  ? 860 HOH B O   1 
HETATM 8913 O O   . HOH O 8 .   ? 19.844  -84.696 -25.240 1.00 37.77  ? 861 HOH B O   1 
HETATM 8914 O O   . HOH O 8 .   ? -8.344  -82.219 -48.480 1.00 35.10  ? 862 HOH B O   1 
HETATM 8915 O O   . HOH O 8 .   ? -6.708  -41.555 -24.034 1.00 33.34  ? 863 HOH B O   1 
HETATM 8916 O O   . HOH O 8 .   ? 15.322  -53.297 -34.862 1.00 42.55  ? 864 HOH B O   1 
HETATM 8917 O O   . HOH O 8 .   ? 3.451   -84.825 -51.070 1.00 49.64  ? 865 HOH B O   1 
HETATM 8918 O O   . HOH O 8 .   ? 7.036   -84.043 -12.416 1.00 38.71  ? 866 HOH B O   1 
HETATM 8919 O O   . HOH O 8 .   ? 11.244  -47.707 9.155   0.96 36.97  ? 867 HOH B O   1 
HETATM 8920 O O   . HOH O 8 .   ? 15.485  -71.320 -22.318 1.00 48.97  ? 868 HOH B O   1 
HETATM 8921 O O   . HOH O 8 .   ? -4.012  -56.050 3.901   1.00 33.97  ? 869 HOH B O   1 
HETATM 8922 O O   . HOH O 8 .   ? -6.457  -71.007 4.572   1.00 43.56  ? 870 HOH B O   1 
HETATM 8923 O O   . HOH O 8 .   ? 0.982   -61.840 -45.889 1.00 26.20  ? 871 HOH B O   1 
HETATM 8924 O O   . HOH O 8 .   ? -0.317  -63.792 -46.625 1.00 26.41  ? 872 HOH B O   1 
HETATM 8925 O O   . HOH O 8 .   ? -4.447  -36.314 -38.441 1.00 44.00  ? 873 HOH B O   1 
HETATM 8926 O O   . HOH O 8 .   ? 5.880   -87.474 -25.031 1.00 44.71  ? 874 HOH B O   1 
HETATM 8927 O O   . HOH O 8 .   ? 14.930  -71.534 -28.352 1.00 41.77  ? 875 HOH B O   1 
HETATM 8928 O O   . HOH O 8 .   ? -3.170  -82.024 -54.521 1.00 38.50  ? 876 HOH B O   1 
HETATM 8929 O O   . HOH O 8 .   ? -3.039  -80.876 -52.106 0.97 34.49  ? 877 HOH B O   1 
HETATM 8930 O O   . HOH O 8 .   ? -5.289  -81.790 -51.635 0.86 32.72  ? 878 HOH B O   1 
HETATM 8931 O O   . HOH O 8 .   ? -2.169  -34.954 -42.520 1.00 48.12  ? 879 HOH B O   1 
HETATM 8932 O O   . HOH O 8 .   ? 12.179  -71.862 -16.343 0.91 43.47  ? 880 HOH B O   1 
HETATM 8933 O O   . HOH O 8 .   ? -2.904  -88.167 -23.984 1.00 46.14  ? 881 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   2   ?   ?   ?   A . n 
A 1 2   ARG 2   3   ?   ?   ?   A . n 
A 1 3   GLU 3   4   4   GLU GLU A . n 
A 1 4   ASP 4   5   5   ASP ASP A . n 
A 1 5   ALA 5   6   6   ALA ALA A . n 
A 1 6   GLU 6   7   7   GLU GLU A . n 
A 1 7   LEU 7   8   8   LEU LEU A . n 
A 1 8   LEU 8   9   9   LEU LEU A . n 
A 1 9   VAL 9   10  10  VAL VAL A . n 
A 1 10  THR 10  11  11  THR THR A . n 
A 1 11  VAL 11  12  12  VAL VAL A . n 
A 1 12  ARG 12  13  13  ARG ARG A . n 
A 1 13  GLY 13  14  14  GLY GLY A . n 
A 1 14  GLY 14  15  15  GLY GLY A . n 
A 1 15  ARG 15  16  16  ARG ARG A . n 
A 1 16  LEU 16  17  17  LEU LEU A . n 
A 1 17  ARG 17  18  18  ARG ARG A . n 
A 1 18  GLY 18  19  19  GLY GLY A . n 
A 1 19  ILE 19  20  20  ILE ILE A . n 
A 1 20  ARG 20  21  21  ARG ARG A . n 
A 1 21  LEU 21  22  22  LEU LEU A . n 
A 1 22  LYS 22  23  23  LYS LYS A . n 
A 1 23  THR 23  24  24  THR THR A . n 
A 1 24  PRO 24  25  25  PRO PRO A . n 
A 1 25  GLY 25  26  26  GLY GLY A . n 
A 1 26  GLY 26  27  27  GLY GLY A . n 
A 1 27  PRO 27  28  28  PRO PRO A . n 
A 1 28  VAL 28  29  29  VAL VAL A . n 
A 1 29  SER 29  30  30  SER SER A . n 
A 1 30  ALA 30  31  31  ALA ALA A . n 
A 1 31  PHE 31  32  32  PHE PHE A . n 
A 1 32  LEU 32  33  33  LEU LEU A . n 
A 1 33  GLY 33  34  34  GLY GLY A . n 
A 1 34  ILE 34  35  35  ILE ILE A . n 
A 1 35  PRO 35  36  36  PRO PRO A . n 
A 1 36  PHE 36  37  37  PHE PHE A . n 
A 1 37  ALA 37  38  38  ALA ALA A . n 
A 1 38  GLU 38  39  39  GLU GLU A . n 
A 1 39  PRO 39  40  40  PRO PRO A . n 
A 1 40  PRO 40  41  41  PRO PRO A . n 
A 1 41  MET 41  42  42  MET MET A . n 
A 1 42  GLY 42  43  43  GLY GLY A . n 
A 1 43  PRO 43  44  44  PRO PRO A . n 
A 1 44  ARG 44  45  45  ARG ARG A . n 
A 1 45  ARG 45  46  46  ARG ARG A . n 
A 1 46  PHE 46  47  47  PHE PHE A . n 
A 1 47  LEU 47  48  48  LEU LEU A . n 
A 1 48  PRO 48  49  49  PRO PRO A . n 
A 1 49  PRO 49  50  50  PRO PRO A . n 
A 1 50  GLU 50  51  51  GLU GLU A . n 
A 1 51  PRO 51  52  52  PRO PRO A . n 
A 1 52  LYS 52  53  53  LYS LYS A . n 
A 1 53  GLN 53  54  54  GLN GLN A . n 
A 1 54  PRO 54  55  55  PRO PRO A . n 
A 1 55  TRP 55  56  56  TRP TRP A . n 
A 1 56  SER 56  57  57  SER SER A . n 
A 1 57  GLY 57  58  58  GLY GLY A . n 
A 1 58  VAL 58  59  59  VAL VAL A . n 
A 1 59  VAL 59  60  60  VAL VAL A . n 
A 1 60  ASP 60  61  61  ASP ASP A . n 
A 1 61  ALA 61  62  62  ALA ALA A . n 
A 1 62  THR 62  63  63  THR THR A . n 
A 1 63  THR 63  64  64  THR THR A . n 
A 1 64  PHE 64  65  65  PHE PHE A . n 
A 1 65  GLN 65  66  66  GLN GLN A . n 
A 1 66  SER 66  67  67  SER SER A . n 
A 1 67  VAL 67  68  68  VAL VAL A . n 
A 1 68  CYS 68  69  69  CYS CYS A . n 
A 1 69  TYR 69  70  70  TYR TYR A . n 
A 1 70  GLN 70  71  71  GLN GLN A . n 
A 1 71  TYR 71  72  72  TYR TYR A . n 
A 1 72  VAL 72  73  73  VAL VAL A . n 
A 1 73  ASP 73  74  74  ASP ASP A . n 
A 1 74  THR 74  75  75  THR THR A . n 
A 1 75  LEU 75  76  76  LEU LEU A . n 
A 1 76  TYR 76  77  77  TYR TYR A . n 
A 1 77  PRO 77  78  78  PRO PRO A . n 
A 1 78  GLY 78  79  79  GLY GLY A . n 
A 1 79  PHE 79  80  80  PHE PHE A . n 
A 1 80  GLU 80  81  81  GLU GLU A . n 
A 1 81  GLY 81  82  82  GLY GLY A . n 
A 1 82  THR 82  83  83  THR THR A . n 
A 1 83  GLU 83  84  84  GLU GLU A . n 
A 1 84  MET 84  85  85  MET MET A . n 
A 1 85  TRP 85  86  86  TRP TRP A . n 
A 1 86  ASN 86  87  87  ASN ASN A . n 
A 1 87  PRO 87  88  88  PRO PRO A . n 
A 1 88  ASN 88  89  89  ASN ASN A . n 
A 1 89  ARG 89  90  90  ARG ARG A . n 
A 1 90  GLU 90  91  91  GLU GLU A . n 
A 1 91  LEU 91  92  92  LEU LEU A . n 
A 1 92  SER 92  93  93  SER SER A . n 
A 1 93  GLU 93  94  94  GLU GLU A . n 
A 1 94  ASP 94  95  95  ASP ASP A . n 
A 1 95  CYS 95  96  96  CYS CYS A . n 
A 1 96  LEU 96  97  97  LEU LEU A . n 
A 1 97  TYR 97  98  98  TYR TYR A . n 
A 1 98  LEU 98  99  99  LEU LEU A . n 
A 1 99  ASN 99  100 100 ASN ASN A . n 
A 1 100 VAL 100 101 101 VAL VAL A . n 
A 1 101 TRP 101 102 102 TRP TRP A . n 
A 1 102 THR 102 103 103 THR THR A . n 
A 1 103 PRO 103 104 104 PRO PRO A . n 
A 1 104 TYR 104 105 105 TYR TYR A . n 
A 1 105 PRO 105 106 106 PRO PRO A . n 
A 1 106 ARG 106 107 107 ARG ARG A . n 
A 1 107 PRO 107 108 108 PRO PRO A . n 
A 1 108 THR 108 109 109 THR THR A . n 
A 1 109 SER 109 110 110 SER SER A . n 
A 1 110 PRO 110 111 111 PRO PRO A . n 
A 1 111 THR 111 112 112 THR THR A . n 
A 1 112 PRO 112 113 113 PRO PRO A . n 
A 1 113 VAL 113 114 114 VAL VAL A . n 
A 1 114 LEU 114 115 115 LEU LEU A . n 
A 1 115 VAL 115 116 116 VAL VAL A . n 
A 1 116 TRP 116 117 117 TRP TRP A . n 
A 1 117 ILE 117 118 118 ILE ILE A . n 
A 1 118 TYR 118 119 119 TYR TYR A . n 
A 1 119 GLY 119 120 120 GLY GLY A . n 
A 1 120 GLY 120 121 121 GLY GLY A . n 
A 1 121 GLY 121 122 122 GLY GLY A . n 
A 1 122 PHE 122 123 123 PHE PHE A . n 
A 1 123 TYR 123 124 124 TYR TYR A . n 
A 1 124 SER 124 125 125 SER SER A . n 
A 1 125 GLY 125 126 126 GLY GLY A . n 
A 1 126 ALA 126 127 127 ALA ALA A . n 
A 1 127 SER 127 128 128 SER SER A . n 
A 1 128 SER 128 129 129 SER SER A . n 
A 1 129 LEU 129 130 130 LEU LEU A . n 
A 1 130 ASP 130 131 131 ASP ASP A . n 
A 1 131 VAL 131 132 132 VAL VAL A . n 
A 1 132 TYR 132 133 133 TYR TYR A . n 
A 1 133 ASP 133 134 134 ASP ASP A . n 
A 1 134 GLY 134 135 135 GLY GLY A . n 
A 1 135 ARG 135 136 136 ARG ARG A . n 
A 1 136 PHE 136 137 137 PHE PHE A . n 
A 1 137 LEU 137 138 138 LEU LEU A . n 
A 1 138 VAL 138 139 139 VAL VAL A . n 
A 1 139 GLN 139 140 140 GLN GLN A . n 
A 1 140 ALA 140 141 141 ALA ALA A . n 
A 1 141 GLU 141 142 142 GLU GLU A . n 
A 1 142 ARG 142 143 143 ARG ARG A . n 
A 1 143 THR 143 144 144 THR THR A . n 
A 1 144 VAL 144 145 145 VAL VAL A . n 
A 1 145 LEU 145 146 146 LEU LEU A . n 
A 1 146 VAL 146 147 147 VAL VAL A . n 
A 1 147 SER 147 148 148 SER SER A . n 
A 1 148 MET 148 149 149 MET MET A . n 
A 1 149 ASN 149 150 150 ASN ASN A . n 
A 1 150 TYR 150 151 151 TYR TYR A . n 
A 1 151 ARG 151 152 152 ARG ARG A . n 
A 1 152 VAL 152 153 153 VAL VAL A . n 
A 1 153 GLY 153 154 154 GLY GLY A . n 
A 1 154 ALA 154 155 155 ALA ALA A . n 
A 1 155 PHE 155 156 156 PHE PHE A . n 
A 1 156 GLY 156 157 157 GLY GLY A . n 
A 1 157 PHE 157 158 158 PHE PHE A . n 
A 1 158 LEU 158 159 159 LEU LEU A . n 
A 1 159 ALA 159 160 160 ALA ALA A . n 
A 1 160 LEU 160 161 161 LEU LEU A . n 
A 1 161 PRO 161 162 162 PRO PRO A . n 
A 1 162 GLY 162 163 163 GLY GLY A . n 
A 1 163 SER 163 164 164 SER SER A . n 
A 1 164 ARG 164 165 165 ARG ARG A . n 
A 1 165 GLU 165 166 166 GLU GLU A . n 
A 1 166 ALA 166 167 167 ALA ALA A . n 
A 1 167 PRO 167 168 168 PRO PRO A . n 
A 1 168 GLY 168 169 169 GLY GLY A . n 
A 1 169 ASN 169 170 170 ASN ASN A . n 
A 1 170 VAL 170 171 171 VAL VAL A . n 
A 1 171 GLY 171 172 172 GLY GLY A . n 
A 1 172 LEU 172 173 173 LEU LEU A . n 
A 1 173 LEU 173 174 174 LEU LEU A . n 
A 1 174 ASP 174 175 175 ASP ASP A . n 
A 1 175 GLN 175 176 176 GLN GLN A . n 
A 1 176 ARG 176 177 177 ARG ARG A . n 
A 1 177 LEU 177 178 178 LEU LEU A . n 
A 1 178 ALA 178 179 179 ALA ALA A . n 
A 1 179 LEU 179 180 180 LEU LEU A . n 
A 1 180 GLN 180 181 181 GLN GLN A . n 
A 1 181 TRP 181 182 182 TRP TRP A . n 
A 1 182 VAL 182 183 183 VAL VAL A . n 
A 1 183 GLN 183 184 184 GLN GLN A . n 
A 1 184 GLU 184 185 185 GLU GLU A . n 
A 1 185 ASN 185 186 186 ASN ASN A . n 
A 1 186 VAL 186 187 187 VAL VAL A . n 
A 1 187 ALA 187 188 188 ALA ALA A . n 
A 1 188 ALA 188 189 189 ALA ALA A . n 
A 1 189 PHE 189 190 190 PHE PHE A . n 
A 1 190 GLY 190 191 191 GLY GLY A . n 
A 1 191 GLY 191 192 192 GLY GLY A . n 
A 1 192 ASP 192 193 193 ASP ASP A . n 
A 1 193 PRO 193 194 194 PRO PRO A . n 
A 1 194 THR 194 195 195 THR THR A . n 
A 1 195 SER 195 196 196 SER SER A . n 
A 1 196 VAL 196 197 197 VAL VAL A . n 
A 1 197 THR 197 198 198 THR THR A . n 
A 1 198 LEU 198 199 199 LEU LEU A . n 
A 1 199 PHE 199 200 200 PHE PHE A . n 
A 1 200 GLY 200 201 201 GLY GLY A . n 
A 1 201 GLU 201 202 202 GLU GLU A . n 
A 1 202 SER 202 203 203 SER SER A . n 
A 1 203 ALA 203 204 204 ALA ALA A . n 
A 1 204 GLY 204 205 205 GLY GLY A . n 
A 1 205 ALA 205 206 206 ALA ALA A . n 
A 1 206 ALA 206 207 207 ALA ALA A . n 
A 1 207 SER 207 208 208 SER SER A . n 
A 1 208 VAL 208 209 209 VAL VAL A . n 
A 1 209 GLY 209 210 210 GLY GLY A . n 
A 1 210 MET 210 211 211 MET MET A . n 
A 1 211 HIS 211 212 212 HIS HIS A . n 
A 1 212 LEU 212 213 213 LEU LEU A . n 
A 1 213 LEU 213 214 214 LEU LEU A . n 
A 1 214 SER 214 215 215 SER SER A . n 
A 1 215 PRO 215 216 216 PRO PRO A . n 
A 1 216 PRO 216 217 217 PRO PRO A . n 
A 1 217 SER 217 218 218 SER SER A . n 
A 1 218 ARG 218 219 219 ARG ARG A . n 
A 1 219 GLY 219 220 220 GLY GLY A . n 
A 1 220 LEU 220 221 221 LEU LEU A . n 
A 1 221 PHE 221 222 222 PHE PHE A . n 
A 1 222 HIS 222 223 223 HIS HIS A . n 
A 1 223 ARG 223 224 224 ARG ARG A . n 
A 1 224 ALA 224 225 225 ALA ALA A . n 
A 1 225 VAL 225 226 226 VAL VAL A . n 
A 1 226 LEU 226 227 227 LEU LEU A . n 
A 1 227 GLN 227 228 228 GLN GLN A . n 
A 1 228 SER 228 229 229 SER SER A . n 
A 1 229 GLY 229 230 230 GLY GLY A . n 
A 1 230 ALA 230 231 231 ALA ALA A . n 
A 1 231 PRO 231 232 232 PRO PRO A . n 
A 1 232 ASN 232 233 233 ASN ASN A . n 
A 1 233 GLY 233 234 234 GLY GLY A . n 
A 1 234 PRO 234 235 235 PRO PRO A . n 
A 1 235 TRP 235 236 236 TRP TRP A . n 
A 1 236 ALA 236 237 237 ALA ALA A . n 
A 1 237 THR 237 238 238 THR THR A . n 
A 1 238 VAL 238 239 239 VAL VAL A . n 
A 1 239 GLY 239 240 240 GLY GLY A . n 
A 1 240 MET 240 241 241 MET MET A . n 
A 1 241 GLY 241 242 242 GLY GLY A . n 
A 1 242 GLU 242 243 243 GLU GLU A . n 
A 1 243 ALA 243 244 244 ALA ALA A . n 
A 1 244 ARG 244 245 245 ARG ARG A . n 
A 1 245 ARG 245 246 246 ARG ARG A . n 
A 1 246 ARG 246 247 247 ARG ARG A . n 
A 1 247 ALA 247 248 248 ALA ALA A . n 
A 1 248 THR 248 249 249 THR THR A . n 
A 1 249 GLN 249 250 250 GLN GLN A . n 
A 1 250 LEU 250 251 251 LEU LEU A . n 
A 1 251 ALA 251 252 252 ALA ALA A . n 
A 1 252 HIS 252 253 253 HIS HIS A . n 
A 1 253 LEU 253 254 254 LEU LEU A . n 
A 1 254 VAL 254 255 255 VAL VAL A . n 
A 1 255 GLY 255 256 256 GLY GLY A . n 
A 1 256 CYS 256 257 257 CYS CYS A . n 
A 1 257 PRO 257 258 258 PRO PRO A . n 
A 1 258 PRO 258 259 ?   ?   ?   A . n 
A 1 259 GLY 259 260 ?   ?   ?   A . n 
A 1 260 GLY 260 261 ?   ?   ?   A . n 
A 1 261 THR 261 262 ?   ?   ?   A . n 
A 1 262 GLY 262 263 ?   ?   ?   A . n 
A 1 263 GLY 263 264 ?   ?   ?   A . n 
A 1 264 ASN 264 265 265 ASN ASN A . n 
A 1 265 ASP 265 266 266 ASP ASP A . n 
A 1 266 THR 266 267 267 THR THR A . n 
A 1 267 GLU 267 268 268 GLU GLU A . n 
A 1 268 LEU 268 269 269 LEU LEU A . n 
A 1 269 VAL 269 270 270 VAL VAL A . n 
A 1 270 ALA 270 271 271 ALA ALA A . n 
A 1 271 CYS 271 272 272 CYS CYS A . n 
A 1 272 LEU 272 273 273 LEU LEU A . n 
A 1 273 ARG 273 274 274 ARG ARG A . n 
A 1 274 THR 274 275 275 THR THR A . n 
A 1 275 ARG 275 276 276 ARG ARG A . n 
A 1 276 PRO 276 277 277 PRO PRO A . n 
A 1 277 ALA 277 278 278 ALA ALA A . n 
A 1 278 GLN 278 279 279 GLN GLN A . n 
A 1 279 VAL 279 280 280 VAL VAL A . n 
A 1 280 LEU 280 281 281 LEU LEU A . n 
A 1 281 VAL 281 282 282 VAL VAL A . n 
A 1 282 ASN 282 283 283 ASN ASN A . n 
A 1 283 HIS 283 284 284 HIS HIS A . n 
A 1 284 GLU 284 285 285 GLU GLU A . n 
A 1 285 TRP 285 286 286 TRP TRP A . n 
A 1 286 HIS 286 287 287 HIS HIS A . n 
A 1 287 VAL 287 288 288 VAL VAL A . n 
A 1 288 LEU 288 289 289 LEU LEU A . n 
A 1 289 PRO 289 290 290 PRO PRO A . n 
A 1 290 GLN 290 291 291 GLN GLN A . n 
A 1 291 GLU 291 292 292 GLU GLU A . n 
A 1 292 SER 292 293 293 SER SER A . n 
A 1 293 VAL 293 294 294 VAL VAL A . n 
A 1 294 PHE 294 295 295 PHE PHE A . n 
A 1 295 ARG 295 296 296 ARG ARG A . n 
A 1 296 PHE 296 297 297 PHE PHE A . n 
A 1 297 SER 297 298 298 SER SER A . n 
A 1 298 PHE 298 299 299 PHE PHE A . n 
A 1 299 VAL 299 300 300 VAL VAL A . n 
A 1 300 PRO 300 301 301 PRO PRO A . n 
A 1 301 VAL 301 302 302 VAL VAL A . n 
A 1 302 VAL 302 303 303 VAL VAL A . n 
A 1 303 ASP 303 304 304 ASP ASP A . n 
A 1 304 GLY 304 305 305 GLY GLY A . n 
A 1 305 ASP 305 306 306 ASP ASP A . n 
A 1 306 PHE 306 307 307 PHE PHE A . n 
A 1 307 LEU 307 308 308 LEU LEU A . n 
A 1 308 SER 308 309 309 SER SER A . n 
A 1 309 ASP 309 310 310 ASP ASP A . n 
A 1 310 THR 310 311 311 THR THR A . n 
A 1 311 PRO 311 312 312 PRO PRO A . n 
A 1 312 GLU 312 313 313 GLU GLU A . n 
A 1 313 ALA 313 314 314 ALA ALA A . n 
A 1 314 LEU 314 315 315 LEU LEU A . n 
A 1 315 ILE 315 316 316 ILE ILE A . n 
A 1 316 ASN 316 317 317 ASN ASN A . n 
A 1 317 ALA 317 318 318 ALA ALA A . n 
A 1 318 GLY 318 319 319 GLY GLY A . n 
A 1 319 ASP 319 320 320 ASP ASP A . n 
A 1 320 PHE 320 321 321 PHE PHE A . n 
A 1 321 HIS 321 322 322 HIS HIS A . n 
A 1 322 GLY 322 323 323 GLY GLY A . n 
A 1 323 LEU 323 324 324 LEU LEU A . n 
A 1 324 GLN 324 325 325 GLN GLN A . n 
A 1 325 VAL 325 326 326 VAL VAL A . n 
A 1 326 LEU 326 327 327 LEU LEU A . n 
A 1 327 VAL 327 328 328 VAL VAL A . n 
A 1 328 GLY 328 329 329 GLY GLY A . n 
A 1 329 VAL 329 330 330 VAL VAL A . n 
A 1 330 VAL 330 331 331 VAL VAL A . n 
A 1 331 LYS 331 332 332 LYS LYS A . n 
A 1 332 ASP 332 333 333 ASP ASP A . n 
A 1 333 GLU 333 334 334 GLU GLU A . n 
A 1 334 GLY 334 335 335 GLY GLY A . n 
A 1 335 SER 335 336 336 SER SER A . n 
A 1 336 TYR 336 337 337 TYR TYR A . n 
A 1 337 PHE 337 338 338 PHE PHE A . n 
A 1 338 LEU 338 339 339 LEU LEU A . n 
A 1 339 VAL 339 340 340 VAL VAL A . n 
A 1 340 TYR 340 341 341 TYR TYR A . n 
A 1 341 GLY 341 342 342 GLY GLY A . n 
A 1 342 ALA 342 343 343 ALA ALA A . n 
A 1 343 PRO 343 344 344 PRO PRO A . n 
A 1 344 GLY 344 345 345 GLY GLY A . n 
A 1 345 PHE 345 346 346 PHE PHE A . n 
A 1 346 SER 346 347 347 SER SER A . n 
A 1 347 LYS 347 348 348 LYS LYS A . n 
A 1 348 ASP 348 349 349 ASP ASP A . n 
A 1 349 ASN 349 350 350 ASN ASN A . n 
A 1 350 GLU 350 351 351 GLU GLU A . n 
A 1 351 SER 351 352 352 SER SER A . n 
A 1 352 LEU 352 353 353 LEU LEU A . n 
A 1 353 ILE 353 354 354 ILE ILE A . n 
A 1 354 SER 354 355 355 SER SER A . n 
A 1 355 ARG 355 356 356 ARG ARG A . n 
A 1 356 ALA 356 357 357 ALA ALA A . n 
A 1 357 GLU 357 358 358 GLU GLU A . n 
A 1 358 PHE 358 359 359 PHE PHE A . n 
A 1 359 LEU 359 360 360 LEU LEU A . n 
A 1 360 ALA 360 361 361 ALA ALA A . n 
A 1 361 GLY 361 362 362 GLY GLY A . n 
A 1 362 VAL 362 363 363 VAL VAL A . n 
A 1 363 ARG 363 364 364 ARG ARG A . n 
A 1 364 VAL 364 365 365 VAL VAL A . n 
A 1 365 GLY 365 366 366 GLY GLY A . n 
A 1 366 VAL 366 367 367 VAL VAL A . n 
A 1 367 PRO 367 368 368 PRO PRO A . n 
A 1 368 GLN 368 369 369 GLN GLN A . n 
A 1 369 VAL 369 370 370 VAL VAL A . n 
A 1 370 SER 370 371 371 SER SER A . n 
A 1 371 ASP 371 372 372 ASP ASP A . n 
A 1 372 LEU 372 373 373 LEU LEU A . n 
A 1 373 ALA 373 374 374 ALA ALA A . n 
A 1 374 ALA 374 375 375 ALA ALA A . n 
A 1 375 GLU 375 376 376 GLU GLU A . n 
A 1 376 ALA 376 377 377 ALA ALA A . n 
A 1 377 VAL 377 378 378 VAL VAL A . n 
A 1 378 VAL 378 379 379 VAL VAL A . n 
A 1 379 LEU 379 380 380 LEU LEU A . n 
A 1 380 HIS 380 381 381 HIS HIS A . n 
A 1 381 TYR 381 382 382 TYR TYR A . n 
A 1 382 THR 382 383 383 THR THR A . n 
A 1 383 ASP 383 384 384 ASP ASP A . n 
A 1 384 TRP 384 385 385 TRP TRP A . n 
A 1 385 LEU 385 386 386 LEU LEU A . n 
A 1 386 HIS 386 387 387 HIS HIS A . n 
A 1 387 PRO 387 388 388 PRO PRO A . n 
A 1 388 GLU 388 389 389 GLU GLU A . n 
A 1 389 ASP 389 390 390 ASP ASP A . n 
A 1 390 PRO 390 391 391 PRO PRO A . n 
A 1 391 ALA 391 392 392 ALA ALA A . n 
A 1 392 ARG 392 393 393 ARG ARG A . n 
A 1 393 LEU 393 394 394 LEU LEU A . n 
A 1 394 ARG 394 395 395 ARG ARG A . n 
A 1 395 GLU 395 396 396 GLU GLU A . n 
A 1 396 ALA 396 397 397 ALA ALA A . n 
A 1 397 LEU 397 398 398 LEU LEU A . n 
A 1 398 SER 398 399 399 SER SER A . n 
A 1 399 ASP 399 400 400 ASP ASP A . n 
A 1 400 VAL 400 401 401 VAL VAL A . n 
A 1 401 VAL 401 402 402 VAL VAL A . n 
A 1 402 GLY 402 403 403 GLY GLY A . n 
A 1 403 ASP 403 404 404 ASP ASP A . n 
A 1 404 HIS 404 405 405 HIS HIS A . n 
A 1 405 ASN 405 406 406 ASN ASN A . n 
A 1 406 VAL 406 407 407 VAL VAL A . n 
A 1 407 VAL 407 408 408 VAL VAL A . n 
A 1 408 CYS 408 409 409 CYS CYS A . n 
A 1 409 PRO 409 410 410 PRO PRO A . n 
A 1 410 VAL 410 411 411 VAL VAL A . n 
A 1 411 ALA 411 412 412 ALA ALA A . n 
A 1 412 GLN 412 413 413 GLN GLN A . n 
A 1 413 LEU 413 414 414 LEU LEU A . n 
A 1 414 ALA 414 415 415 ALA ALA A . n 
A 1 415 GLY 415 416 416 GLY GLY A . n 
A 1 416 ARG 416 417 417 ARG ARG A . n 
A 1 417 LEU 417 418 418 LEU LEU A . n 
A 1 418 ALA 418 419 419 ALA ALA A . n 
A 1 419 ALA 419 420 420 ALA ALA A . n 
A 1 420 GLN 420 421 421 GLN GLN A . n 
A 1 421 GLY 421 422 422 GLY GLY A . n 
A 1 422 ALA 422 423 423 ALA ALA A . n 
A 1 423 ARG 423 424 424 ARG ARG A . n 
A 1 424 VAL 424 425 425 VAL VAL A . n 
A 1 425 TYR 425 426 426 TYR TYR A . n 
A 1 426 ALA 426 427 427 ALA ALA A . n 
A 1 427 TYR 427 428 428 TYR TYR A . n 
A 1 428 VAL 428 429 429 VAL VAL A . n 
A 1 429 PHE 429 430 430 PHE PHE A . n 
A 1 430 GLU 430 431 431 GLU GLU A . n 
A 1 431 HIS 431 432 432 HIS HIS A . n 
A 1 432 ARG 432 433 433 ARG ARG A . n 
A 1 433 ALA 433 434 434 ALA ALA A . n 
A 1 434 SER 434 435 435 SER SER A . n 
A 1 435 THR 435 436 436 THR THR A . n 
A 1 436 LEU 436 437 437 LEU LEU A . n 
A 1 437 SER 437 438 438 SER SER A . n 
A 1 438 TRP 438 439 439 TRP TRP A . n 
A 1 439 PRO 439 440 440 PRO PRO A . n 
A 1 440 LEU 440 441 441 LEU LEU A . n 
A 1 441 TRP 441 442 442 TRP TRP A . n 
A 1 442 MET 442 443 443 MET MET A . n 
A 1 443 GLY 443 444 444 GLY GLY A . n 
A 1 444 VAL 444 445 445 VAL VAL A . n 
A 1 445 PRO 445 446 446 PRO PRO A . n 
A 1 446 HIS 446 447 447 HIS HIS A . n 
A 1 447 GLY 447 448 448 GLY GLY A . n 
A 1 448 TYR 448 449 449 TYR TYR A . n 
A 1 449 GLU 449 450 450 GLU GLU A . n 
A 1 450 ILE 450 451 451 ILE ILE A . n 
A 1 451 GLU 451 452 452 GLU GLU A . n 
A 1 452 PHE 452 453 453 PHE PHE A . n 
A 1 453 ILE 453 454 454 ILE ILE A . n 
A 1 454 PHE 454 455 455 PHE PHE A . n 
A 1 455 GLY 455 456 456 GLY GLY A . n 
A 1 456 ILE 456 457 457 ILE ILE A . n 
A 1 457 PRO 457 458 458 PRO PRO A . n 
A 1 458 LEU 458 459 459 LEU LEU A . n 
A 1 459 ASP 459 460 460 ASP ASP A . n 
A 1 460 PRO 460 461 461 PRO PRO A . n 
A 1 461 SER 461 462 462 SER SER A . n 
A 1 462 ARG 462 463 463 ARG ARG A . n 
A 1 463 ASN 463 464 464 ASN ASN A . n 
A 1 464 TYR 464 465 465 TYR TYR A . n 
A 1 465 THR 465 466 466 THR THR A . n 
A 1 466 ALA 466 467 467 ALA ALA A . n 
A 1 467 GLU 467 468 468 GLU GLU A . n 
A 1 468 GLU 468 469 469 GLU GLU A . n 
A 1 469 LYS 469 470 470 LYS LYS A . n 
A 1 470 ILE 470 471 471 ILE ILE A . n 
A 1 471 PHE 471 472 472 PHE PHE A . n 
A 1 472 ALA 472 473 473 ALA ALA A . n 
A 1 473 GLN 473 474 474 GLN GLN A . n 
A 1 474 ARG 474 475 475 ARG ARG A . n 
A 1 475 LEU 475 476 476 LEU LEU A . n 
A 1 476 MET 476 477 477 MET MET A . n 
A 1 477 ARG 477 478 478 ARG ARG A . n 
A 1 478 TYR 478 479 479 TYR TYR A . n 
A 1 479 TRP 479 480 480 TRP TRP A . n 
A 1 480 ALA 480 481 481 ALA ALA A . n 
A 1 481 ASN 481 482 482 ASN ASN A . n 
A 1 482 PHE 482 483 483 PHE PHE A . n 
A 1 483 ALA 483 484 484 ALA ALA A . n 
A 1 484 ARG 484 485 485 ARG ARG A . n 
A 1 485 THR 485 486 486 THR THR A . n 
A 1 486 GLY 486 487 487 GLY GLY A . n 
A 1 487 ASP 487 488 488 ASP ASP A . n 
A 1 488 PRO 488 489 489 PRO PRO A . n 
A 1 489 ASN 489 490 490 ASN ASN A . n 
A 1 490 GLU 490 491 491 GLU GLU A . n 
A 1 491 PRO 491 492 492 PRO PRO A . n 
A 1 492 ARG 492 493 493 ARG ARG A . n 
A 1 493 ASP 493 494 494 ASP ASP A . n 
A 1 494 PRO 494 495 ?   ?   ?   A . n 
A 1 495 LYS 495 496 ?   ?   ?   A . n 
A 1 496 ALA 496 497 ?   ?   ?   A . n 
A 1 497 PRO 497 498 498 PRO PRO A . n 
A 1 498 GLN 498 499 499 GLN GLN A . n 
A 1 499 TRP 499 500 500 TRP TRP A . n 
A 1 500 PRO 500 501 501 PRO PRO A . n 
A 1 501 PRO 501 502 502 PRO PRO A . n 
A 1 502 TYR 502 503 503 TYR TYR A . n 
A 1 503 THR 503 504 504 THR THR A . n 
A 1 504 ALA 504 505 505 ALA ALA A . n 
A 1 505 GLY 505 506 506 GLY GLY A . n 
A 1 506 ALA 506 507 507 ALA ALA A . n 
A 1 507 GLN 507 508 508 GLN GLN A . n 
A 1 508 GLN 508 509 509 GLN GLN A . n 
A 1 509 TYR 509 510 510 TYR TYR A . n 
A 1 510 VAL 510 511 511 VAL VAL A . n 
A 1 511 SER 511 512 512 SER SER A . n 
A 1 512 LEU 512 513 513 LEU LEU A . n 
A 1 513 ASP 513 514 514 ASP ASP A . n 
A 1 514 LEU 514 515 515 LEU LEU A . n 
A 1 515 ARG 515 516 516 ARG ARG A . n 
A 1 516 PRO 516 517 517 PRO PRO A . n 
A 1 517 LEU 517 518 518 LEU LEU A . n 
A 1 518 GLU 518 519 519 GLU GLU A . n 
A 1 519 VAL 519 520 520 VAL VAL A . n 
A 1 520 ARG 520 521 521 ARG ARG A . n 
A 1 521 ARG 521 522 522 ARG ARG A . n 
A 1 522 GLY 522 523 523 GLY GLY A . n 
A 1 523 LEU 523 524 524 LEU LEU A . n 
A 1 524 ARG 524 525 525 ARG ARG A . n 
A 1 525 ALA 525 526 526 ALA ALA A . n 
A 1 526 GLN 526 527 527 GLN GLN A . n 
A 1 527 ALA 527 528 528 ALA ALA A . n 
A 1 528 CYS 528 529 529 CYS CYS A . n 
A 1 529 ALA 529 530 530 ALA ALA A . n 
A 1 530 PHE 530 531 531 PHE PHE A . n 
A 1 531 TRP 531 532 532 TRP TRP A . n 
A 1 532 ASN 532 533 533 ASN ASN A . n 
A 1 533 ARG 533 534 534 ARG ARG A . n 
A 1 534 PHE 534 535 535 PHE PHE A . n 
A 1 535 LEU 535 536 536 LEU LEU A . n 
A 1 536 PRO 536 537 537 PRO PRO A . n 
A 1 537 LYS 537 538 538 LYS LYS A . n 
A 1 538 LEU 538 539 539 LEU LEU A . n 
A 1 539 LEU 539 540 540 LEU LEU A . n 
A 1 540 SER 540 541 541 SER SER A . n 
A 1 541 ALA 541 542 542 ALA ALA A . n 
A 1 542 THR 542 543 ?   ?   ?   A . n 
B 1 1   GLY 1   2   ?   ?   ?   B . n 
B 1 2   ARG 2   3   ?   ?   ?   B . n 
B 1 3   GLU 3   4   4   GLU GLU B . n 
B 1 4   ASP 4   5   5   ASP ASP B . n 
B 1 5   ALA 5   6   6   ALA ALA B . n 
B 1 6   GLU 6   7   7   GLU GLU B . n 
B 1 7   LEU 7   8   8   LEU LEU B . n 
B 1 8   LEU 8   9   9   LEU LEU B . n 
B 1 9   VAL 9   10  10  VAL VAL B . n 
B 1 10  THR 10  11  11  THR THR B . n 
B 1 11  VAL 11  12  12  VAL VAL B . n 
B 1 12  ARG 12  13  13  ARG ARG B . n 
B 1 13  GLY 13  14  14  GLY GLY B . n 
B 1 14  GLY 14  15  15  GLY GLY B . n 
B 1 15  ARG 15  16  16  ARG ARG B . n 
B 1 16  LEU 16  17  17  LEU LEU B . n 
B 1 17  ARG 17  18  18  ARG ARG B . n 
B 1 18  GLY 18  19  19  GLY GLY B . n 
B 1 19  ILE 19  20  20  ILE ILE B . n 
B 1 20  ARG 20  21  21  ARG ARG B . n 
B 1 21  LEU 21  22  22  LEU LEU B . n 
B 1 22  LYS 22  23  23  LYS LYS B . n 
B 1 23  THR 23  24  24  THR THR B . n 
B 1 24  PRO 24  25  25  PRO PRO B . n 
B 1 25  GLY 25  26  26  GLY GLY B . n 
B 1 26  GLY 26  27  27  GLY GLY B . n 
B 1 27  PRO 27  28  28  PRO PRO B . n 
B 1 28  VAL 28  29  29  VAL VAL B . n 
B 1 29  SER 29  30  30  SER SER B . n 
B 1 30  ALA 30  31  31  ALA ALA B . n 
B 1 31  PHE 31  32  32  PHE PHE B . n 
B 1 32  LEU 32  33  33  LEU LEU B . n 
B 1 33  GLY 33  34  34  GLY GLY B . n 
B 1 34  ILE 34  35  35  ILE ILE B . n 
B 1 35  PRO 35  36  36  PRO PRO B . n 
B 1 36  PHE 36  37  37  PHE PHE B . n 
B 1 37  ALA 37  38  38  ALA ALA B . n 
B 1 38  GLU 38  39  39  GLU GLU B . n 
B 1 39  PRO 39  40  40  PRO PRO B . n 
B 1 40  PRO 40  41  41  PRO PRO B . n 
B 1 41  MET 41  42  42  MET MET B . n 
B 1 42  GLY 42  43  43  GLY GLY B . n 
B 1 43  PRO 43  44  44  PRO PRO B . n 
B 1 44  ARG 44  45  45  ARG ARG B . n 
B 1 45  ARG 45  46  46  ARG ARG B . n 
B 1 46  PHE 46  47  47  PHE PHE B . n 
B 1 47  LEU 47  48  48  LEU LEU B . n 
B 1 48  PRO 48  49  49  PRO PRO B . n 
B 1 49  PRO 49  50  50  PRO PRO B . n 
B 1 50  GLU 50  51  51  GLU GLU B . n 
B 1 51  PRO 51  52  52  PRO PRO B . n 
B 1 52  LYS 52  53  53  LYS LYS B . n 
B 1 53  GLN 53  54  54  GLN GLN B . n 
B 1 54  PRO 54  55  55  PRO PRO B . n 
B 1 55  TRP 55  56  56  TRP TRP B . n 
B 1 56  SER 56  57  57  SER SER B . n 
B 1 57  GLY 57  58  58  GLY GLY B . n 
B 1 58  VAL 58  59  59  VAL VAL B . n 
B 1 59  VAL 59  60  60  VAL VAL B . n 
B 1 60  ASP 60  61  61  ASP ASP B . n 
B 1 61  ALA 61  62  62  ALA ALA B . n 
B 1 62  THR 62  63  63  THR THR B . n 
B 1 63  THR 63  64  64  THR THR B . n 
B 1 64  PHE 64  65  65  PHE PHE B . n 
B 1 65  GLN 65  66  66  GLN GLN B . n 
B 1 66  SER 66  67  67  SER SER B . n 
B 1 67  VAL 67  68  68  VAL VAL B . n 
B 1 68  CYS 68  69  69  CYS CYS B . n 
B 1 69  TYR 69  70  70  TYR TYR B . n 
B 1 70  GLN 70  71  71  GLN GLN B . n 
B 1 71  TYR 71  72  72  TYR TYR B . n 
B 1 72  VAL 72  73  73  VAL VAL B . n 
B 1 73  ASP 73  74  74  ASP ASP B . n 
B 1 74  THR 74  75  75  THR THR B . n 
B 1 75  LEU 75  76  76  LEU LEU B . n 
B 1 76  TYR 76  77  77  TYR TYR B . n 
B 1 77  PRO 77  78  78  PRO PRO B . n 
B 1 78  GLY 78  79  79  GLY GLY B . n 
B 1 79  PHE 79  80  80  PHE PHE B . n 
B 1 80  GLU 80  81  81  GLU GLU B . n 
B 1 81  GLY 81  82  82  GLY GLY B . n 
B 1 82  THR 82  83  83  THR THR B . n 
B 1 83  GLU 83  84  84  GLU GLU B . n 
B 1 84  MET 84  85  85  MET MET B . n 
B 1 85  TRP 85  86  86  TRP TRP B . n 
B 1 86  ASN 86  87  87  ASN ASN B . n 
B 1 87  PRO 87  88  88  PRO PRO B . n 
B 1 88  ASN 88  89  89  ASN ASN B . n 
B 1 89  ARG 89  90  90  ARG ARG B . n 
B 1 90  GLU 90  91  91  GLU GLU B . n 
B 1 91  LEU 91  92  92  LEU LEU B . n 
B 1 92  SER 92  93  93  SER SER B . n 
B 1 93  GLU 93  94  94  GLU GLU B . n 
B 1 94  ASP 94  95  95  ASP ASP B . n 
B 1 95  CYS 95  96  96  CYS CYS B . n 
B 1 96  LEU 96  97  97  LEU LEU B . n 
B 1 97  TYR 97  98  98  TYR TYR B . n 
B 1 98  LEU 98  99  99  LEU LEU B . n 
B 1 99  ASN 99  100 100 ASN ASN B . n 
B 1 100 VAL 100 101 101 VAL VAL B . n 
B 1 101 TRP 101 102 102 TRP TRP B . n 
B 1 102 THR 102 103 103 THR THR B . n 
B 1 103 PRO 103 104 104 PRO PRO B . n 
B 1 104 TYR 104 105 105 TYR TYR B . n 
B 1 105 PRO 105 106 106 PRO PRO B . n 
B 1 106 ARG 106 107 107 ARG ARG B . n 
B 1 107 PRO 107 108 108 PRO PRO B . n 
B 1 108 THR 108 109 109 THR THR B . n 
B 1 109 SER 109 110 110 SER SER B . n 
B 1 110 PRO 110 111 111 PRO PRO B . n 
B 1 111 THR 111 112 112 THR THR B . n 
B 1 112 PRO 112 113 113 PRO PRO B . n 
B 1 113 VAL 113 114 114 VAL VAL B . n 
B 1 114 LEU 114 115 115 LEU LEU B . n 
B 1 115 VAL 115 116 116 VAL VAL B . n 
B 1 116 TRP 116 117 117 TRP TRP B . n 
B 1 117 ILE 117 118 118 ILE ILE B . n 
B 1 118 TYR 118 119 119 TYR TYR B . n 
B 1 119 GLY 119 120 120 GLY GLY B . n 
B 1 120 GLY 120 121 121 GLY GLY B . n 
B 1 121 GLY 121 122 122 GLY GLY B . n 
B 1 122 PHE 122 123 123 PHE PHE B . n 
B 1 123 TYR 123 124 124 TYR TYR B . n 
B 1 124 SER 124 125 125 SER SER B . n 
B 1 125 GLY 125 126 126 GLY GLY B . n 
B 1 126 ALA 126 127 127 ALA ALA B . n 
B 1 127 SER 127 128 128 SER SER B . n 
B 1 128 SER 128 129 129 SER SER B . n 
B 1 129 LEU 129 130 130 LEU LEU B . n 
B 1 130 ASP 130 131 131 ASP ASP B . n 
B 1 131 VAL 131 132 132 VAL VAL B . n 
B 1 132 TYR 132 133 133 TYR TYR B . n 
B 1 133 ASP 133 134 134 ASP ASP B . n 
B 1 134 GLY 134 135 135 GLY GLY B . n 
B 1 135 ARG 135 136 136 ARG ARG B . n 
B 1 136 PHE 136 137 137 PHE PHE B . n 
B 1 137 LEU 137 138 138 LEU LEU B . n 
B 1 138 VAL 138 139 139 VAL VAL B . n 
B 1 139 GLN 139 140 140 GLN GLN B . n 
B 1 140 ALA 140 141 141 ALA ALA B . n 
B 1 141 GLU 141 142 142 GLU GLU B . n 
B 1 142 ARG 142 143 143 ARG ARG B . n 
B 1 143 THR 143 144 144 THR THR B . n 
B 1 144 VAL 144 145 145 VAL VAL B . n 
B 1 145 LEU 145 146 146 LEU LEU B . n 
B 1 146 VAL 146 147 147 VAL VAL B . n 
B 1 147 SER 147 148 148 SER SER B . n 
B 1 148 MET 148 149 149 MET MET B . n 
B 1 149 ASN 149 150 150 ASN ASN B . n 
B 1 150 TYR 150 151 151 TYR TYR B . n 
B 1 151 ARG 151 152 152 ARG ARG B . n 
B 1 152 VAL 152 153 153 VAL VAL B . n 
B 1 153 GLY 153 154 154 GLY GLY B . n 
B 1 154 ALA 154 155 155 ALA ALA B . n 
B 1 155 PHE 155 156 156 PHE PHE B . n 
B 1 156 GLY 156 157 157 GLY GLY B . n 
B 1 157 PHE 157 158 158 PHE PHE B . n 
B 1 158 LEU 158 159 159 LEU LEU B . n 
B 1 159 ALA 159 160 160 ALA ALA B . n 
B 1 160 LEU 160 161 161 LEU LEU B . n 
B 1 161 PRO 161 162 162 PRO PRO B . n 
B 1 162 GLY 162 163 163 GLY GLY B . n 
B 1 163 SER 163 164 164 SER SER B . n 
B 1 164 ARG 164 165 165 ARG ARG B . n 
B 1 165 GLU 165 166 166 GLU GLU B . n 
B 1 166 ALA 166 167 167 ALA ALA B . n 
B 1 167 PRO 167 168 168 PRO PRO B . n 
B 1 168 GLY 168 169 169 GLY GLY B . n 
B 1 169 ASN 169 170 170 ASN ASN B . n 
B 1 170 VAL 170 171 171 VAL VAL B . n 
B 1 171 GLY 171 172 172 GLY GLY B . n 
B 1 172 LEU 172 173 173 LEU LEU B . n 
B 1 173 LEU 173 174 174 LEU LEU B . n 
B 1 174 ASP 174 175 175 ASP ASP B . n 
B 1 175 GLN 175 176 176 GLN GLN B . n 
B 1 176 ARG 176 177 177 ARG ARG B . n 
B 1 177 LEU 177 178 178 LEU LEU B . n 
B 1 178 ALA 178 179 179 ALA ALA B . n 
B 1 179 LEU 179 180 180 LEU LEU B . n 
B 1 180 GLN 180 181 181 GLN GLN B . n 
B 1 181 TRP 181 182 182 TRP TRP B . n 
B 1 182 VAL 182 183 183 VAL VAL B . n 
B 1 183 GLN 183 184 184 GLN GLN B . n 
B 1 184 GLU 184 185 185 GLU GLU B . n 
B 1 185 ASN 185 186 186 ASN ASN B . n 
B 1 186 VAL 186 187 187 VAL VAL B . n 
B 1 187 ALA 187 188 188 ALA ALA B . n 
B 1 188 ALA 188 189 189 ALA ALA B . n 
B 1 189 PHE 189 190 190 PHE PHE B . n 
B 1 190 GLY 190 191 191 GLY GLY B . n 
B 1 191 GLY 191 192 192 GLY GLY B . n 
B 1 192 ASP 192 193 193 ASP ASP B . n 
B 1 193 PRO 193 194 194 PRO PRO B . n 
B 1 194 THR 194 195 195 THR THR B . n 
B 1 195 SER 195 196 196 SER SER B . n 
B 1 196 VAL 196 197 197 VAL VAL B . n 
B 1 197 THR 197 198 198 THR THR B . n 
B 1 198 LEU 198 199 199 LEU LEU B . n 
B 1 199 PHE 199 200 200 PHE PHE B . n 
B 1 200 GLY 200 201 201 GLY GLY B . n 
B 1 201 GLU 201 202 202 GLU GLU B . n 
B 1 202 SER 202 203 203 SER SER B . n 
B 1 203 ALA 203 204 204 ALA ALA B . n 
B 1 204 GLY 204 205 205 GLY GLY B . n 
B 1 205 ALA 205 206 206 ALA ALA B . n 
B 1 206 ALA 206 207 207 ALA ALA B . n 
B 1 207 SER 207 208 208 SER SER B . n 
B 1 208 VAL 208 209 209 VAL VAL B . n 
B 1 209 GLY 209 210 210 GLY GLY B . n 
B 1 210 MET 210 211 211 MET MET B . n 
B 1 211 HIS 211 212 212 HIS HIS B . n 
B 1 212 LEU 212 213 213 LEU LEU B . n 
B 1 213 LEU 213 214 214 LEU LEU B . n 
B 1 214 SER 214 215 215 SER SER B . n 
B 1 215 PRO 215 216 216 PRO PRO B . n 
B 1 216 PRO 216 217 217 PRO PRO B . n 
B 1 217 SER 217 218 218 SER SER B . n 
B 1 218 ARG 218 219 219 ARG ARG B . n 
B 1 219 GLY 219 220 220 GLY GLY B . n 
B 1 220 LEU 220 221 221 LEU LEU B . n 
B 1 221 PHE 221 222 222 PHE PHE B . n 
B 1 222 HIS 222 223 223 HIS HIS B . n 
B 1 223 ARG 223 224 224 ARG ARG B . n 
B 1 224 ALA 224 225 225 ALA ALA B . n 
B 1 225 VAL 225 226 226 VAL VAL B . n 
B 1 226 LEU 226 227 227 LEU LEU B . n 
B 1 227 GLN 227 228 228 GLN GLN B . n 
B 1 228 SER 228 229 229 SER SER B . n 
B 1 229 GLY 229 230 230 GLY GLY B . n 
B 1 230 ALA 230 231 231 ALA ALA B . n 
B 1 231 PRO 231 232 232 PRO PRO B . n 
B 1 232 ASN 232 233 233 ASN ASN B . n 
B 1 233 GLY 233 234 234 GLY GLY B . n 
B 1 234 PRO 234 235 235 PRO PRO B . n 
B 1 235 TRP 235 236 236 TRP TRP B . n 
B 1 236 ALA 236 237 237 ALA ALA B . n 
B 1 237 THR 237 238 238 THR THR B . n 
B 1 238 VAL 238 239 239 VAL VAL B . n 
B 1 239 GLY 239 240 240 GLY GLY B . n 
B 1 240 MET 240 241 241 MET MET B . n 
B 1 241 GLY 241 242 242 GLY GLY B . n 
B 1 242 GLU 242 243 243 GLU GLU B . n 
B 1 243 ALA 243 244 244 ALA ALA B . n 
B 1 244 ARG 244 245 245 ARG ARG B . n 
B 1 245 ARG 245 246 246 ARG ARG B . n 
B 1 246 ARG 246 247 247 ARG ARG B . n 
B 1 247 ALA 247 248 248 ALA ALA B . n 
B 1 248 THR 248 249 249 THR THR B . n 
B 1 249 GLN 249 250 250 GLN GLN B . n 
B 1 250 LEU 250 251 251 LEU LEU B . n 
B 1 251 ALA 251 252 252 ALA ALA B . n 
B 1 252 HIS 252 253 253 HIS HIS B . n 
B 1 253 LEU 253 254 254 LEU LEU B . n 
B 1 254 VAL 254 255 255 VAL VAL B . n 
B 1 255 GLY 255 256 256 GLY GLY B . n 
B 1 256 CYS 256 257 257 CYS CYS B . n 
B 1 257 PRO 257 258 258 PRO PRO B . n 
B 1 258 PRO 258 259 259 PRO PRO B . n 
B 1 259 GLY 259 260 ?   ?   ?   B . n 
B 1 260 GLY 260 261 ?   ?   ?   B . n 
B 1 261 THR 261 262 262 THR THR B . n 
B 1 262 GLY 262 263 263 GLY GLY B . n 
B 1 263 GLY 263 264 264 GLY GLY B . n 
B 1 264 ASN 264 265 265 ASN ASN B . n 
B 1 265 ASP 265 266 266 ASP ASP B . n 
B 1 266 THR 266 267 267 THR THR B . n 
B 1 267 GLU 267 268 268 GLU GLU B . n 
B 1 268 LEU 268 269 269 LEU LEU B . n 
B 1 269 VAL 269 270 270 VAL VAL B . n 
B 1 270 ALA 270 271 271 ALA ALA B . n 
B 1 271 CYS 271 272 272 CYS CYS B . n 
B 1 272 LEU 272 273 273 LEU LEU B . n 
B 1 273 ARG 273 274 274 ARG ARG B . n 
B 1 274 THR 274 275 275 THR THR B . n 
B 1 275 ARG 275 276 276 ARG ARG B . n 
B 1 276 PRO 276 277 277 PRO PRO B . n 
B 1 277 ALA 277 278 278 ALA ALA B . n 
B 1 278 GLN 278 279 279 GLN GLN B . n 
B 1 279 VAL 279 280 280 VAL VAL B . n 
B 1 280 LEU 280 281 281 LEU LEU B . n 
B 1 281 VAL 281 282 282 VAL VAL B . n 
B 1 282 ASN 282 283 283 ASN ASN B . n 
B 1 283 HIS 283 284 284 HIS HIS B . n 
B 1 284 GLU 284 285 285 GLU GLU B . n 
B 1 285 TRP 285 286 286 TRP TRP B . n 
B 1 286 HIS 286 287 287 HIS HIS B . n 
B 1 287 VAL 287 288 288 VAL VAL B . n 
B 1 288 LEU 288 289 289 LEU LEU B . n 
B 1 289 PRO 289 290 290 PRO PRO B . n 
B 1 290 GLN 290 291 291 GLN GLN B . n 
B 1 291 GLU 291 292 292 GLU GLU B . n 
B 1 292 SER 292 293 293 SER SER B . n 
B 1 293 VAL 293 294 294 VAL VAL B . n 
B 1 294 PHE 294 295 295 PHE PHE B . n 
B 1 295 ARG 295 296 296 ARG ARG B . n 
B 1 296 PHE 296 297 297 PHE PHE B . n 
B 1 297 SER 297 298 298 SER SER B . n 
B 1 298 PHE 298 299 299 PHE PHE B . n 
B 1 299 VAL 299 300 300 VAL VAL B . n 
B 1 300 PRO 300 301 301 PRO PRO B . n 
B 1 301 VAL 301 302 302 VAL VAL B . n 
B 1 302 VAL 302 303 303 VAL VAL B . n 
B 1 303 ASP 303 304 304 ASP ASP B . n 
B 1 304 GLY 304 305 305 GLY GLY B . n 
B 1 305 ASP 305 306 306 ASP ASP B . n 
B 1 306 PHE 306 307 307 PHE PHE B . n 
B 1 307 LEU 307 308 308 LEU LEU B . n 
B 1 308 SER 308 309 309 SER SER B . n 
B 1 309 ASP 309 310 310 ASP ASP B . n 
B 1 310 THR 310 311 311 THR THR B . n 
B 1 311 PRO 311 312 312 PRO PRO B . n 
B 1 312 GLU 312 313 313 GLU GLU B . n 
B 1 313 ALA 313 314 314 ALA ALA B . n 
B 1 314 LEU 314 315 315 LEU LEU B . n 
B 1 315 ILE 315 316 316 ILE ILE B . n 
B 1 316 ASN 316 317 317 ASN ASN B . n 
B 1 317 ALA 317 318 318 ALA ALA B . n 
B 1 318 GLY 318 319 319 GLY GLY B . n 
B 1 319 ASP 319 320 320 ASP ASP B . n 
B 1 320 PHE 320 321 321 PHE PHE B . n 
B 1 321 HIS 321 322 322 HIS HIS B . n 
B 1 322 GLY 322 323 323 GLY GLY B . n 
B 1 323 LEU 323 324 324 LEU LEU B . n 
B 1 324 GLN 324 325 325 GLN GLN B . n 
B 1 325 VAL 325 326 326 VAL VAL B . n 
B 1 326 LEU 326 327 327 LEU LEU B . n 
B 1 327 VAL 327 328 328 VAL VAL B . n 
B 1 328 GLY 328 329 329 GLY GLY B . n 
B 1 329 VAL 329 330 330 VAL VAL B . n 
B 1 330 VAL 330 331 331 VAL VAL B . n 
B 1 331 LYS 331 332 332 LYS LYS B . n 
B 1 332 ASP 332 333 333 ASP ASP B . n 
B 1 333 GLU 333 334 334 GLU GLU B . n 
B 1 334 GLY 334 335 335 GLY GLY B . n 
B 1 335 SER 335 336 336 SER SER B . n 
B 1 336 TYR 336 337 337 TYR TYR B . n 
B 1 337 PHE 337 338 338 PHE PHE B . n 
B 1 338 LEU 338 339 339 LEU LEU B . n 
B 1 339 VAL 339 340 340 VAL VAL B . n 
B 1 340 TYR 340 341 341 TYR TYR B . n 
B 1 341 GLY 341 342 342 GLY GLY B . n 
B 1 342 ALA 342 343 343 ALA ALA B . n 
B 1 343 PRO 343 344 344 PRO PRO B . n 
B 1 344 GLY 344 345 345 GLY GLY B . n 
B 1 345 PHE 345 346 346 PHE PHE B . n 
B 1 346 SER 346 347 347 SER SER B . n 
B 1 347 LYS 347 348 348 LYS LYS B . n 
B 1 348 ASP 348 349 349 ASP ASP B . n 
B 1 349 ASN 349 350 350 ASN ASN B . n 
B 1 350 GLU 350 351 351 GLU GLU B . n 
B 1 351 SER 351 352 352 SER SER B . n 
B 1 352 LEU 352 353 353 LEU LEU B . n 
B 1 353 ILE 353 354 354 ILE ILE B . n 
B 1 354 SER 354 355 355 SER SER B . n 
B 1 355 ARG 355 356 356 ARG ARG B . n 
B 1 356 ALA 356 357 357 ALA ALA B . n 
B 1 357 GLU 357 358 358 GLU GLU B . n 
B 1 358 PHE 358 359 359 PHE PHE B . n 
B 1 359 LEU 359 360 360 LEU LEU B . n 
B 1 360 ALA 360 361 361 ALA ALA B . n 
B 1 361 GLY 361 362 362 GLY GLY B . n 
B 1 362 VAL 362 363 363 VAL VAL B . n 
B 1 363 ARG 363 364 364 ARG ARG B . n 
B 1 364 VAL 364 365 365 VAL VAL B . n 
B 1 365 GLY 365 366 366 GLY GLY B . n 
B 1 366 VAL 366 367 367 VAL VAL B . n 
B 1 367 PRO 367 368 368 PRO PRO B . n 
B 1 368 GLN 368 369 369 GLN GLN B . n 
B 1 369 VAL 369 370 370 VAL VAL B . n 
B 1 370 SER 370 371 371 SER SER B . n 
B 1 371 ASP 371 372 372 ASP ASP B . n 
B 1 372 LEU 372 373 373 LEU LEU B . n 
B 1 373 ALA 373 374 374 ALA ALA B . n 
B 1 374 ALA 374 375 375 ALA ALA B . n 
B 1 375 GLU 375 376 376 GLU GLU B . n 
B 1 376 ALA 376 377 377 ALA ALA B . n 
B 1 377 VAL 377 378 378 VAL VAL B . n 
B 1 378 VAL 378 379 379 VAL VAL B . n 
B 1 379 LEU 379 380 380 LEU LEU B . n 
B 1 380 HIS 380 381 381 HIS HIS B . n 
B 1 381 TYR 381 382 382 TYR TYR B . n 
B 1 382 THR 382 383 383 THR THR B . n 
B 1 383 ASP 383 384 384 ASP ASP B . n 
B 1 384 TRP 384 385 385 TRP TRP B . n 
B 1 385 LEU 385 386 386 LEU LEU B . n 
B 1 386 HIS 386 387 387 HIS HIS B . n 
B 1 387 PRO 387 388 388 PRO PRO B . n 
B 1 388 GLU 388 389 389 GLU GLU B . n 
B 1 389 ASP 389 390 390 ASP ASP B . n 
B 1 390 PRO 390 391 391 PRO PRO B . n 
B 1 391 ALA 391 392 392 ALA ALA B . n 
B 1 392 ARG 392 393 393 ARG ARG B . n 
B 1 393 LEU 393 394 394 LEU LEU B . n 
B 1 394 ARG 394 395 395 ARG ARG B . n 
B 1 395 GLU 395 396 396 GLU GLU B . n 
B 1 396 ALA 396 397 397 ALA ALA B . n 
B 1 397 LEU 397 398 398 LEU LEU B . n 
B 1 398 SER 398 399 399 SER SER B . n 
B 1 399 ASP 399 400 400 ASP ASP B . n 
B 1 400 VAL 400 401 401 VAL VAL B . n 
B 1 401 VAL 401 402 402 VAL VAL B . n 
B 1 402 GLY 402 403 403 GLY GLY B . n 
B 1 403 ASP 403 404 404 ASP ASP B . n 
B 1 404 HIS 404 405 405 HIS HIS B . n 
B 1 405 ASN 405 406 406 ASN ASN B . n 
B 1 406 VAL 406 407 407 VAL VAL B . n 
B 1 407 VAL 407 408 408 VAL VAL B . n 
B 1 408 CYS 408 409 409 CYS CYS B . n 
B 1 409 PRO 409 410 410 PRO PRO B . n 
B 1 410 VAL 410 411 411 VAL VAL B . n 
B 1 411 ALA 411 412 412 ALA ALA B . n 
B 1 412 GLN 412 413 413 GLN GLN B . n 
B 1 413 LEU 413 414 414 LEU LEU B . n 
B 1 414 ALA 414 415 415 ALA ALA B . n 
B 1 415 GLY 415 416 416 GLY GLY B . n 
B 1 416 ARG 416 417 417 ARG ARG B . n 
B 1 417 LEU 417 418 418 LEU LEU B . n 
B 1 418 ALA 418 419 419 ALA ALA B . n 
B 1 419 ALA 419 420 420 ALA ALA B . n 
B 1 420 GLN 420 421 421 GLN GLN B . n 
B 1 421 GLY 421 422 422 GLY GLY B . n 
B 1 422 ALA 422 423 423 ALA ALA B . n 
B 1 423 ARG 423 424 424 ARG ARG B . n 
B 1 424 VAL 424 425 425 VAL VAL B . n 
B 1 425 TYR 425 426 426 TYR TYR B . n 
B 1 426 ALA 426 427 427 ALA ALA B . n 
B 1 427 TYR 427 428 428 TYR TYR B . n 
B 1 428 VAL 428 429 429 VAL VAL B . n 
B 1 429 PHE 429 430 430 PHE PHE B . n 
B 1 430 GLU 430 431 431 GLU GLU B . n 
B 1 431 HIS 431 432 432 HIS HIS B . n 
B 1 432 ARG 432 433 433 ARG ARG B . n 
B 1 433 ALA 433 434 434 ALA ALA B . n 
B 1 434 SER 434 435 435 SER SER B . n 
B 1 435 THR 435 436 436 THR THR B . n 
B 1 436 LEU 436 437 437 LEU LEU B . n 
B 1 437 SER 437 438 438 SER SER B . n 
B 1 438 TRP 438 439 439 TRP TRP B . n 
B 1 439 PRO 439 440 440 PRO PRO B . n 
B 1 440 LEU 440 441 441 LEU LEU B . n 
B 1 441 TRP 441 442 442 TRP TRP B . n 
B 1 442 MET 442 443 443 MET MET B . n 
B 1 443 GLY 443 444 444 GLY GLY B . n 
B 1 444 VAL 444 445 445 VAL VAL B . n 
B 1 445 PRO 445 446 446 PRO PRO B . n 
B 1 446 HIS 446 447 447 HIS HIS B . n 
B 1 447 GLY 447 448 448 GLY GLY B . n 
B 1 448 TYR 448 449 449 TYR TYR B . n 
B 1 449 GLU 449 450 450 GLU GLU B . n 
B 1 450 ILE 450 451 451 ILE ILE B . n 
B 1 451 GLU 451 452 452 GLU GLU B . n 
B 1 452 PHE 452 453 453 PHE PHE B . n 
B 1 453 ILE 453 454 454 ILE ILE B . n 
B 1 454 PHE 454 455 455 PHE PHE B . n 
B 1 455 GLY 455 456 456 GLY GLY B . n 
B 1 456 ILE 456 457 457 ILE ILE B . n 
B 1 457 PRO 457 458 458 PRO PRO B . n 
B 1 458 LEU 458 459 459 LEU LEU B . n 
B 1 459 ASP 459 460 460 ASP ASP B . n 
B 1 460 PRO 460 461 461 PRO PRO B . n 
B 1 461 SER 461 462 462 SER SER B . n 
B 1 462 ARG 462 463 463 ARG ARG B . n 
B 1 463 ASN 463 464 464 ASN ASN B . n 
B 1 464 TYR 464 465 465 TYR TYR B . n 
B 1 465 THR 465 466 466 THR THR B . n 
B 1 466 ALA 466 467 467 ALA ALA B . n 
B 1 467 GLU 467 468 468 GLU GLU B . n 
B 1 468 GLU 468 469 469 GLU GLU B . n 
B 1 469 LYS 469 470 470 LYS LYS B . n 
B 1 470 ILE 470 471 471 ILE ILE B . n 
B 1 471 PHE 471 472 472 PHE PHE B . n 
B 1 472 ALA 472 473 473 ALA ALA B . n 
B 1 473 GLN 473 474 474 GLN GLN B . n 
B 1 474 ARG 474 475 475 ARG ARG B . n 
B 1 475 LEU 475 476 476 LEU LEU B . n 
B 1 476 MET 476 477 477 MET MET B . n 
B 1 477 ARG 477 478 478 ARG ARG B . n 
B 1 478 TYR 478 479 479 TYR TYR B . n 
B 1 479 TRP 479 480 480 TRP TRP B . n 
B 1 480 ALA 480 481 481 ALA ALA B . n 
B 1 481 ASN 481 482 482 ASN ASN B . n 
B 1 482 PHE 482 483 483 PHE PHE B . n 
B 1 483 ALA 483 484 484 ALA ALA B . n 
B 1 484 ARG 484 485 485 ARG ARG B . n 
B 1 485 THR 485 486 486 THR THR B . n 
B 1 486 GLY 486 487 487 GLY GLY B . n 
B 1 487 ASP 487 488 488 ASP ASP B . n 
B 1 488 PRO 488 489 489 PRO PRO B . n 
B 1 489 ASN 489 490 490 ASN ASN B . n 
B 1 490 GLU 490 491 491 GLU GLU B . n 
B 1 491 PRO 491 492 492 PRO PRO B . n 
B 1 492 ARG 492 493 ?   ?   ?   B . n 
B 1 493 ASP 493 494 ?   ?   ?   B . n 
B 1 494 PRO 494 495 495 PRO PRO B . n 
B 1 495 LYS 495 496 496 LYS LYS B . n 
B 1 496 ALA 496 497 497 ALA ALA B . n 
B 1 497 PRO 497 498 498 PRO PRO B . n 
B 1 498 GLN 498 499 499 GLN GLN B . n 
B 1 499 TRP 499 500 500 TRP TRP B . n 
B 1 500 PRO 500 501 501 PRO PRO B . n 
B 1 501 PRO 501 502 502 PRO PRO B . n 
B 1 502 TYR 502 503 503 TYR TYR B . n 
B 1 503 THR 503 504 504 THR THR B . n 
B 1 504 ALA 504 505 505 ALA ALA B . n 
B 1 505 GLY 505 506 506 GLY GLY B . n 
B 1 506 ALA 506 507 507 ALA ALA B . n 
B 1 507 GLN 507 508 508 GLN GLN B . n 
B 1 508 GLN 508 509 509 GLN GLN B . n 
B 1 509 TYR 509 510 510 TYR TYR B . n 
B 1 510 VAL 510 511 511 VAL VAL B . n 
B 1 511 SER 511 512 512 SER SER B . n 
B 1 512 LEU 512 513 513 LEU LEU B . n 
B 1 513 ASP 513 514 514 ASP ASP B . n 
B 1 514 LEU 514 515 515 LEU LEU B . n 
B 1 515 ARG 515 516 516 ARG ARG B . n 
B 1 516 PRO 516 517 517 PRO PRO B . n 
B 1 517 LEU 517 518 518 LEU LEU B . n 
B 1 518 GLU 518 519 519 GLU GLU B . n 
B 1 519 VAL 519 520 520 VAL VAL B . n 
B 1 520 ARG 520 521 521 ARG ARG B . n 
B 1 521 ARG 521 522 522 ARG ARG B . n 
B 1 522 GLY 522 523 523 GLY GLY B . n 
B 1 523 LEU 523 524 524 LEU LEU B . n 
B 1 524 ARG 524 525 525 ARG ARG B . n 
B 1 525 ALA 525 526 526 ALA ALA B . n 
B 1 526 GLN 526 527 527 GLN GLN B . n 
B 1 527 ALA 527 528 528 ALA ALA B . n 
B 1 528 CYS 528 529 529 CYS CYS B . n 
B 1 529 ALA 529 530 530 ALA ALA B . n 
B 1 530 PHE 530 531 531 PHE PHE B . n 
B 1 531 TRP 531 532 532 TRP TRP B . n 
B 1 532 ASN 532 533 533 ASN ASN B . n 
B 1 533 ARG 533 534 534 ARG ARG B . n 
B 1 534 PHE 534 535 535 PHE PHE B . n 
B 1 535 LEU 535 536 536 LEU LEU B . n 
B 1 536 PRO 536 537 537 PRO PRO B . n 
B 1 537 LYS 537 538 538 LYS LYS B . n 
B 1 538 LEU 538 539 539 LEU LEU B . n 
B 1 539 LEU 539 540 540 LEU LEU B . n 
B 1 540 SER 540 541 541 SER SER B . n 
B 1 541 ALA 541 542 542 ALA ALA B . n 
B 1 542 THR 542 543 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 GNT 1   604 1   GNT GNT A . 
F 4 EDO 1   605 1   EDO EDO A . 
G 4 EDO 1   606 3   EDO EDO A . 
H 5 NAG 1   604 4   NAG NAG B . 
I 3 GNT 1   605 2   GNT GNT B . 
J 4 EDO 1   606 2   EDO EDO B . 
K 6 NO3 1   607 1   NO3 NO3 B . 
L 6 NO3 1   608 2   NO3 NO3 B . 
M 7 PE8 1   609 1   PE8 PE8 B . 
N 8 HOH 1   701 1   HOH HOH A . 
N 8 HOH 2   702 2   HOH HOH A . 
N 8 HOH 3   703 3   HOH HOH A . 
N 8 HOH 4   704 4   HOH HOH A . 
N 8 HOH 5   705 6   HOH HOH A . 
N 8 HOH 6   706 7   HOH HOH A . 
N 8 HOH 7   707 8   HOH HOH A . 
N 8 HOH 8   708 9   HOH HOH A . 
N 8 HOH 9   709 10  HOH HOH A . 
N 8 HOH 10  710 12  HOH HOH A . 
N 8 HOH 11  711 15  HOH HOH A . 
N 8 HOH 12  712 18  HOH HOH A . 
N 8 HOH 13  713 20  HOH HOH A . 
N 8 HOH 14  714 22  HOH HOH A . 
N 8 HOH 15  715 23  HOH HOH A . 
N 8 HOH 16  716 25  HOH HOH A . 
N 8 HOH 17  717 26  HOH HOH A . 
N 8 HOH 18  718 28  HOH HOH A . 
N 8 HOH 19  719 29  HOH HOH A . 
N 8 HOH 20  720 30  HOH HOH A . 
N 8 HOH 21  721 31  HOH HOH A . 
N 8 HOH 22  722 34  HOH HOH A . 
N 8 HOH 23  723 35  HOH HOH A . 
N 8 HOH 24  724 36  HOH HOH A . 
N 8 HOH 25  725 42  HOH HOH A . 
N 8 HOH 26  726 43  HOH HOH A . 
N 8 HOH 27  727 44  HOH HOH A . 
N 8 HOH 28  728 45  HOH HOH A . 
N 8 HOH 29  729 47  HOH HOH A . 
N 8 HOH 30  730 52  HOH HOH A . 
N 8 HOH 31  731 54  HOH HOH A . 
N 8 HOH 32  732 55  HOH HOH A . 
N 8 HOH 33  733 56  HOH HOH A . 
N 8 HOH 34  734 60  HOH HOH A . 
N 8 HOH 35  735 61  HOH HOH A . 
N 8 HOH 36  736 64  HOH HOH A . 
N 8 HOH 37  737 66  HOH HOH A . 
N 8 HOH 38  738 67  HOH HOH A . 
N 8 HOH 39  739 69  HOH HOH A . 
N 8 HOH 40  740 70  HOH HOH A . 
N 8 HOH 41  741 71  HOH HOH A . 
N 8 HOH 42  742 72  HOH HOH A . 
N 8 HOH 43  743 74  HOH HOH A . 
N 8 HOH 44  744 80  HOH HOH A . 
N 8 HOH 45  745 83  HOH HOH A . 
N 8 HOH 46  746 85  HOH HOH A . 
N 8 HOH 47  747 86  HOH HOH A . 
N 8 HOH 48  748 87  HOH HOH A . 
N 8 HOH 49  749 88  HOH HOH A . 
N 8 HOH 50  750 90  HOH HOH A . 
N 8 HOH 51  751 91  HOH HOH A . 
N 8 HOH 52  752 92  HOH HOH A . 
N 8 HOH 53  753 94  HOH HOH A . 
N 8 HOH 54  754 95  HOH HOH A . 
N 8 HOH 55  755 96  HOH HOH A . 
N 8 HOH 56  756 97  HOH HOH A . 
N 8 HOH 57  757 98  HOH HOH A . 
N 8 HOH 58  758 99  HOH HOH A . 
N 8 HOH 59  759 100 HOH HOH A . 
N 8 HOH 60  760 103 HOH HOH A . 
N 8 HOH 61  761 106 HOH HOH A . 
N 8 HOH 62  762 108 HOH HOH A . 
N 8 HOH 63  763 109 HOH HOH A . 
N 8 HOH 64  764 110 HOH HOH A . 
N 8 HOH 65  765 113 HOH HOH A . 
N 8 HOH 66  766 114 HOH HOH A . 
N 8 HOH 67  767 119 HOH HOH A . 
N 8 HOH 68  768 123 HOH HOH A . 
N 8 HOH 69  769 125 HOH HOH A . 
N 8 HOH 70  770 130 HOH HOH A . 
N 8 HOH 71  771 131 HOH HOH A . 
N 8 HOH 72  772 132 HOH HOH A . 
N 8 HOH 73  773 133 HOH HOH A . 
N 8 HOH 74  774 135 HOH HOH A . 
N 8 HOH 75  775 139 HOH HOH A . 
N 8 HOH 76  776 140 HOH HOH A . 
N 8 HOH 77  777 141 HOH HOH A . 
N 8 HOH 78  778 144 HOH HOH A . 
N 8 HOH 79  779 147 HOH HOH A . 
N 8 HOH 80  780 149 HOH HOH A . 
N 8 HOH 81  781 150 HOH HOH A . 
N 8 HOH 82  782 152 HOH HOH A . 
N 8 HOH 83  783 154 HOH HOH A . 
N 8 HOH 84  784 155 HOH HOH A . 
N 8 HOH 85  785 157 HOH HOH A . 
N 8 HOH 86  786 158 HOH HOH A . 
N 8 HOH 87  787 161 HOH HOH A . 
N 8 HOH 88  788 163 HOH HOH A . 
N 8 HOH 89  789 165 HOH HOH A . 
N 8 HOH 90  790 171 HOH HOH A . 
N 8 HOH 91  791 174 HOH HOH A . 
N 8 HOH 92  792 176 HOH HOH A . 
N 8 HOH 93  793 179 HOH HOH A . 
N 8 HOH 94  794 180 HOH HOH A . 
N 8 HOH 95  795 182 HOH HOH A . 
N 8 HOH 96  796 184 HOH HOH A . 
N 8 HOH 97  797 185 HOH HOH A . 
N 8 HOH 98  798 191 HOH HOH A . 
N 8 HOH 99  799 197 HOH HOH A . 
N 8 HOH 100 800 198 HOH HOH A . 
N 8 HOH 101 801 202 HOH HOH A . 
N 8 HOH 102 802 203 HOH HOH A . 
N 8 HOH 103 803 207 HOH HOH A . 
N 8 HOH 104 804 208 HOH HOH A . 
N 8 HOH 105 805 210 HOH HOH A . 
N 8 HOH 106 806 213 HOH HOH A . 
N 8 HOH 107 807 214 HOH HOH A . 
N 8 HOH 108 808 215 HOH HOH A . 
N 8 HOH 109 809 216 HOH HOH A . 
N 8 HOH 110 810 219 HOH HOH A . 
N 8 HOH 111 811 222 HOH HOH A . 
N 8 HOH 112 812 225 HOH HOH A . 
N 8 HOH 113 813 227 HOH HOH A . 
N 8 HOH 114 814 228 HOH HOH A . 
N 8 HOH 115 815 229 HOH HOH A . 
N 8 HOH 116 816 230 HOH HOH A . 
N 8 HOH 117 817 233 HOH HOH A . 
N 8 HOH 118 818 234 HOH HOH A . 
N 8 HOH 119 819 237 HOH HOH A . 
N 8 HOH 120 820 238 HOH HOH A . 
N 8 HOH 121 821 240 HOH HOH A . 
N 8 HOH 122 822 241 HOH HOH A . 
N 8 HOH 123 823 242 HOH HOH A . 
N 8 HOH 124 824 244 HOH HOH A . 
N 8 HOH 125 825 245 HOH HOH A . 
N 8 HOH 126 826 247 HOH HOH A . 
N 8 HOH 127 827 248 HOH HOH A . 
N 8 HOH 128 828 251 HOH HOH A . 
N 8 HOH 129 829 253 HOH HOH A . 
N 8 HOH 130 830 254 HOH HOH A . 
N 8 HOH 131 831 257 HOH HOH A . 
N 8 HOH 132 832 261 HOH HOH A . 
N 8 HOH 133 833 262 HOH HOH A . 
N 8 HOH 134 834 264 HOH HOH A . 
N 8 HOH 135 835 265 HOH HOH A . 
N 8 HOH 136 836 269 HOH HOH A . 
N 8 HOH 137 837 270 HOH HOH A . 
N 8 HOH 138 838 271 HOH HOH A . 
N 8 HOH 139 839 272 HOH HOH A . 
N 8 HOH 140 840 276 HOH HOH A . 
N 8 HOH 141 841 277 HOH HOH A . 
N 8 HOH 142 842 280 HOH HOH A . 
N 8 HOH 143 843 281 HOH HOH A . 
N 8 HOH 144 844 282 HOH HOH A . 
N 8 HOH 145 845 284 HOH HOH A . 
N 8 HOH 146 846 287 HOH HOH A . 
N 8 HOH 147 847 290 HOH HOH A . 
N 8 HOH 148 848 291 HOH HOH A . 
N 8 HOH 149 849 293 HOH HOH A . 
N 8 HOH 150 850 294 HOH HOH A . 
N 8 HOH 151 851 298 HOH HOH A . 
N 8 HOH 152 852 299 HOH HOH A . 
N 8 HOH 153 853 302 HOH HOH A . 
N 8 HOH 154 854 303 HOH HOH A . 
N 8 HOH 155 855 304 HOH HOH A . 
N 8 HOH 156 856 307 HOH HOH A . 
N 8 HOH 157 857 309 HOH HOH A . 
N 8 HOH 158 858 310 HOH HOH A . 
N 8 HOH 159 859 311 HOH HOH A . 
N 8 HOH 160 860 314 HOH HOH A . 
N 8 HOH 161 861 316 HOH HOH A . 
N 8 HOH 162 862 317 HOH HOH A . 
N 8 HOH 163 863 323 HOH HOH A . 
N 8 HOH 164 864 331 HOH HOH A . 
N 8 HOH 165 865 333 HOH HOH A . 
N 8 HOH 166 866 334 HOH HOH A . 
N 8 HOH 167 867 335 HOH HOH A . 
N 8 HOH 168 868 336 HOH HOH A . 
N 8 HOH 169 869 337 HOH HOH A . 
N 8 HOH 170 870 338 HOH HOH A . 
N 8 HOH 171 871 340 HOH HOH A . 
N 8 HOH 172 872 341 HOH HOH A . 
N 8 HOH 173 873 342 HOH HOH A . 
N 8 HOH 174 874 346 HOH HOH A . 
N 8 HOH 175 875 348 HOH HOH A . 
N 8 HOH 176 876 349 HOH HOH A . 
N 8 HOH 177 877 350 HOH HOH A . 
N 8 HOH 178 878 351 HOH HOH A . 
N 8 HOH 179 879 354 HOH HOH A . 
N 8 HOH 180 880 356 HOH HOH A . 
N 8 HOH 181 881 357 HOH HOH A . 
N 8 HOH 182 882 358 HOH HOH A . 
N 8 HOH 183 883 359 HOH HOH A . 
N 8 HOH 184 884 360 HOH HOH A . 
N 8 HOH 185 885 361 HOH HOH A . 
N 8 HOH 186 886 362 HOH HOH A . 
N 8 HOH 187 887 363 HOH HOH A . 
N 8 HOH 188 888 365 HOH HOH A . 
N 8 HOH 189 889 366 HOH HOH A . 
N 8 HOH 190 890 372 HOH HOH A . 
N 8 HOH 191 891 373 HOH HOH A . 
N 8 HOH 192 892 374 HOH HOH A . 
N 8 HOH 193 893 375 HOH HOH A . 
N 8 HOH 194 894 376 HOH HOH A . 
N 8 HOH 195 895 378 HOH HOH A . 
N 8 HOH 196 896 379 HOH HOH A . 
N 8 HOH 197 897 380 HOH HOH A . 
N 8 HOH 198 898 381 HOH HOH A . 
N 8 HOH 199 899 382 HOH HOH A . 
N 8 HOH 200 900 383 HOH HOH A . 
N 8 HOH 201 901 385 HOH HOH A . 
N 8 HOH 202 902 390 HOH HOH A . 
N 8 HOH 203 903 391 HOH HOH A . 
N 8 HOH 204 904 394 HOH HOH A . 
O 8 HOH 1   701 5   HOH HOH B . 
O 8 HOH 2   702 11  HOH HOH B . 
O 8 HOH 3   703 13  HOH HOH B . 
O 8 HOH 4   704 14  HOH HOH B . 
O 8 HOH 5   705 16  HOH HOH B . 
O 8 HOH 6   706 17  HOH HOH B . 
O 8 HOH 7   707 19  HOH HOH B . 
O 8 HOH 8   708 21  HOH HOH B . 
O 8 HOH 9   709 24  HOH HOH B . 
O 8 HOH 10  710 27  HOH HOH B . 
O 8 HOH 11  711 32  HOH HOH B . 
O 8 HOH 12  712 33  HOH HOH B . 
O 8 HOH 13  713 37  HOH HOH B . 
O 8 HOH 14  714 38  HOH HOH B . 
O 8 HOH 15  715 39  HOH HOH B . 
O 8 HOH 16  716 40  HOH HOH B . 
O 8 HOH 17  717 41  HOH HOH B . 
O 8 HOH 18  718 46  HOH HOH B . 
O 8 HOH 19  719 48  HOH HOH B . 
O 8 HOH 20  720 49  HOH HOH B . 
O 8 HOH 21  721 50  HOH HOH B . 
O 8 HOH 22  722 51  HOH HOH B . 
O 8 HOH 23  723 53  HOH HOH B . 
O 8 HOH 24  724 57  HOH HOH B . 
O 8 HOH 25  725 58  HOH HOH B . 
O 8 HOH 26  726 59  HOH HOH B . 
O 8 HOH 27  727 62  HOH HOH B . 
O 8 HOH 28  728 63  HOH HOH B . 
O 8 HOH 29  729 65  HOH HOH B . 
O 8 HOH 30  730 68  HOH HOH B . 
O 8 HOH 31  731 73  HOH HOH B . 
O 8 HOH 32  732 76  HOH HOH B . 
O 8 HOH 33  733 77  HOH HOH B . 
O 8 HOH 34  734 78  HOH HOH B . 
O 8 HOH 35  735 79  HOH HOH B . 
O 8 HOH 36  736 81  HOH HOH B . 
O 8 HOH 37  737 82  HOH HOH B . 
O 8 HOH 38  738 84  HOH HOH B . 
O 8 HOH 39  739 89  HOH HOH B . 
O 8 HOH 40  740 93  HOH HOH B . 
O 8 HOH 41  741 101 HOH HOH B . 
O 8 HOH 42  742 102 HOH HOH B . 
O 8 HOH 43  743 104 HOH HOH B . 
O 8 HOH 44  744 105 HOH HOH B . 
O 8 HOH 45  745 107 HOH HOH B . 
O 8 HOH 46  746 111 HOH HOH B . 
O 8 HOH 47  747 112 HOH HOH B . 
O 8 HOH 48  748 115 HOH HOH B . 
O 8 HOH 49  749 116 HOH HOH B . 
O 8 HOH 50  750 117 HOH HOH B . 
O 8 HOH 51  751 118 HOH HOH B . 
O 8 HOH 52  752 120 HOH HOH B . 
O 8 HOH 53  753 121 HOH HOH B . 
O 8 HOH 54  754 122 HOH HOH B . 
O 8 HOH 55  755 124 HOH HOH B . 
O 8 HOH 56  756 126 HOH HOH B . 
O 8 HOH 57  757 128 HOH HOH B . 
O 8 HOH 58  758 129 HOH HOH B . 
O 8 HOH 59  759 134 HOH HOH B . 
O 8 HOH 60  760 136 HOH HOH B . 
O 8 HOH 61  761 137 HOH HOH B . 
O 8 HOH 62  762 138 HOH HOH B . 
O 8 HOH 63  763 142 HOH HOH B . 
O 8 HOH 64  764 143 HOH HOH B . 
O 8 HOH 65  765 145 HOH HOH B . 
O 8 HOH 66  766 146 HOH HOH B . 
O 8 HOH 67  767 148 HOH HOH B . 
O 8 HOH 68  768 151 HOH HOH B . 
O 8 HOH 69  769 153 HOH HOH B . 
O 8 HOH 70  770 156 HOH HOH B . 
O 8 HOH 71  771 159 HOH HOH B . 
O 8 HOH 72  772 160 HOH HOH B . 
O 8 HOH 73  773 162 HOH HOH B . 
O 8 HOH 74  774 164 HOH HOH B . 
O 8 HOH 75  775 166 HOH HOH B . 
O 8 HOH 76  776 167 HOH HOH B . 
O 8 HOH 77  777 168 HOH HOH B . 
O 8 HOH 78  778 169 HOH HOH B . 
O 8 HOH 79  779 170 HOH HOH B . 
O 8 HOH 80  780 172 HOH HOH B . 
O 8 HOH 81  781 173 HOH HOH B . 
O 8 HOH 82  782 175 HOH HOH B . 
O 8 HOH 83  783 177 HOH HOH B . 
O 8 HOH 84  784 178 HOH HOH B . 
O 8 HOH 85  785 183 HOH HOH B . 
O 8 HOH 86  786 186 HOH HOH B . 
O 8 HOH 87  787 187 HOH HOH B . 
O 8 HOH 88  788 188 HOH HOH B . 
O 8 HOH 89  789 189 HOH HOH B . 
O 8 HOH 90  790 190 HOH HOH B . 
O 8 HOH 91  791 193 HOH HOH B . 
O 8 HOH 92  792 194 HOH HOH B . 
O 8 HOH 93  793 195 HOH HOH B . 
O 8 HOH 94  794 196 HOH HOH B . 
O 8 HOH 95  795 199 HOH HOH B . 
O 8 HOH 96  796 200 HOH HOH B . 
O 8 HOH 97  797 201 HOH HOH B . 
O 8 HOH 98  798 205 HOH HOH B . 
O 8 HOH 99  799 206 HOH HOH B . 
O 8 HOH 100 800 211 HOH HOH B . 
O 8 HOH 101 801 212 HOH HOH B . 
O 8 HOH 102 802 217 HOH HOH B . 
O 8 HOH 103 803 218 HOH HOH B . 
O 8 HOH 104 804 220 HOH HOH B . 
O 8 HOH 105 805 221 HOH HOH B . 
O 8 HOH 106 806 223 HOH HOH B . 
O 8 HOH 107 807 224 HOH HOH B . 
O 8 HOH 108 808 226 HOH HOH B . 
O 8 HOH 109 809 231 HOH HOH B . 
O 8 HOH 110 810 232 HOH HOH B . 
O 8 HOH 111 811 235 HOH HOH B . 
O 8 HOH 112 812 236 HOH HOH B . 
O 8 HOH 113 813 243 HOH HOH B . 
O 8 HOH 114 814 246 HOH HOH B . 
O 8 HOH 115 815 249 HOH HOH B . 
O 8 HOH 116 816 250 HOH HOH B . 
O 8 HOH 117 817 252 HOH HOH B . 
O 8 HOH 118 818 255 HOH HOH B . 
O 8 HOH 119 819 256 HOH HOH B . 
O 8 HOH 120 820 258 HOH HOH B . 
O 8 HOH 121 821 259 HOH HOH B . 
O 8 HOH 122 822 260 HOH HOH B . 
O 8 HOH 123 823 263 HOH HOH B . 
O 8 HOH 124 824 266 HOH HOH B . 
O 8 HOH 125 825 267 HOH HOH B . 
O 8 HOH 126 826 268 HOH HOH B . 
O 8 HOH 127 827 273 HOH HOH B . 
O 8 HOH 128 828 274 HOH HOH B . 
O 8 HOH 129 829 275 HOH HOH B . 
O 8 HOH 130 830 279 HOH HOH B . 
O 8 HOH 131 831 283 HOH HOH B . 
O 8 HOH 132 832 285 HOH HOH B . 
O 8 HOH 133 833 286 HOH HOH B . 
O 8 HOH 134 834 289 HOH HOH B . 
O 8 HOH 135 835 292 HOH HOH B . 
O 8 HOH 136 836 295 HOH HOH B . 
O 8 HOH 137 837 296 HOH HOH B . 
O 8 HOH 138 838 297 HOH HOH B . 
O 8 HOH 139 839 300 HOH HOH B . 
O 8 HOH 140 840 301 HOH HOH B . 
O 8 HOH 141 841 305 HOH HOH B . 
O 8 HOH 142 842 306 HOH HOH B . 
O 8 HOH 143 843 308 HOH HOH B . 
O 8 HOH 144 844 312 HOH HOH B . 
O 8 HOH 145 845 313 HOH HOH B . 
O 8 HOH 146 846 315 HOH HOH B . 
O 8 HOH 147 847 318 HOH HOH B . 
O 8 HOH 148 848 319 HOH HOH B . 
O 8 HOH 149 849 320 HOH HOH B . 
O 8 HOH 150 850 321 HOH HOH B . 
O 8 HOH 151 851 322 HOH HOH B . 
O 8 HOH 152 852 324 HOH HOH B . 
O 8 HOH 153 853 325 HOH HOH B . 
O 8 HOH 154 854 326 HOH HOH B . 
O 8 HOH 155 855 327 HOH HOH B . 
O 8 HOH 156 856 328 HOH HOH B . 
O 8 HOH 157 857 329 HOH HOH B . 
O 8 HOH 158 858 330 HOH HOH B . 
O 8 HOH 159 859 332 HOH HOH B . 
O 8 HOH 160 860 339 HOH HOH B . 
O 8 HOH 161 861 343 HOH HOH B . 
O 8 HOH 162 862 344 HOH HOH B . 
O 8 HOH 163 863 345 HOH HOH B . 
O 8 HOH 164 864 347 HOH HOH B . 
O 8 HOH 165 865 352 HOH HOH B . 
O 8 HOH 166 866 353 HOH HOH B . 
O 8 HOH 167 867 355 HOH HOH B . 
O 8 HOH 168 868 364 HOH HOH B . 
O 8 HOH 169 869 367 HOH HOH B . 
O 8 HOH 170 870 369 HOH HOH B . 
O 8 HOH 171 871 370 HOH HOH B . 
O 8 HOH 172 872 371 HOH HOH B . 
O 8 HOH 173 873 377 HOH HOH B . 
O 8 HOH 174 874 384 HOH HOH B . 
O 8 HOH 175 875 386 HOH HOH B . 
O 8 HOH 176 876 387 HOH HOH B . 
O 8 HOH 177 877 388 HOH HOH B . 
O 8 HOH 178 878 389 HOH HOH B . 
O 8 HOH 179 879 392 HOH HOH B . 
O 8 HOH 180 880 393 HOH HOH B . 
O 8 HOH 181 881 395 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 B ASN 349 B ASN 350 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 349 A ASN 350 ? ASN 'GLYCOSYLATION SITE' 
3 B ASN 264 B ASN 265 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6810  ? 
1 MORE         30    ? 
1 'SSA (A^2)'  37590 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-10-17 
2 'Structure model' 1 1 2012-12-12 
3 'Structure model' 1 2 2017-11-15 
4 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Refinement description' 
3 4 'Structure model' 'Atomic model'           
4 4 'Structure model' 'Data collection'        
5 4 'Structure model' 'Derived calculations'   
6 4 'Structure model' 'Structure summary'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  3 'Structure model' software                      
2  4 'Structure model' atom_site                     
3  4 'Structure model' chem_comp                     
4  4 'Structure model' entity                        
5  4 'Structure model' pdbx_branch_scheme            
6  4 'Structure model' pdbx_chem_comp_identifier     
7  4 'Structure model' pdbx_entity_branch            
8  4 'Structure model' pdbx_entity_branch_descriptor 
9  4 'Structure model' pdbx_entity_branch_link       
10 4 'Structure model' pdbx_entity_branch_list       
11 4 'Structure model' pdbx_entity_nonpoly           
12 4 'Structure model' pdbx_nonpoly_scheme           
13 4 'Structure model' pdbx_struct_assembly_gen      
14 4 'Structure model' struct_asym                   
15 4 'Structure model' struct_conn                   
16 4 'Structure model' struct_site                   
17 4 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.B_iso_or_equiv'              
2  4 'Structure model' '_atom_site.Cartn_x'                     
3  4 'Structure model' '_atom_site.Cartn_y'                     
4  4 'Structure model' '_atom_site.Cartn_z'                     
5  4 'Structure model' '_atom_site.auth_asym_id'                
6  4 'Structure model' '_atom_site.auth_atom_id'                
7  4 'Structure model' '_atom_site.auth_comp_id'                
8  4 'Structure model' '_atom_site.auth_seq_id'                 
9  4 'Structure model' '_atom_site.label_asym_id'               
10 4 'Structure model' '_atom_site.label_atom_id'               
11 4 'Structure model' '_atom_site.label_comp_id'               
12 4 'Structure model' '_atom_site.label_entity_id'             
13 4 'Structure model' '_atom_site.occupancy'                   
14 4 'Structure model' '_atom_site.type_symbol'                 
15 4 'Structure model' '_chem_comp.name'                        
16 4 'Structure model' '_chem_comp.type'                        
17 4 'Structure model' '_entity.formula_weight'                 
18 4 'Structure model' '_entity.pdbx_description'               
19 4 'Structure model' '_entity.pdbx_number_of_molecules'       
20 4 'Structure model' '_entity.src_method'                     
21 4 'Structure model' '_entity.type'                           
22 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 
23 4 'Structure model' '_struct_conn.pdbx_dist_value'           
24 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'    
25 4 'Structure model' '_struct_conn.pdbx_role'                 
26 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'        
27 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'        
28 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'         
29 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'       
30 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'       
31 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'       
32 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'        
33 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'        
34 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'        
35 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'         
36 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'       
37 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'       
38 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'       
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO       .        ?                package 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data reduction'  
http://www.hkl-xray.com/                  ?   ? 
2 SCALEPACK   .        ?                package 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data scaling'    
http://www.hkl-xray.com/                  ?   ? 
3 PHENIX      1.8_1069 ?                package 'Paul D. Adams'      PDAdams@lbl.gov          refinement        
http://www.phenix-online.org/             C++ ? 
4 PDB_EXTRACT 3.11     'April 22, 2011' package PDB                  deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 
5 HKL-2000    .        ?                ?       ?                    ?                        'data collection' ? ?   ? 
6 HKL-2000    .        ?                ?       ?                    ?                        'data reduction'  ? ?   ? 
7 HKL-2000    .        ?                ?       ?                    ?                        'data scaling'    ? ?   ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 867 ? ? O A HOH 894 ? ? 1.99 
2 1 NE2 B GLN 527 ? ? O B HOH 869 ? ? 2.15 
3 1 NE2 A GLN 527 ? ? O A HOH 847 ? ? 2.16 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 47  ? ? 73.57   -11.10  
2  1 ALA A 62  ? ? -115.14 51.03   
3  1 ALA A 167 ? ? -151.58 76.71   
4  1 SER A 203 ? ? 60.71   -119.07 
5  1 PRO A 235 ? ? -51.16  -8.45   
6  1 ASP A 306 ? ? -90.97  -86.51  
7  1 VAL A 407 ? ? -127.08 -62.72  
8  1 PRO B 25  ? ? -36.94  -33.66  
9  1 PHE B 47  ? ? 72.55   -2.52   
10 1 ALA B 127 ? ? -170.06 148.11  
11 1 ALA B 167 ? ? -150.62 68.83   
12 1 SER B 203 ? ? 58.09   -122.11 
13 1 ASP B 306 ? ? -93.97  -87.08  
14 1 VAL B 407 ? ? -128.35 -64.94  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 2   ? A GLY 1   
2  1 Y 1 A ARG 3   ? A ARG 2   
3  1 Y 1 A PRO 259 ? A PRO 258 
4  1 Y 1 A GLY 260 ? A GLY 259 
5  1 Y 1 A GLY 261 ? A GLY 260 
6  1 Y 1 A THR 262 ? A THR 261 
7  1 Y 1 A GLY 263 ? A GLY 262 
8  1 Y 1 A GLY 264 ? A GLY 263 
9  1 Y 1 A PRO 495 ? A PRO 494 
10 1 Y 1 A LYS 496 ? A LYS 495 
11 1 Y 1 A ALA 497 ? A ALA 496 
12 1 Y 1 A THR 543 ? A THR 542 
13 1 Y 1 B GLY 2   ? B GLY 1   
14 1 Y 1 B ARG 3   ? B ARG 2   
15 1 Y 1 B GLY 260 ? B GLY 259 
16 1 Y 1 B GLY 261 ? B GLY 260 
17 1 Y 1 B ARG 493 ? B ARG 492 
18 1 Y 1 B ASP 494 ? B ASP 493 
19 1 Y 1 B THR 543 ? B THR 542 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
C 2 NAG 1 C NAG 1 C NAG 2 n 
C 2 NAG 2 C NAG 2 C NAG 3 n 
C 2 FUC 3 C FUC 3 C FUC 1 n 
D 2 NAG 1 D NAG 1 D NAG 2 n 
D 2 NAG 2 D NAG 2 D NAG 3 n 
D 2 FUC 3 D FUC 3 D FUC 1 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 LFucpa                         
FUC 'COMMON NAME'                         GMML     1.0 a-L-fucopyranose               
FUC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-L-Fucp                       
FUC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fuc                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 'DGlcpNAcb1-4[LFucpa1-6]DGlcpNAcb1-'                                         'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/2,3,2/[a2122h-1b_1-5_2*NCC/3=O][a1221m-1a_1-5]/1-1-2/a4-b1_a6-c1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}[(6+1)][a-L-Fucp]{}}}'        LINUCS                      PDB-CARE   ?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
2 2 3 FUC C1 O1 1 NAG O6 HO6 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
2 FUC 3 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 '(-)-GALANTHAMINE'                            GNT 
4 1,2-ETHANEDIOL                                EDO 
5 2-acetamido-2-deoxy-beta-D-glucopyranose      NAG 
6 'NITRATE ION'                                 NO3 
7 3,6,9,12,15,18,21-HEPTAOXATRICOSANE-1,23-DIOL PE8 
8 water                                         HOH 
#