data_4EY7
# 
_entry.id   4EY7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4EY7         
RCSB  RCSB072217   
WWPDB D_1000072217 
# 
_pdbx_database_status.entry_id                        4EY7 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-05-01 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Cheung, J.'    1 
'Rudolph, M.'   2 
'Burshteyn, F.' 3 
'Cassidy, M.'   4 
'Gary, E.'      5 
'Love, J.'      6 
'Height, J.'    7 
'Franklin, M.'  8 
# 
_citation.id                        primary 
_citation.title                     'Structures of human acetylcholinesterase in complex with pharmacologically important ligands.' 
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            55 
_citation.page_first                10282 
_citation.page_last                 10286 
_citation.year                      2012 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23035744 
_citation.pdbx_database_id_DOI      10.1021/jm300871x 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Cheung, J.'     1 ? 
primary 'Rudolph, M.J.'  2 ? 
primary 'Burshteyn, F.'  3 ? 
primary 'Cassidy, M.S.'  4 ? 
primary 'Gary, E.N.'     5 ? 
primary 'Love, J.'       6 ? 
primary 'Franklin, M.C.' 7 ? 
primary 'Height, J.J.'   8 ? 
# 
_cell.entry_id           4EY7 
_cell.length_a           105.147 
_cell.length_b           105.147 
_cell.length_c           322.977 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4EY7 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Acetylcholinesterase 59447.105 2   3.1.1.7 ? 'UNP Residues 33-574' ? 
2 branched    man 
'2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose' 570.542   2 
?       ? ?                     ? 
3 non-polymer syn '1-BENZYL-4-[(5,6-DIMETHOXY-1-INDANON-2-YL)METHYL]PIPERIDINE' 379.492   2   ?       ? ?                     ? 
4 non-polymer syn 1,2-ETHANEDIOL 62.068    3   ?       ? ?                     ? 
5 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   1   ?       ? ?                     ? 
6 non-polymer syn 'NITRATE ION' 62.005    2   ?       ? ?                     ? 
7 water       nat water 18.015    552 ?       ? ?                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ARG n 
1 3   GLU n 
1 4   ASP n 
1 5   ALA n 
1 6   GLU n 
1 7   LEU n 
1 8   LEU n 
1 9   VAL n 
1 10  THR n 
1 11  VAL n 
1 12  ARG n 
1 13  GLY n 
1 14  GLY n 
1 15  ARG n 
1 16  LEU n 
1 17  ARG n 
1 18  GLY n 
1 19  ILE n 
1 20  ARG n 
1 21  LEU n 
1 22  LYS n 
1 23  THR n 
1 24  PRO n 
1 25  GLY n 
1 26  GLY n 
1 27  PRO n 
1 28  VAL n 
1 29  SER n 
1 30  ALA n 
1 31  PHE n 
1 32  LEU n 
1 33  GLY n 
1 34  ILE n 
1 35  PRO n 
1 36  PHE n 
1 37  ALA n 
1 38  GLU n 
1 39  PRO n 
1 40  PRO n 
1 41  MET n 
1 42  GLY n 
1 43  PRO n 
1 44  ARG n 
1 45  ARG n 
1 46  PHE n 
1 47  LEU n 
1 48  PRO n 
1 49  PRO n 
1 50  GLU n 
1 51  PRO n 
1 52  LYS n 
1 53  GLN n 
1 54  PRO n 
1 55  TRP n 
1 56  SER n 
1 57  GLY n 
1 58  VAL n 
1 59  VAL n 
1 60  ASP n 
1 61  ALA n 
1 62  THR n 
1 63  THR n 
1 64  PHE n 
1 65  GLN n 
1 66  SER n 
1 67  VAL n 
1 68  CYS n 
1 69  TYR n 
1 70  GLN n 
1 71  TYR n 
1 72  VAL n 
1 73  ASP n 
1 74  THR n 
1 75  LEU n 
1 76  TYR n 
1 77  PRO n 
1 78  GLY n 
1 79  PHE n 
1 80  GLU n 
1 81  GLY n 
1 82  THR n 
1 83  GLU n 
1 84  MET n 
1 85  TRP n 
1 86  ASN n 
1 87  PRO n 
1 88  ASN n 
1 89  ARG n 
1 90  GLU n 
1 91  LEU n 
1 92  SER n 
1 93  GLU n 
1 94  ASP n 
1 95  CYS n 
1 96  LEU n 
1 97  TYR n 
1 98  LEU n 
1 99  ASN n 
1 100 VAL n 
1 101 TRP n 
1 102 THR n 
1 103 PRO n 
1 104 TYR n 
1 105 PRO n 
1 106 ARG n 
1 107 PRO n 
1 108 THR n 
1 109 SER n 
1 110 PRO n 
1 111 THR n 
1 112 PRO n 
1 113 VAL n 
1 114 LEU n 
1 115 VAL n 
1 116 TRP n 
1 117 ILE n 
1 118 TYR n 
1 119 GLY n 
1 120 GLY n 
1 121 GLY n 
1 122 PHE n 
1 123 TYR n 
1 124 SER n 
1 125 GLY n 
1 126 ALA n 
1 127 SER n 
1 128 SER n 
1 129 LEU n 
1 130 ASP n 
1 131 VAL n 
1 132 TYR n 
1 133 ASP n 
1 134 GLY n 
1 135 ARG n 
1 136 PHE n 
1 137 LEU n 
1 138 VAL n 
1 139 GLN n 
1 140 ALA n 
1 141 GLU n 
1 142 ARG n 
1 143 THR n 
1 144 VAL n 
1 145 LEU n 
1 146 VAL n 
1 147 SER n 
1 148 MET n 
1 149 ASN n 
1 150 TYR n 
1 151 ARG n 
1 152 VAL n 
1 153 GLY n 
1 154 ALA n 
1 155 PHE n 
1 156 GLY n 
1 157 PHE n 
1 158 LEU n 
1 159 ALA n 
1 160 LEU n 
1 161 PRO n 
1 162 GLY n 
1 163 SER n 
1 164 ARG n 
1 165 GLU n 
1 166 ALA n 
1 167 PRO n 
1 168 GLY n 
1 169 ASN n 
1 170 VAL n 
1 171 GLY n 
1 172 LEU n 
1 173 LEU n 
1 174 ASP n 
1 175 GLN n 
1 176 ARG n 
1 177 LEU n 
1 178 ALA n 
1 179 LEU n 
1 180 GLN n 
1 181 TRP n 
1 182 VAL n 
1 183 GLN n 
1 184 GLU n 
1 185 ASN n 
1 186 VAL n 
1 187 ALA n 
1 188 ALA n 
1 189 PHE n 
1 190 GLY n 
1 191 GLY n 
1 192 ASP n 
1 193 PRO n 
1 194 THR n 
1 195 SER n 
1 196 VAL n 
1 197 THR n 
1 198 LEU n 
1 199 PHE n 
1 200 GLY n 
1 201 GLU n 
1 202 SER n 
1 203 ALA n 
1 204 GLY n 
1 205 ALA n 
1 206 ALA n 
1 207 SER n 
1 208 VAL n 
1 209 GLY n 
1 210 MET n 
1 211 HIS n 
1 212 LEU n 
1 213 LEU n 
1 214 SER n 
1 215 PRO n 
1 216 PRO n 
1 217 SER n 
1 218 ARG n 
1 219 GLY n 
1 220 LEU n 
1 221 PHE n 
1 222 HIS n 
1 223 ARG n 
1 224 ALA n 
1 225 VAL n 
1 226 LEU n 
1 227 GLN n 
1 228 SER n 
1 229 GLY n 
1 230 ALA n 
1 231 PRO n 
1 232 ASN n 
1 233 GLY n 
1 234 PRO n 
1 235 TRP n 
1 236 ALA n 
1 237 THR n 
1 238 VAL n 
1 239 GLY n 
1 240 MET n 
1 241 GLY n 
1 242 GLU n 
1 243 ALA n 
1 244 ARG n 
1 245 ARG n 
1 246 ARG n 
1 247 ALA n 
1 248 THR n 
1 249 GLN n 
1 250 LEU n 
1 251 ALA n 
1 252 HIS n 
1 253 LEU n 
1 254 VAL n 
1 255 GLY n 
1 256 CYS n 
1 257 PRO n 
1 258 PRO n 
1 259 GLY n 
1 260 GLY n 
1 261 THR n 
1 262 GLY n 
1 263 GLY n 
1 264 ASN n 
1 265 ASP n 
1 266 THR n 
1 267 GLU n 
1 268 LEU n 
1 269 VAL n 
1 270 ALA n 
1 271 CYS n 
1 272 LEU n 
1 273 ARG n 
1 274 THR n 
1 275 ARG n 
1 276 PRO n 
1 277 ALA n 
1 278 GLN n 
1 279 VAL n 
1 280 LEU n 
1 281 VAL n 
1 282 ASN n 
1 283 HIS n 
1 284 GLU n 
1 285 TRP n 
1 286 HIS n 
1 287 VAL n 
1 288 LEU n 
1 289 PRO n 
1 290 GLN n 
1 291 GLU n 
1 292 SER n 
1 293 VAL n 
1 294 PHE n 
1 295 ARG n 
1 296 PHE n 
1 297 SER n 
1 298 PHE n 
1 299 VAL n 
1 300 PRO n 
1 301 VAL n 
1 302 VAL n 
1 303 ASP n 
1 304 GLY n 
1 305 ASP n 
1 306 PHE n 
1 307 LEU n 
1 308 SER n 
1 309 ASP n 
1 310 THR n 
1 311 PRO n 
1 312 GLU n 
1 313 ALA n 
1 314 LEU n 
1 315 ILE n 
1 316 ASN n 
1 317 ALA n 
1 318 GLY n 
1 319 ASP n 
1 320 PHE n 
1 321 HIS n 
1 322 GLY n 
1 323 LEU n 
1 324 GLN n 
1 325 VAL n 
1 326 LEU n 
1 327 VAL n 
1 328 GLY n 
1 329 VAL n 
1 330 VAL n 
1 331 LYS n 
1 332 ASP n 
1 333 GLU n 
1 334 GLY n 
1 335 SER n 
1 336 TYR n 
1 337 PHE n 
1 338 LEU n 
1 339 VAL n 
1 340 TYR n 
1 341 GLY n 
1 342 ALA n 
1 343 PRO n 
1 344 GLY n 
1 345 PHE n 
1 346 SER n 
1 347 LYS n 
1 348 ASP n 
1 349 ASN n 
1 350 GLU n 
1 351 SER n 
1 352 LEU n 
1 353 ILE n 
1 354 SER n 
1 355 ARG n 
1 356 ALA n 
1 357 GLU n 
1 358 PHE n 
1 359 LEU n 
1 360 ALA n 
1 361 GLY n 
1 362 VAL n 
1 363 ARG n 
1 364 VAL n 
1 365 GLY n 
1 366 VAL n 
1 367 PRO n 
1 368 GLN n 
1 369 VAL n 
1 370 SER n 
1 371 ASP n 
1 372 LEU n 
1 373 ALA n 
1 374 ALA n 
1 375 GLU n 
1 376 ALA n 
1 377 VAL n 
1 378 VAL n 
1 379 LEU n 
1 380 HIS n 
1 381 TYR n 
1 382 THR n 
1 383 ASP n 
1 384 TRP n 
1 385 LEU n 
1 386 HIS n 
1 387 PRO n 
1 388 GLU n 
1 389 ASP n 
1 390 PRO n 
1 391 ALA n 
1 392 ARG n 
1 393 LEU n 
1 394 ARG n 
1 395 GLU n 
1 396 ALA n 
1 397 LEU n 
1 398 SER n 
1 399 ASP n 
1 400 VAL n 
1 401 VAL n 
1 402 GLY n 
1 403 ASP n 
1 404 HIS n 
1 405 ASN n 
1 406 VAL n 
1 407 VAL n 
1 408 CYS n 
1 409 PRO n 
1 410 VAL n 
1 411 ALA n 
1 412 GLN n 
1 413 LEU n 
1 414 ALA n 
1 415 GLY n 
1 416 ARG n 
1 417 LEU n 
1 418 ALA n 
1 419 ALA n 
1 420 GLN n 
1 421 GLY n 
1 422 ALA n 
1 423 ARG n 
1 424 VAL n 
1 425 TYR n 
1 426 ALA n 
1 427 TYR n 
1 428 VAL n 
1 429 PHE n 
1 430 GLU n 
1 431 HIS n 
1 432 ARG n 
1 433 ALA n 
1 434 SER n 
1 435 THR n 
1 436 LEU n 
1 437 SER n 
1 438 TRP n 
1 439 PRO n 
1 440 LEU n 
1 441 TRP n 
1 442 MET n 
1 443 GLY n 
1 444 VAL n 
1 445 PRO n 
1 446 HIS n 
1 447 GLY n 
1 448 TYR n 
1 449 GLU n 
1 450 ILE n 
1 451 GLU n 
1 452 PHE n 
1 453 ILE n 
1 454 PHE n 
1 455 GLY n 
1 456 ILE n 
1 457 PRO n 
1 458 LEU n 
1 459 ASP n 
1 460 PRO n 
1 461 SER n 
1 462 ARG n 
1 463 ASN n 
1 464 TYR n 
1 465 THR n 
1 466 ALA n 
1 467 GLU n 
1 468 GLU n 
1 469 LYS n 
1 470 ILE n 
1 471 PHE n 
1 472 ALA n 
1 473 GLN n 
1 474 ARG n 
1 475 LEU n 
1 476 MET n 
1 477 ARG n 
1 478 TYR n 
1 479 TRP n 
1 480 ALA n 
1 481 ASN n 
1 482 PHE n 
1 483 ALA n 
1 484 ARG n 
1 485 THR n 
1 486 GLY n 
1 487 ASP n 
1 488 PRO n 
1 489 ASN n 
1 490 GLU n 
1 491 PRO n 
1 492 ARG n 
1 493 ASP n 
1 494 PRO n 
1 495 LYS n 
1 496 ALA n 
1 497 PRO n 
1 498 GLN n 
1 499 TRP n 
1 500 PRO n 
1 501 PRO n 
1 502 TYR n 
1 503 THR n 
1 504 ALA n 
1 505 GLY n 
1 506 ALA n 
1 507 GLN n 
1 508 GLN n 
1 509 TYR n 
1 510 VAL n 
1 511 SER n 
1 512 LEU n 
1 513 ASP n 
1 514 LEU n 
1 515 ARG n 
1 516 PRO n 
1 517 LEU n 
1 518 GLU n 
1 519 VAL n 
1 520 ARG n 
1 521 ARG n 
1 522 GLY n 
1 523 LEU n 
1 524 ARG n 
1 525 ALA n 
1 526 GLN n 
1 527 ALA n 
1 528 CYS n 
1 529 ALA n 
1 530 PHE n 
1 531 TRP n 
1 532 ASN n 
1 533 ARG n 
1 534 PHE n 
1 535 LEU n 
1 536 PRO n 
1 537 LYS n 
1 538 LEU n 
1 539 LEU n 
1 540 SER n 
1 541 ALA n 
1 542 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ACHE 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK-293 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_HUMAN 
_struct_ref.pdbx_db_accession          P22303 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_struct_ref.pdbx_align_begin           33 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4EY7 A 1 ? 542 ? P22303 33 ? 574 ? 2 543 
2 1 4EY7 B 1 ? 542 ? P22303 33 ? 574 ? 2 543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                                       ?                 'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking'           y ARGININE                                                      ?                 
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                                    ?                 'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                                               ?                 'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking'           y CYSTEINE                                                      ?                 'C3 H7 N O2 S' 
121.158 
E20 non-polymer                   . '1-BENZYL-4-[(5,6-DIMETHOXY-1-INDANON-2-YL)METHYL]PIPERIDINE' E2020             'C24 H29 N O3' 
379.492 
EDO non-polymer                   . 1,2-ETHANEDIOL                                                'ETHYLENE GLYCOL' 'C2 H6 O2' 
62.068  
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                                          ?                 'C6 H12 O5' 
164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                                     ?                 'C5 H10 N2 O3' 
146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                                               ?                 'C5 H9 N O4' 
147.129 
GLY 'peptide linking'             y GLYCINE                                                       ?                 'C2 H5 N O2' 
75.067  
HIS 'L-peptide linking'           y HISTIDINE                                                     ?                 
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                                         ?                 'H2 O' 18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                                    ?                 'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking'           y LEUCINE                                                       ?                 'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking'           y LYSINE                                                        ?                 
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE                                                    ?                 
'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose                      ?                 'C8 H15 N O6' 
221.208 
NO3 non-polymer                   . 'NITRATE ION'                                                 ?                 'N O3 -1' 
62.005  
PHE 'L-peptide linking'           y PHENYLALANINE                                                 ?                 'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking'           y PROLINE                                                       ?                 'C5 H9 N O2' 
115.130 
SER 'L-peptide linking'           y SERINE                                                        ?                 'C3 H7 N O3' 
105.093 
THR 'L-peptide linking'           y THREONINE                                                     ?                 'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                                    ?                 
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                                      ?                 'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking'           y VALINE                                                        ?                 'C5 H11 N O2' 
117.146 
# 
_exptl.entry_id          4EY7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.33 
_exptl_crystal.density_percent_sol   71.63 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'12 to 18% PEG 3350, 0.2M potassium nitrate, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 295K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2012-01-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.075 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.075 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4EY7 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.350 
_reflns.number_obs                   86541 
_reflns.number_all                   87239 
_reflns.percent_possible_obs         99.200 
_reflns.pdbx_Rmerge_I_obs            0.084 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        8.600 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.100 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.percent_possible_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_chi_squared 
1 1  2.350 2.390  98.400 0.626 ? ? 3.100 ? ? ? ? ? ? 
1 2  2.390 2.430  98.500 0.540 ? ? 3.100 ? ? ? ? ? ? 
1 3  2.430 2.480  98.800 0.502 ? ? 3.100 ? ? ? ? ? ? 
1 4  2.480 2.530  98.700 0.427 ? ? 3.100 ? ? ? ? ? ? 
1 5  2.530 2.590  98.900 0.365 ? ? 3.100 ? ? ? ? ? ? 
1 6  2.590 2.650  99.200 0.336 ? ? 3.100 ? ? ? ? ? ? 
1 7  2.650 2.710  99.300 0.280 ? ? 3.100 ? ? ? ? ? ? 
1 8  2.710 2.790  99.300 0.260 ? ? 3.100 ? ? ? ? ? ? 
1 9  2.790 2.870  99.400 0.214 ? ? 3.100 ? ? ? ? ? ? 
1 10 2.870 2.960  99.600 0.171 ? ? 3.100 ? ? ? ? ? ? 
1 11 2.960 3.070  99.700 0.136 ? ? 3.100 ? ? ? ? ? ? 
1 12 3.070 3.190  99.900 0.110 ? ? 3.100 ? ? ? ? ? ? 
1 13 3.190 3.330  99.800 0.086 ? ? 3.100 ? ? ? ? ? ? 
1 14 3.330 3.510  99.900 0.068 ? ? 3.100 ? ? ? ? ? ? 
1 15 3.510 3.730  99.900 0.052 ? ? 3.000 ? ? ? ? ? ? 
1 16 3.730 4.020  99.800 0.045 ? ? 3.000 ? ? ? ? ? ? 
1 17 4.020 4.420  99.600 0.043 ? ? 3.000 ? ? ? ? ? ? 
1 18 4.420 5.060  99.700 0.039 ? ? 3.000 ? ? ? ? ? ? 
1 19 5.060 6.370  98.800 0.035 ? ? 2.900 ? ? ? ? ? ? 
1 20 6.370 50.000 96.600 0.022 ? ? 3.000 ? ? ? ? ? ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4EY7 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     86469 
_refine.ls_number_reflns_all                     90847 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             47.242 
_refine.ls_d_res_high                            2.3509 
_refine.ls_percent_reflns_obs                    99.13 
_refine.ls_R_factor_obs                          0.1767 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1749 
_refine.ls_R_factor_R_free                       0.2115 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.02 
_refine.ls_number_reflns_R_free                  4340 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            0.440 
_refine.occupancy_max                            1.000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            6.4669 
_refine.aniso_B[2][2]                            6.4669 
_refine.aniso_B[3][3]                            -12.9337 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             1.20 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB EMNTRY 4EY8' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.23 
_refine.pdbx_overall_phase_error                 21.23 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8284 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         166 
_refine_hist.number_atoms_solvent             552 
_refine_hist.number_atoms_total               9002 
_refine_hist.d_res_high                       2.3509 
_refine_hist.d_res_low                        47.242 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.007  ? ? 8784  'X-RAY DIFFRACTION' ? 
f_angle_d          1.083  ? ? 12005 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 16.792 ? ? 3194  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.075  ? ? 1286  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 1575  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.3509 2.3776  2627 0.2687 96.00  0.3147 . . 155 . . . . 
'X-RAY DIFFRACTION' . 2.3776 2.4055  2651 0.2502 98.00  0.2976 . . 140 . . . . 
'X-RAY DIFFRACTION' . 2.4055 2.4349  2703 0.2381 99.00  0.3061 . . 142 . . . . 
'X-RAY DIFFRACTION' . 2.4349 2.4657  2694 0.2259 99.00  0.2516 . . 140 . . . . 
'X-RAY DIFFRACTION' . 2.4657 2.4981  2674 0.2235 99.00  0.2749 . . 161 . . . . 
'X-RAY DIFFRACTION' . 2.4981 2.5324  2657 0.2127 99.00  0.2355 . . 140 . . . . 
'X-RAY DIFFRACTION' . 2.5324 2.5685  2742 0.2112 99.00  0.2646 . . 126 . . . . 
'X-RAY DIFFRACTION' . 2.5685 2.6069  2664 0.2100 99.00  0.2793 . . 148 . . . . 
'X-RAY DIFFRACTION' . 2.6069 2.6476  2729 0.2025 99.00  0.2613 . . 161 . . . . 
'X-RAY DIFFRACTION' . 2.6476 2.6910  2682 0.1955 99.00  0.2342 . . 146 . . . . 
'X-RAY DIFFRACTION' . 2.6910 2.7374  2717 0.2002 99.00  0.2631 . . 143 . . . . 
'X-RAY DIFFRACTION' . 2.7374 2.7872  2727 0.1927 99.00  0.2528 . . 146 . . . . 
'X-RAY DIFFRACTION' . 2.7872 2.8408  2730 0.1997 99.00  0.2643 . . 147 . . . . 
'X-RAY DIFFRACTION' . 2.8408 2.8988  2736 0.1903 100.00 0.2635 . . 128 . . . . 
'X-RAY DIFFRACTION' . 2.8988 2.9618  2713 0.1889 100.00 0.2282 . . 138 . . . . 
'X-RAY DIFFRACTION' . 2.9618 3.0307  2741 0.1838 100.00 0.2149 . . 146 . . . . 
'X-RAY DIFFRACTION' . 3.0307 3.1064  2735 0.1794 100.00 0.2328 . . 140 . . . . 
'X-RAY DIFFRACTION' . 3.1064 3.1904  2767 0.1875 100.00 0.2162 . . 141 . . . . 
'X-RAY DIFFRACTION' . 3.1904 3.2843  2753 0.1840 100.00 0.2098 . . 141 . . . . 
'X-RAY DIFFRACTION' . 3.2843 3.3902  2766 0.1782 100.00 0.2071 . . 145 . . . . 
'X-RAY DIFFRACTION' . 3.3902 3.5114  2739 0.1806 100.00 0.2271 . . 152 . . . . 
'X-RAY DIFFRACTION' . 3.5114 3.6519  2768 0.1681 100.00 0.1891 . . 137 . . . . 
'X-RAY DIFFRACTION' . 3.6519 3.8181  2722 0.1624 100.00 0.1902 . . 158 . . . . 
'X-RAY DIFFRACTION' . 3.8181 4.0193  2804 0.1500 100.00 0.1916 . . 137 . . . . 
'X-RAY DIFFRACTION' . 4.0193 4.2709  2758 0.1440 100.00 0.1630 . . 137 . . . . 
'X-RAY DIFFRACTION' . 4.2709 4.6004  2793 0.1335 99.00  0.1664 . . 161 . . . . 
'X-RAY DIFFRACTION' . 4.6004 5.0629  2816 0.1324 100.00 0.1503 . . 134 . . . . 
'X-RAY DIFFRACTION' . 5.0629 5.7944  2795 0.1567 99.00  0.1902 . . 156 . . . . 
'X-RAY DIFFRACTION' . 5.7944 7.2960  2817 0.1689 99.00  0.2063 . . 152 . . . . 
'X-RAY DIFFRACTION' . 7.2960 47.2511 2909 0.1679 96.00  0.1835 . . 142 . . . . 
# 
_struct.entry_id                  4EY7 
_struct.title                     'Crystal Structure of Recombinant Human Acetylcholinesterase in Complex with Donepezil' 
_struct.pdbx_descriptor           'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4EY7 
_struct_keywords.text            'acetylcholinesterase, hydrolase, donepezil, inhibitor, HYDROLASE-HYDROLASE INHIBITOR complex' 
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE INHIBITOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 5 ? 
I N N 3 ? 
J N N 4 ? 
K N N 6 ? 
L N N 6 ? 
M N N 7 ? 
N N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 4   ? GLU A 6   ? ASP A 5   GLU A 7   5 ? 3  
HELX_P HELX_P2  2  MET A 41  ? ARG A 45  ? MET A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  3  PHE A 79  ? MET A 84  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  4  LEU A 129 ? ASP A 133 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  5  GLY A 134 ? ARG A 142 ? GLY A 135 ARG A 143 1 ? 9  
HELX_P HELX_P6  6  VAL A 152 ? LEU A 158 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  7  ASN A 169 ? VAL A 186 ? ASN A 170 VAL A 187 1 ? 18 
HELX_P HELX_P8  8  ALA A 187 ? PHE A 189 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  9  SER A 202 ? LEU A 213 ? SER A 203 LEU A 214 1 ? 12 
HELX_P HELX_P10 10 SER A 214 ? GLY A 219 ? SER A 215 GLY A 220 1 ? 6  
HELX_P HELX_P11 11 GLY A 239 ? VAL A 254 ? GLY A 240 VAL A 255 1 ? 16 
HELX_P HELX_P12 12 ASP A 265 ? THR A 274 ? ASP A 266 THR A 275 1 ? 10 
HELX_P HELX_P13 13 PRO A 276 ? HIS A 283 ? PRO A 277 HIS A 284 1 ? 8  
HELX_P HELX_P14 14 GLU A 284 ? LEU A 288 ? GLU A 285 LEU A 289 5 ? 5  
HELX_P HELX_P15 15 THR A 310 ? ALA A 317 ? THR A 311 ALA A 318 1 ? 8  
HELX_P HELX_P16 16 GLY A 334 ? GLY A 341 ? GLY A 335 GLY A 342 5 ? 8  
HELX_P HELX_P17 17 SER A 354 ? VAL A 366 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 18 SER A 370 ? THR A 382 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 19 ASP A 389 ? VAL A 406 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 20 VAL A 406 ? GLN A 420 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P21 21 PRO A 439 ? GLY A 443 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 22 GLU A 449 ? PHE A 454 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 23 GLY A 455 ? ASP A 459 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P24 24 THR A 465 ? GLY A 486 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P25 25 ARG A 524 ? ARG A 533 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P26 26 ARG A 533 ? SER A 540 ? ARG A 534 SER A 541 1 ? 8  
HELX_P HELX_P27 27 ASP B 4   ? GLU B 6   ? ASP B 5   GLU B 7   5 ? 3  
HELX_P HELX_P28 28 MET B 41  ? ARG B 45  ? MET B 42  ARG B 46  5 ? 5  
HELX_P HELX_P29 29 PHE B 79  ? MET B 84  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P30 30 LEU B 129 ? ASP B 133 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P31 31 GLY B 134 ? ARG B 142 ? GLY B 135 ARG B 143 1 ? 9  
HELX_P HELX_P32 32 VAL B 152 ? LEU B 158 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P33 33 ASN B 169 ? VAL B 186 ? ASN B 170 VAL B 187 1 ? 18 
HELX_P HELX_P34 34 ALA B 187 ? PHE B 189 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P35 35 SER B 202 ? LEU B 213 ? SER B 203 LEU B 214 1 ? 12 
HELX_P HELX_P36 36 SER B 214 ? GLY B 219 ? SER B 215 GLY B 220 1 ? 6  
HELX_P HELX_P37 37 GLY B 239 ? VAL B 254 ? GLY B 240 VAL B 255 1 ? 16 
HELX_P HELX_P38 38 ASN B 264 ? THR B 274 ? ASN B 265 THR B 275 1 ? 11 
HELX_P HELX_P39 39 PRO B 276 ? GLU B 284 ? PRO B 277 GLU B 285 1 ? 9  
HELX_P HELX_P40 40 TRP B 285 ? LEU B 288 ? TRP B 286 LEU B 289 5 ? 4  
HELX_P HELX_P41 41 THR B 310 ? ALA B 317 ? THR B 311 ALA B 318 1 ? 8  
HELX_P HELX_P42 42 GLY B 334 ? GLY B 341 ? GLY B 335 GLY B 342 5 ? 8  
HELX_P HELX_P43 43 SER B 354 ? VAL B 366 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P44 44 SER B 370 ? THR B 382 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P45 45 ASP B 389 ? VAL B 406 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P46 46 VAL B 406 ? GLN B 420 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P47 47 PRO B 439 ? GLY B 443 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P48 48 GLU B 449 ? PHE B 454 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P49 49 GLY B 455 ? ASP B 459 ? GLY B 456 ASP B 460 5 ? 5  
HELX_P HELX_P50 50 THR B 465 ? GLY B 486 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P51 51 ARG B 524 ? ARG B 533 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P52 52 PHE B 534 ? SER B 540 ? PHE B 535 SER B 541 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 68  SG  ? ? ? 1_555 A CYS 95  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.056 ? ?               
disulf2 disulf ?    ? A CYS 256 SG  ? ? ? 1_555 A CYS 271 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.064 ? ?               
disulf3 disulf ?    ? A CYS 408 SG  ? ? ? 1_555 A CYS 528 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf4 disulf ?    ? B CYS 68  SG  ? ? ? 1_555 B CYS 95  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.073 ? ?               
disulf5 disulf ?    ? B CYS 256 SG  ? ? ? 1_555 B CYS 271 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.060 ? ?               
disulf6 disulf ?    ? B CYS 408 SG  ? ? ? 1_555 B CYS 528 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.036 ? ?               
covale1 covale one  ? A ASN 349 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 350 C NAG 1   1_555 ? ? ? ? ? ? ? 1.479 ? N-Glycosylation 
covale2 covale one  ? B ASN 264 ND2 ? ? ? 1_555 H NAG .   C1 ? ? B ASN 265 B NAG 604 1_555 ? ? ? ? ? ? ? 1.483 ? N-Glycosylation 
covale3 covale one  ? B ASN 349 ND2 ? ? ? 1_555 D NAG .   C1 ? ? B ASN 350 D NAG 1   1_555 ? ? ? ? ? ? ? 1.488 ? N-Glycosylation 
covale4 covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1 ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.470 ? ?               
covale5 covale both ? C NAG .   O6  ? ? ? 1_555 C FUC .   C1 ? ? C NAG 1   C FUC 3   1_555 ? ? ? ? ? ? ? 1.436 ? ?               
covale6 covale both ? D NAG .   O4  ? ? ? 1_555 D NAG .   C1 ? ? D NAG 1   D NAG 2   1_555 ? ? ? ? ? ? ? 1.477 ? ?               
covale7 covale both ? D NAG .   O6  ? ? ? 1_555 D FUC .   C1 ? ? D NAG 1   D FUC 3   1_555 ? ? ? ? ? ? ? 1.448 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 104 A . ? TYR 105 A PRO 105 A ? PRO 106 A 1 -1.68 
2 TYR 104 B . ? TYR 105 B PRO 105 B ? PRO 106 B 1 5.33  
3 CYS 256 B . ? CYS 257 B PRO 257 B ? PRO 258 B 1 -4.20 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
C ? 2  ? 
D ? 3  ? 
E ? 11 ? 
F ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? anti-parallel 
C 1  2  ? parallel      
D 1  2  ? anti-parallel 
D 2  3  ? parallel      
E 1  2  ? anti-parallel 
E 2  3  ? anti-parallel 
E 3  4  ? anti-parallel 
E 4  5  ? parallel      
E 5  6  ? parallel      
E 6  7  ? parallel      
E 7  8  ? parallel      
E 8  9  ? parallel      
E 9  10 ? parallel      
E 10 11 ? anti-parallel 
F 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 8   ? VAL A 11  ? LEU A 9   VAL A 12  
A 2  GLY A 14  ? ARG A 17  ? GLY A 15  ARG A 18  
A 3  VAL A 58  ? ASP A 60  ? VAL A 59  ASP A 61  
B 1  ILE A 19  ? LEU A 21  ? ILE A 20  LEU A 22  
B 2  VAL A 28  ? PRO A 35  ? VAL A 29  PRO A 36  
B 3  TYR A 97  ? PRO A 103 ? TYR A 98  PRO A 104 
B 4  VAL A 144 ? MET A 148 ? VAL A 145 MET A 149 
B 5  THR A 111 ? ILE A 117 ? THR A 112 ILE A 118 
B 6  GLY A 191 ? GLU A 201 ? GLY A 192 GLU A 202 
B 7  ARG A 223 ? GLN A 227 ? ARG A 224 GLN A 228 
B 8  GLN A 324 ? VAL A 330 ? GLN A 325 VAL A 331 
B 9  ARG A 423 ? PHE A 429 ? ARG A 424 PHE A 430 
B 10 GLN A 508 ? LEU A 512 ? GLN A 509 LEU A 513 
B 11 GLU A 518 ? ARG A 521 ? GLU A 519 ARG A 522 
C 1  VAL A 67  ? CYS A 68  ? VAL A 68  CYS A 69  
C 2  LEU A 91  ? SER A 92  ? LEU A 92  SER A 93  
D 1  LEU B 8   ? VAL B 11  ? LEU B 9   VAL B 12  
D 2  GLY B 14  ? ARG B 17  ? GLY B 15  ARG B 18  
D 3  VAL B 58  ? ASP B 60  ? VAL B 59  ASP B 61  
E 1  ILE B 19  ? LEU B 21  ? ILE B 20  LEU B 22  
E 2  VAL B 28  ? PRO B 35  ? VAL B 29  PRO B 36  
E 3  TYR B 97  ? PRO B 103 ? TYR B 98  PRO B 104 
E 4  VAL B 144 ? MET B 148 ? VAL B 145 MET B 149 
E 5  THR B 111 ? ILE B 117 ? THR B 112 ILE B 118 
E 6  GLY B 191 ? GLU B 201 ? GLY B 192 GLU B 202 
E 7  ARG B 223 ? GLN B 227 ? ARG B 224 GLN B 228 
E 8  GLN B 324 ? VAL B 330 ? GLN B 325 VAL B 331 
E 9  ARG B 423 ? PHE B 429 ? ARG B 424 PHE B 430 
E 10 GLN B 508 ? LEU B 512 ? GLN B 509 LEU B 513 
E 11 GLU B 518 ? ARG B 521 ? GLU B 519 ARG B 522 
F 1  VAL B 67  ? CYS B 68  ? VAL B 68  CYS B 69  
F 2  LEU B 91  ? SER B 92  ? LEU B 92  SER B 93  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N VAL A 9   ? N VAL A 10  O LEU A 16  ? O LEU A 17  
A 2  3  N ARG A 15  ? N ARG A 16  O VAL A 59  ? O VAL A 60  
B 1  2  N LEU A 21  ? N LEU A 22  O VAL A 28  ? O VAL A 29  
B 2  3  N SER A 29  ? N SER A 30  O THR A 102 ? O THR A 103 
B 3  4  N ASN A 99  ? N ASN A 100 O SER A 147 ? O SER A 148 
B 4  5  O VAL A 144 ? O VAL A 145 N LEU A 114 ? N LEU A 115 
B 5  6  N VAL A 113 ? N VAL A 114 O THR A 197 ? O THR A 198 
B 6  7  N GLY A 200 ? N GLY A 201 O GLN A 227 ? O GLN A 228 
B 7  8  N LEU A 226 ? N LEU A 227 O LEU A 326 ? O LEU A 327 
B 8  9  N VAL A 327 ? N VAL A 328 O TYR A 425 ? O TYR A 426 
B 9  10 N VAL A 428 ? N VAL A 429 O LEU A 512 ? O LEU A 513 
B 10 11 N TYR A 509 ? N TYR A 510 O ARG A 520 ? O ARG A 521 
C 1  2  N VAL A 67  ? N VAL A 68  O SER A 92  ? O SER A 93  
D 1  2  N VAL B 9   ? N VAL B 10  O LEU B 16  ? O LEU B 17  
D 2  3  N ARG B 15  ? N ARG B 16  O VAL B 59  ? O VAL B 60  
E 1  2  N LEU B 21  ? N LEU B 22  O VAL B 28  ? O VAL B 29  
E 2  3  N PHE B 31  ? N PHE B 32  O VAL B 100 ? O VAL B 101 
E 3  4  N ASN B 99  ? N ASN B 100 O SER B 147 ? O SER B 148 
E 4  5  O VAL B 146 ? O VAL B 147 N LEU B 114 ? N LEU B 115 
E 5  6  N THR B 111 ? N THR B 112 O ASP B 192 ? O ASP B 193 
E 6  7  N GLY B 200 ? N GLY B 201 O GLN B 227 ? O GLN B 228 
E 7  8  N LEU B 226 ? N LEU B 227 O LEU B 326 ? O LEU B 327 
E 8  9  N VAL B 327 ? N VAL B 328 O TYR B 425 ? O TYR B 426 
E 9  10 N VAL B 428 ? N VAL B 429 O LEU B 512 ? O LEU B 513 
E 10 11 N TYR B 509 ? N TYR B 510 O ARG B 520 ? O ARG B 521 
F 1  2  N VAL B 67  ? N VAL B 68  O SER B 92  ? O SER B 93  
# 
_atom_sites.entry_id                    4EY7 
_atom_sites.fract_transf_matrix[1][1]   0.009510 
_atom_sites.fract_transf_matrix[1][2]   0.005491 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010982 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003096 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 3   ? 2.514   -35.401 69.696  1.00 63.34  ? 4   GLU A N   1 
ATOM   2    C CA  . GLU A 1 3   ? 2.230   -35.193 68.280  1.00 69.93  ? 4   GLU A CA  1 
ATOM   3    C C   . GLU A 1 3   ? 3.436   -35.566 67.408  1.00 69.11  ? 4   GLU A C   1 
ATOM   4    O O   . GLU A 1 3   ? 4.572   -35.606 67.889  1.00 68.26  ? 4   GLU A O   1 
ATOM   5    C CB  . GLU A 1 3   ? 1.808   -33.745 68.027  1.00 75.30  ? 4   GLU A CB  1 
ATOM   6    C CG  . GLU A 1 3   ? 1.007   -33.544 66.749  1.00 72.83  ? 4   GLU A CG  1 
ATOM   7    C CD  . GLU A 1 3   ? 0.729   -32.081 66.462  1.00 85.00  ? 4   GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 3   ? 1.240   -31.222 67.218  1.00 82.36  ? 4   GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 3   ? 0.004   -31.791 65.480  1.00 82.44  ? 4   GLU A OE2 1 
ATOM   10   N N   . ASP A 1 4   ? 3.181   -35.833 66.128  1.00 52.26  ? 5   ASP A N   1 
ATOM   11   C CA  . ASP A 1 4   ? 4.201   -36.371 65.228  1.00 52.44  ? 5   ASP A CA  1 
ATOM   12   C C   . ASP A 1 4   ? 4.816   -35.290 64.335  1.00 54.45  ? 5   ASP A C   1 
ATOM   13   O O   . ASP A 1 4   ? 4.158   -34.780 63.425  1.00 49.84  ? 5   ASP A O   1 
ATOM   14   C CB  . ASP A 1 4   ? 3.594   -37.477 64.366  1.00 39.43  ? 5   ASP A CB  1 
ATOM   15   C CG  . ASP A 1 4   ? 4.644   -38.385 63.750  1.00 48.34  ? 5   ASP A CG  1 
ATOM   16   O OD1 . ASP A 1 4   ? 4.289   -39.534 63.394  1.00 48.09  ? 5   ASP A OD1 1 
ATOM   17   O OD2 . ASP A 1 4   ? 5.819   -37.960 63.629  1.00 39.55  ? 5   ASP A OD2 1 
ATOM   18   N N   . ALA A 1 5   ? 6.083   -34.963 64.591  1.00 49.41  ? 6   ALA A N   1 
ATOM   19   C CA  . ALA A 1 5   ? 6.767   -33.874 63.893  1.00 47.25  ? 6   ALA A CA  1 
ATOM   20   C C   . ALA A 1 5   ? 6.999   -34.189 62.421  1.00 50.52  ? 6   ALA A C   1 
ATOM   21   O O   . ALA A 1 5   ? 7.210   -33.285 61.609  1.00 49.69  ? 6   ALA A O   1 
ATOM   22   C CB  . ALA A 1 5   ? 8.095   -33.552 64.569  1.00 39.15  ? 6   ALA A CB  1 
ATOM   23   N N   . GLU A 1 6   ? 6.976   -35.472 62.081  1.00 44.06  ? 7   GLU A N   1 
ATOM   24   C CA  . GLU A 1 6   ? 7.172   -35.882 60.701  1.00 44.76  ? 7   GLU A CA  1 
ATOM   25   C C   . GLU A 1 6   ? 6.010   -35.441 59.803  1.00 43.05  ? 7   GLU A C   1 
ATOM   26   O O   . GLU A 1 6   ? 6.171   -35.278 58.594  1.00 37.71  ? 7   GLU A O   1 
ATOM   27   C CB  . GLU A 1 6   ? 7.350   -37.396 60.629  1.00 47.62  ? 7   GLU A CB  1 
ATOM   28   C CG  . GLU A 1 6   ? 8.570   -37.904 61.377  1.00 46.10  ? 7   GLU A CG  1 
ATOM   29   C CD  . GLU A 1 6   ? 9.875   -37.419 60.768  1.00 51.67  ? 7   GLU A CD  1 
ATOM   30   O OE1 . GLU A 1 6   ? 9.880   -37.016 59.580  1.00 46.41  ? 7   GLU A OE1 1 
ATOM   31   O OE2 . GLU A 1 6   ? 10.901  -37.451 61.480  1.00 47.54  ? 7   GLU A OE2 1 
ATOM   32   N N   . LEU A 1 7   ? 4.848   -35.237 60.411  1.00 37.36  ? 8   LEU A N   1 
ATOM   33   C CA  . LEU A 1 7   ? 3.632   -34.935 59.678  1.00 37.81  ? 8   LEU A CA  1 
ATOM   34   C C   . LEU A 1 7   ? 3.298   -33.450 59.708  1.00 37.82  ? 8   LEU A C   1 
ATOM   35   O O   . LEU A 1 7   ? 2.201   -33.047 59.321  1.00 34.33  ? 8   LEU A O   1 
ATOM   36   C CB  . LEU A 1 7   ? 2.471   -35.737 60.268  1.00 37.14  ? 8   LEU A CB  1 
ATOM   37   C CG  . LEU A 1 7   ? 2.729   -37.240 60.358  1.00 40.81  ? 8   LEU A CG  1 
ATOM   38   C CD1 . LEU A 1 7   ? 1.502   -37.949 60.910  1.00 36.15  ? 8   LEU A CD1 1 
ATOM   39   C CD2 . LEU A 1 7   ? 3.125   -37.797 58.983  1.00 31.05  ? 8   LEU A CD2 1 
ATOM   40   N N   . LEU A 1 8   ? 4.237   -32.644 60.192  1.00 37.67  ? 9   LEU A N   1 
ATOM   41   C CA  . LEU A 1 8   ? 4.085   -31.195 60.163  1.00 33.55  ? 9   LEU A CA  1 
ATOM   42   C C   . LEU A 1 8   ? 5.075   -30.632 59.166  1.00 34.56  ? 9   LEU A C   1 
ATOM   43   O O   . LEU A 1 8   ? 6.267   -30.920 59.239  1.00 36.14  ? 9   LEU A O   1 
ATOM   44   C CB  . LEU A 1 8   ? 4.334   -30.587 61.543  1.00 38.69  ? 9   LEU A CB  1 
ATOM   45   C CG  . LEU A 1 8   ? 3.406   -31.057 62.662  1.00 44.18  ? 9   LEU A CG  1 
ATOM   46   C CD1 . LEU A 1 8   ? 3.760   -30.381 63.980  1.00 36.23  ? 9   LEU A CD1 1 
ATOM   47   C CD2 . LEU A 1 8   ? 1.948   -30.806 62.293  1.00 39.51  ? 9   LEU A CD2 1 
ATOM   48   N N   . VAL A 1 9   ? 4.569   -29.852 58.215  1.00 32.80  ? 10  VAL A N   1 
ATOM   49   C CA  . VAL A 1 9   ? 5.402   -29.249 57.181  1.00 28.75  ? 10  VAL A CA  1 
ATOM   50   C C   . VAL A 1 9   ? 4.956   -27.810 56.965  1.00 28.14  ? 10  VAL A C   1 
ATOM   51   O O   . VAL A 1 9   ? 3.764   -27.495 57.022  1.00 25.42  ? 10  VAL A O   1 
ATOM   52   C CB  . VAL A 1 9   ? 5.265   -29.985 55.813  1.00 33.53  ? 10  VAL A CB  1 
ATOM   53   C CG1 . VAL A 1 9   ? 6.195   -29.378 54.770  1.00 33.30  ? 10  VAL A CG1 1 
ATOM   54   C CG2 . VAL A 1 9   ? 5.555   -31.447 55.956  1.00 37.85  ? 10  VAL A CG2 1 
ATOM   55   N N   . THR A 1 10  ? 5.913   -26.936 56.701  1.00 32.95  ? 11  THR A N   1 
ATOM   56   C CA  . THR A 1 10  ? 5.588   -25.570 56.351  1.00 33.65  ? 11  THR A CA  1 
ATOM   57   C C   . THR A 1 10  ? 5.986   -25.337 54.909  1.00 29.68  ? 11  THR A C   1 
ATOM   58   O O   . THR A 1 10  ? 7.135   -25.543 54.530  1.00 32.40  ? 11  THR A O   1 
ATOM   59   C CB  . THR A 1 10  ? 6.300   -24.564 57.280  1.00 34.32  ? 11  THR A CB  1 
ATOM   60   O OG1 . THR A 1 10  ? 5.942   -24.844 58.642  1.00 35.79  ? 11  THR A OG1 1 
ATOM   61   C CG2 . THR A 1 10  ? 5.894   -23.136 56.933  1.00 27.62  ? 11  THR A CG2 1 
ATOM   62   N N   . VAL A 1 11  ? 5.016   -24.941 54.098  1.00 26.59  ? 12  VAL A N   1 
ATOM   63   C CA  . VAL A 1 11  ? 5.291   -24.567 52.720  1.00 33.50  ? 12  VAL A CA  1 
ATOM   64   C C   . VAL A 1 11  ? 5.092   -23.064 52.633  1.00 30.59  ? 12  VAL A C   1 
ATOM   65   O O   . VAL A 1 11  ? 4.693   -22.436 53.611  1.00 37.88  ? 12  VAL A O   1 
ATOM   66   C CB  . VAL A 1 11  ? 4.378   -25.323 51.718  1.00 29.54  ? 12  VAL A CB  1 
ATOM   67   C CG1 . VAL A 1 11  ? 4.746   -26.792 51.688  1.00 28.07  ? 12  VAL A CG1 1 
ATOM   68   C CG2 . VAL A 1 11  ? 2.895   -25.152 52.078  1.00 22.96  ? 12  VAL A CG2 1 
ATOM   69   N N   . ARG A 1 12  ? 5.365   -22.487 51.476  1.00 29.75  ? 13  ARG A N   1 
ATOM   70   C CA  . ARG A 1 12  ? 5.316   -21.039 51.322  1.00 31.99  ? 13  ARG A CA  1 
ATOM   71   C C   . ARG A 1 12  ? 3.998   -20.406 51.748  1.00 30.74  ? 13  ARG A C   1 
ATOM   72   O O   . ARG A 1 12  ? 3.981   -19.295 52.263  1.00 39.48  ? 13  ARG A O   1 
ATOM   73   C CB  . ARG A 1 12  ? 5.663   -20.643 49.883  1.00 27.11  ? 13  ARG A CB  1 
ATOM   74   C CG  . ARG A 1 12  ? 7.114   -20.909 49.557  1.00 34.49  ? 13  ARG A CG  1 
ATOM   75   C CD  . ARG A 1 12  ? 7.582   -20.190 48.308  1.00 46.28  ? 13  ARG A CD  1 
ATOM   76   N NE  . ARG A 1 12  ? 8.927   -20.623 47.931  1.00 55.78  ? 13  ARG A NE  1 
ATOM   77   C CZ  . ARG A 1 12  ? 9.582   -20.193 46.857  1.00 55.33  ? 13  ARG A CZ  1 
ATOM   78   N NH1 . ARG A 1 12  ? 9.017   -19.309 46.046  1.00 55.82  ? 13  ARG A NH1 1 
ATOM   79   N NH2 . ARG A 1 12  ? 10.802  -20.650 46.593  1.00 51.58  ? 13  ARG A NH2 1 
ATOM   80   N N   . GLY A 1 13  ? 2.896   -21.112 51.541  1.00 33.97  ? 14  GLY A N   1 
ATOM   81   C CA  . GLY A 1 13  ? 1.589   -20.553 51.824  1.00 28.80  ? 14  GLY A CA  1 
ATOM   82   C C   . GLY A 1 13  ? 1.136   -20.752 53.255  1.00 31.36  ? 14  GLY A C   1 
ATOM   83   O O   . GLY A 1 13  ? 0.104   -20.219 53.662  1.00 35.36  ? 14  GLY A O   1 
ATOM   84   N N   . GLY A 1 14  ? 1.900   -21.517 54.028  1.00 34.77  ? 15  GLY A N   1 
ATOM   85   C CA  . GLY A 1 14  ? 1.525   -21.792 55.403  1.00 32.18  ? 15  GLY A CA  1 
ATOM   86   C C   . GLY A 1 14  ? 1.807   -23.214 55.846  1.00 29.53  ? 15  GLY A C   1 
ATOM   87   O O   . GLY A 1 14  ? 2.558   -23.944 55.201  1.00 35.95  ? 15  GLY A O   1 
ATOM   88   N N   . ARG A 1 15  ? 1.193   -23.602 56.957  1.00 34.28  ? 16  ARG A N   1 
ATOM   89   C CA  . ARG A 1 15  ? 1.494   -24.870 57.609  1.00 36.24  ? 16  ARG A CA  1 
ATOM   90   C C   . ARG A 1 15  ? 0.532   -25.995 57.210  1.00 34.39  ? 16  ARG A C   1 
ATOM   91   O O   . ARG A 1 15  ? -0.656  -25.754 56.976  1.00 31.78  ? 16  ARG A O   1 
ATOM   92   C CB  . ARG A 1 15  ? 1.481   -24.682 59.131  1.00 37.88  ? 16  ARG A CB  1 
ATOM   93   C CG  . ARG A 1 15  ? 2.704   -23.935 59.691  1.00 44.59  ? 16  ARG A CG  1 
ATOM   94   C CD  . ARG A 1 15  ? 2.591   -23.720 61.209  1.00 36.64  ? 16  ARG A CD  1 
ATOM   95   N NE  . ARG A 1 15  ? 1.441   -22.888 61.552  1.00 46.69  ? 16  ARG A NE  1 
ATOM   96   C CZ  . ARG A 1 15  ? 0.685   -23.055 62.635  1.00 52.46  ? 16  ARG A CZ  1 
ATOM   97   N NH1 . ARG A 1 15  ? 0.949   -24.035 63.489  1.00 49.27  ? 16  ARG A NH1 1 
ATOM   98   N NH2 . ARG A 1 15  ? -0.344  -22.243 62.862  1.00 47.23  ? 16  ARG A NH2 1 
ATOM   99   N N   . LEU A 1 16  ? 1.058   -27.222 57.162  1.00 28.61  ? 17  LEU A N   1 
ATOM   100  C CA  . LEU A 1 16  ? 0.282   -28.410 56.796  1.00 32.47  ? 17  LEU A CA  1 
ATOM   101  C C   . LEU A 1 16  ? 0.421   -29.511 57.836  1.00 29.60  ? 17  LEU A C   1 
ATOM   102  O O   . LEU A 1 16  ? 1.482   -29.678 58.442  1.00 28.51  ? 17  LEU A O   1 
ATOM   103  C CB  . LEU A 1 16  ? 0.777   -28.993 55.462  1.00 29.75  ? 17  LEU A CB  1 
ATOM   104  C CG  . LEU A 1 16  ? 0.773   -28.112 54.223  1.00 27.85  ? 17  LEU A CG  1 
ATOM   105  C CD1 . LEU A 1 16  ? 1.429   -28.843 53.050  1.00 26.86  ? 17  LEU A CD1 1 
ATOM   106  C CD2 . LEU A 1 16  ? -0.655  -27.726 53.894  1.00 31.11  ? 17  LEU A CD2 1 
ATOM   107  N N   . ARG A 1 17  ? -0.645  -30.287 58.000  1.00 29.63  ? 18  ARG A N   1 
ATOM   108  C CA  . ARG A 1 17  ? -0.599  -31.514 58.787  1.00 35.47  ? 18  ARG A CA  1 
ATOM   109  C C   . ARG A 1 17  ? -0.925  -32.725 57.902  1.00 39.58  ? 18  ARG A C   1 
ATOM   110  O O   . ARG A 1 17  ? -1.995  -32.798 57.288  1.00 30.43  ? 18  ARG A O   1 
ATOM   111  C CB  . ARG A 1 17  ? -1.578  -31.445 59.961  1.00 33.61  ? 18  ARG A CB  1 
ATOM   112  C CG  . ARG A 1 17  ? -1.723  -32.753 60.736  1.00 43.66  ? 18  ARG A CG  1 
ATOM   113  C CD  . ARG A 1 17  ? -2.697  -32.581 61.903  1.00 58.88  ? 18  ARG A CD  1 
ATOM   114  N NE  . ARG A 1 17  ? -3.704  -31.551 61.620  1.00 65.15  ? 18  ARG A NE  1 
ATOM   115  C CZ  . ARG A 1 17  ? -4.953  -31.796 61.222  1.00 61.20  ? 18  ARG A CZ  1 
ATOM   116  N NH1 . ARG A 1 17  ? -5.380  -33.048 61.071  1.00 56.33  ? 18  ARG A NH1 1 
ATOM   117  N NH2 . ARG A 1 17  ? -5.785  -30.788 60.987  1.00 52.28  ? 18  ARG A NH2 1 
ATOM   118  N N   . GLY A 1 18  ? 0.001   -33.676 57.848  1.00 32.94  ? 19  GLY A N   1 
ATOM   119  C CA  . GLY A 1 18  ? -0.203  -34.875 57.065  1.00 34.62  ? 19  GLY A CA  1 
ATOM   120  C C   . GLY A 1 18  ? -0.705  -36.052 57.870  1.00 37.12  ? 19  GLY A C   1 
ATOM   121  O O   . GLY A 1 18  ? -1.248  -35.898 58.965  1.00 39.77  ? 19  GLY A O   1 
ATOM   122  N N   . ILE A 1 19  ? -0.520  -37.242 57.312  1.00 33.27  ? 20  ILE A N   1 
ATOM   123  C CA  . ILE A 1 19  ? -0.988  -38.460 57.942  1.00 27.99  ? 20  ILE A CA  1 
ATOM   124  C C   . ILE A 1 19  ? -0.004  -39.577 57.646  1.00 31.46  ? 20  ILE A C   1 
ATOM   125  O O   . ILE A 1 19  ? 0.595   -39.617 56.572  1.00 33.31  ? 20  ILE A O   1 
ATOM   126  C CB  . ILE A 1 19  ? -2.413  -38.832 57.476  1.00 33.65  ? 20  ILE A CB  1 
ATOM   127  C CG1 . ILE A 1 19  ? -2.956  -40.016 58.282  1.00 33.66  ? 20  ILE A CG1 1 
ATOM   128  C CG2 . ILE A 1 19  ? -2.453  -39.123 55.957  1.00 30.57  ? 20  ILE A CG2 1 
ATOM   129  C CD1 . ILE A 1 19  ? -4.390  -40.384 57.929  1.00 29.74  ? 20  ILE A CD1 1 
ATOM   130  N N   . ARG A 1 20  ? 0.186   -40.461 58.621  1.00 34.29  ? 21  ARG A N   1 
ATOM   131  C CA  . ARG A 1 20  ? 1.048   -41.624 58.462  1.00 34.59  ? 21  ARG A CA  1 
ATOM   132  C C   . ARG A 1 20  ? 0.220   -42.748 57.857  1.00 34.51  ? 21  ARG A C   1 
ATOM   133  O O   . ARG A 1 20  ? -0.907  -42.999 58.289  1.00 29.00  ? 21  ARG A O   1 
ATOM   134  C CB  . ARG A 1 20  ? 1.621   -42.053 59.820  1.00 32.91  ? 21  ARG A CB  1 
ATOM   135  C CG  . ARG A 1 20  ? 2.887   -42.897 59.731  1.00 35.53  ? 21  ARG A CG  1 
ATOM   136  C CD  . ARG A 1 20  ? 3.487   -43.168 61.131  1.00 45.17  ? 21  ARG A CD  1 
ATOM   137  N NE  . ARG A 1 20  ? 2.480   -43.667 62.065  1.00 42.00  ? 21  ARG A NE  1 
ATOM   138  C CZ  . ARG A 1 20  ? 2.027   -42.983 63.111  1.00 49.68  ? 21  ARG A CZ  1 
ATOM   139  N NH1 . ARG A 1 20  ? 2.510   -41.771 63.388  1.00 41.69  ? 21  ARG A NH1 1 
ATOM   140  N NH2 . ARG A 1 20  ? 1.094   -43.516 63.887  1.00 51.93  ? 21  ARG A NH2 1 
ATOM   141  N N   . LEU A 1 21  ? 0.763   -43.407 56.839  1.00 30.03  ? 22  LEU A N   1 
ATOM   142  C CA  . LEU A 1 21  ? 0.057   -44.505 56.199  1.00 29.84  ? 22  LEU A CA  1 
ATOM   143  C C   . LEU A 1 21  ? 0.880   -45.773 56.319  1.00 32.54  ? 22  LEU A C   1 
ATOM   144  O O   . LEU A 1 21  ? 2.106   -45.708 56.371  1.00 32.66  ? 22  LEU A O   1 
ATOM   145  C CB  . LEU A 1 21  ? -0.186  -44.199 54.717  1.00 34.51  ? 22  LEU A CB  1 
ATOM   146  C CG  . LEU A 1 21  ? -1.079  -42.996 54.426  1.00 41.05  ? 22  LEU A CG  1 
ATOM   147  C CD1 . LEU A 1 21  ? -1.294  -42.827 52.928  1.00 32.75  ? 22  LEU A CD1 1 
ATOM   148  C CD2 . LEU A 1 21  ? -2.402  -43.136 55.160  1.00 34.25  ? 22  LEU A CD2 1 
ATOM   149  N N   . LYS A 1 22  ? 0.206   -46.922 56.339  1.00 33.18  ? 23  LYS A N   1 
ATOM   150  C CA  . LYS A 1 22  ? 0.886   -48.212 56.369  1.00 29.77  ? 23  LYS A CA  1 
ATOM   151  C C   . LYS A 1 22  ? 1.040   -48.798 54.968  1.00 28.39  ? 23  LYS A C   1 
ATOM   152  O O   . LYS A 1 22  ? 0.213   -48.556 54.091  1.00 31.50  ? 23  LYS A O   1 
ATOM   153  C CB  . LYS A 1 22  ? 0.095   -49.209 57.219  1.00 32.71  ? 23  LYS A CB  1 
ATOM   154  C CG  . LYS A 1 22  ? -0.265  -48.730 58.611  1.00 32.52  ? 23  LYS A CG  1 
ATOM   155  C CD  . LYS A 1 22  ? -1.009  -49.822 59.377  1.00 32.93  ? 23  LYS A CD  1 
ATOM   156  C CE  . LYS A 1 22  ? -2.388  -50.093 58.783  1.00 42.37  ? 23  LYS A CE  1 
ATOM   157  N NZ  . LYS A 1 22  ? -3.017  -51.331 59.345  1.00 45.50  ? 23  LYS A NZ  1 
ATOM   158  N N   . THR A 1 23  ? 2.115   -49.557 54.772  1.00 26.18  ? 24  THR A N   1 
ATOM   159  C CA  . THR A 1 23  ? 2.275   -50.447 53.626  1.00 33.85  ? 24  THR A CA  1 
ATOM   160  C C   . THR A 1 23  ? 2.872   -51.734 54.181  1.00 35.23  ? 24  THR A C   1 
ATOM   161  O O   . THR A 1 23  ? 3.370   -51.749 55.305  1.00 29.03  ? 24  THR A O   1 
ATOM   162  C CB  . THR A 1 23  ? 3.274   -49.902 52.572  1.00 26.38  ? 24  THR A CB  1 
ATOM   163  O OG1 . THR A 1 23  ? 4.615   -50.193 52.993  1.00 27.27  ? 24  THR A OG1 1 
ATOM   164  C CG2 . THR A 1 23  ? 3.098   -48.409 52.361  1.00 30.78  ? 24  THR A CG2 1 
ATOM   165  N N   . PRO A 1 24  ? 2.846   -52.817 53.391  1.00 36.40  ? 25  PRO A N   1 
ATOM   166  C CA  . PRO A 1 24  ? 3.500   -54.059 53.813  1.00 31.77  ? 25  PRO A CA  1 
ATOM   167  C C   . PRO A 1 24  ? 5.007   -53.919 54.023  1.00 33.56  ? 25  PRO A C   1 
ATOM   168  O O   . PRO A 1 24  ? 5.613   -54.793 54.642  1.00 44.91  ? 25  PRO A O   1 
ATOM   169  C CB  . PRO A 1 24  ? 3.238   -55.000 52.641  1.00 34.71  ? 25  PRO A CB  1 
ATOM   170  C CG  . PRO A 1 24  ? 1.988   -54.492 52.033  1.00 38.21  ? 25  PRO A CG  1 
ATOM   171  C CD  . PRO A 1 24  ? 2.044   -53.005 52.170  1.00 35.26  ? 25  PRO A CD  1 
ATOM   172  N N   . GLY A 1 25  ? 5.603   -52.844 53.520  1.00 29.29  ? 26  GLY A N   1 
ATOM   173  C CA  . GLY A 1 25  ? 7.031   -52.637 53.669  1.00 24.77  ? 26  GLY A CA  1 
ATOM   174  C C   . GLY A 1 25  ? 7.382   -51.623 54.743  1.00 30.64  ? 26  GLY A C   1 
ATOM   175  O O   . GLY A 1 25  ? 8.557   -51.299 54.944  1.00 31.70  ? 26  GLY A O   1 
ATOM   176  N N   . GLY A 1 26  ? 6.366   -51.118 55.439  1.00 28.81  ? 27  GLY A N   1 
ATOM   177  C CA  . GLY A 1 26  ? 6.578   -50.081 56.431  1.00 28.06  ? 27  GLY A CA  1 
ATOM   178  C C   . GLY A 1 26  ? 5.834   -48.787 56.125  1.00 35.77  ? 27  GLY A C   1 
ATOM   179  O O   . GLY A 1 26  ? 5.211   -48.647 55.065  1.00 34.74  ? 27  GLY A O   1 
ATOM   180  N N   . PRO A 1 27  ? 5.894   -47.822 57.057  1.00 28.77  ? 28  PRO A N   1 
ATOM   181  C CA  . PRO A 1 27  ? 5.105   -46.598 56.925  1.00 29.10  ? 28  PRO A CA  1 
ATOM   182  C C   . PRO A 1 27  ? 5.602   -45.621 55.859  1.00 26.94  ? 28  PRO A C   1 
ATOM   183  O O   . PRO A 1 27  ? 6.704   -45.704 55.313  1.00 27.73  ? 28  PRO A O   1 
ATOM   184  C CB  . PRO A 1 27  ? 5.231   -45.957 58.312  1.00 28.73  ? 28  PRO A CB  1 
ATOM   185  C CG  . PRO A 1 27  ? 6.532   -46.420 58.801  1.00 28.40  ? 28  PRO A CG  1 
ATOM   186  C CD  . PRO A 1 27  ? 6.694   -47.824 58.291  1.00 24.19  ? 28  PRO A CD  1 
ATOM   187  N N   . VAL A 1 28  ? 4.754   -44.645 55.601  1.00 24.78  ? 29  VAL A N   1 
ATOM   188  C CA  . VAL A 1 28  ? 5.013   -43.664 54.584  1.00 25.61  ? 29  VAL A CA  1 
ATOM   189  C C   . VAL A 1 28  ? 4.299   -42.404 55.056  1.00 29.05  ? 29  VAL A C   1 
ATOM   190  O O   . VAL A 1 28  ? 3.324   -42.498 55.820  1.00 29.22  ? 29  VAL A O   1 
ATOM   191  C CB  . VAL A 1 28  ? 4.472   -44.203 53.235  1.00 31.92  ? 29  VAL A CB  1 
ATOM   192  C CG1 . VAL A 1 28  ? 3.634   -43.171 52.505  1.00 24.51  ? 29  VAL A CG1 1 
ATOM   193  C CG2 . VAL A 1 28  ? 5.614   -44.772 52.385  1.00 27.21  ? 29  VAL A CG2 1 
ATOM   194  N N   . SER A 1 29  ? 4.801   -41.232 54.657  1.00 27.29  ? 30  SER A N   1 
ATOM   195  C CA  . SER A 1 29  ? 4.151   -39.965 55.003  1.00 28.01  ? 30  SER A CA  1 
ATOM   196  C C   . SER A 1 29  ? 3.345   -39.451 53.819  1.00 28.27  ? 30  SER A C   1 
ATOM   197  O O   . SER A 1 29  ? 3.831   -39.428 52.688  1.00 29.39  ? 30  SER A O   1 
ATOM   198  C CB  . SER A 1 29  ? 5.178   -38.903 55.405  1.00 32.65  ? 30  SER A CB  1 
ATOM   199  O OG  . SER A 1 29  ? 6.116   -39.397 56.347  1.00 37.71  ? 30  SER A OG  1 
ATOM   200  N N   . ALA A 1 30  ? 2.117   -39.029 54.092  1.00 27.82  ? 31  ALA A N   1 
ATOM   201  C CA  . ALA A 1 30  ? 1.220   -38.556 53.060  1.00 30.49  ? 31  ALA A CA  1 
ATOM   202  C C   . ALA A 1 30  ? 0.639   -37.202 53.432  1.00 33.65  ? 31  ALA A C   1 
ATOM   203  O O   . ALA A 1 30  ? 0.223   -36.975 54.569  1.00 29.88  ? 31  ALA A O   1 
ATOM   204  C CB  . ALA A 1 30  ? 0.103   -39.559 52.819  1.00 26.08  ? 31  ALA A CB  1 
ATOM   205  N N   . PHE A 1 31  ? 0.625   -36.309 52.452  1.00 27.48  ? 32  PHE A N   1 
ATOM   206  C CA  . PHE A 1 31  ? 0.027   -34.997 52.594  1.00 25.43  ? 32  PHE A CA  1 
ATOM   207  C C   . PHE A 1 31  ? -0.941  -34.851 51.428  1.00 28.56  ? 32  PHE A C   1 
ATOM   208  O O   . PHE A 1 31  ? -0.537  -34.703 50.258  1.00 27.10  ? 32  PHE A O   1 
ATOM   209  C CB  . PHE A 1 31  ? 1.118   -33.924 52.596  1.00 23.49  ? 32  PHE A CB  1 
ATOM   210  C CG  . PHE A 1 31  ? 2.130   -34.111 53.696  1.00 28.30  ? 32  PHE A CG  1 
ATOM   211  C CD1 . PHE A 1 31  ? 3.219   -34.953 53.523  1.00 28.07  ? 32  PHE A CD1 1 
ATOM   212  C CD2 . PHE A 1 31  ? 1.980   -33.464 54.914  1.00 29.85  ? 32  PHE A CD2 1 
ATOM   213  C CE1 . PHE A 1 31  ? 4.146   -35.140 54.545  1.00 35.26  ? 32  PHE A CE1 1 
ATOM   214  C CE2 . PHE A 1 31  ? 2.902   -33.650 55.938  1.00 33.86  ? 32  PHE A CE2 1 
ATOM   215  C CZ  . PHE A 1 31  ? 3.984   -34.495 55.751  1.00 27.54  ? 32  PHE A CZ  1 
ATOM   216  N N   . LEU A 1 32  ? -2.222  -34.947 51.755  1.00 24.65  ? 33  LEU A N   1 
ATOM   217  C CA  . LEU A 1 32  ? -3.268  -35.064 50.759  1.00 25.47  ? 33  LEU A CA  1 
ATOM   218  C C   . LEU A 1 32  ? -4.169  -33.858 50.829  1.00 27.68  ? 33  LEU A C   1 
ATOM   219  O O   . LEU A 1 32  ? -4.550  -33.437 51.916  1.00 27.95  ? 33  LEU A O   1 
ATOM   220  C CB  . LEU A 1 32  ? -4.094  -36.326 51.023  1.00 24.75  ? 33  LEU A CB  1 
ATOM   221  C CG  . LEU A 1 32  ? -3.287  -37.615 51.213  1.00 26.93  ? 33  LEU A CG  1 
ATOM   222  C CD1 . LEU A 1 32  ? -4.200  -38.801 51.538  1.00 23.65  ? 33  LEU A CD1 1 
ATOM   223  C CD2 . LEU A 1 32  ? -2.443  -37.909 49.971  1.00 27.62  ? 33  LEU A CD2 1 
ATOM   224  N N   . GLY A 1 33  ? -4.525  -33.308 49.671  1.00 21.27  ? 34  GLY A N   1 
ATOM   225  C CA  . GLY A 1 33  ? -5.476  -32.211 49.633  1.00 21.36  ? 34  GLY A CA  1 
ATOM   226  C C   . GLY A 1 33  ? -4.857  -30.864 49.967  1.00 24.57  ? 34  GLY A C   1 
ATOM   227  O O   . GLY A 1 33  ? -5.498  -30.014 50.576  1.00 30.16  ? 34  GLY A O   1 
ATOM   228  N N   . ILE A 1 34  ? -3.604  -30.674 49.564  1.00 25.33  ? 35  ILE A N   1 
ATOM   229  C CA  . ILE A 1 34  ? -2.928  -29.388 49.684  1.00 25.24  ? 35  ILE A CA  1 
ATOM   230  C C   . ILE A 1 34  ? -3.395  -28.440 48.587  1.00 27.40  ? 35  ILE A C   1 
ATOM   231  O O   . ILE A 1 34  ? -3.229  -28.731 47.402  1.00 26.75  ? 35  ILE A O   1 
ATOM   232  C CB  . ILE A 1 34  ? -1.429  -29.553 49.473  1.00 24.33  ? 35  ILE A CB  1 
ATOM   233  C CG1 . ILE A 1 34  ? -0.859  -30.637 50.398  1.00 22.51  ? 35  ILE A CG1 1 
ATOM   234  C CG2 . ILE A 1 34  ? -0.736  -28.214 49.637  1.00 26.56  ? 35  ILE A CG2 1 
ATOM   235  C CD1 . ILE A 1 34  ? 0.598   -31.003 50.093  1.00 18.98  ? 35  ILE A CD1 1 
ATOM   236  N N   . PRO A 1 35  ? -3.974  -27.297 48.968  1.00 27.84  ? 36  PRO A N   1 
ATOM   237  C CA  . PRO A 1 35  ? -4.423  -26.329 47.952  1.00 21.12  ? 36  PRO A CA  1 
ATOM   238  C C   . PRO A 1 35  ? -3.253  -25.679 47.206  1.00 27.67  ? 36  PRO A C   1 
ATOM   239  O O   . PRO A 1 35  ? -2.332  -25.163 47.842  1.00 28.79  ? 36  PRO A O   1 
ATOM   240  C CB  . PRO A 1 35  ? -5.186  -25.286 48.772  1.00 25.38  ? 36  PRO A CB  1 
ATOM   241  C CG  . PRO A 1 35  ? -4.573  -25.376 50.163  1.00 30.08  ? 36  PRO A CG  1 
ATOM   242  C CD  . PRO A 1 35  ? -4.194  -26.827 50.349  1.00 27.02  ? 36  PRO A CD  1 
ATOM   243  N N   . PHE A 1 36  ? -3.275  -25.707 45.875  1.00 22.83  ? 37  PHE A N   1 
ATOM   244  C CA  . PHE A 1 36  ? -2.206  -25.062 45.118  1.00 26.61  ? 37  PHE A CA  1 
ATOM   245  C C   . PHE A 1 36  ? -2.674  -23.881 44.262  1.00 26.03  ? 37  PHE A C   1 
ATOM   246  O O   . PHE A 1 36  ? -1.858  -23.139 43.722  1.00 29.33  ? 37  PHE A O   1 
ATOM   247  C CB  . PHE A 1 36  ? -1.386  -26.079 44.301  1.00 29.84  ? 37  PHE A CB  1 
ATOM   248  C CG  . PHE A 1 36  ? -2.120  -26.684 43.129  1.00 21.80  ? 37  PHE A CG  1 
ATOM   249  C CD1 . PHE A 1 36  ? -2.121  -26.050 41.889  1.00 24.95  ? 37  PHE A CD1 1 
ATOM   250  C CD2 . PHE A 1 36  ? -2.760  -27.915 43.253  1.00 21.93  ? 37  PHE A CD2 1 
ATOM   251  C CE1 . PHE A 1 36  ? -2.782  -26.620 40.788  1.00 26.08  ? 37  PHE A CE1 1 
ATOM   252  C CE2 . PHE A 1 36  ? -3.424  -28.500 42.160  1.00 21.82  ? 37  PHE A CE2 1 
ATOM   253  C CZ  . PHE A 1 36  ? -3.437  -27.847 40.928  1.00 22.95  ? 37  PHE A CZ  1 
ATOM   254  N N   . ALA A 1 37  ? -3.986  -23.703 44.155  1.00 22.72  ? 38  ALA A N   1 
ATOM   255  C CA  . ALA A 1 37  ? -4.544  -22.561 43.453  1.00 22.93  ? 38  ALA A CA  1 
ATOM   256  C C   . ALA A 1 37  ? -5.753  -22.049 44.204  1.00 27.43  ? 38  ALA A C   1 
ATOM   257  O O   . ALA A 1 37  ? -6.320  -22.756 45.037  1.00 21.52  ? 38  ALA A O   1 
ATOM   258  C CB  . ALA A 1 37  ? -4.940  -22.941 42.019  1.00 21.83  ? 38  ALA A CB  1 
ATOM   259  N N   . GLU A 1 38  ? -6.149  -20.815 43.907  1.00 30.23  ? 39  GLU A N   1 
ATOM   260  C CA  . GLU A 1 38  ? -7.433  -20.309 44.372  1.00 28.42  ? 39  GLU A CA  1 
ATOM   261  C C   . GLU A 1 38  ? -8.532  -21.126 43.688  1.00 33.53  ? 39  GLU A C   1 
ATOM   262  O O   . GLU A 1 38  ? -8.376  -21.537 42.533  1.00 25.87  ? 39  GLU A O   1 
ATOM   263  C CB  . GLU A 1 38  ? -7.569  -18.816 44.041  1.00 26.70  ? 39  GLU A CB  1 
ATOM   264  C CG  . GLU A 1 38  ? -6.706  -17.908 44.917  1.00 31.16  ? 39  GLU A CG  1 
ATOM   265  C CD  . GLU A 1 38  ? -7.094  -17.992 46.392  1.00 39.36  ? 39  GLU A CD  1 
ATOM   266  O OE1 . GLU A 1 38  ? -8.283  -17.771 46.707  1.00 44.15  ? 39  GLU A OE1 1 
ATOM   267  O OE2 . GLU A 1 38  ? -6.221  -18.304 47.232  1.00 36.49  ? 39  GLU A OE2 1 
ATOM   268  N N   . PRO A 1 39  ? -9.634  -21.394 44.402  1.00 30.29  ? 40  PRO A N   1 
ATOM   269  C CA  . PRO A 1 39  ? -10.712 -22.158 43.759  1.00 25.69  ? 40  PRO A CA  1 
ATOM   270  C C   . PRO A 1 39  ? -11.230 -21.464 42.497  1.00 28.41  ? 40  PRO A C   1 
ATOM   271  O O   . PRO A 1 39  ? -11.714 -20.340 42.567  1.00 34.41  ? 40  PRO A O   1 
ATOM   272  C CB  . PRO A 1 39  ? -11.786 -22.216 44.844  1.00 28.73  ? 40  PRO A CB  1 
ATOM   273  C CG  . PRO A 1 39  ? -10.988 -22.179 46.147  1.00 22.70  ? 40  PRO A CG  1 
ATOM   274  C CD  . PRO A 1 39  ? -9.849  -21.225 45.850  1.00 27.33  ? 40  PRO A CD  1 
ATOM   275  N N   . PRO A 1 40  ? -11.106 -22.128 41.341  1.00 29.22  ? 41  PRO A N   1 
ATOM   276  C CA  . PRO A 1 40  ? -11.497 -21.518 40.065  1.00 29.57  ? 41  PRO A CA  1 
ATOM   277  C C   . PRO A 1 40  ? -13.022 -21.519 39.879  1.00 36.71  ? 41  PRO A C   1 
ATOM   278  O O   . PRO A 1 40  ? -13.547 -22.216 39.007  1.00 30.33  ? 41  PRO A O   1 
ATOM   279  C CB  . PRO A 1 40  ? -10.812 -22.413 39.034  1.00 24.51  ? 41  PRO A CB  1 
ATOM   280  C CG  . PRO A 1 40  ? -10.733 -23.753 39.692  1.00 27.29  ? 41  PRO A CG  1 
ATOM   281  C CD  . PRO A 1 40  ? -10.609 -23.507 41.176  1.00 25.77  ? 41  PRO A CD  1 
ATOM   282  N N   . MET A 1 41  ? -13.710 -20.722 40.695  1.00 32.51  ? 42  MET A N   1 
ATOM   283  C CA  . MET A 1 41  ? -15.171 -20.715 40.756  1.00 36.67  ? 42  MET A CA  1 
ATOM   284  C C   . MET A 1 41  ? -15.781 -19.361 40.374  1.00 38.40  ? 42  MET A C   1 
ATOM   285  O O   . MET A 1 41  ? -15.095 -18.332 40.358  1.00 34.05  ? 42  MET A O   1 
ATOM   286  C CB  . MET A 1 41  ? -15.630 -21.098 42.166  1.00 39.73  ? 42  MET A CB  1 
ATOM   287  C CG  . MET A 1 41  ? -15.072 -22.427 42.641  1.00 36.68  ? 42  MET A CG  1 
ATOM   288  S SD  . MET A 1 41  ? -16.137 -23.231 43.839  1.00 57.16  ? 42  MET A SD  1 
ATOM   289  C CE  . MET A 1 41  ? -16.049 -22.070 45.209  1.00 49.99  ? 42  MET A CE  1 
ATOM   290  N N   . GLY A 1 42  ? -17.080 -19.371 40.080  1.00 30.37  ? 43  GLY A N   1 
ATOM   291  C CA  . GLY A 1 42  ? -17.784 -18.161 39.699  1.00 33.05  ? 43  GLY A CA  1 
ATOM   292  C C   . GLY A 1 42  ? -17.139 -17.463 38.516  1.00 34.49  ? 43  GLY A C   1 
ATOM   293  O O   . GLY A 1 42  ? -17.038 -18.032 37.425  1.00 30.76  ? 43  GLY A O   1 
ATOM   294  N N   . PRO A 1 43  ? -16.685 -16.223 38.728  1.00 35.11  ? 44  PRO A N   1 
ATOM   295  C CA  . PRO A 1 43  ? -16.048 -15.464 37.643  1.00 31.66  ? 44  PRO A CA  1 
ATOM   296  C C   . PRO A 1 43  ? -14.722 -16.085 37.197  1.00 35.68  ? 44  PRO A C   1 
ATOM   297  O O   . PRO A 1 43  ? -14.259 -15.773 36.103  1.00 33.51  ? 44  PRO A O   1 
ATOM   298  C CB  . PRO A 1 43  ? -15.832 -14.078 38.256  1.00 31.49  ? 44  PRO A CB  1 
ATOM   299  C CG  . PRO A 1 43  ? -15.797 -14.326 39.755  1.00 35.04  ? 44  PRO A CG  1 
ATOM   300  C CD  . PRO A 1 43  ? -16.721 -15.481 40.004  1.00 31.47  ? 44  PRO A CD  1 
ATOM   301  N N   . ARG A 1 44  ? -14.139 -16.961 38.017  1.00 36.60  ? 45  ARG A N   1 
ATOM   302  C CA  . ARG A 1 44  ? -12.887 -17.638 37.666  1.00 34.54  ? 45  ARG A CA  1 
ATOM   303  C C   . ARG A 1 44  ? -13.052 -18.905 36.811  1.00 32.23  ? 45  ARG A C   1 
ATOM   304  O O   . ARG A 1 44  ? -12.057 -19.465 36.349  1.00 30.53  ? 45  ARG A O   1 
ATOM   305  C CB  . ARG A 1 44  ? -12.069 -17.990 38.915  1.00 32.99  ? 45  ARG A CB  1 
ATOM   306  C CG  . ARG A 1 44  ? -11.555 -16.810 39.738  1.00 43.08  ? 45  ARG A CG  1 
ATOM   307  C CD  . ARG A 1 44  ? -10.804 -15.756 38.916  1.00 53.00  ? 45  ARG A CD  1 
ATOM   308  N NE  . ARG A 1 44  ? -9.636  -16.262 38.188  1.00 59.27  ? 45  ARG A NE  1 
ATOM   309  C CZ  . ARG A 1 44  ? -8.753  -15.481 37.561  1.00 65.17  ? 45  ARG A CZ  1 
ATOM   310  N NH1 . ARG A 1 44  ? -8.898  -14.159 37.589  1.00 56.69  ? 45  ARG A NH1 1 
ATOM   311  N NH2 . ARG A 1 44  ? -7.719  -16.013 36.910  1.00 53.00  ? 45  ARG A NH2 1 
ATOM   312  N N   . ARG A 1 45  ? -14.282 -19.375 36.620  1.00 29.33  ? 46  ARG A N   1 
ATOM   313  C CA  . ARG A 1 45  ? -14.516 -20.510 35.725  1.00 27.71  ? 46  ARG A CA  1 
ATOM   314  C C   . ARG A 1 45  ? -13.998 -20.198 34.315  1.00 27.01  ? 46  ARG A C   1 
ATOM   315  O O   . ARG A 1 45  ? -14.216 -19.101 33.805  1.00 31.91  ? 46  ARG A O   1 
ATOM   316  C CB  . ARG A 1 45  ? -16.003 -20.878 35.676  1.00 28.48  ? 46  ARG A CB  1 
ATOM   317  C CG  . ARG A 1 45  ? -16.322 -22.024 34.719  1.00 27.46  ? 46  ARG A CG  1 
ATOM   318  C CD  . ARG A 1 45  ? -17.818 -22.264 34.580  1.00 26.70  ? 46  ARG A CD  1 
ATOM   319  N NE  . ARG A 1 45  ? -18.384 -23.018 35.700  1.00 29.15  ? 46  ARG A NE  1 
ATOM   320  C CZ  . ARG A 1 45  ? -19.688 -23.224 35.866  1.00 31.56  ? 46  ARG A CZ  1 
ATOM   321  N NH1 . ARG A 1 45  ? -20.541 -22.730 34.979  1.00 30.91  ? 46  ARG A NH1 1 
ATOM   322  N NH2 . ARG A 1 45  ? -20.144 -23.919 36.907  1.00 23.30  ? 46  ARG A NH2 1 
ATOM   323  N N   . PHE A 1 46  ? -13.301 -21.165 33.716  1.00 28.25  ? 47  PHE A N   1 
ATOM   324  C CA  . PHE A 1 46  ? -12.699 -21.055 32.371  1.00 31.69  ? 47  PHE A CA  1 
ATOM   325  C C   . PHE A 1 46  ? -11.408 -20.228 32.329  1.00 29.70  ? 47  PHE A C   1 
ATOM   326  O O   . PHE A 1 46  ? -10.770 -20.118 31.273  1.00 27.89  ? 47  PHE A O   1 
ATOM   327  C CB  . PHE A 1 46  ? -13.672 -20.502 31.310  1.00 27.02  ? 47  PHE A CB  1 
ATOM   328  C CG  . PHE A 1 46  ? -14.994 -21.212 31.238  1.00 27.00  ? 47  PHE A CG  1 
ATOM   329  C CD1 . PHE A 1 46  ? -15.059 -22.575 31.007  1.00 24.51  ? 47  PHE A CD1 1 
ATOM   330  C CD2 . PHE A 1 46  ? -16.182 -20.494 31.349  1.00 28.87  ? 47  PHE A CD2 1 
ATOM   331  C CE1 . PHE A 1 46  ? -16.285 -23.220 30.916  1.00 27.39  ? 47  PHE A CE1 1 
ATOM   332  C CE2 . PHE A 1 46  ? -17.413 -21.126 31.256  1.00 21.67  ? 47  PHE A CE2 1 
ATOM   333  C CZ  . PHE A 1 46  ? -17.471 -22.490 31.044  1.00 24.31  ? 47  PHE A CZ  1 
ATOM   334  N N   . LEU A 1 47  ? -11.031 -19.638 33.460  1.00 26.60  ? 48  LEU A N   1 
ATOM   335  C CA  . LEU A 1 47  ? -9.857  -18.770 33.501  1.00 30.25  ? 48  LEU A CA  1 
ATOM   336  C C   . LEU A 1 47  ? -8.620  -19.518 33.986  1.00 31.08  ? 48  LEU A C   1 
ATOM   337  O O   . LEU A 1 47  ? -8.743  -20.533 34.676  1.00 25.38  ? 48  LEU A O   1 
ATOM   338  C CB  . LEU A 1 47  ? -10.112 -17.555 34.398  1.00 34.18  ? 48  LEU A CB  1 
ATOM   339  C CG  . LEU A 1 47  ? -11.130 -16.505 33.940  1.00 35.89  ? 48  LEU A CG  1 
ATOM   340  C CD1 . LEU A 1 47  ? -10.997 -15.238 34.787  1.00 34.69  ? 48  LEU A CD1 1 
ATOM   341  C CD2 . LEU A 1 47  ? -10.979 -16.192 32.467  1.00 34.23  ? 48  LEU A CD2 1 
ATOM   342  N N   . PRO A 1 48  ? -7.422  -19.023 33.617  1.00 29.00  ? 49  PRO A N   1 
ATOM   343  C CA  . PRO A 1 48  ? -6.164  -19.563 34.148  1.00 25.22  ? 49  PRO A CA  1 
ATOM   344  C C   . PRO A 1 48  ? -6.186  -19.599 35.666  1.00 28.57  ? 49  PRO A C   1 
ATOM   345  O O   . PRO A 1 48  ? -6.831  -18.763 36.295  1.00 31.57  ? 49  PRO A O   1 
ATOM   346  C CB  . PRO A 1 48  ? -5.129  -18.537 33.691  1.00 23.67  ? 49  PRO A CB  1 
ATOM   347  C CG  . PRO A 1 48  ? -5.695  -17.999 32.410  1.00 31.86  ? 49  PRO A CG  1 
ATOM   348  C CD  . PRO A 1 48  ? -7.189  -17.964 32.616  1.00 26.41  ? 49  PRO A CD  1 
ATOM   349  N N   . PRO A 1 49  ? -5.478  -20.558 36.258  1.00 26.46  ? 50  PRO A N   1 
ATOM   350  C CA  . PRO A 1 49  ? -5.453  -20.667 37.718  1.00 25.74  ? 50  PRO A CA  1 
ATOM   351  C C   . PRO A 1 49  ? -4.658  -19.521 38.356  1.00 31.16  ? 50  PRO A C   1 
ATOM   352  O O   . PRO A 1 49  ? -3.694  -19.047 37.763  1.00 29.04  ? 50  PRO A O   1 
ATOM   353  C CB  . PRO A 1 49  ? -4.732  -21.998 37.944  1.00 25.39  ? 50  PRO A CB  1 
ATOM   354  C CG  . PRO A 1 49  ? -3.815  -22.131 36.737  1.00 22.68  ? 50  PRO A CG  1 
ATOM   355  C CD  . PRO A 1 49  ? -4.629  -21.570 35.598  1.00 23.59  ? 50  PRO A CD  1 
ATOM   356  N N   . GLU A 1 50  ? -5.072  -19.078 39.540  1.00 29.94  ? 51  GLU A N   1 
ATOM   357  C CA  . GLU A 1 50  ? -4.303  -18.115 40.322  1.00 33.02  ? 51  GLU A CA  1 
ATOM   358  C C   . GLU A 1 50  ? -3.632  -18.858 41.468  1.00 30.96  ? 51  GLU A C   1 
ATOM   359  O O   . GLU A 1 50  ? -4.231  -19.758 42.063  1.00 30.72  ? 51  GLU A O   1 
ATOM   360  C CB  . GLU A 1 50  ? -5.209  -17.032 40.920  1.00 32.89  ? 51  GLU A CB  1 
ATOM   361  C CG  . GLU A 1 50  ? -6.167  -16.358 39.946  1.00 50.33  ? 51  GLU A CG  1 
ATOM   362  C CD  . GLU A 1 50  ? -7.187  -15.475 40.663  1.00 65.18  ? 51  GLU A CD  1 
ATOM   363  O OE1 . GLU A 1 50  ? -8.256  -15.991 41.078  1.00 61.78  ? 51  GLU A OE1 1 
ATOM   364  O OE2 . GLU A 1 50  ? -6.913  -14.263 40.820  1.00 71.56  ? 51  GLU A OE2 1 
ATOM   365  N N   . PRO A 1 51  ? -2.389  -18.484 41.788  1.00 29.16  ? 52  PRO A N   1 
ATOM   366  C CA  . PRO A 1 51  ? -1.691  -19.089 42.930  1.00 27.90  ? 52  PRO A CA  1 
ATOM   367  C C   . PRO A 1 51  ? -2.517  -19.002 44.213  1.00 30.01  ? 52  PRO A C   1 
ATOM   368  O O   . PRO A 1 51  ? -3.206  -18.006 44.445  1.00 28.32  ? 52  PRO A O   1 
ATOM   369  C CB  . PRO A 1 51  ? -0.423  -18.244 43.038  1.00 27.69  ? 52  PRO A CB  1 
ATOM   370  C CG  . PRO A 1 51  ? -0.161  -17.803 41.614  1.00 22.16  ? 52  PRO A CG  1 
ATOM   371  C CD  . PRO A 1 51  ? -1.526  -17.556 41.031  1.00 24.99  ? 52  PRO A CD  1 
ATOM   372  N N   . LYS A 1 52  ? -2.487  -20.060 45.013  1.00 27.89  ? 53  LYS A N   1 
ATOM   373  C CA  . LYS A 1 52  ? -3.222  -20.070 46.273  1.00 30.42  ? 53  LYS A CA  1 
ATOM   374  C C   . LYS A 1 52  ? -2.661  -19.001 47.213  1.00 32.66  ? 53  LYS A C   1 
ATOM   375  O O   . LYS A 1 52  ? -1.449  -18.917 47.409  1.00 30.34  ? 53  LYS A O   1 
ATOM   376  C CB  . LYS A 1 52  ? -3.133  -21.453 46.930  1.00 26.75  ? 53  LYS A CB  1 
ATOM   377  C CG  . LYS A 1 52  ? -3.696  -21.525 48.348  1.00 30.16  ? 53  LYS A CG  1 
ATOM   378  C CD  . LYS A 1 52  ? -5.206  -21.372 48.350  1.00 31.12  ? 53  LYS A CD  1 
ATOM   379  C CE  . LYS A 1 52  ? -5.789  -21.655 49.719  1.00 26.92  ? 53  LYS A CE  1 
ATOM   380  N NZ  . LYS A 1 52  ? -7.259  -21.391 49.739  1.00 28.34  ? 53  LYS A NZ  1 
ATOM   381  N N   A GLN A 1 53  ? -3.548  -18.196 47.787  0.43 31.53  ? 54  GLN A N   1 
ATOM   382  N N   B GLN A 1 53  ? -3.536  -18.175 47.775  0.57 31.52  ? 54  GLN A N   1 
ATOM   383  C CA  A GLN A 1 53  ? -3.155  -17.179 48.758  0.43 35.29  ? 54  GLN A CA  1 
ATOM   384  C CA  B GLN A 1 53  ? -3.095  -17.163 48.731  0.57 35.32  ? 54  GLN A CA  1 
ATOM   385  C C   A GLN A 1 53  ? -2.765  -17.837 50.083  0.43 34.30  ? 54  GLN A C   1 
ATOM   386  C C   B GLN A 1 53  ? -2.770  -17.809 50.075  0.57 34.34  ? 54  GLN A C   1 
ATOM   387  O O   A GLN A 1 53  ? -3.389  -18.817 50.494  0.43 33.25  ? 54  GLN A O   1 
ATOM   388  O O   B GLN A 1 53  ? -3.445  -18.750 50.495  0.57 33.27  ? 54  GLN A O   1 
ATOM   389  C CB  A GLN A 1 53  ? -4.297  -16.172 48.966  0.43 34.67  ? 54  GLN A CB  1 
ATOM   390  C CB  B GLN A 1 53  ? -4.145  -16.054 48.896  0.57 34.72  ? 54  GLN A CB  1 
ATOM   391  C CG  A GLN A 1 53  ? -4.604  -15.322 47.731  0.43 35.67  ? 54  GLN A CG  1 
ATOM   392  C CG  B GLN A 1 53  ? -4.171  -15.042 47.748  0.57 35.33  ? 54  GLN A CG  1 
ATOM   393  C CD  A GLN A 1 53  ? -6.033  -14.794 47.700  0.43 38.48  ? 54  GLN A CD  1 
ATOM   394  C CD  B GLN A 1 53  ? -2.859  -14.290 47.598  0.57 36.68  ? 54  GLN A CD  1 
ATOM   395  O OE1 A GLN A 1 53  ? -6.537  -14.406 46.643  0.43 38.77  ? 54  GLN A OE1 1 
ATOM   396  O OE1 B GLN A 1 53  ? -2.448  -13.545 48.492  0.57 40.73  ? 54  GLN A OE1 1 
ATOM   397  N NE2 A GLN A 1 53  ? -6.691  -14.780 48.855  0.43 33.35  ? 54  GLN A NE2 1 
ATOM   398  N NE2 B GLN A 1 53  ? -2.193  -14.487 46.467  0.57 34.01  ? 54  GLN A NE2 1 
ATOM   399  N N   . PRO A 1 54  ? -1.721  -17.312 50.747  1.00 33.15  ? 55  PRO A N   1 
ATOM   400  C CA  . PRO A 1 54  ? -1.291  -17.843 52.052  1.00 34.19  ? 55  PRO A CA  1 
ATOM   401  C C   . PRO A 1 54  ? -2.418  -17.894 53.084  1.00 33.93  ? 55  PRO A C   1 
ATOM   402  O O   . PRO A 1 54  ? -3.324  -17.061 53.061  1.00 31.90  ? 55  PRO A O   1 
ATOM   403  C CB  . PRO A 1 54  ? -0.197  -16.866 52.492  1.00 30.69  ? 55  PRO A CB  1 
ATOM   404  C CG  . PRO A 1 54  ? 0.360   -16.351 51.208  1.00 36.57  ? 55  PRO A CG  1 
ATOM   405  C CD  . PRO A 1 54  ? -0.825  -16.248 50.264  1.00 30.62  ? 55  PRO A CD  1 
ATOM   406  N N   . TRP A 1 55  ? -2.361  -18.897 53.956  1.00 30.06  ? 56  TRP A N   1 
ATOM   407  C CA  . TRP A 1 55  ? -3.368  -19.114 54.985  1.00 31.65  ? 56  TRP A CA  1 
ATOM   408  C C   . TRP A 1 55  ? -2.706  -19.075 56.366  1.00 37.29  ? 56  TRP A C   1 
ATOM   409  O O   . TRP A 1 55  ? -1.498  -19.319 56.505  1.00 29.83  ? 56  TRP A O   1 
ATOM   410  C CB  . TRP A 1 55  ? -4.045  -20.478 54.787  1.00 29.54  ? 56  TRP A CB  1 
ATOM   411  C CG  . TRP A 1 55  ? -3.063  -21.622 54.828  1.00 30.99  ? 56  TRP A CG  1 
ATOM   412  C CD1 . TRP A 1 55  ? -2.635  -22.296 55.935  1.00 31.93  ? 56  TRP A CD1 1 
ATOM   413  C CD2 . TRP A 1 55  ? -2.369  -22.200 53.715  1.00 31.44  ? 56  TRP A CD2 1 
ATOM   414  N NE1 . TRP A 1 55  ? -1.722  -23.257 55.582  1.00 33.07  ? 56  TRP A NE1 1 
ATOM   415  C CE2 . TRP A 1 55  ? -1.542  -23.221 54.224  1.00 30.32  ? 56  TRP A CE2 1 
ATOM   416  C CE3 . TRP A 1 55  ? -2.371  -21.956 52.336  1.00 31.14  ? 56  TRP A CE3 1 
ATOM   417  C CZ2 . TRP A 1 55  ? -0.727  -24.004 53.403  1.00 26.50  ? 56  TRP A CZ2 1 
ATOM   418  C CZ3 . TRP A 1 55  ? -1.562  -22.735 51.521  1.00 28.31  ? 56  TRP A CZ3 1 
ATOM   419  C CH2 . TRP A 1 55  ? -0.748  -23.744 52.060  1.00 28.66  ? 56  TRP A CH2 1 
ATOM   420  N N   . SER A 1 56  ? -3.495  -18.762 57.384  1.00 33.45  ? 57  SER A N   1 
ATOM   421  C CA  . SER A 1 56  ? -3.008  -18.826 58.754  1.00 39.57  ? 57  SER A CA  1 
ATOM   422  C C   . SER A 1 56  ? -3.492  -20.140 59.348  1.00 41.61  ? 57  SER A C   1 
ATOM   423  O O   . SER A 1 56  ? -4.399  -20.772 58.805  1.00 41.55  ? 57  SER A O   1 
ATOM   424  C CB  . SER A 1 56  ? -3.533  -17.646 59.564  1.00 41.88  ? 57  SER A CB  1 
ATOM   425  O OG  . SER A 1 56  ? -4.948  -17.668 59.611  1.00 45.04  ? 57  SER A OG  1 
ATOM   426  N N   . GLY A 1 57  ? -2.888  -20.560 60.453  1.00 40.86  ? 58  GLY A N   1 
ATOM   427  C CA  . GLY A 1 57  ? -3.241  -21.838 61.043  1.00 37.53  ? 58  GLY A CA  1 
ATOM   428  C C   . GLY A 1 57  ? -2.747  -23.020 60.219  1.00 44.22  ? 58  GLY A C   1 
ATOM   429  O O   . GLY A 1 57  ? -1.904  -22.871 59.331  1.00 41.44  ? 58  GLY A O   1 
ATOM   430  N N   . VAL A 1 58  ? -3.283  -24.201 60.507  1.00 39.11  ? 59  VAL A N   1 
ATOM   431  C CA  . VAL A 1 58  ? -2.763  -25.434 59.933  1.00 41.07  ? 59  VAL A CA  1 
ATOM   432  C C   . VAL A 1 58  ? -3.782  -26.101 59.022  1.00 40.03  ? 59  VAL A C   1 
ATOM   433  O O   . VAL A 1 58  ? -4.849  -26.518 59.480  1.00 35.57  ? 59  VAL A O   1 
ATOM   434  C CB  . VAL A 1 58  ? -2.387  -26.444 61.038  1.00 40.95  ? 59  VAL A CB  1 
ATOM   435  C CG1 . VAL A 1 58  ? -1.654  -27.644 60.440  1.00 36.13  ? 59  VAL A CG1 1 
ATOM   436  C CG2 . VAL A 1 58  ? -1.544  -25.775 62.120  1.00 32.77  ? 59  VAL A CG2 1 
ATOM   437  N N   . VAL A 1 59  ? -3.450  -26.208 57.736  1.00 35.85  ? 60  VAL A N   1 
ATOM   438  C CA  . VAL A 1 59  ? -4.287  -26.952 56.792  1.00 32.06  ? 60  VAL A CA  1 
ATOM   439  C C   . VAL A 1 59  ? -4.243  -28.457 57.071  1.00 34.95  ? 60  VAL A C   1 
ATOM   440  O O   . VAL A 1 59  ? -3.170  -29.067 57.178  1.00 32.51  ? 60  VAL A O   1 
ATOM   441  C CB  . VAL A 1 59  ? -3.909  -26.664 55.316  1.00 31.60  ? 60  VAL A CB  1 
ATOM   442  C CG1 . VAL A 1 59  ? -4.473  -27.728 54.390  1.00 29.25  ? 60  VAL A CG1 1 
ATOM   443  C CG2 . VAL A 1 59  ? -4.410  -25.292 54.898  1.00 31.86  ? 60  VAL A CG2 1 
ATOM   444  N N   . ASP A 1 60  ? -5.428  -29.037 57.211  1.00 33.02  ? 61  ASP A N   1 
ATOM   445  C CA  . ASP A 1 60  ? -5.593  -30.470 57.374  1.00 38.98  ? 61  ASP A CA  1 
ATOM   446  C C   . ASP A 1 60  ? -5.325  -31.192 56.052  1.00 41.18  ? 61  ASP A C   1 
ATOM   447  O O   . ASP A 1 60  ? -6.156  -31.171 55.146  1.00 42.08  ? 61  ASP A O   1 
ATOM   448  C CB  . ASP A 1 60  ? -7.020  -30.757 57.837  1.00 38.86  ? 61  ASP A CB  1 
ATOM   449  C CG  . ASP A 1 60  ? -7.355  -32.230 57.821  1.00 47.45  ? 61  ASP A CG  1 
ATOM   450  O OD1 . ASP A 1 60  ? -6.435  -33.057 57.981  1.00 52.46  ? 61  ASP A OD1 1 
ATOM   451  O OD2 . ASP A 1 60  ? -8.546  -32.563 57.655  1.00 57.14  ? 61  ASP A OD2 1 
ATOM   452  N N   . ALA A 1 61  ? -4.167  -31.829 55.940  1.00 33.88  ? 62  ALA A N   1 
ATOM   453  C CA  . ALA A 1 61  ? -3.833  -32.544 54.718  1.00 33.27  ? 62  ALA A CA  1 
ATOM   454  C C   . ALA A 1 61  ? -3.819  -34.053 54.945  1.00 29.34  ? 62  ALA A C   1 
ATOM   455  O O   . ALA A 1 61  ? -2.835  -34.719 54.636  1.00 26.52  ? 62  ALA A O   1 
ATOM   456  C CB  . ALA A 1 61  ? -2.478  -32.074 54.169  1.00 28.50  ? 62  ALA A CB  1 
ATOM   457  N N   . THR A 1 62  ? -4.911  -34.589 55.480  1.00 29.97  ? 63  THR A N   1 
ATOM   458  C CA  . THR A 1 62  ? -4.940  -35.992 55.881  1.00 34.87  ? 63  THR A CA  1 
ATOM   459  C C   . THR A 1 62  ? -5.886  -36.800 55.006  1.00 34.98  ? 63  THR A C   1 
ATOM   460  O O   . THR A 1 62  ? -6.021  -38.014 55.177  1.00 34.94  ? 63  THR A O   1 
ATOM   461  C CB  . THR A 1 62  ? -5.381  -36.158 57.362  1.00 35.26  ? 63  THR A CB  1 
ATOM   462  O OG1 . THR A 1 62  ? -6.697  -35.620 57.530  1.00 32.20  ? 63  THR A OG1 1 
ATOM   463  C CG2 . THR A 1 62  ? -4.432  -35.438 58.289  1.00 30.47  ? 63  THR A CG2 1 
ATOM   464  N N   . THR A 1 63  ? -6.539  -36.127 54.067  1.00 32.28  ? 64  THR A N   1 
ATOM   465  C CA  . THR A 1 63  ? -7.572  -36.774 53.273  1.00 29.96  ? 64  THR A CA  1 
ATOM   466  C C   . THR A 1 63  ? -7.635  -36.208 51.833  1.00 32.97  ? 64  THR A C   1 
ATOM   467  O O   . THR A 1 63  ? -7.289  -35.046 51.599  1.00 31.19  ? 64  THR A O   1 
ATOM   468  C CB  . THR A 1 63  ? -8.936  -36.683 54.021  1.00 31.00  ? 64  THR A CB  1 
ATOM   469  O OG1 . THR A 1 63  ? -9.899  -37.536 53.398  1.00 46.09  ? 64  THR A OG1 1 
ATOM   470  C CG2 . THR A 1 63  ? -9.452  -35.252 54.050  1.00 25.37  ? 64  THR A CG2 1 
ATOM   471  N N   . PHE A 1 64  ? -8.037  -37.035 50.868  1.00 26.42  ? 65  PHE A N   1 
ATOM   472  C CA  . PHE A 1 64  ? -8.167  -36.570 49.491  1.00 25.38  ? 65  PHE A CA  1 
ATOM   473  C C   . PHE A 1 64  ? -9.244  -35.504 49.384  1.00 26.15  ? 65  PHE A C   1 
ATOM   474  O O   . PHE A 1 64  ? -10.265 -35.560 50.068  1.00 28.45  ? 65  PHE A O   1 
ATOM   475  C CB  . PHE A 1 64  ? -8.491  -37.719 48.529  1.00 25.63  ? 65  PHE A CB  1 
ATOM   476  C CG  . PHE A 1 64  ? -7.315  -38.586 48.196  1.00 20.84  ? 65  PHE A CG  1 
ATOM   477  C CD1 . PHE A 1 64  ? -6.187  -38.047 47.605  1.00 20.39  ? 65  PHE A CD1 1 
ATOM   478  C CD2 . PHE A 1 64  ? -7.348  -39.946 48.448  1.00 20.16  ? 65  PHE A CD2 1 
ATOM   479  C CE1 . PHE A 1 64  ? -5.098  -38.849 47.292  1.00 21.43  ? 65  PHE A CE1 1 
ATOM   480  C CE2 . PHE A 1 64  ? -6.264  -40.761 48.134  1.00 18.76  ? 65  PHE A CE2 1 
ATOM   481  C CZ  . PHE A 1 64  ? -5.135  -40.205 47.556  1.00 22.11  ? 65  PHE A CZ  1 
ATOM   482  N N   . GLN A 1 65  ? -9.013  -34.532 48.514  1.00 24.40  ? 66  GLN A N   1 
ATOM   483  C CA  . GLN A 1 65  ? -9.978  -33.472 48.296  1.00 22.11  ? 66  GLN A CA  1 
ATOM   484  C C   . GLN A 1 65  ? -10.901 -33.816 47.126  1.00 26.84  ? 66  GLN A C   1 
ATOM   485  O O   . GLN A 1 65  ? -10.762 -34.872 46.498  1.00 25.86  ? 66  GLN A O   1 
ATOM   486  C CB  . GLN A 1 65  ? -9.247  -32.159 48.026  1.00 27.01  ? 66  GLN A CB  1 
ATOM   487  C CG  . GLN A 1 65  ? -9.063  -31.289 49.236  1.00 24.82  ? 66  GLN A CG  1 
ATOM   488  C CD  . GLN A 1 65  ? -10.328 -30.532 49.594  1.00 35.60  ? 66  GLN A CD  1 
ATOM   489  O OE1 . GLN A 1 65  ? -11.357 -30.645 48.914  1.00 35.85  ? 66  GLN A OE1 1 
ATOM   490  N NE2 . GLN A 1 65  ? -10.256 -29.742 50.657  1.00 26.54  ? 66  GLN A NE2 1 
ATOM   491  N N   . SER A 1 66  ? -11.824 -32.907 46.829  1.00 19.94  ? 67  SER A N   1 
ATOM   492  C CA  . SER A 1 66  ? -12.853 -33.130 45.828  1.00 26.24  ? 67  SER A CA  1 
ATOM   493  C C   . SER A 1 66  ? -12.318 -33.430 44.418  1.00 29.68  ? 67  SER A C   1 
ATOM   494  O O   . SER A 1 66  ? -11.234 -32.987 44.030  1.00 24.61  ? 67  SER A O   1 
ATOM   495  C CB  . SER A 1 66  ? -13.773 -31.917 45.773  1.00 27.81  ? 67  SER A CB  1 
ATOM   496  O OG  . SER A 1 66  ? -14.263 -31.605 47.063  1.00 34.46  ? 67  SER A OG  1 
ATOM   497  N N   . VAL A 1 67  ? -13.099 -34.194 43.663  1.00 26.74  ? 68  VAL A N   1 
ATOM   498  C CA  . VAL A 1 67  ? -12.799 -34.471 42.265  1.00 22.55  ? 68  VAL A CA  1 
ATOM   499  C C   . VAL A 1 67  ? -13.315 -33.322 41.400  1.00 23.76  ? 68  VAL A C   1 
ATOM   500  O O   . VAL A 1 67  ? -14.427 -32.828 41.615  1.00 23.36  ? 68  VAL A O   1 
ATOM   501  C CB  . VAL A 1 67  ? -13.425 -35.815 41.833  1.00 24.54  ? 68  VAL A CB  1 
ATOM   502  C CG1 . VAL A 1 67  ? -13.235 -36.067 40.335  1.00 22.63  ? 68  VAL A CG1 1 
ATOM   503  C CG2 . VAL A 1 67  ? -12.828 -36.955 42.662  1.00 18.61  ? 68  VAL A CG2 1 
ATOM   504  N N   . CYS A 1 68  ? -12.492 -32.869 40.457  1.00 20.75  ? 69  CYS A N   1 
ATOM   505  C CA  . CYS A 1 68  ? -12.910 -31.827 39.515  1.00 24.58  ? 69  CYS A CA  1 
ATOM   506  C C   . CYS A 1 68  ? -14.135 -32.299 38.768  1.00 26.10  ? 69  CYS A C   1 
ATOM   507  O O   . CYS A 1 68  ? -14.199 -33.463 38.367  1.00 24.20  ? 69  CYS A O   1 
ATOM   508  C CB  . CYS A 1 68  ? -11.790 -31.501 38.518  1.00 22.99  ? 69  CYS A CB  1 
ATOM   509  S SG  . CYS A 1 68  ? -10.349 -30.673 39.265  1.00 27.26  ? 69  CYS A SG  1 
ATOM   510  N N   . TYR A 1 69  ? -15.100 -31.398 38.589  1.00 25.05  ? 70  TYR A N   1 
ATOM   511  C CA  . TYR A 1 69  ? -16.350 -31.724 37.903  1.00 26.87  ? 70  TYR A CA  1 
ATOM   512  C C   . TYR A 1 69  ? -16.167 -32.441 36.568  1.00 27.98  ? 70  TYR A C   1 
ATOM   513  O O   . TYR A 1 69  ? -15.441 -31.970 35.691  1.00 25.35  ? 70  TYR A O   1 
ATOM   514  C CB  . TYR A 1 69  ? -17.196 -30.471 37.701  1.00 30.15  ? 70  TYR A CB  1 
ATOM   515  C CG  . TYR A 1 69  ? -18.461 -30.525 38.506  1.00 32.51  ? 70  TYR A CG  1 
ATOM   516  C CD1 . TYR A 1 69  ? -18.555 -29.869 39.728  1.00 26.53  ? 70  TYR A CD1 1 
ATOM   517  C CD2 . TYR A 1 69  ? -19.557 -31.264 38.063  1.00 32.44  ? 70  TYR A CD2 1 
ATOM   518  C CE1 . TYR A 1 69  ? -19.713 -29.922 40.482  1.00 29.37  ? 70  TYR A CE1 1 
ATOM   519  C CE2 . TYR A 1 69  ? -20.725 -31.330 38.819  1.00 36.45  ? 70  TYR A CE2 1 
ATOM   520  C CZ  . TYR A 1 69  ? -20.789 -30.657 40.029  1.00 33.93  ? 70  TYR A CZ  1 
ATOM   521  O OH  . TYR A 1 69  ? -21.936 -30.706 40.787  1.00 52.19  ? 70  TYR A OH  1 
ATOM   522  N N   . GLN A 1 70  ? -16.843 -33.578 36.421  1.00 27.96  ? 71  GLN A N   1 
ATOM   523  C CA  . GLN A 1 70  ? -16.658 -34.421 35.255  1.00 25.32  ? 71  GLN A CA  1 
ATOM   524  C C   . GLN A 1 70  ? -17.798 -35.417 35.074  1.00 31.39  ? 71  GLN A C   1 
ATOM   525  O O   . GLN A 1 70  ? -18.510 -35.747 36.032  1.00 24.05  ? 71  GLN A O   1 
ATOM   526  C CB  . GLN A 1 70  ? -15.346 -35.185 35.372  1.00 21.80  ? 71  GLN A CB  1 
ATOM   527  C CG  . GLN A 1 70  ? -15.315 -36.174 36.519  1.00 20.79  ? 71  GLN A CG  1 
ATOM   528  C CD  . GLN A 1 70  ? -13.930 -36.738 36.749  1.00 23.12  ? 71  GLN A CD  1 
ATOM   529  O OE1 . GLN A 1 70  ? -13.699 -37.937 36.582  1.00 20.38  ? 71  GLN A OE1 1 
ATOM   530  N NE2 . GLN A 1 70  ? -12.998 -35.878 37.153  1.00 22.86  ? 71  GLN A NE2 1 
ATOM   531  N N   . TYR A 1 71  ? -17.955 -35.865 33.827  1.00 23.07  ? 72  TYR A N   1 
ATOM   532  C CA  . TYR A 1 71  ? -18.878 -36.918 33.444  1.00 21.23  ? 72  TYR A CA  1 
ATOM   533  C C   . TYR A 1 71  ? -18.592 -38.187 34.233  1.00 25.36  ? 72  TYR A C   1 
ATOM   534  O O   . TYR A 1 71  ? -17.429 -38.491 34.518  1.00 28.13  ? 72  TYR A O   1 
ATOM   535  C CB  . TYR A 1 71  ? -18.747 -37.186 31.928  1.00 26.46  ? 72  TYR A CB  1 
ATOM   536  C CG  . TYR A 1 71  ? -19.487 -38.417 31.457  1.00 25.78  ? 72  TYR A CG  1 
ATOM   537  C CD1 . TYR A 1 71  ? -20.864 -38.394 31.276  1.00 25.20  ? 72  TYR A CD1 1 
ATOM   538  C CD2 . TYR A 1 71  ? -18.811 -39.607 31.202  1.00 22.40  ? 72  TYR A CD2 1 
ATOM   539  C CE1 . TYR A 1 71  ? -21.553 -39.523 30.851  1.00 26.16  ? 72  TYR A CE1 1 
ATOM   540  C CE2 . TYR A 1 71  ? -19.492 -40.739 30.777  1.00 27.90  ? 72  TYR A CE2 1 
ATOM   541  C CZ  . TYR A 1 71  ? -20.865 -40.691 30.609  1.00 27.12  ? 72  TYR A CZ  1 
ATOM   542  O OH  . TYR A 1 71  ? -21.555 -41.812 30.201  1.00 26.34  ? 72  TYR A OH  1 
ATOM   543  N N   . VAL A 1 72  ? -19.651 -38.910 34.606  1.00 26.54  ? 73  VAL A N   1 
ATOM   544  C CA  . VAL A 1 72  ? -19.520 -40.178 35.330  1.00 25.16  ? 73  VAL A CA  1 
ATOM   545  C C   . VAL A 1 72  ? -19.941 -41.323 34.410  1.00 25.01  ? 73  VAL A C   1 
ATOM   546  O O   . VAL A 1 72  ? -21.075 -41.362 33.938  1.00 31.16  ? 73  VAL A O   1 
ATOM   547  C CB  . VAL A 1 72  ? -20.364 -40.206 36.652  1.00 30.05  ? 73  VAL A CB  1 
ATOM   548  C CG1 . VAL A 1 72  ? -20.243 -41.549 37.356  1.00 26.01  ? 73  VAL A CG1 1 
ATOM   549  C CG2 . VAL A 1 72  ? -19.937 -39.099 37.601  1.00 22.33  ? 73  VAL A CG2 1 
ATOM   550  N N   . ASP A 1 73  ? -19.015 -42.237 34.143  1.00 27.32  ? 74  ASP A N   1 
ATOM   551  C CA  . ASP A 1 73  ? -19.239 -43.349 33.218  1.00 31.49  ? 74  ASP A CA  1 
ATOM   552  C C   . ASP A 1 73  ? -20.332 -44.301 33.714  1.00 29.08  ? 74  ASP A C   1 
ATOM   553  O O   . ASP A 1 73  ? -20.139 -45.000 34.694  1.00 30.74  ? 74  ASP A O   1 
ATOM   554  C CB  . ASP A 1 73  ? -17.932 -44.128 33.032  1.00 29.75  ? 74  ASP A CB  1 
ATOM   555  C CG  . ASP A 1 73  ? -17.992 -45.135 31.878  1.00 34.55  ? 74  ASP A CG  1 
ATOM   556  O OD1 . ASP A 1 73  ? -19.077 -45.335 31.303  1.00 32.93  ? 74  ASP A OD1 1 
ATOM   557  O OD2 . ASP A 1 73  ? -16.946 -45.737 31.549  1.00 37.02  ? 74  ASP A OD2 1 
ATOM   558  N N   . THR A 1 74  ? -21.461 -44.352 33.012  1.00 32.23  ? 75  THR A N   1 
ATOM   559  C CA  . THR A 1 74  ? -22.558 -45.249 33.393  1.00 34.66  ? 75  THR A CA  1 
ATOM   560  C C   . THR A 1 74  ? -22.797 -46.421 32.429  1.00 40.32  ? 75  THR A C   1 
ATOM   561  O O   . THR A 1 74  ? -23.882 -47.002 32.428  1.00 36.31  ? 75  THR A O   1 
ATOM   562  C CB  . THR A 1 74  ? -23.891 -44.487 33.549  1.00 28.12  ? 75  THR A CB  1 
ATOM   563  O OG1 . THR A 1 74  ? -24.119 -43.667 32.391  1.00 33.41  ? 75  THR A OG1 1 
ATOM   564  C CG2 . THR A 1 74  ? -23.874 -43.615 34.792  1.00 25.24  ? 75  THR A CG2 1 
ATOM   565  N N   . LEU A 1 75  ? -21.796 -46.775 31.626  1.00 38.02  ? 76  LEU A N   1 
ATOM   566  C CA  . LEU A 1 75  ? -21.956 -47.842 30.635  1.00 36.60  ? 76  LEU A CA  1 
ATOM   567  C C   . LEU A 1 75  ? -22.394 -49.177 31.246  1.00 41.25  ? 76  LEU A C   1 
ATOM   568  O O   . LEU A 1 75  ? -23.337 -49.818 30.761  1.00 39.67  ? 76  LEU A O   1 
ATOM   569  C CB  . LEU A 1 75  ? -20.672 -48.048 29.828  1.00 33.09  ? 76  LEU A CB  1 
ATOM   570  C CG  . LEU A 1 75  ? -20.762 -49.111 28.731  1.00 36.15  ? 76  LEU A CG  1 
ATOM   571  C CD1 . LEU A 1 75  ? -21.778 -48.696 27.678  1.00 26.38  ? 76  LEU A CD1 1 
ATOM   572  C CD2 . LEU A 1 75  ? -19.404 -49.332 28.100  1.00 35.68  ? 76  LEU A CD2 1 
ATOM   573  N N   . TYR A 1 76  ? -21.700 -49.608 32.292  1.00 28.58  ? 77  TYR A N   1 
ATOM   574  C CA  . TYR A 1 76  ? -22.074 -50.846 32.959  1.00 31.33  ? 77  TYR A CA  1 
ATOM   575  C C   . TYR A 1 76  ? -22.210 -50.600 34.460  1.00 33.33  ? 77  TYR A C   1 
ATOM   576  O O   . TYR A 1 76  ? -21.290 -50.885 35.217  1.00 31.60  ? 77  TYR A O   1 
ATOM   577  C CB  . TYR A 1 76  ? -21.044 -51.946 32.696  1.00 33.27  ? 77  TYR A CB  1 
ATOM   578  C CG  . TYR A 1 76  ? -20.918 -52.391 31.245  1.00 42.31  ? 77  TYR A CG  1 
ATOM   579  C CD1 . TYR A 1 76  ? -21.958 -53.057 30.601  1.00 40.46  ? 77  TYR A CD1 1 
ATOM   580  C CD2 . TYR A 1 76  ? -19.740 -52.171 30.530  1.00 37.43  ? 77  TYR A CD2 1 
ATOM   581  C CE1 . TYR A 1 76  ? -21.833 -53.473 29.276  1.00 41.00  ? 77  TYR A CE1 1 
ATOM   582  C CE2 . TYR A 1 76  ? -19.608 -52.580 29.213  1.00 34.21  ? 77  TYR A CE2 1 
ATOM   583  C CZ  . TYR A 1 76  ? -20.652 -53.229 28.587  1.00 41.56  ? 77  TYR A CZ  1 
ATOM   584  O OH  . TYR A 1 76  ? -20.507 -53.631 27.270  1.00 41.25  ? 77  TYR A OH  1 
ATOM   585  N N   . PRO A 1 77  ? -23.362 -50.059 34.889  1.00 36.04  ? 78  PRO A N   1 
ATOM   586  C CA  . PRO A 1 77  ? -23.577 -49.661 36.292  1.00 34.13  ? 78  PRO A CA  1 
ATOM   587  C C   . PRO A 1 77  ? -23.259 -50.776 37.272  1.00 32.92  ? 78  PRO A C   1 
ATOM   588  O O   . PRO A 1 77  ? -23.841 -51.854 37.185  1.00 37.25  ? 78  PRO A O   1 
ATOM   589  C CB  . PRO A 1 77  ? -25.069 -49.334 36.339  1.00 30.45  ? 78  PRO A CB  1 
ATOM   590  C CG  . PRO A 1 77  ? -25.401 -48.916 34.934  1.00 39.15  ? 78  PRO A CG  1 
ATOM   591  C CD  . PRO A 1 77  ? -24.541 -49.781 34.044  1.00 35.39  ? 78  PRO A CD  1 
ATOM   592  N N   . GLY A 1 78  ? -22.323 -50.517 38.179  1.00 34.95  ? 79  GLY A N   1 
ATOM   593  C CA  . GLY A 1 78  ? -21.968 -51.476 39.207  1.00 34.30  ? 79  GLY A CA  1 
ATOM   594  C C   . GLY A 1 78  ? -20.724 -52.271 38.873  1.00 35.32  ? 79  GLY A C   1 
ATOM   595  O O   . GLY A 1 78  ? -20.012 -52.739 39.755  1.00 36.39  ? 79  GLY A O   1 
ATOM   596  N N   . PHE A 1 79  ? -20.458 -52.418 37.585  1.00 37.05  ? 80  PHE A N   1 
ATOM   597  C CA  . PHE A 1 79  ? -19.299 -53.170 37.122  1.00 35.14  ? 80  PHE A CA  1 
ATOM   598  C C   . PHE A 1 79  ? -17.994 -52.529 37.622  1.00 31.41  ? 80  PHE A C   1 
ATOM   599  O O   . PHE A 1 79  ? -17.756 -51.347 37.415  1.00 35.46  ? 80  PHE A O   1 
ATOM   600  C CB  . PHE A 1 79  ? -19.352 -53.251 35.594  1.00 29.41  ? 80  PHE A CB  1 
ATOM   601  C CG  . PHE A 1 79  ? -18.248 -54.046 34.980  1.00 31.75  ? 80  PHE A CG  1 
ATOM   602  C CD1 . PHE A 1 79  ? -17.980 -55.335 35.411  1.00 29.32  ? 80  PHE A CD1 1 
ATOM   603  C CD2 . PHE A 1 79  ? -17.495 -53.513 33.938  1.00 25.79  ? 80  PHE A CD2 1 
ATOM   604  C CE1 . PHE A 1 79  ? -16.965 -56.081 34.833  1.00 30.14  ? 80  PHE A CE1 1 
ATOM   605  C CE2 . PHE A 1 79  ? -16.477 -54.252 33.356  1.00 28.60  ? 80  PHE A CE2 1 
ATOM   606  C CZ  . PHE A 1 79  ? -16.211 -55.540 33.801  1.00 28.60  ? 80  PHE A CZ  1 
ATOM   607  N N   . GLU A 1 80  ? -17.166 -53.315 38.293  1.00 30.54  ? 81  GLU A N   1 
ATOM   608  C CA  . GLU A 1 80  ? -15.877 -52.852 38.793  1.00 32.97  ? 81  GLU A CA  1 
ATOM   609  C C   . GLU A 1 80  ? -14.986 -52.267 37.688  1.00 39.81  ? 81  GLU A C   1 
ATOM   610  O O   . GLU A 1 80  ? -14.229 -51.315 37.919  1.00 30.76  ? 81  GLU A O   1 
ATOM   611  C CB  . GLU A 1 80  ? -15.154 -54.004 39.509  1.00 38.53  ? 81  GLU A CB  1 
ATOM   612  C CG  . GLU A 1 80  ? -13.671 -53.774 39.822  1.00 56.65  ? 81  GLU A CG  1 
ATOM   613  C CD  . GLU A 1 80  ? -13.427 -52.791 40.971  1.00 71.31  ? 81  GLU A CD  1 
ATOM   614  O OE1 . GLU A 1 80  ? -14.401 -52.162 41.456  1.00 67.23  ? 81  GLU A OE1 1 
ATOM   615  O OE2 . GLU A 1 80  ? -12.251 -52.648 41.390  1.00 64.44  ? 81  GLU A OE2 1 
ATOM   616  N N   . GLY A 1 81  ? -15.094 -52.829 36.485  1.00 33.07  ? 82  GLY A N   1 
ATOM   617  C CA  . GLY A 1 81  ? -14.231 -52.449 35.382  1.00 28.36  ? 82  GLY A CA  1 
ATOM   618  C C   . GLY A 1 81  ? -14.406 -51.019 34.911  1.00 27.54  ? 82  GLY A C   1 
ATOM   619  O O   . GLY A 1 81  ? -13.452 -50.396 34.430  1.00 27.99  ? 82  GLY A O   1 
ATOM   620  N N   . THR A 1 82  ? -15.624 -50.500 35.029  1.00 27.68  ? 83  THR A N   1 
ATOM   621  C CA  . THR A 1 82  ? -15.876 -49.098 34.724  1.00 31.99  ? 83  THR A CA  1 
ATOM   622  C C   . THR A 1 82  ? -15.816 -48.226 35.986  1.00 34.89  ? 83  THR A C   1 
ATOM   623  O O   . THR A 1 82  ? -15.403 -47.062 35.927  1.00 32.43  ? 83  THR A O   1 
ATOM   624  C CB  . THR A 1 82  ? -17.249 -48.879 34.048  1.00 30.33  ? 83  THR A CB  1 
ATOM   625  O OG1 . THR A 1 82  ? -18.263 -49.542 34.807  1.00 37.88  ? 83  THR A OG1 1 
ATOM   626  C CG2 . THR A 1 82  ? -17.253 -49.406 32.629  1.00 30.97  ? 83  THR A CG2 1 
ATOM   627  N N   . GLU A 1 83  ? -16.231 -48.781 37.121  1.00 28.50  ? 84  GLU A N   1 
ATOM   628  C CA  . GLU A 1 83  ? -16.363 -47.977 38.335  1.00 32.61  ? 84  GLU A CA  1 
ATOM   629  C C   . GLU A 1 83  ? -15.026 -47.553 38.938  1.00 30.40  ? 84  GLU A C   1 
ATOM   630  O O   . GLU A 1 83  ? -14.926 -46.484 39.528  1.00 29.64  ? 84  GLU A O   1 
ATOM   631  C CB  . GLU A 1 83  ? -17.199 -48.701 39.393  1.00 33.86  ? 84  GLU A CB  1 
ATOM   632  C CG  . GLU A 1 83  ? -18.646 -48.959 39.000  1.00 40.69  ? 84  GLU A CG  1 
ATOM   633  C CD  . GLU A 1 83  ? -19.504 -47.712 38.947  1.00 46.33  ? 84  GLU A CD  1 
ATOM   634  O OE1 . GLU A 1 83  ? -20.707 -47.849 38.608  1.00 46.73  ? 84  GLU A OE1 1 
ATOM   635  O OE2 . GLU A 1 83  ? -18.989 -46.606 39.249  1.00 45.89  ? 84  GLU A OE2 1 
ATOM   636  N N   . MET A 1 84  ? -14.003 -48.386 38.785  1.00 30.72  ? 85  MET A N   1 
ATOM   637  C CA  . MET A 1 84  ? -12.683 -48.082 39.332  1.00 25.48  ? 85  MET A CA  1 
ATOM   638  C C   . MET A 1 84  ? -12.091 -46.765 38.783  1.00 29.58  ? 85  MET A C   1 
ATOM   639  O O   . MET A 1 84  ? -11.140 -46.238 39.351  1.00 30.73  ? 85  MET A O   1 
ATOM   640  C CB  . MET A 1 84  ? -11.716 -49.246 39.079  1.00 27.96  ? 85  MET A CB  1 
ATOM   641  C CG  . MET A 1 84  ? -11.437 -49.524 37.581  1.00 27.82  ? 85  MET A CG  1 
ATOM   642  S SD  . MET A 1 84  ? -10.164 -50.784 37.292  1.00 33.83  ? 85  MET A SD  1 
ATOM   643  C CE  . MET A 1 84  ? -8.659  -49.888 37.663  1.00 27.28  ? 85  MET A CE  1 
ATOM   644  N N   . TRP A 1 85  ? -12.660 -46.244 37.692  1.00 26.62  ? 86  TRP A N   1 
ATOM   645  C CA  . TRP A 1 85  ? -12.176 -45.014 37.048  1.00 25.70  ? 86  TRP A CA  1 
ATOM   646  C C   . TRP A 1 85  ? -13.030 -43.797 37.384  1.00 24.34  ? 86  TRP A C   1 
ATOM   647  O O   . TRP A 1 85  ? -12.640 -42.661 37.113  1.00 23.76  ? 86  TRP A O   1 
ATOM   648  C CB  . TRP A 1 85  ? -12.137 -45.171 35.518  1.00 24.84  ? 86  TRP A CB  1 
ATOM   649  C CG  . TRP A 1 85  ? -11.376 -46.368 35.055  1.00 25.07  ? 86  TRP A CG  1 
ATOM   650  C CD1 . TRP A 1 85  ? -11.896 -47.527 34.553  1.00 23.51  ? 86  TRP A CD1 1 
ATOM   651  C CD2 . TRP A 1 85  ? -9.959  -46.541 35.075  1.00 25.54  ? 86  TRP A CD2 1 
ATOM   652  N NE1 . TRP A 1 85  ? -10.889 -48.407 34.255  1.00 20.31  ? 86  TRP A NE1 1 
ATOM   653  C CE2 . TRP A 1 85  ? -9.688  -47.829 34.564  1.00 23.69  ? 86  TRP A CE2 1 
ATOM   654  C CE3 . TRP A 1 85  ? -8.888  -45.730 35.466  1.00 25.38  ? 86  TRP A CE3 1 
ATOM   655  C CZ2 . TRP A 1 85  ? -8.391  -48.321 34.422  1.00 22.04  ? 86  TRP A CZ2 1 
ATOM   656  C CZ3 . TRP A 1 85  ? -7.600  -46.227 35.343  1.00 26.45  ? 86  TRP A CZ3 1 
ATOM   657  C CH2 . TRP A 1 85  ? -7.364  -47.511 34.823  1.00 25.01  ? 86  TRP A CH2 1 
ATOM   658  N N   . ASN A 1 86  ? -14.209 -44.046 37.940  1.00 24.25  ? 87  ASN A N   1 
ATOM   659  C CA  . ASN A 1 86  ? -15.158 -42.989 38.269  1.00 22.72  ? 87  ASN A CA  1 
ATOM   660  C C   . ASN A 1 86  ? -14.755 -42.226 39.532  1.00 22.74  ? 87  ASN A C   1 
ATOM   661  O O   . ASN A 1 86  ? -14.007 -42.748 40.370  1.00 20.93  ? 87  ASN A O   1 
ATOM   662  C CB  . ASN A 1 86  ? -16.561 -43.585 38.432  1.00 22.74  ? 87  ASN A CB  1 
ATOM   663  C CG  . ASN A 1 86  ? -17.264 -43.825 37.085  1.00 32.22  ? 87  ASN A CG  1 
ATOM   664  O OD1 . ASN A 1 86  ? -16.924 -43.217 36.066  1.00 25.54  ? 87  ASN A OD1 1 
ATOM   665  N ND2 . ASN A 1 86  ? -18.258 -44.706 37.090  1.00 29.46  ? 87  ASN A ND2 1 
ATOM   666  N N   . PRO A 1 87  ? -15.246 -40.984 39.674  1.00 20.33  ? 88  PRO A N   1 
ATOM   667  C CA  . PRO A 1 87  ? -14.957 -40.185 40.872  1.00 21.13  ? 88  PRO A CA  1 
ATOM   668  C C   . PRO A 1 87  ? -15.208 -40.980 42.150  1.00 28.46  ? 88  PRO A C   1 
ATOM   669  O O   . PRO A 1 87  ? -16.250 -41.627 42.271  1.00 27.39  ? 88  PRO A O   1 
ATOM   670  C CB  . PRO A 1 87  ? -15.954 -39.031 40.766  1.00 20.21  ? 88  PRO A CB  1 
ATOM   671  C CG  . PRO A 1 87  ? -16.189 -38.879 39.291  1.00 18.46  ? 88  PRO A CG  1 
ATOM   672  C CD  . PRO A 1 87  ? -16.079 -40.251 38.700  1.00 20.52  ? 88  PRO A CD  1 
ATOM   673  N N   . ASN A 1 88  ? -14.248 -40.964 43.069  1.00 27.58  ? 89  ASN A N   1 
ATOM   674  C CA  . ASN A 1 88  ? -14.415 -41.619 44.364  1.00 25.82  ? 89  ASN A CA  1 
ATOM   675  C C   . ASN A 1 88  ? -14.413 -40.608 45.522  1.00 26.22  ? 89  ASN A C   1 
ATOM   676  O O   . ASN A 1 88  ? -14.214 -40.972 46.679  1.00 28.49  ? 89  ASN A O   1 
ATOM   677  C CB  . ASN A 1 88  ? -13.332 -42.683 44.577  1.00 22.93  ? 89  ASN A CB  1 
ATOM   678  C CG  . ASN A 1 88  ? -11.947 -42.077 44.753  1.00 28.32  ? 89  ASN A CG  1 
ATOM   679  O OD1 . ASN A 1 88  ? -11.722 -40.911 44.424  1.00 30.26  ? 89  ASN A OD1 1 
ATOM   680  N ND2 . ASN A 1 88  ? -11.012 -42.867 45.263  1.00 25.28  ? 89  ASN A ND2 1 
ATOM   681  N N   . ARG A 1 89  ? -14.596 -39.336 45.185  1.00 25.13  ? 90  ARG A N   1 
ATOM   682  C CA  . ARG A 1 89  ? -14.881 -38.278 46.157  1.00 25.19  ? 90  ARG A CA  1 
ATOM   683  C C   . ARG A 1 89  ? -15.925 -37.377 45.521  1.00 25.05  ? 90  ARG A C   1 
ATOM   684  O O   . ARG A 1 89  ? -16.217 -37.504 44.326  1.00 31.53  ? 90  ARG A O   1 
ATOM   685  C CB  . ARG A 1 89  ? -13.626 -37.459 46.500  1.00 24.61  ? 90  ARG A CB  1 
ATOM   686  C CG  . ARG A 1 89  ? -12.536 -38.221 47.257  1.00 26.05  ? 90  ARG A CG  1 
ATOM   687  C CD  . ARG A 1 89  ? -13.006 -38.651 48.665  1.00 25.38  ? 90  ARG A CD  1 
ATOM   688  N NE  . ARG A 1 89  ? -11.924 -39.244 49.452  1.00 26.77  ? 90  ARG A NE  1 
ATOM   689  C CZ  . ARG A 1 89  ? -11.481 -40.495 49.307  1.00 33.02  ? 90  ARG A CZ  1 
ATOM   690  N NH1 . ARG A 1 89  ? -12.021 -41.297 48.398  1.00 26.91  ? 90  ARG A NH1 1 
ATOM   691  N NH2 . ARG A 1 89  ? -10.485 -40.950 50.064  1.00 24.76  ? 90  ARG A NH2 1 
ATOM   692  N N   . GLU A 1 90  ? -16.477 -36.455 46.294  1.00 22.20  ? 91  GLU A N   1 
ATOM   693  C CA  . GLU A 1 90  ? -17.515 -35.573 45.772  1.00 29.88  ? 91  GLU A CA  1 
ATOM   694  C C   . GLU A 1 90  ? -17.000 -34.669 44.646  1.00 32.61  ? 91  GLU A C   1 
ATOM   695  O O   . GLU A 1 90  ? -15.830 -34.275 44.626  1.00 27.35  ? 91  GLU A O   1 
ATOM   696  C CB  . GLU A 1 90  ? -18.146 -34.734 46.891  1.00 33.85  ? 91  GLU A CB  1 
ATOM   697  C CG  . GLU A 1 90  ? -17.294 -33.569 47.387  1.00 53.36  ? 91  GLU A CG  1 
ATOM   698  C CD  . GLU A 1 90  ? -18.077 -32.596 48.280  1.00 72.21  ? 91  GLU A CD  1 
ATOM   699  O OE1 . GLU A 1 90  ? -19.113 -33.009 48.853  1.00 69.65  ? 91  GLU A OE1 1 
ATOM   700  O OE2 . GLU A 1 90  ? -17.657 -31.418 48.398  1.00 61.11  ? 91  GLU A OE2 1 
ATOM   701  N N   . LEU A 1 91  ? -17.882 -34.353 43.704  1.00 30.19  ? 92  LEU A N   1 
ATOM   702  C CA  . LEU A 1 91  ? -17.536 -33.464 42.608  1.00 27.87  ? 92  LEU A CA  1 
ATOM   703  C C   . LEU A 1 91  ? -17.559 -32.021 43.081  1.00 26.09  ? 92  LEU A C   1 
ATOM   704  O O   . LEU A 1 91  ? -18.454 -31.614 43.816  1.00 32.14  ? 92  LEU A O   1 
ATOM   705  C CB  . LEU A 1 91  ? -18.514 -33.626 41.437  1.00 26.29  ? 92  LEU A CB  1 
ATOM   706  C CG  . LEU A 1 91  ? -18.582 -34.960 40.699  1.00 27.83  ? 92  LEU A CG  1 
ATOM   707  C CD1 . LEU A 1 91  ? -19.508 -34.844 39.499  1.00 22.55  ? 92  LEU A CD1 1 
ATOM   708  C CD2 . LEU A 1 91  ? -17.204 -35.397 40.264  1.00 27.36  ? 92  LEU A CD2 1 
ATOM   709  N N   . SER A 1 92  ? -16.587 -31.236 42.634  1.00 28.50  ? 93  SER A N   1 
ATOM   710  C CA  . SER A 1 92  ? -16.592 -29.809 42.917  1.00 27.43  ? 93  SER A CA  1 
ATOM   711  C C   . SER A 1 92  ? -15.708 -29.052 41.931  1.00 24.88  ? 93  SER A C   1 
ATOM   712  O O   . SER A 1 92  ? -14.727 -29.593 41.424  1.00 25.21  ? 93  SER A O   1 
ATOM   713  C CB  . SER A 1 92  ? -16.097 -29.556 44.345  1.00 19.41  ? 93  SER A CB  1 
ATOM   714  O OG  . SER A 1 92  ? -16.065 -28.167 44.608  1.00 23.57  ? 93  SER A OG  1 
ATOM   715  N N   . GLU A 1 93  ? -16.041 -27.795 41.668  1.00 22.25  ? 94  GLU A N   1 
ATOM   716  C CA  . GLU A 1 93  ? -15.132 -26.944 40.909  1.00 24.77  ? 94  GLU A CA  1 
ATOM   717  C C   . GLU A 1 93  ? -13.966 -26.481 41.792  1.00 27.92  ? 94  GLU A C   1 
ATOM   718  O O   . GLU A 1 93  ? -12.936 -26.034 41.296  1.00 28.79  ? 94  GLU A O   1 
ATOM   719  C CB  . GLU A 1 93  ? -15.875 -25.747 40.324  1.00 20.54  ? 94  GLU A CB  1 
ATOM   720  C CG  . GLU A 1 93  ? -16.754 -26.107 39.129  1.00 27.26  ? 94  GLU A CG  1 
ATOM   721  C CD  . GLU A 1 93  ? -17.412 -24.886 38.521  1.00 30.30  ? 94  GLU A CD  1 
ATOM   722  O OE1 . GLU A 1 93  ? -16.768 -24.231 37.672  1.00 25.85  ? 94  GLU A OE1 1 
ATOM   723  O OE2 . GLU A 1 93  ? -18.564 -24.571 38.907  1.00 26.50  ? 94  GLU A OE2 1 
ATOM   724  N N   . ASP A 1 94  ? -14.147 -26.591 43.104  1.00 20.63  ? 95  ASP A N   1 
ATOM   725  C CA  . ASP A 1 94  ? -13.098 -26.291 44.063  1.00 24.68  ? 95  ASP A CA  1 
ATOM   726  C C   . ASP A 1 94  ? -12.327 -27.582 44.178  1.00 25.21  ? 95  ASP A C   1 
ATOM   727  O O   . ASP A 1 94  ? -12.586 -28.392 45.074  1.00 22.07  ? 95  ASP A O   1 
ATOM   728  C CB  . ASP A 1 94  ? -13.734 -25.909 45.407  1.00 21.33  ? 95  ASP A CB  1 
ATOM   729  C CG  . ASP A 1 94  ? -12.712 -25.551 46.489  1.00 28.16  ? 95  ASP A CG  1 
ATOM   730  O OD1 . ASP A 1 94  ? -11.490 -25.728 46.302  1.00 27.58  ? 95  ASP A OD1 1 
ATOM   731  O OD2 . ASP A 1 94  ? -13.153 -25.086 47.560  1.00 35.93  ? 95  ASP A OD2 1 
ATOM   732  N N   . CYS A 1 95  ? -11.393 -27.796 43.256  1.00 23.66  ? 96  CYS A N   1 
ATOM   733  C CA  . CYS A 1 95  ? -10.767 -29.113 43.135  1.00 22.30  ? 96  CYS A CA  1 
ATOM   734  C C   . CYS A 1 95  ? -9.269  -29.049 42.922  1.00 19.65  ? 96  CYS A C   1 
ATOM   735  O O   . CYS A 1 95  ? -8.622  -30.075 42.758  1.00 23.97  ? 96  CYS A O   1 
ATOM   736  C CB  . CYS A 1 95  ? -11.392 -29.885 41.976  1.00 20.41  ? 96  CYS A CB  1 
ATOM   737  S SG  . CYS A 1 95  ? -11.112 -29.104 40.352  1.00 24.70  ? 96  CYS A SG  1 
ATOM   738  N N   . LEU A 1 96  ? -8.711  -27.848 42.921  1.00 22.14  ? 97  LEU A N   1 
ATOM   739  C CA  . LEU A 1 96  ? -7.297  -27.700 42.619  1.00 21.12  ? 97  LEU A CA  1 
ATOM   740  C C   . LEU A 1 96  ? -6.427  -27.946 43.854  1.00 24.73  ? 97  LEU A C   1 
ATOM   741  O O   . LEU A 1 96  ? -5.961  -27.016 44.513  1.00 23.74  ? 97  LEU A O   1 
ATOM   742  C CB  . LEU A 1 96  ? -7.020  -26.348 41.958  1.00 19.83  ? 97  LEU A CB  1 
ATOM   743  C CG  . LEU A 1 96  ? -7.642  -26.211 40.560  1.00 26.04  ? 97  LEU A CG  1 
ATOM   744  C CD1 . LEU A 1 96  ? -7.196  -24.914 39.872  1.00 20.81  ? 97  LEU A CD1 1 
ATOM   745  C CD2 . LEU A 1 96  ? -7.341  -27.435 39.655  1.00 17.53  ? 97  LEU A CD2 1 
ATOM   746  N N   . TYR A 1 97  ? -6.223  -29.227 44.152  1.00 22.12  ? 98  TYR A N   1 
ATOM   747  C CA  . TYR A 1 97  ? -5.383  -29.656 45.251  1.00 22.08  ? 98  TYR A CA  1 
ATOM   748  C C   . TYR A 1 97  ? -4.386  -30.662 44.717  1.00 22.84  ? 98  TYR A C   1 
ATOM   749  O O   . TYR A 1 97  ? -4.616  -31.267 43.671  1.00 22.52  ? 98  TYR A O   1 
ATOM   750  C CB  . TYR A 1 97  ? -6.239  -30.267 46.374  1.00 23.83  ? 98  TYR A CB  1 
ATOM   751  C CG  . TYR A 1 97  ? -7.255  -29.279 46.895  1.00 26.59  ? 98  TYR A CG  1 
ATOM   752  C CD1 . TYR A 1 97  ? -7.014  -28.550 48.055  1.00 26.95  ? 98  TYR A CD1 1 
ATOM   753  C CD2 . TYR A 1 97  ? -8.450  -29.051 46.208  1.00 27.25  ? 98  TYR A CD2 1 
ATOM   754  C CE1 . TYR A 1 97  ? -7.939  -27.624 48.527  1.00 22.26  ? 98  TYR A CE1 1 
ATOM   755  C CE2 . TYR A 1 97  ? -9.372  -28.125 46.659  1.00 24.41  ? 98  TYR A CE2 1 
ATOM   756  C CZ  . TYR A 1 97  ? -9.110  -27.416 47.824  1.00 27.13  ? 98  TYR A CZ  1 
ATOM   757  O OH  . TYR A 1 97  ? -10.025 -26.499 48.275  1.00 26.26  ? 98  TYR A OH  1 
ATOM   758  N N   . LEU A 1 98  ? -3.267  -30.824 45.416  1.00 20.46  ? 99  LEU A N   1 
ATOM   759  C CA  . LEU A 1 98  ? -2.276  -31.823 45.034  1.00 20.90  ? 99  LEU A CA  1 
ATOM   760  C C   . LEU A 1 98  ? -1.889  -32.652 46.264  1.00 23.93  ? 99  LEU A C   1 
ATOM   761  O O   . LEU A 1 98  ? -2.209  -32.285 47.398  1.00 25.12  ? 99  LEU A O   1 
ATOM   762  C CB  . LEU A 1 98  ? -1.050  -31.178 44.351  1.00 19.30  ? 99  LEU A CB  1 
ATOM   763  C CG  . LEU A 1 98  ? -0.264  -30.036 45.026  1.00 25.48  ? 99  LEU A CG  1 
ATOM   764  C CD1 . LEU A 1 98  ? 0.584   -30.518 46.213  1.00 16.78  ? 99  LEU A CD1 1 
ATOM   765  C CD2 . LEU A 1 98  ? 0.622   -29.301 44.026  1.00 22.19  ? 99  LEU A CD2 1 
ATOM   766  N N   . ASN A 1 99  ? -1.210  -33.769 46.032  1.00 21.81  ? 100 ASN A N   1 
ATOM   767  C CA  . ASN A 1 99  ? -0.840  -34.681 47.097  1.00 22.95  ? 100 ASN A CA  1 
ATOM   768  C C   . ASN A 1 99  ? 0.646   -34.957 47.050  1.00 23.15  ? 100 ASN A C   1 
ATOM   769  O O   . ASN A 1 99  ? 1.223   -35.039 45.974  1.00 24.62  ? 100 ASN A O   1 
ATOM   770  C CB  . ASN A 1 99  ? -1.596  -35.990 46.943  1.00 18.27  ? 100 ASN A CB  1 
ATOM   771  C CG  . ASN A 1 99  ? -3.021  -35.776 46.531  1.00 25.49  ? 100 ASN A CG  1 
ATOM   772  O OD1 . ASN A 1 99  ? -3.840  -35.304 47.319  1.00 26.37  ? 100 ASN A OD1 1 
ATOM   773  N ND2 . ASN A 1 99  ? -3.336  -36.118 45.285  1.00 25.62  ? 100 ASN A ND2 1 
ATOM   774  N N   . VAL A 1 100 ? 1.265   -35.078 48.220  1.00 24.66  ? 101 VAL A N   1 
ATOM   775  C CA  . VAL A 1 100 ? 2.673   -35.450 48.311  1.00 24.05  ? 101 VAL A CA  1 
ATOM   776  C C   . VAL A 1 100 ? 2.805   -36.687 49.208  1.00 28.45  ? 101 VAL A C   1 
ATOM   777  O O   . VAL A 1 100 ? 2.291   -36.703 50.333  1.00 26.83  ? 101 VAL A O   1 
ATOM   778  C CB  . VAL A 1 100 ? 3.519   -34.312 48.930  1.00 23.98  ? 101 VAL A CB  1 
ATOM   779  C CG1 . VAL A 1 100 ? 4.999   -34.680 48.944  1.00 20.85  ? 101 VAL A CG1 1 
ATOM   780  C CG2 . VAL A 1 100 ? 3.296   -33.012 48.194  1.00 21.09  ? 101 VAL A CG2 1 
ATOM   781  N N   . TRP A 1 101 ? 3.464   -37.721 48.692  1.00 24.56  ? 102 TRP A N   1 
ATOM   782  C CA  . TRP A 1 101 ? 3.835   -38.890 49.482  1.00 24.17  ? 102 TRP A CA  1 
ATOM   783  C C   . TRP A 1 101 ? 5.343   -38.871 49.626  1.00 26.87  ? 102 TRP A C   1 
ATOM   784  O O   . TRP A 1 101 ? 6.058   -38.553 48.676  1.00 25.82  ? 102 TRP A O   1 
ATOM   785  C CB  . TRP A 1 101 ? 3.479   -40.196 48.772  1.00 21.44  ? 102 TRP A CB  1 
ATOM   786  C CG  . TRP A 1 101 ? 2.033   -40.561 48.736  1.00 25.82  ? 102 TRP A CG  1 
ATOM   787  C CD1 . TRP A 1 101 ? 1.366   -41.356 49.622  1.00 25.82  ? 102 TRP A CD1 1 
ATOM   788  C CD2 . TRP A 1 101 ? 1.080   -40.183 47.739  1.00 23.43  ? 102 TRP A CD2 1 
ATOM   789  N NE1 . TRP A 1 101 ? 0.054   -41.481 49.247  1.00 28.85  ? 102 TRP A NE1 1 
ATOM   790  C CE2 . TRP A 1 101 ? -0.148  -40.770 48.093  1.00 27.92  ? 102 TRP A CE2 1 
ATOM   791  C CE3 . TRP A 1 101 ? 1.143   -39.395 46.587  1.00 26.59  ? 102 TRP A CE3 1 
ATOM   792  C CZ2 . TRP A 1 101 ? -1.305  -40.596 47.333  1.00 25.40  ? 102 TRP A CZ2 1 
ATOM   793  C CZ3 . TRP A 1 101 ? -0.007  -39.228 45.831  1.00 22.89  ? 102 TRP A CZ3 1 
ATOM   794  C CH2 . TRP A 1 101 ? -1.211  -39.827 46.207  1.00 22.77  ? 102 TRP A CH2 1 
ATOM   795  N N   . THR A 1 102 ? 5.831   -39.237 50.804  1.00 27.75  ? 103 THR A N   1 
ATOM   796  C CA  . THR A 1 102 ? 7.265   -39.237 51.043  1.00 32.55  ? 103 THR A CA  1 
ATOM   797  C C   . THR A 1 102 ? 7.603   -40.358 52.027  1.00 30.46  ? 103 THR A C   1 
ATOM   798  O O   . THR A 1 102 ? 6.726   -40.814 52.763  1.00 31.90  ? 103 THR A O   1 
ATOM   799  C CB  . THR A 1 102 ? 7.727   -37.842 51.545  1.00 34.98  ? 103 THR A CB  1 
ATOM   800  O OG1 . THR A 1 102 ? 9.125   -37.675 51.294  1.00 48.36  ? 103 THR A OG1 1 
ATOM   801  C CG2 . THR A 1 102 ? 7.448   -37.669 53.018  1.00 28.61  ? 103 THR A CG2 1 
ATOM   802  N N   . PRO A 1 103 ? 8.849   -40.855 51.997  1.00 28.45  ? 104 PRO A N   1 
ATOM   803  C CA  . PRO A 1 103 ? 9.242   -41.880 52.972  1.00 28.87  ? 104 PRO A CA  1 
ATOM   804  C C   . PRO A 1 103 ? 9.040   -41.441 54.427  1.00 36.11  ? 104 PRO A C   1 
ATOM   805  O O   . PRO A 1 103 ? 8.895   -40.247 54.712  1.00 36.58  ? 104 PRO A O   1 
ATOM   806  C CB  . PRO A 1 103 ? 10.729  -42.080 52.680  1.00 33.70  ? 104 PRO A CB  1 
ATOM   807  C CG  . PRO A 1 103 ? 10.855  -41.776 51.215  1.00 28.71  ? 104 PRO A CG  1 
ATOM   808  C CD  . PRO A 1 103 ? 9.895   -40.634 50.977  1.00 27.90  ? 104 PRO A CD  1 
ATOM   809  N N   . TYR A 1 104 ? 8.986   -42.416 55.330  1.00 33.82  ? 105 TYR A N   1 
ATOM   810  C CA  . TYR A 1 104 ? 8.867   -42.151 56.761  1.00 36.45  ? 105 TYR A CA  1 
ATOM   811  C C   . TYR A 1 104 ? 10.060  -42.775 57.481  1.00 42.67  ? 105 TYR A C   1 
ATOM   812  O O   . TYR A 1 104 ? 10.351  -43.962 57.298  1.00 35.72  ? 105 TYR A O   1 
ATOM   813  C CB  . TYR A 1 104 ? 7.561   -42.707 57.324  1.00 34.13  ? 105 TYR A CB  1 
ATOM   814  C CG  . TYR A 1 104 ? 7.257   -42.273 58.746  1.00 37.23  ? 105 TYR A CG  1 
ATOM   815  C CD1 . TYR A 1 104 ? 7.881   -42.883 59.841  1.00 39.92  ? 105 TYR A CD1 1 
ATOM   816  C CD2 . TYR A 1 104 ? 6.329   -41.265 59.000  1.00 41.58  ? 105 TYR A CD2 1 
ATOM   817  C CE1 . TYR A 1 104 ? 7.591   -42.489 61.152  1.00 33.33  ? 105 TYR A CE1 1 
ATOM   818  C CE2 . TYR A 1 104 ? 6.034   -40.863 60.299  1.00 36.54  ? 105 TYR A CE2 1 
ATOM   819  C CZ  . TYR A 1 104 ? 6.668   -41.479 61.370  1.00 40.45  ? 105 TYR A CZ  1 
ATOM   820  O OH  . TYR A 1 104 ? 6.375   -41.075 62.656  1.00 42.50  ? 105 TYR A OH  1 
ATOM   821  N N   . PRO A 1 105 ? 10.766  -41.973 58.292  1.00 45.43  ? 106 PRO A N   1 
ATOM   822  C CA  . PRO A 1 105 ? 10.477  -40.550 58.489  1.00 45.26  ? 106 PRO A CA  1 
ATOM   823  C C   . PRO A 1 105 ? 10.917  -39.757 57.256  1.00 42.85  ? 106 PRO A C   1 
ATOM   824  O O   . PRO A 1 105 ? 11.648  -40.317 56.431  1.00 38.81  ? 106 PRO A O   1 
ATOM   825  C CB  . PRO A 1 105 ? 11.347  -40.194 59.701  1.00 40.79  ? 106 PRO A CB  1 
ATOM   826  C CG  . PRO A 1 105 ? 12.524  -41.109 59.581  1.00 38.96  ? 106 PRO A CG  1 
ATOM   827  C CD  . PRO A 1 105 ? 11.960  -42.405 59.046  1.00 39.69  ? 106 PRO A CD  1 
ATOM   828  N N   . ARG A 1 106 ? 10.464  -38.509 57.124  1.00 44.03  ? 107 ARG A N   1 
ATOM   829  C CA  . ARG A 1 106 ? 10.788  -37.686 55.957  1.00 43.51  ? 107 ARG A CA  1 
ATOM   830  C C   . ARG A 1 106 ? 12.267  -37.737 55.631  1.00 38.29  ? 107 ARG A C   1 
ATOM   831  O O   . ARG A 1 106 ? 13.100  -37.692 56.527  1.00 52.90  ? 107 ARG A O   1 
ATOM   832  C CB  . ARG A 1 106 ? 10.368  -36.227 56.166  1.00 42.66  ? 107 ARG A CB  1 
ATOM   833  C CG  . ARG A 1 106 ? 8.866   -36.014 56.289  1.00 46.41  ? 107 ARG A CG  1 
ATOM   834  C CD  . ARG A 1 106 ? 8.449   -34.700 55.627  1.00 48.08  ? 107 ARG A CD  1 
ATOM   835  N NE  . ARG A 1 106 ? 9.174   -33.536 56.151  1.00 43.80  ? 107 ARG A NE  1 
ATOM   836  C CZ  . ARG A 1 106 ? 8.753   -32.790 57.171  1.00 44.36  ? 107 ARG A CZ  1 
ATOM   837  N NH1 . ARG A 1 106 ? 7.619   -33.086 57.799  1.00 36.87  ? 107 ARG A NH1 1 
ATOM   838  N NH2 . ARG A 1 106 ? 9.469   -31.748 57.575  1.00 54.45  ? 107 ARG A NH2 1 
ATOM   839  N N   . PRO A 1 107 ? 12.595  -37.849 54.343  1.00 43.44  ? 108 PRO A N   1 
ATOM   840  C CA  . PRO A 1 107 ? 13.998  -37.835 53.926  1.00 46.55  ? 108 PRO A CA  1 
ATOM   841  C C   . PRO A 1 107 ? 14.636  -36.540 54.394  1.00 53.32  ? 108 PRO A C   1 
ATOM   842  O O   . PRO A 1 107 ? 14.001  -35.484 54.334  1.00 49.91  ? 108 PRO A O   1 
ATOM   843  C CB  . PRO A 1 107 ? 13.914  -37.846 52.397  1.00 42.34  ? 108 PRO A CB  1 
ATOM   844  C CG  . PRO A 1 107 ? 12.569  -38.406 52.089  1.00 39.04  ? 108 PRO A CG  1 
ATOM   845  C CD  . PRO A 1 107 ? 11.668  -37.987 53.207  1.00 39.43  ? 108 PRO A CD  1 
ATOM   846  N N   . THR A 1 108 ? 15.868  -36.618 54.877  1.00 58.25  ? 109 THR A N   1 
ATOM   847  C CA  . THR A 1 108 ? 16.555  -35.419 55.332  1.00 58.20  ? 109 THR A CA  1 
ATOM   848  C C   . THR A 1 108 ? 17.589  -34.994 54.309  1.00 55.07  ? 109 THR A C   1 
ATOM   849  O O   . THR A 1 108 ? 18.404  -34.121 54.579  1.00 61.22  ? 109 THR A O   1 
ATOM   850  C CB  . THR A 1 108 ? 17.214  -35.606 56.720  1.00 51.78  ? 109 THR A CB  1 
ATOM   851  O OG1 . THR A 1 108 ? 18.173  -36.672 56.670  1.00 52.58  ? 109 THR A OG1 1 
ATOM   852  C CG2 . THR A 1 108 ? 16.166  -35.902 57.783  1.00 46.11  ? 109 THR A CG2 1 
ATOM   853  N N   . SER A 1 109 ? 17.549  -35.621 53.135  1.00 51.00  ? 110 SER A N   1 
ATOM   854  C CA  . SER A 1 109 ? 18.417  -35.241 52.020  1.00 50.89  ? 110 SER A CA  1 
ATOM   855  C C   . SER A 1 109 ? 17.648  -35.340 50.695  1.00 45.74  ? 110 SER A C   1 
ATOM   856  O O   . SER A 1 109 ? 16.722  -36.142 50.584  1.00 42.20  ? 110 SER A O   1 
ATOM   857  C CB  . SER A 1 109 ? 19.679  -36.110 52.004  1.00 45.77  ? 110 SER A CB  1 
ATOM   858  O OG  . SER A 1 109 ? 19.348  -37.484 52.032  1.00 45.96  ? 110 SER A OG  1 
ATOM   859  N N   . PRO A 1 110 ? 18.018  -34.515 49.698  1.00 44.51  ? 111 PRO A N   1 
ATOM   860  C CA  . PRO A 1 110 ? 17.301  -34.414 48.415  1.00 39.67  ? 111 PRO A CA  1 
ATOM   861  C C   . PRO A 1 110 ? 16.971  -35.763 47.777  1.00 45.46  ? 111 PRO A C   1 
ATOM   862  O O   . PRO A 1 110 ? 17.866  -36.512 47.381  1.00 46.20  ? 111 PRO A O   1 
ATOM   863  C CB  . PRO A 1 110 ? 18.275  -33.627 47.537  1.00 35.63  ? 111 PRO A CB  1 
ATOM   864  C CG  . PRO A 1 110 ? 18.974  -32.732 48.505  1.00 42.97  ? 111 PRO A CG  1 
ATOM   865  C CD  . PRO A 1 110 ? 19.127  -33.548 49.771  1.00 40.34  ? 111 PRO A CD  1 
ATOM   866  N N   . THR A 1 111 ? 15.675  -36.053 47.698  1.00 41.07  ? 112 THR A N   1 
ATOM   867  C CA  . THR A 1 111 ? 15.157  -37.289 47.122  1.00 39.85  ? 112 THR A CA  1 
ATOM   868  C C   . THR A 1 111 ? 14.520  -37.009 45.747  1.00 39.96  ? 112 THR A C   1 
ATOM   869  O O   . THR A 1 111 ? 13.786  -36.029 45.597  1.00 32.73  ? 112 THR A O   1 
ATOM   870  C CB  . THR A 1 111 ? 14.096  -37.867 48.063  1.00 38.25  ? 112 THR A CB  1 
ATOM   871  O OG1 . THR A 1 111 ? 14.661  -38.023 49.371  1.00 42.56  ? 112 THR A OG1 1 
ATOM   872  C CG2 . THR A 1 111 ? 13.581  -39.202 47.569  1.00 36.47  ? 112 THR A CG2 1 
ATOM   873  N N   . PRO A 1 112 ? 14.805  -37.862 44.741  1.00 42.47  ? 113 PRO A N   1 
ATOM   874  C CA  . PRO A 1 112 ? 14.216  -37.720 43.395  1.00 33.41  ? 113 PRO A CA  1 
ATOM   875  C C   . PRO A 1 112 ? 12.693  -37.738 43.416  1.00 30.49  ? 113 PRO A C   1 
ATOM   876  O O   . PRO A 1 112 ? 12.092  -38.541 44.133  1.00 29.75  ? 113 PRO A O   1 
ATOM   877  C CB  . PRO A 1 112 ? 14.741  -38.948 42.637  1.00 31.72  ? 113 PRO A CB  1 
ATOM   878  C CG  . PRO A 1 112 ? 15.209  -39.902 43.698  1.00 40.75  ? 113 PRO A CG  1 
ATOM   879  C CD  . PRO A 1 112 ? 15.703  -39.027 44.819  1.00 46.30  ? 113 PRO A CD  1 
ATOM   880  N N   . VAL A 1 113 ? 12.090  -36.853 42.629  1.00 28.08  ? 114 VAL A N   1 
ATOM   881  C CA  . VAL A 1 113 ? 10.646  -36.648 42.631  1.00 28.49  ? 114 VAL A CA  1 
ATOM   882  C C   . VAL A 1 113 ? 9.967   -37.217 41.380  1.00 26.63  ? 114 VAL A C   1 
ATOM   883  O O   . VAL A 1 113 ? 10.411  -36.978 40.256  1.00 29.38  ? 114 VAL A O   1 
ATOM   884  C CB  . VAL A 1 113 ? 10.323  -35.142 42.709  1.00 29.32  ? 114 VAL A CB  1 
ATOM   885  C CG1 . VAL A 1 113 ? 8.823   -34.909 42.703  1.00 20.87  ? 114 VAL A CG1 1 
ATOM   886  C CG2 . VAL A 1 113 ? 10.973  -34.525 43.950  1.00 27.84  ? 114 VAL A CG2 1 
ATOM   887  N N   . LEU A 1 114 ? 8.900   -37.979 41.590  1.00 28.70  ? 115 LEU A N   1 
ATOM   888  C CA  . LEU A 1 114 ? 8.016   -38.416 40.511  1.00 25.93  ? 115 LEU A CA  1 
ATOM   889  C C   . LEU A 1 114 ? 6.714   -37.631 40.591  1.00 26.36  ? 115 LEU A C   1 
ATOM   890  O O   . LEU A 1 114 ? 6.109   -37.530 41.669  1.00 24.66  ? 115 LEU A O   1 
ATOM   891  C CB  . LEU A 1 114 ? 7.717   -39.911 40.631  1.00 24.33  ? 115 LEU A CB  1 
ATOM   892  C CG  . LEU A 1 114 ? 8.777   -40.849 40.051  1.00 27.85  ? 115 LEU A CG  1 
ATOM   893  C CD1 . LEU A 1 114 ? 8.684   -42.221 40.677  1.00 32.07  ? 115 LEU A CD1 1 
ATOM   894  C CD2 . LEU A 1 114 ? 8.606   -40.940 38.538  1.00 30.14  ? 115 LEU A CD2 1 
ATOM   895  N N   . VAL A 1 115 ? 6.290   -37.064 39.465  1.00 18.56  ? 116 VAL A N   1 
ATOM   896  C CA  . VAL A 1 115 ? 5.025   -36.338 39.425  1.00 22.75  ? 116 VAL A CA  1 
ATOM   897  C C   . VAL A 1 115 ? 4.033   -37.030 38.505  1.00 22.84  ? 116 VAL A C   1 
ATOM   898  O O   . VAL A 1 115 ? 4.291   -37.192 37.315  1.00 22.85  ? 116 VAL A O   1 
ATOM   899  C CB  . VAL A 1 115 ? 5.203   -34.881 38.966  1.00 20.98  ? 116 VAL A CB  1 
ATOM   900  C CG1 . VAL A 1 115 ? 3.868   -34.155 39.033  1.00 17.02  ? 116 VAL A CG1 1 
ATOM   901  C CG2 . VAL A 1 115 ? 6.238   -34.186 39.828  1.00 21.88  ? 116 VAL A CG2 1 
ATOM   902  N N   . TRP A 1 116 ? 2.906   -37.448 39.064  1.00 21.82  ? 117 TRP A N   1 
ATOM   903  C CA  . TRP A 1 116 ? 1.904   -38.192 38.309  1.00 22.55  ? 117 TRP A CA  1 
ATOM   904  C C   . TRP A 1 116 ? 0.821   -37.271 37.735  1.00 21.27  ? 117 TRP A C   1 
ATOM   905  O O   . TRP A 1 116 ? 0.228   -36.470 38.459  1.00 20.97  ? 117 TRP A O   1 
ATOM   906  C CB  . TRP A 1 116 ? 1.253   -39.269 39.197  1.00 20.20  ? 117 TRP A CB  1 
ATOM   907  C CG  . TRP A 1 116 ? 0.116   -39.996 38.505  1.00 24.63  ? 117 TRP A CG  1 
ATOM   908  C CD1 . TRP A 1 116 ? -1.218  -39.871 38.763  1.00 22.18  ? 117 TRP A CD1 1 
ATOM   909  C CD2 . TRP A 1 116 ? 0.226   -40.928 37.415  1.00 21.67  ? 117 TRP A CD2 1 
ATOM   910  N NE1 . TRP A 1 116 ? -1.945  -40.687 37.922  1.00 19.48  ? 117 TRP A NE1 1 
ATOM   911  C CE2 . TRP A 1 116 ? -1.084  -41.342 37.084  1.00 21.48  ? 117 TRP A CE2 1 
ATOM   912  C CE3 . TRP A 1 116 ? 1.305   -41.462 36.695  1.00 22.53  ? 117 TRP A CE3 1 
ATOM   913  C CZ2 . TRP A 1 116 ? -1.345  -42.262 36.059  1.00 21.31  ? 117 TRP A CZ2 1 
ATOM   914  C CZ3 . TRP A 1 116 ? 1.042   -42.378 35.677  1.00 20.30  ? 117 TRP A CZ3 1 
ATOM   915  C CH2 . TRP A 1 116 ? -0.271  -42.767 35.374  1.00 19.23  ? 117 TRP A CH2 1 
ATOM   916  N N   . ILE A 1 117 ? 0.559   -37.397 36.438  1.00 20.06  ? 118 ILE A N   1 
ATOM   917  C CA  . ILE A 1 117 ? -0.572  -36.714 35.807  1.00 19.74  ? 118 ILE A CA  1 
ATOM   918  C C   . ILE A 1 117 ? -1.555  -37.755 35.270  1.00 20.69  ? 118 ILE A C   1 
ATOM   919  O O   . ILE A 1 117 ? -1.217  -38.500 34.353  1.00 22.31  ? 118 ILE A O   1 
ATOM   920  C CB  . ILE A 1 117 ? -0.110  -35.815 34.647  1.00 17.47  ? 118 ILE A CB  1 
ATOM   921  C CG1 . ILE A 1 117 ? 0.950   -34.821 35.131  1.00 25.61  ? 118 ILE A CG1 1 
ATOM   922  C CG2 . ILE A 1 117 ? -1.282  -35.076 34.039  1.00 15.42  ? 118 ILE A CG2 1 
ATOM   923  C CD1 . ILE A 1 117 ? 1.513   -33.943 34.015  1.00 19.12  ? 118 ILE A CD1 1 
ATOM   924  N N   . TYR A 1 118 ? -2.764  -37.813 35.825  1.00 17.61  ? 119 TYR A N   1 
ATOM   925  C CA  . TYR A 1 118 ? -3.713  -38.855 35.425  1.00 18.62  ? 119 TYR A CA  1 
ATOM   926  C C   . TYR A 1 118 ? -4.248  -38.619 34.026  1.00 20.26  ? 119 TYR A C   1 
ATOM   927  O O   . TYR A 1 118 ? -4.233  -37.493 33.533  1.00 18.75  ? 119 TYR A O   1 
ATOM   928  C CB  . TYR A 1 118 ? -4.896  -38.974 36.406  1.00 18.16  ? 119 TYR A CB  1 
ATOM   929  C CG  . TYR A 1 118 ? -5.661  -37.679 36.665  1.00 21.50  ? 119 TYR A CG  1 
ATOM   930  C CD1 . TYR A 1 118 ? -6.560  -37.158 35.727  1.00 18.60  ? 119 TYR A CD1 1 
ATOM   931  C CD2 . TYR A 1 118 ? -5.496  -36.988 37.866  1.00 17.24  ? 119 TYR A CD2 1 
ATOM   932  C CE1 . TYR A 1 118 ? -7.256  -35.965 35.976  1.00 15.59  ? 119 TYR A CE1 1 
ATOM   933  C CE2 . TYR A 1 118 ? -6.179  -35.809 38.121  1.00 19.43  ? 119 TYR A CE2 1 
ATOM   934  C CZ  . TYR A 1 118 ? -7.055  -35.294 37.184  1.00 21.42  ? 119 TYR A CZ  1 
ATOM   935  O OH  . TYR A 1 118 ? -7.722  -34.112 37.481  1.00 18.69  ? 119 TYR A OH  1 
ATOM   936  N N   . GLY A 1 119 ? -4.743  -39.690 33.407  1.00 21.49  ? 120 GLY A N   1 
ATOM   937  C CA  . GLY A 1 119 ? -5.453  -39.607 32.142  1.00 19.47  ? 120 GLY A CA  1 
ATOM   938  C C   . GLY A 1 119 ? -6.956  -39.647 32.367  1.00 22.29  ? 120 GLY A C   1 
ATOM   939  O O   . GLY A 1 119 ? -7.442  -39.397 33.474  1.00 21.22  ? 120 GLY A O   1 
ATOM   940  N N   . GLY A 1 120 ? -7.696  -39.975 31.317  1.00 21.32  ? 121 GLY A N   1 
ATOM   941  C CA  . GLY A 1 120 ? -9.143  -39.882 31.346  1.00 17.84  ? 121 GLY A CA  1 
ATOM   942  C C   . GLY A 1 120 ? -9.629  -38.975 30.230  1.00 20.78  ? 121 GLY A C   1 
ATOM   943  O O   . GLY A 1 120 ? -10.609 -38.242 30.404  1.00 21.02  ? 121 GLY A O   1 
ATOM   944  N N   . GLY A 1 121 ? -8.926  -39.020 29.092  1.00 21.45  ? 122 GLY A N   1 
ATOM   945  C CA  . GLY A 1 121 ? -9.303  -38.289 27.887  1.00 21.75  ? 122 GLY A CA  1 
ATOM   946  C C   . GLY A 1 121 ? -9.485  -36.782 27.999  1.00 19.32  ? 122 GLY A C   1 
ATOM   947  O O   . GLY A 1 121 ? -10.146 -36.180 27.157  1.00 20.07  ? 122 GLY A O   1 
ATOM   948  N N   . PHE A 1 122 ? -8.903  -36.170 29.032  1.00 19.52  ? 123 PHE A N   1 
ATOM   949  C CA  . PHE A 1 122 ? -9.117  -34.742 29.335  1.00 21.64  ? 123 PHE A CA  1 
ATOM   950  C C   . PHE A 1 122 ? -10.551 -34.398 29.771  1.00 21.47  ? 123 PHE A C   1 
ATOM   951  O O   . PHE A 1 122 ? -10.869 -33.221 29.967  1.00 21.65  ? 123 PHE A O   1 
ATOM   952  C CB  . PHE A 1 122 ? -8.702  -33.824 28.162  1.00 19.28  ? 123 PHE A CB  1 
ATOM   953  C CG  . PHE A 1 122 ? -7.232  -33.847 27.854  1.00 22.10  ? 123 PHE A CG  1 
ATOM   954  C CD1 . PHE A 1 122 ? -6.309  -33.322 28.755  1.00 18.30  ? 123 PHE A CD1 1 
ATOM   955  C CD2 . PHE A 1 122 ? -6.768  -34.381 26.652  1.00 19.91  ? 123 PHE A CD2 1 
ATOM   956  C CE1 . PHE A 1 122 ? -4.945  -33.338 28.468  1.00 24.91  ? 123 PHE A CE1 1 
ATOM   957  C CE2 . PHE A 1 122 ? -5.399  -34.395 26.353  1.00 19.95  ? 123 PHE A CE2 1 
ATOM   958  C CZ  . PHE A 1 122 ? -4.490  -33.872 27.259  1.00 19.79  ? 123 PHE A CZ  1 
ATOM   959  N N   . TYR A 1 123 ? -11.412 -35.407 29.910  1.00 18.10  ? 124 TYR A N   1 
ATOM   960  C CA  . TYR A 1 123 ? -12.791 -35.177 30.356  1.00 21.68  ? 124 TYR A CA  1 
ATOM   961  C C   . TYR A 1 123 ? -13.015 -35.740 31.769  1.00 22.16  ? 124 TYR A C   1 
ATOM   962  O O   . TYR A 1 123 ? -14.054 -35.510 32.387  1.00 25.93  ? 124 TYR A O   1 
ATOM   963  C CB  . TYR A 1 123 ? -13.816 -35.787 29.374  1.00 19.93  ? 124 TYR A CB  1 
ATOM   964  C CG  . TYR A 1 123 ? -13.866 -37.304 29.401  1.00 18.22  ? 124 TYR A CG  1 
ATOM   965  C CD1 . TYR A 1 123 ? -14.653 -37.983 30.328  1.00 21.15  ? 124 TYR A CD1 1 
ATOM   966  C CD2 . TYR A 1 123 ? -13.118 -38.058 28.508  1.00 21.37  ? 124 TYR A CD2 1 
ATOM   967  C CE1 . TYR A 1 123 ? -14.677 -39.365 30.377  1.00 18.91  ? 124 TYR A CE1 1 
ATOM   968  C CE2 . TYR A 1 123 ? -13.146 -39.439 28.542  1.00 20.86  ? 124 TYR A CE2 1 
ATOM   969  C CZ  . TYR A 1 123 ? -13.927 -40.086 29.482  1.00 20.72  ? 124 TYR A CZ  1 
ATOM   970  O OH  . TYR A 1 123 ? -13.949 -41.461 29.515  1.00 25.00  ? 124 TYR A OH  1 
ATOM   971  N N   . SER A 1 124 ? -12.057 -36.504 32.270  1.00 19.62  ? 125 SER A N   1 
ATOM   972  C CA  . SER A 1 124 ? -12.240 -37.150 33.560  1.00 21.00  ? 125 SER A CA  1 
ATOM   973  C C   . SER A 1 124 ? -10.912 -37.485 34.223  1.00 19.97  ? 125 SER A C   1 
ATOM   974  O O   . SER A 1 124 ? -9.848  -37.298 33.636  1.00 22.76  ? 125 SER A O   1 
ATOM   975  C CB  . SER A 1 124 ? -13.029 -38.444 33.374  1.00 20.59  ? 125 SER A CB  1 
ATOM   976  O OG  . SER A 1 124 ? -12.295 -39.369 32.583  1.00 19.56  ? 125 SER A OG  1 
ATOM   977  N N   . GLY A 1 125 ? -10.998 -38.024 35.436  1.00 18.24  ? 126 GLY A N   1 
ATOM   978  C CA  . GLY A 1 125 ? -9.846  -38.504 36.170  1.00 19.93  ? 126 GLY A CA  1 
ATOM   979  C C   . GLY A 1 125 ? -9.766  -37.803 37.506  1.00 20.03  ? 126 GLY A C   1 
ATOM   980  O O   . GLY A 1 125 ? -10.450 -36.807 37.724  1.00 21.13  ? 126 GLY A O   1 
ATOM   981  N N   . ALA A 1 126 ? -8.933  -38.328 38.395  1.00 21.21  ? 127 ALA A N   1 
ATOM   982  C CA  . ALA A 1 126 ? -8.707  -37.731 39.714  1.00 24.49  ? 127 ALA A CA  1 
ATOM   983  C C   . ALA A 1 126 ? -7.443  -38.324 40.313  1.00 24.63  ? 127 ALA A C   1 
ATOM   984  O O   . ALA A 1 126 ? -7.107  -39.478 40.031  1.00 23.57  ? 127 ALA A O   1 
ATOM   985  C CB  . ALA A 1 126 ? -9.893  -37.986 40.641  1.00 20.04  ? 127 ALA A CB  1 
ATOM   986  N N   . SER A 1 127 ? -6.742  -37.542 41.136  1.00 23.24  ? 128 SER A N   1 
ATOM   987  C CA  . SER A 1 127 ? -5.556  -38.040 41.824  1.00 20.64  ? 128 SER A CA  1 
ATOM   988  C C   . SER A 1 127 ? -5.915  -38.997 42.966  1.00 24.81  ? 128 SER A C   1 
ATOM   989  O O   . SER A 1 127 ? -5.056  -39.738 43.460  1.00 21.61  ? 128 SER A O   1 
ATOM   990  C CB  . SER A 1 127 ? -4.709  -36.882 42.358  1.00 25.61  ? 128 SER A CB  1 
ATOM   991  O OG  . SER A 1 127 ? -5.448  -36.077 43.267  1.00 28.47  ? 128 SER A OG  1 
ATOM   992  N N   . SER A 1 128 ? -7.183  -38.987 43.372  1.00 20.56  ? 129 SER A N   1 
ATOM   993  C CA  . SER A 1 128 ? -7.629  -39.772 44.526  1.00 23.61  ? 129 SER A CA  1 
ATOM   994  C C   . SER A 1 128 ? -7.990  -41.220 44.202  1.00 26.44  ? 129 SER A C   1 
ATOM   995  O O   . SER A 1 128 ? -8.331  -41.986 45.101  1.00 24.53  ? 129 SER A O   1 
ATOM   996  C CB  . SER A 1 128 ? -8.833  -39.107 45.181  1.00 21.54  ? 129 SER A CB  1 
ATOM   997  O OG  . SER A 1 128 ? -9.849  -38.847 44.232  1.00 22.74  ? 129 SER A OG  1 
ATOM   998  N N   . LEU A 1 129 ? -7.925  -41.594 42.927  1.00 24.76  ? 130 LEU A N   1 
ATOM   999  C CA  . LEU A 1 129 ? -8.286  -42.952 42.527  1.00 24.77  ? 130 LEU A CA  1 
ATOM   1000 C C   . LEU A 1 129 ? -7.377  -43.984 43.188  1.00 25.28  ? 130 LEU A C   1 
ATOM   1001 O O   . LEU A 1 129 ? -6.176  -43.748 43.353  1.00 25.31  ? 130 LEU A O   1 
ATOM   1002 C CB  . LEU A 1 129 ? -8.243  -43.105 41.001  1.00 22.42  ? 130 LEU A CB  1 
ATOM   1003 C CG  . LEU A 1 129 ? -9.219  -42.223 40.211  1.00 28.16  ? 130 LEU A CG  1 
ATOM   1004 C CD1 . LEU A 1 129 ? -9.338  -42.651 38.725  1.00 19.46  ? 130 LEU A CD1 1 
ATOM   1005 C CD2 . LEU A 1 129 ? -10.589 -42.201 40.895  1.00 24.15  ? 130 LEU A CD2 1 
ATOM   1006 N N   . ASP A 1 130 ? -7.959  -45.123 43.556  1.00 20.78  ? 131 ASP A N   1 
ATOM   1007 C CA  . ASP A 1 130 ? -7.232  -46.208 44.216  1.00 24.01  ? 131 ASP A CA  1 
ATOM   1008 C C   . ASP A 1 130 ? -6.008  -46.645 43.425  1.00 25.55  ? 131 ASP A C   1 
ATOM   1009 O O   . ASP A 1 130 ? -4.954  -46.947 43.983  1.00 26.37  ? 131 ASP A O   1 
ATOM   1010 C CB  . ASP A 1 130 ? -8.147  -47.428 44.380  1.00 22.32  ? 131 ASP A CB  1 
ATOM   1011 C CG  . ASP A 1 130 ? -9.060  -47.327 45.582  1.00 32.16  ? 131 ASP A CG  1 
ATOM   1012 O OD1 . ASP A 1 130 ? -9.202  -46.221 46.161  1.00 27.06  ? 131 ASP A OD1 1 
ATOM   1013 O OD2 . ASP A 1 130 ? -9.643  -48.372 45.945  1.00 37.49  ? 131 ASP A OD2 1 
ATOM   1014 N N   . VAL A 1 131 ? -6.164  -46.706 42.112  1.00 23.20  ? 132 VAL A N   1 
ATOM   1015 C CA  . VAL A 1 131 ? -5.120  -47.242 41.263  1.00 23.96  ? 132 VAL A CA  1 
ATOM   1016 C C   . VAL A 1 131 ? -3.898  -46.296 41.186  1.00 22.91  ? 132 VAL A C   1 
ATOM   1017 O O   . VAL A 1 131 ? -2.830  -46.696 40.737  1.00 23.80  ? 132 VAL A O   1 
ATOM   1018 C CB  . VAL A 1 131 ? -5.706  -47.610 39.875  1.00 27.08  ? 132 VAL A CB  1 
ATOM   1019 C CG1 . VAL A 1 131 ? -6.107  -46.366 39.111  1.00 26.96  ? 132 VAL A CG1 1 
ATOM   1020 C CG2 . VAL A 1 131 ? -4.742  -48.440 39.080  1.00 30.55  ? 132 VAL A CG2 1 
ATOM   1021 N N   . TYR A 1 132 ? -4.054  -45.057 41.659  1.00 21.79  ? 133 TYR A N   1 
ATOM   1022 C CA  . TYR A 1 132 ? -2.953  -44.084 41.669  1.00 24.06  ? 133 TYR A CA  1 
ATOM   1023 C C   . TYR A 1 132 ? -2.334  -43.870 43.064  1.00 26.48  ? 133 TYR A C   1 
ATOM   1024 O O   . TYR A 1 132 ? -1.618  -42.886 43.274  1.00 22.34  ? 133 TYR A O   1 
ATOM   1025 C CB  . TYR A 1 132 ? -3.408  -42.717 41.143  1.00 16.41  ? 133 TYR A CB  1 
ATOM   1026 C CG  . TYR A 1 132 ? -4.092  -42.731 39.793  1.00 25.76  ? 133 TYR A CG  1 
ATOM   1027 C CD1 . TYR A 1 132 ? -3.774  -43.689 38.840  1.00 18.04  ? 133 TYR A CD1 1 
ATOM   1028 C CD2 . TYR A 1 132 ? -5.062  -41.781 39.477  1.00 19.49  ? 133 TYR A CD2 1 
ATOM   1029 C CE1 . TYR A 1 132 ? -4.386  -43.696 37.622  1.00 22.10  ? 133 TYR A CE1 1 
ATOM   1030 C CE2 . TYR A 1 132 ? -5.686  -41.785 38.268  1.00 19.55  ? 133 TYR A CE2 1 
ATOM   1031 C CZ  . TYR A 1 132 ? -5.340  -42.747 37.333  1.00 24.09  ? 133 TYR A CZ  1 
ATOM   1032 O OH  . TYR A 1 132 ? -5.953  -42.767 36.107  1.00 17.97  ? 133 TYR A OH  1 
ATOM   1033 N N   . ASP A 1 133 ? -2.615  -44.772 44.003  1.00 23.28  ? 134 ASP A N   1 
ATOM   1034 C CA  . ASP A 1 133 ? -2.073  -44.687 45.362  1.00 23.73  ? 134 ASP A CA  1 
ATOM   1035 C C   . ASP A 1 133 ? -0.539  -44.685 45.371  1.00 23.54  ? 134 ASP A C   1 
ATOM   1036 O O   . ASP A 1 133 ? 0.098   -45.678 45.029  1.00 21.34  ? 134 ASP A O   1 
ATOM   1037 C CB  . ASP A 1 133 ? -2.607  -45.847 46.205  1.00 25.23  ? 134 ASP A CB  1 
ATOM   1038 C CG  . ASP A 1 133 ? -2.283  -45.705 47.693  1.00 33.25  ? 134 ASP A CG  1 
ATOM   1039 O OD1 . ASP A 1 133 ? -1.488  -44.816 48.067  1.00 30.91  ? 134 ASP A OD1 1 
ATOM   1040 O OD2 . ASP A 1 133 ? -2.825  -46.498 48.494  1.00 35.15  ? 134 ASP A OD2 1 
ATOM   1041 N N   . GLY A 1 134 ? 0.060   -43.574 45.788  1.00 22.67  ? 135 GLY A N   1 
ATOM   1042 C CA  . GLY A 1 134 ? 1.511   -43.468 45.757  1.00 26.18  ? 135 GLY A CA  1 
ATOM   1043 C C   . GLY A 1 134 ? 2.289   -44.194 46.853  1.00 31.25  ? 135 GLY A C   1 
ATOM   1044 O O   . GLY A 1 134 ? 3.527   -44.251 46.802  1.00 29.18  ? 135 GLY A O   1 
ATOM   1045 N N   . ARG A 1 135 ? 1.593   -44.758 47.840  1.00 26.26  ? 136 ARG A N   1 
ATOM   1046 C CA  . ARG A 1 135 ? 2.283   -45.274 49.029  1.00 28.24  ? 136 ARG A CA  1 
ATOM   1047 C C   . ARG A 1 135 ? 3.304   -46.387 48.739  1.00 28.73  ? 136 ARG A C   1 
ATOM   1048 O O   . ARG A 1 135 ? 4.342   -46.457 49.396  1.00 29.29  ? 136 ARG A O   1 
ATOM   1049 C CB  . ARG A 1 135 ? 1.282   -45.738 50.089  1.00 27.22  ? 136 ARG A CB  1 
ATOM   1050 C CG  . ARG A 1 135 ? 0.788   -47.160 49.871  1.00 27.24  ? 136 ARG A CG  1 
ATOM   1051 C CD  . ARG A 1 135 ? -0.184  -47.541 50.948  1.00 29.02  ? 136 ARG A CD  1 
ATOM   1052 N NE  . ARG A 1 135 ? -1.386  -46.728 50.861  1.00 24.65  ? 136 ARG A NE  1 
ATOM   1053 C CZ  . ARG A 1 135 ? -2.252  -46.591 51.852  1.00 33.82  ? 136 ARG A CZ  1 
ATOM   1054 N NH1 . ARG A 1 135 ? -2.030  -47.203 53.018  1.00 25.93  ? 136 ARG A NH1 1 
ATOM   1055 N NH2 . ARG A 1 135 ? -3.323  -45.832 51.683  1.00 25.70  ? 136 ARG A NH2 1 
ATOM   1056 N N   . PHE A 1 136 ? 3.036   -47.241 47.753  1.00 25.48  ? 137 PHE A N   1 
ATOM   1057 C CA  . PHE A 1 136 ? 3.912   -48.397 47.512  1.00 22.79  ? 137 PHE A CA  1 
ATOM   1058 C C   . PHE A 1 136 ? 5.217   -48.020 46.804  1.00 30.12  ? 137 PHE A C   1 
ATOM   1059 O O   . PHE A 1 136 ? 6.271   -48.601 47.085  1.00 26.81  ? 137 PHE A O   1 
ATOM   1060 C CB  . PHE A 1 136 ? 3.176   -49.508 46.743  1.00 24.61  ? 137 PHE A CB  1 
ATOM   1061 C CG  . PHE A 1 136 ? 1.874   -49.916 47.376  1.00 28.63  ? 137 PHE A CG  1 
ATOM   1062 C CD1 . PHE A 1 136 ? 0.668   -49.452 46.877  1.00 22.95  ? 137 PHE A CD1 1 
ATOM   1063 C CD2 . PHE A 1 136 ? 1.859   -50.733 48.500  1.00 29.02  ? 137 PHE A CD2 1 
ATOM   1064 C CE1 . PHE A 1 136 ? -0.535  -49.810 47.479  1.00 29.01  ? 137 PHE A CE1 1 
ATOM   1065 C CE2 . PHE A 1 136 ? 0.661   -51.093 49.112  1.00 27.77  ? 137 PHE A CE2 1 
ATOM   1066 C CZ  . PHE A 1 136 ? -0.534  -50.633 48.605  1.00 23.62  ? 137 PHE A CZ  1 
ATOM   1067 N N   . LEU A 1 137 ? 5.140   -47.052 45.890  1.00 29.14  ? 138 LEU A N   1 
ATOM   1068 C CA  . LEU A 1 137 ? 6.307   -46.622 45.121  1.00 27.70  ? 138 LEU A CA  1 
ATOM   1069 C C   . LEU A 1 137 ? 7.262   -45.881 46.034  1.00 24.34  ? 138 LEU A C   1 
ATOM   1070 O O   . LEU A 1 137 ? 8.483   -46.032 45.967  1.00 23.16  ? 138 LEU A O   1 
ATOM   1071 C CB  . LEU A 1 137 ? 5.885   -45.688 43.980  1.00 22.29  ? 138 LEU A CB  1 
ATOM   1072 C CG  . LEU A 1 137 ? 5.911   -46.248 42.566  1.00 28.58  ? 138 LEU A CG  1 
ATOM   1073 C CD1 . LEU A 1 137 ? 5.152   -45.309 41.634  1.00 30.97  ? 138 LEU A CD1 1 
ATOM   1074 C CD2 . LEU A 1 137 ? 7.345   -46.429 42.100  1.00 26.56  ? 138 LEU A CD2 1 
ATOM   1075 N N   . VAL A 1 138 ? 6.685   -45.046 46.878  1.00 21.58  ? 139 VAL A N   1 
ATOM   1076 C CA  . VAL A 1 138 ? 7.477   -44.249 47.778  1.00 25.63  ? 139 VAL A CA  1 
ATOM   1077 C C   . VAL A 1 138 ? 8.220   -45.146 48.764  1.00 28.74  ? 139 VAL A C   1 
ATOM   1078 O O   . VAL A 1 138 ? 9.421   -44.982 48.968  1.00 29.24  ? 139 VAL A O   1 
ATOM   1079 C CB  . VAL A 1 138 ? 6.598   -43.235 48.495  1.00 32.22  ? 139 VAL A CB  1 
ATOM   1080 C CG1 . VAL A 1 138 ? 7.354   -42.597 49.603  1.00 28.29  ? 139 VAL A CG1 1 
ATOM   1081 C CG2 . VAL A 1 138 ? 6.123   -42.187 47.496  1.00 27.28  ? 139 VAL A CG2 1 
ATOM   1082 N N   . GLN A 1 139 ? 7.519   -46.119 49.341  1.00 31.83  ? 140 GLN A N   1 
ATOM   1083 C CA  . GLN A 1 139 ? 8.149   -47.049 50.275  1.00 29.83  ? 140 GLN A CA  1 
ATOM   1084 C C   . GLN A 1 139 ? 9.234   -47.856 49.575  1.00 29.82  ? 140 GLN A C   1 
ATOM   1085 O O   . GLN A 1 139 ? 10.373  -47.885 50.029  1.00 32.02  ? 140 GLN A O   1 
ATOM   1086 C CB  . GLN A 1 139 ? 7.112   -47.984 50.915  1.00 30.02  ? 140 GLN A CB  1 
ATOM   1087 C CG  . GLN A 1 139 ? 7.581   -48.693 52.191  1.00 29.43  ? 140 GLN A CG  1 
ATOM   1088 C CD  . GLN A 1 139 ? 8.521   -49.856 51.914  1.00 33.84  ? 140 GLN A CD  1 
ATOM   1089 O OE1 . GLN A 1 139 ? 8.305   -50.643 50.988  1.00 33.49  ? 140 GLN A OE1 1 
ATOM   1090 N NE2 . GLN A 1 139 ? 9.578   -49.963 52.708  1.00 30.37  ? 140 GLN A NE2 1 
ATOM   1091 N N   . ALA A 1 140 ? 8.880   -48.493 48.461  1.00 29.27  ? 141 ALA A N   1 
ATOM   1092 C CA  . ALA A 1 140 ? 9.766   -49.464 47.822  1.00 30.81  ? 141 ALA A CA  1 
ATOM   1093 C C   . ALA A 1 140 ? 10.978  -48.841 47.145  1.00 30.50  ? 141 ALA A C   1 
ATOM   1094 O O   . ALA A 1 140 ? 12.050  -49.446 47.085  1.00 30.33  ? 141 ALA A O   1 
ATOM   1095 C CB  . ALA A 1 140 ? 8.984   -50.322 46.811  1.00 29.65  ? 141 ALA A CB  1 
ATOM   1096 N N   . GLU A 1 141 ? 10.810  -47.639 46.613  1.00 26.21  ? 142 GLU A N   1 
ATOM   1097 C CA  . GLU A 1 141 ? 11.848  -47.079 45.772  1.00 25.36  ? 142 GLU A CA  1 
ATOM   1098 C C   . GLU A 1 141 ? 12.414  -45.791 46.333  1.00 28.97  ? 142 GLU A C   1 
ATOM   1099 O O   . GLU A 1 141 ? 13.342  -45.212 45.758  1.00 24.98  ? 142 GLU A O   1 
ATOM   1100 C CB  . GLU A 1 141 ? 11.338  -46.888 44.340  1.00 25.20  ? 142 GLU A CB  1 
ATOM   1101 C CG  . GLU A 1 141 ? 11.117  -48.200 43.613  1.00 27.04  ? 142 GLU A CG  1 
ATOM   1102 C CD  . GLU A 1 141 ? 12.392  -49.013 43.495  1.00 31.40  ? 142 GLU A CD  1 
ATOM   1103 O OE1 . GLU A 1 141 ? 13.473  -48.395 43.383  1.00 32.05  ? 142 GLU A OE1 1 
ATOM   1104 O OE2 . GLU A 1 141 ? 12.320  -50.264 43.518  1.00 32.37  ? 142 GLU A OE2 1 
ATOM   1105 N N   . ARG A 1 142 ? 11.857  -45.364 47.464  1.00 31.35  ? 143 ARG A N   1 
ATOM   1106 C CA  . ARG A 1 142 ? 12.354  -44.204 48.202  1.00 31.83  ? 143 ARG A CA  1 
ATOM   1107 C C   . ARG A 1 142 ? 12.453  -42.952 47.353  1.00 29.37  ? 143 ARG A C   1 
ATOM   1108 O O   . ARG A 1 142 ? 13.489  -42.312 47.273  1.00 35.35  ? 143 ARG A O   1 
ATOM   1109 C CB  . ARG A 1 142 ? 13.660  -44.536 48.926  1.00 28.58  ? 143 ARG A CB  1 
ATOM   1110 C CG  . ARG A 1 142 ? 13.414  -45.552 50.039  1.00 35.03  ? 143 ARG A CG  1 
ATOM   1111 C CD  . ARG A 1 142 ? 14.567  -45.674 51.009  1.00 38.75  ? 143 ARG A CD  1 
ATOM   1112 N NE  . ARG A 1 142 ? 14.739  -44.482 51.836  1.00 46.42  ? 143 ARG A NE  1 
ATOM   1113 C CZ  . ARG A 1 142 ? 14.059  -44.239 52.954  1.00 45.47  ? 143 ARG A CZ  1 
ATOM   1114 N NH1 . ARG A 1 142 ? 13.140  -45.098 53.381  1.00 32.13  ? 143 ARG A NH1 1 
ATOM   1115 N NH2 . ARG A 1 142 ? 14.287  -43.127 53.639  1.00 46.82  ? 143 ARG A NH2 1 
ATOM   1116 N N   . THR A 1 143 ? 11.344  -42.631 46.705  1.00 32.41  ? 144 THR A N   1 
ATOM   1117 C CA  . THR A 1 143 ? 11.202  -41.397 45.963  1.00 30.30  ? 144 THR A CA  1 
ATOM   1118 C C   . THR A 1 143 ? 10.203  -40.522 46.698  1.00 27.99  ? 144 THR A C   1 
ATOM   1119 O O   . THR A 1 143 ? 9.533   -40.975 47.632  1.00 27.84  ? 144 THR A O   1 
ATOM   1120 C CB  . THR A 1 143 ? 10.597  -41.668 44.583  1.00 35.21  ? 144 THR A CB  1 
ATOM   1121 O OG1 . THR A 1 143 ? 9.446   -42.511 44.744  1.00 38.23  ? 144 THR A OG1 1 
ATOM   1122 C CG2 . THR A 1 143 ? 11.603  -42.346 43.673  1.00 33.98  ? 144 THR A CG2 1 
ATOM   1123 N N   . VAL A 1 144 ? 10.100  -39.271 46.273  1.00 23.22  ? 145 VAL A N   1 
ATOM   1124 C CA  . VAL A 1 144 ? 8.945   -38.454 46.618  1.00 29.04  ? 145 VAL A CA  1 
ATOM   1125 C C   . VAL A 1 144 ? 7.980   -38.472 45.423  1.00 32.40  ? 145 VAL A C   1 
ATOM   1126 O O   . VAL A 1 144 ? 8.406   -38.376 44.263  1.00 26.72  ? 145 VAL A O   1 
ATOM   1127 C CB  . VAL A 1 144 ? 9.366   -37.029 46.972  1.00 27.45  ? 145 VAL A CB  1 
ATOM   1128 C CG1 . VAL A 1 144 ? 8.156   -36.103 47.069  1.00 28.13  ? 145 VAL A CG1 1 
ATOM   1129 C CG2 . VAL A 1 144 ? 10.157  -37.042 48.273  1.00 31.38  ? 145 VAL A CG2 1 
ATOM   1130 N N   . LEU A 1 145 ? 6.690   -38.646 45.708  1.00 26.51  ? 146 LEU A N   1 
ATOM   1131 C CA  . LEU A 1 145 ? 5.676   -38.760 44.666  1.00 26.15  ? 146 LEU A CA  1 
ATOM   1132 C C   . LEU A 1 145 ? 4.682   -37.642 44.858  1.00 26.71  ? 146 LEU A C   1 
ATOM   1133 O O   . LEU A 1 145 ? 4.152   -37.457 45.959  1.00 29.11  ? 146 LEU A O   1 
ATOM   1134 C CB  . LEU A 1 145 ? 4.959   -40.115 44.749  1.00 26.19  ? 146 LEU A CB  1 
ATOM   1135 C CG  . LEU A 1 145 ? 4.000   -40.630 43.655  1.00 32.46  ? 146 LEU A CG  1 
ATOM   1136 C CD1 . LEU A 1 145 ? 2.655   -39.907 43.594  1.00 31.30  ? 146 LEU A CD1 1 
ATOM   1137 C CD2 . LEU A 1 145 ? 4.652   -40.560 42.320  1.00 28.97  ? 146 LEU A CD2 1 
ATOM   1138 N N   . VAL A 1 146 ? 4.429   -36.901 43.784  1.00 25.66  ? 147 VAL A N   1 
ATOM   1139 C CA  . VAL A 1 146 ? 3.442   -35.828 43.799  1.00 24.44  ? 147 VAL A CA  1 
ATOM   1140 C C   . VAL A 1 146 ? 2.400   -36.105 42.725  1.00 23.48  ? 147 VAL A C   1 
ATOM   1141 O O   . VAL A 1 146 ? 2.738   -36.539 41.625  1.00 22.06  ? 147 VAL A O   1 
ATOM   1142 C CB  . VAL A 1 146 ? 4.102   -34.453 43.513  1.00 23.14  ? 147 VAL A CB  1 
ATOM   1143 C CG1 . VAL A 1 146 ? 3.066   -33.324 43.556  1.00 18.11  ? 147 VAL A CG1 1 
ATOM   1144 C CG2 . VAL A 1 146 ? 5.232   -34.186 44.500  1.00 22.93  ? 147 VAL A CG2 1 
ATOM   1145 N N   . SER A 1 147 ? 1.132   -35.862 43.038  1.00 22.93  ? 148 SER A N   1 
ATOM   1146 C CA  . SER A 1 147 ? 0.098   -35.901 42.011  1.00 25.29  ? 148 SER A CA  1 
ATOM   1147 C C   . SER A 1 147 ? -0.871  -34.752 42.235  1.00 24.52  ? 148 SER A C   1 
ATOM   1148 O O   . SER A 1 147 ? -1.132  -34.372 43.380  1.00 21.58  ? 148 SER A O   1 
ATOM   1149 C CB  . SER A 1 147 ? -0.642  -37.239 42.032  1.00 19.94  ? 148 SER A CB  1 
ATOM   1150 O OG  . SER A 1 147 ? -1.368  -37.388 43.228  1.00 22.02  ? 148 SER A OG  1 
ATOM   1151 N N   . MET A 1 148 ? -1.405  -34.195 41.149  1.00 18.38  ? 149 MET A N   1 
ATOM   1152 C CA  . MET A 1 148 ? -2.322  -33.072 41.277  1.00 23.28  ? 149 MET A CA  1 
ATOM   1153 C C   . MET A 1 148 ? -3.648  -33.360 40.593  1.00 25.41  ? 149 MET A C   1 
ATOM   1154 O O   . MET A 1 148 ? -3.714  -34.201 39.705  1.00 20.70  ? 149 MET A O   1 
ATOM   1155 C CB  . MET A 1 148 ? -1.707  -31.792 40.693  1.00 20.59  ? 149 MET A CB  1 
ATOM   1156 C CG  . MET A 1 148 ? -1.941  -31.610 39.178  1.00 19.86  ? 149 MET A CG  1 
ATOM   1157 S SD  . MET A 1 148 ? -1.074  -32.876 38.213  1.00 23.30  ? 149 MET A SD  1 
ATOM   1158 C CE  . MET A 1 148 ? 0.637   -32.422 38.502  1.00 17.15  ? 149 MET A CE  1 
ATOM   1159 N N   . ASN A 1 149 ? -4.701  -32.668 41.027  1.00 20.00  ? 150 ASN A N   1 
ATOM   1160 C CA  . ASN A 1 149 ? -5.922  -32.599 40.250  1.00 23.24  ? 150 ASN A CA  1 
ATOM   1161 C C   . ASN A 1 149 ? -5.824  -31.413 39.297  1.00 24.90  ? 150 ASN A C   1 
ATOM   1162 O O   . ASN A 1 149 ? -5.271  -30.377 39.646  1.00 26.11  ? 150 ASN A O   1 
ATOM   1163 C CB  . ASN A 1 149 ? -7.154  -32.453 41.151  1.00 20.18  ? 150 ASN A CB  1 
ATOM   1164 C CG  . ASN A 1 149 ? -7.679  -33.794 41.656  1.00 28.81  ? 150 ASN A CG  1 
ATOM   1165 O OD1 . ASN A 1 149 ? -7.022  -34.830 41.507  1.00 25.52  ? 150 ASN A OD1 1 
ATOM   1166 N ND2 . ASN A 1 149 ? -8.866  -33.777 42.268  1.00 27.97  ? 150 ASN A ND2 1 
ATOM   1167 N N   . TYR A 1 150 ? -6.346  -31.571 38.089  1.00 20.20  ? 151 TYR A N   1 
ATOM   1168 C CA  . TYR A 1 150 ? -6.426  -30.460 37.154  1.00 19.93  ? 151 TYR A CA  1 
ATOM   1169 C C   . TYR A 1 150 ? -7.798  -30.473 36.510  1.00 19.16  ? 151 TYR A C   1 
ATOM   1170 O O   . TYR A 1 150 ? -8.416  -31.531 36.388  1.00 20.88  ? 151 TYR A O   1 
ATOM   1171 C CB  . TYR A 1 150 ? -5.328  -30.565 36.094  1.00 20.27  ? 151 TYR A CB  1 
ATOM   1172 C CG  . TYR A 1 150 ? -5.405  -31.813 35.252  1.00 17.59  ? 151 TYR A CG  1 
ATOM   1173 C CD1 . TYR A 1 150 ? -4.756  -32.978 35.641  1.00 16.30  ? 151 TYR A CD1 1 
ATOM   1174 C CD2 . TYR A 1 150 ? -6.116  -31.820 34.060  1.00 19.29  ? 151 TYR A CD2 1 
ATOM   1175 C CE1 . TYR A 1 150 ? -4.820  -34.119 34.870  1.00 18.96  ? 151 TYR A CE1 1 
ATOM   1176 C CE2 . TYR A 1 150 ? -6.184  -32.956 33.275  1.00 18.48  ? 151 TYR A CE2 1 
ATOM   1177 C CZ  . TYR A 1 150 ? -5.542  -34.100 33.684  1.00 20.22  ? 151 TYR A CZ  1 
ATOM   1178 O OH  . TYR A 1 150 ? -5.618  -35.222 32.901  1.00 18.68  ? 151 TYR A OH  1 
ATOM   1179 N N   . ARG A 1 151 ? -8.274  -29.305 36.098  1.00 19.03  ? 152 ARG A N   1 
ATOM   1180 C CA  . ARG A 1 151 ? -9.610  -29.194 35.511  1.00 21.54  ? 152 ARG A CA  1 
ATOM   1181 C C   . ARG A 1 151 ? -9.756  -29.973 34.212  1.00 24.15  ? 152 ARG A C   1 
ATOM   1182 O O   . ARG A 1 151 ? -8.868  -29.949 33.350  1.00 22.83  ? 152 ARG A O   1 
ATOM   1183 C CB  . ARG A 1 151 ? -9.984  -27.726 35.288  1.00 23.82  ? 152 ARG A CB  1 
ATOM   1184 C CG  . ARG A 1 151 ? -10.372 -26.985 36.565  1.00 19.56  ? 152 ARG A CG  1 
ATOM   1185 C CD  . ARG A 1 151 ? -10.517 -25.503 36.288  1.00 22.58  ? 152 ARG A CD  1 
ATOM   1186 N NE  . ARG A 1 151 ? -9.218  -24.840 36.177  1.00 22.21  ? 152 ARG A NE  1 
ATOM   1187 C CZ  . ARG A 1 151 ? -9.060  -23.549 35.899  1.00 23.75  ? 152 ARG A CZ  1 
ATOM   1188 N NH1 . ARG A 1 151 ? -10.124 -22.781 35.689  1.00 24.78  ? 152 ARG A NH1 1 
ATOM   1189 N NH2 . ARG A 1 151 ? -7.843  -23.025 35.828  1.00 20.31  ? 152 ARG A NH2 1 
ATOM   1190 N N   . VAL A 1 152 ? -10.886 -30.659 34.073  1.00 22.48  ? 153 VAL A N   1 
ATOM   1191 C CA  . VAL A 1 152 ? -11.145 -31.457 32.883  1.00 20.45  ? 153 VAL A CA  1 
ATOM   1192 C C   . VAL A 1 152 ? -12.435 -31.007 32.217  1.00 24.96  ? 153 VAL A C   1 
ATOM   1193 O O   . VAL A 1 152 ? -13.138 -30.138 32.741  1.00 21.71  ? 153 VAL A O   1 
ATOM   1194 C CB  . VAL A 1 152 ? -11.195 -32.963 33.199  1.00 25.37  ? 153 VAL A CB  1 
ATOM   1195 C CG1 . VAL A 1 152 ? -9.801  -33.473 33.577  1.00 19.61  ? 153 VAL A CG1 1 
ATOM   1196 C CG2 . VAL A 1 152 ? -12.196 -33.249 34.324  1.00 17.61  ? 153 VAL A CG2 1 
ATOM   1197 N N   . GLY A 1 153 ? -12.723 -31.572 31.045  1.00 22.57  ? 154 GLY A N   1 
ATOM   1198 C CA  . GLY A 1 153 ? -13.919 -31.222 30.296  1.00 20.33  ? 154 GLY A CA  1 
ATOM   1199 C C   . GLY A 1 153 ? -13.950 -29.737 30.010  1.00 25.35  ? 154 GLY A C   1 
ATOM   1200 O O   . GLY A 1 153 ? -12.901 -29.091 29.975  1.00 24.22  ? 154 GLY A O   1 
ATOM   1201 N N   . ALA A 1 154 ? -15.147 -29.184 29.844  1.00 23.33  ? 155 ALA A N   1 
ATOM   1202 C CA  . ALA A 1 154 ? -15.290 -27.763 29.550  1.00 25.46  ? 155 ALA A CA  1 
ATOM   1203 C C   . ALA A 1 154 ? -14.554 -26.872 30.556  1.00 27.25  ? 155 ALA A C   1 
ATOM   1204 O O   . ALA A 1 154 ? -13.980 -25.848 30.190  1.00 25.72  ? 155 ALA A O   1 
ATOM   1205 C CB  . ALA A 1 154 ? -16.773 -27.377 29.469  1.00 26.57  ? 155 ALA A CB  1 
ATOM   1206 N N   . PHE A 1 155 ? -14.559 -27.279 31.822  1.00 25.39  ? 156 PHE A N   1 
ATOM   1207 C CA  . PHE A 1 155 ? -13.948 -26.479 32.880  1.00 23.14  ? 156 PHE A CA  1 
ATOM   1208 C C   . PHE A 1 155 ? -12.451 -26.274 32.683  1.00 24.00  ? 156 PHE A C   1 
ATOM   1209 O O   . PHE A 1 155 ? -11.910 -25.232 33.051  1.00 27.09  ? 156 PHE A O   1 
ATOM   1210 C CB  . PHE A 1 155 ? -14.253 -27.108 34.239  1.00 21.78  ? 156 PHE A CB  1 
ATOM   1211 C CG  . PHE A 1 155 ? -15.701 -27.388 34.424  1.00 24.35  ? 156 PHE A CG  1 
ATOM   1212 C CD1 . PHE A 1 155 ? -16.208 -28.658 34.190  1.00 22.82  ? 156 PHE A CD1 1 
ATOM   1213 C CD2 . PHE A 1 155 ? -16.574 -26.363 34.768  1.00 20.78  ? 156 PHE A CD2 1 
ATOM   1214 C CE1 . PHE A 1 155 ? -17.554 -28.911 34.329  1.00 23.46  ? 156 PHE A CE1 1 
ATOM   1215 C CE2 . PHE A 1 155 ? -17.927 -26.611 34.927  1.00 24.75  ? 156 PHE A CE2 1 
ATOM   1216 C CZ  . PHE A 1 155 ? -18.417 -27.885 34.697  1.00 24.97  ? 156 PHE A CZ  1 
ATOM   1217 N N   . GLY A 1 156 ? -11.789 -27.257 32.083  1.00 22.51  ? 157 GLY A N   1 
ATOM   1218 C CA  . GLY A 1 156 ? -10.366 -27.155 31.837  1.00 20.74  ? 157 GLY A CA  1 
ATOM   1219 C C   . GLY A 1 156 ? -9.983  -26.794 30.416  1.00 24.31  ? 157 GLY A C   1 
ATOM   1220 O O   . GLY A 1 156 ? -8.869  -26.320 30.188  1.00 27.21  ? 157 GLY A O   1 
ATOM   1221 N N   . PHE A 1 157 ? -10.891 -26.997 29.460  1.00 23.08  ? 158 PHE A N   1 
ATOM   1222 C CA  . PHE A 1 157 ? -10.503 -26.955 28.051  1.00 23.82  ? 158 PHE A CA  1 
ATOM   1223 C C   . PHE A 1 157 ? -11.493 -26.327 27.072  1.00 26.67  ? 158 PHE A C   1 
ATOM   1224 O O   . PHE A 1 157 ? -11.243 -26.323 25.869  1.00 25.88  ? 158 PHE A O   1 
ATOM   1225 C CB  . PHE A 1 157 ? -10.061 -28.354 27.578  1.00 24.72  ? 158 PHE A CB  1 
ATOM   1226 C CG  . PHE A 1 157 ? -8.890  -28.887 28.349  1.00 23.29  ? 158 PHE A CG  1 
ATOM   1227 C CD1 . PHE A 1 157 ? -9.074  -29.783 29.390  1.00 23.35  ? 158 PHE A CD1 1 
ATOM   1228 C CD2 . PHE A 1 157 ? -7.611  -28.423 28.090  1.00 25.46  ? 158 PHE A CD2 1 
ATOM   1229 C CE1 . PHE A 1 157 ? -7.998  -30.239 30.135  1.00 19.80  ? 158 PHE A CE1 1 
ATOM   1230 C CE2 . PHE A 1 157 ? -6.529  -28.875 28.833  1.00 27.06  ? 158 PHE A CE2 1 
ATOM   1231 C CZ  . PHE A 1 157 ? -6.727  -29.786 29.861  1.00 21.72  ? 158 PHE A CZ  1 
ATOM   1232 N N   . LEU A 1 158 ? -12.600 -25.780 27.566  1.00 27.43  ? 159 LEU A N   1 
ATOM   1233 C CA  . LEU A 1 158 ? -13.477 -25.028 26.682  1.00 24.70  ? 159 LEU A CA  1 
ATOM   1234 C C   . LEU A 1 158 ? -12.711 -23.803 26.195  1.00 30.82  ? 159 LEU A C   1 
ATOM   1235 O O   . LEU A 1 158 ? -12.099 -23.085 26.979  1.00 32.86  ? 159 LEU A O   1 
ATOM   1236 C CB  . LEU A 1 158 ? -14.787 -24.628 27.363  1.00 24.52  ? 159 LEU A CB  1 
ATOM   1237 C CG  . LEU A 1 158 ? -15.782 -23.842 26.488  1.00 30.30  ? 159 LEU A CG  1 
ATOM   1238 C CD1 . LEU A 1 158 ? -17.230 -24.297 26.691  1.00 24.74  ? 159 LEU A CD1 1 
ATOM   1239 C CD2 . LEU A 1 158 ? -15.673 -22.353 26.755  1.00 27.05  ? 159 LEU A CD2 1 
ATOM   1240 N N   . ALA A 1 159 ? -12.727 -23.578 24.891  1.00 30.16  ? 160 ALA A N   1 
ATOM   1241 C CA  . ALA A 1 159 ? -11.931 -22.505 24.320  1.00 32.03  ? 160 ALA A CA  1 
ATOM   1242 C C   . ALA A 1 159 ? -12.731 -21.704 23.305  1.00 35.94  ? 160 ALA A C   1 
ATOM   1243 O O   . ALA A 1 159 ? -13.374 -22.272 22.420  1.00 26.91  ? 160 ALA A O   1 
ATOM   1244 C CB  . ALA A 1 159 ? -10.669 -23.072 23.664  1.00 23.68  ? 160 ALA A CB  1 
ATOM   1245 N N   . LEU A 1 160 ? -12.709 -20.385 23.468  1.00 29.61  ? 161 LEU A N   1 
ATOM   1246 C CA  . LEU A 1 160 ? -13.074 -19.468 22.401  1.00 33.91  ? 161 LEU A CA  1 
ATOM   1247 C C   . LEU A 1 160 ? -11.794 -18.743 22.049  1.00 37.16  ? 161 LEU A C   1 
ATOM   1248 O O   . LEU A 1 160 ? -11.461 -17.737 22.672  1.00 40.25  ? 161 LEU A O   1 
ATOM   1249 C CB  . LEU A 1 160 ? -14.137 -18.478 22.860  1.00 30.90  ? 161 LEU A CB  1 
ATOM   1250 C CG  . LEU A 1 160 ? -15.503 -19.125 23.074  1.00 36.25  ? 161 LEU A CG  1 
ATOM   1251 C CD1 . LEU A 1 160 ? -16.367 -18.255 23.954  1.00 38.39  ? 161 LEU A CD1 1 
ATOM   1252 C CD2 . LEU A 1 160 ? -16.181 -19.401 21.737  1.00 25.71  ? 161 LEU A CD2 1 
ATOM   1253 N N   . PRO A 1 161 ? -11.050 -19.281 21.069  1.00 39.19  ? 162 PRO A N   1 
ATOM   1254 C CA  . PRO A 1 161 ? -9.697  -18.813 20.740  1.00 42.68  ? 162 PRO A CA  1 
ATOM   1255 C C   . PRO A 1 161 ? -9.655  -17.315 20.457  1.00 41.58  ? 162 PRO A C   1 
ATOM   1256 O O   . PRO A 1 161 ? -10.478 -16.798 19.700  1.00 40.96  ? 162 PRO A O   1 
ATOM   1257 C CB  . PRO A 1 161 ? -9.347  -19.617 19.489  1.00 38.81  ? 162 PRO A CB  1 
ATOM   1258 C CG  . PRO A 1 161 ? -10.157 -20.873 19.628  1.00 38.57  ? 162 PRO A CG  1 
ATOM   1259 C CD  . PRO A 1 161 ? -11.455 -20.426 20.236  1.00 31.70  ? 162 PRO A CD  1 
ATOM   1260 N N   . GLY A 1 162 ? -8.713  -16.627 21.089  1.00 42.18  ? 163 GLY A N   1 
ATOM   1261 C CA  . GLY A 1 162 ? -8.615  -15.187 20.965  1.00 40.57  ? 163 GLY A CA  1 
ATOM   1262 C C   . GLY A 1 162 ? -9.237  -14.461 22.145  1.00 44.92  ? 163 GLY A C   1 
ATOM   1263 O O   . GLY A 1 162 ? -8.787  -13.378 22.515  1.00 42.80  ? 163 GLY A O   1 
ATOM   1264 N N   . SER A 1 163 ? -10.268 -15.055 22.742  1.00 42.86  ? 164 SER A N   1 
ATOM   1265 C CA  . SER A 1 163 ? -10.985 -14.409 23.840  1.00 41.59  ? 164 SER A CA  1 
ATOM   1266 C C   . SER A 1 163 ? -10.200 -14.452 25.142  1.00 42.81  ? 164 SER A C   1 
ATOM   1267 O O   . SER A 1 163 ? -9.379  -15.337 25.363  1.00 45.41  ? 164 SER A O   1 
ATOM   1268 C CB  . SER A 1 163 ? -12.339 -15.069 24.067  1.00 43.22  ? 164 SER A CB  1 
ATOM   1269 O OG  . SER A 1 163 ? -12.201 -16.179 24.939  1.00 47.27  ? 164 SER A OG  1 
ATOM   1270 N N   . ARG A 1 164 ? -10.472 -13.498 26.016  1.00 47.50  ? 165 ARG A N   1 
ATOM   1271 C CA  . ARG A 1 164 ? -9.806  -13.459 27.302  1.00 46.18  ? 165 ARG A CA  1 
ATOM   1272 C C   . ARG A 1 164 ? -10.607 -14.254 28.319  1.00 41.15  ? 165 ARG A C   1 
ATOM   1273 O O   . ARG A 1 164 ? -10.052 -14.782 29.276  1.00 49.63  ? 165 ARG A O   1 
ATOM   1274 C CB  . ARG A 1 164 ? -9.632  -12.013 27.772  1.00 53.87  ? 165 ARG A CB  1 
ATOM   1275 C CG  . ARG A 1 164 ? -8.841  -11.137 26.807  1.00 66.29  ? 165 ARG A CG  1 
ATOM   1276 C CD  . ARG A 1 164 ? -8.257  -9.923  27.516  1.00 83.14  ? 165 ARG A CD  1 
ATOM   1277 N NE  . ARG A 1 164 ? -7.479  -10.322 28.686  1.00 102.11 ? 165 ARG A NE  1 
ATOM   1278 C CZ  . ARG A 1 164 ? -6.827  -9.481  29.481  1.00 102.00 ? 165 ARG A CZ  1 
ATOM   1279 N NH1 . ARG A 1 164 ? -6.851  -8.178  29.231  1.00 101.62 ? 165 ARG A NH1 1 
ATOM   1280 N NH2 . ARG A 1 164 ? -6.148  -9.944  30.525  1.00 92.70  ? 165 ARG A NH2 1 
ATOM   1281 N N   . GLU A 1 165 ? -11.914 -14.348 28.094  1.00 45.29  ? 166 GLU A N   1 
ATOM   1282 C CA  . GLU A 1 165 ? -12.818 -14.986 29.049  1.00 43.35  ? 166 GLU A CA  1 
ATOM   1283 C C   . GLU A 1 165 ? -12.761 -16.518 29.030  1.00 42.67  ? 166 GLU A C   1 
ATOM   1284 O O   . GLU A 1 165 ? -13.118 -17.162 30.015  1.00 44.50  ? 166 GLU A O   1 
ATOM   1285 C CB  . GLU A 1 165 ? -14.257 -14.502 28.840  1.00 42.48  ? 166 GLU A CB  1 
ATOM   1286 C CG  . GLU A 1 165 ? -14.460 -13.003 29.051  1.00 45.32  ? 166 GLU A CG  1 
ATOM   1287 C CD  . GLU A 1 165 ? -14.277 -12.190 27.766  1.00 58.15  ? 166 GLU A CD  1 
ATOM   1288 O OE1 . GLU A 1 165 ? -13.923 -12.780 26.716  1.00 51.95  ? 166 GLU A OE1 1 
ATOM   1289 O OE2 . GLU A 1 165 ? -14.494 -10.956 27.808  1.00 60.65  ? 166 GLU A OE2 1 
ATOM   1290 N N   . ALA A 1 166 ? -12.315 -17.094 27.916  1.00 36.54  ? 167 ALA A N   1 
ATOM   1291 C CA  . ALA A 1 166 ? -12.119 -18.544 27.814  1.00 37.49  ? 167 ALA A CA  1 
ATOM   1292 C C   . ALA A 1 166 ? -11.014 -18.879 26.812  1.00 35.29  ? 167 ALA A C   1 
ATOM   1293 O O   . ALA A 1 166 ? -11.290 -19.308 25.688  1.00 37.34  ? 167 ALA A O   1 
ATOM   1294 C CB  . ALA A 1 166 ? -13.418 -19.238 27.428  1.00 36.06  ? 167 ALA A CB  1 
ATOM   1295 N N   . PRO A 1 167 ? -9.755  -18.684 27.220  1.00 31.87  ? 168 PRO A N   1 
ATOM   1296 C CA  . PRO A 1 167 ? -8.604  -18.764 26.313  1.00 30.40  ? 168 PRO A CA  1 
ATOM   1297 C C   . PRO A 1 167 ? -8.223  -20.195 25.963  1.00 32.99  ? 168 PRO A C   1 
ATOM   1298 O O   . PRO A 1 167 ? -7.431  -20.402 25.048  1.00 33.75  ? 168 PRO A O   1 
ATOM   1299 C CB  . PRO A 1 167 ? -7.481  -18.118 27.125  1.00 28.22  ? 168 PRO A CB  1 
ATOM   1300 C CG  . PRO A 1 167 ? -7.859  -18.392 28.546  1.00 29.58  ? 168 PRO A CG  1 
ATOM   1301 C CD  . PRO A 1 167 ? -9.355  -18.359 28.600  1.00 28.38  ? 168 PRO A CD  1 
ATOM   1302 N N   . GLY A 1 168 ? -8.774  -21.164 26.689  1.00 34.49  ? 169 GLY A N   1 
ATOM   1303 C CA  . GLY A 1 168 ? -8.441  -22.560 26.474  1.00 28.77  ? 169 GLY A CA  1 
ATOM   1304 C C   . GLY A 1 168 ? -7.206  -22.994 27.246  1.00 29.61  ? 169 GLY A C   1 
ATOM   1305 O O   . GLY A 1 168 ? -6.448  -22.160 27.757  1.00 26.14  ? 169 GLY A O   1 
ATOM   1306 N N   . ASN A 1 169 ? -7.025  -24.310 27.334  1.00 23.30  ? 170 ASN A N   1 
ATOM   1307 C CA  . ASN A 1 169 ? -5.848  -24.922 27.939  1.00 23.17  ? 170 ASN A CA  1 
ATOM   1308 C C   . ASN A 1 169 ? -5.658  -24.679 29.442  1.00 20.20  ? 170 ASN A C   1 
ATOM   1309 O O   . ASN A 1 169 ? -4.588  -24.960 29.977  1.00 19.47  ? 170 ASN A O   1 
ATOM   1310 C CB  . ASN A 1 169 ? -4.571  -24.525 27.179  1.00 23.14  ? 170 ASN A CB  1 
ATOM   1311 C CG  . ASN A 1 169 ? -4.576  -25.000 25.741  1.00 28.93  ? 170 ASN A CG  1 
ATOM   1312 O OD1 . ASN A 1 169 ? -5.194  -26.007 25.412  1.00 29.42  ? 170 ASN A OD1 1 
ATOM   1313 N ND2 . ASN A 1 169 ? -3.885  -24.272 24.872  1.00 26.40  ? 170 ASN A ND2 1 
ATOM   1314 N N   . VAL A 1 170 ? -6.681  -24.191 30.136  1.00 23.36  ? 171 VAL A N   1 
ATOM   1315 C CA  . VAL A 1 170 ? -6.470  -23.843 31.546  1.00 25.34  ? 171 VAL A CA  1 
ATOM   1316 C C   . VAL A 1 170 ? -6.166  -25.067 32.435  1.00 24.82  ? 171 VAL A C   1 
ATOM   1317 O O   . VAL A 1 170 ? -5.452  -24.963 33.428  1.00 22.81  ? 171 VAL A O   1 
ATOM   1318 C CB  . VAL A 1 170 ? -7.580  -22.912 32.125  1.00 26.79  ? 171 VAL A CB  1 
ATOM   1319 C CG1 . VAL A 1 170 ? -7.583  -21.571 31.377  1.00 20.81  ? 171 VAL A CG1 1 
ATOM   1320 C CG2 . VAL A 1 170 ? -8.966  -23.577 32.105  1.00 22.54  ? 171 VAL A CG2 1 
ATOM   1321 N N   . GLY A 1 171 ? -6.670  -26.232 32.048  1.00 24.47  ? 172 GLY A N   1 
ATOM   1322 C CA  . GLY A 1 171 ? -6.340  -27.452 32.761  1.00 21.32  ? 172 GLY A CA  1 
ATOM   1323 C C   . GLY A 1 171 ? -4.860  -27.778 32.650  1.00 22.42  ? 172 GLY A C   1 
ATOM   1324 O O   . GLY A 1 171 ? -4.252  -28.318 33.591  1.00 25.51  ? 172 GLY A O   1 
ATOM   1325 N N   . LEU A 1 172 ? -4.280  -27.467 31.492  1.00 21.66  ? 173 LEU A N   1 
ATOM   1326 C CA  . LEU A 1 172 ? -2.841  -27.618 31.293  1.00 20.92  ? 173 LEU A CA  1 
ATOM   1327 C C   . LEU A 1 172 ? -2.092  -26.643 32.191  1.00 21.56  ? 173 LEU A C   1 
ATOM   1328 O O   . LEU A 1 172 ? -1.064  -27.004 32.778  1.00 20.64  ? 173 LEU A O   1 
ATOM   1329 C CB  . LEU A 1 172 ? -2.457  -27.396 29.833  1.00 22.08  ? 173 LEU A CB  1 
ATOM   1330 C CG  . LEU A 1 172 ? -2.644  -28.580 28.887  1.00 21.24  ? 173 LEU A CG  1 
ATOM   1331 C CD1 . LEU A 1 172 ? -2.318  -28.166 27.471  1.00 16.67  ? 173 LEU A CD1 1 
ATOM   1332 C CD2 . LEU A 1 172 ? -1.756  -29.739 29.324  1.00 19.26  ? 173 LEU A CD2 1 
ATOM   1333 N N   . LEU A 1 173 ? -2.620  -25.422 32.315  1.00 18.37  ? 174 LEU A N   1 
ATOM   1334 C CA  . LEU A 1 173 ? -2.036  -24.433 33.232  1.00 23.66  ? 174 LEU A CA  1 
ATOM   1335 C C   . LEU A 1 173 ? -2.185  -24.849 34.701  1.00 20.11  ? 174 LEU A C   1 
ATOM   1336 O O   . LEU A 1 173 ? -1.313  -24.564 35.511  1.00 22.41  ? 174 LEU A O   1 
ATOM   1337 C CB  . LEU A 1 173 ? -2.590  -23.018 32.986  1.00 19.19  ? 174 LEU A CB  1 
ATOM   1338 C CG  . LEU A 1 173 ? -2.312  -22.416 31.599  1.00 30.59  ? 174 LEU A CG  1 
ATOM   1339 C CD1 . LEU A 1 173 ? -2.970  -21.061 31.435  1.00 23.97  ? 174 LEU A CD1 1 
ATOM   1340 C CD2 . LEU A 1 173 ? -0.818  -22.302 31.345  1.00 26.40  ? 174 LEU A CD2 1 
ATOM   1341 N N   . ASP A 1 174 ? -3.277  -25.535 35.039  1.00 24.57  ? 175 ASP A N   1 
ATOM   1342 C CA  . ASP A 1 174 ? -3.422  -26.105 36.378  1.00 19.23  ? 175 ASP A CA  1 
ATOM   1343 C C   . ASP A 1 174 ? -2.235  -27.018 36.655  1.00 26.36  ? 175 ASP A C   1 
ATOM   1344 O O   . ASP A 1 174 ? -1.667  -26.985 37.749  1.00 25.22  ? 175 ASP A O   1 
ATOM   1345 C CB  . ASP A 1 174 ? -4.706  -26.923 36.520  1.00 18.11  ? 175 ASP A CB  1 
ATOM   1346 C CG  . ASP A 1 174 ? -5.957  -26.082 36.431  1.00 24.05  ? 175 ASP A CG  1 
ATOM   1347 O OD1 . ASP A 1 174 ? -5.859  -24.842 36.578  1.00 22.04  ? 175 ASP A OD1 1 
ATOM   1348 O OD2 . ASP A 1 174 ? -7.044  -26.672 36.214  1.00 23.53  ? 175 ASP A OD2 1 
ATOM   1349 N N   . GLN A 1 175 ? -1.857  -27.825 35.662  1.00 21.63  ? 176 GLN A N   1 
ATOM   1350 C CA  . GLN A 1 175 ? -0.713  -28.726 35.813  1.00 21.59  ? 176 GLN A CA  1 
ATOM   1351 C C   . GLN A 1 175 ? 0.612   -27.962 35.967  1.00 23.98  ? 176 GLN A C   1 
ATOM   1352 O O   . GLN A 1 175 ? 1.465   -28.320 36.800  1.00 25.19  ? 176 GLN A O   1 
ATOM   1353 C CB  . GLN A 1 175 ? -0.610  -29.683 34.622  1.00 25.77  ? 176 GLN A CB  1 
ATOM   1354 C CG  . GLN A 1 175 ? -1.755  -30.680 34.475  1.00 20.49  ? 176 GLN A CG  1 
ATOM   1355 C CD  . GLN A 1 175 ? -1.713  -31.394 33.129  1.00 23.90  ? 176 GLN A CD  1 
ATOM   1356 O OE1 . GLN A 1 175 ? -0.695  -31.364 32.423  1.00 21.15  ? 176 GLN A OE1 1 
ATOM   1357 N NE2 . GLN A 1 175 ? -2.822  -32.028 32.761  1.00 20.77  ? 176 GLN A NE2 1 
ATOM   1358 N N   . ARG A 1 176 ? 0.780   -26.909 35.168  1.00 21.47  ? 177 ARG A N   1 
ATOM   1359 C CA  . ARG A 1 176 ? 2.002   -26.118 35.208  1.00 22.37  ? 177 ARG A CA  1 
ATOM   1360 C C   . ARG A 1 176 ? 2.157   -25.443 36.556  1.00 24.90  ? 177 ARG A C   1 
ATOM   1361 O O   . ARG A 1 176 ? 3.255   -25.421 37.132  1.00 23.90  ? 177 ARG A O   1 
ATOM   1362 C CB  . ARG A 1 176 ? 2.023   -25.062 34.102  1.00 24.55  ? 177 ARG A CB  1 
ATOM   1363 C CG  . ARG A 1 176 ? 3.244   -24.156 34.186  1.00 28.12  ? 177 ARG A CG  1 
ATOM   1364 C CD  . ARG A 1 176 ? 3.264   -23.126 33.088  1.00 25.82  ? 177 ARG A CD  1 
ATOM   1365 N NE  . ARG A 1 176 ? 3.475   -23.750 31.785  1.00 31.94  ? 177 ARG A NE  1 
ATOM   1366 C CZ  . ARG A 1 176 ? 3.263   -23.132 30.630  1.00 32.92  ? 177 ARG A CZ  1 
ATOM   1367 N NH1 . ARG A 1 176 ? 2.834   -21.874 30.640  1.00 28.06  ? 177 ARG A NH1 1 
ATOM   1368 N NH2 . ARG A 1 176 ? 3.474   -23.765 29.477  1.00 26.36  ? 177 ARG A NH2 1 
ATOM   1369 N N   . LEU A 1 177 ? 1.053   -24.900 37.061  1.00 21.03  ? 178 LEU A N   1 
ATOM   1370 C CA  . LEU A 1 177 ? 1.070   -24.249 38.363  1.00 24.07  ? 178 LEU A CA  1 
ATOM   1371 C C   . LEU A 1 177 ? 1.480   -25.259 39.437  1.00 23.99  ? 178 LEU A C   1 
ATOM   1372 O O   . LEU A 1 177 ? 2.286   -24.939 40.315  1.00 26.85  ? 178 LEU A O   1 
ATOM   1373 C CB  . LEU A 1 177 ? -0.281  -23.593 38.680  1.00 22.34  ? 178 LEU A CB  1 
ATOM   1374 C CG  . LEU A 1 177 ? -0.405  -22.944 40.064  1.00 26.94  ? 178 LEU A CG  1 
ATOM   1375 C CD1 . LEU A 1 177 ? 0.616   -21.827 40.244  1.00 22.05  ? 178 LEU A CD1 1 
ATOM   1376 C CD2 . LEU A 1 177 ? -1.812  -22.424 40.308  1.00 22.20  ? 178 LEU A CD2 1 
ATOM   1377 N N   . ALA A 1 178 ? 0.964   -26.486 39.350  1.00 22.50  ? 179 ALA A N   1 
ATOM   1378 C CA  . ALA A 1 178 ? 1.376   -27.535 40.295  1.00 24.01  ? 179 ALA A CA  1 
ATOM   1379 C C   . ALA A 1 178 ? 2.870   -27.854 40.175  1.00 22.18  ? 179 ALA A C   1 
ATOM   1380 O O   . ALA A 1 178 ? 3.550   -28.065 41.180  1.00 24.04  ? 179 ALA A O   1 
ATOM   1381 C CB  . ALA A 1 178 ? 0.534   -28.806 40.118  1.00 21.42  ? 179 ALA A CB  1 
ATOM   1382 N N   . LEU A 1 179 ? 3.381   -27.889 38.945  1.00 23.96  ? 180 LEU A N   1 
ATOM   1383 C CA  . LEU A 1 179 ? 4.812   -28.114 38.740  1.00 24.42  ? 180 LEU A CA  1 
ATOM   1384 C C   . LEU A 1 179 ? 5.661   -26.967 39.319  1.00 26.59  ? 180 LEU A C   1 
ATOM   1385 O O   . LEU A 1 179 ? 6.717   -27.202 39.907  1.00 28.51  ? 180 LEU A O   1 
ATOM   1386 C CB  . LEU A 1 179 ? 5.124   -28.346 37.262  1.00 24.29  ? 180 LEU A CB  1 
ATOM   1387 C CG  . LEU A 1 179 ? 4.501   -29.602 36.639  1.00 23.58  ? 180 LEU A CG  1 
ATOM   1388 C CD1 . LEU A 1 179 ? 4.891   -29.726 35.171  1.00 23.58  ? 180 LEU A CD1 1 
ATOM   1389 C CD2 . LEU A 1 179 ? 4.905   -30.835 37.404  1.00 24.75  ? 180 LEU A CD2 1 
ATOM   1390 N N   . GLN A 1 180 ? 5.185   -25.735 39.165  1.00 24.40  ? 181 GLN A N   1 
ATOM   1391 C CA  . GLN A 1 180 ? 5.803   -24.588 39.824  1.00 30.04  ? 181 GLN A CA  1 
ATOM   1392 C C   . GLN A 1 180 ? 5.723   -24.715 41.345  1.00 30.06  ? 181 GLN A C   1 
ATOM   1393 O O   . GLN A 1 180 ? 6.678   -24.373 42.052  1.00 29.04  ? 181 GLN A O   1 
ATOM   1394 C CB  . GLN A 1 180 ? 5.151   -23.279 39.372  1.00 25.71  ? 181 GLN A CB  1 
ATOM   1395 C CG  . GLN A 1 180 ? 5.426   -22.947 37.921  1.00 30.87  ? 181 GLN A CG  1 
ATOM   1396 C CD  . GLN A 1 180 ? 4.502   -21.876 37.386  1.00 35.16  ? 181 GLN A CD  1 
ATOM   1397 O OE1 . GLN A 1 180 ? 3.504   -21.532 38.018  1.00 36.01  ? 181 GLN A OE1 1 
ATOM   1398 N NE2 . GLN A 1 180 ? 4.826   -21.343 36.209  1.00 35.85  ? 181 GLN A NE2 1 
ATOM   1399 N N   . TRP A 1 181 ? 4.593   -25.210 41.846  1.00 27.52  ? 182 TRP A N   1 
ATOM   1400 C CA  . TRP A 1 181 ? 4.445   -25.435 43.286  1.00 28.59  ? 182 TRP A CA  1 
ATOM   1401 C C   . TRP A 1 181 ? 5.521   -26.415 43.751  1.00 29.75  ? 182 TRP A C   1 
ATOM   1402 O O   . TRP A 1 181 ? 6.120   -26.243 44.811  1.00 27.53  ? 182 TRP A O   1 
ATOM   1403 C CB  . TRP A 1 181 ? 3.047   -25.971 43.619  1.00 19.63  ? 182 TRP A CB  1 
ATOM   1404 C CG  . TRP A 1 181 ? 2.758   -26.089 45.095  1.00 25.81  ? 182 TRP A CG  1 
ATOM   1405 C CD1 . TRP A 1 181 ? 2.094   -25.179 45.879  1.00 20.03  ? 182 TRP A CD1 1 
ATOM   1406 C CD2 . TRP A 1 181 ? 3.099   -27.185 45.960  1.00 21.26  ? 182 TRP A CD2 1 
ATOM   1407 N NE1 . TRP A 1 181 ? 2.012   -25.639 47.164  1.00 25.43  ? 182 TRP A NE1 1 
ATOM   1408 C CE2 . TRP A 1 181 ? 2.622   -26.864 47.246  1.00 22.71  ? 182 TRP A CE2 1 
ATOM   1409 C CE3 . TRP A 1 181 ? 3.767   -28.401 45.772  1.00 21.88  ? 182 TRP A CE3 1 
ATOM   1410 C CZ2 . TRP A 1 181 ? 2.790   -27.714 48.342  1.00 21.35  ? 182 TRP A CZ2 1 
ATOM   1411 C CZ3 . TRP A 1 181 ? 3.934   -29.244 46.859  1.00 25.21  ? 182 TRP A CZ3 1 
ATOM   1412 C CH2 . TRP A 1 181 ? 3.442   -28.901 48.128  1.00 19.84  ? 182 TRP A CH2 1 
ATOM   1413 N N   . VAL A 1 182 ? 5.772   -27.437 42.938  1.00 30.41  ? 183 VAL A N   1 
ATOM   1414 C CA  . VAL A 1 182 ? 6.763   -28.445 43.289  1.00 28.57  ? 183 VAL A CA  1 
ATOM   1415 C C   . VAL A 1 182 ? 8.161   -27.836 43.366  1.00 30.28  ? 183 VAL A C   1 
ATOM   1416 O O   . VAL A 1 182 ? 8.889   -28.062 44.340  1.00 32.75  ? 183 VAL A O   1 
ATOM   1417 C CB  . VAL A 1 182 ? 6.723   -29.642 42.322  1.00 24.72  ? 183 VAL A CB  1 
ATOM   1418 C CG1 . VAL A 1 182 ? 7.979   -30.489 42.455  1.00 21.77  ? 183 VAL A CG1 1 
ATOM   1419 C CG2 . VAL A 1 182 ? 5.481   -30.480 42.592  1.00 18.01  ? 183 VAL A CG2 1 
ATOM   1420 N N   . GLN A 1 183 ? 8.516   -27.043 42.360  1.00 25.98  ? 184 GLN A N   1 
ATOM   1421 C CA  . GLN A 1 183 ? 9.790   -26.326 42.353  1.00 31.20  ? 184 GLN A CA  1 
ATOM   1422 C C   . GLN A 1 183 ? 10.019  -25.537 43.633  1.00 30.44  ? 184 GLN A C   1 
ATOM   1423 O O   . GLN A 1 183 ? 11.121  -25.552 44.198  1.00 27.22  ? 184 GLN A O   1 
ATOM   1424 C CB  . GLN A 1 183 ? 9.876   -25.389 41.150  1.00 23.87  ? 184 GLN A CB  1 
ATOM   1425 C CG  . GLN A 1 183 ? 10.146  -26.123 39.860  1.00 28.49  ? 184 GLN A CG  1 
ATOM   1426 C CD  . GLN A 1 183 ? 11.394  -26.977 39.954  1.00 34.11  ? 184 GLN A CD  1 
ATOM   1427 O OE1 . GLN A 1 183 ? 12.504  -26.462 40.108  1.00 38.97  ? 184 GLN A OE1 1 
ATOM   1428 N NE2 . GLN A 1 183 ? 11.219  -28.288 39.882  1.00 33.18  ? 184 GLN A NE2 1 
ATOM   1429 N N   . GLU A 1 184 ? 8.967   -24.880 44.102  1.00 25.84  ? 185 GLU A N   1 
ATOM   1430 C CA  . GLU A 1 184 ? 9.074   -23.990 45.251  1.00 30.03  ? 185 GLU A CA  1 
ATOM   1431 C C   . GLU A 1 184 ? 8.917   -24.669 46.611  1.00 38.05  ? 185 GLU A C   1 
ATOM   1432 O O   . GLU A 1 184 ? 9.407   -24.155 47.614  1.00 39.83  ? 185 GLU A O   1 
ATOM   1433 C CB  . GLU A 1 184 ? 8.077   -22.835 45.109  1.00 30.10  ? 185 GLU A CB  1 
ATOM   1434 C CG  . GLU A 1 184 ? 8.438   -21.903 43.949  1.00 40.79  ? 185 GLU A CG  1 
ATOM   1435 C CD  . GLU A 1 184 ? 7.364   -20.881 43.639  1.00 51.06  ? 185 GLU A CD  1 
ATOM   1436 O OE1 . GLU A 1 184 ? 7.330   -20.395 42.485  1.00 48.71  ? 185 GLU A OE1 1 
ATOM   1437 O OE2 . GLU A 1 184 ? 6.560   -20.561 44.544  1.00 55.46  ? 185 GLU A OE2 1 
ATOM   1438 N N   . ASN A 1 185 ? 8.254   -25.823 46.651  1.00 34.64  ? 186 ASN A N   1 
ATOM   1439 C CA  . ASN A 1 185 ? 7.857   -26.392 47.934  1.00 29.15  ? 186 ASN A CA  1 
ATOM   1440 C C   . ASN A 1 185 ? 8.298   -27.821 48.217  1.00 31.70  ? 186 ASN A C   1 
ATOM   1441 O O   . ASN A 1 185 ? 8.195   -28.285 49.356  1.00 36.34  ? 186 ASN A O   1 
ATOM   1442 C CB  . ASN A 1 185 ? 6.341   -26.287 48.106  1.00 24.31  ? 186 ASN A CB  1 
ATOM   1443 C CG  . ASN A 1 185 ? 5.857   -24.855 48.090  1.00 28.03  ? 186 ASN A CG  1 
ATOM   1444 O OD1 . ASN A 1 185 ? 6.114   -24.101 49.020  1.00 34.74  ? 186 ASN A OD1 1 
ATOM   1445 N ND2 . ASN A 1 185 ? 5.152   -24.471 47.031  1.00 31.10  ? 186 ASN A ND2 1 
ATOM   1446 N N   . VAL A 1 186 ? 8.785   -28.530 47.206  1.00 28.96  ? 187 VAL A N   1 
ATOM   1447 C CA  . VAL A 1 186 ? 8.974   -29.964 47.385  1.00 29.16  ? 187 VAL A CA  1 
ATOM   1448 C C   . VAL A 1 186 ? 10.131  -30.274 48.325  1.00 33.47  ? 187 VAL A C   1 
ATOM   1449 O O   . VAL A 1 186 ? 10.126  -31.312 48.997  1.00 32.91  ? 187 VAL A O   1 
ATOM   1450 C CB  . VAL A 1 186 ? 9.082   -30.740 46.038  1.00 32.40  ? 187 VAL A CB  1 
ATOM   1451 C CG1 . VAL A 1 186 ? 10.479  -30.622 45.434  1.00 21.52  ? 187 VAL A CG1 1 
ATOM   1452 C CG2 . VAL A 1 186 ? 8.687   -32.211 46.240  1.00 25.93  ? 187 VAL A CG2 1 
ATOM   1453 N N   . ALA A 1 187 ? 11.101  -29.361 48.394  1.00 33.21  ? 188 ALA A N   1 
ATOM   1454 C CA  . ALA A 1 187 ? 12.245  -29.523 49.291  1.00 34.13  ? 188 ALA A CA  1 
ATOM   1455 C C   . ALA A 1 187 ? 11.784  -29.648 50.741  1.00 32.48  ? 188 ALA A C   1 
ATOM   1456 O O   . ALA A 1 187 ? 12.394  -30.364 51.538  1.00 34.72  ? 188 ALA A O   1 
ATOM   1457 C CB  . ALA A 1 187 ? 13.229  -28.363 49.137  1.00 25.47  ? 188 ALA A CB  1 
ATOM   1458 N N   . ALA A 1 188 ? 10.690  -28.971 51.078  1.00 29.35  ? 189 ALA A N   1 
ATOM   1459 C CA  . ALA A 1 188 ? 10.181  -29.001 52.448  1.00 31.49  ? 189 ALA A CA  1 
ATOM   1460 C C   . ALA A 1 188 ? 9.713   -30.402 52.841  1.00 38.15  ? 189 ALA A C   1 
ATOM   1461 O O   . ALA A 1 188 ? 9.433   -30.658 54.013  1.00 37.07  ? 189 ALA A O   1 
ATOM   1462 C CB  . ALA A 1 188 ? 9.043   -27.995 52.625  1.00 26.13  ? 189 ALA A CB  1 
ATOM   1463 N N   . PHE A 1 189 ? 9.619   -31.298 51.857  1.00 33.91  ? 190 PHE A N   1 
ATOM   1464 C CA  . PHE A 1 189 ? 9.188   -32.668 52.104  1.00 33.23  ? 190 PHE A CA  1 
ATOM   1465 C C   . PHE A 1 189 ? 10.342  -33.653 51.952  1.00 31.56  ? 190 PHE A C   1 
ATOM   1466 O O   . PHE A 1 189 ? 10.177  -34.846 52.184  1.00 37.75  ? 190 PHE A O   1 
ATOM   1467 C CB  . PHE A 1 189 ? 8.053   -33.058 51.150  1.00 30.12  ? 190 PHE A CB  1 
ATOM   1468 C CG  . PHE A 1 189 ? 6.829   -32.188 51.261  1.00 27.60  ? 190 PHE A CG  1 
ATOM   1469 C CD1 . PHE A 1 189 ? 6.756   -30.975 50.590  1.00 27.23  ? 190 PHE A CD1 1 
ATOM   1470 C CD2 . PHE A 1 189 ? 5.741   -32.597 52.011  1.00 25.38  ? 190 PHE A CD2 1 
ATOM   1471 C CE1 . PHE A 1 189 ? 5.632   -30.181 50.678  1.00 23.86  ? 190 PHE A CE1 1 
ATOM   1472 C CE2 . PHE A 1 189 ? 4.606   -31.806 52.100  1.00 26.17  ? 190 PHE A CE2 1 
ATOM   1473 C CZ  . PHE A 1 189 ? 4.554   -30.597 51.434  1.00 23.16  ? 190 PHE A CZ  1 
ATOM   1474 N N   . GLY A 1 190 ? 11.509  -33.150 51.562  1.00 25.12  ? 191 GLY A N   1 
ATOM   1475 C CA  . GLY A 1 190 ? 12.659  -34.002 51.327  1.00 31.32  ? 191 GLY A CA  1 
ATOM   1476 C C   . GLY A 1 190 ? 12.924  -34.229 49.851  1.00 35.18  ? 191 GLY A C   1 
ATOM   1477 O O   . GLY A 1 190 ? 13.851  -34.947 49.475  1.00 36.31  ? 191 GLY A O   1 
ATOM   1478 N N   . GLY A 1 191 ? 12.114  -33.603 49.004  1.00 31.45  ? 192 GLY A N   1 
ATOM   1479 C CA  . GLY A 1 191 ? 12.225  -33.812 47.578  1.00 31.16  ? 192 GLY A CA  1 
ATOM   1480 C C   . GLY A 1 191 ? 13.257  -32.908 46.955  1.00 30.81  ? 192 GLY A C   1 
ATOM   1481 O O   . GLY A 1 191 ? 13.529  -31.826 47.469  1.00 41.84  ? 192 GLY A O   1 
ATOM   1482 N N   . ASP A 1 192 ? 13.822  -33.355 45.840  1.00 29.70  ? 193 ASP A N   1 
ATOM   1483 C CA  . ASP A 1 192 ? 14.846  -32.611 45.120  1.00 30.22  ? 193 ASP A CA  1 
ATOM   1484 C C   . ASP A 1 192 ? 14.242  -31.998 43.858  1.00 35.83  ? 193 ASP A C   1 
ATOM   1485 O O   . ASP A 1 192 ? 14.036  -32.694 42.866  1.00 37.04  ? 193 ASP A O   1 
ATOM   1486 C CB  . ASP A 1 192 ? 16.003  -33.559 44.780  1.00 32.05  ? 193 ASP A CB  1 
ATOM   1487 C CG  . ASP A 1 192 ? 17.044  -32.943 43.858  1.00 31.24  ? 193 ASP A CG  1 
ATOM   1488 O OD1 . ASP A 1 192 ? 16.996  -31.734 43.560  1.00 35.77  ? 193 ASP A OD1 1 
ATOM   1489 O OD2 . ASP A 1 192 ? 17.940  -33.690 43.425  1.00 39.32  ? 193 ASP A OD2 1 
ATOM   1490 N N   . PRO A 1 193 ? 13.979  -30.681 43.888  1.00 40.39  ? 194 PRO A N   1 
ATOM   1491 C CA  . PRO A 1 193 ? 13.401  -29.929 42.760  1.00 28.55  ? 194 PRO A CA  1 
ATOM   1492 C C   . PRO A 1 193 ? 14.256  -29.965 41.494  1.00 36.30  ? 194 PRO A C   1 
ATOM   1493 O O   . PRO A 1 193 ? 13.759  -29.658 40.398  1.00 31.78  ? 194 PRO A O   1 
ATOM   1494 C CB  . PRO A 1 193 ? 13.302  -28.494 43.297  1.00 34.98  ? 194 PRO A CB  1 
ATOM   1495 C CG  . PRO A 1 193 ? 14.241  -28.449 44.485  1.00 31.68  ? 194 PRO A CG  1 
ATOM   1496 C CD  . PRO A 1 193 ? 14.195  -29.830 45.073  1.00 27.86  ? 194 PRO A CD  1 
ATOM   1497 N N   . THR A 1 194 ? 15.522  -30.345 41.642  1.00 38.88  ? 195 THR A N   1 
ATOM   1498 C CA  . THR A 1 194 ? 16.428  -30.470 40.496  1.00 39.65  ? 195 THR A CA  1 
ATOM   1499 C C   . THR A 1 194 ? 16.359  -31.869 39.873  1.00 38.04  ? 195 THR A C   1 
ATOM   1500 O O   . THR A 1 194 ? 17.034  -32.145 38.877  1.00 43.83  ? 195 THR A O   1 
ATOM   1501 C CB  . THR A 1 194 ? 17.900  -30.162 40.888  1.00 42.76  ? 195 THR A CB  1 
ATOM   1502 O OG1 . THR A 1 194 ? 18.397  -31.195 41.755  1.00 40.81  ? 195 THR A OG1 1 
ATOM   1503 C CG2 . THR A 1 194 ? 18.009  -28.810 41.598  1.00 30.20  ? 195 THR A CG2 1 
ATOM   1504 N N   . SER A 1 195 ? 15.549  -32.750 40.458  1.00 31.70  ? 196 SER A N   1 
ATOM   1505 C CA  . SER A 1 195 ? 15.331  -34.083 39.879  1.00 37.92  ? 196 SER A CA  1 
ATOM   1506 C C   . SER A 1 195 ? 13.843  -34.470 39.850  1.00 36.52  ? 196 SER A C   1 
ATOM   1507 O O   . SER A 1 195 ? 13.366  -35.254 40.680  1.00 32.26  ? 196 SER A O   1 
ATOM   1508 C CB  . SER A 1 195 ? 16.130  -35.143 40.634  1.00 34.48  ? 196 SER A CB  1 
ATOM   1509 O OG  . SER A 1 195 ? 15.994  -36.408 40.005  1.00 47.57  ? 196 SER A OG  1 
ATOM   1510 N N   . VAL A 1 196 ? 13.117  -33.915 38.888  1.00 30.36  ? 197 VAL A N   1 
ATOM   1511 C CA  . VAL A 1 196 ? 11.680  -34.125 38.791  1.00 27.23  ? 197 VAL A CA  1 
ATOM   1512 C C   . VAL A 1 196 ? 11.342  -34.880 37.510  1.00 28.07  ? 197 VAL A C   1 
ATOM   1513 O O   . VAL A 1 196 ? 11.629  -34.412 36.407  1.00 25.39  ? 197 VAL A O   1 
ATOM   1514 C CB  . VAL A 1 196 ? 10.918  -32.781 38.817  1.00 28.35  ? 197 VAL A CB  1 
ATOM   1515 C CG1 . VAL A 1 196 ? 9.448   -32.977 38.406  1.00 25.43  ? 197 VAL A CG1 1 
ATOM   1516 C CG2 . VAL A 1 196 ? 11.022  -32.137 40.194  1.00 24.24  ? 197 VAL A CG2 1 
ATOM   1517 N N   . THR A 1 197 ? 10.745  -36.058 37.662  1.00 29.77  ? 198 THR A N   1 
ATOM   1518 C CA  . THR A 1 197 ? 10.326  -36.859 36.513  1.00 26.83  ? 198 THR A CA  1 
ATOM   1519 C C   . THR A 1 197 ? 8.802   -36.861 36.407  1.00 24.98  ? 198 THR A C   1 
ATOM   1520 O O   . THR A 1 197 ? 8.106   -37.212 37.364  1.00 22.26  ? 198 THR A O   1 
ATOM   1521 C CB  . THR A 1 197 ? 10.843  -38.320 36.609  1.00 29.00  ? 198 THR A CB  1 
ATOM   1522 O OG1 . THR A 1 197 ? 12.275  -38.332 36.717  1.00 27.34  ? 198 THR A OG1 1 
ATOM   1523 C CG2 . THR A 1 197 ? 10.430  -39.124 35.381  1.00 22.34  ? 198 THR A CG2 1 
ATOM   1524 N N   . LEU A 1 198 ? 8.288   -36.446 35.249  1.00 23.95  ? 199 LEU A N   1 
ATOM   1525 C CA  . LEU A 1 198 ? 6.853   -36.498 34.977  1.00 21.52  ? 199 LEU A CA  1 
ATOM   1526 C C   . LEU A 1 198 ? 6.470   -37.862 34.417  1.00 27.34  ? 199 LEU A C   1 
ATOM   1527 O O   . LEU A 1 198 ? 7.131   -38.377 33.509  1.00 23.45  ? 199 LEU A O   1 
ATOM   1528 C CB  . LEU A 1 198 ? 6.462   -35.454 33.934  1.00 27.87  ? 199 LEU A CB  1 
ATOM   1529 C CG  . LEU A 1 198 ? 6.779   -33.989 34.185  1.00 24.15  ? 199 LEU A CG  1 
ATOM   1530 C CD1 . LEU A 1 198 ? 6.178   -33.142 33.068  1.00 23.75  ? 199 LEU A CD1 1 
ATOM   1531 C CD2 . LEU A 1 198 ? 6.234   -33.583 35.533  1.00 27.88  ? 199 LEU A CD2 1 
ATOM   1532 N N   . PHE A 1 199 ? 5.403   -38.446 34.953  1.00 21.41  ? 200 PHE A N   1 
ATOM   1533 C CA  . PHE A 1 199 ? 4.821   -39.632 34.339  1.00 22.36  ? 200 PHE A CA  1 
ATOM   1534 C C   . PHE A 1 199 ? 3.306   -39.531 34.310  1.00 22.29  ? 200 PHE A C   1 
ATOM   1535 O O   . PHE A 1 199 ? 2.690   -38.943 35.203  1.00 21.52  ? 200 PHE A O   1 
ATOM   1536 C CB  . PHE A 1 199 ? 5.344   -40.970 34.926  1.00 19.85  ? 200 PHE A CB  1 
ATOM   1537 C CG  . PHE A 1 199 ? 4.913   -41.279 36.359  1.00 22.87  ? 200 PHE A CG  1 
ATOM   1538 C CD1 . PHE A 1 199 ? 4.960   -40.319 37.362  1.00 21.29  ? 200 PHE A CD1 1 
ATOM   1539 C CD2 . PHE A 1 199 ? 4.522   -42.572 36.698  1.00 20.88  ? 200 PHE A CD2 1 
ATOM   1540 C CE1 . PHE A 1 199 ? 4.596   -40.635 38.674  1.00 23.94  ? 200 PHE A CE1 1 
ATOM   1541 C CE2 . PHE A 1 199 ? 4.161   -42.896 37.999  1.00 26.67  ? 200 PHE A CE2 1 
ATOM   1542 C CZ  . PHE A 1 199 ? 4.196   -41.919 38.995  1.00 24.32  ? 200 PHE A CZ  1 
ATOM   1543 N N   . GLY A 1 200 ? 2.717   -40.074 33.254  1.00 18.09  ? 201 GLY A N   1 
ATOM   1544 C CA  . GLY A 1 200 ? 1.294   -39.931 33.037  1.00 18.76  ? 201 GLY A CA  1 
ATOM   1545 C C   . GLY A 1 200 ? 0.840   -40.993 32.067  1.00 22.17  ? 201 GLY A C   1 
ATOM   1546 O O   . GLY A 1 200 ? 1.650   -41.569 31.344  1.00 19.77  ? 201 GLY A O   1 
ATOM   1547 N N   . GLU A 1 201 ? -0.460  -41.263 32.059  1.00 23.99  ? 202 GLU A N   1 
ATOM   1548 C CA  . GLU A 1 201 ? -1.006  -42.292 31.192  1.00 21.05  ? 202 GLU A CA  1 
ATOM   1549 C C   . GLU A 1 201 ? -2.154  -41.708 30.386  1.00 21.75  ? 202 GLU A C   1 
ATOM   1550 O O   . GLU A 1 201 ? -2.861  -40.819 30.867  1.00 20.07  ? 202 GLU A O   1 
ATOM   1551 C CB  . GLU A 1 201 ? -1.439  -43.509 32.013  1.00 21.86  ? 202 GLU A CB  1 
ATOM   1552 C CG  . GLU A 1 201 ? -1.869  -44.715 31.196  1.00 20.21  ? 202 GLU A CG  1 
ATOM   1553 C CD  . GLU A 1 201 ? -3.337  -44.662 30.840  1.00 22.32  ? 202 GLU A CD  1 
ATOM   1554 O OE1 . GLU A 1 201 ? -4.014  -43.731 31.319  1.00 21.71  ? 202 GLU A OE1 1 
ATOM   1555 O OE2 . GLU A 1 201 ? -3.809  -45.533 30.073  1.00 22.82  ? 202 GLU A OE2 1 
ATOM   1556 N N   . SER A 1 202 ? -2.317  -42.208 29.160  1.00 22.58  ? 203 SER A N   1 
ATOM   1557 C CA  . SER A 1 202 ? -3.281  -41.676 28.192  1.00 21.40  ? 203 SER A CA  1 
ATOM   1558 C C   . SER A 1 202 ? -3.263  -40.140 28.139  1.00 19.08  ? 203 SER A C   1 
ATOM   1559 O O   . SER A 1 202 ? -2.223  -39.555 27.830  1.00 20.56  ? 203 SER A O   1 
ATOM   1560 C CB  . SER A 1 202 ? -4.691  -42.256 28.395  1.00 21.10  ? 203 SER A CB  1 
ATOM   1561 O OG  . SER A 1 202 ? -5.337  -41.735 29.543  1.00 34.01  ? 203 SER A OG  1 
ATOM   1562 N N   . ALA A 1 203 ? -4.380  -39.482 28.438  1.00 15.74  ? 204 ALA A N   1 
ATOM   1563 C CA  . ALA A 1 203 ? -4.387  -38.013 28.414  1.00 19.38  ? 204 ALA A CA  1 
ATOM   1564 C C   . ALA A 1 203 ? -3.310  -37.401 29.332  1.00 23.32  ? 204 ALA A C   1 
ATOM   1565 O O   . ALA A 1 203 ? -2.815  -36.298 29.071  1.00 21.56  ? 204 ALA A O   1 
ATOM   1566 C CB  . ALA A 1 203 ? -5.772  -37.456 28.740  1.00 18.12  ? 204 ALA A CB  1 
ATOM   1567 N N   . GLY A 1 204 ? -2.942  -38.133 30.388  1.00 18.85  ? 205 GLY A N   1 
ATOM   1568 C CA  . GLY A 1 204 ? -1.814  -37.768 31.224  1.00 17.67  ? 205 GLY A CA  1 
ATOM   1569 C C   . GLY A 1 204 ? -0.475  -37.816 30.495  1.00 20.64  ? 205 GLY A C   1 
ATOM   1570 O O   . GLY A 1 204 ? 0.366   -36.933 30.661  1.00 20.49  ? 205 GLY A O   1 
ATOM   1571 N N   . ALA A 1 205 ? -0.275  -38.866 29.704  1.00 20.64  ? 206 ALA A N   1 
ATOM   1572 C CA  . ALA A 1 205 ? 0.900   -38.992 28.854  1.00 24.30  ? 206 ALA A CA  1 
ATOM   1573 C C   . ALA A 1 205 ? 0.931   -37.856 27.828  1.00 23.06  ? 206 ALA A C   1 
ATOM   1574 O O   . ALA A 1 205 ? 1.968   -37.248 27.594  1.00 24.65  ? 206 ALA A O   1 
ATOM   1575 C CB  . ALA A 1 205 ? 0.912   -40.366 28.150  1.00 18.92  ? 206 ALA A CB  1 
ATOM   1576 N N   . ALA A 1 206 ? -0.220  -37.563 27.238  1.00 23.17  ? 207 ALA A N   1 
ATOM   1577 C CA  . ALA A 1 206 ? -0.316  -36.500 26.248  1.00 25.42  ? 207 ALA A CA  1 
ATOM   1578 C C   . ALA A 1 206 ? 0.049   -35.176 26.898  1.00 25.87  ? 207 ALA A C   1 
ATOM   1579 O O   . ALA A 1 206 ? 0.704   -34.327 26.281  1.00 26.50  ? 207 ALA A O   1 
ATOM   1580 C CB  . ALA A 1 206 ? -1.732  -36.442 25.653  1.00 19.41  ? 207 ALA A CB  1 
ATOM   1581 N N   . SER A 1 207 ? -0.375  -35.020 28.151  1.00 23.04  ? 208 SER A N   1 
ATOM   1582 C CA  . SER A 1 207 ? -0.065  -33.838 28.945  1.00 20.93  ? 208 SER A CA  1 
ATOM   1583 C C   . SER A 1 207 ? 1.435   -33.692 29.162  1.00 24.54  ? 208 SER A C   1 
ATOM   1584 O O   . SER A 1 207 ? 1.991   -32.612 28.944  1.00 22.45  ? 208 SER A O   1 
ATOM   1585 C CB  . SER A 1 207 ? -0.779  -33.896 30.301  1.00 20.63  ? 208 SER A CB  1 
ATOM   1586 O OG  . SER A 1 207 ? -2.160  -33.591 30.172  1.00 22.78  ? 208 SER A OG  1 
ATOM   1587 N N   . VAL A 1 208 ? 2.077   -34.771 29.617  1.00 23.12  ? 209 VAL A N   1 
ATOM   1588 C CA  . VAL A 1 208 ? 3.531   -34.801 29.755  1.00 18.91  ? 209 VAL A CA  1 
ATOM   1589 C C   . VAL A 1 208 ? 4.188   -34.315 28.465  1.00 21.45  ? 209 VAL A C   1 
ATOM   1590 O O   . VAL A 1 208 ? 5.019   -33.409 28.488  1.00 24.76  ? 209 VAL A O   1 
ATOM   1591 C CB  . VAL A 1 208 ? 4.052   -36.218 30.081  1.00 19.87  ? 209 VAL A CB  1 
ATOM   1592 C CG1 . VAL A 1 208 ? 5.556   -36.276 29.927  1.00 19.06  ? 209 VAL A CG1 1 
ATOM   1593 C CG2 . VAL A 1 208 ? 3.633   -36.659 31.495  1.00 19.18  ? 209 VAL A CG2 1 
ATOM   1594 N N   . GLY A 1 209 ? 3.785   -34.899 27.340  1.00 20.80  ? 210 GLY A N   1 
ATOM   1595 C CA  . GLY A 1 209 ? 4.320   -34.518 26.045  1.00 22.46  ? 210 GLY A CA  1 
ATOM   1596 C C   . GLY A 1 209 ? 4.125   -33.043 25.729  1.00 25.68  ? 210 GLY A C   1 
ATOM   1597 O O   . GLY A 1 209 ? 4.988   -32.402 25.130  1.00 26.72  ? 210 GLY A O   1 
ATOM   1598 N N   . MET A 1 210 ? 2.989   -32.494 26.138  1.00 25.06  ? 211 MET A N   1 
ATOM   1599 C CA  . MET A 1 210 ? 2.700   -31.097 25.851  1.00 22.88  ? 211 MET A CA  1 
ATOM   1600 C C   . MET A 1 210 ? 3.578   -30.177 26.665  1.00 25.46  ? 211 MET A C   1 
ATOM   1601 O O   . MET A 1 210 ? 4.002   -29.127 26.174  1.00 23.84  ? 211 MET A O   1 
ATOM   1602 C CB  . MET A 1 210 ? 1.219   -30.785 26.061  1.00 25.67  ? 211 MET A CB  1 
ATOM   1603 C CG  . MET A 1 210 ? 0.393   -31.141 24.831  1.00 29.35  ? 211 MET A CG  1 
ATOM   1604 S SD  . MET A 1 210 ? -1.360  -31.087 25.155  1.00 36.97  ? 211 MET A SD  1 
ATOM   1605 C CE  . MET A 1 210 ? -1.944  -32.463 24.149  1.00 23.81  ? 211 MET A CE  1 
ATOM   1606 N N   . HIS A 1 211 ? 3.861   -30.577 27.902  1.00 21.18  ? 212 HIS A N   1 
ATOM   1607 C CA  . HIS A 1 211 ? 4.811   -29.850 28.730  1.00 24.51  ? 212 HIS A CA  1 
ATOM   1608 C C   . HIS A 1 211 ? 6.221   -29.879 28.125  1.00 27.22  ? 212 HIS A C   1 
ATOM   1609 O O   . HIS A 1 211 ? 6.968   -28.917 28.270  1.00 25.11  ? 212 HIS A O   1 
ATOM   1610 C CB  . HIS A 1 211 ? 4.817   -30.380 30.169  1.00 20.21  ? 212 HIS A CB  1 
ATOM   1611 C CG  . HIS A 1 211 ? 3.569   -30.052 30.928  1.00 26.06  ? 212 HIS A CG  1 
ATOM   1612 N ND1 . HIS A 1 211 ? 3.224   -28.762 31.266  1.00 23.58  ? 212 HIS A ND1 1 
ATOM   1613 C CD2 . HIS A 1 211 ? 2.579   -30.845 31.404  1.00 23.66  ? 212 HIS A CD2 1 
ATOM   1614 C CE1 . HIS A 1 211 ? 2.074   -28.772 31.917  1.00 23.73  ? 212 HIS A CE1 1 
ATOM   1615 N NE2 . HIS A 1 211 ? 1.663   -30.024 32.017  1.00 24.95  ? 212 HIS A NE2 1 
ATOM   1616 N N   . LEU A 1 212 ? 6.573   -30.978 27.453  1.00 20.63  ? 213 LEU A N   1 
ATOM   1617 C CA  . LEU A 1 212 ? 7.838   -31.070 26.731  1.00 28.26  ? 213 LEU A CA  1 
ATOM   1618 C C   . LEU A 1 212 ? 7.926   -30.039 25.611  1.00 32.08  ? 213 LEU A C   1 
ATOM   1619 O O   . LEU A 1 212 ? 9.008   -29.540 25.305  1.00 29.91  ? 213 LEU A O   1 
ATOM   1620 C CB  . LEU A 1 212 ? 8.008   -32.454 26.104  1.00 26.59  ? 213 LEU A CB  1 
ATOM   1621 C CG  . LEU A 1 212 ? 8.497   -33.568 27.015  1.00 28.06  ? 213 LEU A CG  1 
ATOM   1622 C CD1 . LEU A 1 212 ? 8.501   -34.869 26.245  1.00 27.31  ? 213 LEU A CD1 1 
ATOM   1623 C CD2 . LEU A 1 212 ? 9.879   -33.238 27.537  1.00 33.82  ? 213 LEU A CD2 1 
ATOM   1624 N N   . LEU A 1 213 ? 6.787   -29.730 24.998  1.00 25.69  ? 214 LEU A N   1 
ATOM   1625 C CA  . LEU A 1 213 ? 6.775   -28.911 23.786  1.00 25.95  ? 214 LEU A CA  1 
ATOM   1626 C C   . LEU A 1 213 ? 6.418   -27.464 24.083  1.00 27.71  ? 214 LEU A C   1 
ATOM   1627 O O   . LEU A 1 213 ? 6.328   -26.640 23.175  1.00 30.83  ? 214 LEU A O   1 
ATOM   1628 C CB  . LEU A 1 213 ? 5.801   -29.499 22.766  1.00 20.80  ? 214 LEU A CB  1 
ATOM   1629 C CG  . LEU A 1 213 ? 6.011   -30.992 22.510  1.00 29.24  ? 214 LEU A CG  1 
ATOM   1630 C CD1 . LEU A 1 213 ? 4.891   -31.569 21.665  1.00 27.64  ? 214 LEU A CD1 1 
ATOM   1631 C CD2 . LEU A 1 213 ? 7.371   -31.244 21.858  1.00 31.70  ? 214 LEU A CD2 1 
ATOM   1632 N N   . SER A 1 214 ? 6.209   -27.157 25.360  1.00 26.20  ? 215 SER A N   1 
ATOM   1633 C CA  . SER A 1 214 ? 5.897   -25.793 25.765  1.00 28.91  ? 215 SER A CA  1 
ATOM   1634 C C   . SER A 1 214 ? 7.016   -25.256 26.648  1.00 24.75  ? 215 SER A C   1 
ATOM   1635 O O   . SER A 1 214 ? 7.187   -25.721 27.767  1.00 33.26  ? 215 SER A O   1 
ATOM   1636 C CB  . SER A 1 214 ? 4.561   -25.756 26.506  1.00 27.70  ? 215 SER A CB  1 
ATOM   1637 O OG  . SER A 1 214 ? 4.174   -24.428 26.796  1.00 28.17  ? 215 SER A OG  1 
ATOM   1638 N N   . PRO A 1 215 ? 7.794   -24.282 26.141  1.00 32.91  ? 216 PRO A N   1 
ATOM   1639 C CA  . PRO A 1 215 ? 8.973   -23.768 26.867  1.00 29.19  ? 216 PRO A CA  1 
ATOM   1640 C C   . PRO A 1 215 ? 8.752   -23.309 28.323  1.00 27.95  ? 216 PRO A C   1 
ATOM   1641 O O   . PRO A 1 215 ? 9.626   -23.571 29.147  1.00 31.79  ? 216 PRO A O   1 
ATOM   1642 C CB  . PRO A 1 215 ? 9.465   -22.615 25.977  1.00 30.22  ? 216 PRO A CB  1 
ATOM   1643 C CG  . PRO A 1 215 ? 8.999   -23.011 24.574  1.00 29.81  ? 216 PRO A CG  1 
ATOM   1644 C CD  . PRO A 1 215 ? 7.665   -23.687 24.792  1.00 30.86  ? 216 PRO A CD  1 
ATOM   1645 N N   . PRO A 1 216 ? 7.624   -22.644 28.648  1.00 28.03  ? 217 PRO A N   1 
ATOM   1646 C CA  . PRO A 1 216 ? 7.472   -22.285 30.073  1.00 24.13  ? 217 PRO A CA  1 
ATOM   1647 C C   . PRO A 1 216 ? 7.367   -23.474 31.040  1.00 28.02  ? 217 PRO A C   1 
ATOM   1648 O O   . PRO A 1 216 ? 7.576   -23.284 32.237  1.00 32.27  ? 217 PRO A O   1 
ATOM   1649 C CB  . PRO A 1 216 ? 6.171   -21.479 30.097  1.00 22.50  ? 217 PRO A CB  1 
ATOM   1650 C CG  . PRO A 1 216 ? 6.063   -20.899 28.709  1.00 26.89  ? 217 PRO A CG  1 
ATOM   1651 C CD  . PRO A 1 216 ? 6.621   -21.971 27.798  1.00 25.03  ? 217 PRO A CD  1 
ATOM   1652 N N   . SER A 1 217 ? 7.035   -24.663 30.542  1.00 26.88  ? 218 SER A N   1 
ATOM   1653 C CA  . SER A 1 217 ? 6.979   -25.860 31.384  1.00 32.13  ? 218 SER A CA  1 
ATOM   1654 C C   . SER A 1 217 ? 8.309   -26.586 31.418  1.00 30.74  ? 218 SER A C   1 
ATOM   1655 O O   . SER A 1 217 ? 8.635   -27.243 32.398  1.00 31.85  ? 218 SER A O   1 
ATOM   1656 C CB  . SER A 1 217 ? 5.914   -26.843 30.890  1.00 28.56  ? 218 SER A CB  1 
ATOM   1657 O OG  . SER A 1 217 ? 4.613   -26.300 30.992  1.00 30.46  ? 218 SER A OG  1 
ATOM   1658 N N   . ARG A 1 218 ? 9.067   -26.462 30.337  1.00 34.04  ? 219 ARG A N   1 
ATOM   1659 C CA  . ARG A 1 218 ? 10.268  -27.261 30.126  1.00 38.21  ? 219 ARG A CA  1 
ATOM   1660 C C   . ARG A 1 218 ? 11.298  -27.079 31.253  1.00 35.64  ? 219 ARG A C   1 
ATOM   1661 O O   . ARG A 1 218 ? 12.076  -27.987 31.552  1.00 36.49  ? 219 ARG A O   1 
ATOM   1662 C CB  . ARG A 1 218 ? 10.849  -26.973 28.728  1.00 42.02  ? 219 ARG A CB  1 
ATOM   1663 C CG  . ARG A 1 218 ? 11.927  -27.940 28.247  1.00 49.52  ? 219 ARG A CG  1 
ATOM   1664 C CD  . ARG A 1 218 ? 11.431  -29.371 28.107  1.00 45.99  ? 219 ARG A CD  1 
ATOM   1665 N NE  . ARG A 1 218 ? 12.547  -30.316 27.990  1.00 57.13  ? 219 ARG A NE  1 
ATOM   1666 C CZ  . ARG A 1 218 ? 13.133  -30.939 29.019  1.00 58.51  ? 219 ARG A CZ  1 
ATOM   1667 N NH1 . ARG A 1 218 ? 12.722  -30.741 30.277  1.00 37.69  ? 219 ARG A NH1 1 
ATOM   1668 N NH2 . ARG A 1 218 ? 14.140  -31.775 28.790  1.00 50.40  ? 219 ARG A NH2 1 
ATOM   1669 N N   . GLY A 1 219 ? 11.266  -25.931 31.917  1.00 36.05  ? 220 GLY A N   1 
ATOM   1670 C CA  . GLY A 1 219 ? 12.149  -25.706 33.049  1.00 24.05  ? 220 GLY A CA  1 
ATOM   1671 C C   . GLY A 1 219 ? 11.633  -26.209 34.383  1.00 34.44  ? 220 GLY A C   1 
ATOM   1672 O O   . GLY A 1 219 ? 12.254  -25.963 35.417  1.00 40.09  ? 220 GLY A O   1 
ATOM   1673 N N   . LEU A 1 220 ? 10.507  -26.918 34.374  1.00 30.35  ? 221 LEU A N   1 
ATOM   1674 C CA  . LEU A 1 220 ? 9.896   -27.385 35.616  1.00 27.02  ? 221 LEU A CA  1 
ATOM   1675 C C   . LEU A 1 220 ? 10.130  -28.865 35.894  1.00 32.58  ? 221 LEU A C   1 
ATOM   1676 O O   . LEU A 1 220 ? 9.657   -29.396 36.902  1.00 35.22  ? 221 LEU A O   1 
ATOM   1677 C CB  . LEU A 1 220 ? 8.399   -27.095 35.613  1.00 26.15  ? 221 LEU A CB  1 
ATOM   1678 C CG  . LEU A 1 220 ? 8.101   -25.615 35.399  1.00 29.41  ? 221 LEU A CG  1 
ATOM   1679 C CD1 . LEU A 1 220 ? 6.598   -25.378 35.348  1.00 26.24  ? 221 LEU A CD1 1 
ATOM   1680 C CD2 . LEU A 1 220 ? 8.761   -24.796 36.511  1.00 27.01  ? 221 LEU A CD2 1 
ATOM   1681 N N   . PHE A 1 221 ? 10.860  -29.532 35.007  1.00 27.81  ? 222 PHE A N   1 
ATOM   1682 C CA  . PHE A 1 221 ? 11.101  -30.959 35.170  1.00 30.04  ? 222 PHE A CA  1 
ATOM   1683 C C   . PHE A 1 221 ? 12.283  -31.395 34.313  1.00 30.60  ? 222 PHE A C   1 
ATOM   1684 O O   . PHE A 1 221 ? 12.796  -30.618 33.511  1.00 32.94  ? 222 PHE A O   1 
ATOM   1685 C CB  . PHE A 1 221 ? 9.841   -31.771 34.834  1.00 27.84  ? 222 PHE A CB  1 
ATOM   1686 C CG  . PHE A 1 221 ? 9.457   -31.735 33.374  1.00 28.10  ? 222 PHE A CG  1 
ATOM   1687 C CD1 . PHE A 1 221 ? 8.780   -30.647 32.845  1.00 28.25  ? 222 PHE A CD1 1 
ATOM   1688 C CD2 . PHE A 1 221 ? 9.776   -32.794 32.533  1.00 24.84  ? 222 PHE A CD2 1 
ATOM   1689 C CE1 . PHE A 1 221 ? 8.419   -30.616 31.494  1.00 30.36  ? 222 PHE A CE1 1 
ATOM   1690 C CE2 . PHE A 1 221 ? 9.426   -32.771 31.191  1.00 29.01  ? 222 PHE A CE2 1 
ATOM   1691 C CZ  . PHE A 1 221 ? 8.742   -31.677 30.670  1.00 27.17  ? 222 PHE A CZ  1 
ATOM   1692 N N   . HIS A 1 222 ? 12.700  -32.645 34.473  1.00 28.47  ? 223 HIS A N   1 
ATOM   1693 C CA  . HIS A 1 222 ? 13.957  -33.090 33.894  1.00 31.69  ? 223 HIS A CA  1 
ATOM   1694 C C   . HIS A 1 222 ? 13.828  -34.330 33.010  1.00 29.60  ? 223 HIS A C   1 
ATOM   1695 O O   . HIS A 1 222 ? 14.529  -34.454 32.007  1.00 37.05  ? 223 HIS A O   1 
ATOM   1696 C CB  . HIS A 1 222 ? 14.990  -33.259 35.016  1.00 29.79  ? 223 HIS A CB  1 
ATOM   1697 C CG  . HIS A 1 222 ? 15.061  -32.062 35.912  1.00 45.46  ? 223 HIS A CG  1 
ATOM   1698 N ND1 . HIS A 1 222 ? 14.280  -31.930 37.044  1.00 40.67  ? 223 HIS A ND1 1 
ATOM   1699 C CD2 . HIS A 1 222 ? 15.750  -30.900 35.793  1.00 35.56  ? 223 HIS A CD2 1 
ATOM   1700 C CE1 . HIS A 1 222 ? 14.513  -30.755 37.601  1.00 40.14  ? 223 HIS A CE1 1 
ATOM   1701 N NE2 . HIS A 1 222 ? 15.405  -30.113 36.864  1.00 43.12  ? 223 HIS A NE2 1 
ATOM   1702 N N   . ARG A 1 223 ? 12.926  -35.236 33.370  1.00 29.77  ? 224 ARG A N   1 
ATOM   1703 C CA  . ARG A 1 223 ? 12.688  -36.435 32.566  1.00 27.23  ? 224 ARG A CA  1 
ATOM   1704 C C   . ARG A 1 223 ? 11.204  -36.674 32.383  1.00 24.10  ? 224 ARG A C   1 
ATOM   1705 O O   . ARG A 1 223 ? 10.386  -36.159 33.145  1.00 26.13  ? 224 ARG A O   1 
ATOM   1706 C CB  . ARG A 1 223 ? 13.308  -37.660 33.223  1.00 30.12  ? 224 ARG A CB  1 
ATOM   1707 C CG  . ARG A 1 223 ? 14.802  -37.650 33.246  1.00 33.12  ? 224 ARG A CG  1 
ATOM   1708 C CD  . ARG A 1 223 ? 15.323  -38.643 34.271  1.00 36.19  ? 224 ARG A CD  1 
ATOM   1709 N NE  . ARG A 1 223 ? 16.742  -38.419 34.531  1.00 51.26  ? 224 ARG A NE  1 
ATOM   1710 C CZ  . ARG A 1 223 ? 17.205  -37.529 35.404  1.00 55.21  ? 224 ARG A CZ  1 
ATOM   1711 N NH1 . ARG A 1 223 ? 16.359  -36.777 36.111  1.00 47.85  ? 224 ARG A NH1 1 
ATOM   1712 N NH2 . ARG A 1 223 ? 18.517  -37.392 35.571  1.00 63.45  ? 224 ARG A NH2 1 
ATOM   1713 N N   . ALA A 1 224 ? 10.865  -37.482 31.387  1.00 25.41  ? 225 ALA A N   1 
ATOM   1714 C CA  . ALA A 1 224 ? 9.473   -37.697 31.033  1.00 24.82  ? 225 ALA A CA  1 
ATOM   1715 C C   . ALA A 1 224 ? 9.137   -39.168 30.781  1.00 24.15  ? 225 ALA A C   1 
ATOM   1716 O O   . ALA A 1 224 ? 9.933   -39.910 30.205  1.00 25.74  ? 225 ALA A O   1 
ATOM   1717 C CB  . ALA A 1 224 ? 9.111   -36.853 29.823  1.00 21.94  ? 225 ALA A CB  1 
ATOM   1718 N N   . VAL A 1 225 ? 7.951   -39.577 31.223  1.00 23.69  ? 226 VAL A N   1 
ATOM   1719 C CA  . VAL A 1 225 ? 7.438   -40.913 30.963  1.00 21.01  ? 226 VAL A CA  1 
ATOM   1720 C C   . VAL A 1 225 ? 6.061   -40.776 30.347  1.00 25.43  ? 226 VAL A C   1 
ATOM   1721 O O   . VAL A 1 225 ? 5.182   -40.152 30.945  1.00 24.61  ? 226 VAL A O   1 
ATOM   1722 C CB  . VAL A 1 225 ? 7.295   -41.740 32.259  1.00 21.84  ? 226 VAL A CB  1 
ATOM   1723 C CG1 . VAL A 1 225 ? 6.736   -43.133 31.955  1.00 17.34  ? 226 VAL A CG1 1 
ATOM   1724 C CG2 . VAL A 1 225 ? 8.623   -41.829 32.998  1.00 21.56  ? 226 VAL A CG2 1 
ATOM   1725 N N   . LEU A 1 226 ? 5.876   -41.356 29.160  1.00 18.91  ? 227 LEU A N   1 
ATOM   1726 C CA  . LEU A 1 226 ? 4.595   -41.301 28.471  1.00 20.51  ? 227 LEU A CA  1 
ATOM   1727 C C   . LEU A 1 226 ? 4.004   -42.692 28.289  1.00 24.42  ? 227 LEU A C   1 
ATOM   1728 O O   . LEU A 1 226 ? 4.478   -43.478 27.456  1.00 26.58  ? 227 LEU A O   1 
ATOM   1729 C CB  . LEU A 1 226 ? 4.737   -40.620 27.112  1.00 21.42  ? 227 LEU A CB  1 
ATOM   1730 C CG  . LEU A 1 226 ? 4.964   -39.112 27.120  1.00 23.98  ? 227 LEU A CG  1 
ATOM   1731 C CD1 . LEU A 1 226 ? 6.417   -38.782 27.344  1.00 23.66  ? 227 LEU A CD1 1 
ATOM   1732 C CD2 . LEU A 1 226 ? 4.465   -38.510 25.816  1.00 27.24  ? 227 LEU A CD2 1 
ATOM   1733 N N   . GLN A 1 227 ? 2.962   -42.990 29.059  1.00 22.02  ? 228 GLN A N   1 
ATOM   1734 C CA  . GLN A 1 227 ? 2.325   -44.304 29.021  1.00 23.82  ? 228 GLN A CA  1 
ATOM   1735 C C   . GLN A 1 227 ? 1.033   -44.258 28.198  1.00 23.00  ? 228 GLN A C   1 
ATOM   1736 O O   . GLN A 1 227 ? 0.072   -43.573 28.579  1.00 19.83  ? 228 GLN A O   1 
ATOM   1737 C CB  . GLN A 1 227 ? 2.021   -44.791 30.451  1.00 19.01  ? 228 GLN A CB  1 
ATOM   1738 C CG  . GLN A 1 227 ? 3.251   -44.841 31.361  1.00 20.54  ? 228 GLN A CG  1 
ATOM   1739 C CD  . GLN A 1 227 ? 2.925   -45.164 32.813  1.00 23.77  ? 228 GLN A CD  1 
ATOM   1740 O OE1 . GLN A 1 227 ? 3.687   -44.821 33.719  1.00 26.24  ? 228 GLN A OE1 1 
ATOM   1741 N NE2 . GLN A 1 227 ? 1.798   -45.828 33.042  1.00 20.98  ? 228 GLN A NE2 1 
ATOM   1742 N N   . SER A 1 228 ? 1.015   -44.987 27.079  1.00 22.61  ? 229 SER A N   1 
ATOM   1743 C CA  . SER A 1 228 ? -0.201  -45.156 26.266  1.00 19.15  ? 229 SER A CA  1 
ATOM   1744 C C   . SER A 1 228 ? -0.809  -43.825 25.850  1.00 18.53  ? 229 SER A C   1 
ATOM   1745 O O   . SER A 1 228 ? -2.021  -43.637 25.922  1.00 23.59  ? 229 SER A O   1 
ATOM   1746 C CB  . SER A 1 228 ? -1.261  -45.974 27.021  1.00 17.97  ? 229 SER A CB  1 
ATOM   1747 O OG  . SER A 1 228 ? -0.832  -47.306 27.249  1.00 19.68  ? 229 SER A OG  1 
ATOM   1748 N N   . GLY A 1 229 ? 0.027   -42.885 25.440  1.00 15.93  ? 230 GLY A N   1 
ATOM   1749 C CA  . GLY A 1 229 ? -0.495  -41.587 25.064  1.00 20.78  ? 230 GLY A CA  1 
ATOM   1750 C C   . GLY A 1 229 ? 0.601   -40.679 24.566  1.00 23.83  ? 230 GLY A C   1 
ATOM   1751 O O   . GLY A 1 229 ? 1.770   -40.873 24.894  1.00 22.17  ? 230 GLY A O   1 
ATOM   1752 N N   . ALA A 1 230 ? 0.217   -39.697 23.761  1.00 17.39  ? 231 ALA A N   1 
ATOM   1753 C CA  . ALA A 1 230 ? 1.165   -38.792 23.153  1.00 24.73  ? 231 ALA A CA  1 
ATOM   1754 C C   . ALA A 1 230 ? 0.425   -37.520 22.770  1.00 23.26  ? 231 ALA A C   1 
ATOM   1755 O O   . ALA A 1 230 ? -0.754  -37.568 22.447  1.00 24.81  ? 231 ALA A O   1 
ATOM   1756 C CB  . ALA A 1 230 ? 1.814   -39.450 21.931  1.00 20.06  ? 231 ALA A CB  1 
ATOM   1757 N N   . PRO A 1 231 ? 1.113   -36.374 22.820  1.00 22.85  ? 232 PRO A N   1 
ATOM   1758 C CA  . PRO A 1 231 ? 0.480   -35.093 22.486  1.00 22.54  ? 232 PRO A CA  1 
ATOM   1759 C C   . PRO A 1 231 ? 0.042   -35.016 21.026  1.00 26.55  ? 232 PRO A C   1 
ATOM   1760 O O   . PRO A 1 231 ? -0.850  -34.222 20.695  1.00 26.09  ? 232 PRO A O   1 
ATOM   1761 C CB  . PRO A 1 231 ? 1.587   -34.060 22.777  1.00 23.04  ? 232 PRO A CB  1 
ATOM   1762 C CG  . PRO A 1 231 ? 2.876   -34.842 22.740  1.00 19.68  ? 232 PRO A CG  1 
ATOM   1763 C CD  . PRO A 1 231 ? 2.522   -36.218 23.226  1.00 20.79  ? 232 PRO A CD  1 
ATOM   1764 N N   . ASN A 1 232 ? 0.661   -35.825 20.169  1.00 27.72  ? 233 ASN A N   1 
ATOM   1765 C CA  . ASN A 1 232 ? 0.337   -35.831 18.744  1.00 27.94  ? 233 ASN A CA  1 
ATOM   1766 C C   . ASN A 1 232 ? -0.800  -36.793 18.391  1.00 29.49  ? 233 ASN A C   1 
ATOM   1767 O O   . ASN A 1 232 ? -1.177  -36.928 17.223  1.00 28.32  ? 233 ASN A O   1 
ATOM   1768 C CB  . ASN A 1 232 ? 1.580   -36.127 17.893  1.00 23.40  ? 233 ASN A CB  1 
ATOM   1769 C CG  . ASN A 1 232 ? 2.361   -37.329 18.392  1.00 22.31  ? 233 ASN A CG  1 
ATOM   1770 O OD1 . ASN A 1 232 ? 2.768   -37.370 19.547  1.00 27.33  ? 233 ASN A OD1 1 
ATOM   1771 N ND2 . ASN A 1 232 ? 2.548   -38.324 17.533  1.00 21.42  ? 233 ASN A ND2 1 
ATOM   1772 N N   . GLY A 1 233 ? -1.363  -37.457 19.395  1.00 24.31  ? 234 GLY A N   1 
ATOM   1773 C CA  . GLY A 1 233 ? -2.566  -38.250 19.154  1.00 39.31  ? 234 GLY A CA  1 
ATOM   1774 C C   . GLY A 1 233 ? -3.712  -37.445 18.532  1.00 41.70  ? 234 GLY A C   1 
ATOM   1775 O O   . GLY A 1 233 ? -3.952  -36.296 18.932  1.00 40.00  ? 234 GLY A O   1 
ATOM   1776 N N   . PRO A 1 234 ? -4.438  -38.044 17.563  1.00 31.73  ? 235 PRO A N   1 
ATOM   1777 C CA  . PRO A 1 234 ? -5.580  -37.408 16.882  1.00 22.65  ? 235 PRO A CA  1 
ATOM   1778 C C   . PRO A 1 234 ? -6.712  -36.988 17.835  1.00 25.71  ? 235 PRO A C   1 
ATOM   1779 O O   . PRO A 1 234 ? -7.572  -36.193 17.459  1.00 32.78  ? 235 PRO A O   1 
ATOM   1780 C CB  . PRO A 1 234 ? -6.081  -38.506 15.940  1.00 19.87  ? 235 PRO A CB  1 
ATOM   1781 C CG  . PRO A 1 234 ? -5.653  -39.782 16.603  1.00 27.35  ? 235 PRO A CG  1 
ATOM   1782 C CD  . PRO A 1 234 ? -4.313  -39.467 17.204  1.00 26.00  ? 235 PRO A CD  1 
ATOM   1783 N N   . TRP A 1 235 ? -6.709  -37.506 19.055  1.00 23.29  ? 236 TRP A N   1 
ATOM   1784 C CA  . TRP A 1 235 ? -7.689  -37.098 20.059  1.00 24.88  ? 236 TRP A CA  1 
ATOM   1785 C C   . TRP A 1 235 ? -7.192  -36.013 21.025  1.00 25.87  ? 236 TRP A C   1 
ATOM   1786 O O   . TRP A 1 235 ? -8.004  -35.375 21.705  1.00 25.72  ? 236 TRP A O   1 
ATOM   1787 C CB  . TRP A 1 235 ? -8.109  -38.313 20.876  1.00 23.50  ? 236 TRP A CB  1 
ATOM   1788 C CG  . TRP A 1 235 ? -6.932  -39.054 21.405  1.00 25.15  ? 236 TRP A CG  1 
ATOM   1789 C CD1 . TRP A 1 235 ? -6.260  -40.069 20.785  1.00 23.19  ? 236 TRP A CD1 1 
ATOM   1790 C CD2 . TRP A 1 235 ? -6.263  -38.830 22.654  1.00 20.13  ? 236 TRP A CD2 1 
ATOM   1791 N NE1 . TRP A 1 235 ? -5.221  -40.494 21.571  1.00 25.00  ? 236 TRP A NE1 1 
ATOM   1792 C CE2 . TRP A 1 235 ? -5.200  -39.753 22.726  1.00 22.86  ? 236 TRP A CE2 1 
ATOM   1793 C CE3 . TRP A 1 235 ? -6.462  -37.941 23.720  1.00 25.16  ? 236 TRP A CE3 1 
ATOM   1794 C CZ2 . TRP A 1 235 ? -4.332  -39.819 23.824  1.00 20.80  ? 236 TRP A CZ2 1 
ATOM   1795 C CZ3 . TRP A 1 235 ? -5.604  -38.011 24.819  1.00 20.96  ? 236 TRP A CZ3 1 
ATOM   1796 C CH2 . TRP A 1 235 ? -4.552  -38.946 24.859  1.00 24.81  ? 236 TRP A CH2 1 
ATOM   1797 N N   . ALA A 1 236 ? -5.875  -35.812 21.094  1.00 24.38  ? 237 ALA A N   1 
ATOM   1798 C CA  . ALA A 1 236 ? -5.271  -35.015 22.179  1.00 26.50  ? 237 ALA A CA  1 
ATOM   1799 C C   . ALA A 1 236 ? -5.281  -33.500 21.963  1.00 25.74  ? 237 ALA A C   1 
ATOM   1800 O O   . ALA A 1 236 ? -5.074  -32.733 22.904  1.00 23.31  ? 237 ALA A O   1 
ATOM   1801 C CB  . ALA A 1 236 ? -3.847  -35.497 22.482  1.00 22.07  ? 237 ALA A CB  1 
ATOM   1802 N N   . THR A 1 237 ? -5.496  -33.066 20.726  1.00 23.24  ? 238 THR A N   1 
ATOM   1803 C CA  . THR A 1 237 ? -5.653  -31.640 20.457  1.00 23.58  ? 238 THR A CA  1 
ATOM   1804 C C   . THR A 1 237 ? -6.810  -31.386 19.504  1.00 24.76  ? 238 THR A C   1 
ATOM   1805 O O   . THR A 1 237 ? -7.292  -32.292 18.825  1.00 21.78  ? 238 THR A O   1 
ATOM   1806 C CB  . THR A 1 237 ? -4.373  -30.994 19.867  1.00 25.12  ? 238 THR A CB  1 
ATOM   1807 O OG1 . THR A 1 237 ? -4.022  -31.652 18.643  1.00 21.53  ? 238 THR A OG1 1 
ATOM   1808 C CG2 . THR A 1 237 ? -3.214  -31.094 20.852  1.00 21.89  ? 238 THR A CG2 1 
ATOM   1809 N N   . VAL A 1 238 ? -7.252  -30.141 19.462  1.00 23.54  ? 239 VAL A N   1 
ATOM   1810 C CA  . VAL A 1 238 ? -8.286  -29.741 18.524  1.00 26.73  ? 239 VAL A CA  1 
ATOM   1811 C C   . VAL A 1 238 ? -7.891  -28.387 17.927  1.00 28.32  ? 239 VAL A C   1 
ATOM   1812 O O   . VAL A 1 238 ? -7.179  -27.602 18.573  1.00 26.17  ? 239 VAL A O   1 
ATOM   1813 C CB  . VAL A 1 238 ? -9.676  -29.686 19.212  1.00 26.08  ? 239 VAL A CB  1 
ATOM   1814 C CG1 . VAL A 1 238 ? -9.764  -28.516 20.211  1.00 22.06  ? 239 VAL A CG1 1 
ATOM   1815 C CG2 . VAL A 1 238 ? -10.763 -29.588 18.192  1.00 30.33  ? 239 VAL A CG2 1 
ATOM   1816 N N   . GLY A 1 239 ? -8.318  -28.127 16.689  1.00 28.90  ? 240 GLY A N   1 
ATOM   1817 C CA  . GLY A 1 239 ? -8.033  -26.860 16.038  1.00 23.29  ? 240 GLY A CA  1 
ATOM   1818 C C   . GLY A 1 239 ? -8.874  -25.728 16.607  1.00 32.93  ? 240 GLY A C   1 
ATOM   1819 O O   . GLY A 1 239 ? -9.912  -25.976 17.239  1.00 29.27  ? 240 GLY A O   1 
ATOM   1820 N N   . MET A 1 240 ? -8.424  -24.491 16.391  1.00 32.83  ? 241 MET A N   1 
ATOM   1821 C CA  . MET A 1 240 ? -9.133  -23.309 16.883  1.00 32.56  ? 241 MET A CA  1 
ATOM   1822 C C   . MET A 1 240 ? -10.577 -23.249 16.385  1.00 34.99  ? 241 MET A C   1 
ATOM   1823 O O   . MET A 1 240 ? -11.506 -23.018 17.169  1.00 33.14  ? 241 MET A O   1 
ATOM   1824 C CB  . MET A 1 240 ? -8.405  -22.032 16.465  1.00 34.59  ? 241 MET A CB  1 
ATOM   1825 C CG  . MET A 1 240 ? -7.134  -21.754 17.227  1.00 38.47  ? 241 MET A CG  1 
ATOM   1826 S SD  . MET A 1 240 ? -6.380  -20.195 16.703  1.00 49.09  ? 241 MET A SD  1 
ATOM   1827 C CE  . MET A 1 240 ? -6.073  -20.555 14.974  1.00 40.60  ? 241 MET A CE  1 
ATOM   1828 N N   . GLY A 1 241 ? -10.755 -23.457 15.081  1.00 33.86  ? 242 GLY A N   1 
ATOM   1829 C CA  . GLY A 1 241 ? -12.071 -23.443 14.466  1.00 27.42  ? 242 GLY A CA  1 
ATOM   1830 C C   . GLY A 1 241 ? -13.051 -24.407 15.121  1.00 33.65  ? 242 GLY A C   1 
ATOM   1831 O O   . GLY A 1 241 ? -14.164 -24.025 15.483  1.00 32.26  ? 242 GLY A O   1 
ATOM   1832 N N   . GLU A 1 242 ? -12.628 -25.657 15.286  1.00 30.49  ? 243 GLU A N   1 
ATOM   1833 C CA  . GLU A 1 242 ? -13.480 -26.686 15.863  1.00 27.82  ? 243 GLU A CA  1 
ATOM   1834 C C   . GLU A 1 242 ? -13.697 -26.476 17.372  1.00 34.86  ? 243 GLU A C   1 
ATOM   1835 O O   . GLU A 1 242 ? -14.773 -26.777 17.890  1.00 33.61  ? 243 GLU A O   1 
ATOM   1836 C CB  . GLU A 1 242 ? -12.908 -28.078 15.560  1.00 26.00  ? 243 GLU A CB  1 
ATOM   1837 C CG  . GLU A 1 242 ? -13.644 -29.261 16.200  1.00 27.00  ? 243 GLU A CG  1 
ATOM   1838 C CD  . GLU A 1 242 ? -15.042 -29.464 15.650  1.00 33.40  ? 243 GLU A CD  1 
ATOM   1839 O OE1 . GLU A 1 242 ? -15.393 -28.784 14.664  1.00 39.97  ? 243 GLU A OE1 1 
ATOM   1840 O OE2 . GLU A 1 242 ? -15.793 -30.304 16.201  1.00 31.18  ? 243 GLU A OE2 1 
ATOM   1841 N N   . ALA A 1 243 ? -12.691 -25.956 18.075  1.00 31.11  ? 244 ALA A N   1 
ATOM   1842 C CA  . ALA A 1 243 ? -12.866 -25.642 19.494  1.00 28.48  ? 244 ALA A CA  1 
ATOM   1843 C C   . ALA A 1 243 ? -13.965 -24.605 19.654  1.00 31.19  ? 244 ALA A C   1 
ATOM   1844 O O   . ALA A 1 243 ? -14.820 -24.734 20.530  1.00 27.55  ? 244 ALA A O   1 
ATOM   1845 C CB  . ALA A 1 243 ? -11.577 -25.132 20.110  1.00 27.75  ? 244 ALA A CB  1 
ATOM   1846 N N   . ARG A 1 244 ? -13.942 -23.585 18.794  1.00 31.51  ? 245 ARG A N   1 
ATOM   1847 C CA  . ARG A 1 244 ? -14.944 -22.525 18.828  1.00 30.37  ? 245 ARG A CA  1 
ATOM   1848 C C   . ARG A 1 244 ? -16.325 -23.075 18.523  1.00 29.80  ? 245 ARG A C   1 
ATOM   1849 O O   . ARG A 1 244 ? -17.311 -22.694 19.150  1.00 32.55  ? 245 ARG A O   1 
ATOM   1850 C CB  . ARG A 1 244 ? -14.612 -21.399 17.842  1.00 30.24  ? 245 ARG A CB  1 
ATOM   1851 C CG  . ARG A 1 244 ? -15.741 -20.378 17.694  1.00 28.78  ? 245 ARG A CG  1 
ATOM   1852 C CD  . ARG A 1 244 ? -15.287 -19.123 16.952  1.00 25.30  ? 245 ARG A CD  1 
ATOM   1853 N NE  . ARG A 1 244 ? -14.302 -18.372 17.720  1.00 29.68  ? 245 ARG A NE  1 
ATOM   1854 C CZ  . ARG A 1 244 ? -14.612 -17.503 18.677  1.00 32.73  ? 245 ARG A CZ  1 
ATOM   1855 N NH1 . ARG A 1 244 ? -15.884 -17.283 18.990  1.00 34.23  ? 245 ARG A NH1 1 
ATOM   1856 N NH2 . ARG A 1 244 ? -13.654 -16.858 19.326  1.00 30.01  ? 245 ARG A NH2 1 
ATOM   1857 N N   . ARG A 1 245 ? -16.397 -23.987 17.566  1.00 28.84  ? 246 ARG A N   1 
ATOM   1858 C CA  . ARG A 1 245 ? -17.687 -24.547 17.215  1.00 38.52  ? 246 ARG A CA  1 
ATOM   1859 C C   . ARG A 1 245 ? -18.268 -25.338 18.382  1.00 31.98  ? 246 ARG A C   1 
ATOM   1860 O O   . ARG A 1 245 ? -19.444 -25.199 18.705  1.00 27.93  ? 246 ARG A O   1 
ATOM   1861 C CB  . ARG A 1 245 ? -17.601 -25.432 15.977  1.00 30.00  ? 246 ARG A CB  1 
ATOM   1862 C CG  . ARG A 1 245 ? -18.975 -25.795 15.449  1.00 33.64  ? 246 ARG A CG  1 
ATOM   1863 C CD  . ARG A 1 245 ? -18.947 -27.029 14.578  1.00 37.66  ? 246 ARG A CD  1 
ATOM   1864 N NE  . ARG A 1 245 ? -18.481 -28.215 15.293  1.00 37.55  ? 246 ARG A NE  1 
ATOM   1865 C CZ  . ARG A 1 245 ? -19.240 -28.945 16.106  1.00 35.58  ? 246 ARG A CZ  1 
ATOM   1866 N NH1 . ARG A 1 245 ? -20.502 -28.599 16.338  1.00 38.99  ? 246 ARG A NH1 1 
ATOM   1867 N NH2 . ARG A 1 245 ? -18.733 -30.016 16.697  1.00 28.18  ? 246 ARG A NH2 1 
ATOM   1868 N N   . ARG A 1 246 ? -17.433 -26.169 18.999  1.00 36.20  ? 247 ARG A N   1 
ATOM   1869 C CA  . ARG A 1 246 ? -17.860 -27.009 20.111  1.00 32.90  ? 247 ARG A CA  1 
ATOM   1870 C C   . ARG A 1 246 ? -18.295 -26.184 21.313  1.00 27.90  ? 247 ARG A C   1 
ATOM   1871 O O   . ARG A 1 246 ? -19.280 -26.517 21.975  1.00 29.59  ? 247 ARG A O   1 
ATOM   1872 C CB  . ARG A 1 246 ? -16.747 -27.965 20.514  1.00 33.98  ? 247 ARG A CB  1 
ATOM   1873 C CG  . ARG A 1 246 ? -16.510 -29.064 19.496  1.00 33.61  ? 247 ARG A CG  1 
ATOM   1874 C CD  . ARG A 1 246 ? -15.437 -30.005 19.985  1.00 29.17  ? 247 ARG A CD  1 
ATOM   1875 N NE  . ARG A 1 246 ? -14.993 -30.889 18.921  1.00 26.50  ? 247 ARG A NE  1 
ATOM   1876 C CZ  . ARG A 1 246 ? -14.099 -31.847 19.092  1.00 28.59  ? 247 ARG A CZ  1 
ATOM   1877 N NH1 . ARG A 1 246 ? -13.562 -32.034 20.294  1.00 24.41  ? 247 ARG A NH1 1 
ATOM   1878 N NH2 . ARG A 1 246 ? -13.746 -32.614 18.065  1.00 26.25  ? 247 ARG A NH2 1 
ATOM   1879 N N   . ALA A 1 247 ? -17.563 -25.106 21.579  1.00 29.19  ? 248 ALA A N   1 
ATOM   1880 C CA  . ALA A 1 247 ? -17.895 -24.202 22.676  1.00 31.39  ? 248 ALA A CA  1 
ATOM   1881 C C   . ALA A 1 247 ? -19.220 -23.525 22.375  1.00 36.90  ? 248 ALA A C   1 
ATOM   1882 O O   . ALA A 1 247 ? -20.063 -23.353 23.261  1.00 35.05  ? 248 ALA A O   1 
ATOM   1883 C CB  . ALA A 1 247 ? -16.799 -23.154 22.863  1.00 23.03  ? 248 ALA A CB  1 
ATOM   1884 N N   . THR A 1 248 ? -19.402 -23.149 21.111  1.00 28.81  ? 249 THR A N   1 
ATOM   1885 C CA  . THR A 1 248 ? -20.601 -22.436 20.705  1.00 28.17  ? 249 THR A CA  1 
ATOM   1886 C C   . THR A 1 248 ? -21.819 -23.349 20.757  1.00 28.49  ? 249 THR A C   1 
ATOM   1887 O O   . THR A 1 248 ? -22.890 -22.926 21.184  1.00 29.08  ? 249 THR A O   1 
ATOM   1888 C CB  . THR A 1 248 ? -20.437 -21.784 19.319  1.00 39.46  ? 249 THR A CB  1 
ATOM   1889 O OG1 . THR A 1 248 ? -19.357 -20.843 19.372  1.00 38.83  ? 249 THR A OG1 1 
ATOM   1890 C CG2 . THR A 1 248 ? -21.716 -21.050 18.909  1.00 34.47  ? 249 THR A CG2 1 
ATOM   1891 N N   . GLN A 1 249 ? -21.648 -24.607 20.359  1.00 27.63  ? 250 GLN A N   1 
ATOM   1892 C CA  . GLN A 1 249 ? -22.745 -25.562 20.439  1.00 28.63  ? 250 GLN A CA  1 
ATOM   1893 C C   . GLN A 1 249 ? -23.111 -25.898 21.880  1.00 31.94  ? 250 GLN A C   1 
ATOM   1894 O O   . GLN A 1 249 ? -24.277 -26.164 22.182  1.00 32.14  ? 250 GLN A O   1 
ATOM   1895 C CB  . GLN A 1 249 ? -22.440 -26.859 19.684  1.00 26.22  ? 250 GLN A CB  1 
ATOM   1896 C CG  . GLN A 1 249 ? -23.709 -27.687 19.470  1.00 33.51  ? 250 GLN A CG  1 
ATOM   1897 C CD  . GLN A 1 249 ? -23.455 -29.058 18.885  1.00 45.75  ? 250 GLN A CD  1 
ATOM   1898 O OE1 . GLN A 1 249 ? -22.408 -29.317 18.276  1.00 51.28  ? 250 GLN A OE1 1 
ATOM   1899 N NE2 . GLN A 1 249 ? -24.420 -29.952 19.063  1.00 41.59  ? 250 GLN A NE2 1 
ATOM   1900 N N   . LEU A 1 250 ? -22.119 -25.910 22.768  1.00 31.00  ? 251 LEU A N   1 
ATOM   1901 C CA  . LEU A 1 250 ? -22.409 -26.165 24.174  1.00 35.41  ? 251 LEU A CA  1 
ATOM   1902 C C   . LEU A 1 250 ? -23.253 -25.028 24.725  1.00 30.24  ? 251 LEU A C   1 
ATOM   1903 O O   . LEU A 1 250 ? -24.200 -25.264 25.466  1.00 28.35  ? 251 LEU A O   1 
ATOM   1904 C CB  . LEU A 1 250 ? -21.139 -26.330 25.014  1.00 29.75  ? 251 LEU A CB  1 
ATOM   1905 C CG  . LEU A 1 250 ? -21.411 -26.693 26.480  1.00 30.41  ? 251 LEU A CG  1 
ATOM   1906 C CD1 . LEU A 1 250 ? -21.999 -28.104 26.598  1.00 22.37  ? 251 LEU A CD1 1 
ATOM   1907 C CD2 . LEU A 1 250 ? -20.164 -26.548 27.351  1.00 29.82  ? 251 LEU A CD2 1 
ATOM   1908 N N   . ALA A 1 251 ? -22.916 -23.798 24.351  1.00 31.40  ? 252 ALA A N   1 
ATOM   1909 C CA  . ALA A 1 251 ? -23.669 -22.653 24.845  1.00 35.39  ? 252 ALA A CA  1 
ATOM   1910 C C   . ALA A 1 251 ? -25.115 -22.778 24.394  1.00 38.42  ? 252 ALA A C   1 
ATOM   1911 O O   . ALA A 1 251 ? -26.037 -22.633 25.198  1.00 35.04  ? 252 ALA A O   1 
ATOM   1912 C CB  . ALA A 1 251 ? -23.054 -21.336 24.381  1.00 26.33  ? 252 ALA A CB  1 
ATOM   1913 N N   . HIS A 1 252 ? -25.302 -23.090 23.113  1.00 36.18  ? 253 HIS A N   1 
ATOM   1914 C CA  . HIS A 1 252 ? -26.640 -23.300 22.568  1.00 38.15  ? 253 HIS A CA  1 
ATOM   1915 C C   . HIS A 1 252 ? -27.430 -24.387 23.312  1.00 33.08  ? 253 HIS A C   1 
ATOM   1916 O O   . HIS A 1 252 ? -28.600 -24.195 23.636  1.00 36.39  ? 253 HIS A O   1 
ATOM   1917 C CB  . HIS A 1 252 ? -26.582 -23.625 21.067  1.00 37.06  ? 253 HIS A CB  1 
ATOM   1918 C CG  . HIS A 1 252 ? -27.920 -23.948 20.474  1.00 46.47  ? 253 HIS A CG  1 
ATOM   1919 N ND1 . HIS A 1 252 ? -28.380 -25.241 20.332  1.00 46.39  ? 253 HIS A ND1 1 
ATOM   1920 C CD2 . HIS A 1 252 ? -28.908 -23.145 20.009  1.00 49.04  ? 253 HIS A CD2 1 
ATOM   1921 C CE1 . HIS A 1 252 ? -29.588 -25.221 19.797  1.00 47.51  ? 253 HIS A CE1 1 
ATOM   1922 N NE2 . HIS A 1 252 ? -29.931 -23.962 19.591  1.00 55.79  ? 253 HIS A NE2 1 
ATOM   1923 N N   . LEU A 1 253 ? -26.787 -25.520 23.577  1.00 31.13  ? 254 LEU A N   1 
ATOM   1924 C CA  . LEU A 1 253 ? -27.450 -26.653 24.220  1.00 28.49  ? 254 LEU A CA  1 
ATOM   1925 C C   . LEU A 1 253 ? -27.881 -26.390 25.662  1.00 34.16  ? 254 LEU A C   1 
ATOM   1926 O O   . LEU A 1 253 ? -28.754 -27.085 26.186  1.00 35.71  ? 254 LEU A O   1 
ATOM   1927 C CB  . LEU A 1 253 ? -26.558 -27.896 24.184  1.00 31.68  ? 254 LEU A CB  1 
ATOM   1928 C CG  . LEU A 1 253 ? -26.323 -28.573 22.832  1.00 39.90  ? 254 LEU A CG  1 
ATOM   1929 C CD1 . LEU A 1 253 ? -25.276 -29.674 22.974  1.00 33.30  ? 254 LEU A CD1 1 
ATOM   1930 C CD2 . LEU A 1 253 ? -27.636 -29.132 22.289  1.00 29.11  ? 254 LEU A CD2 1 
ATOM   1931 N N   . VAL A 1 254 ? -27.261 -25.408 26.309  1.00 32.47  ? 255 VAL A N   1 
ATOM   1932 C CA  . VAL A 1 254 ? -27.612 -25.078 27.686  1.00 31.34  ? 255 VAL A CA  1 
ATOM   1933 C C   . VAL A 1 254 ? -28.302 -23.712 27.796  1.00 36.46  ? 255 VAL A C   1 
ATOM   1934 O O   . VAL A 1 254 ? -28.388 -23.131 28.885  1.00 33.49  ? 255 VAL A O   1 
ATOM   1935 C CB  . VAL A 1 254 ? -26.393 -25.149 28.632  1.00 29.29  ? 255 VAL A CB  1 
ATOM   1936 C CG1 . VAL A 1 254 ? -25.708 -26.496 28.495  1.00 27.72  ? 255 VAL A CG1 1 
ATOM   1937 C CG2 . VAL A 1 254 ? -25.425 -24.004 28.364  1.00 26.70  ? 255 VAL A CG2 1 
ATOM   1938 N N   . GLY A 1 255 ? -28.798 -23.213 26.663  1.00 29.86  ? 256 GLY A N   1 
ATOM   1939 C CA  . GLY A 1 255 ? -29.640 -22.030 26.660  1.00 31.66  ? 256 GLY A CA  1 
ATOM   1940 C C   . GLY A 1 255 ? -28.937 -20.687 26.660  1.00 31.79  ? 256 GLY A C   1 
ATOM   1941 O O   . GLY A 1 255 ? -29.554 -19.668 26.966  1.00 32.31  ? 256 GLY A O   1 
ATOM   1942 N N   . CYS A 1 256 ? -27.659 -20.672 26.292  1.00 35.91  ? 257 CYS A N   1 
ATOM   1943 C CA  . CYS A 1 256 ? -26.896 -19.427 26.221  1.00 37.16  ? 257 CYS A CA  1 
ATOM   1944 C C   . CYS A 1 256 ? -26.729 -18.942 24.782  1.00 41.86  ? 257 CYS A C   1 
ATOM   1945 O O   . CYS A 1 256 ? -26.718 -19.747 23.857  1.00 44.43  ? 257 CYS A O   1 
ATOM   1946 C CB  . CYS A 1 256 ? -25.532 -19.610 26.891  1.00 36.38  ? 257 CYS A CB  1 
ATOM   1947 S SG  . CYS A 1 256 ? -25.676 -19.935 28.655  1.00 36.74  ? 257 CYS A SG  1 
ATOM   1948 N N   . PRO A 1 257 ? -26.598 -17.619 24.593  1.00 49.86  ? 258 PRO A N   1 
ATOM   1949 C CA  . PRO A 1 257 ? -26.408 -17.033 23.260  1.00 51.14  ? 258 PRO A CA  1 
ATOM   1950 C C   . PRO A 1 257 ? -25.035 -17.347 22.667  1.00 51.83  ? 258 PRO A C   1 
ATOM   1951 O O   . PRO A 1 257 ? -24.894 -17.340 21.438  1.00 71.72  ? 258 PRO A O   1 
ATOM   1952 C CB  . PRO A 1 257 ? -26.526 -15.531 23.525  1.00 51.45  ? 258 PRO A CB  1 
ATOM   1953 C CG  . PRO A 1 257 ? -26.113 -15.370 24.959  1.00 47.94  ? 258 PRO A CG  1 
ATOM   1954 C CD  . PRO A 1 257 ? -26.646 -16.587 25.647  1.00 47.82  ? 258 PRO A CD  1 
ATOM   1955 N N   . ASN A 1 264 ? -20.581 -12.339 20.298  1.00 55.41  ? 265 ASN A N   1 
ATOM   1956 C CA  . ASN A 1 264 ? -19.863 -11.725 21.411  1.00 50.12  ? 265 ASN A CA  1 
ATOM   1957 C C   . ASN A 1 264 ? -19.414 -12.763 22.449  1.00 53.70  ? 265 ASN A C   1 
ATOM   1958 O O   . ASN A 1 264 ? -20.218 -13.262 23.241  1.00 51.66  ? 265 ASN A O   1 
ATOM   1959 C CB  . ASN A 1 264 ? -20.725 -10.637 22.056  1.00 58.06  ? 265 ASN A CB  1 
ATOM   1960 C CG  . ASN A 1 264 ? -19.933 -9.727  22.986  1.00 63.59  ? 265 ASN A CG  1 
ATOM   1961 O OD1 . ASN A 1 264 ? -18.993 -10.162 23.648  1.00 66.72  ? 265 ASN A OD1 1 
ATOM   1962 N ND2 . ASN A 1 264 ? -20.321 -8.453  23.044  1.00 68.68  ? 265 ASN A ND2 1 
ATOM   1963 N N   . ASP A 1 265 ? -18.121 -13.076 22.440  1.00 46.74  ? 266 ASP A N   1 
ATOM   1964 C CA  . ASP A 1 265 ? -17.560 -14.072 23.345  1.00 44.11  ? 266 ASP A CA  1 
ATOM   1965 C C   . ASP A 1 265 ? -17.824 -13.743 24.824  1.00 49.38  ? 266 ASP A C   1 
ATOM   1966 O O   . ASP A 1 265 ? -18.161 -14.633 25.616  1.00 43.46  ? 266 ASP A O   1 
ATOM   1967 C CB  . ASP A 1 265 ? -16.052 -14.225 23.110  1.00 42.99  ? 266 ASP A CB  1 
ATOM   1968 C CG  . ASP A 1 265 ? -15.714 -14.788 21.732  1.00 39.96  ? 266 ASP A CG  1 
ATOM   1969 O OD1 . ASP A 1 265 ? -16.539 -15.515 21.147  1.00 39.30  ? 266 ASP A OD1 1 
ATOM   1970 O OD2 . ASP A 1 265 ? -14.603 -14.508 21.240  1.00 49.48  ? 266 ASP A OD2 1 
ATOM   1971 N N   . THR A 1 266 ? -17.666 -12.471 25.188  1.00 40.97  ? 267 THR A N   1 
ATOM   1972 C CA  . THR A 1 266 ? -17.893 -12.027 26.561  1.00 38.54  ? 267 THR A CA  1 
ATOM   1973 C C   . THR A 1 266 ? -19.263 -12.457 27.096  1.00 42.88  ? 267 THR A C   1 
ATOM   1974 O O   . THR A 1 266 ? -19.360 -13.011 28.196  1.00 43.48  ? 267 THR A O   1 
ATOM   1975 C CB  . THR A 1 266 ? -17.765 -10.499 26.690  1.00 47.27  ? 267 THR A CB  1 
ATOM   1976 O OG1 . THR A 1 266 ? -16.505 -10.074 26.157  1.00 50.74  ? 267 THR A OG1 1 
ATOM   1977 C CG2 . THR A 1 266 ? -17.865 -10.069 28.155  1.00 43.24  ? 267 THR A CG2 1 
ATOM   1978 N N   . GLU A 1 267 ? -20.312 -12.210 26.313  1.00 45.62  ? 268 GLU A N   1 
ATOM   1979 C CA  . GLU A 1 267 ? -21.675 -12.562 26.707  1.00 43.71  ? 268 GLU A CA  1 
ATOM   1980 C C   . GLU A 1 267 ? -21.853 -14.068 26.791  1.00 42.01  ? 268 GLU A C   1 
ATOM   1981 O O   . GLU A 1 267 ? -22.501 -14.586 27.709  1.00 42.76  ? 268 GLU A O   1 
ATOM   1982 C CB  . GLU A 1 267 ? -22.689 -12.003 25.713  1.00 43.94  ? 268 GLU A CB  1 
ATOM   1983 C CG  . GLU A 1 267 ? -22.824 -10.492 25.719  1.00 64.17  ? 268 GLU A CG  1 
ATOM   1984 C CD  . GLU A 1 267 ? -23.896 -10.008 24.749  1.00 87.59  ? 268 GLU A CD  1 
ATOM   1985 O OE1 . GLU A 1 267 ? -24.858 -10.772 24.491  1.00 84.71  ? 268 GLU A OE1 1 
ATOM   1986 O OE2 . GLU A 1 267 ? -23.769 -8.871  24.240  1.00 90.79  ? 268 GLU A OE2 1 
ATOM   1987 N N   . LEU A 1 268 ? -21.282 -14.762 25.816  1.00 39.77  ? 269 LEU A N   1 
ATOM   1988 C CA  . LEU A 1 268 ? -21.390 -16.210 25.732  1.00 39.41  ? 269 LEU A CA  1 
ATOM   1989 C C   . LEU A 1 268 ? -20.791 -16.857 26.985  1.00 34.90  ? 269 LEU A C   1 
ATOM   1990 O O   . LEU A 1 268 ? -21.435 -17.677 27.635  1.00 39.60  ? 269 LEU A O   1 
ATOM   1991 C CB  . LEU A 1 268 ? -20.717 -16.714 24.443  1.00 35.72  ? 269 LEU A CB  1 
ATOM   1992 C CG  . LEU A 1 268 ? -20.946 -18.150 23.964  1.00 39.66  ? 269 LEU A CG  1 
ATOM   1993 C CD1 . LEU A 1 268 ? -20.628 -18.279 22.482  1.00 40.94  ? 269 LEU A CD1 1 
ATOM   1994 C CD2 . LEU A 1 268 ? -20.090 -19.132 24.750  1.00 40.14  ? 269 LEU A CD2 1 
ATOM   1995 N N   . VAL A 1 269 ? -19.567 -16.475 27.333  1.00 34.23  ? 270 VAL A N   1 
ATOM   1996 C CA  . VAL A 1 269 ? -18.921 -17.036 28.514  1.00 39.46  ? 270 VAL A CA  1 
ATOM   1997 C C   . VAL A 1 269 ? -19.651 -16.635 29.802  1.00 37.00  ? 270 VAL A C   1 
ATOM   1998 O O   . VAL A 1 269 ? -19.777 -17.438 30.729  1.00 34.61  ? 270 VAL A O   1 
ATOM   1999 C CB  . VAL A 1 269 ? -17.431 -16.642 28.592  1.00 42.61  ? 270 VAL A CB  1 
ATOM   2000 C CG1 . VAL A 1 269 ? -16.775 -17.258 29.817  1.00 35.28  ? 270 VAL A CG1 1 
ATOM   2001 C CG2 . VAL A 1 269 ? -16.703 -17.087 27.330  1.00 42.78  ? 270 VAL A CG2 1 
ATOM   2002 N N   . ALA A 1 270 ? -20.138 -15.400 29.849  1.00 33.48  ? 271 ALA A N   1 
ATOM   2003 C CA  . ALA A 1 270 ? -20.826 -14.905 31.035  1.00 36.74  ? 271 ALA A CA  1 
ATOM   2004 C C   . ALA A 1 270 ? -22.095 -15.714 31.296  1.00 35.70  ? 271 ALA A C   1 
ATOM   2005 O O   . ALA A 1 270 ? -22.411 -16.041 32.438  1.00 39.78  ? 271 ALA A O   1 
ATOM   2006 C CB  . ALA A 1 270 ? -21.152 -13.424 30.892  1.00 31.07  ? 271 ALA A CB  1 
ATOM   2007 N N   . CYS A 1 271 ? -22.815 -16.045 30.232  1.00 37.01  ? 272 CYS A N   1 
ATOM   2008 C CA  . CYS A 1 271 ? -23.983 -16.899 30.361  1.00 35.60  ? 272 CYS A CA  1 
ATOM   2009 C C   . CYS A 1 271 ? -23.590 -18.320 30.785  1.00 32.05  ? 272 CYS A C   1 
ATOM   2010 O O   . CYS A 1 271 ? -24.254 -18.919 31.635  1.00 35.48  ? 272 CYS A O   1 
ATOM   2011 C CB  . CYS A 1 271 ? -24.793 -16.919 29.059  1.00 37.02  ? 272 CYS A CB  1 
ATOM   2012 S SG  . CYS A 1 271 ? -26.238 -18.006 29.127  1.00 40.95  ? 272 CYS A SG  1 
ATOM   2013 N N   . LEU A 1 272 ? -22.521 -18.855 30.196  1.00 29.52  ? 273 LEU A N   1 
ATOM   2014 C CA  . LEU A 1 272 ? -21.999 -20.166 30.598  1.00 31.53  ? 273 LEU A CA  1 
ATOM   2015 C C   . LEU A 1 272 ? -21.621 -20.194 32.081  1.00 34.00  ? 273 LEU A C   1 
ATOM   2016 O O   . LEU A 1 272 ? -21.840 -21.195 32.772  1.00 31.46  ? 273 LEU A O   1 
ATOM   2017 C CB  . LEU A 1 272 ? -20.776 -20.550 29.767  1.00 25.65  ? 273 LEU A CB  1 
ATOM   2018 C CG  . LEU A 1 272 ? -20.996 -20.974 28.313  1.00 31.64  ? 273 LEU A CG  1 
ATOM   2019 C CD1 . LEU A 1 272 ? -19.658 -21.246 27.648  1.00 28.58  ? 273 LEU A CD1 1 
ATOM   2020 C CD2 . LEU A 1 272 ? -21.890 -22.207 28.218  1.00 27.01  ? 273 LEU A CD2 1 
ATOM   2021 N N   . ARG A 1 273 ? -21.060 -19.091 32.570  1.00 31.47  ? 274 ARG A N   1 
ATOM   2022 C CA  . ARG A 1 273 ? -20.639 -19.025 33.966  1.00 36.88  ? 274 ARG A CA  1 
ATOM   2023 C C   . ARG A 1 273 ? -21.810 -19.091 34.954  1.00 32.63  ? 274 ARG A C   1 
ATOM   2024 O O   . ARG A 1 273 ? -21.609 -19.405 36.119  1.00 27.59  ? 274 ARG A O   1 
ATOM   2025 C CB  . ARG A 1 273 ? -19.757 -17.796 34.231  1.00 32.84  ? 274 ARG A CB  1 
ATOM   2026 C CG  . ARG A 1 273 ? -18.362 -17.910 33.632  1.00 35.67  ? 274 ARG A CG  1 
ATOM   2027 C CD  . ARG A 1 273 ? -17.367 -16.976 34.304  1.00 34.38  ? 274 ARG A CD  1 
ATOM   2028 N NE  . ARG A 1 273 ? -16.993 -15.844 33.458  1.00 50.29  ? 274 ARG A NE  1 
ATOM   2029 C CZ  . ARG A 1 273 ? -15.815 -15.714 32.845  1.00 50.27  ? 274 ARG A CZ  1 
ATOM   2030 N NH1 . ARG A 1 273 ? -14.876 -16.647 32.973  1.00 40.60  ? 274 ARG A NH1 1 
ATOM   2031 N NH2 . ARG A 1 273 ? -15.570 -14.640 32.105  1.00 47.98  ? 274 ARG A NH2 1 
ATOM   2032 N N   . THR A 1 274 ? -23.027 -18.823 34.488  1.00 32.00  ? 275 THR A N   1 
ATOM   2033 C CA  . THR A 1 274 ? -24.190 -18.851 35.378  1.00 30.23  ? 275 THR A CA  1 
ATOM   2034 C C   . THR A 1 274 ? -24.767 -20.256 35.501  1.00 34.45  ? 275 THR A C   1 
ATOM   2035 O O   . THR A 1 274 ? -25.651 -20.505 36.315  1.00 38.79  ? 275 THR A O   1 
ATOM   2036 C CB  . THR A 1 274 ? -25.322 -17.926 34.890  1.00 37.83  ? 275 THR A CB  1 
ATOM   2037 O OG1 . THR A 1 274 ? -25.919 -18.481 33.711  1.00 40.74  ? 275 THR A OG1 1 
ATOM   2038 C CG2 . THR A 1 274 ? -24.803 -16.525 34.593  1.00 38.98  ? 275 THR A CG2 1 
ATOM   2039 N N   . ARG A 1 275 ? -24.271 -21.180 34.691  1.00 26.87  ? 276 ARG A N   1 
ATOM   2040 C CA  . ARG A 1 275 ? -24.842 -22.513 34.667  1.00 24.97  ? 276 ARG A CA  1 
ATOM   2041 C C   . ARG A 1 275 ? -24.202 -23.399 35.729  1.00 30.39  ? 276 ARG A C   1 
ATOM   2042 O O   . ARG A 1 275 ? -22.997 -23.314 35.967  1.00 29.98  ? 276 ARG A O   1 
ATOM   2043 C CB  . ARG A 1 275 ? -24.661 -23.130 33.278  1.00 29.51  ? 276 ARG A CB  1 
ATOM   2044 C CG  . ARG A 1 275 ? -25.428 -22.412 32.177  1.00 28.92  ? 276 ARG A CG  1 
ATOM   2045 C CD  . ARG A 1 275 ? -26.913 -22.594 32.371  1.00 33.03  ? 276 ARG A CD  1 
ATOM   2046 N NE  . ARG A 1 275 ? -27.701 -22.127 31.235  1.00 32.87  ? 276 ARG A NE  1 
ATOM   2047 C CZ  . ARG A 1 275 ? -28.236 -20.912 31.144  1.00 38.01  ? 276 ARG A CZ  1 
ATOM   2048 N NH1 . ARG A 1 275 ? -28.056 -20.027 32.117  1.00 38.64  ? 276 ARG A NH1 1 
ATOM   2049 N NH2 . ARG A 1 275 ? -28.947 -20.578 30.077  1.00 34.54  ? 276 ARG A NH2 1 
ATOM   2050 N N   . PRO A 1 276 ? -25.012 -24.232 36.395  1.00 30.00  ? 277 PRO A N   1 
ATOM   2051 C CA  . PRO A 1 276 ? -24.432 -25.218 37.308  1.00 28.67  ? 277 PRO A CA  1 
ATOM   2052 C C   . PRO A 1 276 ? -23.463 -26.109 36.540  1.00 33.99  ? 277 PRO A C   1 
ATOM   2053 O O   . PRO A 1 276 ? -23.763 -26.480 35.403  1.00 31.93  ? 277 PRO A O   1 
ATOM   2054 C CB  . PRO A 1 276 ? -25.649 -26.038 37.757  1.00 23.85  ? 277 PRO A CB  1 
ATOM   2055 C CG  . PRO A 1 276 ? -26.801 -25.093 37.625  1.00 29.45  ? 277 PRO A CG  1 
ATOM   2056 C CD  . PRO A 1 276 ? -26.487 -24.243 36.420  1.00 28.32  ? 277 PRO A CD  1 
ATOM   2057 N N   . ALA A 1 277 ? -22.327 -26.429 37.150  1.00 31.40  ? 278 ALA A N   1 
ATOM   2058 C CA  . ALA A 1 277 ? -21.328 -27.308 36.553  1.00 28.42  ? 278 ALA A CA  1 
ATOM   2059 C C   . ALA A 1 277 ? -21.934 -28.547 35.908  1.00 28.93  ? 278 ALA A C   1 
ATOM   2060 O O   . ALA A 1 277 ? -21.587 -28.907 34.765  1.00 25.96  ? 278 ALA A O   1 
ATOM   2061 C CB  . ALA A 1 277 ? -20.298 -27.720 37.598  1.00 26.96  ? 278 ALA A CB  1 
ATOM   2062 N N   . GLN A 1 278 ? -22.840 -29.190 36.641  1.00 28.41  ? 279 GLN A N   1 
ATOM   2063 C CA  . GLN A 1 278 ? -23.475 -30.427 36.186  1.00 30.33  ? 279 GLN A CA  1 
ATOM   2064 C C   . GLN A 1 278 ? -24.206 -30.255 34.847  1.00 33.06  ? 279 GLN A C   1 
ATOM   2065 O O   . GLN A 1 278 ? -24.290 -31.191 34.046  1.00 29.64  ? 279 GLN A O   1 
ATOM   2066 C CB  . GLN A 1 278 ? -24.437 -30.961 37.254  1.00 23.47  ? 279 GLN A CB  1 
ATOM   2067 C CG  . GLN A 1 278 ? -24.907 -32.399 37.007  1.00 23.74  ? 279 GLN A CG  1 
ATOM   2068 C CD  . GLN A 1 278 ? -23.750 -33.377 36.850  1.00 33.49  ? 279 GLN A CD  1 
ATOM   2069 O OE1 . GLN A 1 278 ? -22.853 -33.431 37.688  1.00 42.40  ? 279 GLN A OE1 1 
ATOM   2070 N NE2 . GLN A 1 278 ? -23.768 -34.155 35.770  1.00 30.82  ? 279 GLN A NE2 1 
ATOM   2071 N N   . VAL A 1 279 ? -24.735 -29.061 34.609  1.00 24.82  ? 280 VAL A N   1 
ATOM   2072 C CA  . VAL A 1 279 ? -25.454 -28.803 33.376  1.00 33.54  ? 280 VAL A CA  1 
ATOM   2073 C C   . VAL A 1 279 ? -24.508 -28.851 32.173  1.00 31.38  ? 280 VAL A C   1 
ATOM   2074 O O   . VAL A 1 279 ? -24.846 -29.428 31.140  1.00 33.93  ? 280 VAL A O   1 
ATOM   2075 C CB  . VAL A 1 279 ? -26.234 -27.466 33.440  1.00 34.75  ? 280 VAL A CB  1 
ATOM   2076 C CG1 . VAL A 1 279 ? -26.623 -26.984 32.040  1.00 30.77  ? 280 VAL A CG1 1 
ATOM   2077 C CG2 . VAL A 1 279 ? -27.462 -27.627 34.314  1.00 25.24  ? 280 VAL A CG2 1 
ATOM   2078 N N   . LEU A 1 280 ? -23.318 -28.272 32.312  1.00 30.01  ? 281 LEU A N   1 
ATOM   2079 C CA  . LEU A 1 280 ? -22.334 -28.346 31.234  1.00 30.05  ? 281 LEU A CA  1 
ATOM   2080 C C   . LEU A 1 280 ? -21.954 -29.801 30.986  1.00 27.76  ? 281 LEU A C   1 
ATOM   2081 O O   . LEU A 1 280 ? -21.879 -30.251 29.842  1.00 33.36  ? 281 LEU A O   1 
ATOM   2082 C CB  . LEU A 1 280 ? -21.087 -27.512 31.551  1.00 26.59  ? 281 LEU A CB  1 
ATOM   2083 C CG  . LEU A 1 280 ? -21.304 -26.053 31.966  1.00 28.04  ? 281 LEU A CG  1 
ATOM   2084 C CD1 . LEU A 1 280 ? -20.003 -25.268 31.900  1.00 27.45  ? 281 LEU A CD1 1 
ATOM   2085 C CD2 . LEU A 1 280 ? -22.375 -25.376 31.132  1.00 24.18  ? 281 LEU A CD2 1 
ATOM   2086 N N   . VAL A 1 281 ? -21.732 -30.539 32.065  1.00 24.60  ? 282 VAL A N   1 
ATOM   2087 C CA  . VAL A 1 281 ? -21.397 -31.952 31.956  1.00 30.33  ? 282 VAL A CA  1 
ATOM   2088 C C   . VAL A 1 281 ? -22.473 -32.754 31.201  1.00 33.63  ? 282 VAL A C   1 
ATOM   2089 O O   . VAL A 1 281 ? -22.152 -33.613 30.382  1.00 34.80  ? 282 VAL A O   1 
ATOM   2090 C CB  . VAL A 1 281 ? -21.120 -32.575 33.348  1.00 23.95  ? 282 VAL A CB  1 
ATOM   2091 C CG1 . VAL A 1 281 ? -20.963 -34.077 33.250  1.00 24.10  ? 282 VAL A CG1 1 
ATOM   2092 C CG2 . VAL A 1 281 ? -19.884 -31.961 33.951  1.00 23.86  ? 282 VAL A CG2 1 
ATOM   2093 N N   . ASN A 1 282 ? -23.744 -32.457 31.459  1.00 32.75  ? 283 ASN A N   1 
ATOM   2094 C CA  . ASN A 1 282 ? -24.842 -33.215 30.857  1.00 32.23  ? 283 ASN A CA  1 
ATOM   2095 C C   . ASN A 1 282 ? -24.951 -33.109 29.328  1.00 31.93  ? 283 ASN A C   1 
ATOM   2096 O O   . ASN A 1 282 ? -25.569 -33.953 28.687  1.00 31.18  ? 283 ASN A O   1 
ATOM   2097 C CB  . ASN A 1 282 ? -26.174 -32.838 31.510  1.00 30.33  ? 283 ASN A CB  1 
ATOM   2098 C CG  . ASN A 1 282 ? -26.283 -33.353 32.927  1.00 33.60  ? 283 ASN A CG  1 
ATOM   2099 O OD1 . ASN A 1 282 ? -25.520 -34.226 33.338  1.00 33.22  ? 283 ASN A OD1 1 
ATOM   2100 N ND2 . ASN A 1 282 ? -27.230 -32.817 33.684  1.00 30.13  ? 283 ASN A ND2 1 
ATOM   2101 N N   . HIS A 1 283 ? -24.357 -32.075 28.749  1.00 24.43  ? 284 HIS A N   1 
ATOM   2102 C CA  . HIS A 1 283 ? -24.416 -31.905 27.308  1.00 33.00  ? 284 HIS A CA  1 
ATOM   2103 C C   . HIS A 1 283 ? -23.055 -32.094 26.632  1.00 34.33  ? 284 HIS A C   1 
ATOM   2104 O O   . HIS A 1 283 ? -22.925 -31.848 25.441  1.00 34.18  ? 284 HIS A O   1 
ATOM   2105 C CB  . HIS A 1 283 ? -24.994 -30.528 26.968  1.00 32.38  ? 284 HIS A CB  1 
ATOM   2106 C CG  . HIS A 1 283 ? -26.403 -30.347 27.432  1.00 42.07  ? 284 HIS A CG  1 
ATOM   2107 N ND1 . HIS A 1 283 ? -27.488 -30.745 26.680  1.00 44.72  ? 284 HIS A ND1 1 
ATOM   2108 C CD2 . HIS A 1 283 ? -26.906 -29.843 28.584  1.00 31.89  ? 284 HIS A CD2 1 
ATOM   2109 C CE1 . HIS A 1 283 ? -28.600 -30.480 27.342  1.00 38.32  ? 284 HIS A CE1 1 
ATOM   2110 N NE2 . HIS A 1 283 ? -28.275 -29.931 28.499  1.00 40.01  ? 284 HIS A NE2 1 
ATOM   2111 N N   . GLU A 1 284 ? -22.059 -32.542 27.394  1.00 34.17  ? 285 GLU A N   1 
ATOM   2112 C CA  . GLU A 1 284 ? -20.674 -32.571 26.927  1.00 33.28  ? 285 GLU A CA  1 
ATOM   2113 C C   . GLU A 1 284 ? -20.484 -33.393 25.645  1.00 31.74  ? 285 GLU A C   1 
ATOM   2114 O O   . GLU A 1 284 ? -19.929 -32.905 24.664  1.00 26.88  ? 285 GLU A O   1 
ATOM   2115 C CB  . GLU A 1 284 ? -19.738 -33.102 28.025  1.00 28.94  ? 285 GLU A CB  1 
ATOM   2116 C CG  . GLU A 1 284 ? -18.272 -33.115 27.598  1.00 30.34  ? 285 GLU A CG  1 
ATOM   2117 C CD  . GLU A 1 284 ? -17.333 -33.711 28.646  1.00 34.90  ? 285 GLU A CD  1 
ATOM   2118 O OE1 . GLU A 1 284 ? -17.528 -33.466 29.854  1.00 33.45  ? 285 GLU A OE1 1 
ATOM   2119 O OE2 . GLU A 1 284 ? -16.390 -34.425 28.255  1.00 30.99  ? 285 GLU A OE2 1 
ATOM   2120 N N   . TRP A 1 285 ? -20.958 -34.634 25.668  1.00 26.72  ? 286 TRP A N   1 
ATOM   2121 C CA  . TRP A 1 285 ? -20.742 -35.557 24.574  1.00 32.01  ? 286 TRP A CA  1 
ATOM   2122 C C   . TRP A 1 285 ? -21.473 -35.145 23.298  1.00 35.78  ? 286 TRP A C   1 
ATOM   2123 O O   . TRP A 1 285 ? -21.116 -35.581 22.201  1.00 32.35  ? 286 TRP A O   1 
ATOM   2124 C CB  . TRP A 1 285 ? -21.107 -36.977 25.009  1.00 26.15  ? 286 TRP A CB  1 
ATOM   2125 C CG  . TRP A 1 285 ? -20.213 -37.456 26.110  1.00 30.54  ? 286 TRP A CG  1 
ATOM   2126 C CD1 . TRP A 1 285 ? -20.468 -37.417 27.456  1.00 30.84  ? 286 TRP A CD1 1 
ATOM   2127 C CD2 . TRP A 1 285 ? -18.899 -38.013 25.968  1.00 26.55  ? 286 TRP A CD2 1 
ATOM   2128 N NE1 . TRP A 1 285 ? -19.401 -37.930 28.155  1.00 25.87  ? 286 TRP A NE1 1 
ATOM   2129 C CE2 . TRP A 1 285 ? -18.423 -38.300 27.268  1.00 28.66  ? 286 TRP A CE2 1 
ATOM   2130 C CE3 . TRP A 1 285 ? -18.079 -38.300 24.868  1.00 26.79  ? 286 TRP A CE3 1 
ATOM   2131 C CZ2 . TRP A 1 285 ? -17.161 -38.859 27.499  1.00 23.83  ? 286 TRP A CZ2 1 
ATOM   2132 C CZ3 . TRP A 1 285 ? -16.829 -38.865 25.099  1.00 25.35  ? 286 TRP A CZ3 1 
ATOM   2133 C CH2 . TRP A 1 285 ? -16.382 -39.137 26.406  1.00 24.43  ? 286 TRP A CH2 1 
ATOM   2134 N N   . HIS A 1 286 ? -22.454 -34.261 23.444  1.00 36.28  ? 287 HIS A N   1 
ATOM   2135 C CA  . HIS A 1 286 ? -23.293 -33.846 22.326  1.00 34.94  ? 287 HIS A CA  1 
ATOM   2136 C C   . HIS A 1 286 ? -22.669 -32.815 21.396  1.00 34.99  ? 287 HIS A C   1 
ATOM   2137 O O   . HIS A 1 286 ? -23.234 -32.526 20.349  1.00 44.11  ? 287 HIS A O   1 
ATOM   2138 C CB  . HIS A 1 286 ? -24.658 -33.367 22.831  1.00 37.41  ? 287 HIS A CB  1 
ATOM   2139 C CG  . HIS A 1 286 ? -25.461 -34.449 23.488  1.00 49.46  ? 287 HIS A CG  1 
ATOM   2140 N ND1 . HIS A 1 286 ? -26.178 -34.249 24.652  1.00 54.02  ? 287 HIS A ND1 1 
ATOM   2141 C CD2 . HIS A 1 286 ? -25.645 -35.748 23.150  1.00 46.20  ? 287 HIS A CD2 1 
ATOM   2142 C CE1 . HIS A 1 286 ? -26.773 -35.377 24.999  1.00 52.51  ? 287 HIS A CE1 1 
ATOM   2143 N NE2 . HIS A 1 286 ? -26.468 -36.302 24.103  1.00 59.58  ? 287 HIS A NE2 1 
ATOM   2144 N N   . VAL A 1 287 ? -21.513 -32.258 21.746  1.00 36.90  ? 288 VAL A N   1 
ATOM   2145 C CA  . VAL A 1 287 ? -20.858 -31.331 20.812  1.00 30.26  ? 288 VAL A CA  1 
ATOM   2146 C C   . VAL A 1 287 ? -19.875 -32.031 19.869  1.00 30.86  ? 288 VAL A C   1 
ATOM   2147 O O   . VAL A 1 287 ? -19.295 -31.403 18.987  1.00 34.34  ? 288 VAL A O   1 
ATOM   2148 C CB  . VAL A 1 287 ? -20.181 -30.128 21.508  1.00 31.90  ? 288 VAL A CB  1 
ATOM   2149 C CG1 . VAL A 1 287 ? -21.210 -29.341 22.318  1.00 34.01  ? 288 VAL A CG1 1 
ATOM   2150 C CG2 . VAL A 1 287 ? -19.009 -30.582 22.372  1.00 22.44  ? 288 VAL A CG2 1 
ATOM   2151 N N   . LEU A 1 288 ? -19.695 -33.333 20.046  1.00 28.61  ? 289 LEU A N   1 
ATOM   2152 C CA  . LEU A 1 288 ? -18.910 -34.092 19.090  1.00 31.47  ? 289 LEU A CA  1 
ATOM   2153 C C   . LEU A 1 288 ? -19.657 -34.111 17.752  1.00 35.32  ? 289 LEU A C   1 
ATOM   2154 O O   . LEU A 1 288 ? -20.843 -34.431 17.707  1.00 34.79  ? 289 LEU A O   1 
ATOM   2155 C CB  . LEU A 1 288 ? -18.620 -35.501 19.609  1.00 22.19  ? 289 LEU A CB  1 
ATOM   2156 C CG  . LEU A 1 288 ? -17.607 -35.556 20.769  1.00 26.54  ? 289 LEU A CG  1 
ATOM   2157 C CD1 . LEU A 1 288 ? -17.383 -36.977 21.262  1.00 16.75  ? 289 LEU A CD1 1 
ATOM   2158 C CD2 . LEU A 1 288 ? -16.268 -34.906 20.391  1.00 25.36  ? 289 LEU A CD2 1 
ATOM   2159 N N   . PRO A 1 289 ? -18.966 -33.741 16.662  1.00 34.08  ? 290 PRO A N   1 
ATOM   2160 C CA  . PRO A 1 289 ? -19.576 -33.592 15.327  1.00 33.67  ? 290 PRO A CA  1 
ATOM   2161 C C   . PRO A 1 289 ? -20.065 -34.902 14.712  1.00 34.58  ? 290 PRO A C   1 
ATOM   2162 O O   . PRO A 1 289 ? -21.027 -34.868 13.958  1.00 41.20  ? 290 PRO A O   1 
ATOM   2163 C CB  . PRO A 1 289 ? -18.445 -33.001 14.481  1.00 31.84  ? 290 PRO A CB  1 
ATOM   2164 C CG  . PRO A 1 289 ? -17.184 -33.437 15.180  1.00 40.19  ? 290 PRO A CG  1 
ATOM   2165 C CD  . PRO A 1 289 ? -17.518 -33.464 16.651  1.00 32.87  ? 290 PRO A CD  1 
ATOM   2166 N N   . GLN A 1 290 ? -19.430 -36.031 15.017  1.00 37.51  ? 291 GLN A N   1 
ATOM   2167 C CA  . GLN A 1 290 ? -19.866 -37.309 14.442  1.00 34.40  ? 291 GLN A CA  1 
ATOM   2168 C C   . GLN A 1 290 ? -19.796 -38.430 15.460  1.00 32.41  ? 291 GLN A C   1 
ATOM   2169 O O   . GLN A 1 290 ? -19.104 -38.323 16.473  1.00 36.76  ? 291 GLN A O   1 
ATOM   2170 C CB  . GLN A 1 290 ? -19.018 -37.693 13.215  1.00 41.43  ? 291 GLN A CB  1 
ATOM   2171 C CG  . GLN A 1 290 ? -19.040 -36.692 12.049  1.00 43.40  ? 291 GLN A CG  1 
ATOM   2172 C CD  . GLN A 1 290 ? -20.368 -36.667 11.292  1.00 53.77  ? 291 GLN A CD  1 
ATOM   2173 O OE1 . GLN A 1 290 ? -21.100 -37.661 11.262  1.00 48.56  ? 291 GLN A OE1 1 
ATOM   2174 N NE2 . GLN A 1 290 ? -20.682 -35.523 10.679  1.00 42.95  ? 291 GLN A NE2 1 
ATOM   2175 N N   . GLU A 1 291 ? -20.518 -39.506 15.175  1.00 32.38  ? 292 GLU A N   1 
ATOM   2176 C CA  . GLU A 1 291 ? -20.495 -40.727 15.971  1.00 29.72  ? 292 GLU A CA  1 
ATOM   2177 C C   . GLU A 1 291 ? -19.053 -41.230 16.041  1.00 35.49  ? 292 GLU A C   1 
ATOM   2178 O O   . GLU A 1 291 ? -18.367 -41.267 15.020  1.00 37.52  ? 292 GLU A O   1 
ATOM   2179 C CB  . GLU A 1 291 ? -21.397 -41.767 15.297  1.00 33.26  ? 292 GLU A CB  1 
ATOM   2180 C CG  . GLU A 1 291 ? -21.564 -43.087 16.031  1.00 48.14  ? 292 GLU A CG  1 
ATOM   2181 C CD  . GLU A 1 291 ? -22.407 -44.102 15.245  1.00 55.58  ? 292 GLU A CD  1 
ATOM   2182 O OE1 . GLU A 1 291 ? -22.631 -43.894 14.029  1.00 50.51  ? 292 GLU A OE1 1 
ATOM   2183 O OE2 . GLU A 1 291 ? -22.841 -45.111 15.846  1.00 61.30  ? 292 GLU A OE2 1 
ATOM   2184 N N   . SER A 1 292 ? -18.589 -41.611 17.232  1.00 27.52  ? 293 SER A N   1 
ATOM   2185 C CA  . SER A 1 292 ? -17.175 -41.946 17.415  1.00 25.58  ? 293 SER A CA  1 
ATOM   2186 C C   . SER A 1 292 ? -16.864 -42.749 18.683  1.00 27.39  ? 293 SER A C   1 
ATOM   2187 O O   . SER A 1 292 ? -17.731 -42.980 19.522  1.00 32.07  ? 293 SER A O   1 
ATOM   2188 C CB  . SER A 1 292 ? -16.330 -40.665 17.415  1.00 24.93  ? 293 SER A CB  1 
ATOM   2189 O OG  . SER A 1 292 ? -16.588 -39.881 18.573  1.00 27.41  ? 293 SER A OG  1 
ATOM   2190 N N   . VAL A 1 293 ? -15.624 -43.217 18.783  1.00 27.30  ? 294 VAL A N   1 
ATOM   2191 C CA  . VAL A 1 293 ? -15.042 -43.613 20.059  1.00 23.38  ? 294 VAL A CA  1 
ATOM   2192 C C   . VAL A 1 293 ? -13.657 -42.982 20.117  1.00 24.64  ? 294 VAL A C   1 
ATOM   2193 O O   . VAL A 1 293 ? -13.134 -42.544 19.081  1.00 23.18  ? 294 VAL A O   1 
ATOM   2194 C CB  . VAL A 1 293 ? -14.968 -45.150 20.261  1.00 24.79  ? 294 VAL A CB  1 
ATOM   2195 C CG1 . VAL A 1 293 ? -16.369 -45.755 20.300  1.00 26.24  ? 294 VAL A CG1 1 
ATOM   2196 C CG2 . VAL A 1 293 ? -14.095 -45.829 19.198  1.00 23.02  ? 294 VAL A CG2 1 
ATOM   2197 N N   . PHE A 1 294 ? -13.082 -42.905 21.317  1.00 24.25  ? 295 PHE A N   1 
ATOM   2198 C CA  . PHE A 1 294 ? -11.747 -42.328 21.522  1.00 18.76  ? 295 PHE A CA  1 
ATOM   2199 C C   . PHE A 1 294 ? -11.675 -40.869 21.051  1.00 22.92  ? 295 PHE A C   1 
ATOM   2200 O O   . PHE A 1 294 ? -10.644 -40.418 20.525  1.00 24.32  ? 295 PHE A O   1 
ATOM   2201 C CB  . PHE A 1 294 ? -10.652 -43.189 20.849  1.00 17.57  ? 295 PHE A CB  1 
ATOM   2202 C CG  . PHE A 1 294 ? -9.384  -43.324 21.671  1.00 20.30  ? 295 PHE A CG  1 
ATOM   2203 C CD1 . PHE A 1 294 ? -8.837  -42.226 22.326  1.00 17.45  ? 295 PHE A CD1 1 
ATOM   2204 C CD2 . PHE A 1 294 ? -8.749  -44.553 21.800  1.00 18.14  ? 295 PHE A CD2 1 
ATOM   2205 C CE1 . PHE A 1 294 ? -7.681  -42.343 23.089  1.00 18.18  ? 295 PHE A CE1 1 
ATOM   2206 C CE2 . PHE A 1 294 ? -7.585  -44.671 22.551  1.00 19.72  ? 295 PHE A CE2 1 
ATOM   2207 C CZ  . PHE A 1 294 ? -7.059  -43.565 23.212  1.00 15.67  ? 295 PHE A CZ  1 
ATOM   2208 N N   . ARG A 1 295 ? -12.780 -40.142 21.217  1.00 18.05  ? 296 ARG A N   1 
ATOM   2209 C CA  . ARG A 1 295 ? -12.815 -38.712 20.905  1.00 21.16  ? 296 ARG A CA  1 
ATOM   2210 C C   . ARG A 1 295 ? -13.485 -37.991 22.052  1.00 23.12  ? 296 ARG A C   1 
ATOM   2211 O O   . ARG A 1 295 ? -14.506 -38.440 22.563  1.00 20.28  ? 296 ARG A O   1 
ATOM   2212 C CB  . ARG A 1 295 ? -13.585 -38.410 19.614  1.00 18.49  ? 296 ARG A CB  1 
ATOM   2213 C CG  . ARG A 1 295 ? -12.884 -38.822 18.327  1.00 23.57  ? 296 ARG A CG  1 
ATOM   2214 C CD  . ARG A 1 295 ? -11.617 -38.016 18.095  1.00 25.95  ? 296 ARG A CD  1 
ATOM   2215 N NE  . ARG A 1 295 ? -10.946 -38.439 16.875  1.00 28.30  ? 296 ARG A NE  1 
ATOM   2216 C CZ  . ARG A 1 295 ? -10.158 -39.506 16.775  1.00 27.16  ? 296 ARG A CZ  1 
ATOM   2217 N NH1 . ARG A 1 295 ? -9.926  -40.272 17.837  1.00 21.89  ? 296 ARG A NH1 1 
ATOM   2218 N NH2 . ARG A 1 295 ? -9.602  -39.807 15.606  1.00 22.49  ? 296 ARG A NH2 1 
ATOM   2219 N N   . PHE A 1 296 ? -12.929 -36.854 22.443  1.00 21.88  ? 297 PHE A N   1 
ATOM   2220 C CA  . PHE A 1 296 ? -13.447 -36.146 23.604  1.00 22.59  ? 297 PHE A CA  1 
ATOM   2221 C C   . PHE A 1 296 ? -13.655 -34.683 23.267  1.00 24.31  ? 297 PHE A C   1 
ATOM   2222 O O   . PHE A 1 296 ? -12.880 -34.095 22.510  1.00 25.76  ? 297 PHE A O   1 
ATOM   2223 C CB  . PHE A 1 296 ? -12.491 -36.340 24.775  1.00 18.27  ? 297 PHE A CB  1 
ATOM   2224 C CG  . PHE A 1 296 ? -11.853 -37.684 24.782  1.00 17.67  ? 297 PHE A CG  1 
ATOM   2225 C CD1 . PHE A 1 296 ? -12.599 -38.811 25.074  1.00 18.03  ? 297 PHE A CD1 1 
ATOM   2226 C CD2 . PHE A 1 296 ? -10.518 -37.833 24.451  1.00 19.89  ? 297 PHE A CD2 1 
ATOM   2227 C CE1 . PHE A 1 296 ? -12.019 -40.074 25.055  1.00 20.47  ? 297 PHE A CE1 1 
ATOM   2228 C CE2 . PHE A 1 296 ? -9.926  -39.093 24.438  1.00 19.79  ? 297 PHE A CE2 1 
ATOM   2229 C CZ  . PHE A 1 296 ? -10.678 -40.212 24.739  1.00 19.51  ? 297 PHE A CZ  1 
ATOM   2230 N N   . SER A 1 297 ? -14.709 -34.105 23.829  1.00 24.71  ? 298 SER A N   1 
ATOM   2231 C CA  . SER A 1 297 ? -15.180 -32.792 23.404  1.00 27.45  ? 298 SER A CA  1 
ATOM   2232 C C   . SER A 1 297 ? -14.209 -31.652 23.674  1.00 26.14  ? 298 SER A C   1 
ATOM   2233 O O   . SER A 1 297 ? -13.908 -30.873 22.777  1.00 28.28  ? 298 SER A O   1 
ATOM   2234 C CB  . SER A 1 297 ? -16.536 -32.487 24.040  1.00 23.34  ? 298 SER A CB  1 
ATOM   2235 O OG  . SER A 1 297 ? -17.525 -33.332 23.482  1.00 30.43  ? 298 SER A OG  1 
ATOM   2236 N N   . PHE A 1 298 ? -13.732 -31.547 24.911  1.00 23.00  ? 299 PHE A N   1 
ATOM   2237 C CA  . PHE A 1 298 ? -12.884 -30.426 25.292  1.00 23.92  ? 299 PHE A CA  1 
ATOM   2238 C C   . PHE A 1 298 ? -11.469 -30.868 25.630  1.00 27.99  ? 299 PHE A C   1 
ATOM   2239 O O   . PHE A 1 298 ? -11.217 -31.479 26.679  1.00 21.70  ? 299 PHE A O   1 
ATOM   2240 C CB  . PHE A 1 298 ? -13.542 -29.610 26.410  1.00 23.64  ? 299 PHE A CB  1 
ATOM   2241 C CG  . PHE A 1 298 ? -14.891 -29.098 26.026  1.00 25.23  ? 299 PHE A CG  1 
ATOM   2242 C CD1 . PHE A 1 298 ? -15.009 -28.039 25.132  1.00 27.98  ? 299 PHE A CD1 1 
ATOM   2243 C CD2 . PHE A 1 298 ? -16.045 -29.718 26.490  1.00 22.29  ? 299 PHE A CD2 1 
ATOM   2244 C CE1 . PHE A 1 298 ? -16.264 -27.578 24.722  1.00 23.47  ? 299 PHE A CE1 1 
ATOM   2245 C CE2 . PHE A 1 298 ? -17.301 -29.269 26.091  1.00 25.92  ? 299 PHE A CE2 1 
ATOM   2246 C CZ  . PHE A 1 298 ? -17.410 -28.194 25.205  1.00 24.79  ? 299 PHE A CZ  1 
ATOM   2247 N N   . VAL A 1 299 ? -10.557 -30.572 24.704  1.00 22.10  ? 300 VAL A N   1 
ATOM   2248 C CA  . VAL A 1 299 ? -9.169  -31.009 24.807  1.00 22.42  ? 300 VAL A CA  1 
ATOM   2249 C C   . VAL A 1 299 ? -8.245  -29.814 24.563  1.00 20.22  ? 300 VAL A C   1 
ATOM   2250 O O   . VAL A 1 299 ? -8.722  -28.744 24.198  1.00 21.24  ? 300 VAL A O   1 
ATOM   2251 C CB  . VAL A 1 299 ? -8.880  -32.171 23.819  1.00 23.10  ? 300 VAL A CB  1 
ATOM   2252 C CG1 . VAL A 1 299 ? -9.770  -33.376 24.139  1.00 18.44  ? 300 VAL A CG1 1 
ATOM   2253 C CG2 . VAL A 1 299 ? -9.051  -31.711 22.373  1.00 20.54  ? 300 VAL A CG2 1 
ATOM   2254 N N   . PRO A 1 300 ? -6.930  -29.975 24.799  1.00 24.37  ? 301 PRO A N   1 
ATOM   2255 C CA  . PRO A 1 300 ? -6.001  -28.882 24.476  1.00 25.07  ? 301 PRO A CA  1 
ATOM   2256 C C   . PRO A 1 300 ? -6.172  -28.327 23.056  1.00 30.22  ? 301 PRO A C   1 
ATOM   2257 O O   . PRO A 1 300 ? -6.373  -29.073 22.094  1.00 25.83  ? 301 PRO A O   1 
ATOM   2258 C CB  . PRO A 1 300 ? -4.633  -29.550 24.613  1.00 23.26  ? 301 PRO A CB  1 
ATOM   2259 C CG  . PRO A 1 300 ? -4.846  -30.567 25.681  1.00 26.00  ? 301 PRO A CG  1 
ATOM   2260 C CD  . PRO A 1 300 ? -6.234  -31.101 25.456  1.00 19.57  ? 301 PRO A CD  1 
ATOM   2261 N N   . VAL A 1 301 ? -6.110  -27.007 22.939  1.00 28.76  ? 302 VAL A N   1 
ATOM   2262 C CA  . VAL A 1 301 ? -6.291  -26.349 21.661  1.00 28.19  ? 302 VAL A CA  1 
ATOM   2263 C C   . VAL A 1 301 ? -4.948  -25.784 21.180  1.00 34.31  ? 302 VAL A C   1 
ATOM   2264 O O   . VAL A 1 301 ? -4.133  -25.318 21.977  1.00 32.40  ? 302 VAL A O   1 
ATOM   2265 C CB  . VAL A 1 301 ? -7.398  -25.249 21.744  1.00 33.01  ? 302 VAL A CB  1 
ATOM   2266 C CG1 . VAL A 1 301 ? -6.977  -24.107 22.667  1.00 33.69  ? 302 VAL A CG1 1 
ATOM   2267 C CG2 . VAL A 1 301 ? -7.748  -24.719 20.361  1.00 35.82  ? 302 VAL A CG2 1 
ATOM   2268 N N   . VAL A 1 302 ? -4.693  -25.881 19.880  1.00 38.19  ? 303 VAL A N   1 
ATOM   2269 C CA  . VAL A 1 302 ? -3.486  -25.296 19.306  1.00 37.52  ? 303 VAL A CA  1 
ATOM   2270 C C   . VAL A 1 302 ? -3.826  -23.879 18.893  1.00 38.56  ? 303 VAL A C   1 
ATOM   2271 O O   . VAL A 1 302 ? -4.544  -23.668 17.914  1.00 42.58  ? 303 VAL A O   1 
ATOM   2272 C CB  . VAL A 1 302 ? -3.012  -26.067 18.062  1.00 39.71  ? 303 VAL A CB  1 
ATOM   2273 C CG1 . VAL A 1 302 ? -1.689  -25.508 17.568  1.00 36.03  ? 303 VAL A CG1 1 
ATOM   2274 C CG2 . VAL A 1 302 ? -2.895  -27.554 18.365  1.00 37.39  ? 303 VAL A CG2 1 
ATOM   2275 N N   . ASP A 1 303 ? -3.334  -22.903 19.640  1.00 38.42  ? 304 ASP A N   1 
ATOM   2276 C CA  . ASP A 1 303 ? -3.734  -21.524 19.396  1.00 42.73  ? 304 ASP A CA  1 
ATOM   2277 C C   . ASP A 1 303 ? -2.540  -20.575 19.307  1.00 44.58  ? 304 ASP A C   1 
ATOM   2278 O O   . ASP A 1 303 ? -2.713  -19.360 19.237  1.00 50.09  ? 304 ASP A O   1 
ATOM   2279 C CB  . ASP A 1 303 ? -4.710  -21.057 20.481  1.00 41.11  ? 304 ASP A CB  1 
ATOM   2280 C CG  . ASP A 1 303 ? -4.028  -20.813 21.819  1.00 40.98  ? 304 ASP A CG  1 
ATOM   2281 O OD1 . ASP A 1 303 ? -2.955  -21.396 22.071  1.00 40.45  ? 304 ASP A OD1 1 
ATOM   2282 O OD2 . ASP A 1 303 ? -4.573  -20.033 22.626  1.00 50.49  ? 304 ASP A OD2 1 
ATOM   2283 N N   . GLY A 1 304 ? -1.333  -21.132 19.326  1.00 39.12  ? 305 GLY A N   1 
ATOM   2284 C CA  . GLY A 1 304 ? -0.131  -20.328 19.225  1.00 37.31  ? 305 GLY A CA  1 
ATOM   2285 C C   . GLY A 1 304 ? 0.471   -19.929 20.559  1.00 44.74  ? 305 GLY A C   1 
ATOM   2286 O O   . GLY A 1 304 ? 1.592   -19.420 20.602  1.00 46.74  ? 305 GLY A O   1 
ATOM   2287 N N   . ASP A 1 305 ? -0.259  -20.173 21.647  1.00 41.02  ? 306 ASP A N   1 
ATOM   2288 C CA  . ASP A 1 305 ? 0.175   -19.763 22.983  1.00 38.02  ? 306 ASP A CA  1 
ATOM   2289 C C   . ASP A 1 305 ? 0.905   -20.882 23.754  1.00 43.86  ? 306 ASP A C   1 
ATOM   2290 O O   . ASP A 1 305 ? 2.128   -20.998 23.641  1.00 40.78  ? 306 ASP A O   1 
ATOM   2291 C CB  . ASP A 1 305 ? -1.010  -19.205 23.781  1.00 37.18  ? 306 ASP A CB  1 
ATOM   2292 C CG  . ASP A 1 305 ? -0.587  -18.573 25.098  1.00 47.53  ? 306 ASP A CG  1 
ATOM   2293 O OD1 . ASP A 1 305 ? 0.637   -18.480 25.358  1.00 39.59  ? 306 ASP A OD1 1 
ATOM   2294 O OD2 . ASP A 1 305 ? -1.484  -18.151 25.866  1.00 52.97  ? 306 ASP A OD2 1 
ATOM   2295 N N   . PHE A 1 306 ? 0.175   -21.678 24.546  1.00 38.70  ? 307 PHE A N   1 
ATOM   2296 C CA  . PHE A 1 306 ? 0.764   -22.843 25.224  1.00 31.70  ? 307 PHE A CA  1 
ATOM   2297 C C   . PHE A 1 306 ? 1.490   -23.724 24.205  1.00 37.55  ? 307 PHE A C   1 
ATOM   2298 O O   . PHE A 1 306 ? 2.623   -24.152 24.424  1.00 40.20  ? 307 PHE A O   1 
ATOM   2299 C CB  . PHE A 1 306 ? -0.313  -23.669 25.934  1.00 35.00  ? 307 PHE A CB  1 
ATOM   2300 C CG  . PHE A 1 306 ? 0.235   -24.683 26.915  1.00 30.59  ? 307 PHE A CG  1 
ATOM   2301 C CD1 . PHE A 1 306 ? 0.795   -25.877 26.472  1.00 27.47  ? 307 PHE A CD1 1 
ATOM   2302 C CD2 . PHE A 1 306 ? 0.175   -24.444 28.281  1.00 30.22  ? 307 PHE A CD2 1 
ATOM   2303 C CE1 . PHE A 1 306 ? 1.299   -26.807 27.375  1.00 29.22  ? 307 PHE A CE1 1 
ATOM   2304 C CE2 . PHE A 1 306 ? 0.671   -25.372 29.199  1.00 26.08  ? 307 PHE A CE2 1 
ATOM   2305 C CZ  . PHE A 1 306 ? 1.232   -26.553 28.747  1.00 26.19  ? 307 PHE A CZ  1 
ATOM   2306 N N   . LEU A 1 307 ? 0.818   -23.992 23.091  1.00 33.65  ? 308 LEU A N   1 
ATOM   2307 C CA  . LEU A 1 307 ? 1.422   -24.691 21.972  1.00 39.58  ? 308 LEU A CA  1 
ATOM   2308 C C   . LEU A 1 307 ? 1.545   -23.719 20.798  1.00 40.30  ? 308 LEU A C   1 
ATOM   2309 O O   . LEU A 1 307 ? 0.539   -23.333 20.202  1.00 44.59  ? 308 LEU A O   1 
ATOM   2310 C CB  . LEU A 1 307 ? 0.552   -25.881 21.575  1.00 35.62  ? 308 LEU A CB  1 
ATOM   2311 C CG  . LEU A 1 307 ? 0.276   -26.911 22.669  1.00 41.43  ? 308 LEU A CG  1 
ATOM   2312 C CD1 . LEU A 1 307 ? -0.815  -27.867 22.213  1.00 33.84  ? 308 LEU A CD1 1 
ATOM   2313 C CD2 . LEU A 1 307 ? 1.556   -27.670 23.051  1.00 30.55  ? 308 LEU A CD2 1 
ATOM   2314 N N   . SER A 1 308 ? 2.769   -23.316 20.471  1.00 34.30  ? 309 SER A N   1 
ATOM   2315 C CA  . SER A 1 308 ? 2.984   -22.352 19.393  1.00 44.40  ? 309 SER A CA  1 
ATOM   2316 C C   . SER A 1 308 ? 2.684   -22.954 18.016  1.00 43.27  ? 309 SER A C   1 
ATOM   2317 O O   . SER A 1 308 ? 2.444   -22.233 17.058  1.00 50.15  ? 309 SER A O   1 
ATOM   2318 C CB  . SER A 1 308 ? 4.402   -21.784 19.442  1.00 38.91  ? 309 SER A CB  1 
ATOM   2319 O OG  . SER A 1 308 ? 5.361   -22.812 19.320  1.00 45.78  ? 309 SER A OG  1 
ATOM   2320 N N   . ASP A 1 309 ? 2.684   -24.277 17.930  1.00 45.10  ? 310 ASP A N   1 
ATOM   2321 C CA  . ASP A 1 309 ? 2.293   -24.967 16.708  1.00 44.33  ? 310 ASP A CA  1 
ATOM   2322 C C   . ASP A 1 309 ? 1.636   -26.284 17.110  1.00 40.79  ? 310 ASP A C   1 
ATOM   2323 O O   . ASP A 1 309 ? 1.514   -26.575 18.291  1.00 40.13  ? 310 ASP A O   1 
ATOM   2324 C CB  . ASP A 1 309 ? 3.524   -25.236 15.841  1.00 47.92  ? 310 ASP A CB  1 
ATOM   2325 C CG  . ASP A 1 309 ? 3.201   -25.304 14.352  1.00 52.63  ? 310 ASP A CG  1 
ATOM   2326 O OD1 . ASP A 1 309 ? 2.064   -25.683 13.986  1.00 45.33  ? 310 ASP A OD1 1 
ATOM   2327 O OD2 . ASP A 1 309 ? 4.100   -24.977 13.546  1.00 53.26  ? 310 ASP A OD2 1 
ATOM   2328 N N   . THR A 1 310 ? 1.204   -27.073 16.134  1.00 40.30  ? 311 THR A N   1 
ATOM   2329 C CA  . THR A 1 310 ? 0.721   -28.417 16.418  1.00 39.03  ? 311 THR A CA  1 
ATOM   2330 C C   . THR A 1 310 ? 1.837   -29.230 17.080  1.00 39.52  ? 311 THR A C   1 
ATOM   2331 O O   . THR A 1 310 ? 3.022   -28.968 16.855  1.00 41.00  ? 311 THR A O   1 
ATOM   2332 C CB  . THR A 1 310 ? 0.263   -29.139 15.134  1.00 44.58  ? 311 THR A CB  1 
ATOM   2333 O OG1 . THR A 1 310 ? 1.405   -29.486 14.341  1.00 44.53  ? 311 THR A OG1 1 
ATOM   2334 C CG2 . THR A 1 310 ? -0.671  -28.251 14.326  1.00 34.09  ? 311 THR A CG2 1 
ATOM   2335 N N   . PRO A 1 311 ? 1.469   -30.206 17.921  1.00 38.37  ? 312 PRO A N   1 
ATOM   2336 C CA  . PRO A 1 311 ? 2.517   -31.029 18.533  1.00 36.87  ? 312 PRO A CA  1 
ATOM   2337 C C   . PRO A 1 311 ? 3.323   -31.781 17.473  1.00 37.32  ? 312 PRO A C   1 
ATOM   2338 O O   . PRO A 1 311 ? 4.529   -31.954 17.629  1.00 37.83  ? 312 PRO A O   1 
ATOM   2339 C CB  . PRO A 1 311 ? 1.724   -31.998 19.417  1.00 32.85  ? 312 PRO A CB  1 
ATOM   2340 C CG  . PRO A 1 311 ? 0.467   -31.243 19.758  1.00 32.08  ? 312 PRO A CG  1 
ATOM   2341 C CD  . PRO A 1 311 ? 0.140   -30.472 18.503  1.00 36.52  ? 312 PRO A CD  1 
ATOM   2342 N N   A GLU A 1 312 ? 2.655   -32.216 16.408  0.45 40.47  ? 313 GLU A N   1 
ATOM   2343 N N   B GLU A 1 312 ? 2.653   -32.213 16.409  0.55 40.47  ? 313 GLU A N   1 
ATOM   2344 C CA  A GLU A 1 312 ? 3.334   -32.884 15.301  0.45 41.44  ? 313 GLU A CA  1 
ATOM   2345 C CA  B GLU A 1 312 ? 3.312   -32.865 15.279  0.55 41.44  ? 313 GLU A CA  1 
ATOM   2346 C C   A GLU A 1 312 ? 4.456   -32.011 14.730  0.45 43.11  ? 313 GLU A C   1 
ATOM   2347 C C   B GLU A 1 312 ? 4.456   -32.004 14.755  0.55 43.10  ? 313 GLU A C   1 
ATOM   2348 O O   A GLU A 1 312 ? 5.579   -32.479 14.542  0.45 44.39  ? 313 GLU A O   1 
ATOM   2349 O O   B GLU A 1 312 ? 5.588   -32.469 14.618  0.55 44.36  ? 313 GLU A O   1 
ATOM   2350 C CB  A GLU A 1 312 ? 2.339   -33.281 14.202  0.45 40.97  ? 313 GLU A CB  1 
ATOM   2351 C CB  B GLU A 1 312 ? 2.302   -33.125 14.160  0.55 40.94  ? 313 GLU A CB  1 
ATOM   2352 C CG  A GLU A 1 312 ? 1.476   -34.508 14.527  0.45 40.40  ? 313 GLU A CG  1 
ATOM   2353 C CG  B GLU A 1 312 ? 2.888   -33.734 12.896  0.55 40.68  ? 313 GLU A CG  1 
ATOM   2354 C CD  A GLU A 1 312 ? 0.140   -34.159 15.185  0.45 41.13  ? 313 GLU A CD  1 
ATOM   2355 C CD  B GLU A 1 312 ? 1.904   -33.709 11.741  0.55 42.16  ? 313 GLU A CD  1 
ATOM   2356 O OE1 A GLU A 1 312 ? -0.814  -34.955 15.036  0.45 41.54  ? 313 GLU A OE1 1 
ATOM   2357 O OE1 B GLU A 1 312 ? 0.762   -33.245 11.945  0.55 38.56  ? 313 GLU A OE1 1 
ATOM   2358 O OE2 A GLU A 1 312 ? 0.040   -33.102 15.849  0.45 34.24  ? 313 GLU A OE2 1 
ATOM   2359 O OE2 B GLU A 1 312 ? 2.272   -34.149 10.630  0.55 45.91  ? 313 GLU A OE2 1 
ATOM   2360 N N   . ALA A 1 313 ? 4.152   -30.742 14.474  1.00 39.34  ? 314 ALA A N   1 
ATOM   2361 C CA  . ALA A 1 313 ? 5.153   -29.801 13.988  1.00 40.75  ? 314 ALA A CA  1 
ATOM   2362 C C   . ALA A 1 313 ? 6.260   -29.591 15.016  1.00 43.85  ? 314 ALA A C   1 
ATOM   2363 O O   . ALA A 1 313 ? 7.445   -29.706 14.692  1.00 43.87  ? 314 ALA A O   1 
ATOM   2364 C CB  . ALA A 1 313 ? 4.502   -28.463 13.629  1.00 41.36  ? 314 ALA A CB  1 
ATOM   2365 N N   . LEU A 1 314 ? 5.864   -29.286 16.255  1.00 45.66  ? 315 LEU A N   1 
ATOM   2366 C CA  . LEU A 1 314 ? 6.813   -29.002 17.330  1.00 37.09  ? 315 LEU A CA  1 
ATOM   2367 C C   . LEU A 1 314 ? 7.752   -30.178 17.567  1.00 38.04  ? 315 LEU A C   1 
ATOM   2368 O O   . LEU A 1 314 ? 8.937   -29.996 17.862  1.00 38.97  ? 315 LEU A O   1 
ATOM   2369 C CB  . LEU A 1 314 ? 6.077   -28.655 18.624  1.00 40.59  ? 315 LEU A CB  1 
ATOM   2370 C CG  . LEU A 1 314 ? 5.332   -27.326 18.646  1.00 43.56  ? 315 LEU A CG  1 
ATOM   2371 C CD1 . LEU A 1 314 ? 4.705   -27.097 20.012  1.00 36.99  ? 315 LEU A CD1 1 
ATOM   2372 C CD2 . LEU A 1 314 ? 6.274   -26.188 18.281  1.00 44.42  ? 315 LEU A CD2 1 
ATOM   2373 N N   . ILE A 1 315 ? 7.207   -31.381 17.439  1.00 36.19  ? 316 ILE A N   1 
ATOM   2374 C CA  . ILE A 1 315 ? 7.998   -32.597 17.537  1.00 39.95  ? 316 ILE A CA  1 
ATOM   2375 C C   . ILE A 1 315 ? 9.003   -32.670 16.393  1.00 40.32  ? 316 ILE A C   1 
ATOM   2376 O O   . ILE A 1 315 ? 10.207  -32.723 16.629  1.00 44.96  ? 316 ILE A O   1 
ATOM   2377 C CB  . ILE A 1 315 ? 7.098   -33.857 17.579  1.00 37.42  ? 316 ILE A CB  1 
ATOM   2378 C CG1 . ILE A 1 315 ? 6.490   -34.014 18.969  1.00 38.94  ? 316 ILE A CG1 1 
ATOM   2379 C CG2 . ILE A 1 315 ? 7.889   -35.106 17.281  1.00 34.48  ? 316 ILE A CG2 1 
ATOM   2380 C CD1 . ILE A 1 315 ? 5.203   -34.798 18.976  1.00 33.67  ? 316 ILE A CD1 1 
ATOM   2381 N N   . ASN A 1 316 ? 8.507   -32.641 15.157  1.00 51.63  ? 317 ASN A N   1 
ATOM   2382 C CA  . ASN A 1 316 ? 9.365   -32.749 13.973  1.00 48.94  ? 317 ASN A CA  1 
ATOM   2383 C C   . ASN A 1 316 ? 10.510  -31.735 13.913  1.00 47.69  ? 317 ASN A C   1 
ATOM   2384 O O   . ASN A 1 316 ? 11.550  -32.015 13.323  1.00 56.86  ? 317 ASN A O   1 
ATOM   2385 C CB  . ASN A 1 316 ? 8.536   -32.675 12.690  1.00 46.15  ? 317 ASN A CB  1 
ATOM   2386 C CG  . ASN A 1 316 ? 7.544   -33.812 12.572  1.00 52.93  ? 317 ASN A CG  1 
ATOM   2387 O OD1 . ASN A 1 316 ? 7.688   -34.857 13.215  1.00 56.06  ? 317 ASN A OD1 1 
ATOM   2388 N ND2 . ASN A 1 316 ? 6.522   -33.615 11.746  1.00 55.78  ? 317 ASN A ND2 1 
ATOM   2389 N N   . ALA A 1 317 ? 10.328  -30.580 14.551  1.00 50.93  ? 318 ALA A N   1 
ATOM   2390 C CA  . ALA A 1 317 ? 11.292  -29.484 14.467  1.00 46.95  ? 318 ALA A CA  1 
ATOM   2391 C C   . ALA A 1 317 ? 12.130  -29.262 15.730  1.00 51.65  ? 318 ALA A C   1 
ATOM   2392 O O   . ALA A 1 317 ? 12.915  -28.309 15.799  1.00 52.04  ? 318 ALA A O   1 
ATOM   2393 C CB  . ALA A 1 317 ? 10.569  -28.188 14.093  1.00 43.38  ? 318 ALA A CB  1 
ATOM   2394 N N   . GLY A 1 318 ? 11.976  -30.128 16.726  1.00 49.62  ? 319 GLY A N   1 
ATOM   2395 C CA  . GLY A 1 318 ? 12.622  -29.905 18.012  1.00 37.36  ? 319 GLY A CA  1 
ATOM   2396 C C   . GLY A 1 318 ? 14.026  -30.474 18.144  1.00 41.98  ? 319 GLY A C   1 
ATOM   2397 O O   . GLY A 1 318 ? 14.385  -31.442 17.470  1.00 45.58  ? 319 GLY A O   1 
ATOM   2398 N N   . ASP A 1 319 ? 14.821  -29.854 19.016  1.00 37.58  ? 320 ASP A N   1 
ATOM   2399 C CA  . ASP A 1 319 ? 16.143  -30.348 19.379  1.00 43.63  ? 320 ASP A CA  1 
ATOM   2400 C C   . ASP A 1 319 ? 15.984  -30.960 20.767  1.00 44.73  ? 320 ASP A C   1 
ATOM   2401 O O   . ASP A 1 319 ? 15.701  -30.250 21.733  1.00 42.42  ? 320 ASP A O   1 
ATOM   2402 C CB  . ASP A 1 319 ? 17.158  -29.187 19.385  1.00 40.28  ? 320 ASP A CB  1 
ATOM   2403 C CG  . ASP A 1 319 ? 18.551  -29.591 19.894  1.00 51.11  ? 320 ASP A CG  1 
ATOM   2404 O OD1 . ASP A 1 319 ? 18.715  -30.688 20.473  1.00 52.23  ? 320 ASP A OD1 1 
ATOM   2405 O OD2 . ASP A 1 319 ? 19.500  -28.782 19.732  1.00 57.71  ? 320 ASP A OD2 1 
ATOM   2406 N N   . PHE A 1 320 ? 16.168  -32.275 20.866  1.00 40.53  ? 321 PHE A N   1 
ATOM   2407 C CA  . PHE A 1 320 ? 15.905  -32.976 22.121  1.00 34.15  ? 321 PHE A CA  1 
ATOM   2408 C C   . PHE A 1 320 ? 17.144  -33.622 22.734  1.00 41.70  ? 321 PHE A C   1 
ATOM   2409 O O   . PHE A 1 320 ? 17.039  -34.611 23.472  1.00 38.14  ? 321 PHE A O   1 
ATOM   2410 C CB  . PHE A 1 320 ? 14.792  -34.012 21.937  1.00 31.78  ? 321 PHE A CB  1 
ATOM   2411 C CG  . PHE A 1 320 ? 13.473  -33.412 21.531  1.00 37.41  ? 321 PHE A CG  1 
ATOM   2412 C CD1 . PHE A 1 320 ? 12.650  -32.809 22.473  1.00 30.90  ? 321 PHE A CD1 1 
ATOM   2413 C CD2 . PHE A 1 320 ? 13.065  -33.435 20.206  1.00 34.59  ? 321 PHE A CD2 1 
ATOM   2414 C CE1 . PHE A 1 320 ? 11.441  -32.253 22.106  1.00 30.60  ? 321 PHE A CE1 1 
ATOM   2415 C CE2 . PHE A 1 320 ? 11.854  -32.871 19.826  1.00 37.44  ? 321 PHE A CE2 1 
ATOM   2416 C CZ  . PHE A 1 320 ? 11.041  -32.282 20.784  1.00 38.03  ? 321 PHE A CZ  1 
ATOM   2417 N N   . HIS A 1 321 ? 18.317  -33.073 22.426  1.00 39.99  ? 322 HIS A N   1 
ATOM   2418 C CA  . HIS A 1 321 ? 19.525  -33.477 23.137  1.00 45.55  ? 322 HIS A CA  1 
ATOM   2419 C C   . HIS A 1 321 ? 19.363  -33.092 24.600  1.00 42.42  ? 322 HIS A C   1 
ATOM   2420 O O   . HIS A 1 321 ? 18.813  -32.030 24.912  1.00 41.22  ? 322 HIS A O   1 
ATOM   2421 C CB  . HIS A 1 321 ? 20.780  -32.827 22.535  1.00 43.13  ? 322 HIS A CB  1 
ATOM   2422 C CG  . HIS A 1 321 ? 21.186  -33.419 21.222  1.00 40.16  ? 322 HIS A CG  1 
ATOM   2423 N ND1 . HIS A 1 321 ? 20.806  -32.879 20.012  1.00 37.83  ? 322 HIS A ND1 1 
ATOM   2424 C CD2 . HIS A 1 321 ? 21.907  -34.529 20.930  1.00 35.53  ? 322 HIS A CD2 1 
ATOM   2425 C CE1 . HIS A 1 321 ? 21.285  -33.623 19.030  1.00 40.44  ? 322 HIS A CE1 1 
ATOM   2426 N NE2 . HIS A 1 321 ? 21.958  -34.629 19.562  1.00 38.10  ? 322 HIS A NE2 1 
ATOM   2427 N N   . GLY A 1 322 ? 19.816  -33.968 25.492  1.00 38.52  ? 323 GLY A N   1 
ATOM   2428 C CA  . GLY A 1 322 ? 19.698  -33.726 26.919  1.00 41.24  ? 323 GLY A CA  1 
ATOM   2429 C C   . GLY A 1 322 ? 18.464  -34.369 27.530  1.00 40.91  ? 323 GLY A C   1 
ATOM   2430 O O   . GLY A 1 322 ? 18.336  -34.450 28.749  1.00 45.29  ? 323 GLY A O   1 
ATOM   2431 N N   . LEU A 1 323 ? 17.557  -34.834 26.675  1.00 37.18  ? 324 LEU A N   1 
ATOM   2432 C CA  . LEU A 1 323 ? 16.309  -35.438 27.124  1.00 34.07  ? 324 LEU A CA  1 
ATOM   2433 C C   . LEU A 1 323 ? 16.358  -36.977 27.181  1.00 26.56  ? 324 LEU A C   1 
ATOM   2434 O O   . LEU A 1 323 ? 16.871  -37.641 26.274  1.00 30.78  ? 324 LEU A O   1 
ATOM   2435 C CB  . LEU A 1 323 ? 15.152  -34.962 26.229  1.00 34.43  ? 324 LEU A CB  1 
ATOM   2436 C CG  . LEU A 1 323 ? 13.732  -35.476 26.505  1.00 31.32  ? 324 LEU A CG  1 
ATOM   2437 C CD1 . LEU A 1 323 ? 13.255  -35.053 27.890  1.00 27.23  ? 324 LEU A CD1 1 
ATOM   2438 C CD2 . LEU A 1 323 ? 12.767  -34.983 25.441  1.00 26.28  ? 324 LEU A CD2 1 
ATOM   2439 N N   . GLN A 1 324 ? 15.833  -37.537 28.263  1.00 26.91  ? 325 GLN A N   1 
ATOM   2440 C CA  . GLN A 1 324 ? 15.576  -38.973 28.318  1.00 32.12  ? 325 GLN A CA  1 
ATOM   2441 C C   . GLN A 1 324 ? 14.080  -39.192 28.516  1.00 29.99  ? 325 GLN A C   1 
ATOM   2442 O O   . GLN A 1 324 ? 13.443  -38.505 29.311  1.00 29.51  ? 325 GLN A O   1 
ATOM   2443 C CB  . GLN A 1 324 ? 16.364  -39.658 29.440  1.00 33.24  ? 325 GLN A CB  1 
ATOM   2444 C CG  . GLN A 1 324 ? 17.874  -39.504 29.349  1.00 35.15  ? 325 GLN A CG  1 
ATOM   2445 C CD  . GLN A 1 324 ? 18.376  -38.316 30.136  1.00 42.38  ? 325 GLN A CD  1 
ATOM   2446 O OE1 . GLN A 1 324 ? 17.997  -38.113 31.296  1.00 44.08  ? 325 GLN A OE1 1 
ATOM   2447 N NE2 . GLN A 1 324 ? 19.221  -37.509 29.506  1.00 48.06  ? 325 GLN A NE2 1 
ATOM   2448 N N   . VAL A 1 325 ? 13.516  -40.136 27.774  1.00 29.09  ? 326 VAL A N   1 
ATOM   2449 C CA  . VAL A 1 325 ? 12.082  -40.376 27.818  1.00 27.12  ? 326 VAL A CA  1 
ATOM   2450 C C   . VAL A 1 325 ? 11.825  -41.872 27.895  1.00 29.09  ? 326 VAL A C   1 
ATOM   2451 O O   . VAL A 1 325 ? 12.536  -42.664 27.267  1.00 30.47  ? 326 VAL A O   1 
ATOM   2452 C CB  . VAL A 1 325 ? 11.367  -39.840 26.545  1.00 30.99  ? 326 VAL A CB  1 
ATOM   2453 C CG1 . VAL A 1 325 ? 9.958   -39.413 26.878  1.00 31.05  ? 326 VAL A CG1 1 
ATOM   2454 C CG2 . VAL A 1 325 ? 12.115  -38.675 25.947  1.00 36.39  ? 326 VAL A CG2 1 
ATOM   2455 N N   . LEU A 1 326 ? 10.805  -42.254 28.659  1.00 26.83  ? 327 LEU A N   1 
ATOM   2456 C CA  . LEU A 1 326 ? 10.331  -43.639 28.694  1.00 25.10  ? 327 LEU A CA  1 
ATOM   2457 C C   . LEU A 1 326 ? 8.918   -43.669 28.123  1.00 24.82  ? 327 LEU A C   1 
ATOM   2458 O O   . LEU A 1 326 ? 8.028   -42.968 28.613  1.00 26.01  ? 327 LEU A O   1 
ATOM   2459 C CB  . LEU A 1 326 ? 10.338  -44.170 30.127  1.00 23.82  ? 327 LEU A CB  1 
ATOM   2460 C CG  . LEU A 1 326 ? 9.793   -45.573 30.423  1.00 26.62  ? 327 LEU A CG  1 
ATOM   2461 C CD1 . LEU A 1 326 ? 10.617  -46.626 29.746  1.00 27.61  ? 327 LEU A CD1 1 
ATOM   2462 C CD2 . LEU A 1 326 ? 9.789   -45.827 31.926  1.00 30.20  ? 327 LEU A CD2 1 
ATOM   2463 N N   . VAL A 1 327 ? 8.711   -44.453 27.070  1.00 23.86  ? 328 VAL A N   1 
ATOM   2464 C CA  . VAL A 1 327 ? 7.391   -44.523 26.441  1.00 24.94  ? 328 VAL A CA  1 
ATOM   2465 C C   . VAL A 1 327 ? 6.961   -45.969 26.226  1.00 24.06  ? 328 VAL A C   1 
ATOM   2466 O O   . VAL A 1 327 ? 7.790   -46.871 26.137  1.00 21.42  ? 328 VAL A O   1 
ATOM   2467 C CB  . VAL A 1 327 ? 7.339   -43.779 25.081  1.00 23.74  ? 328 VAL A CB  1 
ATOM   2468 C CG1 . VAL A 1 327 ? 7.850   -42.351 25.224  1.00 22.32  ? 328 VAL A CG1 1 
ATOM   2469 C CG2 . VAL A 1 327 ? 8.127   -44.532 24.028  1.00 21.83  ? 328 VAL A CG2 1 
ATOM   2470 N N   . GLY A 1 328 ? 5.659   -46.190 26.137  1.00 18.02  ? 329 GLY A N   1 
ATOM   2471 C CA  . GLY A 1 328 ? 5.168   -47.531 25.917  1.00 18.90  ? 329 GLY A CA  1 
ATOM   2472 C C   . GLY A 1 328 ? 3.666   -47.604 25.796  1.00 22.66  ? 329 GLY A C   1 
ATOM   2473 O O   . GLY A 1 328 ? 2.954   -46.598 25.932  1.00 19.46  ? 329 GLY A O   1 
ATOM   2474 N N   . VAL A 1 329 ? 3.188   -48.815 25.540  1.00 17.93  ? 330 VAL A N   1 
ATOM   2475 C CA  . VAL A 1 329 ? 1.794   -49.051 25.241  1.00 18.46  ? 330 VAL A CA  1 
ATOM   2476 C C   . VAL A 1 329 ? 1.434   -50.371 25.884  1.00 24.94  ? 330 VAL A C   1 
ATOM   2477 O O   . VAL A 1 329 ? 2.332   -51.153 26.220  1.00 21.09  ? 330 VAL A O   1 
ATOM   2478 C CB  . VAL A 1 329 ? 1.590   -49.197 23.714  1.00 21.64  ? 330 VAL A CB  1 
ATOM   2479 C CG1 . VAL A 1 329 ? 1.900   -47.890 22.993  1.00 20.24  ? 330 VAL A CG1 1 
ATOM   2480 C CG2 . VAL A 1 329 ? 2.471   -50.312 23.162  1.00 19.18  ? 330 VAL A CG2 1 
ATOM   2481 N N   . VAL A 1 330 ? 0.135   -50.628 26.056  1.00 21.32  ? 331 VAL A N   1 
ATOM   2482 C CA  . VAL A 1 330 ? -0.324  -51.980 26.393  1.00 23.09  ? 331 VAL A CA  1 
ATOM   2483 C C   . VAL A 1 330 ? -0.492  -52.833 25.129  1.00 26.05  ? 331 VAL A C   1 
ATOM   2484 O O   . VAL A 1 330 ? -0.491  -52.312 24.011  1.00 23.57  ? 331 VAL A O   1 
ATOM   2485 C CB  . VAL A 1 330 ? -1.639  -51.976 27.197  1.00 25.63  ? 331 VAL A CB  1 
ATOM   2486 C CG1 . VAL A 1 330 ? -1.446  -51.243 28.530  1.00 18.82  ? 331 VAL A CG1 1 
ATOM   2487 C CG2 . VAL A 1 330 ? -2.775  -51.358 26.382  1.00 21.06  ? 331 VAL A CG2 1 
ATOM   2488 N N   . LYS A 1 331 ? -0.631  -54.142 25.317  1.00 26.90  ? 332 LYS A N   1 
ATOM   2489 C CA  . LYS A 1 331 ? -0.742  -55.082 24.208  1.00 29.99  ? 332 LYS A CA  1 
ATOM   2490 C C   . LYS A 1 331 ? -1.955  -54.817 23.316  1.00 29.15  ? 332 LYS A C   1 
ATOM   2491 O O   . LYS A 1 331 ? -1.874  -54.967 22.099  1.00 27.12  ? 332 LYS A O   1 
ATOM   2492 C CB  . LYS A 1 331 ? -0.779  -56.524 24.724  1.00 31.15  ? 332 LYS A CB  1 
ATOM   2493 C CG  . LYS A 1 331 ? -0.633  -57.589 23.628  1.00 27.70  ? 332 LYS A CG  1 
ATOM   2494 C CD  . LYS A 1 331 ? -0.439  -58.970 24.254  1.00 34.51  ? 332 LYS A CD  1 
ATOM   2495 C CE  . LYS A 1 331 ? -0.093  -60.025 23.220  1.00 35.15  ? 332 LYS A CE  1 
ATOM   2496 N NZ  . LYS A 1 331 ? -1.231  -60.356 22.302  1.00 46.13  ? 332 LYS A NZ  1 
ATOM   2497 N N   . ASP A 1 332 ? -3.070  -54.413 23.918  1.00 23.08  ? 333 ASP A N   1 
ATOM   2498 C CA  . ASP A 1 332 ? -4.297  -54.190 23.157  1.00 26.75  ? 333 ASP A CA  1 
ATOM   2499 C C   . ASP A 1 332 ? -4.918  -52.822 23.424  1.00 26.56  ? 333 ASP A C   1 
ATOM   2500 O O   . ASP A 1 332 ? -5.945  -52.723 24.091  1.00 27.52  ? 333 ASP A O   1 
ATOM   2501 C CB  . ASP A 1 332 ? -5.309  -55.308 23.453  1.00 25.08  ? 333 ASP A CB  1 
ATOM   2502 C CG  . ASP A 1 332 ? -4.737  -56.698 23.172  1.00 29.59  ? 333 ASP A CG  1 
ATOM   2503 O OD1 . ASP A 1 332 ? -4.718  -57.108 21.986  1.00 32.00  ? 333 ASP A OD1 1 
ATOM   2504 O OD2 . ASP A 1 332 ? -4.283  -57.367 24.133  1.00 26.66  ? 333 ASP A OD2 1 
ATOM   2505 N N   . GLU A 1 333 ? -4.300  -51.775 22.881  1.00 26.23  ? 334 GLU A N   1 
ATOM   2506 C CA  . GLU A 1 333 ? -4.741  -50.397 23.106  1.00 24.52  ? 334 GLU A CA  1 
ATOM   2507 C C   . GLU A 1 333 ? -6.187  -50.119 22.706  1.00 26.78  ? 334 GLU A C   1 
ATOM   2508 O O   . GLU A 1 333 ? -6.872  -49.321 23.358  1.00 25.34  ? 334 GLU A O   1 
ATOM   2509 C CB  . GLU A 1 333 ? -3.815  -49.398 22.387  1.00 21.93  ? 334 GLU A CB  1 
ATOM   2510 C CG  . GLU A 1 333 ? -2.406  -49.284 22.993  1.00 19.96  ? 334 GLU A CG  1 
ATOM   2511 C CD  . GLU A 1 333 ? -2.412  -48.616 24.371  1.00 26.36  ? 334 GLU A CD  1 
ATOM   2512 O OE1 . GLU A 1 333 ? -3.469  -48.069 24.763  1.00 24.03  ? 334 GLU A OE1 1 
ATOM   2513 O OE2 . GLU A 1 333 ? -1.366  -48.632 25.063  1.00 23.90  ? 334 GLU A OE2 1 
ATOM   2514 N N   . GLY A 1 334 ? -6.660  -50.764 21.644  1.00 23.90  ? 335 GLY A N   1 
ATOM   2515 C CA  . GLY A 1 334 ? -7.946  -50.388 21.077  1.00 22.42  ? 335 GLY A CA  1 
ATOM   2516 C C   . GLY A 1 334 ? -9.174  -51.090 21.634  1.00 23.54  ? 335 GLY A C   1 
ATOM   2517 O O   . GLY A 1 334 ? -10.283 -50.564 21.555  1.00 20.98  ? 335 GLY A O   1 
ATOM   2518 N N   . SER A 1 335 ? -8.978  -52.274 22.202  1.00 23.11  ? 336 SER A N   1 
ATOM   2519 C CA  . SER A 1 335 ? -10.095 -53.149 22.543  1.00 26.70  ? 336 SER A CA  1 
ATOM   2520 C C   . SER A 1 335 ? -11.143 -52.500 23.458  1.00 27.34  ? 336 SER A C   1 
ATOM   2521 O O   . SER A 1 335 ? -12.338 -52.562 23.183  1.00 29.04  ? 336 SER A O   1 
ATOM   2522 C CB  . SER A 1 335 ? -9.577  -54.460 23.137  1.00 27.44  ? 336 SER A CB  1 
ATOM   2523 O OG  . SER A 1 335 ? -9.049  -54.263 24.429  1.00 28.54  ? 336 SER A OG  1 
ATOM   2524 N N   . TYR A 1 336 ? -10.674 -51.866 24.526  1.00 27.57  ? 337 TYR A N   1 
ATOM   2525 C CA  . TYR A 1 336 ? -11.517 -51.200 25.516  1.00 24.96  ? 337 TYR A CA  1 
ATOM   2526 C C   . TYR A 1 336 ? -12.529 -50.254 24.877  1.00 25.09  ? 337 TYR A C   1 
ATOM   2527 O O   . TYR A 1 336 ? -13.702 -50.228 25.244  1.00 28.42  ? 337 TYR A O   1 
ATOM   2528 C CB  . TYR A 1 336 ? -10.600 -50.402 26.438  1.00 29.14  ? 337 TYR A CB  1 
ATOM   2529 C CG  . TYR A 1 336 ? -11.082 -50.168 27.846  1.00 28.05  ? 337 TYR A CG  1 
ATOM   2530 C CD1 . TYR A 1 336 ? -12.430 -49.969 28.136  1.00 28.74  ? 337 TYR A CD1 1 
ATOM   2531 C CD2 . TYR A 1 336 ? -10.172 -50.123 28.895  1.00 27.72  ? 337 TYR A CD2 1 
ATOM   2532 C CE1 . TYR A 1 336 ? -12.852 -49.747 29.439  1.00 26.86  ? 337 TYR A CE1 1 
ATOM   2533 C CE2 . TYR A 1 336 ? -10.584 -49.896 30.196  1.00 27.01  ? 337 TYR A CE2 1 
ATOM   2534 C CZ  . TYR A 1 336 ? -11.918 -49.705 30.464  1.00 25.53  ? 337 TYR A CZ  1 
ATOM   2535 O OH  . TYR A 1 336 ? -12.304 -49.478 31.766  1.00 26.03  ? 337 TYR A OH  1 
ATOM   2536 N N   . PHE A 1 337 ? -12.075 -49.474 23.912  1.00 22.82  ? 338 PHE A N   1 
ATOM   2537 C CA  . PHE A 1 337 ? -12.919 -48.443 23.325  1.00 21.85  ? 338 PHE A CA  1 
ATOM   2538 C C   . PHE A 1 337 ? -14.076 -48.966 22.462  1.00 26.20  ? 338 PHE A C   1 
ATOM   2539 O O   . PHE A 1 337 ? -15.075 -48.265 22.273  1.00 20.06  ? 338 PHE A O   1 
ATOM   2540 C CB  . PHE A 1 337 ? -12.050 -47.443 22.553  1.00 24.01  ? 338 PHE A CB  1 
ATOM   2541 C CG  . PHE A 1 337 ? -11.095 -46.704 23.432  1.00 20.39  ? 338 PHE A CG  1 
ATOM   2542 C CD1 . PHE A 1 337 ? -9.901  -47.288 23.815  1.00 21.01  ? 338 PHE A CD1 1 
ATOM   2543 C CD2 . PHE A 1 337 ? -11.414 -45.447 23.922  1.00 19.20  ? 338 PHE A CD2 1 
ATOM   2544 C CE1 . PHE A 1 337 ? -9.031  -46.624 24.675  1.00 22.38  ? 338 PHE A CE1 1 
ATOM   2545 C CE2 . PHE A 1 337 ? -10.542 -44.773 24.761  1.00 19.97  ? 338 PHE A CE2 1 
ATOM   2546 C CZ  . PHE A 1 337 ? -9.352  -45.367 25.140  1.00 17.92  ? 338 PHE A CZ  1 
ATOM   2547 N N   . LEU A 1 338 ? -13.961 -50.200 21.973  1.00 26.33  ? 339 LEU A N   1 
ATOM   2548 C CA  . LEU A 1 338 ? -14.969 -50.754 21.065  1.00 29.21  ? 339 LEU A CA  1 
ATOM   2549 C C   . LEU A 1 338 ? -16.361 -50.880 21.693  1.00 32.14  ? 339 LEU A C   1 
ATOM   2550 O O   . LEU A 1 338 ? -17.372 -50.764 20.987  1.00 30.47  ? 339 LEU A O   1 
ATOM   2551 C CB  . LEU A 1 338 ? -14.507 -52.102 20.497  1.00 24.76  ? 339 LEU A CB  1 
ATOM   2552 C CG  . LEU A 1 338 ? -13.170 -51.983 19.763  1.00 24.66  ? 339 LEU A CG  1 
ATOM   2553 C CD1 . LEU A 1 338 ? -12.638 -53.315 19.253  1.00 25.37  ? 339 LEU A CD1 1 
ATOM   2554 C CD2 . LEU A 1 338 ? -13.305 -50.990 18.645  1.00 21.23  ? 339 LEU A CD2 1 
ATOM   2555 N N   . VAL A 1 339 ? -16.421 -51.096 23.009  1.00 25.61  ? 340 VAL A N   1 
ATOM   2556 C CA  . VAL A 1 339 ? -17.715 -51.247 23.671  1.00 24.07  ? 340 VAL A CA  1 
ATOM   2557 C C   . VAL A 1 339 ? -18.429 -49.922 23.928  1.00 30.99  ? 340 VAL A C   1 
ATOM   2558 O O   . VAL A 1 339 ? -19.548 -49.916 24.438  1.00 33.06  ? 340 VAL A O   1 
ATOM   2559 C CB  . VAL A 1 339 ? -17.623 -52.051 24.973  1.00 30.08  ? 340 VAL A CB  1 
ATOM   2560 C CG1 . VAL A 1 339 ? -17.162 -53.483 24.680  1.00 28.51  ? 340 VAL A CG1 1 
ATOM   2561 C CG2 . VAL A 1 339 ? -16.701 -51.359 25.972  1.00 27.77  ? 340 VAL A CG2 1 
ATOM   2562 N N   . TYR A 1 340 ? -17.801 -48.806 23.556  1.00 24.57  ? 341 TYR A N   1 
ATOM   2563 C CA  . TYR A 1 340 ? -18.427 -47.492 23.731  1.00 20.56  ? 341 TYR A CA  1 
ATOM   2564 C C   . TYR A 1 340 ? -18.986 -46.895 22.441  1.00 24.89  ? 341 TYR A C   1 
ATOM   2565 O O   . TYR A 1 340 ? -19.209 -45.680 22.384  1.00 23.54  ? 341 TYR A O   1 
ATOM   2566 C CB  . TYR A 1 340 ? -17.440 -46.484 24.352  1.00 23.39  ? 341 TYR A CB  1 
ATOM   2567 C CG  . TYR A 1 340 ? -17.145 -46.710 25.820  1.00 23.42  ? 341 TYR A CG  1 
ATOM   2568 C CD1 . TYR A 1 340 ? -17.801 -45.975 26.804  1.00 23.97  ? 341 TYR A CD1 1 
ATOM   2569 C CD2 . TYR A 1 340 ? -16.228 -47.668 26.220  1.00 21.18  ? 341 TYR A CD2 1 
ATOM   2570 C CE1 . TYR A 1 340 ? -17.545 -46.184 28.145  1.00 22.86  ? 341 TYR A CE1 1 
ATOM   2571 C CE2 . TYR A 1 340 ? -15.967 -47.889 27.555  1.00 25.11  ? 341 TYR A CE2 1 
ATOM   2572 C CZ  . TYR A 1 340 ? -16.625 -47.140 28.514  1.00 23.75  ? 341 TYR A CZ  1 
ATOM   2573 O OH  . TYR A 1 340 ? -16.354 -47.356 29.841  1.00 24.33  ? 341 TYR A OH  1 
ATOM   2574 N N   . GLY A 1 341 ? -19.203 -47.718 21.411  1.00 25.46  ? 342 GLY A N   1 
ATOM   2575 C CA  . GLY A 1 341 ? -19.739 -47.204 20.158  1.00 25.99  ? 342 GLY A CA  1 
ATOM   2576 C C   . GLY A 1 341 ? -19.644 -48.051 18.893  1.00 28.24  ? 342 GLY A C   1 
ATOM   2577 O O   . GLY A 1 341 ? -20.348 -47.795 17.918  1.00 29.98  ? 342 GLY A O   1 
ATOM   2578 N N   . ALA A 1 342 ? -18.775 -49.050 18.883  1.00 31.23  ? 343 ALA A N   1 
ATOM   2579 C CA  . ALA A 1 342 ? -18.662 -49.902 17.711  1.00 31.05  ? 343 ALA A CA  1 
ATOM   2580 C C   . ALA A 1 342 ? -19.840 -50.870 17.668  1.00 31.62  ? 343 ALA A C   1 
ATOM   2581 O O   . ALA A 1 342 ? -20.101 -51.567 18.645  1.00 35.06  ? 343 ALA A O   1 
ATOM   2582 C CB  . ALA A 1 342 ? -17.348 -50.659 17.725  1.00 28.45  ? 343 ALA A CB  1 
ATOM   2583 N N   . PRO A 1 343 ? -20.561 -50.907 16.534  1.00 29.97  ? 344 PRO A N   1 
ATOM   2584 C CA  . PRO A 1 343 ? -21.691 -51.831 16.365  1.00 30.94  ? 344 PRO A CA  1 
ATOM   2585 C C   . PRO A 1 343 ? -21.275 -53.283 16.550  1.00 33.09  ? 344 PRO A C   1 
ATOM   2586 O O   . PRO A 1 343 ? -20.244 -53.714 16.023  1.00 29.48  ? 344 PRO A O   1 
ATOM   2587 C CB  . PRO A 1 343 ? -22.139 -51.590 14.915  1.00 30.57  ? 344 PRO A CB  1 
ATOM   2588 C CG  . PRO A 1 343 ? -20.971 -50.917 14.243  1.00 35.11  ? 344 PRO A CG  1 
ATOM   2589 C CD  . PRO A 1 343 ? -20.330 -50.091 15.328  1.00 30.43  ? 344 PRO A CD  1 
ATOM   2590 N N   . GLY A 1 344 ? -22.064 -54.020 17.323  1.00 32.04  ? 345 GLY A N   1 
ATOM   2591 C CA  . GLY A 1 344 ? -21.825 -55.433 17.520  1.00 33.17  ? 345 GLY A CA  1 
ATOM   2592 C C   . GLY A 1 344 ? -20.965 -55.780 18.721  1.00 34.90  ? 345 GLY A C   1 
ATOM   2593 O O   . GLY A 1 344 ? -20.758 -56.959 19.007  1.00 34.40  ? 345 GLY A O   1 
ATOM   2594 N N   . PHE A 1 345 ? -20.468 -54.777 19.439  1.00 32.75  ? 346 PHE A N   1 
ATOM   2595 C CA  . PHE A 1 345 ? -19.559 -55.072 20.554  1.00 31.69  ? 346 PHE A CA  1 
ATOM   2596 C C   . PHE A 1 345 ? -20.222 -55.103 21.925  1.00 30.22  ? 346 PHE A C   1 
ATOM   2597 O O   . PHE A 1 345 ? -21.126 -54.323 22.214  1.00 37.20  ? 346 PHE A O   1 
ATOM   2598 C CB  . PHE A 1 345 ? -18.372 -54.108 20.561  1.00 25.90  ? 346 PHE A CB  1 
ATOM   2599 C CG  . PHE A 1 345 ? -17.315 -54.457 19.557  1.00 30.40  ? 346 PHE A CG  1 
ATOM   2600 C CD1 . PHE A 1 345 ? -16.212 -55.204 19.926  1.00 26.14  ? 346 PHE A CD1 1 
ATOM   2601 C CD2 . PHE A 1 345 ? -17.430 -54.043 18.238  1.00 27.66  ? 346 PHE A CD2 1 
ATOM   2602 C CE1 . PHE A 1 345 ? -15.246 -55.530 19.002  1.00 26.44  ? 346 PHE A CE1 1 
ATOM   2603 C CE2 . PHE A 1 345 ? -16.466 -54.363 17.315  1.00 29.07  ? 346 PHE A CE2 1 
ATOM   2604 C CZ  . PHE A 1 345 ? -15.377 -55.108 17.694  1.00 25.30  ? 346 PHE A CZ  1 
ATOM   2605 N N   . SER A 1 346 ? -19.751 -56.007 22.774  1.00 36.78  ? 347 SER A N   1 
ATOM   2606 C CA  . SER A 1 346 ? -20.181 -56.034 24.167  1.00 32.82  ? 347 SER A CA  1 
ATOM   2607 C C   . SER A 1 346 ? -19.114 -56.690 25.025  1.00 30.94  ? 347 SER A C   1 
ATOM   2608 O O   . SER A 1 346 ? -18.376 -57.556 24.564  1.00 30.27  ? 347 SER A O   1 
ATOM   2609 C CB  . SER A 1 346 ? -21.512 -56.782 24.320  1.00 37.63  ? 347 SER A CB  1 
ATOM   2610 O OG  . SER A 1 346 ? -21.906 -56.870 25.684  1.00 44.65  ? 347 SER A OG  1 
ATOM   2611 N N   . LYS A 1 347 ? -19.029 -56.284 26.283  1.00 30.04  ? 348 LYS A N   1 
ATOM   2612 C CA  . LYS A 1 347 ? -18.106 -56.942 27.185  1.00 31.61  ? 348 LYS A CA  1 
ATOM   2613 C C   . LYS A 1 347 ? -18.701 -58.289 27.569  1.00 30.55  ? 348 LYS A C   1 
ATOM   2614 O O   . LYS A 1 347 ? -18.005 -59.162 28.086  1.00 32.59  ? 348 LYS A O   1 
ATOM   2615 C CB  . LYS A 1 347 ? -17.876 -56.093 28.440  1.00 36.30  ? 348 LYS A CB  1 
ATOM   2616 C CG  . LYS A 1 347 ? -18.929 -56.293 29.533  1.00 26.56  ? 348 LYS A CG  1 
ATOM   2617 C CD  . LYS A 1 347 ? -18.602 -55.505 30.795  1.00 32.36  ? 348 LYS A CD  1 
ATOM   2618 C CE  . LYS A 1 347 ? -19.544 -55.881 31.936  1.00 28.29  ? 348 LYS A CE  1 
ATOM   2619 N NZ  . LYS A 1 347 ? -19.302 -57.290 32.403  1.00 24.87  ? 348 LYS A NZ  1 
ATOM   2620 N N   . ASP A 1 348 ? -20.000 -58.443 27.317  1.00 32.19  ? 349 ASP A N   1 
ATOM   2621 C CA  . ASP A 1 348 ? -20.740 -59.623 27.772  1.00 39.76  ? 349 ASP A CA  1 
ATOM   2622 C C   . ASP A 1 348 ? -20.886 -60.733 26.726  1.00 42.12  ? 349 ASP A C   1 
ATOM   2623 O O   . ASP A 1 348 ? -21.442 -61.785 27.026  1.00 42.87  ? 349 ASP A O   1 
ATOM   2624 C CB  . ASP A 1 348 ? -22.116 -59.229 28.318  1.00 32.87  ? 349 ASP A CB  1 
ATOM   2625 C CG  . ASP A 1 348 ? -22.028 -58.456 29.625  1.00 34.27  ? 349 ASP A CG  1 
ATOM   2626 O OD1 . ASP A 1 348 ? -21.254 -58.877 30.518  1.00 31.14  ? 349 ASP A OD1 1 
ATOM   2627 O OD2 . ASP A 1 348 ? -22.733 -57.427 29.751  1.00 30.90  ? 349 ASP A OD2 1 
ATOM   2628 N N   . ASN A 1 349 ? -20.410 -60.501 25.504  1.00 36.31  ? 350 ASN A N   1 
ATOM   2629 C CA  . ASN A 1 349 ? -20.195 -61.614 24.575  1.00 40.40  ? 350 ASN A CA  1 
ATOM   2630 C C   . ASN A 1 349 ? -18.822 -61.593 23.912  1.00 39.83  ? 350 ASN A C   1 
ATOM   2631 O O   . ASN A 1 349 ? -17.955 -60.783 24.273  1.00 34.61  ? 350 ASN A O   1 
ATOM   2632 C CB  . ASN A 1 349 ? -21.328 -61.766 23.546  1.00 32.02  ? 350 ASN A CB  1 
ATOM   2633 C CG  . ASN A 1 349 ? -21.565 -60.517 22.736  1.00 36.99  ? 350 ASN A CG  1 
ATOM   2634 O OD1 . ASN A 1 349 ? -20.627 -59.890 22.245  1.00 41.10  ? 350 ASN A OD1 1 
ATOM   2635 N ND2 . ASN A 1 349 ? -22.837 -60.144 22.598  1.00 32.34  ? 350 ASN A ND2 1 
ATOM   2636 N N   . GLU A 1 350 ? -18.623 -62.499 22.959  1.00 31.05  ? 351 GLU A N   1 
ATOM   2637 C CA  . GLU A 1 350 ? -17.339 -62.624 22.282  1.00 34.11  ? 351 GLU A CA  1 
ATOM   2638 C C   . GLU A 1 350 ? -17.119 -61.509 21.261  1.00 27.96  ? 351 GLU A C   1 
ATOM   2639 O O   . GLU A 1 350 ? -16.048 -61.406 20.675  1.00 28.93  ? 351 GLU A O   1 
ATOM   2640 C CB  . GLU A 1 350 ? -17.203 -63.998 21.608  1.00 37.14  ? 351 GLU A CB  1 
ATOM   2641 C CG  . GLU A 1 350 ? -16.947 -65.147 22.565  1.00 37.42  ? 351 GLU A CG  1 
ATOM   2642 C CD  . GLU A 1 350 ? -15.819 -64.838 23.542  1.00 54.91  ? 351 GLU A CD  1 
ATOM   2643 O OE1 . GLU A 1 350 ? -14.647 -65.142 23.223  1.00 53.57  ? 351 GLU A OE1 1 
ATOM   2644 O OE2 . GLU A 1 350 ? -16.102 -64.286 24.634  1.00 58.71  ? 351 GLU A OE2 1 
ATOM   2645 N N   . SER A 1 351 ? -18.137 -60.682 21.062  1.00 26.02  ? 352 SER A N   1 
ATOM   2646 C CA  . SER A 1 351 ? -18.083 -59.606 20.080  1.00 36.19  ? 352 SER A CA  1 
ATOM   2647 C C   . SER A 1 351 ? -17.534 -60.081 18.728  1.00 36.49  ? 352 SER A C   1 
ATOM   2648 O O   . SER A 1 351 ? -16.680 -59.430 18.127  1.00 32.39  ? 352 SER A O   1 
ATOM   2649 C CB  . SER A 1 351 ? -17.258 -58.435 20.619  1.00 33.77  ? 352 SER A CB  1 
ATOM   2650 O OG  . SER A 1 351 ? -17.900 -57.848 21.737  1.00 32.52  ? 352 SER A OG  1 
ATOM   2651 N N   . LEU A 1 352 ? -18.016 -61.229 18.267  1.00 35.45  ? 353 LEU A N   1 
ATOM   2652 C CA  . LEU A 1 352 ? -17.618 -61.758 16.969  1.00 33.17  ? 353 LEU A CA  1 
ATOM   2653 C C   . LEU A 1 352 ? -18.418 -61.063 15.885  1.00 32.82  ? 353 LEU A C   1 
ATOM   2654 O O   . LEU A 1 352 ? -19.489 -61.528 15.516  1.00 41.45  ? 353 LEU A O   1 
ATOM   2655 C CB  . LEU A 1 352 ? -17.880 -63.256 16.925  1.00 29.84  ? 353 LEU A CB  1 
ATOM   2656 C CG  . LEU A 1 352 ? -17.030 -64.044 17.915  1.00 31.06  ? 353 LEU A CG  1 
ATOM   2657 C CD1 . LEU A 1 352 ? -17.513 -65.483 18.006  1.00 27.72  ? 353 LEU A CD1 1 
ATOM   2658 C CD2 . LEU A 1 352 ? -15.571 -63.985 17.499  1.00 29.65  ? 353 LEU A CD2 1 
ATOM   2659 N N   . ILE A 1 353 ? -17.908 -59.942 15.384  1.00 32.32  ? 354 ILE A N   1 
ATOM   2660 C CA  . ILE A 1 353 ? -18.671 -59.105 14.453  1.00 33.21  ? 354 ILE A CA  1 
ATOM   2661 C C   . ILE A 1 353 ? -18.651 -59.584 12.995  1.00 40.34  ? 354 ILE A C   1 
ATOM   2662 O O   . ILE A 1 353 ? -17.822 -60.407 12.592  1.00 33.08  ? 354 ILE A O   1 
ATOM   2663 C CB  . ILE A 1 353 ? -18.182 -57.649 14.475  1.00 32.94  ? 354 ILE A CB  1 
ATOM   2664 C CG1 . ILE A 1 353 ? -16.689 -57.588 14.117  1.00 31.25  ? 354 ILE A CG1 1 
ATOM   2665 C CG2 . ILE A 1 353 ? -18.448 -57.022 15.833  1.00 35.62  ? 354 ILE A CG2 1 
ATOM   2666 C CD1 . ILE A 1 353 ? -16.155 -56.188 13.984  1.00 25.38  ? 354 ILE A CD1 1 
ATOM   2667 N N   . SER A 1 354 ? -19.581 -59.041 12.217  1.00 33.65  ? 355 SER A N   1 
ATOM   2668 C CA  . SER A 1 354 ? -19.701 -59.337 10.800  1.00 31.88  ? 355 SER A CA  1 
ATOM   2669 C C   . SER A 1 354 ? -18.866 -58.337 10.015  1.00 35.78  ? 355 SER A C   1 
ATOM   2670 O O   . SER A 1 354 ? -18.407 -57.322 10.565  1.00 30.30  ? 355 SER A O   1 
ATOM   2671 C CB  . SER A 1 354 ? -21.164 -59.210 10.365  1.00 24.45  ? 355 SER A CB  1 
ATOM   2672 O OG  . SER A 1 354 ? -21.570 -57.847 10.390  1.00 27.73  ? 355 SER A OG  1 
ATOM   2673 N N   . ARG A 1 355 ? -18.691 -58.610 8.724   1.00 30.95  ? 356 ARG A N   1 
ATOM   2674 C CA  . ARG A 1 355 ? -17.917 -57.729 7.864   1.00 26.47  ? 356 ARG A CA  1 
ATOM   2675 C C   . ARG A 1 355 ? -18.580 -56.363 7.787   1.00 26.84  ? 356 ARG A C   1 
ATOM   2676 O O   . ARG A 1 355 ? -17.909 -55.330 7.876   1.00 32.00  ? 356 ARG A O   1 
ATOM   2677 C CB  . ARG A 1 355 ? -17.739 -58.340 6.473   1.00 34.45  ? 356 ARG A CB  1 
ATOM   2678 C CG  . ARG A 1 355 ? -17.099 -57.404 5.445   1.00 35.75  ? 356 ARG A CG  1 
ATOM   2679 C CD  . ARG A 1 355 ? -15.615 -57.652 5.345   1.00 33.66  ? 356 ARG A CD  1 
ATOM   2680 N NE  . ARG A 1 355 ? -14.957 -56.715 4.445   1.00 33.44  ? 356 ARG A NE  1 
ATOM   2681 C CZ  . ARG A 1 355 ? -13.680 -56.362 4.554   1.00 34.14  ? 356 ARG A CZ  1 
ATOM   2682 N NH1 . ARG A 1 355 ? -12.934 -56.875 5.530   1.00 30.29  ? 356 ARG A NH1 1 
ATOM   2683 N NH2 . ARG A 1 355 ? -13.153 -55.488 3.701   1.00 24.27  ? 356 ARG A NH2 1 
ATOM   2684 N N   . ALA A 1 356 ? -19.902 -56.353 7.656   1.00 28.18  ? 357 ALA A N   1 
ATOM   2685 C CA  . ALA A 1 356 ? -20.644 -55.094 7.617   1.00 30.52  ? 357 ALA A CA  1 
ATOM   2686 C C   . ALA A 1 356 ? -20.457 -54.276 8.903   1.00 33.44  ? 357 ALA A C   1 
ATOM   2687 O O   . ALA A 1 356 ? -20.321 -53.054 8.853   1.00 35.10  ? 357 ALA A O   1 
ATOM   2688 C CB  . ALA A 1 356 ? -22.119 -55.352 7.350   1.00 23.37  ? 357 ALA A CB  1 
ATOM   2689 N N   . GLU A 1 357 ? -20.445 -54.946 10.053  1.00 32.97  ? 358 GLU A N   1 
ATOM   2690 C CA  . GLU A 1 357 ? -20.228 -54.252 11.320  1.00 33.01  ? 358 GLU A CA  1 
ATOM   2691 C C   . GLU A 1 357 ? -18.795 -53.725 11.393  1.00 31.64  ? 358 GLU A C   1 
ATOM   2692 O O   . GLU A 1 357 ? -18.557 -52.607 11.845  1.00 28.43  ? 358 GLU A O   1 
ATOM   2693 C CB  . GLU A 1 357 ? -20.523 -55.170 12.507  1.00 30.45  ? 358 GLU A CB  1 
ATOM   2694 C CG  . GLU A 1 357 ? -21.997 -55.464 12.697  1.00 30.65  ? 358 GLU A CG  1 
ATOM   2695 C CD  . GLU A 1 357 ? -22.265 -56.532 13.752  1.00 34.65  ? 358 GLU A CD  1 
ATOM   2696 O OE1 . GLU A 1 357 ? -21.491 -57.510 13.854  1.00 35.45  ? 358 GLU A OE1 1 
ATOM   2697 O OE2 . GLU A 1 357 ? -23.263 -56.388 14.484  1.00 42.45  ? 358 GLU A OE2 1 
ATOM   2698 N N   . PHE A 1 358 ? -17.848 -54.531 10.929  1.00 28.58  ? 359 PHE A N   1 
ATOM   2699 C CA  . PHE A 1 358 ? -16.465 -54.087 10.844  1.00 33.25  ? 359 PHE A CA  1 
ATOM   2700 C C   . PHE A 1 358 ? -16.362 -52.813 10.003  1.00 31.16  ? 359 PHE A C   1 
ATOM   2701 O O   . PHE A 1 358 ? -15.742 -51.838 10.424  1.00 35.53  ? 359 PHE A O   1 
ATOM   2702 C CB  . PHE A 1 358 ? -15.566 -55.205 10.295  1.00 32.11  ? 359 PHE A CB  1 
ATOM   2703 C CG  . PHE A 1 358 ? -14.183 -54.746 9.915   1.00 34.27  ? 359 PHE A CG  1 
ATOM   2704 C CD1 . PHE A 1 358 ? -13.169 -54.690 10.861  1.00 32.84  ? 359 PHE A CD1 1 
ATOM   2705 C CD2 . PHE A 1 358 ? -13.894 -54.384 8.605   1.00 31.73  ? 359 PHE A CD2 1 
ATOM   2706 C CE1 . PHE A 1 358 ? -11.884 -54.278 10.512  1.00 27.55  ? 359 PHE A CE1 1 
ATOM   2707 C CE2 . PHE A 1 358 ? -12.612 -53.966 8.245   1.00 31.88  ? 359 PHE A CE2 1 
ATOM   2708 C CZ  . PHE A 1 358 ? -11.607 -53.911 9.202   1.00 34.61  ? 359 PHE A CZ  1 
ATOM   2709 N N   . LEU A 1 359 ? -16.991 -52.812 8.832   1.00 30.77  ? 360 LEU A N   1 
ATOM   2710 C CA  . LEU A 1 359 ? -16.969 -51.641 7.956   1.00 27.06  ? 360 LEU A CA  1 
ATOM   2711 C C   . LEU A 1 359 ? -17.576 -50.396 8.612   1.00 28.39  ? 360 LEU A C   1 
ATOM   2712 O O   . LEU A 1 359 ? -17.021 -49.303 8.519   1.00 29.80  ? 360 LEU A O   1 
ATOM   2713 C CB  . LEU A 1 359 ? -17.668 -51.944 6.626   1.00 29.49  ? 360 LEU A CB  1 
ATOM   2714 C CG  . LEU A 1 359 ? -16.979 -52.942 5.686   1.00 36.32  ? 360 LEU A CG  1 
ATOM   2715 C CD1 . LEU A 1 359 ? -17.721 -53.020 4.349   1.00 25.45  ? 360 LEU A CD1 1 
ATOM   2716 C CD2 . LEU A 1 359 ? -15.504 -52.589 5.469   1.00 25.35  ? 360 LEU A CD2 1 
ATOM   2717 N N   . ALA A 1 360 ? -18.721 -50.555 9.265   1.00 28.87  ? 361 ALA A N   1 
ATOM   2718 C CA  . ALA A 1 360 ? -19.323 -49.448 9.997   1.00 29.54  ? 361 ALA A CA  1 
ATOM   2719 C C   . ALA A 1 360 ? -18.423 -49.047 11.173  1.00 34.49  ? 361 ALA A C   1 
ATOM   2720 O O   . ALA A 1 360 ? -18.246 -47.859 11.458  1.00 32.83  ? 361 ALA A O   1 
ATOM   2721 C CB  . ALA A 1 360 ? -20.707 -49.837 10.500  1.00 31.49  ? 361 ALA A CB  1 
ATOM   2722 N N   . GLY A 1 361 ? -17.856 -50.044 11.848  1.00 23.72  ? 362 GLY A N   1 
ATOM   2723 C CA  . GLY A 1 361 ? -16.938 -49.798 12.948  1.00 28.52  ? 362 GLY A CA  1 
ATOM   2724 C C   . GLY A 1 361 ? -15.755 -48.912 12.575  1.00 31.24  ? 362 GLY A C   1 
ATOM   2725 O O   . GLY A 1 361 ? -15.322 -48.079 13.376  1.00 25.92  ? 362 GLY A O   1 
ATOM   2726 N N   . VAL A 1 362 ? -15.241 -49.085 11.357  1.00 31.03  ? 363 VAL A N   1 
ATOM   2727 C CA  . VAL A 1 362 ? -14.105 -48.303 10.870  1.00 25.40  ? 363 VAL A CA  1 
ATOM   2728 C C   . VAL A 1 362 ? -14.417 -46.805 10.811  1.00 25.29  ? 363 VAL A C   1 
ATOM   2729 O O   . VAL A 1 362 ? -13.567 -45.986 11.148  1.00 29.50  ? 363 VAL A O   1 
ATOM   2730 C CB  . VAL A 1 362 ? -13.608 -48.813 9.488   1.00 26.46  ? 363 VAL A CB  1 
ATOM   2731 C CG1 . VAL A 1 362 ? -12.699 -47.786 8.796   1.00 22.87  ? 363 VAL A CG1 1 
ATOM   2732 C CG2 . VAL A 1 362 ? -12.897 -50.140 9.637   1.00 21.44  ? 363 VAL A CG2 1 
ATOM   2733 N N   . ARG A 1 363 ? -15.626 -46.433 10.394  1.00 28.11  ? 364 ARG A N   1 
ATOM   2734 C CA  . ARG A 1 363 ? -15.975 -45.011 10.354  1.00 24.72  ? 364 ARG A CA  1 
ATOM   2735 C C   . ARG A 1 363 ? -16.128 -44.451 11.768  1.00 29.34  ? 364 ARG A C   1 
ATOM   2736 O O   . ARG A 1 363 ? -15.956 -43.254 11.984  1.00 29.49  ? 364 ARG A O   1 
ATOM   2737 C CB  . ARG A 1 363 ? -17.262 -44.744 9.570   1.00 26.64  ? 364 ARG A CB  1 
ATOM   2738 C CG  . ARG A 1 363 ? -17.302 -45.278 8.136   1.00 34.70  ? 364 ARG A CG  1 
ATOM   2739 C CD  . ARG A 1 363 ? -16.034 -45.001 7.338   1.00 26.86  ? 364 ARG A CD  1 
ATOM   2740 N NE  . ARG A 1 363 ? -15.756 -43.586 7.089   1.00 32.05  ? 364 ARG A NE  1 
ATOM   2741 C CZ  . ARG A 1 363 ? -16.067 -42.946 5.964   1.00 34.02  ? 364 ARG A CZ  1 
ATOM   2742 N NH1 . ARG A 1 363 ? -16.701 -43.582 4.991   1.00 29.08  ? 364 ARG A NH1 1 
ATOM   2743 N NH2 . ARG A 1 363 ? -15.754 -41.665 5.814   1.00 28.57  ? 364 ARG A NH2 1 
ATOM   2744 N N   . VAL A 1 364 ? -16.457 -45.315 12.726  1.00 26.09  ? 365 VAL A N   1 
ATOM   2745 C CA  . VAL A 1 364 ? -16.607 -44.879 14.111  1.00 32.56  ? 365 VAL A CA  1 
ATOM   2746 C C   . VAL A 1 364 ? -15.237 -44.736 14.774  1.00 28.28  ? 365 VAL A C   1 
ATOM   2747 O O   . VAL A 1 364 ? -14.977 -43.773 15.496  1.00 29.22  ? 365 VAL A O   1 
ATOM   2748 C CB  . VAL A 1 364 ? -17.532 -45.819 14.918  1.00 26.99  ? 365 VAL A CB  1 
ATOM   2749 C CG1 . VAL A 1 364 ? -17.577 -45.410 16.386  1.00 25.61  ? 365 VAL A CG1 1 
ATOM   2750 C CG2 . VAL A 1 364 ? -18.937 -45.796 14.332  1.00 27.11  ? 365 VAL A CG2 1 
ATOM   2751 N N   . GLY A 1 365 ? -14.355 -45.687 14.498  1.00 26.78  ? 366 GLY A N   1 
ATOM   2752 C CA  . GLY A 1 365 ? -13.009 -45.645 15.027  1.00 25.34  ? 366 GLY A CA  1 
ATOM   2753 C C   . GLY A 1 365 ? -12.141 -44.594 14.362  1.00 27.53  ? 366 GLY A C   1 
ATOM   2754 O O   . GLY A 1 365 ? -11.157 -44.147 14.939  1.00 29.70  ? 366 GLY A O   1 
ATOM   2755 N N   . VAL A 1 366 ? -12.485 -44.208 13.134  1.00 33.98  ? 367 VAL A N   1 
ATOM   2756 C CA  . VAL A 1 366 ? -11.718 -43.184 12.422  1.00 27.43  ? 367 VAL A CA  1 
ATOM   2757 C C   . VAL A 1 366 ? -12.651 -42.101 11.907  1.00 27.81  ? 367 VAL A C   1 
ATOM   2758 O O   . VAL A 1 366 ? -12.831 -41.949 10.690  1.00 29.82  ? 367 VAL A O   1 
ATOM   2759 C CB  . VAL A 1 366 ? -10.900 -43.780 11.246  1.00 29.63  ? 367 VAL A CB  1 
ATOM   2760 C CG1 . VAL A 1 366 ? -9.855  -42.783 10.756  1.00 26.38  ? 367 VAL A CG1 1 
ATOM   2761 C CG2 . VAL A 1 366 ? -10.225 -45.074 11.666  1.00 25.98  ? 367 VAL A CG2 1 
ATOM   2762 N N   . PRO A 1 367 ? -13.235 -41.323 12.835  1.00 30.81  ? 368 PRO A N   1 
ATOM   2763 C CA  . PRO A 1 367 ? -14.275 -40.358 12.468  1.00 26.43  ? 368 PRO A CA  1 
ATOM   2764 C C   . PRO A 1 367 ? -13.747 -39.202 11.613  1.00 29.52  ? 368 PRO A C   1 
ATOM   2765 O O   . PRO A 1 367 ? -12.557 -38.898 11.630  1.00 33.13  ? 368 PRO A O   1 
ATOM   2766 C CB  . PRO A 1 367 ? -14.767 -39.848 13.832  1.00 28.83  ? 368 PRO A CB  1 
ATOM   2767 C CG  . PRO A 1 367 ? -13.597 -40.019 14.744  1.00 26.00  ? 368 PRO A CG  1 
ATOM   2768 C CD  . PRO A 1 367 ? -12.931 -41.285 14.284  1.00 26.00  ? 368 PRO A CD  1 
ATOM   2769 N N   . GLN A 1 368 ? -14.645 -38.584 10.857  1.00 29.14  ? 369 GLN A N   1 
ATOM   2770 C CA  . GLN A 1 368 ? -14.317 -37.416 10.035  1.00 37.95  ? 369 GLN A CA  1 
ATOM   2771 C C   . GLN A 1 368 ? -13.113 -37.516 9.082   1.00 37.72  ? 369 GLN A C   1 
ATOM   2772 O O   . GLN A 1 368 ? -12.355 -36.555 8.928   1.00 35.60  ? 369 GLN A O   1 
ATOM   2773 C CB  . GLN A 1 368 ? -14.185 -36.177 10.917  1.00 41.01  ? 369 GLN A CB  1 
ATOM   2774 C CG  . GLN A 1 368 ? -15.512 -35.680 11.475  1.00 39.17  ? 369 GLN A CG  1 
ATOM   2775 C CD  . GLN A 1 368 ? -15.305 -34.529 12.412  1.00 43.50  ? 369 GLN A CD  1 
ATOM   2776 O OE1 . GLN A 1 368 ? -14.681 -34.686 13.463  1.00 52.78  ? 369 GLN A OE1 1 
ATOM   2777 N NE2 . GLN A 1 368 ? -15.797 -33.352 12.035  1.00 35.79  ? 369 GLN A NE2 1 
ATOM   2778 N N   . VAL A 1 369 ? -12.941 -38.661 8.433   1.00 34.38  ? 370 VAL A N   1 
ATOM   2779 C CA  . VAL A 1 369 ? -12.026 -38.721 7.304   1.00 28.71  ? 370 VAL A CA  1 
ATOM   2780 C C   . VAL A 1 369 ? -12.837 -39.050 6.068   1.00 32.20  ? 370 VAL A C   1 
ATOM   2781 O O   . VAL A 1 369 ? -13.960 -39.547 6.165   1.00 31.56  ? 370 VAL A O   1 
ATOM   2782 C CB  . VAL A 1 369 ? -10.885 -39.763 7.480   1.00 30.10  ? 370 VAL A CB  1 
ATOM   2783 C CG1 . VAL A 1 369 ? -10.027 -39.438 8.703   1.00 22.84  ? 370 VAL A CG1 1 
ATOM   2784 C CG2 . VAL A 1 369 ? -11.439 -41.184 7.543   1.00 22.56  ? 370 VAL A CG2 1 
ATOM   2785 N N   . SER A 1 370 ? -12.260 -38.777 4.906   1.00 28.81  ? 371 SER A N   1 
ATOM   2786 C CA  . SER A 1 370 ? -12.924 -39.048 3.640   1.00 32.80  ? 371 SER A CA  1 
ATOM   2787 C C   . SER A 1 370 ? -13.165 -40.535 3.448   1.00 35.63  ? 371 SER A C   1 
ATOM   2788 O O   . SER A 1 370 ? -12.501 -41.377 4.076   1.00 32.38  ? 371 SER A O   1 
ATOM   2789 C CB  . SER A 1 370 ? -12.065 -38.536 2.492   1.00 31.59  ? 371 SER A CB  1 
ATOM   2790 O OG  . SER A 1 370 ? -10.817 -39.210 2.483   1.00 39.99  ? 371 SER A OG  1 
ATOM   2791 N N   . ASP A 1 371 ? -14.121 -40.849 2.577   1.00 34.78  ? 372 ASP A N   1 
ATOM   2792 C CA  . ASP A 1 371 ? -14.367 -42.224 2.157   1.00 37.81  ? 372 ASP A CA  1 
ATOM   2793 C C   . ASP A 1 371 ? -13.090 -42.885 1.635   1.00 35.69  ? 372 ASP A C   1 
ATOM   2794 O O   . ASP A 1 371 ? -12.801 -44.040 1.963   1.00 32.05  ? 372 ASP A O   1 
ATOM   2795 C CB  . ASP A 1 371 ? -15.458 -42.271 1.081   1.00 38.64  ? 372 ASP A CB  1 
ATOM   2796 C CG  . ASP A 1 371 ? -16.815 -41.838 1.603   1.00 44.44  ? 372 ASP A CG  1 
ATOM   2797 O OD1 . ASP A 1 371 ? -16.997 -41.790 2.844   1.00 44.99  ? 372 ASP A OD1 1 
ATOM   2798 O OD2 . ASP A 1 371 ? -17.701 -41.548 0.769   1.00 47.59  ? 372 ASP A OD2 1 
ATOM   2799 N N   . LEU A 1 372 ? -12.327 -42.155 0.824   1.00 33.87  ? 373 LEU A N   1 
ATOM   2800 C CA  . LEU A 1 372 ? -11.060 -42.688 0.338   1.00 36.02  ? 373 LEU A CA  1 
ATOM   2801 C C   . LEU A 1 372 ? -10.138 -43.109 1.496   1.00 33.76  ? 373 LEU A C   1 
ATOM   2802 O O   . LEU A 1 372 ? -9.591  -44.213 1.489   1.00 31.73  ? 373 LEU A O   1 
ATOM   2803 C CB  . LEU A 1 372 ? -10.348 -41.687 -0.569  1.00 28.18  ? 373 LEU A CB  1 
ATOM   2804 C CG  . LEU A 1 372 ? -9.114  -42.294 -1.239  1.00 32.22  ? 373 LEU A CG  1 
ATOM   2805 C CD1 . LEU A 1 372 ? -9.514  -43.482 -2.118  1.00 31.60  ? 373 LEU A CD1 1 
ATOM   2806 C CD2 . LEU A 1 372 ? -8.356  -41.252 -2.041  1.00 34.94  ? 373 LEU A CD2 1 
ATOM   2807 N N   . ALA A 1 373 ? -9.983  -42.237 2.489   1.00 32.17  ? 374 ALA A N   1 
ATOM   2808 C CA  . ALA A 1 373 ? -9.138  -42.539 3.646   1.00 26.49  ? 374 ALA A CA  1 
ATOM   2809 C C   . ALA A 1 373 ? -9.651  -43.768 4.382   1.00 27.42  ? 374 ALA A C   1 
ATOM   2810 O O   . ALA A 1 373 ? -8.868  -44.643 4.773   1.00 25.71  ? 374 ALA A O   1 
ATOM   2811 C CB  . ALA A 1 373 ? -9.063  -41.349 4.579   1.00 24.26  ? 374 ALA A CB  1 
ATOM   2812 N N   . ALA A 1 374 ? -10.967 -43.842 4.555   1.00 25.32  ? 375 ALA A N   1 
ATOM   2813 C CA  . ALA A 1 374 ? -11.583 -45.009 5.185   1.00 25.32  ? 375 ALA A CA  1 
ATOM   2814 C C   . ALA A 1 374 ? -11.312 -46.288 4.386   1.00 32.41  ? 375 ALA A C   1 
ATOM   2815 O O   . ALA A 1 374 ? -11.023 -47.341 4.968   1.00 32.15  ? 375 ALA A O   1 
ATOM   2816 C CB  . ALA A 1 374 ? -13.074 -44.796 5.355   1.00 23.99  ? 375 ALA A CB  1 
ATOM   2817 N N   . GLU A 1 375 ? -11.411 -46.189 3.058   1.00 31.81  ? 376 GLU A N   1 
ATOM   2818 C CA  . GLU A 1 375 ? -11.112 -47.309 2.166   1.00 28.20  ? 376 GLU A CA  1 
ATOM   2819 C C   . GLU A 1 375 ? -9.687  -47.798 2.371   1.00 25.95  ? 376 GLU A C   1 
ATOM   2820 O O   . GLU A 1 375 ? -9.428  -49.001 2.432   1.00 27.84  ? 376 GLU A O   1 
ATOM   2821 C CB  . GLU A 1 375 ? -11.289 -46.896 0.699   1.00 34.23  ? 376 GLU A CB  1 
ATOM   2822 C CG  . GLU A 1 375 ? -12.732 -46.803 0.227   1.00 41.94  ? 376 GLU A CG  1 
ATOM   2823 C CD  . GLU A 1 375 ? -13.493 -48.088 0.461   1.00 49.51  ? 376 GLU A CD  1 
ATOM   2824 O OE1 . GLU A 1 375 ? -12.938 -49.174 0.186   1.00 52.84  ? 376 GLU A OE1 1 
ATOM   2825 O OE2 . GLU A 1 375 ? -14.646 -48.013 0.933   1.00 66.88  ? 376 GLU A OE2 1 
ATOM   2826 N N   . ALA A 1 376 ? -8.757  -46.855 2.468   1.00 24.20  ? 377 ALA A N   1 
ATOM   2827 C CA  . ALA A 1 376 ? -7.366  -47.201 2.720   1.00 25.54  ? 377 ALA A CA  1 
ATOM   2828 C C   . ALA A 1 376 ? -7.208  -47.950 4.048   1.00 31.40  ? 377 ALA A C   1 
ATOM   2829 O O   . ALA A 1 376 ? -6.424  -48.900 4.132   1.00 32.08  ? 377 ALA A O   1 
ATOM   2830 C CB  . ALA A 1 376 ? -6.495  -45.960 2.693   1.00 26.18  ? 377 ALA A CB  1 
ATOM   2831 N N   . VAL A 1 377 ? -7.950  -47.536 5.079   1.00 22.64  ? 378 VAL A N   1 
ATOM   2832 C CA  . VAL A 1 377 ? -7.901  -48.250 6.349   1.00 27.13  ? 378 VAL A CA  1 
ATOM   2833 C C   . VAL A 1 377 ? -8.371  -49.696 6.172   1.00 26.04  ? 378 VAL A C   1 
ATOM   2834 O O   . VAL A 1 377 ? -7.703  -50.640 6.603   1.00 27.58  ? 378 VAL A O   1 
ATOM   2835 C CB  . VAL A 1 377 ? -8.736  -47.558 7.447   1.00 29.30  ? 378 VAL A CB  1 
ATOM   2836 C CG1 . VAL A 1 377 ? -8.714  -48.396 8.725   1.00 23.62  ? 378 VAL A CG1 1 
ATOM   2837 C CG2 . VAL A 1 377 ? -8.217  -46.149 7.711   1.00 22.47  ? 378 VAL A CG2 1 
ATOM   2838 N N   . VAL A 1 378 ? -9.512  -49.859 5.515   1.00 26.25  ? 379 VAL A N   1 
ATOM   2839 C CA  . VAL A 1 378 ? -10.075 -51.180 5.259   1.00 27.00  ? 379 VAL A CA  1 
ATOM   2840 C C   . VAL A 1 378 ? -9.117  -52.069 4.468   1.00 32.46  ? 379 VAL A C   1 
ATOM   2841 O O   . VAL A 1 378 ? -9.012  -53.274 4.730   1.00 31.44  ? 379 VAL A O   1 
ATOM   2842 C CB  . VAL A 1 378 ? -11.410 -51.064 4.507   1.00 31.31  ? 379 VAL A CB  1 
ATOM   2843 C CG1 . VAL A 1 378 ? -11.891 -52.427 4.065   1.00 32.95  ? 379 VAL A CG1 1 
ATOM   2844 C CG2 . VAL A 1 378 ? -12.449 -50.397 5.390   1.00 27.37  ? 379 VAL A CG2 1 
ATOM   2845 N N   . LEU A 1 379 ? -8.410  -51.470 3.512   1.00 25.49  ? 380 LEU A N   1 
ATOM   2846 C CA  . LEU A 1 379 ? -7.421  -52.202 2.726   1.00 29.31  ? 380 LEU A CA  1 
ATOM   2847 C C   . LEU A 1 379 ? -6.313  -52.773 3.600   1.00 29.31  ? 380 LEU A C   1 
ATOM   2848 O O   . LEU A 1 379 ? -6.029  -53.975 3.555   1.00 26.14  ? 380 LEU A O   1 
ATOM   2849 C CB  . LEU A 1 379 ? -6.796  -51.311 1.636   1.00 28.14  ? 380 LEU A CB  1 
ATOM   2850 C CG  . LEU A 1 379 ? -5.532  -51.888 0.982   1.00 28.32  ? 380 LEU A CG  1 
ATOM   2851 C CD1 . LEU A 1 379 ? -5.861  -53.039 0.016   1.00 25.95  ? 380 LEU A CD1 1 
ATOM   2852 C CD2 . LEU A 1 379 ? -4.702  -50.800 0.301   1.00 26.95  ? 380 LEU A CD2 1 
ATOM   2853 N N   A HIS A 1 380 ? -5.689  -51.901 4.386   0.54 27.06  ? 381 HIS A N   1 
ATOM   2854 N N   B HIS A 1 380 ? -5.688  -51.915 4.399   0.46 27.12  ? 381 HIS A N   1 
ATOM   2855 C CA  A HIS A 1 380 ? -4.569  -52.295 5.229   0.54 29.28  ? 381 HIS A CA  1 
ATOM   2856 C CA  B HIS A 1 380 ? -4.549  -52.343 5.204   0.46 29.27  ? 381 HIS A CA  1 
ATOM   2857 C C   A HIS A 1 380 ? -4.988  -53.341 6.258   0.54 30.41  ? 381 HIS A C   1 
ATOM   2858 C C   B HIS A 1 380 ? -4.936  -53.254 6.367   0.46 30.38  ? 381 HIS A C   1 
ATOM   2859 O O   A HIS A 1 380 ? -4.246  -54.287 6.539   0.54 30.39  ? 381 HIS A O   1 
ATOM   2860 O O   B HIS A 1 380 ? -4.110  -54.028 6.854   0.46 30.62  ? 381 HIS A O   1 
ATOM   2861 C CB  A HIS A 1 380 ? -3.989  -51.068 5.940   0.54 29.71  ? 381 HIS A CB  1 
ATOM   2862 C CB  B HIS A 1 380 ? -3.746  -51.134 5.691   0.46 29.77  ? 381 HIS A CB  1 
ATOM   2863 C CG  A HIS A 1 380 ? -2.559  -51.225 6.354   0.54 29.59  ? 381 HIS A CG  1 
ATOM   2864 C CG  B HIS A 1 380 ? -3.110  -50.359 4.581   0.46 29.27  ? 381 HIS A CG  1 
ATOM   2865 N ND1 A HIS A 1 380 ? -1.511  -51.116 5.464   0.54 29.53  ? 381 HIS A ND1 1 
ATOM   2866 N ND1 B HIS A 1 380 ? -1.879  -50.688 4.057   0.46 30.04  ? 381 HIS A ND1 1 
ATOM   2867 C CD2 A HIS A 1 380 ? -2.001  -51.478 7.563   0.54 30.53  ? 381 HIS A CD2 1 
ATOM   2868 C CD2 B HIS A 1 380 ? -3.548  -49.292 3.873   0.46 29.53  ? 381 HIS A CD2 1 
ATOM   2869 C CE1 A HIS A 1 380 ? -0.370  -51.297 6.106   0.54 32.85  ? 381 HIS A CE1 1 
ATOM   2870 C CE1 B HIS A 1 380 ? -1.583  -49.853 3.078   0.46 31.43  ? 381 HIS A CE1 1 
ATOM   2871 N NE2 A HIS A 1 380 ? -0.639  -51.523 7.380   0.54 32.75  ? 381 HIS A NE2 1 
ATOM   2872 N NE2 B HIS A 1 380 ? -2.578  -48.993 2.947   0.46 30.60  ? 381 HIS A NE2 1 
ATOM   2873 N N   . TYR A 1 381 ? -6.190  -53.179 6.802   1.00 27.90  ? 382 TYR A N   1 
ATOM   2874 C CA  . TYR A 1 381 ? -6.626  -53.988 7.940   1.00 28.68  ? 382 TYR A CA  1 
ATOM   2875 C C   . TYR A 1 381 ? -7.486  -55.204 7.607   1.00 29.15  ? 382 TYR A C   1 
ATOM   2876 O O   . TYR A 1 381 ? -7.926  -55.925 8.505   1.00 27.00  ? 382 TYR A O   1 
ATOM   2877 C CB  . TYR A 1 381 ? -7.295  -53.109 9.003   1.00 24.67  ? 382 TYR A CB  1 
ATOM   2878 C CG  . TYR A 1 381 ? -6.291  -52.326 9.802   1.00 26.18  ? 382 TYR A CG  1 
ATOM   2879 C CD1 . TYR A 1 381 ? -5.755  -52.841 10.980  1.00 20.42  ? 382 TYR A CD1 1 
ATOM   2880 C CD2 . TYR A 1 381 ? -5.856  -51.079 9.369   1.00 25.68  ? 382 TYR A CD2 1 
ATOM   2881 C CE1 . TYR A 1 381 ? -4.820  -52.127 11.707  1.00 21.55  ? 382 TYR A CE1 1 
ATOM   2882 C CE2 . TYR A 1 381 ? -4.922  -50.358 10.086  1.00 24.46  ? 382 TYR A CE2 1 
ATOM   2883 C CZ  . TYR A 1 381 ? -4.410  -50.884 11.260  1.00 26.20  ? 382 TYR A CZ  1 
ATOM   2884 O OH  . TYR A 1 381 ? -3.478  -50.161 11.973  1.00 21.98  ? 382 TYR A OH  1 
ATOM   2885 N N   . THR A 1 382 ? -7.719  -55.443 6.323   1.00 30.28  ? 383 THR A N   1 
ATOM   2886 C CA  . THR A 1 382 ? -8.404  -56.661 5.920   1.00 24.73  ? 383 THR A CA  1 
ATOM   2887 C C   . THR A 1 382 ? -7.377  -57.734 5.594   1.00 26.99  ? 383 THR A C   1 
ATOM   2888 O O   . THR A 1 382 ? -6.368  -57.454 4.952   1.00 27.46  ? 383 THR A O   1 
ATOM   2889 C CB  . THR A 1 382 ? -9.326  -56.413 4.712   1.00 27.08  ? 383 THR A CB  1 
ATOM   2890 O OG1 . THR A 1 382 ? -10.399 -55.543 5.100   1.00 26.64  ? 383 THR A OG1 1 
ATOM   2891 C CG2 . THR A 1 382 ? -9.916  -57.717 4.189   1.00 25.21  ? 383 THR A CG2 1 
ATOM   2892 N N   . ASP A 1 383 ? -7.618  -58.953 6.068   1.00 26.97  ? 384 ASP A N   1 
ATOM   2893 C CA  . ASP A 1 383 ? -6.903  -60.121 5.574   1.00 24.93  ? 384 ASP A CA  1 
ATOM   2894 C C   . ASP A 1 383 ? -7.712  -60.638 4.387   1.00 31.27  ? 384 ASP A C   1 
ATOM   2895 O O   . ASP A 1 383 ? -8.774  -61.231 4.574   1.00 27.91  ? 384 ASP A O   1 
ATOM   2896 C CB  . ASP A 1 383 ? -6.817  -61.185 6.665   1.00 28.57  ? 384 ASP A CB  1 
ATOM   2897 C CG  . ASP A 1 383 ? -6.093  -62.454 6.212   1.00 35.35  ? 384 ASP A CG  1 
ATOM   2898 O OD1 . ASP A 1 383 ? -6.041  -62.742 4.998   1.00 31.44  ? 384 ASP A OD1 1 
ATOM   2899 O OD2 . ASP A 1 383 ? -5.580  -63.179 7.089   1.00 34.54  ? 384 ASP A OD2 1 
ATOM   2900 N N   . TRP A 1 384 ? -7.216  -60.424 3.169   1.00 26.91  ? 385 TRP A N   1 
ATOM   2901 C CA  . TRP A 1 384 ? -8.004  -60.757 1.974   1.00 30.08  ? 385 TRP A CA  1 
ATOM   2902 C C   . TRP A 1 384 ? -8.095  -62.255 1.650   1.00 27.91  ? 385 TRP A C   1 
ATOM   2903 O O   . TRP A 1 384 ? -8.741  -62.652 0.677   1.00 34.23  ? 385 TRP A O   1 
ATOM   2904 C CB  . TRP A 1 384 ? -7.572  -59.918 0.762   1.00 25.55  ? 385 TRP A CB  1 
ATOM   2905 C CG  . TRP A 1 384 ? -7.767  -58.457 1.015   1.00 24.41  ? 385 TRP A CG  1 
ATOM   2906 C CD1 . TRP A 1 384 ? -6.837  -57.573 1.491   1.00 22.44  ? 385 TRP A CD1 1 
ATOM   2907 C CD2 . TRP A 1 384 ? -8.980  -57.711 0.848   1.00 22.18  ? 385 TRP A CD2 1 
ATOM   2908 N NE1 . TRP A 1 384 ? -7.395  -56.322 1.614   1.00 23.17  ? 385 TRP A NE1 1 
ATOM   2909 C CE2 . TRP A 1 384 ? -8.707  -56.380 1.223   1.00 20.76  ? 385 TRP A CE2 1 
ATOM   2910 C CE3 . TRP A 1 384 ? -10.266 -58.037 0.403   1.00 22.99  ? 385 TRP A CE3 1 
ATOM   2911 C CZ2 . TRP A 1 384 ? -9.675  -55.376 1.170   1.00 24.80  ? 385 TRP A CZ2 1 
ATOM   2912 C CZ3 . TRP A 1 384 ? -11.222 -57.039 0.346   1.00 22.72  ? 385 TRP A CZ3 1 
ATOM   2913 C CH2 . TRP A 1 384 ? -10.923 -55.724 0.731   1.00 24.41  ? 385 TRP A CH2 1 
ATOM   2914 N N   . LEU A 1 385 ? -7.468  -63.082 2.478   1.00 29.02  ? 386 LEU A N   1 
ATOM   2915 C CA  . LEU A 1 385 ? -7.731  -64.522 2.448   1.00 32.41  ? 386 LEU A CA  1 
ATOM   2916 C C   . LEU A 1 385 ? -8.857  -64.926 3.424   1.00 37.64  ? 386 LEU A C   1 
ATOM   2917 O O   . LEU A 1 385 ? -9.390  -66.036 3.348   1.00 33.76  ? 386 LEU A O   1 
ATOM   2918 C CB  . LEU A 1 385 ? -6.452  -65.304 2.748   1.00 30.71  ? 386 LEU A CB  1 
ATOM   2919 C CG  . LEU A 1 385 ? -5.417  -65.281 1.617   1.00 38.59  ? 386 LEU A CG  1 
ATOM   2920 C CD1 . LEU A 1 385 ? -4.138  -65.965 2.030   1.00 36.26  ? 386 LEU A CD1 1 
ATOM   2921 C CD2 . LEU A 1 385 ? -5.997  -65.946 0.402   1.00 31.53  ? 386 LEU A CD2 1 
ATOM   2922 N N   . HIS A 1 386 ? -9.203  -64.021 4.340   1.00 35.19  ? 387 HIS A N   1 
ATOM   2923 C CA  . HIS A 1 386 ? -10.253 -64.263 5.334   1.00 32.55  ? 387 HIS A CA  1 
ATOM   2924 C C   . HIS A 1 386 ? -11.030 -62.979 5.591   1.00 30.04  ? 387 HIS A C   1 
ATOM   2925 O O   . HIS A 1 386 ? -11.087 -62.514 6.725   1.00 39.05  ? 387 HIS A O   1 
ATOM   2926 C CB  . HIS A 1 386 ? -9.640  -64.735 6.661   1.00 23.66  ? 387 HIS A CB  1 
ATOM   2927 C CG  . HIS A 1 386 ? -8.718  -65.904 6.524   1.00 29.35  ? 387 HIS A CG  1 
ATOM   2928 N ND1 . HIS A 1 386 ? -9.170  -67.206 6.452   1.00 32.01  ? 387 HIS A ND1 1 
ATOM   2929 C CD2 . HIS A 1 386 ? -7.368  -65.969 6.434   1.00 33.28  ? 387 HIS A CD2 1 
ATOM   2930 C CE1 . HIS A 1 386 ? -8.138  -68.022 6.324   1.00 30.25  ? 387 HIS A CE1 1 
ATOM   2931 N NE2 . HIS A 1 386 ? -7.033  -67.296 6.306   1.00 31.34  ? 387 HIS A NE2 1 
ATOM   2932 N N   . PRO A 1 387 ? -11.629 -62.395 4.544   1.00 31.59  ? 388 PRO A N   1 
ATOM   2933 C CA  . PRO A 1 387 ? -12.196 -61.049 4.697   1.00 32.84  ? 388 PRO A CA  1 
ATOM   2934 C C   . PRO A 1 387 ? -13.389 -60.983 5.645   1.00 36.58  ? 388 PRO A C   1 
ATOM   2935 O O   . PRO A 1 387 ? -13.710 -59.894 6.126   1.00 36.04  ? 388 PRO A O   1 
ATOM   2936 C CB  . PRO A 1 387 ? -12.651 -60.695 3.272   1.00 29.02  ? 388 PRO A CB  1 
ATOM   2937 C CG  . PRO A 1 387 ? -12.934 -62.014 2.631   1.00 25.80  ? 388 PRO A CG  1 
ATOM   2938 C CD  . PRO A 1 387 ? -11.900 -62.960 3.206   1.00 33.70  ? 388 PRO A CD  1 
ATOM   2939 N N   . GLU A 1 388 ? -14.020 -62.121 5.922   1.00 32.03  ? 389 GLU A N   1 
ATOM   2940 C CA  . GLU A 1 388 ? -15.290 -62.117 6.646   1.00 36.97  ? 389 GLU A CA  1 
ATOM   2941 C C   . GLU A 1 388 ? -15.254 -62.881 7.967   1.00 33.58  ? 389 GLU A C   1 
ATOM   2942 O O   . GLU A 1 388 ? -16.291 -63.072 8.600   1.00 35.49  ? 389 GLU A O   1 
ATOM   2943 C CB  . GLU A 1 388 ? -16.406 -62.679 5.755   1.00 35.32  ? 389 GLU A CB  1 
ATOM   2944 C CG  . GLU A 1 388 ? -16.495 -62.017 4.387   1.00 38.11  ? 389 GLU A CG  1 
ATOM   2945 C CD  . GLU A 1 388 ? -17.889 -61.516 4.052   1.00 53.90  ? 389 GLU A CD  1 
ATOM   2946 O OE1 . GLU A 1 388 ? -18.863 -61.988 4.681   1.00 52.88  ? 389 GLU A OE1 1 
ATOM   2947 O OE2 . GLU A 1 388 ? -18.010 -60.640 3.161   1.00 59.79  ? 389 GLU A OE2 1 
ATOM   2948 N N   . ASP A 1 389 ? -14.069 -63.321 8.377   1.00 27.50  ? 390 ASP A N   1 
ATOM   2949 C CA  . ASP A 1 389 ? -13.924 -64.078 9.611   1.00 31.12  ? 390 ASP A CA  1 
ATOM   2950 C C   . ASP A 1 389 ? -14.103 -63.182 10.845  1.00 34.26  ? 390 ASP A C   1 
ATOM   2951 O O   . ASP A 1 389 ? -13.291 -62.291 11.098  1.00 32.21  ? 390 ASP A O   1 
ATOM   2952 C CB  . ASP A 1 389 ? -12.568 -64.783 9.646   1.00 30.62  ? 390 ASP A CB  1 
ATOM   2953 C CG  . ASP A 1 389 ? -12.340 -65.525 10.947  1.00 40.77  ? 390 ASP A CG  1 
ATOM   2954 O OD1 . ASP A 1 389 ? -13.344 -65.885 11.595  1.00 47.65  ? 390 ASP A OD1 1 
ATOM   2955 O OD2 . ASP A 1 389 ? -11.167 -65.750 11.328  1.00 44.78  ? 390 ASP A OD2 1 
ATOM   2956 N N   . PRO A 1 390 ? -15.174 -63.424 11.616  1.00 39.33  ? 391 PRO A N   1 
ATOM   2957 C CA  . PRO A 1 390 ? -15.560 -62.585 12.763  1.00 34.43  ? 391 PRO A CA  1 
ATOM   2958 C C   . PRO A 1 390 ? -14.439 -62.303 13.761  1.00 30.94  ? 391 PRO A C   1 
ATOM   2959 O O   . PRO A 1 390 ? -14.198 -61.133 14.075  1.00 27.53  ? 391 PRO A O   1 
ATOM   2960 C CB  . PRO A 1 390 ? -16.686 -63.392 13.413  1.00 36.25  ? 391 PRO A CB  1 
ATOM   2961 C CG  . PRO A 1 390 ? -17.340 -64.074 12.222  1.00 34.30  ? 391 PRO A CG  1 
ATOM   2962 C CD  . PRO A 1 390 ? -16.165 -64.486 11.361  1.00 33.40  ? 391 PRO A CD  1 
ATOM   2963 N N   . ALA A 1 391 ? -13.758 -63.339 14.240  1.00 27.80  ? 392 ALA A N   1 
ATOM   2964 C CA  . ALA A 1 391 ? -12.677 -63.133 15.196  1.00 32.06  ? 392 ALA A CA  1 
ATOM   2965 C C   . ALA A 1 391 ? -11.577 -62.212 14.647  1.00 34.94  ? 392 ALA A C   1 
ATOM   2966 O O   . ALA A 1 391 ? -11.106 -61.308 15.350  1.00 30.08  ? 392 ALA A O   1 
ATOM   2967 C CB  . ALA A 1 391 ? -12.098 -64.465 15.659  1.00 33.37  ? 392 ALA A CB  1 
ATOM   2968 N N   . ARG A 1 392 ? -11.182 -62.431 13.394  1.00 29.19  ? 393 ARG A N   1 
ATOM   2969 C CA  . ARG A 1 392 ? -10.152 -61.602 12.776  1.00 26.17  ? 393 ARG A CA  1 
ATOM   2970 C C   . ARG A 1 392 ? -10.628 -60.161 12.610  1.00 28.86  ? 393 ARG A C   1 
ATOM   2971 O O   . ARG A 1 392 ? -9.851  -59.223 12.789  1.00 30.19  ? 393 ARG A O   1 
ATOM   2972 C CB  . ARG A 1 392 ? -9.711  -62.186 11.433  1.00 28.84  ? 393 ARG A CB  1 
ATOM   2973 C CG  . ARG A 1 392 ? -8.782  -63.395 11.537  1.00 31.37  ? 393 ARG A CG  1 
ATOM   2974 C CD  . ARG A 1 392 ? -8.332  -63.781 10.130  1.00 34.11  ? 393 ARG A CD  1 
ATOM   2975 N NE  . ARG A 1 392 ? -7.380  -64.890 10.061  1.00 30.40  ? 393 ARG A NE  1 
ATOM   2976 C CZ  . ARG A 1 392 ? -7.740  -66.168 9.957   1.00 36.71  ? 393 ARG A CZ  1 
ATOM   2977 N NH1 . ARG A 1 392 ? -9.027  -66.495 9.951   1.00 35.78  ? 393 ARG A NH1 1 
ATOM   2978 N NH2 . ARG A 1 392 ? -6.819  -67.120 9.868   1.00 29.88  ? 393 ARG A NH2 1 
ATOM   2979 N N   . LEU A 1 393 ? -11.909 -59.993 12.283  1.00 24.13  ? 394 LEU A N   1 
ATOM   2980 C CA  . LEU A 1 393 ? -12.510 -58.668 12.178  1.00 24.22  ? 394 LEU A CA  1 
ATOM   2981 C C   . LEU A 1 393 ? -12.495 -57.947 13.522  1.00 29.21  ? 394 LEU A C   1 
ATOM   2982 O O   . LEU A 1 393 ? -12.227 -56.743 13.588  1.00 26.61  ? 394 LEU A O   1 
ATOM   2983 C CB  . LEU A 1 393 ? -13.945 -58.764 11.659  1.00 23.20  ? 394 LEU A CB  1 
ATOM   2984 C CG  . LEU A 1 393 ? -14.093 -59.263 10.219  1.00 33.56  ? 394 LEU A CG  1 
ATOM   2985 C CD1 . LEU A 1 393 ? -15.546 -59.581 9.895   1.00 28.58  ? 394 LEU A CD1 1 
ATOM   2986 C CD2 . LEU A 1 393 ? -13.553 -58.230 9.256   1.00 23.66  ? 394 LEU A CD2 1 
ATOM   2987 N N   . ARG A 1 394 ? -12.791 -58.688 14.588  1.00 29.48  ? 395 ARG A N   1 
ATOM   2988 C CA  . ARG A 1 394 ? -12.766 -58.135 15.937  1.00 29.95  ? 395 ARG A CA  1 
ATOM   2989 C C   . ARG A 1 394 ? -11.362 -57.636 16.277  1.00 27.14  ? 395 ARG A C   1 
ATOM   2990 O O   . ARG A 1 394 ? -11.179 -56.463 16.603  1.00 23.89  ? 395 ARG A O   1 
ATOM   2991 C CB  . ARG A 1 394 ? -13.224 -59.180 16.952  1.00 26.84  ? 395 ARG A CB  1 
ATOM   2992 C CG  . ARG A 1 394 ? -13.375 -58.651 18.369  1.00 31.70  ? 395 ARG A CG  1 
ATOM   2993 C CD  . ARG A 1 394 ? -13.586 -59.801 19.326  1.00 27.33  ? 395 ARG A CD  1 
ATOM   2994 N NE  . ARG A 1 394 ? -12.485 -60.755 19.253  1.00 30.33  ? 395 ARG A NE  1 
ATOM   2995 C CZ  . ARG A 1 394 ? -12.579 -62.040 19.583  1.00 32.82  ? 395 ARG A CZ  1 
ATOM   2996 N NH1 . ARG A 1 394 ? -13.734 -62.546 19.994  1.00 31.24  ? 395 ARG A NH1 1 
ATOM   2997 N NH2 . ARG A 1 394 ? -11.514 -62.825 19.496  1.00 33.27  ? 395 ARG A NH2 1 
ATOM   2998 N N   . GLU A 1 395 ? -10.377 -58.528 16.174  1.00 27.45  ? 396 GLU A N   1 
ATOM   2999 C CA  . GLU A 1 395 ? -8.971  -58.175 16.366  1.00 28.72  ? 396 GLU A CA  1 
ATOM   3000 C C   . GLU A 1 395 ? -8.525  -57.009 15.479  1.00 28.62  ? 396 GLU A C   1 
ATOM   3001 O O   . GLU A 1 395 ? -7.791  -56.126 15.925  1.00 30.19  ? 396 GLU A O   1 
ATOM   3002 C CB  . GLU A 1 395 ? -8.065  -59.389 16.120  1.00 27.94  ? 396 GLU A CB  1 
ATOM   3003 C CG  . GLU A 1 395 ? -7.624  -60.154 17.368  1.00 36.37  ? 396 GLU A CG  1 
ATOM   3004 C CD  . GLU A 1 395 ? -8.782  -60.783 18.149  1.00 46.91  ? 396 GLU A CD  1 
ATOM   3005 O OE1 . GLU A 1 395 ? -9.597  -60.033 18.738  1.00 49.83  ? 396 GLU A OE1 1 
ATOM   3006 O OE2 . GLU A 1 395 ? -8.869  -62.034 18.194  1.00 44.31  ? 396 GLU A OE2 1 
ATOM   3007 N N   . ALA A 1 396 ? -8.974  -56.995 14.230  1.00 29.47  ? 397 ALA A N   1 
ATOM   3008 C CA  . ALA A 1 396 ? -8.507  -55.972 13.300  1.00 27.17  ? 397 ALA A CA  1 
ATOM   3009 C C   . ALA A 1 396 ? -9.067  -54.601 13.653  1.00 23.41  ? 397 ALA A C   1 
ATOM   3010 O O   . ALA A 1 396 ? -8.372  -53.597 13.532  1.00 23.74  ? 397 ALA A O   1 
ATOM   3011 C CB  . ALA A 1 396 ? -8.843  -56.346 11.842  1.00 22.82  ? 397 ALA A CB  1 
ATOM   3012 N N   . LEU A 1 397 ? -10.323 -54.551 14.084  1.00 21.22  ? 398 LEU A N   1 
ATOM   3013 C CA  . LEU A 1 397 ? -10.900 -53.268 14.443  1.00 20.80  ? 398 LEU A CA  1 
ATOM   3014 C C   . LEU A 1 397 ? -10.261 -52.745 15.740  1.00 27.40  ? 398 LEU A C   1 
ATOM   3015 O O   . LEU A 1 397 ? -10.060 -51.539 15.902  1.00 23.80  ? 398 LEU A O   1 
ATOM   3016 C CB  . LEU A 1 397 ? -12.413 -53.351 14.584  1.00 24.83  ? 398 LEU A CB  1 
ATOM   3017 C CG  . LEU A 1 397 ? -13.073 -51.977 14.745  1.00 25.96  ? 398 LEU A CG  1 
ATOM   3018 C CD1 . LEU A 1 397 ? -12.880 -51.154 13.479  1.00 24.09  ? 398 LEU A CD1 1 
ATOM   3019 C CD2 . LEU A 1 397 ? -14.540 -52.112 15.090  1.00 29.22  ? 398 LEU A CD2 1 
ATOM   3020 N N   . SER A 1 398 ? -9.934  -53.661 16.648  1.00 24.53  ? 399 SER A N   1 
ATOM   3021 C CA  . SER A 1 398 ? -9.189  -53.312 17.846  1.00 27.36  ? 399 SER A CA  1 
ATOM   3022 C C   . SER A 1 398 ? -7.867  -52.660 17.442  1.00 28.12  ? 399 SER A C   1 
ATOM   3023 O O   . SER A 1 398 ? -7.511  -51.589 17.950  1.00 25.55  ? 399 SER A O   1 
ATOM   3024 C CB  . SER A 1 398 ? -8.931  -54.560 18.690  1.00 27.84  ? 399 SER A CB  1 
ATOM   3025 O OG  . SER A 1 398 ? -8.081  -54.273 19.791  1.00 30.97  ? 399 SER A OG  1 
ATOM   3026 N N   . ASP A 1 399 ? -7.160  -53.311 16.518  1.00 23.60  ? 400 ASP A N   1 
ATOM   3027 C CA  . ASP A 1 399 ? -5.918  -52.790 15.947  1.00 23.90  ? 400 ASP A CA  1 
ATOM   3028 C C   . ASP A 1 399 ? -6.094  -51.414 15.311  1.00 24.80  ? 400 ASP A C   1 
ATOM   3029 O O   . ASP A 1 399 ? -5.243  -50.545 15.467  1.00 23.04  ? 400 ASP A O   1 
ATOM   3030 C CB  . ASP A 1 399 ? -5.375  -53.738 14.877  1.00 27.32  ? 400 ASP A CB  1 
ATOM   3031 C CG  . ASP A 1 399 ? -4.716  -54.958 15.461  1.00 31.10  ? 400 ASP A CG  1 
ATOM   3032 O OD1 . ASP A 1 399 ? -4.458  -54.963 16.682  1.00 34.65  ? 400 ASP A OD1 1 
ATOM   3033 O OD2 . ASP A 1 399 ? -4.434  -55.902 14.692  1.00 40.27  ? 400 ASP A OD2 1 
ATOM   3034 N N   . VAL A 1 400 ? -7.184  -51.217 14.578  1.00 22.86  ? 401 VAL A N   1 
ATOM   3035 C CA  . VAL A 1 400 ? -7.410  -49.920 13.945  1.00 25.06  ? 401 VAL A CA  1 
ATOM   3036 C C   . VAL A 1 400 ? -7.458  -48.816 15.002  1.00 24.94  ? 401 VAL A C   1 
ATOM   3037 O O   . VAL A 1 400 ? -6.664  -47.881 14.964  1.00 24.27  ? 401 VAL A O   1 
ATOM   3038 C CB  . VAL A 1 400 ? -8.699  -49.894 13.091  1.00 20.50  ? 401 VAL A CB  1 
ATOM   3039 C CG1 . VAL A 1 400 ? -9.069  -48.456 12.722  1.00 17.07  ? 401 VAL A CG1 1 
ATOM   3040 C CG2 . VAL A 1 400 ? -8.529  -50.746 11.849  1.00 20.91  ? 401 VAL A CG2 1 
ATOM   3041 N N   . VAL A 1 401 ? -8.380  -48.948 15.952  1.00 24.59  ? 402 VAL A N   1 
ATOM   3042 C CA  . VAL A 1 401 ? -8.568  -47.955 16.998  1.00 25.75  ? 402 VAL A CA  1 
ATOM   3043 C C   . VAL A 1 401 ? -7.288  -47.745 17.811  1.00 25.08  ? 402 VAL A C   1 
ATOM   3044 O O   . VAL A 1 401 ? -6.901  -46.611 18.085  1.00 20.68  ? 402 VAL A O   1 
ATOM   3045 C CB  . VAL A 1 401 ? -9.737  -48.349 17.921  1.00 26.04  ? 402 VAL A CB  1 
ATOM   3046 C CG1 . VAL A 1 401 ? -9.846  -47.383 19.095  1.00 18.44  ? 402 VAL A CG1 1 
ATOM   3047 C CG2 . VAL A 1 401 ? -11.040 -48.401 17.115  1.00 23.97  ? 402 VAL A CG2 1 
ATOM   3048 N N   . GLY A 1 402 ? -6.619  -48.842 18.152  1.00 24.74  ? 403 GLY A N   1 
ATOM   3049 C CA  . GLY A 1 402 ? -5.397  -48.788 18.937  1.00 26.13  ? 403 GLY A CA  1 
ATOM   3050 C C   . GLY A 1 402 ? -4.174  -48.207 18.241  1.00 25.68  ? 403 GLY A C   1 
ATOM   3051 O O   . GLY A 1 402 ? -3.400  -47.459 18.862  1.00 21.02  ? 403 GLY A O   1 
ATOM   3052 N N   . ASP A 1 403 ? -3.992  -48.547 16.962  1.00 20.79  ? 404 ASP A N   1 
ATOM   3053 C CA  . ASP A 1 403 ? -2.836  -48.074 16.205  1.00 20.06  ? 404 ASP A CA  1 
ATOM   3054 C C   . ASP A 1 403 ? -2.997  -46.591 15.923  1.00 24.12  ? 404 ASP A C   1 
ATOM   3055 O O   . ASP A 1 403 ? -2.082  -45.782 16.130  1.00 23.52  ? 404 ASP A O   1 
ATOM   3056 C CB  . ASP A 1 403 ? -2.690  -48.832 14.874  1.00 20.13  ? 404 ASP A CB  1 
ATOM   3057 C CG  . ASP A 1 403 ? -2.412  -50.321 15.064  1.00 23.47  ? 404 ASP A CG  1 
ATOM   3058 O OD1 . ASP A 1 403 ? -2.054  -50.742 16.190  1.00 25.85  ? 404 ASP A OD1 1 
ATOM   3059 O OD2 . ASP A 1 403 ? -2.566  -51.078 14.081  1.00 25.17  ? 404 ASP A OD2 1 
ATOM   3060 N N   . HIS A 1 404 ? -4.188  -46.254 15.456  1.00 19.39  ? 405 HIS A N   1 
ATOM   3061 C CA  . HIS A 1 404 ? -4.552  -44.895 15.112  1.00 22.74  ? 405 HIS A CA  1 
ATOM   3062 C C   . HIS A 1 404 ? -4.479  -43.947 16.319  1.00 24.69  ? 405 HIS A C   1 
ATOM   3063 O O   . HIS A 1 404 ? -3.904  -42.861 16.239  1.00 26.36  ? 405 HIS A O   1 
ATOM   3064 C CB  . HIS A 1 404 ? -5.961  -44.913 14.510  1.00 19.16  ? 405 HIS A CB  1 
ATOM   3065 C CG  . HIS A 1 404 ? -6.535  -43.558 14.258  1.00 26.56  ? 405 HIS A CG  1 
ATOM   3066 N ND1 . HIS A 1 404 ? -5.855  -42.580 13.564  1.00 25.09  ? 405 HIS A ND1 1 
ATOM   3067 C CD2 . HIS A 1 404 ? -7.731  -43.019 14.604  1.00 26.60  ? 405 HIS A CD2 1 
ATOM   3068 C CE1 . HIS A 1 404 ? -6.611  -41.496 13.486  1.00 25.88  ? 405 HIS A CE1 1 
ATOM   3069 N NE2 . HIS A 1 404 ? -7.754  -41.737 14.107  1.00 29.98  ? 405 HIS A NE2 1 
ATOM   3070 N N   . ASN A 1 405 ? -5.052  -44.358 17.439  1.00 21.07  ? 406 ASN A N   1 
ATOM   3071 C CA  . ASN A 1 405 ? -5.116  -43.473 18.597  1.00 25.47  ? 406 ASN A CA  1 
ATOM   3072 C C   . ASN A 1 405 ? -3.896  -43.493 19.517  1.00 21.80  ? 406 ASN A C   1 
ATOM   3073 O O   . ASN A 1 405 ? -3.554  -42.468 20.100  1.00 22.88  ? 406 ASN A O   1 
ATOM   3074 C CB  . ASN A 1 405 ? -6.394  -43.714 19.410  1.00 18.56  ? 406 ASN A CB  1 
ATOM   3075 C CG  . ASN A 1 405 ? -7.644  -43.260 18.674  1.00 21.51  ? 406 ASN A CG  1 
ATOM   3076 O OD1 . ASN A 1 405 ? -7.854  -42.065 18.457  1.00 18.76  ? 406 ASN A OD1 1 
ATOM   3077 N ND2 . ASN A 1 405 ? -8.482  -44.215 18.291  1.00 19.22  ? 406 ASN A ND2 1 
ATOM   3078 N N   . VAL A 1 406 ? -3.239  -44.640 19.653  1.00 20.47  ? 407 VAL A N   1 
ATOM   3079 C CA  . VAL A 1 406 ? -2.162  -44.737 20.637  1.00 19.47  ? 407 VAL A CA  1 
ATOM   3080 C C   . VAL A 1 406 ? -0.805  -45.177 20.102  1.00 22.42  ? 407 VAL A C   1 
ATOM   3081 O O   . VAL A 1 406 ? 0.176   -44.434 20.203  1.00 21.81  ? 407 VAL A O   1 
ATOM   3082 C CB  . VAL A 1 406 ? -2.536  -45.677 21.797  1.00 20.93  ? 407 VAL A CB  1 
ATOM   3083 C CG1 . VAL A 1 406 ? -1.385  -45.751 22.799  1.00 19.76  ? 407 VAL A CG1 1 
ATOM   3084 C CG2 . VAL A 1 406 ? -3.820  -45.200 22.468  1.00 22.32  ? 407 VAL A CG2 1 
ATOM   3085 N N   . VAL A 1 407 ? -0.747  -46.393 19.562  1.00 17.97  ? 408 VAL A N   1 
ATOM   3086 C CA  . VAL A 1 407 ? 0.528   -47.004 19.189  1.00 20.12  ? 408 VAL A CA  1 
ATOM   3087 C C   . VAL A 1 407 ? 1.324   -46.163 18.183  1.00 23.83  ? 408 VAL A C   1 
ATOM   3088 O O   . VAL A 1 407 ? 2.511   -45.887 18.378  1.00 21.98  ? 408 VAL A O   1 
ATOM   3089 C CB  . VAL A 1 407 ? 0.335   -48.430 18.616  1.00 21.63  ? 408 VAL A CB  1 
ATOM   3090 C CG1 . VAL A 1 407 ? 1.671   -49.010 18.211  1.00 20.13  ? 408 VAL A CG1 1 
ATOM   3091 C CG2 . VAL A 1 407 ? -0.363  -49.339 19.638  1.00 19.04  ? 408 VAL A CG2 1 
ATOM   3092 N N   . CYS A 1 408 ? 0.671   -45.753 17.104  1.00 21.73  ? 409 CYS A N   1 
ATOM   3093 C CA  . CYS A 1 408 ? 1.383   -45.014 16.069  1.00 24.08  ? 409 CYS A CA  1 
ATOM   3094 C C   . CYS A 1 408 ? 1.729   -43.578 16.463  1.00 24.52  ? 409 CYS A C   1 
ATOM   3095 O O   . CYS A 1 408 ? 2.785   -43.079 16.072  1.00 24.47  ? 409 CYS A O   1 
ATOM   3096 C CB  . CYS A 1 408 ? 0.651   -45.093 14.721  1.00 20.37  ? 409 CYS A CB  1 
ATOM   3097 S SG  . CYS A 1 408 ? 0.455   -46.808 14.161  1.00 21.78  ? 409 CYS A SG  1 
ATOM   3098 N N   . PRO A 1 409 ? 0.846   -42.897 17.221  1.00 25.26  ? 410 PRO A N   1 
ATOM   3099 C CA  . PRO A 1 409 ? 1.335   -41.609 17.730  1.00 23.93  ? 410 PRO A CA  1 
ATOM   3100 C C   . PRO A 1 409 ? 2.529   -41.747 18.689  1.00 23.85  ? 410 PRO A C   1 
ATOM   3101 O O   . PRO A 1 409 ? 3.424   -40.898 18.651  1.00 23.22  ? 410 PRO A O   1 
ATOM   3102 C CB  . PRO A 1 409 ? 0.111   -41.028 18.439  1.00 24.24  ? 410 PRO A CB  1 
ATOM   3103 C CG  . PRO A 1 409 ? -1.039  -41.583 17.673  1.00 20.33  ? 410 PRO A CG  1 
ATOM   3104 C CD  . PRO A 1 409 ? -0.624  -42.993 17.317  1.00 19.27  ? 410 PRO A CD  1 
ATOM   3105 N N   . VAL A 1 410 ? 2.557   -42.797 19.508  1.00 21.90  ? 411 VAL A N   1 
ATOM   3106 C CA  . VAL A 1 410 ? 3.678   -43.015 20.422  1.00 23.44  ? 411 VAL A CA  1 
ATOM   3107 C C   . VAL A 1 410 ? 4.941   -43.378 19.634  1.00 25.90  ? 411 VAL A C   1 
ATOM   3108 O O   . VAL A 1 410 ? 6.028   -42.873 19.910  1.00 23.81  ? 411 VAL A O   1 
ATOM   3109 C CB  . VAL A 1 410 ? 3.359   -44.099 21.490  1.00 24.76  ? 411 VAL A CB  1 
ATOM   3110 C CG1 . VAL A 1 410 ? 4.626   -44.562 22.212  1.00 22.20  ? 411 VAL A CG1 1 
ATOM   3111 C CG2 . VAL A 1 410 ? 2.347   -43.583 22.486  1.00 16.43  ? 411 VAL A CG2 1 
ATOM   3112 N N   . ALA A 1 411 ? 4.783   -44.236 18.635  1.00 24.47  ? 412 ALA A N   1 
ATOM   3113 C CA  . ALA A 1 411 ? 5.903   -44.631 17.783  1.00 26.37  ? 412 ALA A CA  1 
ATOM   3114 C C   . ALA A 1 411 ? 6.522   -43.425 17.088  1.00 23.66  ? 412 ALA A C   1 
ATOM   3115 O O   . ALA A 1 411 ? 7.741   -43.255 17.066  1.00 28.37  ? 412 ALA A O   1 
ATOM   3116 C CB  . ALA A 1 411 ? 5.453   -45.661 16.757  1.00 24.17  ? 412 ALA A CB  1 
ATOM   3117 N N   . GLN A 1 412 ? 5.676   -42.578 16.525  1.00 24.46  ? 413 GLN A N   1 
ATOM   3118 C CA  . GLN A 1 412 ? 6.150   -41.378 15.861  1.00 24.19  ? 413 GLN A CA  1 
ATOM   3119 C C   . GLN A 1 412 ? 6.882   -40.453 16.830  1.00 27.61  ? 413 GLN A C   1 
ATOM   3120 O O   . GLN A 1 412 ? 7.942   -39.921 16.505  1.00 25.97  ? 413 GLN A O   1 
ATOM   3121 C CB  . GLN A 1 412 ? 4.985   -40.632 15.221  1.00 28.47  ? 413 GLN A CB  1 
ATOM   3122 C CG  . GLN A 1 412 ? 5.304   -39.183 14.902  1.00 28.52  ? 413 GLN A CG  1 
ATOM   3123 C CD  . GLN A 1 412 ? 5.042   -38.848 13.465  1.00 36.45  ? 413 GLN A CD  1 
ATOM   3124 O OE1 . GLN A 1 412 ? 4.047   -38.201 13.145  1.00 53.07  ? 413 GLN A OE1 1 
ATOM   3125 N NE2 . GLN A 1 412 ? 5.930   -39.295 12.577  1.00 42.93  ? 413 GLN A NE2 1 
ATOM   3126 N N   . LEU A 1 413 ? 6.308   -40.253 18.016  1.00 26.71  ? 414 LEU A N   1 
ATOM   3127 C CA  . LEU A 1 413 ? 6.975   -39.469 19.050  1.00 23.78  ? 414 LEU A CA  1 
ATOM   3128 C C   . LEU A 1 413 ? 8.352   -40.048 19.383  1.00 25.72  ? 414 LEU A C   1 
ATOM   3129 O O   . LEU A 1 413 ? 9.340   -39.321 19.456  1.00 25.03  ? 414 LEU A O   1 
ATOM   3130 C CB  . LEU A 1 413 ? 6.134   -39.416 20.322  1.00 24.33  ? 414 LEU A CB  1 
ATOM   3131 C CG  . LEU A 1 413 ? 6.836   -38.645 21.442  1.00 28.17  ? 414 LEU A CG  1 
ATOM   3132 C CD1 . LEU A 1 413 ? 6.942   -37.178 21.073  1.00 28.96  ? 414 LEU A CD1 1 
ATOM   3133 C CD2 . LEU A 1 413 ? 6.100   -38.792 22.719  1.00 30.66  ? 414 LEU A CD2 1 
ATOM   3134 N N   . ALA A 1 414 ? 8.410   -41.362 19.570  1.00 19.11  ? 415 ALA A N   1 
ATOM   3135 C CA  . ALA A 1 414 ? 9.648   -42.017 19.964  1.00 21.51  ? 415 ALA A CA  1 
ATOM   3136 C C   . ALA A 1 414 ? 10.714  -41.909 18.869  1.00 30.91  ? 415 ALA A C   1 
ATOM   3137 O O   . ALA A 1 414 ? 11.889  -41.670 19.159  1.00 27.97  ? 415 ALA A O   1 
ATOM   3138 C CB  . ALA A 1 414 ? 9.384   -43.473 20.312  1.00 23.90  ? 415 ALA A CB  1 
ATOM   3139 N N   . GLY A 1 415 ? 10.297  -42.071 17.615  1.00 27.27  ? 416 GLY A N   1 
ATOM   3140 C CA  . GLY A 1 415 ? 11.217  -42.012 16.494  1.00 22.95  ? 416 GLY A CA  1 
ATOM   3141 C C   . GLY A 1 415 ? 11.812  -40.634 16.304  1.00 22.46  ? 416 GLY A C   1 
ATOM   3142 O O   . GLY A 1 415 ? 13.024  -40.470 16.176  1.00 30.69  ? 416 GLY A O   1 
ATOM   3143 N N   . ARG A 1 416 ? 10.959  -39.625 16.293  1.00 25.00  ? 417 ARG A N   1 
ATOM   3144 C CA  . ARG A 1 416 ? 11.434  -38.264 16.130  1.00 26.73  ? 417 ARG A CA  1 
ATOM   3145 C C   . ARG A 1 416 ? 12.311  -37.822 17.296  1.00 34.63  ? 417 ARG A C   1 
ATOM   3146 O O   . ARG A 1 416 ? 13.356  -37.207 17.083  1.00 39.13  ? 417 ARG A O   1 
ATOM   3147 C CB  . ARG A 1 416 ? 10.263  -37.305 15.938  1.00 30.99  ? 417 ARG A CB  1 
ATOM   3148 C CG  . ARG A 1 416 ? 9.570   -37.457 14.595  1.00 37.21  ? 417 ARG A CG  1 
ATOM   3149 C CD  . ARG A 1 416 ? 10.598  -37.612 13.486  1.00 36.81  ? 417 ARG A CD  1 
ATOM   3150 N NE  . ARG A 1 416 ? 10.101  -37.140 12.199  1.00 62.44  ? 417 ARG A NE  1 
ATOM   3151 C CZ  . ARG A 1 416 ? 10.375  -35.942 11.693  1.00 56.80  ? 417 ARG A CZ  1 
ATOM   3152 N NH1 . ARG A 1 416 ? 11.145  -35.097 12.367  1.00 59.03  ? 417 ARG A NH1 1 
ATOM   3153 N NH2 . ARG A 1 416 ? 9.880   -35.590 10.514  1.00 49.35  ? 417 ARG A NH2 1 
ATOM   3154 N N   . LEU A 1 417 ? 11.897  -38.130 18.524  1.00 28.64  ? 418 LEU A N   1 
ATOM   3155 C CA  . LEU A 1 417 ? 12.686  -37.719 19.685  1.00 30.44  ? 418 LEU A CA  1 
ATOM   3156 C C   . LEU A 1 417 ? 14.071  -38.364 19.632  1.00 26.99  ? 418 LEU A C   1 
ATOM   3157 O O   . LEU A 1 417 ? 15.077  -37.682 19.780  1.00 32.27  ? 418 LEU A O   1 
ATOM   3158 C CB  . LEU A 1 417 ? 11.983  -38.033 21.019  1.00 21.13  ? 418 LEU A CB  1 
ATOM   3159 C CG  . LEU A 1 417 ? 10.696  -37.288 21.418  1.00 31.55  ? 418 LEU A CG  1 
ATOM   3160 C CD1 . LEU A 1 417 ? 10.337  -37.511 22.886  1.00 24.60  ? 418 LEU A CD1 1 
ATOM   3161 C CD2 . LEU A 1 417 ? 10.769  -35.814 21.142  1.00 32.52  ? 418 LEU A CD2 1 
ATOM   3162 N N   . ALA A 1 418 ? 14.117  -39.675 19.414  1.00 25.08  ? 419 ALA A N   1 
ATOM   3163 C CA  . ALA A 1 418 ? 15.390  -40.392 19.302  1.00 28.50  ? 419 ALA A CA  1 
ATOM   3164 C C   . ALA A 1 418 ? 16.276  -39.856 18.169  1.00 37.35  ? 419 ALA A C   1 
ATOM   3165 O O   . ALA A 1 418 ? 17.477  -39.650 18.359  1.00 38.50  ? 419 ALA A O   1 
ATOM   3166 C CB  . ALA A 1 418 ? 15.150  -41.892 19.119  1.00 22.50  ? 419 ALA A CB  1 
ATOM   3167 N N   . ALA A 1 419 ? 15.686  -39.630 16.996  1.00 31.96  ? 420 ALA A N   1 
ATOM   3168 C CA  . ALA A 1 419 ? 16.450  -39.135 15.849  1.00 34.66  ? 420 ALA A CA  1 
ATOM   3169 C C   . ALA A 1 419 ? 16.887  -37.686 16.020  1.00 35.33  ? 420 ALA A C   1 
ATOM   3170 O O   . ALA A 1 419 ? 17.733  -37.204 15.275  1.00 40.38  ? 420 ALA A O   1 
ATOM   3171 C CB  . ALA A 1 419 ? 15.651  -39.290 14.564  1.00 27.80  ? 420 ALA A CB  1 
ATOM   3172 N N   . GLN A 1 420 ? 16.314  -36.991 16.999  1.00 35.89  ? 421 GLN A N   1 
ATOM   3173 C CA  . GLN A 1 420 ? 16.633  -35.582 17.204  1.00 25.77  ? 421 GLN A CA  1 
ATOM   3174 C C   . GLN A 1 420 ? 17.297  -35.315 18.543  1.00 31.19  ? 421 GLN A C   1 
ATOM   3175 O O   . GLN A 1 420 ? 17.222  -34.205 19.089  1.00 31.62  ? 421 GLN A O   1 
ATOM   3176 C CB  . GLN A 1 420 ? 15.396  -34.717 16.991  1.00 31.03  ? 421 GLN A CB  1 
ATOM   3177 C CG  . GLN A 1 420 ? 14.917  -34.821 15.551  1.00 39.90  ? 421 GLN A CG  1 
ATOM   3178 C CD  . GLN A 1 420 ? 13.504  -34.331 15.343  1.00 44.93  ? 421 GLN A CD  1 
ATOM   3179 O OE1 . GLN A 1 420 ? 12.762  -34.884 14.527  1.00 45.53  ? 421 GLN A OE1 1 
ATOM   3180 N NE2 . GLN A 1 420 ? 13.124  -33.284 16.070  1.00 42.40  ? 421 GLN A NE2 1 
ATOM   3181 N N   . GLY A 1 421 ? 17.951  -36.347 19.069  1.00 33.24  ? 422 GLY A N   1 
ATOM   3182 C CA  . GLY A 1 421 ? 18.866  -36.157 20.177  1.00 39.92  ? 422 GLY A CA  1 
ATOM   3183 C C   . GLY A 1 421 ? 18.486  -36.726 21.527  1.00 38.93  ? 422 GLY A C   1 
ATOM   3184 O O   . GLY A 1 421 ? 19.282  -36.663 22.453  1.00 37.16  ? 422 GLY A O   1 
ATOM   3185 N N   . ALA A 1 422 ? 17.286  -37.278 21.656  1.00 35.51  ? 423 ALA A N   1 
ATOM   3186 C CA  . ALA A 1 422 ? 16.861  -37.795 22.949  1.00 32.75  ? 423 ALA A CA  1 
ATOM   3187 C C   . ALA A 1 422 ? 17.227  -39.258 23.080  1.00 28.54  ? 423 ALA A C   1 
ATOM   3188 O O   . ALA A 1 422 ? 17.340  -39.958 22.082  1.00 32.18  ? 423 ALA A O   1 
ATOM   3189 C CB  . ALA A 1 422 ? 15.365  -37.609 23.132  1.00 32.19  ? 423 ALA A CB  1 
ATOM   3190 N N   . ARG A 1 423 ? 17.411  -39.715 24.317  1.00 28.73  ? 424 ARG A N   1 
ATOM   3191 C CA  . ARG A 1 423 ? 17.542  -41.139 24.586  1.00 29.17  ? 424 ARG A CA  1 
ATOM   3192 C C   . ARG A 1 423 ? 16.173  -41.682 24.968  1.00 29.84  ? 424 ARG A C   1 
ATOM   3193 O O   . ARG A 1 423 ? 15.577  -41.256 25.960  1.00 35.05  ? 424 ARG A O   1 
ATOM   3194 C CB  . ARG A 1 423 ? 18.551  -41.421 25.707  1.00 28.38  ? 424 ARG A CB  1 
ATOM   3195 C CG  . ARG A 1 423 ? 18.873  -42.912 25.845  1.00 32.89  ? 424 ARG A CG  1 
ATOM   3196 C CD  . ARG A 1 423 ? 20.250  -43.163 26.457  1.00 38.46  ? 424 ARG A CD  1 
ATOM   3197 N NE  . ARG A 1 423 ? 20.187  -43.229 27.919  1.00 57.58  ? 424 ARG A NE  1 
ATOM   3198 C CZ  . ARG A 1 423 ? 20.693  -42.316 28.744  1.00 50.14  ? 424 ARG A CZ  1 
ATOM   3199 N NH1 . ARG A 1 423 ? 21.319  -41.249 28.261  1.00 56.71  ? 424 ARG A NH1 1 
ATOM   3200 N NH2 . ARG A 1 423 ? 20.578  -42.475 30.056  1.00 46.64  ? 424 ARG A NH2 1 
ATOM   3201 N N   . VAL A 1 424 ? 15.680  -42.625 24.176  1.00 26.01  ? 425 VAL A N   1 
ATOM   3202 C CA  . VAL A 1 424 ? 14.344  -43.151 24.358  1.00 22.30  ? 425 VAL A CA  1 
ATOM   3203 C C   . VAL A 1 424 ? 14.362  -44.624 24.769  1.00 30.22  ? 425 VAL A C   1 
ATOM   3204 O O   . VAL A 1 424 ? 15.113  -45.422 24.212  1.00 29.02  ? 425 VAL A O   1 
ATOM   3205 C CB  . VAL A 1 424 ? 13.535  -42.994 23.054  1.00 25.52  ? 425 VAL A CB  1 
ATOM   3206 C CG1 . VAL A 1 424 ? 12.112  -43.527 23.225  1.00 19.82  ? 425 VAL A CG1 1 
ATOM   3207 C CG2 . VAL A 1 424 ? 13.540  -41.528 22.596  1.00 19.93  ? 425 VAL A CG2 1 
ATOM   3208 N N   . TYR A 1 425 ? 13.540  -44.982 25.752  1.00 24.33  ? 426 TYR A N   1 
ATOM   3209 C CA  . TYR A 1 425 ? 13.262  -46.388 26.030  1.00 25.70  ? 426 TYR A CA  1 
ATOM   3210 C C   . TYR A 1 425 ? 11.791  -46.699 25.747  1.00 26.68  ? 426 TYR A C   1 
ATOM   3211 O O   . TYR A 1 425 ? 10.903  -45.916 26.104  1.00 27.55  ? 426 TYR A O   1 
ATOM   3212 C CB  . TYR A 1 425 ? 13.617  -46.738 27.478  1.00 24.33  ? 426 TYR A CB  1 
ATOM   3213 C CG  . TYR A 1 425 ? 15.073  -46.513 27.786  1.00 28.82  ? 426 TYR A CG  1 
ATOM   3214 C CD1 . TYR A 1 425 ? 16.006  -47.538 27.633  1.00 26.87  ? 426 TYR A CD1 1 
ATOM   3215 C CD2 . TYR A 1 425 ? 15.525  -45.266 28.212  1.00 23.25  ? 426 TYR A CD2 1 
ATOM   3216 C CE1 . TYR A 1 425 ? 17.350  -47.326 27.907  1.00 27.11  ? 426 TYR A CE1 1 
ATOM   3217 C CE2 . TYR A 1 425 ? 16.857  -45.048 28.487  1.00 26.98  ? 426 TYR A CE2 1 
ATOM   3218 C CZ  . TYR A 1 425 ? 17.766  -46.076 28.332  1.00 28.04  ? 426 TYR A CZ  1 
ATOM   3219 O OH  . TYR A 1 425 ? 19.092  -45.842 28.610  1.00 29.63  ? 426 TYR A OH  1 
ATOM   3220 N N   . ALA A 1 426 ? 11.539  -47.843 25.117  1.00 23.25  ? 427 ALA A N   1 
ATOM   3221 C CA  . ALA A 1 426 ? 10.184  -48.237 24.737  1.00 22.32  ? 427 ALA A CA  1 
ATOM   3222 C C   . ALA A 1 426 ? 9.814   -49.614 25.283  1.00 26.38  ? 427 ALA A C   1 
ATOM   3223 O O   . ALA A 1 426 ? 10.665  -50.503 25.372  1.00 28.09  ? 427 ALA A O   1 
ATOM   3224 C CB  . ALA A 1 426 ? 10.037  -48.216 23.209  1.00 23.11  ? 427 ALA A CB  1 
ATOM   3225 N N   . TYR A 1 427 ? 8.543   -49.797 25.630  1.00 19.79  ? 428 TYR A N   1 
ATOM   3226 C CA  . TYR A 1 427 ? 8.066   -51.081 26.138  1.00 23.49  ? 428 TYR A CA  1 
ATOM   3227 C C   . TYR A 1 427 ? 6.696   -51.375 25.560  1.00 23.32  ? 428 TYR A C   1 
ATOM   3228 O O   . TYR A 1 427 ? 5.969   -50.460 25.171  1.00 23.74  ? 428 TYR A O   1 
ATOM   3229 C CB  . TYR A 1 427 ? 7.949   -51.078 27.687  1.00 19.45  ? 428 TYR A CB  1 
ATOM   3230 C CG  . TYR A 1 427 ? 6.884   -50.118 28.201  1.00 21.92  ? 428 TYR A CG  1 
ATOM   3231 C CD1 . TYR A 1 427 ? 5.538   -50.489 28.263  1.00 20.04  ? 428 TYR A CD1 1 
ATOM   3232 C CD2 . TYR A 1 427 ? 7.222   -48.836 28.607  1.00 19.87  ? 428 TYR A CD2 1 
ATOM   3233 C CE1 . TYR A 1 427 ? 4.563   -49.602 28.708  1.00 20.35  ? 428 TYR A CE1 1 
ATOM   3234 C CE2 . TYR A 1 427 ? 6.256   -47.942 29.058  1.00 20.99  ? 428 TYR A CE2 1 
ATOM   3235 C CZ  . TYR A 1 427 ? 4.930   -48.327 29.102  1.00 25.04  ? 428 TYR A CZ  1 
ATOM   3236 O OH  . TYR A 1 427 ? 3.977   -47.424 29.540  1.00 24.46  ? 428 TYR A OH  1 
ATOM   3237 N N   . VAL A 1 428 ? 6.341   -52.652 25.533  1.00 22.88  ? 429 VAL A N   1 
ATOM   3238 C CA  . VAL A 1 428 ? 4.954   -53.060 25.393  1.00 23.42  ? 429 VAL A CA  1 
ATOM   3239 C C   . VAL A 1 428 ? 4.617   -53.885 26.611  1.00 22.55  ? 429 VAL A C   1 
ATOM   3240 O O   . VAL A 1 428 ? 5.364   -54.789 26.987  1.00 24.57  ? 429 VAL A O   1 
ATOM   3241 C CB  . VAL A 1 428 ? 4.701   -53.905 24.126  1.00 25.90  ? 429 VAL A CB  1 
ATOM   3242 C CG1 . VAL A 1 428 ? 3.231   -54.269 24.035  1.00 24.83  ? 429 VAL A CG1 1 
ATOM   3243 C CG2 . VAL A 1 428 ? 5.107   -53.125 22.888  1.00 26.71  ? 429 VAL A CG2 1 
ATOM   3244 N N   . PHE A 1 429 ? 3.498   -53.561 27.239  1.00 26.81  ? 430 PHE A N   1 
ATOM   3245 C CA  . PHE A 1 429 ? 3.118   -54.204 28.485  1.00 25.15  ? 430 PHE A CA  1 
ATOM   3246 C C   . PHE A 1 429 ? 2.136   -55.319 28.150  1.00 24.50  ? 430 PHE A C   1 
ATOM   3247 O O   . PHE A 1 429 ? 1.063   -55.071 27.614  1.00 25.87  ? 430 PHE A O   1 
ATOM   3248 C CB  . PHE A 1 429 ? 2.518   -53.164 29.426  1.00 20.68  ? 430 PHE A CB  1 
ATOM   3249 C CG  . PHE A 1 429 ? 2.097   -53.710 30.760  1.00 25.71  ? 430 PHE A CG  1 
ATOM   3250 C CD1 . PHE A 1 429 ? 2.961   -53.671 31.841  1.00 26.20  ? 430 PHE A CD1 1 
ATOM   3251 C CD2 . PHE A 1 429 ? 0.829   -54.239 30.940  1.00 25.24  ? 430 PHE A CD2 1 
ATOM   3252 C CE1 . PHE A 1 429 ? 2.568   -54.161 33.075  1.00 28.16  ? 430 PHE A CE1 1 
ATOM   3253 C CE2 . PHE A 1 429 ? 0.434   -54.735 32.170  1.00 23.94  ? 430 PHE A CE2 1 
ATOM   3254 C CZ  . PHE A 1 429 ? 1.304   -54.693 33.235  1.00 26.33  ? 430 PHE A CZ  1 
ATOM   3255 N N   . GLU A 1 430 ? 2.515   -56.551 28.465  1.00 27.95  ? 431 GLU A N   1 
ATOM   3256 C CA  . GLU A 1 430 ? 1.838   -57.715 27.899  1.00 30.59  ? 431 GLU A CA  1 
ATOM   3257 C C   . GLU A 1 430 ? 1.282   -58.664 28.943  1.00 33.80  ? 431 GLU A C   1 
ATOM   3258 O O   . GLU A 1 430 ? 1.007   -59.825 28.644  1.00 34.48  ? 431 GLU A O   1 
ATOM   3259 C CB  . GLU A 1 430 ? 2.790   -58.486 26.978  1.00 25.93  ? 431 GLU A CB  1 
ATOM   3260 C CG  . GLU A 1 430 ? 3.159   -57.743 25.707  1.00 25.92  ? 431 GLU A CG  1 
ATOM   3261 C CD  . GLU A 1 430 ? 3.789   -58.652 24.659  1.00 35.29  ? 431 GLU A CD  1 
ATOM   3262 O OE1 . GLU A 1 430 ? 3.304   -58.659 23.514  1.00 47.00  ? 431 GLU A OE1 1 
ATOM   3263 O OE2 . GLU A 1 430 ? 4.765   -59.362 24.976  1.00 48.81  ? 431 GLU A OE2 1 
ATOM   3264 N N   . HIS A 1 431 ? 1.131   -58.183 30.169  1.00 25.24  ? 432 HIS A N   1 
ATOM   3265 C CA  . HIS A 1 431 ? 0.569   -59.020 31.207  1.00 29.29  ? 432 HIS A CA  1 
ATOM   3266 C C   . HIS A 1 431 ? -0.885  -58.670 31.482  1.00 30.75  ? 432 HIS A C   1 
ATOM   3267 O O   . HIS A 1 431 ? -1.215  -57.515 31.748  1.00 29.88  ? 432 HIS A O   1 
ATOM   3268 C CB  . HIS A 1 431 ? 1.374   -58.934 32.499  1.00 27.69  ? 432 HIS A CB  1 
ATOM   3269 C CG  . HIS A 1 431 ? 0.780   -59.739 33.607  1.00 37.42  ? 432 HIS A CG  1 
ATOM   3270 N ND1 . HIS A 1 431 ? 0.824   -61.117 33.626  1.00 42.63  ? 432 HIS A ND1 1 
ATOM   3271 C CD2 . HIS A 1 431 ? 0.078   -59.367 34.705  1.00 30.57  ? 432 HIS A CD2 1 
ATOM   3272 C CE1 . HIS A 1 431 ? 0.201   -61.557 34.706  1.00 41.80  ? 432 HIS A CE1 1 
ATOM   3273 N NE2 . HIS A 1 431 ? -0.269  -60.515 35.371  1.00 33.49  ? 432 HIS A NE2 1 
ATOM   3274 N N   . ARG A 1 432 ? -1.753  -59.673 31.400  1.00 29.51  ? 433 ARG A N   1 
ATOM   3275 C CA  . ARG A 1 432 ? -3.156  -59.496 31.744  1.00 33.23  ? 433 ARG A CA  1 
ATOM   3276 C C   . ARG A 1 432 ? -3.329  -59.813 33.224  1.00 30.15  ? 433 ARG A C   1 
ATOM   3277 O O   . ARG A 1 432 ? -3.005  -60.917 33.668  1.00 32.68  ? 433 ARG A O   1 
ATOM   3278 C CB  . ARG A 1 432 ? -4.044  -60.411 30.890  1.00 31.06  ? 433 ARG A CB  1 
ATOM   3279 C CG  . ARG A 1 432 ? -5.525  -60.134 31.052  1.00 35.10  ? 433 ARG A CG  1 
ATOM   3280 C CD  . ARG A 1 432 ? -6.382  -61.102 30.249  1.00 32.15  ? 433 ARG A CD  1 
ATOM   3281 N NE  . ARG A 1 432 ? -7.730  -61.217 30.812  1.00 28.67  ? 433 ARG A NE  1 
ATOM   3282 C CZ  . ARG A 1 432 ? -8.790  -60.572 30.338  1.00 35.27  ? 433 ARG A CZ  1 
ATOM   3283 N NH1 . ARG A 1 432 ? -8.661  -59.770 29.279  1.00 29.47  ? 433 ARG A NH1 1 
ATOM   3284 N NH2 . ARG A 1 432 ? -9.979  -60.733 30.914  1.00 28.71  ? 433 ARG A NH2 1 
ATOM   3285 N N   . ALA A 1 433 ? -3.811  -58.839 33.989  1.00 31.61  ? 434 ALA A N   1 
ATOM   3286 C CA  . ALA A 1 433 ? -3.958  -58.996 35.436  1.00 33.89  ? 434 ALA A CA  1 
ATOM   3287 C C   . ALA A 1 433 ? -4.873  -60.167 35.762  1.00 38.84  ? 434 ALA A C   1 
ATOM   3288 O O   . ALA A 1 433 ? -5.935  -60.322 35.147  1.00 33.93  ? 434 ALA A O   1 
ATOM   3289 C CB  . ALA A 1 433 ? -4.506  -57.720 36.057  1.00 32.59  ? 434 ALA A CB  1 
ATOM   3290 N N   . SER A 1 434 ? -4.466  -60.987 36.729  1.00 30.25  ? 435 SER A N   1 
ATOM   3291 C CA  . SER A 1 434 ? -5.301  -62.104 37.174  1.00 31.51  ? 435 SER A CA  1 
ATOM   3292 C C   . SER A 1 434 ? -6.645  -61.600 37.687  1.00 35.89  ? 435 SER A C   1 
ATOM   3293 O O   . SER A 1 434 ? -7.644  -62.313 37.652  1.00 35.40  ? 435 SER A O   1 
ATOM   3294 C CB  . SER A 1 434 ? -4.596  -62.909 38.266  1.00 35.53  ? 435 SER A CB  1 
ATOM   3295 O OG  . SER A 1 434 ? -4.572  -62.189 39.486  1.00 44.45  ? 435 SER A OG  1 
ATOM   3296 N N   . THR A 1 435 ? -6.663  -60.353 38.142  1.00 37.53  ? 436 THR A N   1 
ATOM   3297 C CA  . THR A 1 435 ? -7.854  -59.764 38.736  1.00 36.39  ? 436 THR A CA  1 
ATOM   3298 C C   . THR A 1 435 ? -8.744  -59.061 37.719  1.00 35.08  ? 436 THR A C   1 
ATOM   3299 O O   . THR A 1 435 ? -9.791  -58.520 38.073  1.00 38.96  ? 436 THR A O   1 
ATOM   3300 C CB  . THR A 1 435 ? -7.468  -58.747 39.824  1.00 37.13  ? 436 THR A CB  1 
ATOM   3301 O OG1 . THR A 1 435 ? -6.523  -57.806 39.287  1.00 36.28  ? 436 THR A OG1 1 
ATOM   3302 C CG2 . THR A 1 435 ? -6.844  -59.464 41.017  1.00 41.75  ? 436 THR A CG2 1 
ATOM   3303 N N   . LEU A 1 436 ? -8.329  -59.052 36.458  1.00 32.01  ? 437 LEU A N   1 
ATOM   3304 C CA  . LEU A 1 436 ? -9.047  -58.275 35.452  1.00 31.37  ? 437 LEU A CA  1 
ATOM   3305 C C   . LEU A 1 436 ? -10.445 -58.835 35.207  1.00 34.16  ? 437 LEU A C   1 
ATOM   3306 O O   . LEU A 1 436 ? -10.623 -60.044 35.042  1.00 37.61  ? 437 LEU A O   1 
ATOM   3307 C CB  . LEU A 1 436 ? -8.248  -58.201 34.148  1.00 34.59  ? 437 LEU A CB  1 
ATOM   3308 C CG  . LEU A 1 436 ? -8.800  -57.277 33.058  1.00 36.68  ? 437 LEU A CG  1 
ATOM   3309 C CD1 . LEU A 1 436 ? -8.745  -55.841 33.511  1.00 29.03  ? 437 LEU A CD1 1 
ATOM   3310 C CD2 . LEU A 1 436 ? -8.037  -57.463 31.746  1.00 28.90  ? 437 LEU A CD2 1 
ATOM   3311 N N   . SER A 1 437 ? -11.434 -57.949 35.180  1.00 32.38  ? 438 SER A N   1 
ATOM   3312 C CA  . SER A 1 437 ? -12.823 -58.365 35.067  1.00 33.09  ? 438 SER A CA  1 
ATOM   3313 C C   . SER A 1 437 ? -13.446 -58.062 33.707  1.00 37.59  ? 438 SER A C   1 
ATOM   3314 O O   . SER A 1 437 ? -14.601 -58.415 33.465  1.00 38.50  ? 438 SER A O   1 
ATOM   3315 C CB  . SER A 1 437 ? -13.655 -57.702 36.158  1.00 34.90  ? 438 SER A CB  1 
ATOM   3316 O OG  . SER A 1 437 ? -13.671 -56.302 35.964  1.00 43.42  ? 438 SER A OG  1 
ATOM   3317 N N   . TRP A 1 438 ? -12.704 -57.384 32.832  1.00 31.13  ? 439 TRP A N   1 
ATOM   3318 C CA  . TRP A 1 438 ? -13.107 -57.283 31.434  1.00 29.80  ? 439 TRP A CA  1 
ATOM   3319 C C   . TRP A 1 438 ? -12.856 -58.642 30.772  1.00 28.87  ? 439 TRP A C   1 
ATOM   3320 O O   . TRP A 1 438 ? -11.956 -59.379 31.196  1.00 28.19  ? 439 TRP A O   1 
ATOM   3321 C CB  . TRP A 1 438 ? -12.341 -56.162 30.707  1.00 31.64  ? 439 TRP A CB  1 
ATOM   3322 C CG  . TRP A 1 438 ? -12.640 -54.799 31.252  1.00 26.49  ? 439 TRP A CG  1 
ATOM   3323 C CD1 . TRP A 1 438 ? -11.927 -54.120 32.202  1.00 23.10  ? 439 TRP A CD1 1 
ATOM   3324 C CD2 . TRP A 1 438 ? -13.742 -53.956 30.901  1.00 22.21  ? 439 TRP A CD2 1 
ATOM   3325 N NE1 . TRP A 1 438 ? -12.518 -52.908 32.458  1.00 23.88  ? 439 TRP A NE1 1 
ATOM   3326 C CE2 . TRP A 1 438 ? -13.633 -52.781 31.674  1.00 24.58  ? 439 TRP A CE2 1 
ATOM   3327 C CE3 . TRP A 1 438 ? -14.814 -54.083 30.022  1.00 23.78  ? 439 TRP A CE3 1 
ATOM   3328 C CZ2 . TRP A 1 438 ? -14.553 -51.737 31.582  1.00 23.44  ? 439 TRP A CZ2 1 
ATOM   3329 C CZ3 . TRP A 1 438 ? -15.725 -53.042 29.927  1.00 24.91  ? 439 TRP A CZ3 1 
ATOM   3330 C CH2 . TRP A 1 438 ? -15.587 -51.886 30.700  1.00 25.50  ? 439 TRP A CH2 1 
ATOM   3331 N N   . PRO A 1 439 ? -13.643 -58.977 29.730  1.00 26.32  ? 440 PRO A N   1 
ATOM   3332 C CA  . PRO A 1 439 ? -13.551 -60.299 29.102  1.00 27.99  ? 440 PRO A CA  1 
ATOM   3333 C C   . PRO A 1 439 ? -12.177 -60.591 28.511  1.00 30.91  ? 440 PRO A C   1 
ATOM   3334 O O   . PRO A 1 439 ? -11.389 -59.682 28.278  1.00 31.87  ? 440 PRO A O   1 
ATOM   3335 C CB  . PRO A 1 439 ? -14.594 -60.227 27.977  1.00 29.76  ? 440 PRO A CB  1 
ATOM   3336 C CG  . PRO A 1 439 ? -14.756 -58.785 27.694  1.00 28.39  ? 440 PRO A CG  1 
ATOM   3337 C CD  . PRO A 1 439 ? -14.604 -58.109 29.027  1.00 28.82  ? 440 PRO A CD  1 
ATOM   3338 N N   . LEU A 1 440 ? -11.913 -61.866 28.263  1.00 33.53  ? 441 LEU A N   1 
ATOM   3339 C CA  . LEU A 1 440 ? -10.656 -62.308 27.674  1.00 34.83  ? 441 LEU A CA  1 
ATOM   3340 C C   . LEU A 1 440 ? -10.390 -61.731 26.274  1.00 34.71  ? 441 LEU A C   1 
ATOM   3341 O O   . LEU A 1 440 ? -9.232  -61.508 25.904  1.00 34.83  ? 441 LEU A O   1 
ATOM   3342 C CB  . LEU A 1 440 ? -10.624 -63.836 27.625  1.00 39.37  ? 441 LEU A CB  1 
ATOM   3343 C CG  . LEU A 1 440 ? -9.255  -64.491 27.798  1.00 49.18  ? 441 LEU A CG  1 
ATOM   3344 C CD1 . LEU A 1 440 ? -8.790  -64.386 29.245  1.00 41.01  ? 441 LEU A CD1 1 
ATOM   3345 C CD2 . LEU A 1 440 ? -9.299  -65.943 27.351  1.00 51.15  ? 441 LEU A CD2 1 
ATOM   3346 N N   . TRP A 1 441 ? -11.441 -61.489 25.490  1.00 27.33  ? 442 TRP A N   1 
ATOM   3347 C CA  . TRP A 1 441 ? -11.222 -61.007 24.125  1.00 29.30  ? 442 TRP A CA  1 
ATOM   3348 C C   . TRP A 1 441 ? -10.586 -59.619 24.090  1.00 31.09  ? 442 TRP A C   1 
ATOM   3349 O O   . TRP A 1 441 ? -10.003 -59.219 23.081  1.00 30.58  ? 442 TRP A O   1 
ATOM   3350 C CB  . TRP A 1 441 ? -12.493 -61.062 23.251  1.00 27.33  ? 442 TRP A CB  1 
ATOM   3351 C CG  . TRP A 1 441 ? -13.592 -60.077 23.595  1.00 26.60  ? 442 TRP A CG  1 
ATOM   3352 C CD1 . TRP A 1 441 ? -14.735 -60.338 24.295  1.00 28.60  ? 442 TRP A CD1 1 
ATOM   3353 C CD2 . TRP A 1 441 ? -13.661 -58.691 23.222  1.00 26.83  ? 442 TRP A CD2 1 
ATOM   3354 N NE1 . TRP A 1 441 ? -15.505 -59.202 24.392  1.00 26.49  ? 442 TRP A NE1 1 
ATOM   3355 C CE2 . TRP A 1 441 ? -14.868 -58.178 23.743  1.00 23.68  ? 442 TRP A CE2 1 
ATOM   3356 C CE3 . TRP A 1 441 ? -12.821 -57.835 22.496  1.00 26.62  ? 442 TRP A CE3 1 
ATOM   3357 C CZ2 . TRP A 1 441 ? -15.249 -56.845 23.572  1.00 23.08  ? 442 TRP A CZ2 1 
ATOM   3358 C CZ3 . TRP A 1 441 ? -13.204 -56.515 22.326  1.00 23.66  ? 442 TRP A CZ3 1 
ATOM   3359 C CH2 . TRP A 1 441 ? -14.407 -56.032 22.864  1.00 25.81  ? 442 TRP A CH2 1 
ATOM   3360 N N   . MET A 1 442 ? -10.689 -58.886 25.192  1.00 34.31  ? 443 MET A N   1 
ATOM   3361 C CA  . MET A 1 442 ? -10.089 -57.563 25.250  1.00 27.89  ? 443 MET A CA  1 
ATOM   3362 C C   . MET A 1 442 ? -8.570  -57.610 25.422  1.00 27.47  ? 443 MET A C   1 
ATOM   3363 O O   . MET A 1 442 ? -7.892  -56.622 25.161  1.00 28.28  ? 443 MET A O   1 
ATOM   3364 C CB  . MET A 1 442 ? -10.746 -56.710 26.324  1.00 24.93  ? 443 MET A CB  1 
ATOM   3365 C CG  . MET A 1 442 ? -12.050 -56.066 25.877  1.00 29.79  ? 443 MET A CG  1 
ATOM   3366 S SD  . MET A 1 442 ? -12.603 -54.899 27.134  1.00 33.82  ? 443 MET A SD  1 
ATOM   3367 C CE  . MET A 1 442 ? -14.163 -54.333 26.495  1.00 22.84  ? 443 MET A CE  1 
ATOM   3368 N N   . GLY A 1 443 ? -8.038  -58.763 25.821  1.00 25.08  ? 444 GLY A N   1 
ATOM   3369 C CA  . GLY A 1 443 ? -6.607  -58.912 26.019  1.00 22.89  ? 444 GLY A CA  1 
ATOM   3370 C C   . GLY A 1 443 ? -6.109  -58.037 27.163  1.00 31.72  ? 444 GLY A C   1 
ATOM   3371 O O   . GLY A 1 443 ? -6.690  -58.046 28.253  1.00 28.49  ? 444 GLY A O   1 
ATOM   3372 N N   . VAL A 1 444 ? -5.032  -57.289 26.923  1.00 27.33  ? 445 VAL A N   1 
ATOM   3373 C CA  . VAL A 1 444 ? -4.538  -56.317 27.904  1.00 28.59  ? 445 VAL A CA  1 
ATOM   3374 C C   . VAL A 1 444 ? -5.016  -54.902 27.536  1.00 24.00  ? 445 VAL A C   1 
ATOM   3375 O O   . VAL A 1 444 ? -4.408  -54.235 26.705  1.00 25.21  ? 445 VAL A O   1 
ATOM   3376 C CB  . VAL A 1 444 ? -2.994  -56.323 27.987  1.00 26.29  ? 445 VAL A CB  1 
ATOM   3377 C CG1 . VAL A 1 444 ? -2.520  -55.452 29.145  1.00 24.82  ? 445 VAL A CG1 1 
ATOM   3378 C CG2 . VAL A 1 444 ? -2.460  -57.746 28.120  1.00 21.36  ? 445 VAL A CG2 1 
ATOM   3379 N N   . PRO A 1 445 ? -6.107  -54.436 28.158  1.00 24.45  ? 446 PRO A N   1 
ATOM   3380 C CA  . PRO A 1 445 ? -6.711  -53.181 27.696  1.00 28.19  ? 446 PRO A CA  1 
ATOM   3381 C C   . PRO A 1 445 ? -6.008  -51.928 28.209  1.00 24.69  ? 446 PRO A C   1 
ATOM   3382 O O   . PRO A 1 445 ? -5.273  -51.970 29.196  1.00 22.78  ? 446 PRO A O   1 
ATOM   3383 C CB  . PRO A 1 445 ? -8.143  -53.238 28.265  1.00 22.28  ? 446 PRO A CB  1 
ATOM   3384 C CG  . PRO A 1 445 ? -8.317  -54.654 28.782  1.00 26.81  ? 446 PRO A CG  1 
ATOM   3385 C CD  . PRO A 1 445 ? -6.934  -55.088 29.182  1.00 22.91  ? 446 PRO A CD  1 
ATOM   3386 N N   . HIS A 1 446 ? -6.254  -50.831 27.499  1.00 22.67  ? 447 HIS A N   1 
ATOM   3387 C CA  . HIS A 1 446 ? -5.836  -49.479 27.849  1.00 25.93  ? 447 HIS A CA  1 
ATOM   3388 C C   . HIS A 1 446 ? -6.039  -49.227 29.338  1.00 24.45  ? 447 HIS A C   1 
ATOM   3389 O O   . HIS A 1 446 ? -7.115  -49.484 29.866  1.00 25.45  ? 447 HIS A O   1 
ATOM   3390 C CB  . HIS A 1 446 ? -6.711  -48.524 27.046  1.00 18.26  ? 447 HIS A CB  1 
ATOM   3391 C CG  . HIS A 1 446 ? -6.275  -47.093 27.072  1.00 23.82  ? 447 HIS A CG  1 
ATOM   3392 N ND1 . HIS A 1 446 ? -5.134  -46.649 26.439  1.00 22.30  ? 447 HIS A ND1 1 
ATOM   3393 C CD2 . HIS A 1 446 ? -6.871  -45.992 27.590  1.00 21.83  ? 447 HIS A CD2 1 
ATOM   3394 C CE1 . HIS A 1 446 ? -5.034  -45.339 26.585  1.00 17.15  ? 447 HIS A CE1 1 
ATOM   3395 N NE2 . HIS A 1 446 ? -6.075  -44.917 27.280  1.00 23.47  ? 447 HIS A NE2 1 
ATOM   3396 N N   . GLY A 1 447 ? -5.001  -48.751 30.017  1.00 24.01  ? 448 GLY A N   1 
ATOM   3397 C CA  . GLY A 1 447 ? -5.108  -48.415 31.431  1.00 21.59  ? 448 GLY A CA  1 
ATOM   3398 C C   . GLY A 1 447 ? -4.660  -49.484 32.420  1.00 25.57  ? 448 GLY A C   1 
ATOM   3399 O O   . GLY A 1 447 ? -4.444  -49.180 33.585  1.00 26.49  ? 448 GLY A O   1 
ATOM   3400 N N   . TYR A 1 448 ? -4.491  -50.728 31.977  1.00 23.96  ? 449 TYR A N   1 
ATOM   3401 C CA  . TYR A 1 448 ? -4.279  -51.813 32.937  1.00 22.61  ? 449 TYR A CA  1 
ATOM   3402 C C   . TYR A 1 448 ? -2.835  -52.187 33.254  1.00 24.00  ? 449 TYR A C   1 
ATOM   3403 O O   . TYR A 1 448 ? -2.586  -53.223 33.863  1.00 29.24  ? 449 TYR A O   1 
ATOM   3404 C CB  . TYR A 1 448 ? -5.162  -53.033 32.623  1.00 19.78  ? 449 TYR A CB  1 
ATOM   3405 C CG  . TYR A 1 448 ? -6.584  -52.725 33.006  1.00 25.70  ? 449 TYR A CG  1 
ATOM   3406 C CD1 . TYR A 1 448 ? -6.970  -52.744 34.338  1.00 21.66  ? 449 TYR A CD1 1 
ATOM   3407 C CD2 . TYR A 1 448 ? -7.527  -52.351 32.050  1.00 22.02  ? 449 TYR A CD2 1 
ATOM   3408 C CE1 . TYR A 1 448 ? -8.256  -52.429 34.713  1.00 23.90  ? 449 TYR A CE1 1 
ATOM   3409 C CE2 . TYR A 1 448 ? -8.821  -52.031 32.419  1.00 22.58  ? 449 TYR A CE2 1 
ATOM   3410 C CZ  . TYR A 1 448 ? -9.177  -52.069 33.757  1.00 25.36  ? 449 TYR A CZ  1 
ATOM   3411 O OH  . TYR A 1 448 ? -10.453 -51.748 34.153  1.00 24.77  ? 449 TYR A OH  1 
ATOM   3412 N N   . GLU A 1 449 ? -1.896  -51.325 32.872  1.00 25.52  ? 450 GLU A N   1 
ATOM   3413 C CA  . GLU A 1 449 ? -0.521  -51.426 33.365  1.00 24.39  ? 450 GLU A CA  1 
ATOM   3414 C C   . GLU A 1 449 ? -0.306  -50.550 34.607  1.00 24.17  ? 450 GLU A C   1 
ATOM   3415 O O   . GLU A 1 449 ? 0.578   -50.823 35.409  1.00 25.41  ? 450 GLU A O   1 
ATOM   3416 C CB  . GLU A 1 449 ? 0.483   -51.024 32.277  1.00 22.35  ? 450 GLU A CB  1 
ATOM   3417 C CG  . GLU A 1 449 ? 0.839   -49.552 32.246  1.00 14.42  ? 450 GLU A CG  1 
ATOM   3418 C CD  . GLU A 1 449 ? -0.260  -48.671 31.693  1.00 23.59  ? 450 GLU A CD  1 
ATOM   3419 O OE1 . GLU A 1 449 ? -1.420  -49.132 31.569  1.00 25.15  ? 450 GLU A OE1 1 
ATOM   3420 O OE2 . GLU A 1 449 ? 0.041   -47.502 31.366  1.00 24.11  ? 450 GLU A OE2 1 
ATOM   3421 N N   . ILE A 1 450 ? -1.120  -49.502 34.751  1.00 23.20  ? 451 ILE A N   1 
ATOM   3422 C CA  . ILE A 1 450 ? -0.949  -48.513 35.809  1.00 24.91  ? 451 ILE A CA  1 
ATOM   3423 C C   . ILE A 1 450 ? -0.863  -49.120 37.219  1.00 28.74  ? 451 ILE A C   1 
ATOM   3424 O O   . ILE A 1 450 ? 0.044   -48.784 37.982  1.00 27.00  ? 451 ILE A O   1 
ATOM   3425 C CB  . ILE A 1 450 ? -2.076  -47.455 35.776  1.00 26.35  ? 451 ILE A CB  1 
ATOM   3426 C CG1 . ILE A 1 450 ? -2.164  -46.819 34.389  1.00 19.96  ? 451 ILE A CG1 1 
ATOM   3427 C CG2 . ILE A 1 450 ? -1.853  -46.375 36.848  1.00 19.76  ? 451 ILE A CG2 1 
ATOM   3428 C CD1 . ILE A 1 450 ? -3.311  -45.835 34.235  1.00 16.46  ? 451 ILE A CD1 1 
ATOM   3429 N N   . GLU A 1 451 ? -1.790  -50.015 37.554  1.00 24.77  ? 452 GLU A N   1 
ATOM   3430 C CA  . GLU A 1 451 ? -1.818  -50.631 38.881  1.00 27.00  ? 452 GLU A CA  1 
ATOM   3431 C C   . GLU A 1 451 ? -0.510  -51.364 39.197  1.00 28.81  ? 452 GLU A C   1 
ATOM   3432 O O   . GLU A 1 451 ? -0.100  -51.452 40.360  1.00 27.33  ? 452 GLU A O   1 
ATOM   3433 C CB  . GLU A 1 451 ? -3.022  -51.575 39.031  1.00 25.32  ? 452 GLU A CB  1 
ATOM   3434 C CG  . GLU A 1 451 ? -3.048  -52.720 38.010  1.00 30.83  ? 452 GLU A CG  1 
ATOM   3435 C CD  . GLU A 1 451 ? -4.454  -53.257 37.784  1.00 35.75  ? 452 GLU A CD  1 
ATOM   3436 O OE1 . GLU A 1 451 ? -4.697  -54.444 38.089  1.00 37.28  ? 452 GLU A OE1 1 
ATOM   3437 O OE2 . GLU A 1 451 ? -5.322  -52.490 37.309  1.00 36.52  ? 452 GLU A OE2 1 
ATOM   3438 N N   . PHE A 1 452 ? 0.149   -51.866 38.158  1.00 24.75  ? 453 PHE A N   1 
ATOM   3439 C CA  . PHE A 1 452 ? 1.438   -52.526 38.329  1.00 26.89  ? 453 PHE A CA  1 
ATOM   3440 C C   . PHE A 1 452 ? 2.587   -51.549 38.550  1.00 28.55  ? 453 PHE A C   1 
ATOM   3441 O O   . PHE A 1 452 ? 3.462   -51.797 39.386  1.00 28.27  ? 453 PHE A O   1 
ATOM   3442 C CB  . PHE A 1 452 ? 1.716   -53.472 37.157  1.00 24.87  ? 453 PHE A CB  1 
ATOM   3443 C CG  . PHE A 1 452 ? 0.864   -54.696 37.190  1.00 28.57  ? 453 PHE A CG  1 
ATOM   3444 C CD1 . PHE A 1 452 ? -0.363  -54.717 36.547  1.00 28.16  ? 453 PHE A CD1 1 
ATOM   3445 C CD2 . PHE A 1 452 ? 1.253   -55.802 37.930  1.00 26.18  ? 453 PHE A CD2 1 
ATOM   3446 C CE1 . PHE A 1 452 ? -1.175  -55.840 36.611  1.00 35.94  ? 453 PHE A CE1 1 
ATOM   3447 C CE2 . PHE A 1 452 ? 0.444   -56.931 37.999  1.00 31.42  ? 453 PHE A CE2 1 
ATOM   3448 C CZ  . PHE A 1 452 ? -0.771  -56.948 37.341  1.00 30.45  ? 453 PHE A CZ  1 
ATOM   3449 N N   . ILE A 1 453 ? 2.579   -50.445 37.808  1.00 19.99  ? 454 ILE A N   1 
ATOM   3450 C CA  . ILE A 1 453 ? 3.572   -49.399 37.986  1.00 23.42  ? 454 ILE A CA  1 
ATOM   3451 C C   . ILE A 1 453 ? 3.478   -48.841 39.418  1.00 27.75  ? 454 ILE A C   1 
ATOM   3452 O O   . ILE A 1 453 ? 4.499   -48.580 40.052  1.00 25.18  ? 454 ILE A O   1 
ATOM   3453 C CB  . ILE A 1 453 ? 3.383   -48.247 36.958  1.00 29.93  ? 454 ILE A CB  1 
ATOM   3454 C CG1 . ILE A 1 453 ? 3.342   -48.783 35.515  1.00 23.48  ? 454 ILE A CG1 1 
ATOM   3455 C CG2 . ILE A 1 453 ? 4.454   -47.163 37.133  1.00 24.96  ? 454 ILE A CG2 1 
ATOM   3456 C CD1 . ILE A 1 453 ? 4.511   -49.665 35.141  1.00 25.38  ? 454 ILE A CD1 1 
ATOM   3457 N N   . PHE A 1 454 ? 2.257   -48.685 39.932  1.00 24.15  ? 455 PHE A N   1 
ATOM   3458 C CA  . PHE A 1 454 ? 2.062   -48.144 41.283  1.00 24.82  ? 455 PHE A CA  1 
ATOM   3459 C C   . PHE A 1 454 ? 2.202   -49.187 42.379  1.00 27.72  ? 455 PHE A C   1 
ATOM   3460 O O   . PHE A 1 454 ? 2.072   -48.870 43.549  1.00 27.40  ? 455 PHE A O   1 
ATOM   3461 C CB  . PHE A 1 454 ? 0.709   -47.440 41.418  1.00 20.92  ? 455 PHE A CB  1 
ATOM   3462 C CG  . PHE A 1 454 ? 0.715   -46.023 40.912  1.00 29.29  ? 455 PHE A CG  1 
ATOM   3463 C CD1 . PHE A 1 454 ? 0.568   -45.752 39.560  1.00 20.10  ? 455 PHE A CD1 1 
ATOM   3464 C CD2 . PHE A 1 454 ? 0.892   -44.963 41.786  1.00 25.52  ? 455 PHE A CD2 1 
ATOM   3465 C CE1 . PHE A 1 454 ? 0.581   -44.446 39.087  1.00 22.52  ? 455 PHE A CE1 1 
ATOM   3466 C CE2 . PHE A 1 454 ? 0.905   -43.656 41.321  1.00 26.99  ? 455 PHE A CE2 1 
ATOM   3467 C CZ  . PHE A 1 454 ? 0.741   -43.395 39.969  1.00 24.45  ? 455 PHE A CZ  1 
ATOM   3468 N N   . GLY A 1 455 ? 2.455   -50.433 41.999  1.00 30.51  ? 456 GLY A N   1 
ATOM   3469 C CA  . GLY A 1 455 ? 2.703   -51.471 42.979  1.00 29.98  ? 456 GLY A CA  1 
ATOM   3470 C C   . GLY A 1 455 ? 1.472   -51.850 43.783  1.00 29.41  ? 456 GLY A C   1 
ATOM   3471 O O   . GLY A 1 455 ? 1.590   -52.385 44.880  1.00 30.16  ? 456 GLY A O   1 
ATOM   3472 N N   . ILE A 1 456 ? 0.294   -51.569 43.234  1.00 29.62  ? 457 ILE A N   1 
ATOM   3473 C CA  . ILE A 1 456 ? -0.970  -51.995 43.833  1.00 28.84  ? 457 ILE A CA  1 
ATOM   3474 C C   . ILE A 1 456 ? -1.044  -53.505 44.162  1.00 33.09  ? 457 ILE A C   1 
ATOM   3475 O O   . ILE A 1 456 ? -1.663  -53.887 45.155  1.00 31.64  ? 457 ILE A O   1 
ATOM   3476 C CB  . ILE A 1 456 ? -2.179  -51.584 42.956  1.00 30.31  ? 457 ILE A CB  1 
ATOM   3477 C CG1 . ILE A 1 456 ? -2.151  -50.080 42.675  1.00 28.30  ? 457 ILE A CG1 1 
ATOM   3478 C CG2 . ILE A 1 456 ? -3.488  -51.977 43.617  1.00 27.50  ? 457 ILE A CG2 1 
ATOM   3479 C CD1 . ILE A 1 456 ? -2.206  -49.211 43.930  1.00 23.56  ? 457 ILE A CD1 1 
ATOM   3480 N N   . PRO A 1 457 ? -0.416  -54.372 43.340  1.00 34.06  ? 458 PRO A N   1 
ATOM   3481 C CA  . PRO A 1 457 ? -0.442  -55.780 43.763  1.00 31.55  ? 458 PRO A CA  1 
ATOM   3482 C C   . PRO A 1 457 ? 0.147   -56.067 45.147  1.00 35.51  ? 458 PRO A C   1 
ATOM   3483 O O   . PRO A 1 457 ? -0.169  -57.113 45.710  1.00 37.58  ? 458 PRO A O   1 
ATOM   3484 C CB  . PRO A 1 457 ? 0.373   -56.481 42.675  1.00 29.43  ? 458 PRO A CB  1 
ATOM   3485 C CG  . PRO A 1 457 ? 0.050   -55.688 41.441  1.00 30.52  ? 458 PRO A CG  1 
ATOM   3486 C CD  . PRO A 1 457 ? -0.026  -54.248 41.919  1.00 32.10  ? 458 PRO A CD  1 
ATOM   3487 N N   . LEU A 1 458 ? 0.967   -55.170 45.687  1.00 32.98  ? 459 LEU A N   1 
ATOM   3488 C CA  . LEU A 1 458 ? 1.537   -55.380 47.019  1.00 34.67  ? 459 LEU A CA  1 
ATOM   3489 C C   . LEU A 1 458 ? 0.494   -55.250 48.129  1.00 34.41  ? 459 LEU A C   1 
ATOM   3490 O O   . LEU A 1 458 ? 0.733   -55.662 49.260  1.00 36.84  ? 459 LEU A O   1 
ATOM   3491 C CB  . LEU A 1 458 ? 2.710   -54.428 47.279  1.00 33.18  ? 459 LEU A CB  1 
ATOM   3492 C CG  . LEU A 1 458 ? 3.931   -54.671 46.389  1.00 41.36  ? 459 LEU A CG  1 
ATOM   3493 C CD1 . LEU A 1 458 ? 5.082   -53.757 46.783  1.00 35.73  ? 459 LEU A CD1 1 
ATOM   3494 C CD2 . LEU A 1 458 ? 4.348   -56.130 46.462  1.00 40.34  ? 459 LEU A CD2 1 
ATOM   3495 N N   . ASP A 1 459 ? -0.659  -54.677 47.800  1.00 34.30  ? 460 ASP A N   1 
ATOM   3496 C CA  . ASP A 1 459 ? -1.735  -54.521 48.765  1.00 35.20  ? 460 ASP A CA  1 
ATOM   3497 C C   . ASP A 1 459 ? -2.271  -55.903 49.150  1.00 46.66  ? 460 ASP A C   1 
ATOM   3498 O O   . ASP A 1 459 ? -2.867  -56.594 48.326  1.00 36.09  ? 460 ASP A O   1 
ATOM   3499 C CB  . ASP A 1 459 ? -2.846  -53.644 48.188  1.00 32.48  ? 460 ASP A CB  1 
ATOM   3500 C CG  . ASP A 1 459 ? -3.900  -53.270 49.220  1.00 44.35  ? 460 ASP A CG  1 
ATOM   3501 O OD1 . ASP A 1 459 ? -3.980  -53.937 50.277  1.00 46.90  ? 460 ASP A OD1 1 
ATOM   3502 O OD2 . ASP A 1 459 ? -4.658  -52.312 48.969  1.00 44.80  ? 460 ASP A OD2 1 
ATOM   3503 N N   . PRO A 1 460 ? -2.065  -56.301 50.419  1.00 48.95  ? 461 PRO A N   1 
ATOM   3504 C CA  . PRO A 1 460 ? -2.403  -57.646 50.906  1.00 49.71  ? 461 PRO A CA  1 
ATOM   3505 C C   . PRO A 1 460 ? -3.895  -57.947 50.793  1.00 49.28  ? 461 PRO A C   1 
ATOM   3506 O O   . PRO A 1 460 ? -4.278  -59.100 50.585  1.00 53.09  ? 461 PRO A O   1 
ATOM   3507 C CB  . PRO A 1 460 ? -1.985  -57.605 52.381  1.00 48.53  ? 461 PRO A CB  1 
ATOM   3508 C CG  . PRO A 1 460 ? -1.001  -56.489 52.470  1.00 55.07  ? 461 PRO A CG  1 
ATOM   3509 C CD  . PRO A 1 460 ? -1.473  -55.466 51.476  1.00 40.71  ? 461 PRO A CD  1 
ATOM   3510 N N   . SER A 1 461 ? -4.721  -56.914 50.911  1.00 39.53  ? 462 SER A N   1 
ATOM   3511 C CA  . SER A 1 461 ? -6.165  -57.080 50.838  1.00 43.50  ? 462 SER A CA  1 
ATOM   3512 C C   . SER A 1 461 ? -6.692  -57.187 49.407  1.00 49.18  ? 462 SER A C   1 
ATOM   3513 O O   . SER A 1 461 ? -7.895  -57.089 49.181  1.00 48.60  ? 462 SER A O   1 
ATOM   3514 C CB  . SER A 1 461 ? -6.861  -55.921 51.544  1.00 50.23  ? 462 SER A CB  1 
ATOM   3515 O OG  . SER A 1 461 ? -6.816  -54.757 50.744  1.00 50.68  ? 462 SER A OG  1 
ATOM   3516 N N   . ARG A 1 462 ? -5.802  -57.375 48.440  1.00 47.02  ? 463 ARG A N   1 
ATOM   3517 C CA  . ARG A 1 462 ? -6.235  -57.611 47.065  1.00 43.66  ? 463 ARG A CA  1 
ATOM   3518 C C   . ARG A 1 462 ? -5.742  -58.979 46.587  1.00 43.96  ? 463 ARG A C   1 
ATOM   3519 O O   . ARG A 1 462 ? -4.924  -59.611 47.253  1.00 49.62  ? 463 ARG A O   1 
ATOM   3520 C CB  . ARG A 1 462 ? -5.775  -56.487 46.137  1.00 44.77  ? 463 ARG A CB  1 
ATOM   3521 C CG  . ARG A 1 462 ? -6.397  -55.140 46.454  1.00 40.49  ? 463 ARG A CG  1 
ATOM   3522 C CD  . ARG A 1 462 ? -5.929  -54.074 45.474  1.00 38.83  ? 463 ARG A CD  1 
ATOM   3523 N NE  . ARG A 1 462 ? -6.307  -52.735 45.915  1.00 46.88  ? 463 ARG A NE  1 
ATOM   3524 C CZ  . ARG A 1 462 ? -7.382  -52.082 45.486  1.00 42.63  ? 463 ARG A CZ  1 
ATOM   3525 N NH1 . ARG A 1 462 ? -8.188  -52.637 44.593  1.00 52.05  ? 463 ARG A NH1 1 
ATOM   3526 N NH2 . ARG A 1 462 ? -7.649  -50.870 45.949  1.00 47.43  ? 463 ARG A NH2 1 
ATOM   3527 N N   . ASN A 1 463 ? -6.233  -59.430 45.438  1.00 43.08  ? 464 ASN A N   1 
ATOM   3528 C CA  . ASN A 1 463 ? -6.145  -60.850 45.102  1.00 50.05  ? 464 ASN A CA  1 
ATOM   3529 C C   . ASN A 1 463 ? -5.069  -61.223 44.091  1.00 47.44  ? 464 ASN A C   1 
ATOM   3530 O O   . ASN A 1 463 ? -5.183  -62.244 43.406  1.00 50.70  ? 464 ASN A O   1 
ATOM   3531 C CB  . ASN A 1 463 ? -7.512  -61.378 44.635  1.00 44.69  ? 464 ASN A CB  1 
ATOM   3532 C CG  . ASN A 1 463 ? -8.585  -61.250 45.705  1.00 57.54  ? 464 ASN A CG  1 
ATOM   3533 O OD1 . ASN A 1 463 ? -8.280  -61.078 46.889  1.00 63.53  ? 464 ASN A OD1 1 
ATOM   3534 N ND2 . ASN A 1 463 ? -9.848  -61.340 45.295  1.00 62.13  ? 464 ASN A ND2 1 
ATOM   3535 N N   . TYR A 1 464 ? -4.019  -60.414 44.004  1.00 42.27  ? 465 TYR A N   1 
ATOM   3536 C CA  . TYR A 1 464 ? -2.960  -60.666 43.031  1.00 39.46  ? 465 TYR A CA  1 
ATOM   3537 C C   . TYR A 1 464 ? -2.122  -61.876 43.447  1.00 35.90  ? 465 TYR A C   1 
ATOM   3538 O O   . TYR A 1 464 ? -2.090  -62.232 44.612  1.00 39.41  ? 465 TYR A O   1 
ATOM   3539 C CB  . TYR A 1 464 ? -2.072  -59.430 42.880  1.00 32.20  ? 465 TYR A CB  1 
ATOM   3540 C CG  . TYR A 1 464 ? -2.747  -58.241 42.226  1.00 30.93  ? 465 TYR A CG  1 
ATOM   3541 C CD1 . TYR A 1 464 ? -3.422  -57.295 42.984  1.00 26.64  ? 465 TYR A CD1 1 
ATOM   3542 C CD2 . TYR A 1 464 ? -2.693  -58.061 40.844  1.00 27.68  ? 465 TYR A CD2 1 
ATOM   3543 C CE1 . TYR A 1 464 ? -4.021  -56.204 42.392  1.00 29.55  ? 465 TYR A CE1 1 
ATOM   3544 C CE2 . TYR A 1 464 ? -3.294  -56.986 40.245  1.00 28.13  ? 465 TYR A CE2 1 
ATOM   3545 C CZ  . TYR A 1 464 ? -3.949  -56.053 41.018  1.00 31.24  ? 465 TYR A CZ  1 
ATOM   3546 O OH  . TYR A 1 464 ? -4.546  -54.976 40.406  1.00 26.63  ? 465 TYR A OH  1 
ATOM   3547 N N   . THR A 1 465 ? -1.441  -62.497 42.493  1.00 37.96  ? 466 THR A N   1 
ATOM   3548 C CA  . THR A 1 465 ? -0.609  -63.660 42.784  1.00 33.69  ? 466 THR A CA  1 
ATOM   3549 C C   . THR A 1 465 ? 0.777   -63.244 43.240  1.00 35.24  ? 466 THR A C   1 
ATOM   3550 O O   . THR A 1 465 ? 1.176   -62.092 43.074  1.00 40.92  ? 466 THR A O   1 
ATOM   3551 C CB  . THR A 1 465 ? -0.428  -64.551 41.537  1.00 37.32  ? 466 THR A CB  1 
ATOM   3552 O OG1 . THR A 1 465 ? 0.375   -63.863 40.567  1.00 41.73  ? 466 THR A OG1 1 
ATOM   3553 C CG2 . THR A 1 465 ? -1.773  -64.898 40.926  1.00 32.49  ? 466 THR A CG2 1 
ATOM   3554 N N   . ALA A 1 466 ? 1.513   -64.199 43.797  1.00 34.84  ? 467 ALA A N   1 
ATOM   3555 C CA  . ALA A 1 466 ? 2.878   -63.966 44.249  1.00 41.85  ? 467 ALA A CA  1 
ATOM   3556 C C   . ALA A 1 466 ? 3.767   -63.480 43.107  1.00 38.26  ? 467 ALA A C   1 
ATOM   3557 O O   . ALA A 1 466 ? 4.582   -62.578 43.292  1.00 39.48  ? 467 ALA A O   1 
ATOM   3558 C CB  . ALA A 1 466 ? 3.456   -65.235 44.877  1.00 30.93  ? 467 ALA A CB  1 
ATOM   3559 N N   . GLU A 1 467 ? 3.601   -64.077 41.930  1.00 34.97  ? 468 GLU A N   1 
ATOM   3560 C CA  . GLU A 1 467 ? 4.366   -63.674 40.755  1.00 42.81  ? 468 GLU A CA  1 
ATOM   3561 C C   . GLU A 1 467 ? 4.022   -62.246 40.346  1.00 38.69  ? 468 GLU A C   1 
ATOM   3562 O O   . GLU A 1 467 ? 4.887   -61.491 39.895  1.00 32.63  ? 468 GLU A O   1 
ATOM   3563 C CB  . GLU A 1 467 ? 4.093   -64.609 39.574  1.00 39.89  ? 468 GLU A CB  1 
ATOM   3564 C CG  . GLU A 1 467 ? 4.448   -66.066 39.804  1.00 53.65  ? 468 GLU A CG  1 
ATOM   3565 C CD  . GLU A 1 467 ? 4.070   -66.946 38.617  1.00 84.36  ? 468 GLU A CD  1 
ATOM   3566 O OE1 . GLU A 1 467 ? 3.056   -66.647 37.933  1.00 70.30  ? 468 GLU A OE1 1 
ATOM   3567 O OE2 . GLU A 1 467 ? 4.792   -67.936 38.365  1.00 91.22  ? 468 GLU A OE2 1 
ATOM   3568 N N   . GLU A 1 468 ? 2.750   -61.887 40.487  1.00 33.82  ? 469 GLU A N   1 
ATOM   3569 C CA  . GLU A 1 468 ? 2.304   -60.558 40.119  1.00 31.00  ? 469 GLU A CA  1 
ATOM   3570 C C   . GLU A 1 468 ? 2.950   -59.510 41.024  1.00 41.01  ? 469 GLU A C   1 
ATOM   3571 O O   . GLU A 1 468 ? 3.314   -58.416 40.563  1.00 31.83  ? 469 GLU A O   1 
ATOM   3572 C CB  . GLU A 1 468 ? 0.775   -60.472 40.109  1.00 31.48  ? 469 GLU A CB  1 
ATOM   3573 C CG  . GLU A 1 468 ? 0.167   -61.024 38.810  1.00 34.20  ? 469 GLU A CG  1 
ATOM   3574 C CD  . GLU A 1 468 ? -1.359  -61.027 38.799  1.00 37.65  ? 469 GLU A CD  1 
ATOM   3575 O OE1 . GLU A 1 468 ? -1.969  -61.263 39.864  1.00 38.30  ? 469 GLU A OE1 1 
ATOM   3576 O OE2 . GLU A 1 468 ? -1.950  -60.804 37.719  1.00 36.38  ? 469 GLU A OE2 1 
ATOM   3577 N N   . LYS A 1 469 ? 3.134   -59.861 42.296  1.00 35.28  ? 470 LYS A N   1 
ATOM   3578 C CA  . LYS A 1 469 ? 3.796   -58.961 43.234  1.00 32.43  ? 470 LYS A CA  1 
ATOM   3579 C C   . LYS A 1 469 ? 5.246   -58.725 42.836  1.00 32.92  ? 470 LYS A C   1 
ATOM   3580 O O   . LYS A 1 469 ? 5.716   -57.586 42.807  1.00 33.00  ? 470 LYS A O   1 
ATOM   3581 C CB  . LYS A 1 469 ? 3.709   -59.492 44.669  1.00 32.31  ? 470 LYS A CB  1 
ATOM   3582 C CG  . LYS A 1 469 ? 2.290   -59.587 45.193  1.00 37.54  ? 470 LYS A CG  1 
ATOM   3583 C CD  . LYS A 1 469 ? 2.252   -60.150 46.608  1.00 46.37  ? 470 LYS A CD  1 
ATOM   3584 C CE  . LYS A 1 469 ? 0.824   -60.280 47.127  1.00 40.76  ? 470 LYS A CE  1 
ATOM   3585 N NZ  . LYS A 1 469 ? 0.792   -60.222 48.620  1.00 52.35  ? 470 LYS A NZ  1 
ATOM   3586 N N   . ILE A 1 470 ? 5.955   -59.804 42.529  1.00 30.15  ? 471 ILE A N   1 
ATOM   3587 C CA  . ILE A 1 470 ? 7.335   -59.694 42.067  1.00 33.02  ? 471 ILE A CA  1 
ATOM   3588 C C   . ILE A 1 470 ? 7.443   -58.811 40.810  1.00 31.76  ? 471 ILE A C   1 
ATOM   3589 O O   . ILE A 1 470 ? 8.330   -57.959 40.721  1.00 31.86  ? 471 ILE A O   1 
ATOM   3590 C CB  . ILE A 1 470 ? 7.949   -61.097 41.829  1.00 39.83  ? 471 ILE A CB  1 
ATOM   3591 C CG1 . ILE A 1 470 ? 8.188   -61.793 43.175  1.00 39.25  ? 471 ILE A CG1 1 
ATOM   3592 C CG2 . ILE A 1 470 ? 9.248   -61.014 41.013  1.00 27.70  ? 471 ILE A CG2 1 
ATOM   3593 C CD1 . ILE A 1 470 ? 8.386   -63.286 43.060  1.00 40.13  ? 471 ILE A CD1 1 
ATOM   3594 N N   . PHE A 1 471 ? 6.520   -59.010 39.869  1.00 29.20  ? 472 PHE A N   1 
ATOM   3595 C CA  . PHE A 1 471 ? 6.438   -58.234 38.628  1.00 32.71  ? 472 PHE A CA  1 
ATOM   3596 C C   . PHE A 1 471 ? 6.258   -56.744 38.916  1.00 30.00  ? 472 PHE A C   1 
ATOM   3597 O O   . PHE A 1 471 ? 6.960   -55.898 38.350  1.00 26.98  ? 472 PHE A O   1 
ATOM   3598 C CB  . PHE A 1 471 ? 5.278   -58.762 37.765  1.00 31.81  ? 472 PHE A CB  1 
ATOM   3599 C CG  . PHE A 1 471 ? 5.112   -58.063 36.431  1.00 33.80  ? 472 PHE A CG  1 
ATOM   3600 C CD1 . PHE A 1 471 ? 6.194   -57.878 35.576  1.00 31.63  ? 472 PHE A CD1 1 
ATOM   3601 C CD2 . PHE A 1 471 ? 3.855   -57.635 36.013  1.00 29.77  ? 472 PHE A CD2 1 
ATOM   3602 C CE1 . PHE A 1 471 ? 6.032   -57.249 34.342  1.00 30.14  ? 472 PHE A CE1 1 
ATOM   3603 C CE2 . PHE A 1 471 ? 3.680   -57.003 34.776  1.00 25.32  ? 472 PHE A CE2 1 
ATOM   3604 C CZ  . PHE A 1 471 ? 4.771   -56.816 33.938  1.00 25.93  ? 472 PHE A CZ  1 
ATOM   3605 N N   . ALA A 1 472 ? 5.316   -56.426 39.798  1.00 27.67  ? 473 ALA A N   1 
ATOM   3606 C CA  . ALA A 1 472 ? 5.088   -55.039 40.178  1.00 26.07  ? 473 ALA A CA  1 
ATOM   3607 C C   . ALA A 1 472 ? 6.384   -54.443 40.717  1.00 30.39  ? 473 ALA A C   1 
ATOM   3608 O O   . ALA A 1 472 ? 6.756   -53.314 40.370  1.00 26.17  ? 473 ALA A O   1 
ATOM   3609 C CB  . ALA A 1 472 ? 3.986   -54.940 41.202  1.00 25.01  ? 473 ALA A CB  1 
ATOM   3610 N N   . GLN A 1 473 ? 7.092   -55.230 41.522  1.00 25.20  ? 474 GLN A N   1 
ATOM   3611 C CA  . GLN A 1 473 ? 8.337   -54.776 42.118  1.00 29.82  ? 474 GLN A CA  1 
ATOM   3612 C C   . GLN A 1 473 ? 9.398   -54.487 41.061  1.00 27.88  ? 474 GLN A C   1 
ATOM   3613 O O   . GLN A 1 473 ? 10.139  -53.506 41.176  1.00 27.53  ? 474 GLN A O   1 
ATOM   3614 C CB  . GLN A 1 473 ? 8.836   -55.768 43.185  1.00 29.59  ? 474 GLN A CB  1 
ATOM   3615 C CG  . GLN A 1 473 ? 7.972   -55.760 44.449  1.00 33.85  ? 474 GLN A CG  1 
ATOM   3616 C CD  . GLN A 1 473 ? 8.425   -56.758 45.511  1.00 40.20  ? 474 GLN A CD  1 
ATOM   3617 O OE1 . GLN A 1 473 ? 8.754   -57.911 45.216  1.00 42.75  ? 474 GLN A OE1 1 
ATOM   3618 N NE2 . GLN A 1 473 ? 8.443   -56.310 46.758  1.00 36.28  ? 474 GLN A NE2 1 
ATOM   3619 N N   . ARG A 1 474 ? 9.462   -55.332 40.033  1.00 26.86  ? 475 ARG A N   1 
ATOM   3620 C CA  . ARG A 1 474 ? 10.363  -55.102 38.912  1.00 28.86  ? 475 ARG A CA  1 
ATOM   3621 C C   . ARG A 1 474 ? 10.015  -53.798 38.203  1.00 29.12  ? 475 ARG A C   1 
ATOM   3622 O O   . ARG A 1 474 ? 10.901  -53.032 37.816  1.00 27.91  ? 475 ARG A O   1 
ATOM   3623 C CB  . ARG A 1 474 ? 10.250  -56.224 37.884  1.00 34.20  ? 475 ARG A CB  1 
ATOM   3624 C CG  . ARG A 1 474 ? 10.961  -57.512 38.202  1.00 34.85  ? 475 ARG A CG  1 
ATOM   3625 C CD  . ARG A 1 474 ? 10.714  -58.500 37.052  1.00 39.28  ? 475 ARG A CD  1 
ATOM   3626 N NE  . ARG A 1 474 ? 11.138  -57.941 35.768  1.00 37.71  ? 475 ARG A NE  1 
ATOM   3627 C CZ  . ARG A 1 474 ? 10.576  -58.226 34.596  1.00 40.54  ? 475 ARG A CZ  1 
ATOM   3628 N NH1 . ARG A 1 474 ? 9.548   -59.066 34.534  1.00 36.14  ? 475 ARG A NH1 1 
ATOM   3629 N NH2 . ARG A 1 474 ? 11.041  -57.665 33.482  1.00 29.23  ? 475 ARG A NH2 1 
ATOM   3630 N N   . LEU A 1 475 ? 8.718   -53.569 38.011  1.00 23.61  ? 476 LEU A N   1 
ATOM   3631 C CA  . LEU A 1 475 ? 8.263   -52.412 37.250  1.00 28.36  ? 476 LEU A CA  1 
ATOM   3632 C C   . LEU A 1 475 ? 8.591   -51.131 37.991  1.00 27.63  ? 476 LEU A C   1 
ATOM   3633 O O   . LEU A 1 475 ? 9.069   -50.153 37.394  1.00 27.93  ? 476 LEU A O   1 
ATOM   3634 C CB  . LEU A 1 475 ? 6.761   -52.499 36.964  1.00 26.97  ? 476 LEU A CB  1 
ATOM   3635 C CG  . LEU A 1 475 ? 6.377   -53.590 35.956  1.00 34.32  ? 476 LEU A CG  1 
ATOM   3636 C CD1 . LEU A 1 475 ? 4.902   -53.551 35.649  1.00 32.76  ? 476 LEU A CD1 1 
ATOM   3637 C CD2 . LEU A 1 475 ? 7.174   -53.460 34.675  1.00 25.37  ? 476 LEU A CD2 1 
ATOM   3638 N N   . MET A 1 476 ? 8.346   -51.150 39.299  1.00 27.14  ? 477 MET A N   1 
ATOM   3639 C CA  . MET A 1 476 ? 8.607   -49.996 40.142  1.00 24.45  ? 477 MET A CA  1 
ATOM   3640 C C   . MET A 1 476 ? 10.085  -49.668 40.094  1.00 24.66  ? 477 MET A C   1 
ATOM   3641 O O   . MET A 1 476 ? 10.462  -48.502 40.034  1.00 27.59  ? 477 MET A O   1 
ATOM   3642 C CB  . MET A 1 476 ? 8.161   -50.264 41.582  1.00 25.29  ? 477 MET A CB  1 
ATOM   3643 C CG  . MET A 1 476 ? 6.654   -50.283 41.768  1.00 25.66  ? 477 MET A CG  1 
ATOM   3644 S SD  . MET A 1 476 ? 6.149   -50.206 43.510  1.00 32.43  ? 477 MET A SD  1 
ATOM   3645 C CE  . MET A 1 476 ? 6.906   -51.699 44.156  1.00 24.62  ? 477 MET A CE  1 
ATOM   3646 N N   . ARG A 1 477 ? 10.918  -50.705 40.091  1.00 25.39  ? 478 ARG A N   1 
ATOM   3647 C CA  . ARG A 1 477 ? 12.368  -50.524 40.005  1.00 26.99  ? 478 ARG A CA  1 
ATOM   3648 C C   . ARG A 1 477 ? 12.789  -49.931 38.650  1.00 29.83  ? 478 ARG A C   1 
ATOM   3649 O O   . ARG A 1 477 ? 13.630  -49.021 38.607  1.00 25.83  ? 478 ARG A O   1 
ATOM   3650 C CB  . ARG A 1 477 ? 13.099  -51.846 40.291  1.00 25.28  ? 478 ARG A CB  1 
ATOM   3651 C CG  . ARG A 1 477 ? 14.621  -51.771 40.241  1.00 27.48  ? 478 ARG A CG  1 
ATOM   3652 C CD  . ARG A 1 477 ? 15.194  -50.802 41.280  1.00 30.70  ? 478 ARG A CD  1 
ATOM   3653 N NE  . ARG A 1 477 ? 14.768  -51.151 42.631  1.00 32.52  ? 478 ARG A NE  1 
ATOM   3654 C CZ  . ARG A 1 477 ? 15.281  -52.156 43.337  1.00 38.35  ? 478 ARG A CZ  1 
ATOM   3655 N NH1 . ARG A 1 477 ? 16.237  -52.917 42.815  1.00 30.62  ? 478 ARG A NH1 1 
ATOM   3656 N NH2 . ARG A 1 477 ? 14.833  -52.405 44.561  1.00 35.06  ? 478 ARG A NH2 1 
ATOM   3657 N N   . TYR A 1 478 ? 12.208  -50.427 37.551  1.00 22.03  ? 479 TYR A N   1 
ATOM   3658 C CA  . TYR A 1 478 ? 12.502  -49.847 36.233  1.00 24.29  ? 479 TYR A CA  1 
ATOM   3659 C C   . TYR A 1 478 ? 12.146  -48.363 36.229  1.00 27.25  ? 479 TYR A C   1 
ATOM   3660 O O   . TYR A 1 478 ? 12.948  -47.524 35.813  1.00 26.50  ? 479 TYR A O   1 
ATOM   3661 C CB  . TYR A 1 478 ? 11.728  -50.538 35.094  1.00 27.15  ? 479 TYR A CB  1 
ATOM   3662 C CG  . TYR A 1 478 ? 12.195  -51.927 34.734  1.00 22.83  ? 479 TYR A CG  1 
ATOM   3663 C CD1 . TYR A 1 478 ? 13.544  -52.232 34.652  1.00 23.39  ? 479 TYR A CD1 1 
ATOM   3664 C CD2 . TYR A 1 478 ? 11.277  -52.938 34.473  1.00 26.78  ? 479 TYR A CD2 1 
ATOM   3665 C CE1 . TYR A 1 478 ? 13.968  -53.510 34.316  1.00 28.76  ? 479 TYR A CE1 1 
ATOM   3666 C CE2 . TYR A 1 478 ? 11.689  -54.217 34.146  1.00 24.10  ? 479 TYR A CE2 1 
ATOM   3667 C CZ  . TYR A 1 478 ? 13.034  -54.498 34.067  1.00 25.13  ? 479 TYR A CZ  1 
ATOM   3668 O OH  . TYR A 1 478 ? 13.446  -55.771 33.741  1.00 34.94  ? 479 TYR A OH  1 
ATOM   3669 N N   . TRP A 1 479 ? 10.940  -48.045 36.699  1.00 24.54  ? 480 TRP A N   1 
ATOM   3670 C CA  . TRP A 1 479 ? 10.443  -46.674 36.634  1.00 24.17  ? 480 TRP A CA  1 
ATOM   3671 C C   . TRP A 1 479 ? 11.271  -45.719 37.494  1.00 26.89  ? 480 TRP A C   1 
ATOM   3672 O O   . TRP A 1 479 ? 11.618  -44.616 37.067  1.00 27.20  ? 480 TRP A O   1 
ATOM   3673 C CB  . TRP A 1 479 ? 8.969   -46.623 37.044  1.00 22.42  ? 480 TRP A CB  1 
ATOM   3674 C CG  . TRP A 1 479 ? 8.006   -46.489 35.887  1.00 26.25  ? 480 TRP A CG  1 
ATOM   3675 C CD1 . TRP A 1 479 ? 7.135   -45.463 35.665  1.00 23.10  ? 480 TRP A CD1 1 
ATOM   3676 C CD2 . TRP A 1 479 ? 7.821   -47.416 34.803  1.00 21.45  ? 480 TRP A CD2 1 
ATOM   3677 N NE1 . TRP A 1 479 ? 6.417   -45.694 34.519  1.00 21.76  ? 480 TRP A NE1 1 
ATOM   3678 C CE2 . TRP A 1 479 ? 6.816   -46.885 33.970  1.00 23.24  ? 480 TRP A CE2 1 
ATOM   3679 C CE3 . TRP A 1 479 ? 8.400   -48.650 34.464  1.00 21.48  ? 480 TRP A CE3 1 
ATOM   3680 C CZ2 . TRP A 1 479 ? 6.381   -47.537 32.803  1.00 19.76  ? 480 TRP A CZ2 1 
ATOM   3681 C CZ3 . TRP A 1 479 ? 7.966   -49.298 33.316  1.00 22.23  ? 480 TRP A CZ3 1 
ATOM   3682 C CH2 . TRP A 1 479 ? 6.966   -48.737 32.496  1.00 19.06  ? 480 TRP A CH2 1 
ATOM   3683 N N   . ALA A 1 480 ? 11.600  -46.157 38.702  1.00 28.09  ? 481 ALA A N   1 
ATOM   3684 C CA  . ALA A 1 480 ? 12.350  -45.321 39.633  1.00 27.33  ? 481 ALA A CA  1 
ATOM   3685 C C   . ALA A 1 480 ? 13.820  -45.198 39.227  1.00 27.15  ? 481 ALA A C   1 
ATOM   3686 O O   . ALA A 1 480 ? 14.445  -44.152 39.446  1.00 23.91  ? 481 ALA A O   1 
ATOM   3687 C CB  . ALA A 1 480 ? 12.216  -45.852 41.042  1.00 23.02  ? 481 ALA A CB  1 
ATOM   3688 N N   . ASN A 1 481 ? 14.364  -46.259 38.628  1.00 23.70  ? 482 ASN A N   1 
ATOM   3689 C CA  . ASN A 1 481 ? 15.715  -46.193 38.077  1.00 25.11  ? 482 ASN A CA  1 
ATOM   3690 C C   . ASN A 1 481 ? 15.743  -45.107 37.033  1.00 29.68  ? 482 ASN A C   1 
ATOM   3691 O O   . ASN A 1 481 ? 16.675  -44.297 36.978  1.00 28.76  ? 482 ASN A O   1 
ATOM   3692 C CB  . ASN A 1 481 ? 16.141  -47.522 37.435  1.00 25.27  ? 482 ASN A CB  1 
ATOM   3693 C CG  . ASN A 1 481 ? 16.683  -48.522 38.447  1.00 27.86  ? 482 ASN A CG  1 
ATOM   3694 O OD1 . ASN A 1 481 ? 16.720  -48.250 39.646  1.00 33.86  ? 482 ASN A OD1 1 
ATOM   3695 N ND2 . ASN A 1 481 ? 17.091  -49.692 37.968  1.00 29.67  ? 482 ASN A ND2 1 
ATOM   3696 N N   . PHE A 1 482 ? 14.711  -45.098 36.193  1.00 25.96  ? 483 PHE A N   1 
ATOM   3697 C CA  . PHE A 1 482 ? 14.640  -44.120 35.126  1.00 26.05  ? 483 PHE A CA  1 
ATOM   3698 C C   . PHE A 1 482 ? 14.540  -42.719 35.708  1.00 22.26  ? 483 PHE A C   1 
ATOM   3699 O O   . PHE A 1 482 ? 15.206  -41.803 35.243  1.00 25.85  ? 483 PHE A O   1 
ATOM   3700 C CB  . PHE A 1 482 ? 13.473  -44.393 34.169  1.00 26.10  ? 483 PHE A CB  1 
ATOM   3701 C CG  . PHE A 1 482 ? 13.280  -43.313 33.152  1.00 23.19  ? 483 PHE A CG  1 
ATOM   3702 C CD1 . PHE A 1 482 ? 14.090  -43.258 32.017  1.00 23.62  ? 483 PHE A CD1 1 
ATOM   3703 C CD2 . PHE A 1 482 ? 12.320  -42.324 33.343  1.00 17.43  ? 483 PHE A CD2 1 
ATOM   3704 C CE1 . PHE A 1 482 ? 13.929  -42.247 31.073  1.00 20.16  ? 483 PHE A CE1 1 
ATOM   3705 C CE2 . PHE A 1 482 ? 12.155  -41.311 32.410  1.00 23.53  ? 483 PHE A CE2 1 
ATOM   3706 C CZ  . PHE A 1 482 ? 12.963  -41.273 31.270  1.00 23.72  ? 483 PHE A CZ  1 
ATOM   3707 N N   . ALA A 1 483 ? 13.710  -42.554 36.731  1.00 23.45  ? 484 ALA A N   1 
ATOM   3708 C CA  . ALA A 1 483 ? 13.603  -41.263 37.399  1.00 29.16  ? 484 ALA A CA  1 
ATOM   3709 C C   . ALA A 1 483 ? 14.951  -40.789 37.968  1.00 29.25  ? 484 ALA A C   1 
ATOM   3710 O O   . ALA A 1 483 ? 15.270  -39.598 37.940  1.00 32.60  ? 484 ALA A O   1 
ATOM   3711 C CB  . ALA A 1 483 ? 12.547  -41.321 38.492  1.00 21.04  ? 484 ALA A CB  1 
ATOM   3712 N N   . ARG A 1 484 ? 15.739  -41.732 38.471  1.00 26.79  ? 485 ARG A N   1 
ATOM   3713 C CA  . ARG A 1 484 ? 16.995  -41.409 39.145  1.00 28.99  ? 485 ARG A CA  1 
ATOM   3714 C C   . ARG A 1 484 ? 18.135  -41.140 38.183  1.00 31.97  ? 485 ARG A C   1 
ATOM   3715 O O   . ARG A 1 484 ? 18.966  -40.281 38.455  1.00 33.66  ? 485 ARG A O   1 
ATOM   3716 C CB  . ARG A 1 484 ? 17.406  -42.527 40.110  1.00 25.28  ? 485 ARG A CB  1 
ATOM   3717 C CG  . ARG A 1 484 ? 16.640  -42.521 41.427  1.00 28.48  ? 485 ARG A CG  1 
ATOM   3718 C CD  . ARG A 1 484 ? 17.159  -43.590 42.390  1.00 25.28  ? 485 ARG A CD  1 
ATOM   3719 N NE  . ARG A 1 484 ? 16.870  -44.939 41.907  1.00 30.49  ? 485 ARG A NE  1 
ATOM   3720 C CZ  . ARG A 1 484 ? 15.861  -45.684 42.344  1.00 25.28  ? 485 ARG A CZ  1 
ATOM   3721 N NH1 . ARG A 1 484 ? 15.051  -45.209 43.275  1.00 22.07  ? 485 ARG A NH1 1 
ATOM   3722 N NH2 . ARG A 1 484 ? 15.662  -46.898 41.850  1.00 23.96  ? 485 ARG A NH2 1 
ATOM   3723 N N   . THR A 1 485 ? 18.173  -41.862 37.062  1.00 25.50  ? 486 THR A N   1 
ATOM   3724 C CA  . THR A 1 485 ? 19.358  -41.844 36.200  1.00 29.27  ? 486 THR A CA  1 
ATOM   3725 C C   . THR A 1 485 ? 19.074  -41.582 34.729  1.00 32.71  ? 486 THR A C   1 
ATOM   3726 O O   . THR A 1 485 ? 20.002  -41.377 33.945  1.00 35.12  ? 486 THR A O   1 
ATOM   3727 C CB  . THR A 1 485 ? 20.110  -43.192 36.240  1.00 29.91  ? 486 THR A CB  1 
ATOM   3728 O OG1 . THR A 1 485 ? 19.317  -44.199 35.598  1.00 31.78  ? 486 THR A OG1 1 
ATOM   3729 C CG2 . THR A 1 485 ? 20.426  -43.618 37.675  1.00 25.34  ? 486 THR A CG2 1 
ATOM   3730 N N   . GLY A 1 486 ? 17.804  -41.611 34.347  1.00 29.49  ? 487 GLY A N   1 
ATOM   3731 C CA  . GLY A 1 486 ? 17.447  -41.552 32.943  1.00 32.73  ? 487 GLY A CA  1 
ATOM   3732 C C   . GLY A 1 486 ? 17.634  -42.891 32.251  1.00 30.26  ? 487 GLY A C   1 
ATOM   3733 O O   . GLY A 1 486 ? 17.620  -42.973 31.025  1.00 32.67  ? 487 GLY A O   1 
ATOM   3734 N N   . ASP A 1 487 ? 17.778  -43.952 33.037  1.00 30.84  ? 488 ASP A N   1 
ATOM   3735 C CA  . ASP A 1 487 ? 18.014  -45.285 32.480  1.00 29.60  ? 488 ASP A CA  1 
ATOM   3736 C C   . ASP A 1 487 ? 17.330  -46.331 33.364  1.00 28.21  ? 488 ASP A C   1 
ATOM   3737 O O   . ASP A 1 487 ? 17.704  -46.501 34.525  1.00 34.25  ? 488 ASP A O   1 
ATOM   3738 C CB  . ASP A 1 487 ? 19.525  -45.529 32.427  1.00 28.42  ? 488 ASP A CB  1 
ATOM   3739 C CG  . ASP A 1 487 ? 19.905  -46.816 31.735  1.00 32.19  ? 488 ASP A CG  1 
ATOM   3740 O OD1 . ASP A 1 487 ? 19.074  -47.750 31.652  1.00 34.36  ? 488 ASP A OD1 1 
ATOM   3741 O OD2 . ASP A 1 487 ? 21.070  -46.892 31.287  1.00 39.74  ? 488 ASP A OD2 1 
ATOM   3742 N N   . PRO A 1 488 ? 16.339  -47.050 32.816  1.00 25.19  ? 489 PRO A N   1 
ATOM   3743 C CA  . PRO A 1 488 ? 15.582  -48.004 33.636  1.00 27.20  ? 489 PRO A CA  1 
ATOM   3744 C C   . PRO A 1 488 ? 16.403  -49.220 34.072  1.00 26.45  ? 489 PRO A C   1 
ATOM   3745 O O   . PRO A 1 488 ? 16.061  -49.853 35.070  1.00 30.78  ? 489 PRO A O   1 
ATOM   3746 C CB  . PRO A 1 488 ? 14.450  -48.435 32.703  1.00 22.05  ? 489 PRO A CB  1 
ATOM   3747 C CG  . PRO A 1 488 ? 15.042  -48.301 31.332  1.00 24.29  ? 489 PRO A CG  1 
ATOM   3748 C CD  . PRO A 1 488 ? 15.927  -47.089 31.401  1.00 26.32  ? 489 PRO A CD  1 
ATOM   3749 N N   . ASN A 1 489 ? 17.478  -49.526 33.353  1.00 26.51  ? 490 ASN A N   1 
ATOM   3750 C CA  . ASN A 1 489 ? 18.256  -50.735 33.617  1.00 28.38  ? 490 ASN A CA  1 
ATOM   3751 C C   . ASN A 1 489 ? 18.865  -50.876 35.013  1.00 38.06  ? 490 ASN A C   1 
ATOM   3752 O O   . ASN A 1 489 ? 19.470  -49.939 35.545  1.00 35.96  ? 490 ASN A O   1 
ATOM   3753 C CB  . ASN A 1 489 ? 19.372  -50.889 32.589  1.00 33.66  ? 490 ASN A CB  1 
ATOM   3754 C CG  . ASN A 1 489 ? 18.855  -51.239 31.227  1.00 29.57  ? 490 ASN A CG  1 
ATOM   3755 O OD1 . ASN A 1 489 ? 18.514  -52.391 30.955  1.00 30.73  ? 490 ASN A OD1 1 
ATOM   3756 N ND2 . ASN A 1 489 ? 18.793  -50.251 30.355  1.00 26.79  ? 490 ASN A ND2 1 
ATOM   3757 N N   . GLU A 1 490 ? 18.692  -52.070 35.579  1.00 36.91  ? 491 GLU A N   1 
ATOM   3758 C CA  . GLU A 1 490 ? 19.430  -52.545 36.741  1.00 47.06  ? 491 GLU A CA  1 
ATOM   3759 C C   . GLU A 1 490 ? 20.857  -52.927 36.318  1.00 56.09  ? 491 GLU A C   1 
ATOM   3760 O O   . GLU A 1 490 ? 21.156  -52.975 35.122  1.00 55.45  ? 491 GLU A O   1 
ATOM   3761 C CB  . GLU A 1 490 ? 18.718  -53.781 37.302  1.00 54.15  ? 491 GLU A CB  1 
ATOM   3762 C CG  . GLU A 1 490 ? 17.444  -53.496 38.089  1.00 50.58  ? 491 GLU A CG  1 
ATOM   3763 C CD  . GLU A 1 490 ? 17.732  -53.137 39.534  1.00 47.29  ? 491 GLU A CD  1 
ATOM   3764 O OE1 . GLU A 1 490 ? 18.425  -52.127 39.768  1.00 48.14  ? 491 GLU A OE1 1 
ATOM   3765 O OE2 . GLU A 1 490 ? 17.279  -53.873 40.437  1.00 55.32  ? 491 GLU A OE2 1 
ATOM   3766 N N   . PRO A 1 491 ? 21.749  -53.190 37.295  1.00 64.54  ? 492 PRO A N   1 
ATOM   3767 C CA  . PRO A 1 491 ? 23.075  -53.744 36.969  1.00 68.23  ? 492 PRO A CA  1 
ATOM   3768 C C   . PRO A 1 491 ? 23.011  -55.049 36.159  1.00 72.66  ? 492 PRO A C   1 
ATOM   3769 O O   . PRO A 1 491 ? 22.128  -55.876 36.394  1.00 72.80  ? 492 PRO A O   1 
ATOM   3770 C CB  . PRO A 1 491 ? 23.687  -54.002 38.346  1.00 54.34  ? 492 PRO A CB  1 
ATOM   3771 C CG  . PRO A 1 491 ? 23.086  -52.934 39.210  1.00 59.22  ? 492 PRO A CG  1 
ATOM   3772 C CD  . PRO A 1 491 ? 21.671  -52.748 38.703  1.00 61.59  ? 492 PRO A CD  1 
ATOM   3773 N N   . ARG A 1 492 ? 23.955  -55.221 35.232  1.00 71.22  ? 493 ARG A N   1 
ATOM   3774 C CA  . ARG A 1 492 ? 23.938  -56.325 34.266  1.00 77.82  ? 493 ARG A CA  1 
ATOM   3775 C C   . ARG A 1 492 ? 23.827  -57.712 34.901  1.00 83.29  ? 493 ARG A C   1 
ATOM   3776 O O   . ARG A 1 492 ? 24.351  -57.954 35.993  1.00 79.84  ? 493 ARG A O   1 
ATOM   3777 C CB  . ARG A 1 492 ? 25.168  -56.265 33.353  1.00 66.68  ? 493 ARG A CB  1 
ATOM   3778 C CG  . ARG A 1 492 ? 25.714  -54.862 33.142  1.00 80.52  ? 493 ARG A CG  1 
ATOM   3779 C CD  . ARG A 1 492 ? 26.641  -54.798 31.939  1.00 84.61  ? 493 ARG A CD  1 
ATOM   3780 N NE  . ARG A 1 492 ? 25.890  -54.696 30.692  1.00 89.10  ? 493 ARG A NE  1 
ATOM   3781 C CZ  . ARG A 1 492 ? 26.441  -54.693 29.482  1.00 102.39 ? 493 ARG A CZ  1 
ATOM   3782 N NH1 . ARG A 1 492 ? 27.758  -54.794 29.350  1.00 104.92 ? 493 ARG A NH1 1 
ATOM   3783 N NH2 . ARG A 1 492 ? 25.673  -54.593 28.402  1.00 94.94  ? 493 ARG A NH2 1 
ATOM   3784 N N   . ASP A 1 493 ? 23.148  -58.613 34.192  1.00 83.07  ? 494 ASP A N   1 
ATOM   3785 C CA  . ASP A 1 493 ? 22.843  -59.951 34.688  1.00 87.34  ? 494 ASP A CA  1 
ATOM   3786 C C   . ASP A 1 493 ? 22.234  -60.800 33.571  1.00 86.15  ? 494 ASP A C   1 
ATOM   3787 O O   . ASP A 1 493 ? 22.606  -61.959 33.375  1.00 83.72  ? 494 ASP A O   1 
ATOM   3788 C CB  . ASP A 1 493 ? 21.873  -59.864 35.872  1.00 94.18  ? 494 ASP A CB  1 
ATOM   3789 C CG  . ASP A 1 493 ? 21.521  -61.224 36.451  1.00 94.94  ? 494 ASP A CG  1 
ATOM   3790 O OD1 . ASP A 1 493 ? 22.326  -62.166 36.299  1.00 94.47  ? 494 ASP A OD1 1 
ATOM   3791 O OD2 . ASP A 1 493 ? 20.438  -61.347 37.066  1.00 90.21  ? 494 ASP A OD2 1 
ATOM   3792 N N   . PRO A 1 497 ? 19.131  -59.506 31.313  1.00 63.12  ? 498 PRO A N   1 
ATOM   3793 C CA  . PRO A 1 497 ? 19.066  -58.993 29.934  1.00 66.77  ? 498 PRO A CA  1 
ATOM   3794 C C   . PRO A 1 497 ? 18.794  -57.489 29.924  1.00 55.82  ? 498 PRO A C   1 
ATOM   3795 O O   . PRO A 1 497 ? 17.949  -57.016 30.692  1.00 49.71  ? 498 PRO A O   1 
ATOM   3796 C CB  . PRO A 1 497 ? 17.880  -59.756 29.318  1.00 64.10  ? 498 PRO A CB  1 
ATOM   3797 C CG  . PRO A 1 497 ? 17.603  -60.897 30.261  1.00 67.85  ? 498 PRO A CG  1 
ATOM   3798 C CD  . PRO A 1 497 ? 18.011  -60.410 31.620  1.00 63.57  ? 498 PRO A CD  1 
ATOM   3799 N N   . GLN A 1 498 ? 19.502  -56.748 29.077  1.00 39.26  ? 499 GLN A N   1 
ATOM   3800 C CA  . GLN A 1 498 ? 19.427  -55.293 29.123  1.00 42.50  ? 499 GLN A CA  1 
ATOM   3801 C C   . GLN A 1 498 ? 18.319  -54.703 28.241  1.00 42.99  ? 499 GLN A C   1 
ATOM   3802 O O   . GLN A 1 498 ? 17.989  -55.236 27.176  1.00 38.38  ? 499 GLN A O   1 
ATOM   3803 C CB  . GLN A 1 498 ? 20.780  -54.664 28.774  1.00 41.69  ? 499 GLN A CB  1 
ATOM   3804 C CG  . GLN A 1 498 ? 21.881  -54.944 29.794  1.00 55.30  ? 499 GLN A CG  1 
ATOM   3805 C CD  . GLN A 1 498 ? 21.565  -54.409 31.189  1.00 52.96  ? 499 GLN A CD  1 
ATOM   3806 O OE1 . GLN A 1 498 ? 21.734  -53.218 31.467  1.00 50.39  ? 499 GLN A OE1 1 
ATOM   3807 N NE2 . GLN A 1 498 ? 21.115  -55.292 32.073  1.00 49.34  ? 499 GLN A NE2 1 
ATOM   3808 N N   . TRP A 1 499 ? 17.760  -53.594 28.713  1.00 33.96  ? 500 TRP A N   1 
ATOM   3809 C CA  . TRP A 1 499 ? 16.747  -52.842 27.999  1.00 27.88  ? 500 TRP A CA  1 
ATOM   3810 C C   . TRP A 1 499 ? 17.475  -51.791 27.177  1.00 29.91  ? 500 TRP A C   1 
ATOM   3811 O O   . TRP A 1 499 ? 17.979  -50.818 27.725  1.00 31.03  ? 500 TRP A O   1 
ATOM   3812 C CB  . TRP A 1 499 ? 15.802  -52.195 29.019  1.00 31.86  ? 500 TRP A CB  1 
ATOM   3813 C CG  . TRP A 1 499 ? 14.600  -51.482 28.464  1.00 31.86  ? 500 TRP A CG  1 
ATOM   3814 C CD1 . TRP A 1 499 ? 14.399  -51.068 27.172  1.00 28.00  ? 500 TRP A CD1 1 
ATOM   3815 C CD2 . TRP A 1 499 ? 13.427  -51.091 29.195  1.00 30.66  ? 500 TRP A CD2 1 
ATOM   3816 N NE1 . TRP A 1 499 ? 13.178  -50.446 27.061  1.00 26.59  ? 500 TRP A NE1 1 
ATOM   3817 C CE2 . TRP A 1 499 ? 12.559  -50.450 28.283  1.00 28.29  ? 500 TRP A CE2 1 
ATOM   3818 C CE3 . TRP A 1 499 ? 13.025  -51.230 30.530  1.00 26.84  ? 500 TRP A CE3 1 
ATOM   3819 C CZ2 . TRP A 1 499 ? 11.313  -49.948 28.665  1.00 23.19  ? 500 TRP A CZ2 1 
ATOM   3820 C CZ3 . TRP A 1 499 ? 11.796  -50.727 30.909  1.00 24.10  ? 500 TRP A CZ3 1 
ATOM   3821 C CH2 . TRP A 1 499 ? 10.951  -50.093 29.980  1.00 25.67  ? 500 TRP A CH2 1 
ATOM   3822 N N   . PRO A 1 500 ? 17.539  -51.993 25.851  1.00 31.98  ? 501 PRO A N   1 
ATOM   3823 C CA  . PRO A 1 500 ? 18.247  -51.097 24.932  1.00 29.37  ? 501 PRO A CA  1 
ATOM   3824 C C   . PRO A 1 500 ? 17.417  -49.880 24.564  1.00 27.98  ? 501 PRO A C   1 
ATOM   3825 O O   . PRO A 1 500 ? 16.193  -49.964 24.530  1.00 31.20  ? 501 PRO A O   1 
ATOM   3826 C CB  . PRO A 1 500 ? 18.441  -51.957 23.672  1.00 29.46  ? 501 PRO A CB  1 
ATOM   3827 C CG  . PRO A 1 500 ? 17.643  -53.216 23.890  1.00 35.99  ? 501 PRO A CG  1 
ATOM   3828 C CD  . PRO A 1 500 ? 16.817  -53.049 25.127  1.00 28.00  ? 501 PRO A CD  1 
ATOM   3829 N N   . PRO A 1 501 ? 18.077  -48.759 24.266  1.00 27.69  ? 502 PRO A N   1 
ATOM   3830 C CA  . PRO A 1 501 ? 17.372  -47.566 23.784  1.00 25.13  ? 502 PRO A CA  1 
ATOM   3831 C C   . PRO A 1 501 ? 16.678  -47.790 22.424  1.00 33.90  ? 502 PRO A C   1 
ATOM   3832 O O   . PRO A 1 501 ? 17.188  -48.499 21.549  1.00 27.98  ? 502 PRO A O   1 
ATOM   3833 C CB  . PRO A 1 501 ? 18.494  -46.530 23.641  1.00 30.60  ? 502 PRO A CB  1 
ATOM   3834 C CG  . PRO A 1 501 ? 19.579  -47.012 24.579  1.00 32.65  ? 502 PRO A CG  1 
ATOM   3835 C CD  . PRO A 1 501 ? 19.511  -48.511 24.492  1.00 28.87  ? 502 PRO A CD  1 
ATOM   3836 N N   . TYR A 1 502 ? 15.504  -47.185 22.272  1.00 28.46  ? 503 TYR A N   1 
ATOM   3837 C CA  . TYR A 1 502 ? 14.759  -47.208 21.027  1.00 28.73  ? 503 TYR A CA  1 
ATOM   3838 C C   . TYR A 1 502 ? 15.367  -46.205 20.063  1.00 24.32  ? 503 TYR A C   1 
ATOM   3839 O O   . TYR A 1 502 ? 15.677  -45.090 20.445  1.00 24.28  ? 503 TYR A O   1 
ATOM   3840 C CB  . TYR A 1 502 ? 13.297  -46.839 21.292  1.00 29.16  ? 503 TYR A CB  1 
ATOM   3841 C CG  . TYR A 1 502 ? 12.396  -46.838 20.070  1.00 26.35  ? 503 TYR A CG  1 
ATOM   3842 C CD1 . TYR A 1 502 ? 12.233  -45.688 19.297  1.00 28.54  ? 503 TYR A CD1 1 
ATOM   3843 C CD2 . TYR A 1 502 ? 11.684  -47.976 19.710  1.00 24.26  ? 503 TYR A CD2 1 
ATOM   3844 C CE1 . TYR A 1 502 ? 11.403  -45.683 18.186  1.00 25.71  ? 503 TYR A CE1 1 
ATOM   3845 C CE2 . TYR A 1 502 ? 10.846  -47.980 18.608  1.00 24.90  ? 503 TYR A CE2 1 
ATOM   3846 C CZ  . TYR A 1 502 ? 10.710  -46.835 17.851  1.00 25.92  ? 503 TYR A CZ  1 
ATOM   3847 O OH  . TYR A 1 502 ? 9.878   -46.845 16.755  1.00 32.62  ? 503 TYR A OH  1 
ATOM   3848 N N   . THR A 1 503 ? 15.539  -46.605 18.812  1.00 23.47  ? 504 THR A N   1 
ATOM   3849 C CA  . THR A 1 503 ? 16.037  -45.696 17.778  1.00 30.76  ? 504 THR A CA  1 
ATOM   3850 C C   . THR A 1 503 ? 15.178  -45.822 16.526  1.00 26.81  ? 504 THR A C   1 
ATOM   3851 O O   . THR A 1 503 ? 14.515  -46.846 16.325  1.00 25.17  ? 504 THR A O   1 
ATOM   3852 C CB  . THR A 1 503 ? 17.495  -46.010 17.407  1.00 27.90  ? 504 THR A CB  1 
ATOM   3853 O OG1 . THR A 1 503 ? 17.595  -47.391 17.048  1.00 29.77  ? 504 THR A OG1 1 
ATOM   3854 C CG2 . THR A 1 503 ? 18.421  -45.744 18.591  1.00 28.51  ? 504 THR A CG2 1 
ATOM   3855 N N   . ALA A 1 504 ? 15.190  -44.787 15.689  1.00 32.27  ? 505 ALA A N   1 
ATOM   3856 C CA  . ALA A 1 504 ? 14.382  -44.779 14.464  1.00 29.23  ? 505 ALA A CA  1 
ATOM   3857 C C   . ALA A 1 504 ? 14.706  -45.953 13.539  1.00 28.05  ? 505 ALA A C   1 
ATOM   3858 O O   . ALA A 1 504 ? 13.829  -46.460 12.848  1.00 32.22  ? 505 ALA A O   1 
ATOM   3859 C CB  . ALA A 1 504 ? 14.538  -43.462 13.725  1.00 25.35  ? 505 ALA A CB  1 
ATOM   3860 N N   . GLY A 1 505 ? 15.959  -46.398 13.546  1.00 27.54  ? 506 GLY A N   1 
ATOM   3861 C CA  . GLY A 1 505 ? 16.358  -47.520 12.717  1.00 23.18  ? 506 GLY A CA  1 
ATOM   3862 C C   . GLY A 1 505 ? 16.062  -48.897 13.281  1.00 27.55  ? 506 GLY A C   1 
ATOM   3863 O O   . GLY A 1 505 ? 15.261  -49.657 12.724  1.00 28.33  ? 506 GLY A O   1 
ATOM   3864 N N   . ALA A 1 506 ? 16.727  -49.246 14.377  1.00 26.56  ? 507 ALA A N   1 
ATOM   3865 C CA  . ALA A 1 506 ? 16.548  -50.578 14.956  1.00 27.12  ? 507 ALA A CA  1 
ATOM   3866 C C   . ALA A 1 506 ? 15.188  -50.745 15.640  1.00 23.57  ? 507 ALA A C   1 
ATOM   3867 O O   . ALA A 1 506 ? 14.659  -51.853 15.700  1.00 26.83  ? 507 ALA A O   1 
ATOM   3868 C CB  . ALA A 1 506 ? 17.693  -50.918 15.904  1.00 18.80  ? 507 ALA A CB  1 
ATOM   3869 N N   . GLN A 1 507 ? 14.634  -49.644 16.148  1.00 24.61  ? 508 GLN A N   1 
ATOM   3870 C CA  . GLN A 1 507 ? 13.268  -49.634 16.684  1.00 27.10  ? 508 GLN A CA  1 
ATOM   3871 C C   . GLN A 1 507 ? 13.062  -50.643 17.813  1.00 27.62  ? 508 GLN A C   1 
ATOM   3872 O O   . GLN A 1 507 ? 12.025  -51.305 17.894  1.00 27.55  ? 508 GLN A O   1 
ATOM   3873 C CB  . GLN A 1 507 ? 12.254  -49.899 15.565  1.00 24.57  ? 508 GLN A CB  1 
ATOM   3874 C CG  . GLN A 1 507 ? 12.266  -48.861 14.446  1.00 28.27  ? 508 GLN A CG  1 
ATOM   3875 C CD  . GLN A 1 507 ? 11.436  -49.292 13.244  1.00 31.38  ? 508 GLN A CD  1 
ATOM   3876 O OE1 . GLN A 1 507 ? 10.214  -49.382 13.319  1.00 32.07  ? 508 GLN A OE1 1 
ATOM   3877 N NE2 . GLN A 1 507 ? 12.102  -49.576 12.138  1.00 28.93  ? 508 GLN A NE2 1 
ATOM   3878 N N   . GLN A 1 508 ? 14.057  -50.773 18.681  1.00 27.85  ? 509 GLN A N   1 
ATOM   3879 C CA  . GLN A 1 508 ? 14.005  -51.796 19.718  1.00 29.36  ? 509 GLN A CA  1 
ATOM   3880 C C   . GLN A 1 508 ? 13.170  -51.376 20.925  1.00 25.85  ? 509 GLN A C   1 
ATOM   3881 O O   . GLN A 1 508 ? 13.183  -50.217 21.339  1.00 22.12  ? 509 GLN A O   1 
ATOM   3882 C CB  . GLN A 1 508 ? 15.416  -52.195 20.149  1.00 28.51  ? 509 GLN A CB  1 
ATOM   3883 C CG  . GLN A 1 508 ? 16.133  -53.106 19.159  1.00 29.19  ? 509 GLN A CG  1 
ATOM   3884 C CD  . GLN A 1 508 ? 17.601  -53.312 19.512  1.00 30.77  ? 509 GLN A CD  1 
ATOM   3885 O OE1 . GLN A 1 508 ? 18.357  -52.351 19.649  1.00 36.45  ? 509 GLN A OE1 1 
ATOM   3886 N NE2 . GLN A 1 508 ? 18.005  -54.566 19.659  1.00 28.18  ? 509 GLN A NE2 1 
ATOM   3887 N N   . TYR A 1 509 ? 12.433  -52.333 21.472  1.00 25.86  ? 510 TYR A N   1 
ATOM   3888 C CA  . TYR A 1 509 ? 11.661  -52.112 22.686  1.00 27.98  ? 510 TYR A CA  1 
ATOM   3889 C C   . TYR A 1 509 ? 11.641  -53.433 23.446  1.00 28.62  ? 510 TYR A C   1 
ATOM   3890 O O   . TYR A 1 509 ? 12.032  -54.458 22.888  1.00 28.55  ? 510 TYR A O   1 
ATOM   3891 C CB  . TYR A 1 509 ? 10.238  -51.689 22.330  1.00 27.05  ? 510 TYR A CB  1 
ATOM   3892 C CG  . TYR A 1 509 ? 9.455   -52.770 21.627  1.00 29.50  ? 510 TYR A CG  1 
ATOM   3893 C CD1 . TYR A 1 509 ? 9.493   -52.899 20.236  1.00 28.48  ? 510 TYR A CD1 1 
ATOM   3894 C CD2 . TYR A 1 509 ? 8.687   -53.676 22.350  1.00 24.20  ? 510 TYR A CD2 1 
ATOM   3895 C CE1 . TYR A 1 509 ? 8.773   -53.891 19.594  1.00 24.00  ? 510 TYR A CE1 1 
ATOM   3896 C CE2 . TYR A 1 509 ? 7.975   -54.672 21.714  1.00 28.06  ? 510 TYR A CE2 1 
ATOM   3897 C CZ  . TYR A 1 509 ? 8.018   -54.772 20.341  1.00 27.12  ? 510 TYR A CZ  1 
ATOM   3898 O OH  . TYR A 1 509 ? 7.303   -55.770 19.729  1.00 35.61  ? 510 TYR A OH  1 
ATOM   3899 N N   . VAL A 1 510 ? 11.187  -53.424 24.699  1.00 24.76  ? 511 VAL A N   1 
ATOM   3900 C CA  . VAL A 1 510 ? 11.057  -54.673 25.458  1.00 22.25  ? 511 VAL A CA  1 
ATOM   3901 C C   . VAL A 1 510 ? 9.611   -55.033 25.753  1.00 23.39  ? 511 VAL A C   1 
ATOM   3902 O O   . VAL A 1 510 ? 8.739   -54.168 25.803  1.00 24.42  ? 511 VAL A O   1 
ATOM   3903 C CB  . VAL A 1 510 ? 11.817  -54.644 26.807  1.00 28.67  ? 511 VAL A CB  1 
ATOM   3904 C CG1 . VAL A 1 510 ? 13.320  -54.515 26.583  1.00 25.52  ? 511 VAL A CG1 1 
ATOM   3905 C CG2 . VAL A 1 510 ? 11.278  -53.532 27.701  1.00 20.79  ? 511 VAL A CG2 1 
ATOM   3906 N N   . SER A 1 511 ? 9.361   -56.321 25.952  1.00 22.83  ? 512 SER A N   1 
ATOM   3907 C CA  . SER A 1 511 ? 8.063   -56.768 26.428  1.00 24.93  ? 512 SER A CA  1 
ATOM   3908 C C   . SER A 1 511 ? 8.090   -56.818 27.952  1.00 31.13  ? 512 SER A C   1 
ATOM   3909 O O   . SER A 1 511 ? 9.027   -57.339 28.550  1.00 26.63  ? 512 SER A O   1 
ATOM   3910 C CB  . SER A 1 511 ? 7.722   -58.143 25.853  1.00 29.55  ? 512 SER A CB  1 
ATOM   3911 O OG  . SER A 1 511 ? 8.750   -59.069 26.151  1.00 40.37  ? 512 SER A OG  1 
ATOM   3912 N N   . LEU A 1 512 ? 7.065   -56.255 28.576  1.00 31.52  ? 513 LEU A N   1 
ATOM   3913 C CA  . LEU A 1 512 ? 6.943   -56.295 30.020  1.00 25.58  ? 513 LEU A CA  1 
ATOM   3914 C C   . LEU A 1 512 ? 5.878   -57.301 30.433  1.00 31.83  ? 513 LEU A C   1 
ATOM   3915 O O   . LEU A 1 512 ? 4.678   -57.064 30.235  1.00 29.08  ? 513 LEU A O   1 
ATOM   3916 C CB  . LEU A 1 512 ? 6.599   -54.905 30.567  1.00 22.76  ? 513 LEU A CB  1 
ATOM   3917 C CG  . LEU A 1 512 ? 7.677   -53.833 30.392  1.00 29.66  ? 513 LEU A CG  1 
ATOM   3918 C CD1 . LEU A 1 512 ? 7.238   -52.492 31.005  1.00 21.14  ? 513 LEU A CD1 1 
ATOM   3919 C CD2 . LEU A 1 512 ? 9.002   -54.315 30.984  1.00 23.57  ? 513 LEU A CD2 1 
ATOM   3920 N N   . ASP A 1 513 ? 6.320   -58.428 30.988  1.00 25.47  ? 514 ASP A N   1 
ATOM   3921 C CA  . ASP A 1 513 ? 5.407   -59.412 31.565  1.00 33.20  ? 514 ASP A CA  1 
ATOM   3922 C C   . ASP A 1 513 ? 6.122   -60.273 32.604  1.00 34.83  ? 514 ASP A C   1 
ATOM   3923 O O   . ASP A 1 513 ? 7.216   -59.925 33.050  1.00 35.18  ? 514 ASP A O   1 
ATOM   3924 C CB  . ASP A 1 513 ? 4.743   -60.278 30.485  1.00 34.97  ? 514 ASP A CB  1 
ATOM   3925 C CG  . ASP A 1 513 ? 5.746   -61.020 29.618  1.00 40.28  ? 514 ASP A CG  1 
ATOM   3926 O OD1 . ASP A 1 513 ? 6.953   -61.034 29.951  1.00 38.65  ? 514 ASP A OD1 1 
ATOM   3927 O OD2 . ASP A 1 513 ? 5.313   -61.605 28.603  1.00 45.51  ? 514 ASP A OD2 1 
ATOM   3928 N N   . LEU A 1 514 ? 5.512   -61.394 32.978  1.00 35.40  ? 515 LEU A N   1 
ATOM   3929 C CA  . LEU A 1 514 ? 6.066   -62.252 34.030  1.00 36.59  ? 515 LEU A CA  1 
ATOM   3930 C C   . LEU A 1 514 ? 7.409   -62.867 33.650  1.00 34.58  ? 515 LEU A C   1 
ATOM   3931 O O   . LEU A 1 514 ? 8.247   -63.104 34.514  1.00 45.52  ? 515 LEU A O   1 
ATOM   3932 C CB  . LEU A 1 514 ? 5.080   -63.351 34.403  1.00 30.84  ? 515 LEU A CB  1 
ATOM   3933 C CG  . LEU A 1 514 ? 3.721   -62.889 34.918  1.00 33.74  ? 515 LEU A CG  1 
ATOM   3934 C CD1 . LEU A 1 514 ? 2.898   -64.101 35.332  1.00 35.09  ? 515 LEU A CD1 1 
ATOM   3935 C CD2 . LEU A 1 514 ? 3.876   -61.912 36.078  1.00 35.24  ? 515 LEU A CD2 1 
ATOM   3936 N N   . ARG A 1 515 ? 7.606   -63.117 32.359  1.00 38.46  ? 516 ARG A N   1 
ATOM   3937 C CA  . ARG A 1 515 ? 8.869   -63.634 31.834  1.00 36.84  ? 516 ARG A CA  1 
ATOM   3938 C C   . ARG A 1 515 ? 9.934   -62.550 31.883  1.00 34.70  ? 516 ARG A C   1 
ATOM   3939 O O   . ARG A 1 515 ? 9.610   -61.373 31.950  1.00 35.38  ? 516 ARG A O   1 
ATOM   3940 C CB  . ARG A 1 515 ? 8.693   -64.059 30.373  1.00 38.63  ? 516 ARG A CB  1 
ATOM   3941 C CG  . ARG A 1 515 ? 7.643   -65.126 30.114  1.00 48.11  ? 516 ARG A CG  1 
ATOM   3942 C CD  . ARG A 1 515 ? 7.464   -65.341 28.604  1.00 55.91  ? 516 ARG A CD  1 
ATOM   3943 N NE  . ARG A 1 515 ? 7.071   -64.110 27.910  1.00 65.65  ? 516 ARG A NE  1 
ATOM   3944 C CZ  . ARG A 1 515 ? 7.782   -63.509 26.954  1.00 60.23  ? 516 ARG A CZ  1 
ATOM   3945 N NH1 . ARG A 1 515 ? 8.939   -64.023 26.548  1.00 54.11  ? 516 ARG A NH1 1 
ATOM   3946 N NH2 . ARG A 1 515 ? 7.327   -62.392 26.394  1.00 54.91  ? 516 ARG A NH2 1 
ATOM   3947 N N   . PRO A 1 516 ? 11.216  -62.940 31.827  1.00 41.57  ? 517 PRO A N   1 
ATOM   3948 C CA  . PRO A 1 516 ? 12.293  -61.945 31.740  1.00 39.46  ? 517 PRO A CA  1 
ATOM   3949 C C   . PRO A 1 516 ? 12.139  -61.051 30.508  1.00 40.76  ? 517 PRO A C   1 
ATOM   3950 O O   . PRO A 1 516 ? 11.484  -61.461 29.541  1.00 33.73  ? 517 PRO A O   1 
ATOM   3951 C CB  . PRO A 1 516 ? 13.547  -62.807 31.585  1.00 36.37  ? 517 PRO A CB  1 
ATOM   3952 C CG  . PRO A 1 516 ? 13.188  -64.105 32.210  1.00 37.49  ? 517 PRO A CG  1 
ATOM   3953 C CD  . PRO A 1 516 ? 11.738  -64.315 31.912  1.00 37.69  ? 517 PRO A CD  1 
ATOM   3954 N N   . LEU A 1 517 ? 12.731  -59.856 30.553  1.00 36.34  ? 518 LEU A N   1 
ATOM   3955 C CA  . LEU A 1 517 ? 12.713  -58.928 29.425  1.00 34.47  ? 518 LEU A CA  1 
ATOM   3956 C C   . LEU A 1 517 ? 13.071  -59.643 28.136  1.00 39.53  ? 518 LEU A C   1 
ATOM   3957 O O   . LEU A 1 517 ? 13.956  -60.494 28.107  1.00 40.55  ? 518 LEU A O   1 
ATOM   3958 C CB  . LEU A 1 517 ? 13.716  -57.791 29.621  1.00 34.68  ? 518 LEU A CB  1 
ATOM   3959 C CG  . LEU A 1 517 ? 13.444  -56.626 30.564  1.00 38.57  ? 518 LEU A CG  1 
ATOM   3960 C CD1 . LEU A 1 517 ? 14.541  -55.587 30.396  1.00 37.22  ? 518 LEU A CD1 1 
ATOM   3961 C CD2 . LEU A 1 517 ? 12.067  -56.014 30.324  1.00 35.34  ? 518 LEU A CD2 1 
ATOM   3962 N N   . GLU A 1 518 ? 12.369  -59.289 27.073  1.00 36.10  ? 519 GLU A N   1 
ATOM   3963 C CA  . GLU A 1 518 ? 12.646  -59.822 25.756  1.00 38.36  ? 519 GLU A CA  1 
ATOM   3964 C C   . GLU A 1 518 ? 12.696  -58.634 24.809  1.00 33.00  ? 519 GLU A C   1 
ATOM   3965 O O   . GLU A 1 518 ? 11.774  -57.820 24.782  1.00 28.01  ? 519 GLU A O   1 
ATOM   3966 C CB  . GLU A 1 518 ? 11.549  -60.800 25.352  1.00 37.76  ? 519 GLU A CB  1 
ATOM   3967 C CG  . GLU A 1 518 ? 11.774  -61.472 24.016  1.00 53.61  ? 519 GLU A CG  1 
ATOM   3968 C CD  . GLU A 1 518 ? 10.568  -62.286 23.569  1.00 64.78  ? 519 GLU A CD  1 
ATOM   3969 O OE1 . GLU A 1 518 ? 9.978   -62.997 24.419  1.00 64.60  ? 519 GLU A OE1 1 
ATOM   3970 O OE2 . GLU A 1 518 ? 10.208  -62.203 22.370  1.00 59.40  ? 519 GLU A OE2 1 
ATOM   3971 N N   . VAL A 1 519 ? 13.795  -58.506 24.072  1.00 33.56  ? 520 VAL A N   1 
ATOM   3972 C CA  . VAL A 1 519 ? 13.960  -57.395 23.144  1.00 29.57  ? 520 VAL A CA  1 
ATOM   3973 C C   . VAL A 1 519 ? 13.329  -57.734 21.803  1.00 33.97  ? 520 VAL A C   1 
ATOM   3974 O O   . VAL A 1 519 ? 13.506  -58.835 21.297  1.00 36.71  ? 520 VAL A O   1 
ATOM   3975 C CB  . VAL A 1 519 ? 15.436  -57.060 22.925  1.00 32.54  ? 520 VAL A CB  1 
ATOM   3976 C CG1 . VAL A 1 519 ? 15.583  -55.932 21.906  1.00 28.80  ? 520 VAL A CG1 1 
ATOM   3977 C CG2 . VAL A 1 519 ? 16.079  -56.674 24.242  1.00 29.32  ? 520 VAL A CG2 1 
ATOM   3978 N N   . ARG A 1 520 ? 12.574  -56.789 21.249  1.00 34.38  ? 521 ARG A N   1 
ATOM   3979 C CA  . ARG A 1 520 ? 11.919  -56.966 19.961  1.00 29.48  ? 521 ARG A CA  1 
ATOM   3980 C C   . ARG A 1 520 ? 12.092  -55.720 19.117  1.00 30.63  ? 521 ARG A C   1 
ATOM   3981 O O   . ARG A 1 520 ? 12.625  -54.715 19.591  1.00 37.34  ? 521 ARG A O   1 
ATOM   3982 C CB  . ARG A 1 520 ? 10.441  -57.264 20.156  1.00 33.43  ? 521 ARG A CB  1 
ATOM   3983 C CG  . ARG A 1 520 ? 10.190  -58.522 20.942  1.00 36.19  ? 521 ARG A CG  1 
ATOM   3984 C CD  . ARG A 1 520 ? 8.721   -58.693 21.243  1.00 42.05  ? 521 ARG A CD  1 
ATOM   3985 N NE  . ARG A 1 520 ? 8.508   -59.858 22.093  1.00 47.35  ? 521 ARG A NE  1 
ATOM   3986 C CZ  . ARG A 1 520 ? 7.366   -60.134 22.707  1.00 53.69  ? 521 ARG A CZ  1 
ATOM   3987 N NH1 . ARG A 1 520 ? 6.326   -59.320 22.564  1.00 51.75  ? 521 ARG A NH1 1 
ATOM   3988 N NH2 . ARG A 1 520 ? 7.268   -61.221 23.466  1.00 51.57  ? 521 ARG A NH2 1 
ATOM   3989 N N   . ARG A 1 521 ? 11.644  -55.791 17.868  1.00 31.29  ? 522 ARG A N   1 
ATOM   3990 C CA  . ARG A 1 521 ? 11.818  -54.695 16.919  1.00 35.65  ? 522 ARG A CA  1 
ATOM   3991 C C   . ARG A 1 521 ? 10.484  -54.244 16.341  1.00 30.66  ? 522 ARG A C   1 
ATOM   3992 O O   . ARG A 1 521 ? 9.683   -55.066 15.902  1.00 35.43  ? 522 ARG A O   1 
ATOM   3993 C CB  . ARG A 1 521 ? 12.736  -55.109 15.758  1.00 31.85  ? 522 ARG A CB  1 
ATOM   3994 C CG  . ARG A 1 521 ? 14.173  -55.426 16.134  1.00 34.39  ? 522 ARG A CG  1 
ATOM   3995 C CD  . ARG A 1 521 ? 15.060  -55.463 14.889  1.00 27.26  ? 522 ARG A CD  1 
ATOM   3996 N NE  . ARG A 1 521 ? 15.037  -54.170 14.211  1.00 29.66  ? 522 ARG A NE  1 
ATOM   3997 C CZ  . ARG A 1 521 ? 14.858  -54.007 12.903  1.00 39.97  ? 522 ARG A CZ  1 
ATOM   3998 N NH1 . ARG A 1 521 ? 14.705  -55.067 12.109  1.00 30.68  ? 522 ARG A NH1 1 
ATOM   3999 N NH2 . ARG A 1 521 ? 14.842  -52.777 12.392  1.00 32.57  ? 522 ARG A NH2 1 
ATOM   4000 N N   . GLY A 1 522 ? 10.258  -52.936 16.337  1.00 28.85  ? 523 GLY A N   1 
ATOM   4001 C CA  . GLY A 1 522 ? 9.123   -52.362 15.639  1.00 29.20  ? 523 GLY A CA  1 
ATOM   4002 C C   . GLY A 1 522 ? 7.855   -52.220 16.451  1.00 29.85  ? 523 GLY A C   1 
ATOM   4003 O O   . GLY A 1 522 ? 7.238   -53.207 16.853  1.00 27.16  ? 523 GLY A O   1 
ATOM   4004 N N   . LEU A 1 523 ? 7.461   -50.976 16.695  1.00 26.31  ? 524 LEU A N   1 
ATOM   4005 C CA  . LEU A 1 523 ? 6.166   -50.719 17.300  1.00 29.51  ? 524 LEU A CA  1 
ATOM   4006 C C   . LEU A 1 523 ? 5.114   -50.739 16.195  1.00 30.59  ? 524 LEU A C   1 
ATOM   4007 O O   . LEU A 1 523 ? 4.674   -49.677 15.726  1.00 26.81  ? 524 LEU A O   1 
ATOM   4008 C CB  . LEU A 1 523 ? 6.161   -49.369 18.019  1.00 21.81  ? 524 LEU A CB  1 
ATOM   4009 C CG  . LEU A 1 523 ? 7.065   -49.275 19.247  1.00 27.97  ? 524 LEU A CG  1 
ATOM   4010 C CD1 . LEU A 1 523 ? 7.188   -47.822 19.702  1.00 26.48  ? 524 LEU A CD1 1 
ATOM   4011 C CD2 . LEU A 1 523 ? 6.517   -50.156 20.360  1.00 22.04  ? 524 LEU A CD2 1 
ATOM   4012 N N   A ARG A 1 524 ? 4.719   -51.949 15.800  0.44 27.08  ? 525 ARG A N   1 
ATOM   4013 N N   B ARG A 1 524 ? 4.715   -51.940 15.782  0.56 26.88  ? 525 ARG A N   1 
ATOM   4014 C CA  A ARG A 1 524 ? 3.777   -52.159 14.706  0.44 30.14  ? 525 ARG A CA  1 
ATOM   4015 C CA  B ARG A 1 524 ? 3.732   -52.097 14.717  0.56 30.18  ? 525 ARG A CA  1 
ATOM   4016 C C   A ARG A 1 524 ? 4.170   -51.315 13.504  0.44 29.07  ? 525 ARG A C   1 
ATOM   4017 C C   B ARG A 1 524 ? 4.168   -51.293 13.496  0.56 29.12  ? 525 ARG A C   1 
ATOM   4018 O O   A ARG A 1 524 ? 3.381   -50.519 12.988  0.44 28.48  ? 525 ARG A O   1 
ATOM   4019 O O   B ARG A 1 524 ? 3.399   -50.492 12.957  0.56 28.45  ? 525 ARG A O   1 
ATOM   4020 C CB  A ARG A 1 524 ? 2.344   -51.877 15.155  0.44 29.15  ? 525 ARG A CB  1 
ATOM   4021 C CB  B ARG A 1 524 ? 2.349   -51.641 15.192  0.56 29.10  ? 525 ARG A CB  1 
ATOM   4022 C CG  A ARG A 1 524 ? 1.892   -52.791 16.282  0.44 27.15  ? 525 ARG A CG  1 
ATOM   4023 C CG  B ARG A 1 524 ? 1.802   -52.425 16.382  0.56 27.49  ? 525 ARG A CG  1 
ATOM   4024 C CD  A ARG A 1 524 ? 0.393   -52.727 16.507  0.44 24.02  ? 525 ARG A CD  1 
ATOM   4025 C CD  B ARG A 1 524 ? 0.920   -53.573 15.925  0.56 25.05  ? 525 ARG A CD  1 
ATOM   4026 N NE  A ARG A 1 524 ? -0.006  -53.576 17.625  0.44 26.68  ? 525 ARG A NE  1 
ATOM   4027 N NE  B ARG A 1 524 ? -0.140  -53.113 15.031  0.56 29.99  ? 525 ARG A NE  1 
ATOM   4028 C CZ  A ARG A 1 524 ? -1.264  -53.845 17.952  0.44 28.56  ? 525 ARG A CZ  1 
ATOM   4029 C CZ  B ARG A 1 524 ? -0.884  -53.916 14.275  0.56 25.21  ? 525 ARG A CZ  1 
ATOM   4030 N NH1 A ARG A 1 524 ? -2.261  -53.328 17.244  0.44 24.69  ? 525 ARG A NH1 1 
ATOM   4031 N NH1 B ARG A 1 524 ? -0.695  -55.227 14.311  0.56 29.79  ? 525 ARG A NH1 1 
ATOM   4032 N NH2 A ARG A 1 524 ? -1.523  -54.635 18.990  0.44 26.19  ? 525 ARG A NH2 1 
ATOM   4033 N NH2 B ARG A 1 524 ? -1.818  -53.409 13.491  0.56 16.65  ? 525 ARG A NH2 1 
ATOM   4034 N N   . ALA A 1 525 ? 5.417   -51.500 13.088  1.00 28.97  ? 526 ALA A N   1 
ATOM   4035 C CA  . ALA A 1 525 ? 6.027   -50.732 12.014  1.00 26.01  ? 526 ALA A CA  1 
ATOM   4036 C C   . ALA A 1 525 ? 5.239   -50.714 10.698  1.00 25.97  ? 526 ALA A C   1 
ATOM   4037 O O   . ALA A 1 525 ? 5.096   -49.662 10.081  1.00 22.97  ? 526 ALA A O   1 
ATOM   4038 C CB  . ALA A 1 525 ? 7.460   -51.220 11.781  1.00 25.78  ? 526 ALA A CB  1 
ATOM   4039 N N   . GLN A 1 526 ? 4.734   -51.869 10.276  1.00 25.99  ? 527 GLN A N   1 
ATOM   4040 C CA  . GLN A 1 526 ? 3.961   -51.931 9.041   1.00 28.75  ? 527 GLN A CA  1 
ATOM   4041 C C   . GLN A 1 526 ? 2.699   -51.092 9.132   1.00 23.13  ? 527 GLN A C   1 
ATOM   4042 O O   . GLN A 1 526 ? 2.440   -50.275 8.261   1.00 31.77  ? 527 GLN A O   1 
ATOM   4043 C CB  . GLN A 1 526 ? 3.618   -53.372 8.655   1.00 21.52  ? 527 GLN A CB  1 
ATOM   4044 C CG  . GLN A 1 526 ? 4.809   -54.324 8.650   1.00 31.69  ? 527 GLN A CG  1 
ATOM   4045 C CD  . GLN A 1 526 ? 6.011   -53.840 7.818   1.00 36.82  ? 527 GLN A CD  1 
ATOM   4046 O OE1 . GLN A 1 526 ? 7.166   -54.109 8.174   1.00 45.76  ? 527 GLN A OE1 1 
ATOM   4047 N NE2 . GLN A 1 526 ? 5.745   -53.162 6.703   1.00 24.42  ? 527 GLN A NE2 1 
ATOM   4048 N N   . ALA A 1 527 ? 1.924   -51.277 10.192  1.00 27.42  ? 528 ALA A N   1 
ATOM   4049 C CA  . ALA A 1 527 ? 0.703   -50.498 10.375  1.00 24.78  ? 528 ALA A CA  1 
ATOM   4050 C C   . ALA A 1 527 ? 1.007   -49.014 10.589  1.00 25.74  ? 528 ALA A C   1 
ATOM   4051 O O   . ALA A 1 527 ? 0.308   -48.145 10.071  1.00 30.15  ? 528 ALA A O   1 
ATOM   4052 C CB  . ALA A 1 527 ? -0.110  -51.048 11.540  1.00 26.45  ? 528 ALA A CB  1 
ATOM   4053 N N   . CYS A 1 528 ? 2.053   -48.714 11.344  1.00 21.23  ? 529 CYS A N   1 
ATOM   4054 C CA  . CYS A 1 528 ? 2.338   -47.315 11.661  1.00 22.48  ? 529 CYS A CA  1 
ATOM   4055 C C   . CYS A 1 528 ? 2.937   -46.528 10.486  1.00 26.74  ? 529 CYS A C   1 
ATOM   4056 O O   . CYS A 1 528 ? 2.814   -45.299 10.425  1.00 23.49  ? 529 CYS A O   1 
ATOM   4057 C CB  . CYS A 1 528 ? 3.186   -47.202 12.935  1.00 25.75  ? 529 CYS A CB  1 
ATOM   4058 S SG  . CYS A 1 528 ? 2.258   -47.695 14.454  1.00 26.72  ? 529 CYS A SG  1 
ATOM   4059 N N   . ALA A 1 529 ? 3.561   -47.233 9.543   1.00 22.48  ? 530 ALA A N   1 
ATOM   4060 C CA  . ALA A 1 529 ? 3.980   -46.601 8.295   1.00 24.24  ? 530 ALA A CA  1 
ATOM   4061 C C   . ALA A 1 529 ? 2.763   -46.008 7.602   1.00 24.53  ? 530 ALA A C   1 
ATOM   4062 O O   . ALA A 1 529 ? 2.827   -44.914 7.036   1.00 24.08  ? 530 ALA A O   1 
ATOM   4063 C CB  . ALA A 1 529 ? 4.660   -47.603 7.385   1.00 21.84  ? 530 ALA A CB  1 
ATOM   4064 N N   . PHE A 1 530 ? 1.650   -46.736 7.657   1.00 21.27  ? 531 PHE A N   1 
ATOM   4065 C CA  . PHE A 1 530 ? 0.407   -46.265 7.052   1.00 23.07  ? 531 PHE A CA  1 
ATOM   4066 C C   . PHE A 1 530 ? -0.102  -44.981 7.721   1.00 27.44  ? 531 PHE A C   1 
ATOM   4067 O O   . PHE A 1 530 ? -0.340  -43.984 7.042   1.00 27.79  ? 531 PHE A O   1 
ATOM   4068 C CB  . PHE A 1 530 ? -0.664  -47.365 7.078   1.00 25.82  ? 531 PHE A CB  1 
ATOM   4069 C CG  . PHE A 1 530 ? -2.056  -46.864 6.803   1.00 25.95  ? 531 PHE A CG  1 
ATOM   4070 C CD1 . PHE A 1 530 ? -2.458  -46.569 5.508   1.00 25.61  ? 531 PHE A CD1 1 
ATOM   4071 C CD2 . PHE A 1 530 ? -2.963  -46.693 7.840   1.00 23.77  ? 531 PHE A CD2 1 
ATOM   4072 C CE1 . PHE A 1 530 ? -3.741  -46.099 5.248   1.00 29.73  ? 531 PHE A CE1 1 
ATOM   4073 C CE2 . PHE A 1 530 ? -4.243  -46.222 7.592   1.00 28.02  ? 531 PHE A CE2 1 
ATOM   4074 C CZ  . PHE A 1 530 ? -4.636  -45.923 6.289   1.00 30.35  ? 531 PHE A CZ  1 
ATOM   4075 N N   . TRP A 1 531 ? -0.242  -45.002 9.047   1.00 21.54  ? 532 TRP A N   1 
ATOM   4076 C CA  . TRP A 1 531 ? -0.804  -43.863 9.776   1.00 23.16  ? 532 TRP A CA  1 
ATOM   4077 C C   . TRP A 1 531 ? 0.125   -42.664 9.798   1.00 26.60  ? 532 TRP A C   1 
ATOM   4078 O O   . TRP A 1 531 ? -0.333  -41.515 9.741   1.00 25.43  ? 532 TRP A O   1 
ATOM   4079 C CB  . TRP A 1 531 ? -1.175  -44.248 11.223  1.00 19.76  ? 532 TRP A CB  1 
ATOM   4080 C CG  . TRP A 1 531 ? -2.256  -45.287 11.302  1.00 18.42  ? 532 TRP A CG  1 
ATOM   4081 C CD1 . TRP A 1 531 ? -2.101  -46.627 11.524  1.00 20.41  ? 532 TRP A CD1 1 
ATOM   4082 C CD2 . TRP A 1 531 ? -3.660  -45.071 11.130  1.00 18.93  ? 532 TRP A CD2 1 
ATOM   4083 N NE1 . TRP A 1 531 ? -3.322  -47.257 11.508  1.00 18.50  ? 532 TRP A NE1 1 
ATOM   4084 C CE2 . TRP A 1 531 ? -4.296  -46.318 11.277  1.00 21.68  ? 532 TRP A CE2 1 
ATOM   4085 C CE3 . TRP A 1 531 ? -4.442  -43.941 10.868  1.00 19.57  ? 532 TRP A CE3 1 
ATOM   4086 C CZ2 . TRP A 1 531 ? -5.677  -46.465 11.167  1.00 23.43  ? 532 TRP A CZ2 1 
ATOM   4087 C CZ3 . TRP A 1 531 ? -5.813  -44.092 10.762  1.00 18.85  ? 532 TRP A CZ3 1 
ATOM   4088 C CH2 . TRP A 1 531 ? -6.414  -45.338 10.910  1.00 18.05  ? 532 TRP A CH2 1 
ATOM   4089 N N   . ASN A 1 532 ? 1.426   -42.930 9.882   1.00 26.46  ? 533 ASN A N   1 
ATOM   4090 C CA  . ASN A 1 532 ? 2.406   -41.866 10.085  1.00 23.38  ? 533 ASN A CA  1 
ATOM   4091 C C   . ASN A 1 532 ? 3.015   -41.328 8.791   1.00 23.77  ? 533 ASN A C   1 
ATOM   4092 O O   . ASN A 1 532 ? 3.359   -40.153 8.710   1.00 24.32  ? 533 ASN A O   1 
ATOM   4093 C CB  . ASN A 1 532 ? 3.510   -42.301 11.070  1.00 22.14  ? 533 ASN A CB  1 
ATOM   4094 C CG  . ASN A 1 532 ? 2.974   -42.568 12.487  1.00 27.69  ? 533 ASN A CG  1 
ATOM   4095 O OD1 . ASN A 1 532 ? 1.935   -42.039 12.880  1.00 26.73  ? 533 ASN A OD1 1 
ATOM   4096 N ND2 . ASN A 1 532 ? 3.691   -43.392 13.252  1.00 21.16  ? 533 ASN A ND2 1 
ATOM   4097 N N   . ARG A 1 533 ? 3.149   -42.178 7.778   1.00 24.48  ? 534 ARG A N   1 
ATOM   4098 C CA  . ARG A 1 533 ? 3.812   -41.757 6.540   1.00 25.46  ? 534 ARG A CA  1 
ATOM   4099 C C   . ARG A 1 533 ? 2.856   -41.520 5.382   1.00 24.93  ? 534 ARG A C   1 
ATOM   4100 O O   . ARG A 1 533 ? 2.909   -40.478 4.742   1.00 36.43  ? 534 ARG A O   1 
ATOM   4101 C CB  . ARG A 1 533 ? 4.875   -42.768 6.125   1.00 26.52  ? 534 ARG A CB  1 
ATOM   4102 C CG  . ARG A 1 533 ? 5.956   -42.942 7.167   1.00 28.43  ? 534 ARG A CG  1 
ATOM   4103 C CD  . ARG A 1 533 ? 6.888   -44.096 6.831   1.00 31.59  ? 534 ARG A CD  1 
ATOM   4104 N NE  . ARG A 1 533 ? 7.785   -44.316 7.955   1.00 39.95  ? 534 ARG A NE  1 
ATOM   4105 C CZ  . ARG A 1 533 ? 8.942   -43.685 8.117   1.00 40.83  ? 534 ARG A CZ  1 
ATOM   4106 N NH1 . ARG A 1 533 ? 9.359   -42.813 7.201   1.00 34.71  ? 534 ARG A NH1 1 
ATOM   4107 N NH2 . ARG A 1 533 ? 9.688   -43.940 9.186   1.00 40.23  ? 534 ARG A NH2 1 
ATOM   4108 N N   . PHE A 1 534 ? 1.983   -42.483 5.113   1.00 25.85  ? 535 PHE A N   1 
ATOM   4109 C CA  . PHE A 1 534 ? 1.089   -42.384 3.960   1.00 27.73  ? 535 PHE A CA  1 
ATOM   4110 C C   . PHE A 1 534 ? -0.180  -41.566 4.193   1.00 29.52  ? 535 PHE A C   1 
ATOM   4111 O O   . PHE A 1 534 ? -0.463  -40.645 3.438   1.00 32.74  ? 535 PHE A O   1 
ATOM   4112 C CB  . PHE A 1 534 ? 0.696   -43.765 3.411   1.00 24.39  ? 535 PHE A CB  1 
ATOM   4113 C CG  . PHE A 1 534 ? -0.233  -43.685 2.238   1.00 26.16  ? 535 PHE A CG  1 
ATOM   4114 C CD1 . PHE A 1 534 ? 0.227   -43.235 1.012   1.00 27.67  ? 535 PHE A CD1 1 
ATOM   4115 C CD2 . PHE A 1 534 ? -1.571  -44.016 2.367   1.00 26.36  ? 535 PHE A CD2 1 
ATOM   4116 C CE1 . PHE A 1 534 ? -0.633  -43.125 -0.075  1.00 29.19  ? 535 PHE A CE1 1 
ATOM   4117 C CE2 . PHE A 1 534 ? -2.436  -43.917 1.289   1.00 32.17  ? 535 PHE A CE2 1 
ATOM   4118 C CZ  . PHE A 1 534 ? -1.967  -43.471 0.065   1.00 31.02  ? 535 PHE A CZ  1 
ATOM   4119 N N   . LEU A 1 535 ? -0.955  -41.918 5.216   1.00 32.97  ? 536 LEU A N   1 
ATOM   4120 C CA  . LEU A 1 535 ? -2.271  -41.301 5.409   1.00 33.83  ? 536 LEU A CA  1 
ATOM   4121 C C   . LEU A 1 535 ? -2.303  -39.759 5.453   1.00 34.18  ? 536 LEU A C   1 
ATOM   4122 O O   . LEU A 1 535 ? -3.211  -39.159 4.888   1.00 37.39  ? 536 LEU A O   1 
ATOM   4123 C CB  . LEU A 1 535 ? -3.011  -41.909 6.600   1.00 27.61  ? 536 LEU A CB  1 
ATOM   4124 C CG  . LEU A 1 535 ? -4.518  -41.661 6.565   1.00 36.86  ? 536 LEU A CG  1 
ATOM   4125 C CD1 . LEU A 1 535 ? -5.148  -42.390 5.400   1.00 37.05  ? 536 LEU A CD1 1 
ATOM   4126 C CD2 . LEU A 1 535 ? -5.172  -42.084 7.852   1.00 32.33  ? 536 LEU A CD2 1 
ATOM   4127 N N   . PRO A 1 536 ? -1.322  -39.115 6.118   1.00 35.13  ? 537 PRO A N   1 
ATOM   4128 C CA  . PRO A 1 536 ? -1.260  -37.649 6.016   1.00 32.33  ? 537 PRO A CA  1 
ATOM   4129 C C   . PRO A 1 536 ? -1.191  -37.139 4.576   1.00 39.65  ? 537 PRO A C   1 
ATOM   4130 O O   . PRO A 1 536 ? -1.914  -36.198 4.243   1.00 43.30  ? 537 PRO A O   1 
ATOM   4131 C CB  . PRO A 1 536 ? 0.041   -37.306 6.739   1.00 31.23  ? 537 PRO A CB  1 
ATOM   4132 C CG  . PRO A 1 536 ? 0.208   -38.397 7.738   1.00 34.87  ? 537 PRO A CG  1 
ATOM   4133 C CD  . PRO A 1 536 ? -0.346  -39.637 7.094   1.00 33.67  ? 537 PRO A CD  1 
ATOM   4134 N N   . LYS A 1 537 ? -0.335  -37.740 3.747   1.00 43.30  ? 538 LYS A N   1 
ATOM   4135 C CA  . LYS A 1 537 ? -0.200  -37.342 2.338   1.00 38.29  ? 538 LYS A CA  1 
ATOM   4136 C C   . LYS A 1 537 ? -1.543  -37.403 1.631   1.00 38.99  ? 538 LYS A C   1 
ATOM   4137 O O   . LYS A 1 537 ? -1.918  -36.486 0.906   1.00 49.85  ? 538 LYS A O   1 
ATOM   4138 C CB  . LYS A 1 537 ? 0.809   -38.233 1.607   1.00 32.88  ? 538 LYS A CB  1 
ATOM   4139 C CG  . LYS A 1 537 ? 2.240   -38.121 2.139   1.00 37.25  ? 538 LYS A CG  1 
ATOM   4140 C CD  . LYS A 1 537 ? 3.208   -38.962 1.328   1.00 34.07  ? 538 LYS A CD  1 
ATOM   4141 C CE  . LYS A 1 537 ? 4.656   -38.625 1.672   1.00 40.29  ? 538 LYS A CE  1 
ATOM   4142 N NZ  . LYS A 1 537 ? 5.029   -39.050 3.049   1.00 49.96  ? 538 LYS A NZ  1 
ATOM   4143 N N   . LEU A 1 538 ? -2.265  -38.492 1.862   1.00 37.42  ? 539 LEU A N   1 
ATOM   4144 C CA  . LEU A 1 538 ? -3.585  -38.679 1.289   1.00 44.09  ? 539 LEU A CA  1 
ATOM   4145 C C   . LEU A 1 538 ? -4.516  -37.539 1.685   1.00 43.65  ? 539 LEU A C   1 
ATOM   4146 O O   . LEU A 1 538 ? -5.081  -36.868 0.824   1.00 49.22  ? 539 LEU A O   1 
ATOM   4147 C CB  . LEU A 1 538 ? -4.158  -40.030 1.720   1.00 38.01  ? 539 LEU A CB  1 
ATOM   4148 C CG  . LEU A 1 538 ? -5.526  -40.403 1.158   1.00 44.98  ? 539 LEU A CG  1 
ATOM   4149 C CD1 . LEU A 1 538 ? -5.599  -41.889 0.905   1.00 37.82  ? 539 LEU A CD1 1 
ATOM   4150 C CD2 . LEU A 1 538 ? -6.630  -39.979 2.108   1.00 41.41  ? 539 LEU A CD2 1 
ATOM   4151 N N   . LEU A 1 539 ? -4.666  -37.322 2.988   1.00 53.11  ? 540 LEU A N   1 
ATOM   4152 C CA  . LEU A 1 539 ? -5.513  -36.244 3.508   1.00 51.08  ? 540 LEU A CA  1 
ATOM   4153 C C   . LEU A 1 539 ? -5.178  -34.863 2.909   1.00 49.04  ? 540 LEU A C   1 
ATOM   4154 O O   . LEU A 1 539 ? -6.078  -34.068 2.633   1.00 60.01  ? 540 LEU A O   1 
ATOM   4155 C CB  . LEU A 1 539 ? -5.464  -36.203 5.042   1.00 42.63  ? 540 LEU A CB  1 
ATOM   4156 C CG  . LEU A 1 539 ? -5.946  -37.451 5.801   1.00 45.41  ? 540 LEU A CG  1 
ATOM   4157 C CD1 . LEU A 1 539 ? -5.959  -37.228 7.302   1.00 32.64  ? 540 LEU A CD1 1 
ATOM   4158 C CD2 . LEU A 1 539 ? -7.317  -37.884 5.342   1.00 42.75  ? 540 LEU A CD2 1 
ATOM   4159 N N   . SER A 1 540 ? -3.893  -34.598 2.682   1.00 46.80  ? 541 SER A N   1 
ATOM   4160 C CA  . SER A 1 540 ? -3.448  -33.332 2.092   1.00 48.24  ? 541 SER A CA  1 
ATOM   4161 C C   . SER A 1 540 ? -3.767  -33.197 0.602   1.00 58.15  ? 541 SER A C   1 
ATOM   4162 O O   . SER A 1 540 ? -3.442  -32.179 -0.008  1.00 60.94  ? 541 SER A O   1 
ATOM   4163 C CB  . SER A 1 540 ? -1.944  -33.145 2.290   1.00 47.04  ? 541 SER A CB  1 
ATOM   4164 O OG  . SER A 1 540 ? -1.594  -33.272 3.655   1.00 58.30  ? 541 SER A OG  1 
ATOM   4165 N N   . ALA A 1 541 ? -4.384  -34.222 0.017   1.00 61.61  ? 542 ALA A N   1 
ATOM   4166 C CA  . ALA A 1 541 ? -4.797  -34.177 -1.385  1.00 61.36  ? 542 ALA A CA  1 
ATOM   4167 C C   . ALA A 1 541 ? -6.292  -34.471 -1.547  1.00 62.64  ? 542 ALA A C   1 
ATOM   4168 O O   . ALA A 1 541 ? -7.111  -34.089 -0.702  1.00 61.06  ? 542 ALA A O   1 
ATOM   4169 C CB  . ALA A 1 541 ? -3.965  -35.142 -2.216  1.00 49.85  ? 542 ALA A CB  1 
ATOM   4170 N N   . GLU B 1 3   ? 4.106   -88.834 -54.655 1.00 49.59  ? 4   GLU B N   1 
ATOM   4171 C CA  . GLU B 1 3   ? 3.408   -88.028 -53.652 1.00 59.92  ? 4   GLU B CA  1 
ATOM   4172 C C   . GLU B 1 3   ? 2.936   -88.875 -52.442 1.00 62.93  ? 4   GLU B C   1 
ATOM   4173 O O   . GLU B 1 3   ? 2.771   -90.092 -52.558 1.00 58.73  ? 4   GLU B O   1 
ATOM   4174 C CB  . GLU B 1 3   ? 2.241   -87.272 -54.309 1.00 53.04  ? 4   GLU B CB  1 
ATOM   4175 C CG  . GLU B 1 3   ? 1.904   -85.920 -53.664 1.00 65.35  ? 4   GLU B CG  1 
ATOM   4176 C CD  . GLU B 1 3   ? 2.622   -84.719 -54.294 1.00 60.96  ? 4   GLU B CD  1 
ATOM   4177 O OE1 . GLU B 1 3   ? 3.797   -84.469 -53.939 1.00 59.21  ? 4   GLU B OE1 1 
ATOM   4178 O OE2 . GLU B 1 3   ? 2.001   -84.008 -55.123 1.00 51.94  ? 4   GLU B OE2 1 
ATOM   4179 N N   . ASP B 1 4   ? 2.752   -88.229 -51.286 1.00 57.33  ? 5   ASP B N   1 
ATOM   4180 C CA  . ASP B 1 4   ? 2.286   -88.892 -50.055 1.00 45.28  ? 5   ASP B CA  1 
ATOM   4181 C C   . ASP B 1 4   ? 0.931   -88.325 -49.625 1.00 45.53  ? 5   ASP B C   1 
ATOM   4182 O O   . ASP B 1 4   ? 0.834   -87.165 -49.225 1.00 44.06  ? 5   ASP B O   1 
ATOM   4183 C CB  . ASP B 1 4   ? 3.310   -88.714 -48.922 1.00 41.08  ? 5   ASP B CB  1 
ATOM   4184 C CG  . ASP B 1 4   ? 2.879   -89.380 -47.597 1.00 53.77  ? 5   ASP B CG  1 
ATOM   4185 O OD1 . ASP B 1 4   ? 1.753   -89.921 -47.499 1.00 54.53  ? 5   ASP B OD1 1 
ATOM   4186 O OD2 . ASP B 1 4   ? 3.683   -89.354 -46.632 1.00 43.15  ? 5   ASP B OD2 1 
ATOM   4187 N N   . ALA B 1 5   ? -0.100  -89.162 -49.678 1.00 48.11  ? 6   ALA B N   1 
ATOM   4188 C CA  . ALA B 1 5   ? -1.481  -88.742 -49.425 1.00 48.31  ? 6   ALA B CA  1 
ATOM   4189 C C   . ALA B 1 5   ? -1.684  -87.987 -48.108 1.00 46.51  ? 6   ALA B C   1 
ATOM   4190 O O   . ALA B 1 5   ? -2.496  -87.059 -48.042 1.00 44.35  ? 6   ALA B O   1 
ATOM   4191 C CB  . ALA B 1 5   ? -2.426  -89.946 -49.500 1.00 38.45  ? 6   ALA B CB  1 
ATOM   4192 N N   . GLU B 1 6   ? -0.946  -88.381 -47.072 1.00 47.41  ? 7   GLU B N   1 
ATOM   4193 C CA  . GLU B 1 6   ? -1.042  -87.724 -45.767 1.00 49.37  ? 7   GLU B CA  1 
ATOM   4194 C C   . GLU B 1 6   ? -0.655  -86.249 -45.838 1.00 45.90  ? 7   GLU B C   1 
ATOM   4195 O O   . GLU B 1 6   ? -1.188  -85.425 -45.095 1.00 37.89  ? 7   GLU B O   1 
ATOM   4196 C CB  . GLU B 1 6   ? -0.169  -88.440 -44.734 1.00 51.32  ? 7   GLU B CB  1 
ATOM   4197 C CG  . GLU B 1 6   ? -0.648  -89.842 -44.386 1.00 57.67  ? 7   GLU B CG  1 
ATOM   4198 C CD  . GLU B 1 6   ? -2.021  -89.844 -43.736 1.00 60.59  ? 7   GLU B CD  1 
ATOM   4199 O OE1 . GLU B 1 6   ? -2.221  -89.084 -42.767 1.00 62.45  ? 7   GLU B OE1 1 
ATOM   4200 O OE2 . GLU B 1 6   ? -2.904  -90.600 -44.194 1.00 70.10  ? 7   GLU B OE2 1 
ATOM   4201 N N   . LEU B 1 7   ? 0.257   -85.921 -46.752 1.00 36.65  ? 8   LEU B N   1 
ATOM   4202 C CA  . LEU B 1 7   ? 0.784   -84.568 -46.848 1.00 35.13  ? 8   LEU B CA  1 
ATOM   4203 C C   . LEU B 1 7   ? 0.033   -83.698 -47.840 1.00 32.23  ? 8   LEU B C   1 
ATOM   4204 O O   . LEU B 1 7   ? 0.501   -82.618 -48.193 1.00 33.75  ? 8   LEU B O   1 
ATOM   4205 C CB  . LEU B 1 7   ? 2.267   -84.599 -47.203 1.00 33.94  ? 8   LEU B CB  1 
ATOM   4206 C CG  . LEU B 1 7   ? 3.074   -85.460 -46.236 1.00 40.29  ? 8   LEU B CG  1 
ATOM   4207 C CD1 . LEU B 1 7   ? 4.516   -85.517 -46.689 1.00 25.82  ? 8   LEU B CD1 1 
ATOM   4208 C CD2 . LEU B 1 7   ? 2.947   -84.932 -44.791 1.00 35.41  ? 8   LEU B CD2 1 
ATOM   4209 N N   . LEU B 1 8   ? -1.131  -84.161 -48.282 1.00 30.64  ? 9   LEU B N   1 
ATOM   4210 C CA  . LEU B 1 8   ? -1.937  -83.389 -49.212 1.00 30.17  ? 9   LEU B CA  1 
ATOM   4211 C C   . LEU B 1 8   ? -3.293  -83.068 -48.618 1.00 31.10  ? 9   LEU B C   1 
ATOM   4212 O O   . LEU B 1 8   ? -4.002  -83.952 -48.137 1.00 35.77  ? 9   LEU B O   1 
ATOM   4213 C CB  . LEU B 1 8   ? -2.116  -84.144 -50.528 1.00 34.03  ? 9   LEU B CB  1 
ATOM   4214 C CG  . LEU B 1 8   ? -0.861  -84.354 -51.367 1.00 39.59  ? 9   LEU B CG  1 
ATOM   4215 C CD1 . LEU B 1 8   ? -1.239  -85.059 -52.665 1.00 39.29  ? 9   LEU B CD1 1 
ATOM   4216 C CD2 . LEU B 1 8   ? -0.191  -83.026 -51.654 1.00 33.27  ? 9   LEU B CD2 1 
ATOM   4217 N N   . VAL B 1 9   ? -3.652  -81.793 -48.649 1.00 28.63  ? 10  VAL B N   1 
ATOM   4218 C CA  . VAL B 1 9   ? -4.901  -81.351 -48.064 1.00 33.14  ? 10  VAL B CA  1 
ATOM   4219 C C   . VAL B 1 9   ? -5.501  -80.295 -48.961 1.00 27.71  ? 10  VAL B C   1 
ATOM   4220 O O   . VAL B 1 9   ? -4.788  -79.460 -49.510 1.00 30.60  ? 10  VAL B O   1 
ATOM   4221 C CB  . VAL B 1 9   ? -4.693  -80.759 -46.634 1.00 32.32  ? 10  VAL B CB  1 
ATOM   4222 C CG1 . VAL B 1 9   ? -5.971  -80.110 -46.110 1.00 34.11  ? 10  VAL B CG1 1 
ATOM   4223 C CG2 . VAL B 1 9   ? -4.244  -81.835 -45.671 1.00 37.60  ? 10  VAL B CG2 1 
ATOM   4224 N N   . THR B 1 10  ? -6.817  -80.344 -49.118 1.00 30.73  ? 11  THR B N   1 
ATOM   4225 C CA  . THR B 1 10  ? -7.533  -79.290 -49.813 1.00 35.04  ? 11  THR B CA  1 
ATOM   4226 C C   . THR B 1 10  ? -8.291  -78.427 -48.811 1.00 34.36  ? 11  THR B C   1 
ATOM   4227 O O   . THR B 1 10  ? -9.127  -78.921 -48.056 1.00 37.13  ? 11  THR B O   1 
ATOM   4228 C CB  . THR B 1 10  ? -8.502  -79.871 -50.870 1.00 36.25  ? 11  THR B CB  1 
ATOM   4229 O OG1 . THR B 1 10  ? -7.745  -80.574 -51.864 1.00 39.97  ? 11  THR B OG1 1 
ATOM   4230 C CG2 . THR B 1 10  ? -9.286  -78.770 -51.543 1.00 26.84  ? 11  THR B CG2 1 
ATOM   4231 N N   . VAL B 1 11  ? -7.977  -77.139 -48.793 1.00 35.86  ? 12  VAL B N   1 
ATOM   4232 C CA  . VAL B 1 11  ? -8.731  -76.181 -47.994 1.00 38.18  ? 12  VAL B CA  1 
ATOM   4233 C C   . VAL B 1 11  ? -9.505  -75.292 -48.952 1.00 37.22  ? 12  VAL B C   1 
ATOM   4234 O O   . VAL B 1 11  ? -9.287  -75.359 -50.161 1.00 43.12  ? 12  VAL B O   1 
ATOM   4235 C CB  . VAL B 1 11  ? -7.809  -75.318 -47.126 1.00 36.86  ? 12  VAL B CB  1 
ATOM   4236 C CG1 . VAL B 1 11  ? -7.054  -76.191 -46.125 1.00 28.04  ? 12  VAL B CG1 1 
ATOM   4237 C CG2 . VAL B 1 11  ? -6.852  -74.537 -48.005 1.00 32.20  ? 12  VAL B CG2 1 
ATOM   4238 N N   . ARG B 1 12  ? -10.395 -74.456 -48.426 1.00 38.97  ? 13  ARG B N   1 
ATOM   4239 C CA  . ARG B 1 12  ? -11.298 -73.680 -49.282 1.00 38.80  ? 13  ARG B CA  1 
ATOM   4240 C C   . ARG B 1 12  ? -10.614 -72.836 -50.362 1.00 37.43  ? 13  ARG B C   1 
ATOM   4241 O O   . ARG B 1 12  ? -11.212 -72.556 -51.394 1.00 40.55  ? 13  ARG B O   1 
ATOM   4242 C CB  . ARG B 1 12  ? -12.239 -72.812 -48.445 1.00 35.63  ? 13  ARG B CB  1 
ATOM   4243 C CG  . ARG B 1 12  ? -13.254 -73.619 -47.650 1.00 49.94  ? 13  ARG B CG  1 
ATOM   4244 C CD  . ARG B 1 12  ? -14.387 -72.748 -47.124 1.00 63.07  ? 13  ARG B CD  1 
ATOM   4245 N NE  . ARG B 1 12  ? -15.135 -73.434 -46.073 1.00 68.06  ? 13  ARG B NE  1 
ATOM   4246 C CZ  . ARG B 1 12  ? -16.199 -72.932 -45.453 1.00 70.21  ? 13  ARG B CZ  1 
ATOM   4247 N NH1 . ARG B 1 12  ? -16.657 -71.730 -45.781 1.00 70.83  ? 13  ARG B NH1 1 
ATOM   4248 N NH2 . ARG B 1 12  ? -16.808 -73.636 -44.505 1.00 68.16  ? 13  ARG B NH2 1 
ATOM   4249 N N   . GLY B 1 13  ? -9.367  -72.438 -50.130 1.00 35.42  ? 14  GLY B N   1 
ATOM   4250 C CA  . GLY B 1 13  ? -8.658  -71.592 -51.073 1.00 36.70  ? 14  GLY B CA  1 
ATOM   4251 C C   . GLY B 1 13  ? -7.901  -72.332 -52.174 1.00 36.87  ? 14  GLY B C   1 
ATOM   4252 O O   . GLY B 1 13  ? -7.464  -71.723 -53.153 1.00 31.36  ? 14  GLY B O   1 
ATOM   4253 N N   . GLY B 1 14  ? -7.734  -73.641 -52.017 1.00 32.09  ? 15  GLY B N   1 
ATOM   4254 C CA  . GLY B 1 14  ? -6.913  -74.406 -52.937 1.00 30.39  ? 15  GLY B CA  1 
ATOM   4255 C C   . GLY B 1 14  ? -6.165  -75.534 -52.260 1.00 31.78  ? 15  GLY B C   1 
ATOM   4256 O O   . GLY B 1 14  ? -6.368  -75.804 -51.078 1.00 35.72  ? 15  GLY B O   1 
ATOM   4257 N N   . ARG B 1 15  ? -5.288  -76.190 -53.012 1.00 31.97  ? 16  ARG B N   1 
ATOM   4258 C CA  . ARG B 1 15  ? -4.554  -77.353 -52.522 1.00 31.08  ? 16  ARG B CA  1 
ATOM   4259 C C   . ARG B 1 15  ? -3.255  -76.991 -51.805 1.00 32.74  ? 16  ARG B C   1 
ATOM   4260 O O   . ARG B 1 15  ? -2.608  -75.984 -52.118 1.00 31.68  ? 16  ARG B O   1 
ATOM   4261 C CB  . ARG B 1 15  ? -4.257  -78.320 -53.672 1.00 34.18  ? 16  ARG B CB  1 
ATOM   4262 C CG  . ARG B 1 15  ? -5.439  -79.191 -54.092 1.00 40.74  ? 16  ARG B CG  1 
ATOM   4263 C CD  . ARG B 1 15  ? -5.057  -80.116 -55.252 1.00 36.74  ? 16  ARG B CD  1 
ATOM   4264 N NE  . ARG B 1 15  ? -4.971  -79.375 -56.506 1.00 49.70  ? 16  ARG B NE  1 
ATOM   4265 C CZ  . ARG B 1 15  ? -4.132  -79.663 -57.498 1.00 54.50  ? 16  ARG B CZ  1 
ATOM   4266 N NH1 . ARG B 1 15  ? -3.286  -80.684 -57.388 1.00 53.07  ? 16  ARG B NH1 1 
ATOM   4267 N NH2 . ARG B 1 15  ? -4.136  -78.923 -58.603 1.00 40.42  ? 16  ARG B NH2 1 
ATOM   4268 N N   . LEU B 1 16  ? -2.876  -77.845 -50.859 1.00 26.05  ? 17  LEU B N   1 
ATOM   4269 C CA  . LEU B 1 16  ? -1.712  -77.629 -50.016 1.00 27.93  ? 17  LEU B CA  1 
ATOM   4270 C C   . LEU B 1 16  ? -0.901  -78.901 -49.938 1.00 29.03  ? 17  LEU B C   1 
ATOM   4271 O O   . LEU B 1 16  ? -1.451  -80.005 -49.946 1.00 32.40  ? 17  LEU B O   1 
ATOM   4272 C CB  . LEU B 1 16  ? -2.146  -77.264 -48.587 1.00 30.57  ? 17  LEU B CB  1 
ATOM   4273 C CG  . LEU B 1 16  ? -2.848  -75.934 -48.317 1.00 27.80  ? 17  LEU B CG  1 
ATOM   4274 C CD1 . LEU B 1 16  ? -3.326  -75.885 -46.864 1.00 32.30  ? 17  LEU B CD1 1 
ATOM   4275 C CD2 . LEU B 1 16  ? -1.913  -74.773 -48.605 1.00 25.74  ? 17  LEU B CD2 1 
ATOM   4276 N N   . ARG B 1 17  ? 0.410   -78.735 -49.836 1.00 28.57  ? 18  ARG B N   1 
ATOM   4277 C CA  . ARG B 1 17  ? 1.332   -79.849 -49.674 1.00 30.13  ? 18  ARG B CA  1 
ATOM   4278 C C   . ARG B 1 17  ? 2.121   -79.558 -48.412 1.00 29.23  ? 18  ARG B C   1 
ATOM   4279 O O   . ARG B 1 17  ? 2.654   -78.458 -48.254 1.00 22.79  ? 18  ARG B O   1 
ATOM   4280 C CB  . ARG B 1 17  ? 2.290   -79.933 -50.876 1.00 30.55  ? 18  ARG B CB  1 
ATOM   4281 C CG  . ARG B 1 17  ? 3.415   -80.944 -50.712 1.00 27.97  ? 18  ARG B CG  1 
ATOM   4282 C CD  . ARG B 1 17  ? 4.302   -81.022 -51.959 1.00 38.14  ? 18  ARG B CD  1 
ATOM   4283 N NE  . ARG B 1 17  ? 3.558   -81.418 -53.154 1.00 37.33  ? 18  ARG B NE  1 
ATOM   4284 C CZ  . ARG B 1 17  ? 3.315   -80.629 -54.204 1.00 43.31  ? 18  ARG B CZ  1 
ATOM   4285 N NH1 . ARG B 1 17  ? 3.771   -79.377 -54.243 1.00 37.07  ? 18  ARG B NH1 1 
ATOM   4286 N NH2 . ARG B 1 17  ? 2.617   -81.102 -55.233 1.00 40.42  ? 18  ARG B NH2 1 
ATOM   4287 N N   . GLY B 1 18  ? 2.192   -80.531 -47.510 1.00 31.16  ? 19  GLY B N   1 
ATOM   4288 C CA  . GLY B 1 18  ? 2.891   -80.330 -46.256 1.00 24.68  ? 19  GLY B CA  1 
ATOM   4289 C C   . GLY B 1 18  ? 4.161   -81.138 -46.162 1.00 31.74  ? 19  GLY B C   1 
ATOM   4290 O O   . GLY B 1 18  ? 4.732   -81.548 -47.173 1.00 36.64  ? 19  GLY B O   1 
ATOM   4291 N N   . ILE B 1 19  ? 4.597   -81.379 -44.934 1.00 31.46  ? 20  ILE B N   1 
ATOM   4292 C CA  . ILE B 1 19  ? 5.858   -82.048 -44.694 1.00 32.36  ? 20  ILE B CA  1 
ATOM   4293 C C   . ILE B 1 19  ? 5.720   -83.009 -43.505 1.00 39.53  ? 20  ILE B C   1 
ATOM   4294 O O   . ILE B 1 19  ? 4.958   -82.754 -42.561 1.00 32.84  ? 20  ILE B O   1 
ATOM   4295 C CB  . ILE B 1 19  ? 6.989   -81.003 -44.477 1.00 38.12  ? 20  ILE B CB  1 
ATOM   4296 C CG1 . ILE B 1 19  ? 8.361   -81.619 -44.735 1.00 43.63  ? 20  ILE B CG1 1 
ATOM   4297 C CG2 . ILE B 1 19  ? 6.923   -80.371 -43.072 1.00 38.83  ? 20  ILE B CG2 1 
ATOM   4298 C CD1 . ILE B 1 19  ? 9.501   -80.631 -44.575 1.00 45.12  ? 20  ILE B CD1 1 
ATOM   4299 N N   . ARG B 1 20  ? 6.427   -84.133 -43.571 1.00 38.46  ? 21  ARG B N   1 
ATOM   4300 C CA  . ARG B 1 20  ? 6.428   -85.108 -42.485 1.00 35.52  ? 21  ARG B CA  1 
ATOM   4301 C C   . ARG B 1 20  ? 7.559   -84.799 -41.505 1.00 41.83  ? 21  ARG B C   1 
ATOM   4302 O O   . ARG B 1 20  ? 8.736   -84.789 -41.880 1.00 36.15  ? 21  ARG B O   1 
ATOM   4303 C CB  . ARG B 1 20  ? 6.577   -86.525 -43.042 1.00 42.09  ? 21  ARG B CB  1 
ATOM   4304 C CG  . ARG B 1 20  ? 6.657   -87.646 -42.005 1.00 48.29  ? 21  ARG B CG  1 
ATOM   4305 C CD  . ARG B 1 20  ? 6.953   -88.984 -42.710 1.00 56.69  ? 21  ARG B CD  1 
ATOM   4306 N NE  . ARG B 1 20  ? 6.694   -90.165 -41.881 1.00 59.92  ? 21  ARG B NE  1 
ATOM   4307 C CZ  . ARG B 1 20  ? 7.624   -90.812 -41.180 1.00 63.49  ? 21  ARG B CZ  1 
ATOM   4308 N NH1 . ARG B 1 20  ? 8.884   -90.393 -41.201 1.00 67.69  ? 21  ARG B NH1 1 
ATOM   4309 N NH2 . ARG B 1 20  ? 7.296   -91.876 -40.455 1.00 59.43  ? 21  ARG B NH2 1 
ATOM   4310 N N   . LEU B 1 21  ? 7.196   -84.533 -40.253 1.00 36.13  ? 22  LEU B N   1 
ATOM   4311 C CA  . LEU B 1 21  ? 8.181   -84.235 -39.222 1.00 40.05  ? 22  LEU B CA  1 
ATOM   4312 C C   . LEU B 1 21  ? 8.445   -85.437 -38.339 1.00 38.01  ? 22  LEU B C   1 
ATOM   4313 O O   . LEU B 1 21  ? 7.521   -86.170 -37.983 1.00 41.41  ? 22  LEU B O   1 
ATOM   4314 C CB  . LEU B 1 21  ? 7.697   -83.096 -38.336 1.00 39.86  ? 22  LEU B CB  1 
ATOM   4315 C CG  . LEU B 1 21  ? 7.542   -81.728 -38.982 1.00 41.14  ? 22  LEU B CG  1 
ATOM   4316 C CD1 . LEU B 1 21  ? 7.215   -80.737 -37.887 1.00 40.37  ? 22  LEU B CD1 1 
ATOM   4317 C CD2 . LEU B 1 21  ? 8.818   -81.348 -39.704 1.00 30.51  ? 22  LEU B CD2 1 
ATOM   4318 N N   . LYS B 1 22  ? 9.709   -85.626 -37.977 1.00 40.99  ? 23  LYS B N   1 
ATOM   4319 C CA  . LYS B 1 22  ? 10.082  -86.619 -36.975 1.00 47.20  ? 23  LYS B CA  1 
ATOM   4320 C C   . LYS B 1 22  ? 9.927   -86.052 -35.571 1.00 46.84  ? 23  LYS B C   1 
ATOM   4321 O O   . LYS B 1 22  ? 10.214  -84.883 -35.327 1.00 46.67  ? 23  LYS B O   1 
ATOM   4322 C CB  . LYS B 1 22  ? 11.526  -87.076 -37.176 1.00 39.01  ? 23  LYS B CB  1 
ATOM   4323 C CG  . LYS B 1 22  ? 11.751  -87.771 -38.496 1.00 49.11  ? 23  LYS B CG  1 
ATOM   4324 C CD  . LYS B 1 22  ? 13.202  -88.157 -38.696 1.00 56.61  ? 23  LYS B CD  1 
ATOM   4325 C CE  . LYS B 1 22  ? 13.365  -88.905 -40.007 1.00 60.57  ? 23  LYS B CE  1 
ATOM   4326 N NZ  . LYS B 1 22  ? 14.791  -89.147 -40.312 1.00 61.40  ? 23  LYS B NZ  1 
ATOM   4327 N N   . THR B 1 23  ? 9.444   -86.880 -34.656 1.00 44.47  ? 24  THR B N   1 
ATOM   4328 C CA  . THR B 1 23  ? 9.479   -86.552 -33.238 1.00 55.59  ? 24  THR B CA  1 
ATOM   4329 C C   . THR B 1 23  ? 9.865   -87.815 -32.482 1.00 51.22  ? 24  THR B C   1 
ATOM   4330 O O   . THR B 1 23  ? 9.563   -88.919 -32.928 1.00 54.88  ? 24  THR B O   1 
ATOM   4331 C CB  . THR B 1 23  ? 8.111   -86.081 -32.702 1.00 50.90  ? 24  THR B CB  1 
ATOM   4332 O OG1 . THR B 1 23  ? 7.375   -87.217 -32.234 1.00 50.84  ? 24  THR B OG1 1 
ATOM   4333 C CG2 . THR B 1 23  ? 7.304   -85.333 -33.778 1.00 46.45  ? 24  THR B CG2 1 
ATOM   4334 N N   . PRO B 1 24  ? 10.538  -87.655 -31.337 1.00 57.47  ? 25  PRO B N   1 
ATOM   4335 C CA  . PRO B 1 24  ? 10.870  -88.762 -30.432 1.00 58.84  ? 25  PRO B CA  1 
ATOM   4336 C C   . PRO B 1 24  ? 9.773   -89.822 -30.288 1.00 57.37  ? 25  PRO B C   1 
ATOM   4337 O O   . PRO B 1 24  ? 10.104  -90.997 -30.162 1.00 60.89  ? 25  PRO B O   1 
ATOM   4338 C CB  . PRO B 1 24  ? 11.102  -88.044 -29.109 1.00 54.24  ? 25  PRO B CB  1 
ATOM   4339 C CG  . PRO B 1 24  ? 11.749  -86.757 -29.537 1.00 58.10  ? 25  PRO B CG  1 
ATOM   4340 C CD  . PRO B 1 24  ? 11.126  -86.386 -30.871 1.00 57.50  ? 25  PRO B CD  1 
ATOM   4341 N N   . GLY B 1 25  ? 8.503   -89.434 -30.334 1.00 51.01  ? 26  GLY B N   1 
ATOM   4342 C CA  . GLY B 1 25  ? 7.437   -90.410 -30.196 1.00 50.39  ? 26  GLY B CA  1 
ATOM   4343 C C   . GLY B 1 25  ? 6.724   -90.840 -31.475 1.00 58.41  ? 26  GLY B C   1 
ATOM   4344 O O   . GLY B 1 25  ? 5.660   -91.456 -31.406 1.00 66.46  ? 26  GLY B O   1 
ATOM   4345 N N   . GLY B 1 26  ? 7.284   -90.533 -32.642 1.00 46.23  ? 27  GLY B N   1 
ATOM   4346 C CA  . GLY B 1 26  ? 6.625   -90.886 -33.892 1.00 46.40  ? 27  GLY B CA  1 
ATOM   4347 C C   . GLY B 1 26  ? 6.330   -89.700 -34.796 1.00 48.55  ? 27  GLY B C   1 
ATOM   4348 O O   . GLY B 1 26  ? 6.469   -88.553 -34.375 1.00 50.80  ? 27  GLY B O   1 
ATOM   4349 N N   . PRO B 1 27  ? 5.909   -89.970 -36.047 1.00 50.07  ? 28  PRO B N   1 
ATOM   4350 C CA  . PRO B 1 27  ? 5.740   -88.937 -37.076 1.00 47.67  ? 28  PRO B CA  1 
ATOM   4351 C C   . PRO B 1 27  ? 4.558   -87.989 -36.851 1.00 44.60  ? 28  PRO B C   1 
ATOM   4352 O O   . PRO B 1 27  ? 3.523   -88.378 -36.304 1.00 39.70  ? 28  PRO B O   1 
ATOM   4353 C CB  . PRO B 1 27  ? 5.505   -89.759 -38.352 1.00 46.70  ? 28  PRO B CB  1 
ATOM   4354 C CG  . PRO B 1 27  ? 4.870   -91.009 -37.864 1.00 41.98  ? 28  PRO B CG  1 
ATOM   4355 C CD  . PRO B 1 27  ? 5.553   -91.307 -36.559 1.00 45.15  ? 28  PRO B CD  1 
ATOM   4356 N N   . VAL B 1 28  ? 4.726   -86.748 -37.303 1.00 38.10  ? 29  VAL B N   1 
ATOM   4357 C CA  . VAL B 1 28  ? 3.667   -85.751 -37.282 1.00 31.38  ? 29  VAL B CA  1 
ATOM   4358 C C   . VAL B 1 28  ? 3.615   -85.089 -38.656 1.00 32.50  ? 29  VAL B C   1 
ATOM   4359 O O   . VAL B 1 28  ? 4.649   -84.909 -39.293 1.00 37.80  ? 29  VAL B O   1 
ATOM   4360 C CB  . VAL B 1 28  ? 3.939   -84.680 -36.196 1.00 31.16  ? 29  VAL B CB  1 
ATOM   4361 C CG1 . VAL B 1 28  ? 2.990   -83.518 -36.339 1.00 31.06  ? 29  VAL B CG1 1 
ATOM   4362 C CG2 . VAL B 1 28  ? 3.832   -85.289 -34.789 1.00 32.96  ? 29  VAL B CG2 1 
ATOM   4363 N N   . SER B 1 29  ? 2.419   -84.752 -39.129 1.00 29.27  ? 30  SER B N   1 
ATOM   4364 C CA  . SER B 1 29  ? 2.281   -83.983 -40.358 1.00 32.51  ? 30  SER B CA  1 
ATOM   4365 C C   . SER B 1 29  ? 2.251   -82.502 -40.018 1.00 36.87  ? 30  SER B C   1 
ATOM   4366 O O   . SER B 1 29  ? 1.554   -82.080 -39.094 1.00 35.53  ? 30  SER B O   1 
ATOM   4367 C CB  . SER B 1 29  ? 1.000   -84.354 -41.107 1.00 33.14  ? 30  SER B CB  1 
ATOM   4368 O OG  . SER B 1 29  ? 0.973   -85.728 -41.452 1.00 41.19  ? 30  SER B OG  1 
ATOM   4369 N N   . ALA B 1 30  ? 3.008   -81.712 -40.765 1.00 32.21  ? 31  ALA B N   1 
ATOM   4370 C CA  . ALA B 1 30  ? 3.015   -80.278 -40.554 1.00 28.31  ? 31  ALA B CA  1 
ATOM   4371 C C   . ALA B 1 30  ? 2.742   -79.528 -41.853 1.00 30.45  ? 31  ALA B C   1 
ATOM   4372 O O   . ALA B 1 30  ? 3.280   -79.847 -42.913 1.00 32.04  ? 31  ALA B O   1 
ATOM   4373 C CB  . ALA B 1 30  ? 4.329   -79.831 -39.931 1.00 22.06  ? 31  ALA B CB  1 
ATOM   4374 N N   . PHE B 1 31  ? 1.878   -78.534 -41.753 1.00 28.48  ? 32  PHE B N   1 
ATOM   4375 C CA  . PHE B 1 31  ? 1.576   -77.656 -42.858 1.00 25.30  ? 32  PHE B CA  1 
ATOM   4376 C C   . PHE B 1 31  ? 1.949   -76.255 -42.381 1.00 29.70  ? 32  PHE B C   1 
ATOM   4377 O O   . PHE B 1 31  ? 1.200   -75.614 -41.633 1.00 26.59  ? 32  PHE B O   1 
ATOM   4378 C CB  . PHE B 1 31  ? 0.098   -77.789 -43.240 1.00 25.28  ? 32  PHE B CB  1 
ATOM   4379 C CG  . PHE B 1 31  ? -0.271  -79.178 -43.699 1.00 33.14  ? 32  PHE B CG  1 
ATOM   4380 C CD1 . PHE B 1 31  ? -0.559  -80.181 -42.777 1.00 30.32  ? 32  PHE B CD1 1 
ATOM   4381 C CD2 . PHE B 1 31  ? -0.297  -79.493 -45.056 1.00 30.68  ? 32  PHE B CD2 1 
ATOM   4382 C CE1 . PHE B 1 31  ? -0.876  -81.467 -43.201 1.00 29.98  ? 32  PHE B CE1 1 
ATOM   4383 C CE2 . PHE B 1 31  ? -0.615  -80.774 -45.488 1.00 30.90  ? 32  PHE B CE2 1 
ATOM   4384 C CZ  . PHE B 1 31  ? -0.907  -81.763 -44.560 1.00 33.78  ? 32  PHE B CZ  1 
ATOM   4385 N N   . LEU B 1 32  ? 3.140   -75.817 -42.783 1.00 24.62  ? 33  LEU B N   1 
ATOM   4386 C CA  . LEU B 1 32  ? 3.742   -74.587 -42.281 1.00 27.17  ? 33  LEU B CA  1 
ATOM   4387 C C   . LEU B 1 32  ? 3.744   -73.502 -43.337 1.00 26.78  ? 33  LEU B C   1 
ATOM   4388 O O   . LEU B 1 32  ? 4.164   -73.734 -44.461 1.00 29.16  ? 33  LEU B O   1 
ATOM   4389 C CB  . LEU B 1 32  ? 5.184   -74.858 -41.885 1.00 23.88  ? 33  LEU B CB  1 
ATOM   4390 C CG  . LEU B 1 32  ? 5.433   -75.992 -40.897 1.00 26.30  ? 33  LEU B CG  1 
ATOM   4391 C CD1 . LEU B 1 32  ? 6.908   -76.027 -40.536 1.00 23.33  ? 33  LEU B CD1 1 
ATOM   4392 C CD2 . LEU B 1 32  ? 4.573   -75.827 -39.651 1.00 23.81  ? 33  LEU B CD2 1 
ATOM   4393 N N   . GLY B 1 33  ? 3.299   -72.308 -42.975 1.00 25.19  ? 34  GLY B N   1 
ATOM   4394 C CA  . GLY B 1 33  ? 3.282   -71.203 -43.910 1.00 25.12  ? 34  GLY B CA  1 
ATOM   4395 C C   . GLY B 1 33  ? 2.109   -71.246 -44.875 1.00 27.94  ? 34  GLY B C   1 
ATOM   4396 O O   . GLY B 1 33  ? 2.284   -71.060 -46.086 1.00 26.43  ? 34  GLY B O   1 
ATOM   4397 N N   . ILE B 1 34  ? 0.915   -71.485 -44.337 1.00 22.84  ? 35  ILE B N   1 
ATOM   4398 C CA  . ILE B 1 34  ? -0.324  -71.400 -45.107 1.00 22.34  ? 35  ILE B CA  1 
ATOM   4399 C C   . ILE B 1 34  ? -0.851  -69.969 -45.130 1.00 25.06  ? 35  ILE B C   1 
ATOM   4400 O O   . ILE B 1 34  ? -1.091  -69.387 -44.081 1.00 28.47  ? 35  ILE B O   1 
ATOM   4401 C CB  . ILE B 1 34  ? -1.417  -72.282 -44.492 1.00 25.62  ? 35  ILE B CB  1 
ATOM   4402 C CG1 . ILE B 1 34  ? -0.897  -73.708 -44.291 1.00 23.10  ? 35  ILE B CG1 1 
ATOM   4403 C CG2 . ILE B 1 34  ? -2.689  -72.240 -45.350 1.00 20.71  ? 35  ILE B CG2 1 
ATOM   4404 C CD1 . ILE B 1 34  ? -1.820  -74.593 -43.467 1.00 22.14  ? 35  ILE B CD1 1 
ATOM   4405 N N   . PRO B 1 35  ? -1.034  -69.394 -46.332 1.00 29.50  ? 36  PRO B N   1 
ATOM   4406 C CA  . PRO B 1 35  ? -1.531  -68.013 -46.410 1.00 24.98  ? 36  PRO B CA  1 
ATOM   4407 C C   . PRO B 1 35  ? -2.992  -67.921 -45.981 1.00 27.98  ? 36  PRO B C   1 
ATOM   4408 O O   . PRO B 1 35  ? -3.821  -68.697 -46.460 1.00 27.36  ? 36  PRO B O   1 
ATOM   4409 C CB  . PRO B 1 35  ? -1.377  -67.663 -47.900 1.00 31.94  ? 36  PRO B CB  1 
ATOM   4410 C CG  . PRO B 1 35  ? -1.372  -68.988 -48.617 1.00 26.45  ? 36  PRO B CG  1 
ATOM   4411 C CD  . PRO B 1 35  ? -0.722  -69.960 -47.659 1.00 24.60  ? 36  PRO B CD  1 
ATOM   4412 N N   . PHE B 1 36  ? -3.316  -66.999 -45.077 1.00 27.67  ? 37  PHE B N   1 
ATOM   4413 C CA  . PHE B 1 36  ? -4.711  -66.884 -44.641 1.00 28.70  ? 37  PHE B CA  1 
ATOM   4414 C C   . PHE B 1 36  ? -5.286  -65.516 -44.960 1.00 24.37  ? 37  PHE B C   1 
ATOM   4415 O O   . PHE B 1 36  ? -6.491  -65.295 -44.874 1.00 32.94  ? 37  PHE B O   1 
ATOM   4416 C CB  . PHE B 1 36  ? -4.900  -67.285 -43.157 1.00 22.69  ? 37  PHE B CB  1 
ATOM   4417 C CG  . PHE B 1 36  ? -4.302  -66.320 -42.167 1.00 22.02  ? 37  PHE B CG  1 
ATOM   4418 C CD1 . PHE B 1 36  ? -5.014  -65.195 -41.749 1.00 24.18  ? 37  PHE B CD1 1 
ATOM   4419 C CD2 . PHE B 1 36  ? -3.053  -66.556 -41.624 1.00 24.49  ? 37  PHE B CD2 1 
ATOM   4420 C CE1 . PHE B 1 36  ? -4.474  -64.302 -40.824 1.00 24.89  ? 37  PHE B CE1 1 
ATOM   4421 C CE2 . PHE B 1 36  ? -2.494  -65.679 -40.695 1.00 27.34  ? 37  PHE B CE2 1 
ATOM   4422 C CZ  . PHE B 1 36  ? -3.208  -64.548 -40.286 1.00 30.07  ? 37  PHE B CZ  1 
ATOM   4423 N N   . ALA B 1 37  ? -4.410  -64.609 -45.359 1.00 27.27  ? 38  ALA B N   1 
ATOM   4424 C CA  . ALA B 1 37  ? -4.812  -63.282 -45.780 1.00 27.20  ? 38  ALA B CA  1 
ATOM   4425 C C   . ALA B 1 37  ? -3.984  -62.851 -46.993 1.00 31.87  ? 38  ALA B C   1 
ATOM   4426 O O   . ALA B 1 37  ? -2.883  -63.362 -47.214 1.00 28.05  ? 38  ALA B O   1 
ATOM   4427 C CB  . ALA B 1 37  ? -4.619  -62.302 -44.639 1.00 21.26  ? 38  ALA B CB  1 
ATOM   4428 N N   . GLU B 1 38  ? -4.518  -61.921 -47.780 1.00 25.36  ? 39  GLU B N   1 
ATOM   4429 C CA  . GLU B 1 38  ? -3.715  -61.227 -48.773 1.00 31.96  ? 39  GLU B CA  1 
ATOM   4430 C C   . GLU B 1 38  ? -2.650  -60.437 -48.024 1.00 30.21  ? 39  GLU B C   1 
ATOM   4431 O O   . GLU B 1 38  ? -2.907  -59.930 -46.931 1.00 34.59  ? 39  GLU B O   1 
ATOM   4432 C CB  . GLU B 1 38  ? -4.586  -60.287 -49.617 1.00 33.01  ? 39  GLU B CB  1 
ATOM   4433 C CG  . GLU B 1 38  ? -5.638  -61.004 -50.456 1.00 35.66  ? 39  GLU B CG  1 
ATOM   4434 C CD  . GLU B 1 38  ? -5.034  -61.866 -51.557 1.00 36.25  ? 39  GLU B CD  1 
ATOM   4435 O OE1 . GLU B 1 38  ? -4.157  -61.362 -52.288 1.00 40.88  ? 39  GLU B OE1 1 
ATOM   4436 O OE2 . GLU B 1 38  ? -5.432  -63.044 -51.694 1.00 37.20  ? 39  GLU B OE2 1 
ATOM   4437 N N   . PRO B 1 39  ? -1.441  -60.347 -48.591 1.00 30.73  ? 40  PRO B N   1 
ATOM   4438 C CA  . PRO B 1 39  ? -0.358  -59.626 -47.908 1.00 27.60  ? 40  PRO B CA  1 
ATOM   4439 C C   . PRO B 1 39  ? -0.684  -58.143 -47.697 1.00 32.81  ? 40  PRO B C   1 
ATOM   4440 O O   . PRO B 1 39  ? -1.015  -57.452 -48.649 1.00 35.42  ? 40  PRO B O   1 
ATOM   4441 C CB  . PRO B 1 39  ? 0.831   -59.799 -48.860 1.00 25.36  ? 40  PRO B CB  1 
ATOM   4442 C CG  . PRO B 1 39  ? 0.515   -61.068 -49.629 1.00 30.18  ? 40  PRO B CG  1 
ATOM   4443 C CD  . PRO B 1 39  ? -0.976  -61.037 -49.810 1.00 29.82  ? 40  PRO B CD  1 
ATOM   4444 N N   . PRO B 1 40  ? -0.597  -57.658 -46.449 1.00 36.72  ? 41  PRO B N   1 
ATOM   4445 C CA  . PRO B 1 40  ? -0.921  -56.262 -46.121 1.00 33.63  ? 41  PRO B CA  1 
ATOM   4446 C C   . PRO B 1 40  ? 0.149   -55.293 -46.605 1.00 37.44  ? 41  PRO B C   1 
ATOM   4447 O O   . PRO B 1 40  ? 0.653   -54.500 -45.806 1.00 39.40  ? 41  PRO B O   1 
ATOM   4448 C CB  . PRO B 1 40  ? -0.937  -56.250 -44.588 1.00 35.88  ? 41  PRO B CB  1 
ATOM   4449 C CG  . PRO B 1 40  ? -0.866  -57.660 -44.158 1.00 32.70  ? 41  PRO B CG  1 
ATOM   4450 C CD  . PRO B 1 40  ? -0.213  -58.427 -45.258 1.00 32.50  ? 41  PRO B CD  1 
ATOM   4451 N N   . MET B 1 41  ? 0.478   -55.360 -47.891 1.00 38.44  ? 42  MET B N   1 
ATOM   4452 C CA  . MET B 1 41  ? 1.564   -54.582 -48.477 1.00 42.47  ? 42  MET B CA  1 
ATOM   4453 C C   . MET B 1 41  ? 1.076   -53.218 -48.928 1.00 38.16  ? 42  MET B C   1 
ATOM   4454 O O   . MET B 1 41  ? -0.105  -53.054 -49.231 1.00 35.64  ? 42  MET B O   1 
ATOM   4455 C CB  . MET B 1 41  ? 2.113   -55.301 -49.719 1.00 43.84  ? 42  MET B CB  1 
ATOM   4456 C CG  . MET B 1 41  ? 2.596   -56.705 -49.481 1.00 40.64  ? 42  MET B CG  1 
ATOM   4457 S SD  . MET B 1 41  ? 3.965   -56.715 -48.325 1.00 52.14  ? 42  MET B SD  1 
ATOM   4458 C CE  . MET B 1 41  ? 5.102   -55.570 -49.107 1.00 49.17  ? 42  MET B CE  1 
ATOM   4459 N N   . GLY B 1 42  ? 2.001   -52.262 -48.994 1.00 32.99  ? 43  GLY B N   1 
ATOM   4460 C CA  . GLY B 1 42  ? 1.763   -50.972 -49.620 1.00 33.10  ? 43  GLY B CA  1 
ATOM   4461 C C   . GLY B 1 42  ? 0.527   -50.239 -49.142 1.00 40.68  ? 43  GLY B C   1 
ATOM   4462 O O   . GLY B 1 42  ? 0.481   -49.768 -47.996 1.00 34.87  ? 43  GLY B O   1 
ATOM   4463 N N   . PRO B 1 43  ? -0.482  -50.135 -50.026 1.00 38.55  ? 44  PRO B N   1 
ATOM   4464 C CA  . PRO B 1 43  ? -1.775  -49.505 -49.737 1.00 33.24  ? 44  PRO B CA  1 
ATOM   4465 C C   . PRO B 1 43  ? -2.537  -50.217 -48.628 1.00 34.95  ? 44  PRO B C   1 
ATOM   4466 O O   . PRO B 1 43  ? -3.406  -49.606 -48.009 1.00 39.16  ? 44  PRO B O   1 
ATOM   4467 C CB  . PRO B 1 43  ? -2.540  -49.630 -51.075 1.00 32.32  ? 44  PRO B CB  1 
ATOM   4468 C CG  . PRO B 1 43  ? -1.850  -50.715 -51.823 1.00 31.19  ? 44  PRO B CG  1 
ATOM   4469 C CD  . PRO B 1 43  ? -0.403  -50.604 -51.423 1.00 34.71  ? 44  PRO B CD  1 
ATOM   4470 N N   . ARG B 1 44  ? -2.219  -51.487 -48.385 1.00 38.53  ? 45  ARG B N   1 
ATOM   4471 C CA  . ARG B 1 44  ? -2.911  -52.266 -47.362 1.00 37.42  ? 45  ARG B CA  1 
ATOM   4472 C C   . ARG B 1 44  ? -2.285  -52.189 -45.962 1.00 35.88  ? 45  ARG B C   1 
ATOM   4473 O O   . ARG B 1 44  ? -2.788  -52.802 -45.023 1.00 32.89  ? 45  ARG B O   1 
ATOM   4474 C CB  . ARG B 1 44  ? -3.051  -53.720 -47.799 1.00 36.82  ? 45  ARG B CB  1 
ATOM   4475 C CG  . ARG B 1 44  ? -3.957  -53.926 -48.998 1.00 38.64  ? 45  ARG B CG  1 
ATOM   4476 C CD  . ARG B 1 44  ? -3.733  -55.328 -49.554 1.00 52.50  ? 45  ARG B CD  1 
ATOM   4477 N NE  . ARG B 1 44  ? -4.349  -55.554 -50.860 1.00 70.82  ? 45  ARG B NE  1 
ATOM   4478 C CZ  . ARG B 1 44  ? -5.344  -56.409 -51.068 1.00 69.91  ? 45  ARG B CZ  1 
ATOM   4479 N NH1 . ARG B 1 44  ? -5.824  -57.112 -50.052 1.00 69.80  ? 45  ARG B NH1 1 
ATOM   4480 N NH2 . ARG B 1 44  ? -5.854  -56.569 -52.282 1.00 62.71  ? 45  ARG B NH2 1 
ATOM   4481 N N   . ARG B 1 45  ? -1.200  -51.435 -45.819 1.00 36.56  ? 46  ARG B N   1 
ATOM   4482 C CA  . ARG B 1 45  ? -0.595  -51.223 -44.506 1.00 30.72  ? 46  ARG B CA  1 
ATOM   4483 C C   . ARG B 1 45  ? -1.588  -50.502 -43.584 1.00 35.03  ? 46  ARG B C   1 
ATOM   4484 O O   . ARG B 1 45  ? -2.307  -49.609 -44.024 1.00 34.50  ? 46  ARG B O   1 
ATOM   4485 C CB  . ARG B 1 45  ? 0.700   -50.416 -44.642 1.00 26.02  ? 46  ARG B CB  1 
ATOM   4486 C CG  . ARG B 1 45  ? 1.514   -50.306 -43.367 1.00 27.72  ? 46  ARG B CG  1 
ATOM   4487 C CD  . ARG B 1 45  ? 2.684   -49.338 -43.510 1.00 29.45  ? 46  ARG B CD  1 
ATOM   4488 N NE  . ARG B 1 45  ? 3.907   -49.962 -44.018 1.00 26.22  ? 46  ARG B NE  1 
ATOM   4489 C CZ  . ARG B 1 45  ? 5.015   -49.280 -44.303 1.00 30.60  ? 46  ARG B CZ  1 
ATOM   4490 N NH1 . ARG B 1 45  ? 5.043   -47.962 -44.142 1.00 24.38  ? 46  ARG B NH1 1 
ATOM   4491 N NH2 . ARG B 1 45  ? 6.097   -49.906 -44.752 1.00 29.63  ? 46  ARG B NH2 1 
ATOM   4492 N N   . PHE B 1 46  ? -1.620  -50.909 -42.316 1.00 32.96  ? 47  PHE B N   1 
ATOM   4493 C CA  . PHE B 1 46  ? -2.542  -50.383 -41.300 1.00 29.13  ? 47  PHE B CA  1 
ATOM   4494 C C   . PHE B 1 46  ? -4.004  -50.787 -41.489 1.00 32.71  ? 47  PHE B C   1 
ATOM   4495 O O   . PHE B 1 46  ? -4.851  -50.424 -40.675 1.00 32.14  ? 47  PHE B O   1 
ATOM   4496 C CB  . PHE B 1 46  ? -2.464  -48.857 -41.155 1.00 28.79  ? 47  PHE B CB  1 
ATOM   4497 C CG  . PHE B 1 46  ? -1.076  -48.325 -41.014 1.00 30.17  ? 47  PHE B CG  1 
ATOM   4498 C CD1 . PHE B 1 46  ? -0.260  -48.741 -39.975 1.00 27.10  ? 47  PHE B CD1 1 
ATOM   4499 C CD2 . PHE B 1 46  ? -0.587  -47.391 -41.919 1.00 29.16  ? 47  PHE B CD2 1 
ATOM   4500 C CE1 . PHE B 1 46  ? 1.027   -48.241 -39.843 1.00 22.95  ? 47  PHE B CE1 1 
ATOM   4501 C CE2 . PHE B 1 46  ? 0.696   -46.883 -41.793 1.00 26.56  ? 47  PHE B CE2 1 
ATOM   4502 C CZ  . PHE B 1 46  ? 1.500   -47.303 -40.747 1.00 28.41  ? 47  PHE B CZ  1 
ATOM   4503 N N   . LEU B 1 47  ? -4.307  -51.538 -42.542 1.00 25.79  ? 48  LEU B N   1 
ATOM   4504 C CA  . LEU B 1 47  ? -5.698  -51.864 -42.836 1.00 27.44  ? 48  LEU B CA  1 
ATOM   4505 C C   . LEU B 1 47  ? -6.074  -53.249 -42.322 1.00 27.16  ? 48  LEU B C   1 
ATOM   4506 O O   . LEU B 1 47  ? -5.209  -54.100 -42.155 1.00 27.88  ? 48  LEU B O   1 
ATOM   4507 C CB  . LEU B 1 47  ? -5.966  -51.772 -44.345 1.00 32.08  ? 48  LEU B CB  1 
ATOM   4508 C CG  . LEU B 1 47  ? -6.105  -50.372 -44.954 1.00 41.74  ? 48  LEU B CG  1 
ATOM   4509 C CD1 . LEU B 1 47  ? -6.321  -50.461 -46.464 1.00 29.78  ? 48  LEU B CD1 1 
ATOM   4510 C CD2 . LEU B 1 47  ? -7.245  -49.609 -44.291 1.00 32.29  ? 48  LEU B CD2 1 
ATOM   4511 N N   . PRO B 1 48  ? -7.373  -53.477 -42.072 1.00 23.48  ? 49  PRO B N   1 
ATOM   4512 C CA  . PRO B 1 48  ? -7.864  -54.812 -41.720 1.00 27.00  ? 49  PRO B CA  1 
ATOM   4513 C C   . PRO B 1 48  ? -7.447  -55.849 -42.760 1.00 34.08  ? 49  PRO B C   1 
ATOM   4514 O O   . PRO B 1 48  ? -7.391  -55.543 -43.948 1.00 35.21  ? 49  PRO B O   1 
ATOM   4515 C CB  . PRO B 1 48  ? -9.388  -54.640 -41.750 1.00 21.97  ? 49  PRO B CB  1 
ATOM   4516 C CG  . PRO B 1 48  ? -9.600  -53.204 -41.432 1.00 26.13  ? 49  PRO B CG  1 
ATOM   4517 C CD  . PRO B 1 48  ? -8.459  -52.484 -42.101 1.00 22.96  ? 49  PRO B CD  1 
ATOM   4518 N N   . PRO B 1 49  ? -7.170  -57.079 -42.320 1.00 37.16  ? 50  PRO B N   1 
ATOM   4519 C CA  . PRO B 1 49  ? -6.731  -58.102 -43.271 1.00 29.60  ? 50  PRO B CA  1 
ATOM   4520 C C   . PRO B 1 49  ? -7.859  -58.523 -44.221 1.00 32.40  ? 50  PRO B C   1 
ATOM   4521 O O   . PRO B 1 49  ? -9.015  -58.621 -43.811 1.00 36.78  ? 50  PRO B O   1 
ATOM   4522 C CB  . PRO B 1 49  ? -6.349  -59.265 -42.363 1.00 26.39  ? 50  PRO B CB  1 
ATOM   4523 C CG  . PRO B 1 49  ? -7.281  -59.115 -41.172 1.00 28.37  ? 50  PRO B CG  1 
ATOM   4524 C CD  . PRO B 1 49  ? -7.424  -57.626 -40.975 1.00 25.33  ? 50  PRO B CD  1 
ATOM   4525 N N   . GLU B 1 50  ? -7.520  -58.767 -45.482 1.00 32.02  ? 51  GLU B N   1 
ATOM   4526 C CA  . GLU B 1 50  ? -8.484  -59.324 -46.430 1.00 38.96  ? 51  GLU B CA  1 
ATOM   4527 C C   . GLU B 1 50  ? -8.247  -60.817 -46.578 1.00 33.85  ? 51  GLU B C   1 
ATOM   4528 O O   . GLU B 1 50  ? -7.107  -61.272 -46.562 1.00 32.90  ? 51  GLU B O   1 
ATOM   4529 C CB  . GLU B 1 50  ? -8.391  -58.614 -47.778 1.00 37.00  ? 51  GLU B CB  1 
ATOM   4530 C CG  . GLU B 1 50  ? -8.893  -57.173 -47.707 1.00 54.33  ? 51  GLU B CG  1 
ATOM   4531 C CD  . GLU B 1 50  ? -8.361  -56.299 -48.824 1.00 74.83  ? 51  GLU B CD  1 
ATOM   4532 O OE1 . GLU B 1 50  ? -8.534  -56.670 -50.008 1.00 74.08  ? 51  GLU B OE1 1 
ATOM   4533 O OE2 . GLU B 1 50  ? -7.752  -55.246 -48.516 1.00 78.36  ? 51  GLU B OE2 1 
ATOM   4534 N N   . PRO B 1 51  ? -9.329  -61.590 -46.682 1.00 29.51  ? 52  PRO B N   1 
ATOM   4535 C CA  . PRO B 1 51  ? -9.211  -63.044 -46.839 1.00 32.32  ? 52  PRO B CA  1 
ATOM   4536 C C   . PRO B 1 51  ? -8.363  -63.409 -48.061 1.00 34.60  ? 52  PRO B C   1 
ATOM   4537 O O   . PRO B 1 51  ? -8.443  -62.746 -49.099 1.00 31.72  ? 52  PRO B O   1 
ATOM   4538 C CB  . PRO B 1 51  ? -10.663 -63.490 -47.038 1.00 35.24  ? 52  PRO B CB  1 
ATOM   4539 C CG  . PRO B 1 51  ? -11.481 -62.411 -46.377 1.00 30.02  ? 52  PRO B CG  1 
ATOM   4540 C CD  . PRO B 1 51  ? -10.731 -61.140 -46.650 1.00 26.22  ? 52  PRO B CD  1 
ATOM   4541 N N   . LYS B 1 52  ? -7.536  -64.439 -47.919 1.00 36.40  ? 53  LYS B N   1 
ATOM   4542 C CA  . LYS B 1 52  ? -6.696  -64.906 -49.009 1.00 29.62  ? 53  LYS B CA  1 
ATOM   4543 C C   . LYS B 1 52  ? -7.554  -65.377 -50.182 1.00 30.45  ? 53  LYS B C   1 
ATOM   4544 O O   . LYS B 1 52  ? -8.433  -66.217 -50.016 1.00 34.52  ? 53  LYS B O   1 
ATOM   4545 C CB  . LYS B 1 52  ? -5.792  -66.039 -48.521 1.00 28.27  ? 53  LYS B CB  1 
ATOM   4546 C CG  . LYS B 1 52  ? -4.963  -66.713 -49.610 1.00 31.18  ? 53  LYS B CG  1 
ATOM   4547 C CD  . LYS B 1 52  ? -3.977  -65.743 -50.236 1.00 31.66  ? 53  LYS B CD  1 
ATOM   4548 C CE  . LYS B 1 52  ? -2.933  -66.463 -51.064 1.00 33.11  ? 53  LYS B CE  1 
ATOM   4549 N NZ  . LYS B 1 52  ? -1.848  -65.548 -51.540 1.00 34.53  ? 53  LYS B NZ  1 
ATOM   4550 N N   . GLN B 1 53  ? -7.300  -64.824 -51.363 1.00 33.43  ? 54  GLN B N   1 
ATOM   4551 C CA  . GLN B 1 53  ? -7.975  -65.260 -52.588 1.00 39.32  ? 54  GLN B CA  1 
ATOM   4552 C C   . GLN B 1 53  ? -7.599  -66.694 -52.961 1.00 31.91  ? 54  GLN B C   1 
ATOM   4553 O O   . GLN B 1 53  ? -6.456  -67.112 -52.755 1.00 32.04  ? 54  GLN B O   1 
ATOM   4554 C CB  . GLN B 1 53  ? -7.630  -64.315 -53.744 1.00 40.05  ? 54  GLN B CB  1 
ATOM   4555 C CG  . GLN B 1 53  ? -8.422  -63.015 -53.744 1.00 47.57  ? 54  GLN B CG  1 
ATOM   4556 C CD  . GLN B 1 53  ? -9.918  -63.247 -53.924 1.00 62.91  ? 54  GLN B CD  1 
ATOM   4557 O OE1 . GLN B 1 53  ? -10.642 -63.484 -52.952 1.00 61.93  ? 54  GLN B OE1 1 
ATOM   4558 N NE2 . GLN B 1 53  ? -10.388 -63.185 -55.171 1.00 60.99  ? 54  GLN B NE2 1 
ATOM   4559 N N   . PRO B 1 54  ? -8.556  -67.455 -53.516 1.00 36.34  ? 55  PRO B N   1 
ATOM   4560 C CA  . PRO B 1 54  ? -8.282  -68.846 -53.915 1.00 33.44  ? 55  PRO B CA  1 
ATOM   4561 C C   . PRO B 1 54  ? -7.176  -68.924 -54.965 1.00 35.11  ? 55  PRO B C   1 
ATOM   4562 O O   . PRO B 1 54  ? -6.968  -67.960 -55.690 1.00 29.59  ? 55  PRO B O   1 
ATOM   4563 C CB  . PRO B 1 54  ? -9.612  -69.314 -54.510 1.00 34.82  ? 55  PRO B CB  1 
ATOM   4564 C CG  . PRO B 1 54  ? -10.643 -68.382 -53.924 1.00 37.72  ? 55  PRO B CG  1 
ATOM   4565 C CD  . PRO B 1 54  ? -9.947  -67.062 -53.795 1.00 34.41  ? 55  PRO B CD  1 
ATOM   4566 N N   . TRP B 1 55  ? -6.464  -70.046 -55.019 1.00 35.32  ? 56  TRP B N   1 
ATOM   4567 C CA  . TRP B 1 55  ? -5.350  -70.218 -55.948 1.00 33.72  ? 56  TRP B CA  1 
ATOM   4568 C C   . TRP B 1 55  ? -5.491  -71.537 -56.695 1.00 33.38  ? 56  TRP B C   1 
ATOM   4569 O O   . TRP B 1 55  ? -6.143  -72.466 -56.217 1.00 32.87  ? 56  TRP B O   1 
ATOM   4570 C CB  . TRP B 1 55  ? -4.007  -70.208 -55.197 1.00 29.12  ? 56  TRP B CB  1 
ATOM   4571 C CG  . TRP B 1 55  ? -3.890  -71.319 -54.177 1.00 39.87  ? 56  TRP B CG  1 
ATOM   4572 C CD1 . TRP B 1 55  ? -3.453  -72.598 -54.396 1.00 36.95  ? 56  TRP B CD1 1 
ATOM   4573 C CD2 . TRP B 1 55  ? -4.232  -71.249 -52.785 1.00 29.27  ? 56  TRP B CD2 1 
ATOM   4574 N NE1 . TRP B 1 55  ? -3.502  -73.321 -53.228 1.00 32.09  ? 56  TRP B NE1 1 
ATOM   4575 C CE2 . TRP B 1 55  ? -3.977  -72.517 -52.227 1.00 31.08  ? 56  TRP B CE2 1 
ATOM   4576 C CE3 . TRP B 1 55  ? -4.726  -70.235 -51.958 1.00 33.47  ? 56  TRP B CE3 1 
ATOM   4577 C CZ2 . TRP B 1 55  ? -4.197  -72.797 -50.878 1.00 32.83  ? 56  TRP B CZ2 1 
ATOM   4578 C CZ3 . TRP B 1 55  ? -4.945  -70.518 -50.617 1.00 27.19  ? 56  TRP B CZ3 1 
ATOM   4579 C CH2 . TRP B 1 55  ? -4.680  -71.786 -50.094 1.00 25.75  ? 56  TRP B CH2 1 
ATOM   4580 N N   . SER B 1 56  ? -4.873  -71.617 -57.868 1.00 36.64  ? 57  SER B N   1 
ATOM   4581 C CA  . SER B 1 56  ? -4.826  -72.868 -58.614 1.00 39.60  ? 57  SER B CA  1 
ATOM   4582 C C   . SER B 1 56  ? -3.486  -73.533 -58.325 1.00 32.64  ? 57  SER B C   1 
ATOM   4583 O O   . SER B 1 56  ? -2.538  -72.870 -57.907 1.00 37.68  ? 57  SER B O   1 
ATOM   4584 C CB  . SER B 1 56  ? -4.990  -72.607 -60.115 1.00 34.49  ? 57  SER B CB  1 
ATOM   4585 O OG  . SER B 1 56  ? -3.840  -71.963 -60.632 1.00 36.30  ? 57  SER B OG  1 
ATOM   4586 N N   . GLY B 1 57  ? -3.400  -74.839 -58.535 1.00 34.97  ? 58  GLY B N   1 
ATOM   4587 C CA  . GLY B 1 57  ? -2.159  -75.546 -58.266 1.00 29.15  ? 58  GLY B CA  1 
ATOM   4588 C C   . GLY B 1 57  ? -1.990  -75.852 -56.786 1.00 36.49  ? 58  GLY B C   1 
ATOM   4589 O O   . GLY B 1 57  ? -2.940  -75.764 -56.002 1.00 33.22  ? 58  GLY B O   1 
ATOM   4590 N N   . VAL B 1 58  ? -0.771  -76.207 -56.401 1.00 32.82  ? 59  VAL B N   1 
ATOM   4591 C CA  . VAL B 1 58  ? -0.484  -76.605 -55.034 1.00 32.11  ? 59  VAL B CA  1 
ATOM   4592 C C   . VAL B 1 58  ? 0.506   -75.654 -54.356 1.00 33.80  ? 59  VAL B C   1 
ATOM   4593 O O   . VAL B 1 58  ? 1.629   -75.469 -54.836 1.00 26.44  ? 59  VAL B O   1 
ATOM   4594 C CB  . VAL B 1 58  ? 0.095   -78.030 -54.986 1.00 34.54  ? 59  VAL B CB  1 
ATOM   4595 C CG1 . VAL B 1 58  ? 0.134   -78.530 -53.546 1.00 37.71  ? 59  VAL B CG1 1 
ATOM   4596 C CG2 . VAL B 1 58  ? -0.716  -78.976 -55.881 1.00 27.46  ? 59  VAL B CG2 1 
ATOM   4597 N N   . VAL B 1 59  ? 0.079   -75.057 -53.242 1.00 31.99  ? 60  VAL B N   1 
ATOM   4598 C CA  . VAL B 1 59  ? 0.963   -74.241 -52.408 1.00 31.91  ? 60  VAL B CA  1 
ATOM   4599 C C   . VAL B 1 59  ? 1.759   -75.147 -51.476 1.00 29.09  ? 60  VAL B C   1 
ATOM   4600 O O   . VAL B 1 59  ? 1.173   -75.954 -50.756 1.00 32.87  ? 60  VAL B O   1 
ATOM   4601 C CB  . VAL B 1 59  ? 0.167   -73.216 -51.551 1.00 31.85  ? 60  VAL B CB  1 
ATOM   4602 C CG1 . VAL B 1 59  ? 1.002   -72.727 -50.353 1.00 25.23  ? 60  VAL B CG1 1 
ATOM   4603 C CG2 . VAL B 1 59  ? -0.297  -72.045 -52.398 1.00 25.13  ? 60  VAL B CG2 1 
ATOM   4604 N N   . ASP B 1 60  ? 3.086   -75.026 -51.499 1.00 28.36  ? 61  ASP B N   1 
ATOM   4605 C CA  . ASP B 1 60  ? 3.940   -75.759 -50.561 1.00 25.85  ? 61  ASP B CA  1 
ATOM   4606 C C   . ASP B 1 60  ? 3.922   -75.136 -49.150 1.00 28.78  ? 61  ASP B C   1 
ATOM   4607 O O   . ASP B 1 60  ? 4.477   -74.055 -48.923 1.00 27.02  ? 61  ASP B O   1 
ATOM   4608 C CB  . ASP B 1 60  ? 5.389   -75.853 -51.077 1.00 25.61  ? 61  ASP B CB  1 
ATOM   4609 C CG  . ASP B 1 60  ? 5.538   -76.834 -52.243 1.00 39.00  ? 61  ASP B CG  1 
ATOM   4610 O OD1 . ASP B 1 60  ? 5.364   -78.055 -52.026 1.00 36.87  ? 61  ASP B OD1 1 
ATOM   4611 O OD2 . ASP B 1 60  ? 5.842   -76.387 -53.374 1.00 34.65  ? 61  ASP B OD2 1 
ATOM   4612 N N   . ALA B 1 61  ? 3.278   -75.824 -48.212 1.00 27.35  ? 62  ALA B N   1 
ATOM   4613 C CA  . ALA B 1 61  ? 3.273   -75.408 -46.809 1.00 28.07  ? 62  ALA B CA  1 
ATOM   4614 C C   . ALA B 1 61  ? 4.342   -76.183 -46.080 1.00 27.90  ? 62  ALA B C   1 
ATOM   4615 O O   . ALA B 1 61  ? 4.038   -77.061 -45.276 1.00 25.36  ? 62  ALA B O   1 
ATOM   4616 C CB  . ALA B 1 61  ? 1.922   -75.669 -46.167 1.00 23.29  ? 62  ALA B CB  1 
ATOM   4617 N N   . THR B 1 62  ? 5.599   -75.855 -46.356 1.00 27.46  ? 63  THR B N   1 
ATOM   4618 C CA  . THR B 1 62  ? 6.686   -76.747 -45.996 1.00 26.21  ? 63  THR B CA  1 
ATOM   4619 C C   . THR B 1 62  ? 7.748   -76.107 -45.107 1.00 27.70  ? 63  THR B C   1 
ATOM   4620 O O   . THR B 1 62  ? 8.702   -76.771 -44.696 1.00 28.23  ? 63  THR B O   1 
ATOM   4621 C CB  . THR B 1 62  ? 7.345   -77.315 -47.276 1.00 27.66  ? 63  THR B CB  1 
ATOM   4622 O OG1 . THR B 1 62  ? 7.716   -76.230 -48.126 1.00 27.40  ? 63  THR B OG1 1 
ATOM   4623 C CG2 . THR B 1 62  ? 6.367   -78.196 -48.033 1.00 23.36  ? 63  THR B CG2 1 
ATOM   4624 N N   . THR B 1 63  ? 7.596   -74.819 -44.821 1.00 26.02  ? 64  THR B N   1 
ATOM   4625 C CA  . THR B 1 63  ? 8.503   -74.134 -43.895 1.00 25.14  ? 64  THR B CA  1 
ATOM   4626 C C   . THR B 1 63  ? 7.785   -72.902 -43.351 1.00 25.66  ? 64  THR B C   1 
ATOM   4627 O O   . THR B 1 63  ? 6.850   -72.404 -43.978 1.00 27.91  ? 64  THR B O   1 
ATOM   4628 C CB  . THR B 1 63  ? 9.832   -73.717 -44.588 1.00 24.93  ? 64  THR B CB  1 
ATOM   4629 O OG1 . THR B 1 63  ? 10.843  -73.471 -43.607 1.00 32.44  ? 64  THR B OG1 1 
ATOM   4630 C CG2 . THR B 1 63  ? 9.644   -72.453 -45.435 1.00 25.38  ? 64  THR B CG2 1 
ATOM   4631 N N   . PHE B 1 64  ? 8.194   -72.428 -42.180 1.00 25.11  ? 65  PHE B N   1 
ATOM   4632 C CA  . PHE B 1 64  ? 7.641   -71.189 -41.635 1.00 27.87  ? 65  PHE B CA  1 
ATOM   4633 C C   . PHE B 1 64  ? 7.868   -70.027 -42.586 1.00 28.54  ? 65  PHE B C   1 
ATOM   4634 O O   . PHE B 1 64  ? 8.964   -69.859 -43.134 1.00 27.34  ? 65  PHE B O   1 
ATOM   4635 C CB  . PHE B 1 64  ? 8.281   -70.829 -40.287 1.00 24.41  ? 65  PHE B CB  1 
ATOM   4636 C CG  . PHE B 1 64  ? 7.935   -71.776 -39.168 1.00 26.70  ? 65  PHE B CG  1 
ATOM   4637 C CD1 . PHE B 1 64  ? 6.631   -71.884 -38.708 1.00 24.92  ? 65  PHE B CD1 1 
ATOM   4638 C CD2 . PHE B 1 64  ? 8.922   -72.546 -38.565 1.00 26.84  ? 65  PHE B CD2 1 
ATOM   4639 C CE1 . PHE B 1 64  ? 6.315   -72.755 -37.672 1.00 25.34  ? 65  PHE B CE1 1 
ATOM   4640 C CE2 . PHE B 1 64  ? 8.612   -73.421 -37.531 1.00 29.35  ? 65  PHE B CE2 1 
ATOM   4641 C CZ  . PHE B 1 64  ? 7.310   -73.524 -37.084 1.00 24.58  ? 65  PHE B CZ  1 
ATOM   4642 N N   . GLN B 1 65  ? 6.836   -69.211 -42.759 1.00 26.24  ? 66  GLN B N   1 
ATOM   4643 C CA  . GLN B 1 65  ? 6.970   -67.967 -43.503 1.00 23.18  ? 66  GLN B CA  1 
ATOM   4644 C C   . GLN B 1 65  ? 7.617   -66.854 -42.683 1.00 22.91  ? 66  GLN B C   1 
ATOM   4645 O O   . GLN B 1 65  ? 7.994   -67.049 -41.523 1.00 25.59  ? 66  GLN B O   1 
ATOM   4646 C CB  . GLN B 1 65  ? 5.610   -67.512 -44.024 1.00 22.83  ? 66  GLN B CB  1 
ATOM   4647 C CG  . GLN B 1 65  ? 5.355   -67.885 -45.468 1.00 24.98  ? 66  GLN B CG  1 
ATOM   4648 C CD  . GLN B 1 65  ? 6.035   -66.940 -46.432 1.00 28.00  ? 66  GLN B CD  1 
ATOM   4649 O OE1 . GLN B 1 65  ? 6.818   -66.070 -46.033 1.00 30.17  ? 66  GLN B OE1 1 
ATOM   4650 N NE2 . GLN B 1 65  ? 5.732   -67.096 -47.709 1.00 26.14  ? 66  GLN B NE2 1 
ATOM   4651 N N   . SER B 1 66  ? 7.725   -65.683 -43.302 1.00 23.31  ? 67  SER B N   1 
ATOM   4652 C CA  . SER B 1 66  ? 8.416   -64.537 -42.720 1.00 25.51  ? 67  SER B CA  1 
ATOM   4653 C C   . SER B 1 66  ? 7.831   -64.077 -41.389 1.00 26.26  ? 67  SER B C   1 
ATOM   4654 O O   . SER B 1 66  ? 6.639   -64.217 -41.130 1.00 27.51  ? 67  SER B O   1 
ATOM   4655 C CB  . SER B 1 66  ? 8.417   -63.354 -43.702 1.00 26.90  ? 67  SER B CB  1 
ATOM   4656 O OG  . SER B 1 66  ? 9.197   -63.625 -44.855 1.00 29.34  ? 67  SER B OG  1 
ATOM   4657 N N   . VAL B 1 67  ? 8.693   -63.520 -40.550 1.00 24.01  ? 68  VAL B N   1 
ATOM   4658 C CA  . VAL B 1 67  ? 8.273   -62.895 -39.311 1.00 29.12  ? 68  VAL B CA  1 
ATOM   4659 C C   . VAL B 1 67  ? 7.707   -61.500 -39.616 1.00 31.47  ? 68  VAL B C   1 
ATOM   4660 O O   . VAL B 1 67  ? 8.270   -60.774 -40.437 1.00 31.08  ? 68  VAL B O   1 
ATOM   4661 C CB  . VAL B 1 67  ? 9.471   -62.788 -38.360 1.00 29.23  ? 68  VAL B CB  1 
ATOM   4662 C CG1 . VAL B 1 67  ? 9.089   -62.063 -37.099 1.00 32.63  ? 68  VAL B CG1 1 
ATOM   4663 C CG2 . VAL B 1 67  ? 10.018  -64.183 -38.047 1.00 27.78  ? 68  VAL B CG2 1 
ATOM   4664 N N   . CYS B 1 68  ? 6.588   -61.132 -38.988 1.00 24.42  ? 69  CYS B N   1 
ATOM   4665 C CA  . CYS B 1 68  ? 6.025   -59.799 -39.195 1.00 23.99  ? 69  CYS B CA  1 
ATOM   4666 C C   . CYS B 1 68  ? 7.013   -58.746 -38.749 1.00 23.79  ? 69  CYS B C   1 
ATOM   4667 O O   . CYS B 1 68  ? 7.695   -58.924 -37.738 1.00 29.58  ? 69  CYS B O   1 
ATOM   4668 C CB  . CYS B 1 68  ? 4.712   -59.622 -38.438 1.00 22.57  ? 69  CYS B CB  1 
ATOM   4669 S SG  . CYS B 1 68  ? 3.355   -60.629 -39.054 1.00 27.22  ? 69  CYS B SG  1 
ATOM   4670 N N   . TYR B 1 69  ? 7.088   -57.649 -39.495 1.00 24.84  ? 70  TYR B N   1 
ATOM   4671 C CA  . TYR B 1 69  ? 8.072   -56.607 -39.217 1.00 26.00  ? 70  TYR B CA  1 
ATOM   4672 C C   . TYR B 1 69  ? 8.026   -56.112 -37.765 1.00 28.94  ? 70  TYR B C   1 
ATOM   4673 O O   . TYR B 1 69  ? 6.960   -55.789 -37.233 1.00 23.69  ? 70  TYR B O   1 
ATOM   4674 C CB  . TYR B 1 69  ? 7.931   -55.441 -40.202 1.00 29.32  ? 70  TYR B CB  1 
ATOM   4675 C CG  . TYR B 1 69  ? 9.259   -55.056 -40.817 1.00 28.94  ? 70  TYR B CG  1 
ATOM   4676 C CD1 . TYR B 1 69  ? 9.566   -55.373 -42.143 1.00 35.92  ? 70  TYR B CD1 1 
ATOM   4677 C CD2 . TYR B 1 69  ? 10.220  -54.409 -40.059 1.00 32.57  ? 70  TYR B CD2 1 
ATOM   4678 C CE1 . TYR B 1 69  ? 10.796  -55.030 -42.693 1.00 31.02  ? 70  TYR B CE1 1 
ATOM   4679 C CE2 . TYR B 1 69  ? 11.441  -54.071 -40.590 1.00 35.73  ? 70  TYR B CE2 1 
ATOM   4680 C CZ  . TYR B 1 69  ? 11.727  -54.381 -41.899 1.00 38.79  ? 70  TYR B CZ  1 
ATOM   4681 O OH  . TYR B 1 69  ? 12.957  -54.018 -42.397 1.00 60.38  ? 70  TYR B OH  1 
ATOM   4682 N N   . GLN B 1 70  ? 9.190   -56.059 -37.128 1.00 23.87  ? 71  GLN B N   1 
ATOM   4683 C CA  . GLN B 1 70  ? 9.235   -55.762 -35.715 1.00 21.58  ? 71  GLN B CA  1 
ATOM   4684 C C   . GLN B 1 70  ? 10.616  -55.344 -35.256 1.00 28.51  ? 71  GLN B C   1 
ATOM   4685 O O   . GLN B 1 70  ? 11.629  -55.633 -35.901 1.00 27.93  ? 71  GLN B O   1 
ATOM   4686 C CB  . GLN B 1 70  ? 8.768   -56.981 -34.898 1.00 25.18  ? 71  GLN B CB  1 
ATOM   4687 C CG  . GLN B 1 70  ? 9.606   -58.253 -35.095 1.00 25.20  ? 71  GLN B CG  1 
ATOM   4688 C CD  . GLN B 1 70  ? 9.006   -59.481 -34.406 1.00 24.25  ? 71  GLN B CD  1 
ATOM   4689 O OE1 . GLN B 1 70  ? 9.545   -59.979 -33.413 1.00 25.78  ? 71  GLN B OE1 1 
ATOM   4690 N NE2 . GLN B 1 70  ? 7.896   -59.979 -34.940 1.00 20.64  ? 71  GLN B NE2 1 
ATOM   4691 N N   . TYR B 1 71  ? 10.637  -54.668 -34.117 1.00 25.85  ? 72  TYR B N   1 
ATOM   4692 C CA  . TYR B 1 71  ? 11.864  -54.325 -33.437 1.00 26.12  ? 72  TYR B CA  1 
ATOM   4693 C C   . TYR B 1 71  ? 12.634  -55.600 -33.087 1.00 27.20  ? 72  TYR B C   1 
ATOM   4694 O O   . TYR B 1 71  ? 12.037  -56.623 -32.750 1.00 26.98  ? 72  TYR B O   1 
ATOM   4695 C CB  . TYR B 1 71  ? 11.519  -53.530 -32.176 1.00 28.27  ? 72  TYR B CB  1 
ATOM   4696 C CG  . TYR B 1 71  ? 12.686  -53.295 -31.249 1.00 28.87  ? 72  TYR B CG  1 
ATOM   4697 C CD1 . TYR B 1 71  ? 13.641  -52.324 -31.535 1.00 29.01  ? 72  TYR B CD1 1 
ATOM   4698 C CD2 . TYR B 1 71  ? 12.830  -54.036 -30.086 1.00 21.03  ? 72  TYR B CD2 1 
ATOM   4699 C CE1 . TYR B 1 71  ? 14.711  -52.101 -30.684 1.00 26.73  ? 72  TYR B CE1 1 
ATOM   4700 C CE2 . TYR B 1 71  ? 13.896  -53.825 -29.236 1.00 29.45  ? 72  TYR B CE2 1 
ATOM   4701 C CZ  . TYR B 1 71  ? 14.835  -52.855 -29.538 1.00 30.81  ? 72  TYR B CZ  1 
ATOM   4702 O OH  . TYR B 1 71  ? 15.902  -52.643 -28.691 1.00 33.35  ? 72  TYR B OH  1 
ATOM   4703 N N   . VAL B 1 72  ? 13.957  -55.542 -33.186 1.00 29.36  ? 73  VAL B N   1 
ATOM   4704 C CA  . VAL B 1 72  ? 14.808  -56.665 -32.800 1.00 27.65  ? 73  VAL B CA  1 
ATOM   4705 C C   . VAL B 1 72  ? 15.557  -56.303 -31.519 1.00 26.25  ? 73  VAL B C   1 
ATOM   4706 O O   . VAL B 1 72  ? 16.212  -55.268 -31.452 1.00 29.70  ? 73  VAL B O   1 
ATOM   4707 C CB  . VAL B 1 72  ? 15.816  -57.016 -33.918 1.00 29.03  ? 73  VAL B CB  1 
ATOM   4708 C CG1 . VAL B 1 72  ? 16.738  -58.142 -33.485 1.00 23.14  ? 73  VAL B CG1 1 
ATOM   4709 C CG2 . VAL B 1 72  ? 15.086  -57.400 -35.189 1.00 24.68  ? 73  VAL B CG2 1 
ATOM   4710 N N   . ASP B 1 73  ? 15.447  -57.149 -30.503 1.00 29.91  ? 74  ASP B N   1 
ATOM   4711 C CA  . ASP B 1 73  ? 16.015  -56.856 -29.185 1.00 34.63  ? 74  ASP B CA  1 
ATOM   4712 C C   . ASP B 1 73  ? 17.541  -56.915 -29.198 1.00 32.69  ? 74  ASP B C   1 
ATOM   4713 O O   . ASP B 1 73  ? 18.126  -57.960 -29.468 1.00 37.20  ? 74  ASP B O   1 
ATOM   4714 C CB  . ASP B 1 73  ? 15.468  -57.846 -28.146 1.00 34.27  ? 74  ASP B CB  1 
ATOM   4715 C CG  . ASP B 1 73  ? 15.847  -57.480 -26.715 1.00 35.05  ? 74  ASP B CG  1 
ATOM   4716 O OD1 . ASP B 1 73  ? 16.756  -56.652 -26.501 1.00 35.36  ? 74  ASP B OD1 1 
ATOM   4717 O OD2 . ASP B 1 73  ? 15.226  -58.036 -25.791 1.00 35.98  ? 74  ASP B OD2 1 
ATOM   4718 N N   . THR B 1 74  ? 18.180  -55.805 -28.852 1.00 33.94  ? 75  THR B N   1 
ATOM   4719 C CA  . THR B 1 74  ? 19.636  -55.732 -28.889 1.00 32.04  ? 75  THR B CA  1 
ATOM   4720 C C   . THR B 1 74  ? 20.305  -55.535 -27.528 1.00 36.09  ? 75  THR B C   1 
ATOM   4721 O O   . THR B 1 74  ? 21.484  -55.187 -27.473 1.00 41.99  ? 75  THR B O   1 
ATOM   4722 C CB  . THR B 1 74  ? 20.099  -54.590 -29.813 1.00 36.81  ? 75  THR B CB  1 
ATOM   4723 O OG1 . THR B 1 74  ? 19.515  -53.361 -29.369 1.00 38.16  ? 75  THR B OG1 1 
ATOM   4724 C CG2 . THR B 1 74  ? 19.680  -54.860 -31.260 1.00 32.17  ? 75  THR B CG2 1 
ATOM   4725 N N   . LEU B 1 75  ? 19.571  -55.774 -26.442 1.00 32.66  ? 76  LEU B N   1 
ATOM   4726 C CA  . LEU B 1 75  ? 20.070  -55.494 -25.090 1.00 34.23  ? 76  LEU B CA  1 
ATOM   4727 C C   . LEU B 1 75  ? 21.338  -56.276 -24.714 1.00 39.40  ? 76  LEU B C   1 
ATOM   4728 O O   . LEU B 1 75  ? 22.299  -55.716 -24.160 1.00 38.82  ? 76  LEU B O   1 
ATOM   4729 C CB  . LEU B 1 75  ? 18.970  -55.712 -24.040 1.00 29.79  ? 76  LEU B CB  1 
ATOM   4730 C CG  . LEU B 1 75  ? 19.360  -55.416 -22.585 1.00 33.23  ? 76  LEU B CG  1 
ATOM   4731 C CD1 . LEU B 1 75  ? 19.697  -53.943 -22.387 1.00 27.86  ? 76  LEU B CD1 1 
ATOM   4732 C CD2 . LEU B 1 75  ? 18.258  -55.841 -21.638 1.00 33.42  ? 76  LEU B CD2 1 
ATOM   4733 N N   . TYR B 1 76  ? 21.352  -57.567 -25.002 1.00 31.98  ? 77  TYR B N   1 
ATOM   4734 C CA  . TYR B 1 76  ? 22.569  -58.332 -24.769 1.00 35.38  ? 77  TYR B CA  1 
ATOM   4735 C C   . TYR B 1 76  ? 22.932  -59.105 -26.028 1.00 37.96  ? 77  TYR B C   1 
ATOM   4736 O O   . TYR B 1 76  ? 22.601  -60.286 -26.154 1.00 37.63  ? 77  TYR B O   1 
ATOM   4737 C CB  . TYR B 1 76  ? 22.409  -59.277 -23.585 1.00 32.56  ? 77  TYR B CB  1 
ATOM   4738 C CG  . TYR B 1 76  ? 22.225  -58.600 -22.238 1.00 37.40  ? 77  TYR B CG  1 
ATOM   4739 C CD1 . TYR B 1 76  ? 23.298  -58.007 -21.577 1.00 30.29  ? 77  TYR B CD1 1 
ATOM   4740 C CD2 . TYR B 1 76  ? 20.982  -58.581 -21.612 1.00 35.57  ? 77  TYR B CD2 1 
ATOM   4741 C CE1 . TYR B 1 76  ? 23.133  -57.403 -20.341 1.00 34.92  ? 77  TYR B CE1 1 
ATOM   4742 C CE2 . TYR B 1 76  ? 20.806  -57.977 -20.372 1.00 34.57  ? 77  TYR B CE2 1 
ATOM   4743 C CZ  . TYR B 1 76  ? 21.882  -57.394 -19.737 1.00 37.50  ? 77  TYR B CZ  1 
ATOM   4744 O OH  . TYR B 1 76  ? 21.708  -56.799 -18.499 1.00 35.62  ? 77  TYR B OH  1 
ATOM   4745 N N   . PRO B 1 77  ? 23.616  -58.434 -26.968 1.00 43.54  ? 78  PRO B N   1 
ATOM   4746 C CA  . PRO B 1 77  ? 23.876  -59.007 -28.297 1.00 39.95  ? 78  PRO B CA  1 
ATOM   4747 C C   . PRO B 1 77  ? 24.598  -60.342 -28.169 1.00 40.14  ? 78  PRO B C   1 
ATOM   4748 O O   . PRO B 1 77  ? 25.615  -60.417 -27.478 1.00 37.79  ? 78  PRO B O   1 
ATOM   4749 C CB  . PRO B 1 77  ? 24.779  -57.960 -28.967 1.00 30.43  ? 78  PRO B CB  1 
ATOM   4750 C CG  . PRO B 1 77  ? 24.566  -56.692 -28.174 1.00 40.17  ? 78  PRO B CG  1 
ATOM   4751 C CD  . PRO B 1 77  ? 24.308  -57.148 -26.768 1.00 35.02  ? 78  PRO B CD  1 
ATOM   4752 N N   . GLY B 1 78  ? 24.050  -61.387 -28.784 1.00 41.29  ? 79  GLY B N   1 
ATOM   4753 C CA  . GLY B 1 78  ? 24.636  -62.714 -28.702 1.00 36.00  ? 79  GLY B CA  1 
ATOM   4754 C C   . GLY B 1 78  ? 24.207  -63.573 -27.524 1.00 38.95  ? 79  GLY B C   1 
ATOM   4755 O O   . GLY B 1 78  ? 24.432  -64.783 -27.527 1.00 42.98  ? 79  GLY B O   1 
ATOM   4756 N N   . PHE B 1 79  ? 23.588  -62.966 -26.514 1.00 35.73  ? 80  PHE B N   1 
ATOM   4757 C CA  . PHE B 1 79  ? 23.107  -63.720 -25.353 1.00 31.44  ? 80  PHE B CA  1 
ATOM   4758 C C   . PHE B 1 79  ? 21.879  -64.565 -25.723 1.00 37.58  ? 80  PHE B C   1 
ATOM   4759 O O   . PHE B 1 79  ? 20.912  -64.045 -26.266 1.00 35.22  ? 80  PHE B O   1 
ATOM   4760 C CB  . PHE B 1 79  ? 22.789  -62.748 -24.217 1.00 33.36  ? 80  PHE B CB  1 
ATOM   4761 C CG  . PHE B 1 79  ? 22.316  -63.406 -22.955 1.00 34.72  ? 80  PHE B CG  1 
ATOM   4762 C CD1 . PHE B 1 79  ? 23.080  -64.380 -22.332 1.00 32.66  ? 80  PHE B CD1 1 
ATOM   4763 C CD2 . PHE B 1 79  ? 21.123  -63.016 -22.368 1.00 34.43  ? 80  PHE B CD2 1 
ATOM   4764 C CE1 . PHE B 1 79  ? 22.645  -64.980 -21.158 1.00 35.84  ? 80  PHE B CE1 1 
ATOM   4765 C CE2 . PHE B 1 79  ? 20.681  -63.606 -21.188 1.00 34.41  ? 80  PHE B CE2 1 
ATOM   4766 C CZ  . PHE B 1 79  ? 21.444  -64.590 -20.583 1.00 35.64  ? 80  PHE B CZ  1 
ATOM   4767 N N   . GLU B 1 80  ? 21.912  -65.867 -25.444 1.00 34.79  ? 81  GLU B N   1 
ATOM   4768 C CA  . GLU B 1 80  ? 20.796  -66.736 -25.832 1.00 36.94  ? 81  GLU B CA  1 
ATOM   4769 C C   . GLU B 1 80  ? 19.467  -66.339 -25.158 1.00 40.47  ? 81  GLU B C   1 
ATOM   4770 O O   . GLU B 1 80  ? 18.393  -66.468 -25.756 1.00 38.23  ? 81  GLU B O   1 
ATOM   4771 C CB  . GLU B 1 80  ? 21.131  -68.219 -25.585 1.00 36.86  ? 81  GLU B CB  1 
ATOM   4772 C CG  . GLU B 1 80  ? 19.986  -69.226 -25.873 1.00 52.90  ? 81  GLU B CG  1 
ATOM   4773 C CD  . GLU B 1 80  ? 19.583  -69.344 -27.367 1.00 69.53  ? 81  GLU B CD  1 
ATOM   4774 O OE1 . GLU B 1 80  ? 20.177  -68.659 -28.235 1.00 70.13  ? 81  GLU B OE1 1 
ATOM   4775 O OE2 . GLU B 1 80  ? 18.653  -70.133 -27.675 1.00 67.27  ? 81  GLU B OE2 1 
ATOM   4776 N N   . GLY B 1 81  ? 19.550  -65.837 -23.927 1.00 34.53  ? 82  GLY B N   1 
ATOM   4777 C CA  . GLY B 1 81  ? 18.371  -65.411 -23.189 1.00 36.65  ? 82  GLY B CA  1 
ATOM   4778 C C   . GLY B 1 81  ? 17.540  -64.362 -23.905 1.00 32.77  ? 82  GLY B C   1 
ATOM   4779 O O   . GLY B 1 81  ? 16.315  -64.382 -23.847 1.00 32.34  ? 82  GLY B O   1 
ATOM   4780 N N   . THR B 1 82  ? 18.209  -63.444 -24.591 1.00 31.62  ? 83  THR B N   1 
ATOM   4781 C CA  . THR B 1 82  ? 17.523  -62.455 -25.403 1.00 31.12  ? 83  THR B CA  1 
ATOM   4782 C C   . THR B 1 82  ? 17.308  -62.912 -26.851 1.00 34.20  ? 83  THR B C   1 
ATOM   4783 O O   . THR B 1 82  ? 16.255  -62.642 -27.427 1.00 30.95  ? 83  THR B O   1 
ATOM   4784 C CB  . THR B 1 82  ? 18.293  -61.135 -25.420 1.00 33.13  ? 83  THR B CB  1 
ATOM   4785 O OG1 . THR B 1 82  ? 19.652  -61.400 -25.767 1.00 36.80  ? 83  THR B OG1 1 
ATOM   4786 C CG2 . THR B 1 82  ? 18.261  -60.480 -24.046 1.00 31.52  ? 83  THR B CG2 1 
ATOM   4787 N N   . GLU B 1 83  ? 18.294  -63.597 -27.439 1.00 33.35  ? 84  GLU B N   1 
ATOM   4788 C CA  . GLU B 1 83  ? 18.232  -63.933 -28.868 1.00 33.92  ? 84  GLU B CA  1 
ATOM   4789 C C   . GLU B 1 83  ? 17.131  -64.933 -29.184 1.00 32.87  ? 84  GLU B C   1 
ATOM   4790 O O   . GLU B 1 83  ? 16.598  -64.931 -30.288 1.00 29.88  ? 84  GLU B O   1 
ATOM   4791 C CB  . GLU B 1 83  ? 19.566  -64.477 -29.412 1.00 35.98  ? 84  GLU B CB  1 
ATOM   4792 C CG  . GLU B 1 83  ? 20.814  -63.603 -29.213 1.00 43.50  ? 84  GLU B CG  1 
ATOM   4793 C CD  . GLU B 1 83  ? 20.823  -62.305 -30.008 1.00 46.59  ? 84  GLU B CD  1 
ATOM   4794 O OE1 . GLU B 1 83  ? 19.788  -61.945 -30.612 1.00 49.08  ? 84  GLU B OE1 1 
ATOM   4795 O OE2 . GLU B 1 83  ? 21.885  -61.639 -30.023 1.00 46.86  ? 84  GLU B OE2 1 
ATOM   4796 N N   . MET B 1 84  ? 16.795  -65.789 -28.221 1.00 31.95  ? 85  MET B N   1 
ATOM   4797 C CA  . MET B 1 84  ? 15.785  -66.823 -28.448 1.00 29.53  ? 85  MET B CA  1 
ATOM   4798 C C   . MET B 1 84  ? 14.392  -66.259 -28.745 1.00 30.11  ? 85  MET B C   1 
ATOM   4799 O O   . MET B 1 84  ? 13.521  -66.993 -29.193 1.00 26.52  ? 85  MET B O   1 
ATOM   4800 C CB  . MET B 1 84  ? 15.697  -67.768 -27.248 1.00 29.78  ? 85  MET B CB  1 
ATOM   4801 C CG  . MET B 1 84  ? 15.193  -67.103 -25.966 1.00 26.29  ? 85  MET B CG  1 
ATOM   4802 S SD  . MET B 1 84  ? 14.955  -68.273 -24.603 1.00 34.75  ? 85  MET B SD  1 
ATOM   4803 C CE  . MET B 1 84  ? 13.380  -69.004 -25.070 1.00 20.58  ? 85  MET B CE  1 
ATOM   4804 N N   . TRP B 1 85  ? 14.186  -64.965 -28.492 1.00 26.37  ? 86  TRP B N   1 
ATOM   4805 C CA  . TRP B 1 85  ? 12.879  -64.335 -28.689 1.00 25.67  ? 86  TRP B CA  1 
ATOM   4806 C C   . TRP B 1 85  ? 12.854  -63.500 -29.962 1.00 25.46  ? 86  TRP B C   1 
ATOM   4807 O O   . TRP B 1 85  ? 11.798  -63.073 -30.428 1.00 25.29  ? 86  TRP B O   1 
ATOM   4808 C CB  . TRP B 1 85  ? 12.536  -63.442 -27.487 1.00 24.67  ? 86  TRP B CB  1 
ATOM   4809 C CG  . TRP B 1 85  ? 12.564  -64.165 -26.186 1.00 23.67  ? 86  TRP B CG  1 
ATOM   4810 C CD1 . TRP B 1 85  ? 13.544  -64.112 -25.234 1.00 27.21  ? 86  TRP B CD1 1 
ATOM   4811 C CD2 . TRP B 1 85  ? 11.578  -65.078 -25.696 1.00 23.17  ? 86  TRP B CD2 1 
ATOM   4812 N NE1 . TRP B 1 85  ? 13.220  -64.924 -24.178 1.00 27.57  ? 86  TRP B NE1 1 
ATOM   4813 C CE2 . TRP B 1 85  ? 12.018  -65.531 -24.437 1.00 27.07  ? 86  TRP B CE2 1 
ATOM   4814 C CE3 . TRP B 1 85  ? 10.359  -65.547 -26.195 1.00 24.41  ? 86  TRP B CE3 1 
ATOM   4815 C CZ2 . TRP B 1 85  ? 11.276  -66.425 -23.665 1.00 23.69  ? 86  TRP B CZ2 1 
ATOM   4816 C CZ3 . TRP B 1 85  ? 9.629   -66.443 -25.431 1.00 24.80  ? 86  TRP B CZ3 1 
ATOM   4817 C CH2 . TRP B 1 85  ? 10.090  -66.871 -24.180 1.00 22.71  ? 86  TRP B CH2 1 
ATOM   4818 N N   . ASN B 1 86  ? 14.039  -63.257 -30.503 1.00 24.40  ? 87  ASN B N   1 
ATOM   4819 C CA  . ASN B 1 86  ? 14.211  -62.467 -31.709 1.00 27.21  ? 87  ASN B CA  1 
ATOM   4820 C C   . ASN B 1 86  ? 13.777  -63.219 -32.974 1.00 27.05  ? 87  ASN B C   1 
ATOM   4821 O O   . ASN B 1 86  ? 13.676  -64.447 -32.958 1.00 24.02  ? 87  ASN B O   1 
ATOM   4822 C CB  . ASN B 1 86  ? 15.669  -62.005 -31.797 1.00 26.61  ? 87  ASN B CB  1 
ATOM   4823 C CG  . ASN B 1 86  ? 15.939  -60.791 -30.929 1.00 31.19  ? 87  ASN B CG  1 
ATOM   4824 O OD1 . ASN B 1 86  ? 15.022  -60.027 -30.611 1.00 31.37  ? 87  ASN B OD1 1 
ATOM   4825 N ND2 . ASN B 1 86  ? 17.194  -60.595 -30.556 1.00 30.23  ? 87  ASN B ND2 1 
ATOM   4826 N N   . PRO B 1 87  ? 13.489  -62.483 -34.067 1.00 28.70  ? 88  PRO B N   1 
ATOM   4827 C CA  . PRO B 1 87  ? 13.042  -63.129 -35.311 1.00 24.73  ? 88  PRO B CA  1 
ATOM   4828 C C   . PRO B 1 87  ? 14.033  -64.165 -35.837 1.00 26.93  ? 88  PRO B C   1 
ATOM   4829 O O   . PRO B 1 87  ? 15.239  -63.917 -35.882 1.00 24.54  ? 88  PRO B O   1 
ATOM   4830 C CB  . PRO B 1 87  ? 12.943  -61.961 -36.293 1.00 25.41  ? 88  PRO B CB  1 
ATOM   4831 C CG  . PRO B 1 87  ? 12.684  -60.766 -35.431 1.00 22.52  ? 88  PRO B CG  1 
ATOM   4832 C CD  . PRO B 1 87  ? 13.486  -61.012 -34.182 1.00 23.84  ? 88  PRO B CD  1 
ATOM   4833 N N   . ASN B 1 88  ? 13.518  -65.326 -36.222 1.00 25.07  ? 89  ASN B N   1 
ATOM   4834 C CA  . ASN B 1 88  ? 14.351  -66.382 -36.775 1.00 28.13  ? 89  ASN B CA  1 
ATOM   4835 C C   . ASN B 1 88  ? 13.978  -66.684 -38.228 1.00 26.40  ? 89  ASN B C   1 
ATOM   4836 O O   . ASN B 1 88  ? 14.337  -67.725 -38.770 1.00 30.70  ? 89  ASN B O   1 
ATOM   4837 C CB  . ASN B 1 88  ? 14.257  -67.646 -35.915 1.00 25.70  ? 89  ASN B CB  1 
ATOM   4838 C CG  . ASN B 1 88  ? 12.887  -68.279 -35.971 1.00 28.90  ? 89  ASN B CG  1 
ATOM   4839 O OD1 . ASN B 1 88  ? 11.881  -67.598 -36.199 1.00 26.17  ? 89  ASN B OD1 1 
ATOM   4840 N ND2 . ASN B 1 88  ? 12.834  -69.588 -35.768 1.00 31.61  ? 89  ASN B ND2 1 
ATOM   4841 N N   . ARG B 1 89  ? 13.224  -65.776 -38.835 1.00 26.62  ? 90  ARG B N   1 
ATOM   4842 C CA  . ARG B 1 89  ? 13.050  -65.743 -40.285 1.00 27.76  ? 90  ARG B CA  1 
ATOM   4843 C C   . ARG B 1 89  ? 13.192  -64.288 -40.667 1.00 33.55  ? 90  ARG B C   1 
ATOM   4844 O O   . ARG B 1 89  ? 13.298  -63.427 -39.789 1.00 31.98  ? 90  ARG B O   1 
ATOM   4845 C CB  . ARG B 1 89  ? 11.671  -66.235 -40.693 1.00 30.54  ? 90  ARG B CB  1 
ATOM   4846 C CG  . ARG B 1 89  ? 11.467  -67.716 -40.516 1.00 34.95  ? 90  ARG B CG  1 
ATOM   4847 C CD  . ARG B 1 89  ? 12.202  -68.480 -41.601 1.00 38.06  ? 90  ARG B CD  1 
ATOM   4848 N NE  . ARG B 1 89  ? 11.739  -69.858 -41.672 1.00 40.31  ? 90  ARG B NE  1 
ATOM   4849 C CZ  . ARG B 1 89  ? 12.142  -70.810 -40.841 1.00 38.78  ? 90  ARG B CZ  1 
ATOM   4850 N NH1 . ARG B 1 89  ? 13.023  -70.523 -39.890 1.00 27.30  ? 90  ARG B NH1 1 
ATOM   4851 N NH2 . ARG B 1 89  ? 11.662  -72.042 -40.964 1.00 38.10  ? 90  ARG B NH2 1 
ATOM   4852 N N   . GLU B 1 90  ? 13.199  -64.000 -41.961 1.00 31.02  ? 91  GLU B N   1 
ATOM   4853 C CA  . GLU B 1 90  ? 13.370  -62.626 -42.410 1.00 34.33  ? 91  GLU B CA  1 
ATOM   4854 C C   . GLU B 1 90  ? 12.140  -61.777 -42.069 1.00 31.36  ? 91  GLU B C   1 
ATOM   4855 O O   . GLU B 1 90  ? 11.014  -62.276 -42.016 1.00 25.72  ? 91  GLU B O   1 
ATOM   4856 C CB  . GLU B 1 90  ? 13.650  -62.576 -43.915 1.00 34.78  ? 91  GLU B CB  1 
ATOM   4857 C CG  . GLU B 1 90  ? 12.425  -62.801 -44.763 1.00 37.75  ? 91  GLU B CG  1 
ATOM   4858 C CD  . GLU B 1 90  ? 12.660  -62.506 -46.231 1.00 54.43  ? 91  GLU B CD  1 
ATOM   4859 O OE1 . GLU B 1 90  ? 13.703  -62.944 -46.766 1.00 61.34  ? 91  GLU B OE1 1 
ATOM   4860 O OE2 . GLU B 1 90  ? 11.799  -61.836 -46.847 1.00 53.03  ? 91  GLU B OE2 1 
ATOM   4861 N N   . LEU B 1 91  ? 12.375  -60.493 -41.833 1.00 28.97  ? 92  LEU B N   1 
ATOM   4862 C CA  . LEU B 1 91  ? 11.307  -59.545 -41.571 1.00 29.35  ? 92  LEU B CA  1 
ATOM   4863 C C   . LEU B 1 91  ? 10.595  -59.151 -42.861 1.00 34.11  ? 92  LEU B C   1 
ATOM   4864 O O   . LEU B 1 91  ? 11.228  -58.815 -43.857 1.00 33.42  ? 92  LEU B O   1 
ATOM   4865 C CB  . LEU B 1 91  ? 11.876  -58.295 -40.903 1.00 28.56  ? 92  LEU B CB  1 
ATOM   4866 C CG  . LEU B 1 91  ? 12.563  -58.512 -39.558 1.00 28.27  ? 92  LEU B CG  1 
ATOM   4867 C CD1 . LEU B 1 91  ? 13.020  -57.178 -38.982 1.00 24.15  ? 92  LEU B CD1 1 
ATOM   4868 C CD2 . LEU B 1 91  ? 11.603  -59.221 -38.616 1.00 27.00  ? 92  LEU B CD2 1 
ATOM   4869 N N   . SER B 1 92  ? 9.272   -59.183 -42.835 1.00 31.47  ? 93  SER B N   1 
ATOM   4870 C CA  . SER B 1 92  ? 8.491   -58.775 -43.986 1.00 30.81  ? 93  SER B CA  1 
ATOM   4871 C C   . SER B 1 92  ? 7.084   -58.374 -43.551 1.00 31.48  ? 93  SER B C   1 
ATOM   4872 O O   . SER B 1 92  ? 6.532   -58.943 -42.607 1.00 31.55  ? 93  SER B O   1 
ATOM   4873 C CB  . SER B 1 92  ? 8.424   -59.912 -45.009 1.00 24.17  ? 93  SER B CB  1 
ATOM   4874 O OG  . SER B 1 92  ? 7.515   -59.603 -46.057 1.00 24.19  ? 93  SER B OG  1 
ATOM   4875 N N   . GLU B 1 93  ? 6.505   -57.392 -44.236 1.00 30.46  ? 94  GLU B N   1 
ATOM   4876 C CA  . GLU B 1 93  ? 5.099   -57.057 -44.029 1.00 29.21  ? 94  GLU B CA  1 
ATOM   4877 C C   . GLU B 1 93  ? 4.213   -58.127 -44.665 1.00 28.50  ? 94  GLU B C   1 
ATOM   4878 O O   . GLU B 1 93  ? 3.027   -58.228 -44.365 1.00 32.38  ? 94  GLU B O   1 
ATOM   4879 C CB  . GLU B 1 93  ? 4.769   -55.682 -44.601 1.00 27.79  ? 94  GLU B CB  1 
ATOM   4880 C CG  . GLU B 1 93  ? 5.433   -54.521 -43.863 1.00 26.67  ? 94  GLU B CG  1 
ATOM   4881 C CD  . GLU B 1 93  ? 4.996   -53.173 -44.428 1.00 31.31  ? 94  GLU B CD  1 
ATOM   4882 O OE1 . GLU B 1 93  ? 3.922   -52.667 -44.034 1.00 31.57  ? 94  GLU B OE1 1 
ATOM   4883 O OE2 . GLU B 1 93  ? 5.717   -52.627 -45.284 1.00 33.95  ? 94  GLU B OE2 1 
ATOM   4884 N N   . ASP B 1 94  ? 4.801   -58.919 -45.554 1.00 28.71  ? 95  ASP B N   1 
ATOM   4885 C CA  . ASP B 1 94  ? 4.131   -60.092 -46.098 1.00 28.29  ? 95  ASP B CA  1 
ATOM   4886 C C   . ASP B 1 94  ? 4.324   -61.248 -45.107 1.00 30.80  ? 95  ASP B C   1 
ATOM   4887 O O   . ASP B 1 94  ? 5.230   -62.067 -45.264 1.00 24.90  ? 95  ASP B O   1 
ATOM   4888 C CB  . ASP B 1 94  ? 4.717   -60.411 -47.476 1.00 24.56  ? 95  ASP B CB  1 
ATOM   4889 C CG  . ASP B 1 94  ? 4.104   -61.645 -48.116 1.00 31.51  ? 95  ASP B CG  1 
ATOM   4890 O OD1 . ASP B 1 94  ? 3.132   -62.207 -47.571 1.00 32.34  ? 95  ASP B OD1 1 
ATOM   4891 O OD2 . ASP B 1 94  ? 4.597   -62.048 -49.187 1.00 38.90  ? 95  ASP B OD2 1 
ATOM   4892 N N   . CYS B 1 95  ? 3.469   -61.306 -44.083 1.00 29.00  ? 96  CYS B N   1 
ATOM   4893 C CA  . CYS B 1 95  ? 3.687   -62.223 -42.961 1.00 26.32  ? 96  CYS B CA  1 
ATOM   4894 C C   . CYS B 1 95  ? 2.445   -62.955 -42.467 1.00 25.35  ? 96  CYS B C   1 
ATOM   4895 O O   . CYS B 1 95  ? 2.506   -63.686 -41.482 1.00 27.78  ? 96  CYS B O   1 
ATOM   4896 C CB  . CYS B 1 95  ? 4.311   -61.476 -41.785 1.00 24.05  ? 96  CYS B CB  1 
ATOM   4897 S SG  . CYS B 1 95  ? 3.245   -60.175 -41.074 1.00 27.08  ? 96  CYS B SG  1 
ATOM   4898 N N   . LEU B 1 96  ? 1.317   -62.767 -43.137 1.00 24.79  ? 97  LEU B N   1 
ATOM   4899 C CA  . LEU B 1 96  ? 0.077   -63.349 -42.643 1.00 20.65  ? 97  LEU B CA  1 
ATOM   4900 C C   . LEU B 1 96  ? -0.116  -64.811 -43.056 1.00 25.59  ? 97  LEU B C   1 
ATOM   4901 O O   . LEU B 1 96  ? -0.893  -65.130 -43.962 1.00 28.44  ? 97  LEU B O   1 
ATOM   4902 C CB  . LEU B 1 96  ? -1.116  -62.471 -43.010 1.00 21.91  ? 97  LEU B CB  1 
ATOM   4903 C CG  . LEU B 1 96  ? -1.110  -61.113 -42.306 1.00 25.85  ? 97  LEU B CG  1 
ATOM   4904 C CD1 . LEU B 1 96  ? -2.381  -60.338 -42.634 1.00 26.68  ? 97  LEU B CD1 1 
ATOM   4905 C CD2 . LEU B 1 96  ? -0.947  -61.267 -40.777 1.00 18.58  ? 97  LEU B CD2 1 
ATOM   4906 N N   . TYR B 1 97  ? 0.600   -65.691 -42.359 1.00 25.29  ? 98  TYR B N   1 
ATOM   4907 C CA  . TYR B 1 97  ? 0.581   -67.122 -42.624 1.00 20.68  ? 98  TYR B CA  1 
ATOM   4908 C C   . TYR B 1 97  ? 0.336   -67.882 -41.315 1.00 26.49  ? 98  TYR B C   1 
ATOM   4909 O O   . TYR B 1 97  ? 0.713   -67.410 -40.245 1.00 25.15  ? 98  TYR B O   1 
ATOM   4910 C CB  . TYR B 1 97  ? 1.922   -67.551 -43.241 1.00 21.11  ? 98  TYR B CB  1 
ATOM   4911 C CG  . TYR B 1 97  ? 2.227   -66.863 -44.552 1.00 23.76  ? 98  TYR B CG  1 
ATOM   4912 C CD1 . TYR B 1 97  ? 1.889   -67.460 -45.772 1.00 27.61  ? 98  TYR B CD1 1 
ATOM   4913 C CD2 . TYR B 1 97  ? 2.836   -65.615 -44.579 1.00 22.73  ? 98  TYR B CD2 1 
ATOM   4914 C CE1 . TYR B 1 97  ? 2.160   -66.836 -46.976 1.00 27.39  ? 98  TYR B CE1 1 
ATOM   4915 C CE2 . TYR B 1 97  ? 3.107   -64.973 -45.775 1.00 29.22  ? 98  TYR B CE2 1 
ATOM   4916 C CZ  . TYR B 1 97  ? 2.770   -65.590 -46.972 1.00 33.48  ? 98  TYR B CZ  1 
ATOM   4917 O OH  . TYR B 1 97  ? 3.038   -64.953 -48.160 1.00 29.12  ? 98  TYR B OH  1 
ATOM   4918 N N   . LEU B 1 98  ? -0.296  -69.053 -41.397 1.00 25.43  ? 99  LEU B N   1 
ATOM   4919 C CA  . LEU B 1 98  ? -0.500  -69.882 -40.211 1.00 27.42  ? 99  LEU B CA  1 
ATOM   4920 C C   . LEU B 1 98  ? 0.051   -71.292 -40.390 1.00 26.78  ? 99  LEU B C   1 
ATOM   4921 O O   . LEU B 1 98  ? 0.462   -71.674 -41.476 1.00 25.43  ? 99  LEU B O   1 
ATOM   4922 C CB  . LEU B 1 98  ? -1.979  -69.907 -39.784 1.00 24.59  ? 99  LEU B CB  1 
ATOM   4923 C CG  . LEU B 1 98  ? -3.078  -70.332 -40.768 1.00 28.59  ? 99  LEU B CG  1 
ATOM   4924 C CD1 . LEU B 1 98  ? -3.137  -71.845 -40.961 1.00 25.44  ? 99  LEU B CD1 1 
ATOM   4925 C CD2 . LEU B 1 98  ? -4.434  -69.798 -40.305 1.00 26.70  ? 99  LEU B CD2 1 
ATOM   4926 N N   . ASN B 1 99  ? 0.047   -72.062 -39.311 1.00 28.49  ? 100 ASN B N   1 
ATOM   4927 C CA  . ASN B 1 99  ? 0.649   -73.385 -39.305 1.00 25.90  ? 100 ASN B CA  1 
ATOM   4928 C C   . ASN B 1 99  ? -0.292  -74.381 -38.664 1.00 26.36  ? 100 ASN B C   1 
ATOM   4929 O O   . ASN B 1 99  ? -0.926  -74.083 -37.648 1.00 28.00  ? 100 ASN B O   1 
ATOM   4930 C CB  . ASN B 1 99  ? 1.972   -73.364 -38.534 1.00 21.91  ? 100 ASN B CB  1 
ATOM   4931 C CG  . ASN B 1 99  ? 2.802   -72.140 -38.848 1.00 31.46  ? 100 ASN B CG  1 
ATOM   4932 O OD1 . ASN B 1 99  ? 3.283   -71.978 -39.973 1.00 27.37  ? 100 ASN B OD1 1 
ATOM   4933 N ND2 . ASN B 1 99  ? 2.969   -71.259 -37.855 1.00 26.32  ? 100 ASN B ND2 1 
ATOM   4934 N N   . VAL B 1 100 ? -0.384  -75.564 -39.259 1.00 24.70  ? 101 VAL B N   1 
ATOM   4935 C CA  . VAL B 1 100 ? -1.187  -76.639 -38.697 1.00 23.76  ? 101 VAL B CA  1 
ATOM   4936 C C   . VAL B 1 100 ? -0.303  -77.861 -38.478 1.00 28.65  ? 101 VAL B C   1 
ATOM   4937 O O   . VAL B 1 100 ? 0.416   -78.279 -39.383 1.00 29.66  ? 101 VAL B O   1 
ATOM   4938 C CB  . VAL B 1 100 ? -2.354  -77.025 -39.626 1.00 26.28  ? 101 VAL B CB  1 
ATOM   4939 C CG1 . VAL B 1 100 ? -3.177  -78.161 -39.020 1.00 23.05  ? 101 VAL B CG1 1 
ATOM   4940 C CG2 . VAL B 1 100 ? -3.232  -75.810 -39.931 1.00 21.55  ? 101 VAL B CG2 1 
ATOM   4941 N N   . TRP B 1 101 ? -0.325  -78.403 -37.263 1.00 26.54  ? 102 TRP B N   1 
ATOM   4942 C CA  . TRP B 1 101 ? 0.289   -79.695 -36.993 1.00 25.89  ? 102 TRP B CA  1 
ATOM   4943 C C   . TRP B 1 101 ? -0.808  -80.713 -36.692 1.00 31.59  ? 102 TRP B C   1 
ATOM   4944 O O   . TRP B 1 101 ? -1.738  -80.424 -35.926 1.00 31.15  ? 102 TRP B O   1 
ATOM   4945 C CB  . TRP B 1 101 ? 1.200   -79.623 -35.785 1.00 26.11  ? 102 TRP B CB  1 
ATOM   4946 C CG  . TRP B 1 101 ? 2.493   -78.898 -35.935 1.00 24.27  ? 102 TRP B CG  1 
ATOM   4947 C CD1 . TRP B 1 101 ? 3.715   -79.448 -36.212 1.00 24.62  ? 102 TRP B CD1 1 
ATOM   4948 C CD2 . TRP B 1 101 ? 2.716   -77.498 -35.736 1.00 22.36  ? 102 TRP B CD2 1 
ATOM   4949 N NE1 . TRP B 1 101 ? 4.681   -78.469 -36.216 1.00 25.72  ? 102 TRP B NE1 1 
ATOM   4950 C CE2 . TRP B 1 101 ? 4.092   -77.264 -35.926 1.00 26.37  ? 102 TRP B CE2 1 
ATOM   4951 C CE3 . TRP B 1 101 ? 1.883   -76.418 -35.419 1.00 23.93  ? 102 TRP B CE3 1 
ATOM   4952 C CZ2 . TRP B 1 101 ? 4.655   -75.991 -35.805 1.00 23.96  ? 102 TRP B CZ2 1 
ATOM   4953 C CZ3 . TRP B 1 101 ? 2.442   -75.160 -35.297 1.00 20.73  ? 102 TRP B CZ3 1 
ATOM   4954 C CH2 . TRP B 1 101 ? 3.816   -74.958 -35.486 1.00 23.48  ? 102 TRP B CH2 1 
ATOM   4955 N N   . THR B 1 102 ? -0.694  -81.904 -37.278 1.00 29.80  ? 103 THR B N   1 
ATOM   4956 C CA  . THR B 1 102 ? -1.703  -82.947 -37.103 1.00 26.23  ? 103 THR B CA  1 
ATOM   4957 C C   . THR B 1 102 ? -1.011  -84.301 -36.984 1.00 30.65  ? 103 THR B C   1 
ATOM   4958 O O   . THR B 1 102 ? 0.122   -84.459 -37.445 1.00 34.08  ? 103 THR B O   1 
ATOM   4959 C CB  . THR B 1 102 ? -2.730  -82.934 -38.267 1.00 33.75  ? 103 THR B CB  1 
ATOM   4960 O OG1 . THR B 1 102 ? -3.941  -83.589 -37.869 1.00 37.01  ? 103 THR B OG1 1 
ATOM   4961 C CG2 . THR B 1 102 ? -2.166  -83.615 -39.511 1.00 33.21  ? 103 THR B CG2 1 
ATOM   4962 N N   . PRO B 1 103 ? -1.661  -85.274 -36.320 1.00 37.41  ? 104 PRO B N   1 
ATOM   4963 C CA  . PRO B 1 103 ? -1.044  -86.604 -36.191 1.00 37.11  ? 104 PRO B CA  1 
ATOM   4964 C C   . PRO B 1 103 ? -0.884  -87.316 -37.533 1.00 41.56  ? 104 PRO B C   1 
ATOM   4965 O O   . PRO B 1 103 ? -1.606  -87.013 -38.484 1.00 38.77  ? 104 PRO B O   1 
ATOM   4966 C CB  . PRO B 1 103 ? -2.028  -87.361 -35.297 1.00 36.21  ? 104 PRO B CB  1 
ATOM   4967 C CG  . PRO B 1 103 ? -2.694  -86.290 -34.497 1.00 35.69  ? 104 PRO B CG  1 
ATOM   4968 C CD  . PRO B 1 103 ? -2.835  -85.126 -35.440 1.00 34.78  ? 104 PRO B CD  1 
ATOM   4969 N N   . TYR B 1 104 ? 0.069   -88.244 -37.588 1.00 46.45  ? 105 TYR B N   1 
ATOM   4970 C CA  . TYR B 1 104 ? 0.389   -89.011 -38.788 1.00 43.21  ? 105 TYR B CA  1 
ATOM   4971 C C   . TYR B 1 104 ? 0.280   -90.503 -38.460 1.00 48.13  ? 105 TYR B C   1 
ATOM   4972 O O   . TYR B 1 104 ? 1.103   -91.039 -37.717 1.00 51.36  ? 105 TYR B O   1 
ATOM   4973 C CB  . TYR B 1 104 ? 1.812   -88.678 -39.257 1.00 44.93  ? 105 TYR B CB  1 
ATOM   4974 C CG  . TYR B 1 104 ? 2.197   -89.229 -40.621 1.00 53.11  ? 105 TYR B CG  1 
ATOM   4975 C CD1 . TYR B 1 104 ? 2.353   -90.601 -40.834 1.00 51.76  ? 105 TYR B CD1 1 
ATOM   4976 C CD2 . TYR B 1 104 ? 2.440   -88.372 -41.691 1.00 54.23  ? 105 TYR B CD2 1 
ATOM   4977 C CE1 . TYR B 1 104 ? 2.718   -91.101 -42.077 1.00 48.96  ? 105 TYR B CE1 1 
ATOM   4978 C CE2 . TYR B 1 104 ? 2.808   -88.863 -42.942 1.00 53.00  ? 105 TYR B CE2 1 
ATOM   4979 C CZ  . TYR B 1 104 ? 2.945   -90.226 -43.130 1.00 58.06  ? 105 TYR B CZ  1 
ATOM   4980 O OH  . TYR B 1 104 ? 3.305   -90.706 -44.374 1.00 49.28  ? 105 TYR B OH  1 
ATOM   4981 N N   . PRO B 1 105 ? -0.720  -91.192 -39.030 1.00 46.66  ? 106 PRO B N   1 
ATOM   4982 C CA  . PRO B 1 105 ? -1.677  -90.707 -40.030 1.00 49.46  ? 106 PRO B CA  1 
ATOM   4983 C C   . PRO B 1 105 ? -2.732  -89.760 -39.470 1.00 49.28  ? 106 PRO B C   1 
ATOM   4984 O O   . PRO B 1 105 ? -3.029  -89.766 -38.264 1.00 51.82  ? 106 PRO B O   1 
ATOM   4985 C CB  . PRO B 1 105 ? -2.357  -91.993 -40.498 1.00 46.23  ? 106 PRO B CB  1 
ATOM   4986 C CG  . PRO B 1 105 ? -2.334  -92.857 -39.288 1.00 44.32  ? 106 PRO B CG  1 
ATOM   4987 C CD  . PRO B 1 105 ? -1.000  -92.586 -38.643 1.00 43.58  ? 106 PRO B CD  1 
ATOM   4988 N N   . ARG B 1 106 ? -3.283  -88.954 -40.371 1.00 40.70  ? 107 ARG B N   1 
ATOM   4989 C CA  . ARG B 1 106 ? -4.345  -88.007 -40.070 1.00 47.18  ? 107 ARG B CA  1 
ATOM   4990 C C   . ARG B 1 106 ? -5.473  -88.687 -39.294 1.00 47.44  ? 107 ARG B C   1 
ATOM   4991 O O   . ARG B 1 106 ? -5.844  -89.819 -39.594 1.00 46.99  ? 107 ARG B O   1 
ATOM   4992 C CB  . ARG B 1 106 ? -4.870  -87.419 -41.383 1.00 47.39  ? 107 ARG B CB  1 
ATOM   4993 C CG  . ARG B 1 106 ? -5.552  -86.075 -41.267 1.00 44.50  ? 107 ARG B CG  1 
ATOM   4994 C CD  . ARG B 1 106 ? -5.975  -85.559 -42.633 1.00 47.91  ? 107 ARG B CD  1 
ATOM   4995 N NE  . ARG B 1 106 ? -4.842  -85.428 -43.548 1.00 54.72  ? 107 ARG B NE  1 
ATOM   4996 C CZ  . ARG B 1 106 ? -4.961  -85.176 -44.852 1.00 57.14  ? 107 ARG B CZ  1 
ATOM   4997 N NH1 . ARG B 1 106 ? -6.165  -85.027 -45.395 1.00 46.17  ? 107 ARG B NH1 1 
ATOM   4998 N NH2 . ARG B 1 106 ? -3.877  -85.075 -45.618 1.00 45.40  ? 107 ARG B NH2 1 
ATOM   4999 N N   . PRO B 1 107 ? -5.997  -88.008 -38.266 1.00 52.99  ? 108 PRO B N   1 
ATOM   5000 C CA  . PRO B 1 107 ? -7.057  -88.552 -37.411 1.00 53.28  ? 108 PRO B CA  1 
ATOM   5001 C C   . PRO B 1 107 ? -8.265  -89.042 -38.202 1.00 55.79  ? 108 PRO B C   1 
ATOM   5002 O O   . PRO B 1 107 ? -8.685  -88.384 -39.156 1.00 52.63  ? 108 PRO B O   1 
ATOM   5003 C CB  . PRO B 1 107 ? -7.453  -87.350 -36.553 1.00 47.05  ? 108 PRO B CB  1 
ATOM   5004 C CG  . PRO B 1 107 ? -6.198  -86.565 -36.438 1.00 46.46  ? 108 PRO B CG  1 
ATOM   5005 C CD  . PRO B 1 107 ? -5.512  -86.706 -37.775 1.00 50.09  ? 108 PRO B CD  1 
ATOM   5006 N N   . THR B 1 108 ? -8.808  -90.187 -37.796 1.00 58.30  ? 109 THR B N   1 
ATOM   5007 C CA  . THR B 1 108 ? -9.986  -90.763 -38.437 1.00 59.22  ? 109 THR B CA  1 
ATOM   5008 C C   . THR B 1 108 ? -11.256 -90.024 -38.012 1.00 55.70  ? 109 THR B C   1 
ATOM   5009 O O   . THR B 1 108 ? -12.155 -89.803 -38.822 1.00 54.91  ? 109 THR B O   1 
ATOM   5010 C CB  . THR B 1 108 ? -10.128 -92.261 -38.096 1.00 55.23  ? 109 THR B CB  1 
ATOM   5011 O OG1 . THR B 1 108 ? -10.219 -92.420 -36.676 1.00 71.40  ? 109 THR B OG1 1 
ATOM   5012 C CG2 . THR B 1 108 ? -8.926  -93.039 -38.595 1.00 51.44  ? 109 THR B CG2 1 
ATOM   5013 N N   . SER B 1 109 ? -11.317 -89.640 -36.738 1.00 54.47  ? 110 SER B N   1 
ATOM   5014 C CA  . SER B 1 109 ? -12.467 -88.918 -36.188 1.00 52.91  ? 110 SER B CA  1 
ATOM   5015 C C   . SER B 1 109 ? -12.058 -87.519 -35.714 1.00 48.93  ? 110 SER B C   1 
ATOM   5016 O O   . SER B 1 109 ? -10.909 -87.321 -35.327 1.00 45.02  ? 110 SER B O   1 
ATOM   5017 C CB  . SER B 1 109 ? -13.063 -89.720 -35.033 1.00 47.52  ? 110 SER B CB  1 
ATOM   5018 O OG  . SER B 1 109 ? -12.035 -90.295 -34.243 1.00 54.24  ? 110 SER B OG  1 
ATOM   5019 N N   . PRO B 1 110 ? -12.995 -86.546 -35.748 1.00 51.35  ? 111 PRO B N   1 
ATOM   5020 C CA  . PRO B 1 110 ? -12.730 -85.142 -35.380 1.00 47.47  ? 111 PRO B CA  1 
ATOM   5021 C C   . PRO B 1 110 ? -11.974 -84.969 -34.059 1.00 46.14  ? 111 PRO B C   1 
ATOM   5022 O O   . PRO B 1 110 ? -12.383 -85.496 -33.026 1.00 45.19  ? 111 PRO B O   1 
ATOM   5023 C CB  . PRO B 1 110 ? -14.131 -84.540 -35.269 1.00 44.92  ? 111 PRO B CB  1 
ATOM   5024 C CG  . PRO B 1 110 ? -14.935 -85.324 -36.242 1.00 44.09  ? 111 PRO B CG  1 
ATOM   5025 C CD  . PRO B 1 110 ? -14.390 -86.734 -36.187 1.00 45.35  ? 111 PRO B CD  1 
ATOM   5026 N N   . THR B 1 111 ? -10.881 -84.213 -34.118 1.00 47.02  ? 112 THR B N   1 
ATOM   5027 C CA  . THR B 1 111 ? -9.918  -84.096 -33.024 1.00 44.60  ? 112 THR B CA  1 
ATOM   5028 C C   . THR B 1 111 ? -9.881  -82.670 -32.455 1.00 37.95  ? 112 THR B C   1 
ATOM   5029 O O   . THR B 1 111 ? -9.888  -81.700 -33.215 1.00 38.03  ? 112 THR B O   1 
ATOM   5030 C CB  . THR B 1 111 ? -8.512  -84.494 -33.534 1.00 39.58  ? 112 THR B CB  1 
ATOM   5031 O OG1 . THR B 1 111 ? -8.546  -85.847 -34.006 1.00 47.95  ? 112 THR B OG1 1 
ATOM   5032 C CG2 . THR B 1 111 ? -7.465  -84.378 -32.447 1.00 38.91  ? 112 THR B CG2 1 
ATOM   5033 N N   . PRO B 1 112 ? -9.855  -82.539 -31.116 1.00 36.56  ? 113 PRO B N   1 
ATOM   5034 C CA  . PRO B 1 112 ? -9.733  -81.234 -30.449 1.00 37.71  ? 113 PRO B CA  1 
ATOM   5035 C C   . PRO B 1 112 ? -8.531  -80.417 -30.945 1.00 33.35  ? 113 PRO B C   1 
ATOM   5036 O O   . PRO B 1 112 ? -7.439  -80.952 -31.186 1.00 30.64  ? 113 PRO B O   1 
ATOM   5037 C CB  . PRO B 1 112 ? -9.545  -81.609 -28.970 1.00 42.28  ? 113 PRO B CB  1 
ATOM   5038 C CG  . PRO B 1 112 ? -9.193  -83.075 -28.974 1.00 41.85  ? 113 PRO B CG  1 
ATOM   5039 C CD  . PRO B 1 112 ? -9.944  -83.632 -30.136 1.00 43.03  ? 113 PRO B CD  1 
ATOM   5040 N N   . VAL B 1 113 ? -8.750  -79.117 -31.098 1.00 26.80  ? 114 VAL B N   1 
ATOM   5041 C CA  . VAL B 1 113 ? -7.740  -78.227 -31.641 1.00 26.79  ? 114 VAL B CA  1 
ATOM   5042 C C   . VAL B 1 113 ? -7.253  -77.210 -30.612 1.00 29.82  ? 114 VAL B C   1 
ATOM   5043 O O   . VAL B 1 113 ? -8.060  -76.547 -29.949 1.00 31.85  ? 114 VAL B O   1 
ATOM   5044 C CB  . VAL B 1 113 ? -8.277  -77.451 -32.848 1.00 27.28  ? 114 VAL B CB  1 
ATOM   5045 C CG1 . VAL B 1 113 ? -7.166  -76.649 -33.486 1.00 25.27  ? 114 VAL B CG1 1 
ATOM   5046 C CG2 . VAL B 1 113 ? -8.898  -78.404 -33.868 1.00 26.97  ? 114 VAL B CG2 1 
ATOM   5047 N N   . LEU B 1 114 ? -5.931  -77.106 -30.484 1.00 23.00  ? 115 LEU B N   1 
ATOM   5048 C CA  . LEU B 1 114 ? -5.298  -76.025 -29.737 1.00 30.75  ? 115 LEU B CA  1 
ATOM   5049 C C   . LEU B 1 114 ? -4.775  -74.939 -30.689 1.00 30.02  ? 115 LEU B C   1 
ATOM   5050 O O   . LEU B 1 114 ? -3.997  -75.229 -31.602 1.00 28.87  ? 115 LEU B O   1 
ATOM   5051 C CB  . LEU B 1 114 ? -4.140  -76.577 -28.909 1.00 27.09  ? 115 LEU B CB  1 
ATOM   5052 C CG  . LEU B 1 114 ? -4.477  -77.304 -27.615 1.00 29.71  ? 115 LEU B CG  1 
ATOM   5053 C CD1 . LEU B 1 114 ? -3.264  -78.083 -27.164 1.00 33.34  ? 115 LEU B CD1 1 
ATOM   5054 C CD2 . LEU B 1 114 ? -4.863  -76.296 -26.566 1.00 24.42  ? 115 LEU B CD2 1 
ATOM   5055 N N   . VAL B 1 115 ? -5.192  -73.693 -30.471 1.00 28.38  ? 116 VAL B N   1 
ATOM   5056 C CA  . VAL B 1 115 ? -4.685  -72.573 -31.262 1.00 22.03  ? 116 VAL B CA  1 
ATOM   5057 C C   . VAL B 1 115 ? -3.778  -71.660 -30.429 1.00 29.36  ? 116 VAL B C   1 
ATOM   5058 O O   . VAL B 1 115 ? -4.244  -70.999 -29.497 1.00 27.90  ? 116 VAL B O   1 
ATOM   5059 C CB  . VAL B 1 115 ? -5.828  -71.740 -31.863 1.00 25.48  ? 116 VAL B CB  1 
ATOM   5060 C CG1 . VAL B 1 115 ? -5.270  -70.639 -32.750 1.00 23.34  ? 116 VAL B CG1 1 
ATOM   5061 C CG2 . VAL B 1 115 ? -6.776  -72.628 -32.660 1.00 25.89  ? 116 VAL B CG2 1 
ATOM   5062 N N   . TRP B 1 116 ? -2.489  -71.632 -30.772 1.00 23.31  ? 117 TRP B N   1 
ATOM   5063 C CA  . TRP B 1 116 ? -1.500  -70.810 -30.079 1.00 21.50  ? 117 TRP B CA  1 
ATOM   5064 C C   . TRP B 1 116 ? -1.445  -69.370 -30.574 1.00 24.88  ? 117 TRP B C   1 
ATOM   5065 O O   . TRP B 1 116 ? -1.398  -69.119 -31.777 1.00 28.44  ? 117 TRP B O   1 
ATOM   5066 C CB  . TRP B 1 116 ? -0.108  -71.421 -30.221 1.00 21.22  ? 117 TRP B CB  1 
ATOM   5067 C CG  . TRP B 1 116 ? 0.987   -70.602 -29.566 1.00 24.57  ? 117 TRP B CG  1 
ATOM   5068 C CD1 . TRP B 1 116 ? 2.025   -69.947 -30.188 1.00 22.92  ? 117 TRP B CD1 1 
ATOM   5069 C CD2 . TRP B 1 116 ? 1.154   -70.366 -28.156 1.00 23.08  ? 117 TRP B CD2 1 
ATOM   5070 N NE1 . TRP B 1 116 ? 2.822   -69.318 -29.245 1.00 22.60  ? 117 TRP B NE1 1 
ATOM   5071 C CE2 . TRP B 1 116 ? 2.308   -69.564 -27.995 1.00 22.37  ? 117 TRP B CE2 1 
ATOM   5072 C CE3 . TRP B 1 116 ? 0.440   -70.757 -27.018 1.00 22.30  ? 117 TRP B CE3 1 
ATOM   5073 C CZ2 . TRP B 1 116 ? 2.753   -69.140 -26.739 1.00 23.49  ? 117 TRP B CZ2 1 
ATOM   5074 C CZ3 . TRP B 1 116 ? 0.886   -70.337 -25.769 1.00 21.66  ? 117 TRP B CZ3 1 
ATOM   5075 C CH2 . TRP B 1 116 ? 2.030   -69.537 -25.642 1.00 23.51  ? 117 TRP B CH2 1 
ATOM   5076 N N   . ILE B 1 117 ? -1.433  -68.423 -29.641 1.00 26.29  ? 118 ILE B N   1 
ATOM   5077 C CA  . ILE B 1 117 ? -1.210  -67.022 -29.978 1.00 23.53  ? 118 ILE B CA  1 
ATOM   5078 C C   . ILE B 1 117 ? 0.008   -66.522 -29.213 1.00 25.71  ? 118 ILE B C   1 
ATOM   5079 O O   . ILE B 1 117 ? -0.024  -66.419 -27.980 1.00 24.80  ? 118 ILE B O   1 
ATOM   5080 C CB  . ILE B 1 117 ? -2.428  -66.148 -29.642 1.00 22.26  ? 118 ILE B CB  1 
ATOM   5081 C CG1 . ILE B 1 117 ? -3.665  -66.677 -30.357 1.00 19.68  ? 118 ILE B CG1 1 
ATOM   5082 C CG2 . ILE B 1 117 ? -2.176  -64.693 -30.035 1.00 18.57  ? 118 ILE B CG2 1 
ATOM   5083 C CD1 . ILE B 1 117 ? -4.930  -65.960 -29.972 1.00 21.27  ? 118 ILE B CD1 1 
ATOM   5084 N N   . TYR B 1 118 ? 1.092   -66.233 -29.930 1.00 22.81  ? 119 TYR B N   1 
ATOM   5085 C CA  . TYR B 1 118 ? 2.334   -65.844 -29.263 1.00 21.02  ? 119 TYR B CA  1 
ATOM   5086 C C   . TYR B 1 118 ? 2.218   -64.489 -28.594 1.00 19.09  ? 119 TYR B C   1 
ATOM   5087 O O   . TYR B 1 118 ? 1.409   -63.651 -29.007 1.00 21.32  ? 119 TYR B O   1 
ATOM   5088 C CB  . TYR B 1 118 ? 3.519   -65.833 -30.236 1.00 22.88  ? 119 TYR B CB  1 
ATOM   5089 C CG  . TYR B 1 118 ? 3.361   -64.943 -31.459 1.00 18.61  ? 119 TYR B CG  1 
ATOM   5090 C CD1 . TYR B 1 118 ? 3.447   -63.556 -31.362 1.00 23.27  ? 119 TYR B CD1 1 
ATOM   5091 C CD2 . TYR B 1 118 ? 3.173   -65.496 -32.717 1.00 23.07  ? 119 TYR B CD2 1 
ATOM   5092 C CE1 . TYR B 1 118 ? 3.320   -62.749 -32.484 1.00 21.42  ? 119 TYR B CE1 1 
ATOM   5093 C CE2 . TYR B 1 118 ? 3.050   -64.698 -33.847 1.00 23.34  ? 119 TYR B CE2 1 
ATOM   5094 C CZ  . TYR B 1 118 ? 3.122   -63.329 -33.723 1.00 23.07  ? 119 TYR B CZ  1 
ATOM   5095 O OH  . TYR B 1 118 ? 2.986   -62.543 -34.843 1.00 23.35  ? 119 TYR B OH  1 
ATOM   5096 N N   . GLY B 1 119 ? 3.043   -64.282 -27.574 1.00 19.63  ? 120 GLY B N   1 
ATOM   5097 C CA  . GLY B 1 119 ? 3.184   -62.987 -26.928 1.00 20.43  ? 120 GLY B CA  1 
ATOM   5098 C C   . GLY B 1 119 ? 4.358   -62.196 -27.486 1.00 23.44  ? 120 GLY B C   1 
ATOM   5099 O O   . GLY B 1 119 ? 4.860   -62.488 -28.579 1.00 25.19  ? 120 GLY B O   1 
ATOM   5100 N N   . GLY B 1 120 ? 4.797   -61.185 -26.741 1.00 26.34  ? 121 GLY B N   1 
ATOM   5101 C CA  . GLY B 1 120 ? 5.831   -60.284 -27.221 1.00 25.80  ? 121 GLY B CA  1 
ATOM   5102 C C   . GLY B 1 120 ? 5.401   -58.824 -27.185 1.00 26.90  ? 121 GLY B C   1 
ATOM   5103 O O   . GLY B 1 120 ? 5.833   -58.019 -28.017 1.00 23.99  ? 121 GLY B O   1 
ATOM   5104 N N   . GLY B 1 121 ? 4.550   -58.488 -26.215 1.00 26.54  ? 122 GLY B N   1 
ATOM   5105 C CA  . GLY B 1 121 ? 4.164   -57.112 -25.950 1.00 21.69  ? 122 GLY B CA  1 
ATOM   5106 C C   . GLY B 1 121 ? 3.384   -56.412 -27.043 1.00 23.25  ? 122 GLY B C   1 
ATOM   5107 O O   . GLY B 1 121 ? 3.263   -55.189 -27.017 1.00 24.97  ? 122 GLY B O   1 
ATOM   5108 N N   . PHE B 1 122 ? 2.864   -57.187 -27.996 1.00 23.98  ? 123 PHE B N   1 
ATOM   5109 C CA  . PHE B 1 122 ? 2.204   -56.663 -29.189 1.00 21.68  ? 123 PHE B CA  1 
ATOM   5110 C C   . PHE B 1 122 ? 3.153   -55.933 -30.142 1.00 22.97  ? 123 PHE B C   1 
ATOM   5111 O O   . PHE B 1 122 ? 2.694   -55.349 -31.122 1.00 21.18  ? 123 PHE B O   1 
ATOM   5112 C CB  . PHE B 1 122 ? 1.017   -55.744 -28.841 1.00 23.44  ? 123 PHE B CB  1 
ATOM   5113 C CG  . PHE B 1 122 ? -0.163  -56.462 -28.236 1.00 21.44  ? 123 PHE B CG  1 
ATOM   5114 C CD1 . PHE B 1 122 ? -0.953  -57.296 -29.009 1.00 20.75  ? 123 PHE B CD1 1 
ATOM   5115 C CD2 . PHE B 1 122 ? -0.492  -56.284 -26.898 1.00 20.04  ? 123 PHE B CD2 1 
ATOM   5116 C CE1 . PHE B 1 122 ? -2.041  -57.966 -28.454 1.00 22.95  ? 123 PHE B CE1 1 
ATOM   5117 C CE2 . PHE B 1 122 ? -1.583  -56.946 -26.328 1.00 24.35  ? 123 PHE B CE2 1 
ATOM   5118 C CZ  . PHE B 1 122 ? -2.365  -57.783 -27.110 1.00 23.60  ? 123 PHE B CZ  1 
ATOM   5119 N N   . TYR B 1 123 ? 4.458   -55.954 -29.860 1.00 21.84  ? 124 TYR B N   1 
ATOM   5120 C CA  . TYR B 1 123 ? 5.433   -55.272 -30.723 1.00 27.73  ? 124 TYR B CA  1 
ATOM   5121 C C   . TYR B 1 123 ? 6.391   -56.253 -31.401 1.00 26.60  ? 124 TYR B C   1 
ATOM   5122 O O   . TYR B 1 123 ? 7.207   -55.850 -32.231 1.00 24.21  ? 124 TYR B O   1 
ATOM   5123 C CB  . TYR B 1 123 ? 6.262   -54.235 -29.941 1.00 21.13  ? 124 TYR B CB  1 
ATOM   5124 C CG  . TYR B 1 123 ? 7.236   -54.867 -28.972 1.00 23.73  ? 124 TYR B CG  1 
ATOM   5125 C CD1 . TYR B 1 123 ? 8.536   -55.184 -29.358 1.00 22.03  ? 124 TYR B CD1 1 
ATOM   5126 C CD2 . TYR B 1 123 ? 6.848   -55.170 -27.677 1.00 27.18  ? 124 TYR B CD2 1 
ATOM   5127 C CE1 . TYR B 1 123 ? 9.411   -55.787 -28.485 1.00 24.55  ? 124 TYR B CE1 1 
ATOM   5128 C CE2 . TYR B 1 123 ? 7.718   -55.768 -26.791 1.00 24.97  ? 124 TYR B CE2 1 
ATOM   5129 C CZ  . TYR B 1 123 ? 8.996   -56.076 -27.200 1.00 27.01  ? 124 TYR B CZ  1 
ATOM   5130 O OH  . TYR B 1 123 ? 9.853   -56.674 -26.314 1.00 23.73  ? 124 TYR B OH  1 
ATOM   5131 N N   . SER B 1 124 ? 6.313   -57.523 -31.016 1.00 21.67  ? 125 SER B N   1 
ATOM   5132 C CA  . SER B 1 124 ? 7.270   -58.530 -31.464 1.00 20.97  ? 125 SER B CA  1 
ATOM   5133 C C   . SER B 1 124 ? 6.649   -59.910 -31.361 1.00 22.19  ? 125 SER B C   1 
ATOM   5134 O O   . SER B 1 124 ? 5.525   -60.053 -30.888 1.00 23.56  ? 125 SER B O   1 
ATOM   5135 C CB  . SER B 1 124 ? 8.532   -58.498 -30.594 1.00 22.61  ? 125 SER B CB  1 
ATOM   5136 O OG  . SER B 1 124 ? 8.225   -58.774 -29.231 1.00 23.52  ? 125 SER B OG  1 
ATOM   5137 N N   . GLY B 1 125 ? 7.399   -60.927 -31.778 1.00 22.37  ? 126 GLY B N   1 
ATOM   5138 C CA  . GLY B 1 125 ? 6.957   -62.305 -31.674 1.00 17.94  ? 126 GLY B CA  1 
ATOM   5139 C C   . GLY B 1 125 ? 6.716   -62.932 -33.028 1.00 24.50  ? 126 GLY B C   1 
ATOM   5140 O O   . GLY B 1 125 ? 6.575   -62.223 -34.040 1.00 23.60  ? 126 GLY B O   1 
ATOM   5141 N N   . ALA B 1 126 ? 6.650   -64.262 -33.050 1.00 24.65  ? 127 ALA B N   1 
ATOM   5142 C CA  . ALA B 1 126 ? 6.433   -65.003 -34.292 1.00 25.14  ? 127 ALA B CA  1 
ATOM   5143 C C   . ALA B 1 126 ? 6.074   -66.448 -33.988 1.00 27.18  ? 127 ALA B C   1 
ATOM   5144 O O   . ALA B 1 126 ? 6.529   -67.005 -32.988 1.00 22.69  ? 127 ALA B O   1 
ATOM   5145 C CB  . ALA B 1 126 ? 7.686   -64.945 -35.177 1.00 22.46  ? 127 ALA B CB  1 
ATOM   5146 N N   . SER B 1 127 ? 5.289   -67.074 -34.861 1.00 25.90  ? 128 SER B N   1 
ATOM   5147 C CA  . SER B 1 127 ? 4.900   -68.460 -34.616 1.00 26.79  ? 128 SER B CA  1 
ATOM   5148 C C   . SER B 1 127 ? 6.010   -69.440 -34.986 1.00 29.82  ? 128 SER B C   1 
ATOM   5149 O O   . SER B 1 127 ? 5.892   -70.645 -34.748 1.00 25.94  ? 128 SER B O   1 
ATOM   5150 C CB  . SER B 1 127 ? 3.606   -68.808 -35.345 1.00 23.09  ? 128 SER B CB  1 
ATOM   5151 O OG  . SER B 1 127 ? 3.772   -68.704 -36.740 1.00 26.27  ? 128 SER B OG  1 
ATOM   5152 N N   . SER B 1 128 ? 7.097   -68.915 -35.545 1.00 26.47  ? 129 SER B N   1 
ATOM   5153 C CA  . SER B 1 128 ? 8.203   -69.750 -36.010 1.00 27.83  ? 129 SER B CA  1 
ATOM   5154 C C   . SER B 1 128 ? 9.270   -70.023 -34.948 1.00 28.25  ? 129 SER B C   1 
ATOM   5155 O O   . SER B 1 128 ? 10.139  -70.869 -35.152 1.00 27.22  ? 129 SER B O   1 
ATOM   5156 C CB  . SER B 1 128 ? 8.868   -69.114 -37.234 1.00 27.15  ? 129 SER B CB  1 
ATOM   5157 O OG  . SER B 1 128 ? 9.297   -67.792 -36.953 1.00 26.02  ? 129 SER B OG  1 
ATOM   5158 N N   . LEU B 1 129 ? 9.218   -69.302 -33.831 1.00 28.84  ? 130 LEU B N   1 
ATOM   5159 C CA  . LEU B 1 129 ? 10.214  -69.469 -32.772 1.00 25.49  ? 130 LEU B CA  1 
ATOM   5160 C C   . LEU B 1 129 ? 10.320  -70.925 -32.315 1.00 26.04  ? 130 LEU B C   1 
ATOM   5161 O O   . LEU B 1 129 ? 9.314   -71.633 -32.237 1.00 27.34  ? 130 LEU B O   1 
ATOM   5162 C CB  . LEU B 1 129 ? 9.884   -68.564 -31.585 1.00 26.90  ? 130 LEU B CB  1 
ATOM   5163 C CG  . LEU B 1 129 ? 9.789   -67.071 -31.908 1.00 28.42  ? 130 LEU B CG  1 
ATOM   5164 C CD1 . LEU B 1 129 ? 9.674   -66.248 -30.630 1.00 24.90  ? 130 LEU B CD1 1 
ATOM   5165 C CD2 . LEU B 1 129 ? 10.973  -66.611 -32.761 1.00 25.14  ? 130 LEU B CD2 1 
ATOM   5166 N N   . ASP B 1 130 ? 11.542  -71.369 -32.028 1.00 27.51  ? 131 ASP B N   1 
ATOM   5167 C CA  . ASP B 1 130 ? 11.793  -72.764 -31.653 1.00 31.89  ? 131 ASP B CA  1 
ATOM   5168 C C   . ASP B 1 130 ? 10.939  -73.200 -30.480 1.00 29.07  ? 131 ASP B C   1 
ATOM   5169 O O   . ASP B 1 130 ? 10.436  -74.320 -30.437 1.00 29.08  ? 131 ASP B O   1 
ATOM   5170 C CB  . ASP B 1 130 ? 13.272  -72.981 -31.325 1.00 29.73  ? 131 ASP B CB  1 
ATOM   5171 C CG  . ASP B 1 130 ? 14.142  -72.888 -32.546 1.00 33.96  ? 131 ASP B CG  1 
ATOM   5172 O OD1 . ASP B 1 130 ? 13.574  -72.898 -33.661 1.00 31.32  ? 131 ASP B OD1 1 
ATOM   5173 O OD2 . ASP B 1 130 ? 15.379  -72.807 -32.401 1.00 39.34  ? 131 ASP B OD2 1 
ATOM   5174 N N   . VAL B 1 131 ? 10.748  -72.280 -29.549 1.00 29.79  ? 132 VAL B N   1 
ATOM   5175 C CA  . VAL B 1 131 ? 10.003  -72.556 -28.332 1.00 29.66  ? 132 VAL B CA  1 
ATOM   5176 C C   . VAL B 1 131 ? 8.487   -72.759 -28.550 1.00 27.62  ? 132 VAL B C   1 
ATOM   5177 O O   . VAL B 1 131 ? 7.794   -73.220 -27.645 1.00 30.07  ? 132 VAL B O   1 
ATOM   5178 C CB  . VAL B 1 131 ? 10.295  -71.449 -27.297 1.00 32.15  ? 132 VAL B CB  1 
ATOM   5179 C CG1 . VAL B 1 131 ? 9.577   -70.159 -27.674 1.00 31.69  ? 132 VAL B CG1 1 
ATOM   5180 C CG2 . VAL B 1 131 ? 9.939   -71.893 -25.921 1.00 31.71  ? 132 VAL B CG2 1 
ATOM   5181 N N   . TYR B 1 132 ? 7.972   -72.446 -29.743 1.00 27.26  ? 133 TYR B N   1 
ATOM   5182 C CA  . TYR B 1 132 ? 6.538   -72.657 -30.038 1.00 28.39  ? 133 TYR B CA  1 
ATOM   5183 C C   . TYR B 1 132 ? 6.307   -73.830 -30.993 1.00 31.00  ? 133 TYR B C   1 
ATOM   5184 O O   . TYR B 1 132 ? 5.233   -73.959 -31.584 1.00 30.70  ? 133 TYR B O   1 
ATOM   5185 C CB  . TYR B 1 132 ? 5.873   -71.398 -30.632 1.00 26.81  ? 133 TYR B CB  1 
ATOM   5186 C CG  . TYR B 1 132 ? 6.077   -70.119 -29.843 1.00 22.10  ? 133 TYR B CG  1 
ATOM   5187 C CD1 . TYR B 1 132 ? 6.119   -70.130 -28.456 1.00 22.17  ? 133 TYR B CD1 1 
ATOM   5188 C CD2 . TYR B 1 132 ? 6.236   -68.901 -30.494 1.00 24.06  ? 133 TYR B CD2 1 
ATOM   5189 C CE1 . TYR B 1 132 ? 6.318   -68.959 -27.738 1.00 26.51  ? 133 TYR B CE1 1 
ATOM   5190 C CE2 . TYR B 1 132 ? 6.438   -67.728 -29.790 1.00 19.03  ? 133 TYR B CE2 1 
ATOM   5191 C CZ  . TYR B 1 132 ? 6.480   -67.762 -28.413 1.00 24.46  ? 133 TYR B CZ  1 
ATOM   5192 O OH  . TYR B 1 132 ? 6.678   -66.604 -27.706 1.00 20.53  ? 133 TYR B OH  1 
ATOM   5193 N N   . ASP B 1 133 ? 7.323   -74.675 -31.142 1.00 28.42  ? 134 ASP B N   1 
ATOM   5194 C CA  . ASP B 1 133 ? 7.250   -75.845 -32.005 1.00 26.54  ? 134 ASP B CA  1 
ATOM   5195 C C   . ASP B 1 133 ? 6.156   -76.805 -31.533 1.00 31.79  ? 134 ASP B C   1 
ATOM   5196 O O   . ASP B 1 133 ? 6.290   -77.447 -30.491 1.00 30.44  ? 134 ASP B O   1 
ATOM   5197 C CB  . ASP B 1 133 ? 8.614   -76.547 -32.028 1.00 32.66  ? 134 ASP B CB  1 
ATOM   5198 C CG  . ASP B 1 133 ? 8.679   -77.689 -33.038 1.00 33.17  ? 134 ASP B CG  1 
ATOM   5199 O OD1 . ASP B 1 133 ? 7.630   -78.056 -33.614 1.00 28.40  ? 134 ASP B OD1 1 
ATOM   5200 O OD2 . ASP B 1 133 ? 9.791   -78.229 -33.240 1.00 32.40  ? 134 ASP B OD2 1 
ATOM   5201 N N   . GLY B 1 134 ? 5.088   -76.914 -32.321 1.00 29.25  ? 135 GLY B N   1 
ATOM   5202 C CA  . GLY B 1 134 ? 3.942   -77.721 -31.950 1.00 27.98  ? 135 GLY B CA  1 
ATOM   5203 C C   . GLY B 1 134 ? 4.050   -79.224 -32.171 1.00 31.21  ? 135 GLY B C   1 
ATOM   5204 O O   . GLY B 1 134 ? 3.096   -79.955 -31.888 1.00 31.80  ? 135 GLY B O   1 
ATOM   5205 N N   . ARG B 1 135 ? 5.189   -79.704 -32.662 1.00 29.27  ? 136 ARG B N   1 
ATOM   5206 C CA  . ARG B 1 135 ? 5.293   -81.124 -33.014 1.00 31.71  ? 136 ARG B CA  1 
ATOM   5207 C C   . ARG B 1 135 ? 5.099   -82.057 -31.798 1.00 31.00  ? 136 ARG B C   1 
ATOM   5208 O O   . ARG B 1 135 ? 4.408   -83.074 -31.894 1.00 32.24  ? 136 ARG B O   1 
ATOM   5209 C CB  . ARG B 1 135 ? 6.597   -81.428 -33.777 1.00 24.73  ? 136 ARG B CB  1 
ATOM   5210 C CG  . ARG B 1 135 ? 7.834   -81.666 -32.914 1.00 30.64  ? 136 ARG B CG  1 
ATOM   5211 C CD  . ARG B 1 135 ? 9.038   -82.014 -33.769 1.00 29.90  ? 136 ARG B CD  1 
ATOM   5212 N NE  . ARG B 1 135 ? 9.582   -80.835 -34.436 1.00 33.48  ? 136 ARG B NE  1 
ATOM   5213 C CZ  . ARG B 1 135 ? 10.342  -80.869 -35.528 1.00 40.72  ? 136 ARG B CZ  1 
ATOM   5214 N NH1 . ARG B 1 135 ? 10.654  -82.029 -36.095 1.00 36.92  ? 136 ARG B NH1 1 
ATOM   5215 N NH2 . ARG B 1 135 ? 10.788  -79.736 -36.062 1.00 38.79  ? 136 ARG B NH2 1 
ATOM   5216 N N   . PHE B 1 136 ? 5.666   -81.678 -30.655 1.00 28.56  ? 137 PHE B N   1 
ATOM   5217 C CA  . PHE B 1 136 ? 5.620   -82.508 -29.451 1.00 30.23  ? 137 PHE B CA  1 
ATOM   5218 C C   . PHE B 1 136 ? 4.228   -82.629 -28.824 1.00 30.37  ? 137 PHE B C   1 
ATOM   5219 O O   . PHE B 1 136 ? 3.805   -83.728 -28.457 1.00 29.26  ? 137 PHE B O   1 
ATOM   5220 C CB  . PHE B 1 136 ? 6.623   -81.999 -28.427 1.00 23.32  ? 137 PHE B CB  1 
ATOM   5221 C CG  . PHE B 1 136 ? 7.990   -81.778 -28.994 1.00 29.95  ? 137 PHE B CG  1 
ATOM   5222 C CD1 . PHE B 1 136 ? 8.432   -80.498 -29.292 1.00 24.82  ? 137 PHE B CD1 1 
ATOM   5223 C CD2 . PHE B 1 136 ? 8.831   -82.856 -29.254 1.00 31.04  ? 137 PHE B CD2 1 
ATOM   5224 C CE1 . PHE B 1 136 ? 9.694   -80.287 -29.823 1.00 27.70  ? 137 PHE B CE1 1 
ATOM   5225 C CE2 . PHE B 1 136 ? 10.106  -82.654 -29.793 1.00 31.02  ? 137 PHE B CE2 1 
ATOM   5226 C CZ  . PHE B 1 136 ? 10.535  -81.369 -30.078 1.00 31.71  ? 137 PHE B CZ  1 
ATOM   5227 N N   . LEU B 1 137 ? 3.518   -81.510 -28.703 1.00 29.43  ? 138 LEU B N   1 
ATOM   5228 C CA  . LEU B 1 137 ? 2.149   -81.544 -28.189 1.00 30.65  ? 138 LEU B CA  1 
ATOM   5229 C C   . LEU B 1 137 ? 1.280   -82.448 -29.039 1.00 31.99  ? 138 LEU B C   1 
ATOM   5230 O O   . LEU B 1 137 ? 0.475   -83.218 -28.516 1.00 32.05  ? 138 LEU B O   1 
ATOM   5231 C CB  . LEU B 1 137 ? 1.530   -80.145 -28.173 1.00 28.18  ? 138 LEU B CB  1 
ATOM   5232 C CG  . LEU B 1 137 ? 1.505   -79.418 -26.832 1.00 34.02  ? 138 LEU B CG  1 
ATOM   5233 C CD1 . LEU B 1 137 ? 1.020   -77.997 -27.032 1.00 29.84  ? 138 LEU B CD1 1 
ATOM   5234 C CD2 . LEU B 1 137 ? 0.621   -80.156 -25.848 1.00 30.89  ? 138 LEU B CD2 1 
ATOM   5235 N N   . VAL B 1 138 ? 1.430   -82.337 -30.358 1.00 33.34  ? 139 VAL B N   1 
ATOM   5236 C CA  . VAL B 1 138 ? 0.588   -83.108 -31.263 1.00 35.29  ? 139 VAL B CA  1 
ATOM   5237 C C   . VAL B 1 138 ? 0.900   -84.593 -31.126 1.00 29.98  ? 139 VAL B C   1 
ATOM   5238 O O   . VAL B 1 138 ? -0.002  -85.417 -31.033 1.00 32.92  ? 139 VAL B O   1 
ATOM   5239 C CB  . VAL B 1 138 ? 0.722   -82.637 -32.721 1.00 35.33  ? 139 VAL B CB  1 
ATOM   5240 C CG1 . VAL B 1 138 ? 0.023   -83.611 -33.656 1.00 29.92  ? 139 VAL B CG1 1 
ATOM   5241 C CG2 . VAL B 1 138 ? 0.123   -81.247 -32.864 1.00 30.99  ? 139 VAL B CG2 1 
ATOM   5242 N N   . GLN B 1 139 ? 2.182   -84.923 -31.068 1.00 28.72  ? 140 GLN B N   1 
ATOM   5243 C CA  . GLN B 1 139 ? 2.594   -86.305 -30.898 1.00 34.31  ? 140 GLN B CA  1 
ATOM   5244 C C   . GLN B 1 139 ? 2.204   -86.882 -29.530 1.00 39.27  ? 140 GLN B C   1 
ATOM   5245 O O   . GLN B 1 139 ? 1.658   -87.987 -29.449 1.00 35.38  ? 140 GLN B O   1 
ATOM   5246 C CB  . GLN B 1 139 ? 4.102   -86.432 -31.112 1.00 41.42  ? 140 GLN B CB  1 
ATOM   5247 C CG  . GLN B 1 139 ? 4.540   -87.849 -31.475 1.00 54.35  ? 140 GLN B CG  1 
ATOM   5248 C CD  . GLN B 1 139 ? 4.503   -88.795 -30.291 1.00 59.12  ? 140 GLN B CD  1 
ATOM   5249 O OE1 . GLN B 1 139 ? 4.985   -88.462 -29.204 1.00 53.73  ? 140 GLN B OE1 1 
ATOM   5250 N NE2 . GLN B 1 139 ? 3.916   -89.978 -30.489 1.00 57.80  ? 140 GLN B NE2 1 
ATOM   5251 N N   . ALA B 1 140 ? 2.502   -86.149 -28.459 1.00 34.81  ? 141 ALA B N   1 
ATOM   5252 C CA  . ALA B 1 140 ? 2.230   -86.643 -27.107 1.00 36.56  ? 141 ALA B CA  1 
ATOM   5253 C C   . ALA B 1 140 ? 0.739   -86.788 -26.842 1.00 34.10  ? 141 ALA B C   1 
ATOM   5254 O O   . ALA B 1 140 ? 0.305   -87.754 -26.222 1.00 33.45  ? 141 ALA B O   1 
ATOM   5255 C CB  . ALA B 1 140 ? 2.865   -85.735 -26.050 1.00 31.15  ? 141 ALA B CB  1 
ATOM   5256 N N   . GLU B 1 141 ? -0.049  -85.834 -27.317 1.00 34.01  ? 142 GLU B N   1 
ATOM   5257 C CA  . GLU B 1 141 ? -1.435  -85.745 -26.871 1.00 30.98  ? 142 GLU B CA  1 
ATOM   5258 C C   . GLU B 1 141 ? -2.478  -85.911 -27.963 1.00 33.04  ? 142 GLU B C   1 
ATOM   5259 O O   . GLU B 1 141 ? -3.673  -85.863 -27.679 1.00 32.60  ? 142 GLU B O   1 
ATOM   5260 C CB  . GLU B 1 141 ? -1.659  -84.433 -26.114 1.00 32.00  ? 142 GLU B CB  1 
ATOM   5261 C CG  . GLU B 1 141 ? -0.936  -84.376 -24.776 1.00 32.38  ? 142 GLU B CG  1 
ATOM   5262 C CD  . GLU B 1 141 ? -1.443  -85.418 -23.798 1.00 31.30  ? 142 GLU B CD  1 
ATOM   5263 O OE1 . GLU B 1 141 ? -2.662  -85.720 -23.826 1.00 31.88  ? 142 GLU B OE1 1 
ATOM   5264 O OE2 . GLU B 1 141 ? -0.625  -85.930 -23.001 1.00 31.36  ? 142 GLU B OE2 1 
ATOM   5265 N N   . ARG B 1 142 ? -2.023  -86.101 -29.201 1.00 38.29  ? 143 ARG B N   1 
ATOM   5266 C CA  . ARG B 1 142 ? -2.909  -86.337 -30.344 1.00 35.70  ? 143 ARG B CA  1 
ATOM   5267 C C   . ARG B 1 142 ? -3.981  -85.272 -30.510 1.00 34.08  ? 143 ARG B C   1 
ATOM   5268 O O   . ARG B 1 142 ? -5.135  -85.592 -30.762 1.00 41.22  ? 143 ARG B O   1 
ATOM   5269 C CB  . ARG B 1 142 ? -3.593  -87.709 -30.254 1.00 38.01  ? 143 ARG B CB  1 
ATOM   5270 C CG  . ARG B 1 142 ? -2.671  -88.873 -29.937 1.00 44.76  ? 143 ARG B CG  1 
ATOM   5271 C CD  . ARG B 1 142 ? -1.618  -89.079 -31.008 1.00 56.86  ? 143 ARG B CD  1 
ATOM   5272 N NE  . ARG B 1 142 ? -0.907  -90.344 -30.829 1.00 61.35  ? 143 ARG B NE  1 
ATOM   5273 C CZ  . ARG B 1 142 ? 0.244   -90.642 -31.424 1.00 67.45  ? 143 ARG B CZ  1 
ATOM   5274 N NH1 . ARG B 1 142 ? 0.817   -89.759 -32.236 1.00 65.74  ? 143 ARG B NH1 1 
ATOM   5275 N NH2 . ARG B 1 142 ? 0.826   -91.817 -31.204 1.00 66.73  ? 143 ARG B NH2 1 
ATOM   5276 N N   . THR B 1 143 ? -3.613  -84.009 -30.354 1.00 33.03  ? 144 THR B N   1 
ATOM   5277 C CA  . THR B 1 143 ? -4.513  -82.928 -30.715 1.00 30.30  ? 144 THR B CA  1 
ATOM   5278 C C   . THR B 1 143 ? -4.037  -82.375 -32.048 1.00 31.97  ? 144 THR B C   1 
ATOM   5279 O O   . THR B 1 143 ? -2.961  -82.733 -32.511 1.00 30.55  ? 144 THR B O   1 
ATOM   5280 C CB  . THR B 1 143 ? -4.463  -81.800 -29.689 1.00 32.06  ? 144 THR B CB  1 
ATOM   5281 O OG1 . THR B 1 143 ? -3.108  -81.351 -29.549 1.00 33.70  ? 144 THR B OG1 1 
ATOM   5282 C CG2 . THR B 1 143 ? -4.968  -82.291 -28.333 1.00 39.52  ? 144 THR B CG2 1 
ATOM   5283 N N   . VAL B 1 144 ? -4.843  -81.519 -32.665 1.00 29.44  ? 145 VAL B N   1 
ATOM   5284 C CA  . VAL B 1 144 ? -4.371  -80.681 -33.759 1.00 25.70  ? 145 VAL B CA  1 
ATOM   5285 C C   . VAL B 1 144 ? -3.956  -79.334 -33.173 1.00 30.65  ? 145 VAL B C   1 
ATOM   5286 O O   . VAL B 1 144 ? -4.662  -78.775 -32.337 1.00 34.20  ? 145 VAL B O   1 
ATOM   5287 C CB  . VAL B 1 144 ? -5.464  -80.436 -34.810 1.00 30.19  ? 145 VAL B CB  1 
ATOM   5288 C CG1 . VAL B 1 144 ? -4.941  -79.515 -35.929 1.00 21.96  ? 145 VAL B CG1 1 
ATOM   5289 C CG2 . VAL B 1 144 ? -5.965  -81.763 -35.371 1.00 32.00  ? 145 VAL B CG2 1 
ATOM   5290 N N   . LEU B 1 145 ? -2.811  -78.820 -33.609 1.00 30.59  ? 146 LEU B N   1 
ATOM   5291 C CA  . LEU B 1 145 ? -2.282  -77.555 -33.112 1.00 27.02  ? 146 LEU B CA  1 
ATOM   5292 C C   . LEU B 1 145 ? -2.198  -76.551 -34.266 1.00 28.37  ? 146 LEU B C   1 
ATOM   5293 O O   . LEU B 1 145 ? -1.643  -76.851 -35.325 1.00 29.40  ? 146 LEU B O   1 
ATOM   5294 C CB  . LEU B 1 145 ? -0.898  -77.794 -32.502 1.00 26.53  ? 146 LEU B CB  1 
ATOM   5295 C CG  . LEU B 1 145 ? -0.133  -76.784 -31.636 1.00 41.74  ? 146 LEU B CG  1 
ATOM   5296 C CD1 . LEU B 1 145 ? 0.164   -75.467 -32.358 1.00 36.78  ? 146 LEU B CD1 1 
ATOM   5297 C CD2 . LEU B 1 145 ? -0.847  -76.525 -30.326 1.00 41.51  ? 146 LEU B CD2 1 
ATOM   5298 N N   . VAL B 1 146 ? -2.764  -75.364 -34.056 1.00 28.65  ? 147 VAL B N   1 
ATOM   5299 C CA  . VAL B 1 146 ? -2.659  -74.271 -35.011 1.00 25.75  ? 147 VAL B CA  1 
ATOM   5300 C C   . VAL B 1 146 ? -1.962  -73.079 -34.369 1.00 27.40  ? 147 VAL B C   1 
ATOM   5301 O O   . VAL B 1 146 ? -2.198  -72.776 -33.205 1.00 29.11  ? 147 VAL B O   1 
ATOM   5302 C CB  . VAL B 1 146 ? -4.050  -73.820 -35.523 1.00 29.50  ? 147 VAL B CB  1 
ATOM   5303 C CG1 . VAL B 1 146 ? -3.908  -72.751 -36.612 1.00 23.06  ? 147 VAL B CG1 1 
ATOM   5304 C CG2 . VAL B 1 146 ? -4.823  -75.008 -36.061 1.00 27.19  ? 147 VAL B CG2 1 
ATOM   5305 N N   . SER B 1 147 ? -1.089  -72.414 -35.121 1.00 28.96  ? 148 SER B N   1 
ATOM   5306 C CA  . SER B 1 147 ? -0.565  -71.118 -34.705 1.00 24.63  ? 148 SER B CA  1 
ATOM   5307 C C   . SER B 1 147 ? -0.548  -70.159 -35.897 1.00 24.84  ? 148 SER B C   1 
ATOM   5308 O O   . SER B 1 147 ? -0.384  -70.585 -37.036 1.00 26.88  ? 148 SER B O   1 
ATOM   5309 C CB  . SER B 1 147 ? 0.828   -71.250 -34.074 1.00 26.64  ? 148 SER B CB  1 
ATOM   5310 O OG  . SER B 1 147 ? 1.806   -71.657 -35.015 1.00 23.93  ? 148 SER B OG  1 
ATOM   5311 N N   . MET B 1 148 ? -0.731  -68.866 -35.642 1.00 26.63  ? 149 MET B N   1 
ATOM   5312 C CA  . MET B 1 148 ? -0.718  -67.887 -36.725 1.00 23.16  ? 149 MET B CA  1 
ATOM   5313 C C   . MET B 1 148 ? 0.252   -66.753 -36.449 1.00 27.48  ? 149 MET B C   1 
ATOM   5314 O O   . MET B 1 148 ? 0.584   -66.463 -35.294 1.00 21.19  ? 149 MET B O   1 
ATOM   5315 C CB  . MET B 1 148 ? -2.121  -67.310 -36.971 1.00 19.23  ? 149 MET B CB  1 
ATOM   5316 C CG  . MET B 1 148 ? -2.491  -66.127 -36.068 1.00 27.85  ? 149 MET B CG  1 
ATOM   5317 S SD  . MET B 1 148 ? -2.647  -66.554 -34.308 1.00 29.02  ? 149 MET B SD  1 
ATOM   5318 C CE  . MET B 1 148 ? -4.079  -67.625 -34.340 1.00 25.72  ? 149 MET B CE  1 
ATOM   5319 N N   . ASN B 1 149 ? 0.715   -66.113 -37.517 1.00 22.44  ? 150 ASN B N   1 
ATOM   5320 C CA  . ASN B 1 149 ? 1.398   -64.842 -37.356 1.00 20.45  ? 150 ASN B CA  1 
ATOM   5321 C C   . ASN B 1 149 ? 0.358   -63.729 -37.412 1.00 24.05  ? 150 ASN B C   1 
ATOM   5322 O O   . ASN B 1 149 ? -0.647  -63.841 -38.118 1.00 21.63  ? 150 ASN B O   1 
ATOM   5323 C CB  . ASN B 1 149 ? 2.466   -64.649 -38.429 1.00 20.71  ? 150 ASN B CB  1 
ATOM   5324 C CG  . ASN B 1 149 ? 3.805   -65.221 -38.028 1.00 23.33  ? 150 ASN B CG  1 
ATOM   5325 O OD1 . ASN B 1 149 ? 3.915   -65.954 -37.047 1.00 28.27  ? 150 ASN B OD1 1 
ATOM   5326 N ND2 . ASN B 1 149 ? 4.843   -64.880 -38.785 1.00 31.82  ? 150 ASN B ND2 1 
ATOM   5327 N N   . TYR B 1 150 ? 0.576   -62.669 -36.641 1.00 22.19  ? 151 TYR B N   1 
ATOM   5328 C CA  . TYR B 1 150 ? -0.308  -61.518 -36.696 1.00 17.34  ? 151 TYR B CA  1 
ATOM   5329 C C   . TYR B 1 150 ? 0.567   -60.290 -36.604 1.00 19.85  ? 151 TYR B C   1 
ATOM   5330 O O   . TYR B 1 150 ? 1.634   -60.321 -35.983 1.00 20.56  ? 151 TYR B O   1 
ATOM   5331 C CB  . TYR B 1 150 ? -1.351  -61.550 -35.567 1.00 22.04  ? 151 TYR B CB  1 
ATOM   5332 C CG  . TYR B 1 150 ? -0.757  -61.523 -34.172 1.00 17.44  ? 151 TYR B CG  1 
ATOM   5333 C CD1 . TYR B 1 150 ? -0.456  -62.695 -33.505 1.00 16.72  ? 151 TYR B CD1 1 
ATOM   5334 C CD2 . TYR B 1 150 ? -0.486  -60.318 -33.536 1.00 17.75  ? 151 TYR B CD2 1 
ATOM   5335 C CE1 . TYR B 1 150 ? 0.096   -62.673 -32.232 1.00 20.19  ? 151 TYR B CE1 1 
ATOM   5336 C CE2 . TYR B 1 150 ? 0.062   -60.280 -32.274 1.00 21.45  ? 151 TYR B CE2 1 
ATOM   5337 C CZ  . TYR B 1 150 ? 0.352   -61.460 -31.620 1.00 27.02  ? 151 TYR B CZ  1 
ATOM   5338 O OH  . TYR B 1 150 ? 0.905   -61.423 -30.352 1.00 24.50  ? 151 TYR B OH  1 
ATOM   5339 N N   . ARG B 1 151 ? 0.127   -59.219 -37.247 1.00 22.24  ? 152 ARG B N   1 
ATOM   5340 C CA  . ARG B 1 151 ? 0.903   -57.996 -37.308 1.00 22.03  ? 152 ARG B CA  1 
ATOM   5341 C C   . ARG B 1 151 ? 1.103   -57.393 -35.920 1.00 24.35  ? 152 ARG B C   1 
ATOM   5342 O O   . ARG B 1 151 ? 0.196   -57.405 -35.084 1.00 24.01  ? 152 ARG B O   1 
ATOM   5343 C CB  . ARG B 1 151 ? 0.225   -56.997 -38.245 1.00 26.14  ? 152 ARG B CB  1 
ATOM   5344 C CG  . ARG B 1 151 ? 0.360   -57.327 -39.738 1.00 21.14  ? 152 ARG B CG  1 
ATOM   5345 C CD  . ARG B 1 151 ? -0.497  -56.381 -40.588 1.00 18.21  ? 152 ARG B CD  1 
ATOM   5346 N NE  . ARG B 1 151 ? -1.906  -56.770 -40.616 1.00 25.69  ? 152 ARG B NE  1 
ATOM   5347 C CZ  . ARG B 1 151 ? -2.872  -56.044 -41.178 1.00 27.65  ? 152 ARG B CZ  1 
ATOM   5348 N NH1 . ARG B 1 151 ? -2.585  -54.877 -41.746 1.00 24.04  ? 152 ARG B NH1 1 
ATOM   5349 N NH2 . ARG B 1 151 ? -4.125  -56.481 -41.173 1.00 24.81  ? 152 ARG B NH2 1 
ATOM   5350 N N   . VAL B 1 152 ? 2.301   -56.867 -35.692 1.00 17.88  ? 153 VAL B N   1 
ATOM   5351 C CA  . VAL B 1 152 ? 2.676   -56.296 -34.417 1.00 16.06  ? 153 VAL B CA  1 
ATOM   5352 C C   . VAL B 1 152 ? 3.232   -54.902 -34.632 1.00 23.71  ? 153 VAL B C   1 
ATOM   5353 O O   . VAL B 1 152 ? 3.420   -54.470 -35.777 1.00 23.53  ? 153 VAL B O   1 
ATOM   5354 C CB  . VAL B 1 152 ? 3.744   -57.151 -33.711 1.00 25.58  ? 153 VAL B CB  1 
ATOM   5355 C CG1 . VAL B 1 152 ? 3.137   -58.480 -33.238 1.00 23.41  ? 153 VAL B CG1 1 
ATOM   5356 C CG2 . VAL B 1 152 ? 4.955   -57.385 -34.627 1.00 19.21  ? 153 VAL B CG2 1 
ATOM   5357 N N   . GLY B 1 153 ? 3.495   -54.198 -33.532 1.00 21.29  ? 154 GLY B N   1 
ATOM   5358 C CA  . GLY B 1 153 ? 3.988   -52.829 -33.598 1.00 24.68  ? 154 GLY B CA  1 
ATOM   5359 C C   . GLY B 1 153 ? 3.035   -51.897 -34.336 1.00 25.38  ? 154 GLY B C   1 
ATOM   5360 O O   . GLY B 1 153 ? 1.823   -52.119 -34.362 1.00 23.44  ? 154 GLY B O   1 
ATOM   5361 N N   . ALA B 1 154 ? 3.579   -50.851 -34.945 1.00 25.92  ? 155 ALA B N   1 
ATOM   5362 C CA  . ALA B 1 154 ? 2.755   -49.917 -35.699 1.00 24.00  ? 155 ALA B CA  1 
ATOM   5363 C C   . ALA B 1 154 ? 1.938   -50.616 -36.790 1.00 27.03  ? 155 ALA B C   1 
ATOM   5364 O O   . ALA B 1 154 ? 0.788   -50.256 -37.036 1.00 29.42  ? 155 ALA B O   1 
ATOM   5365 C CB  . ALA B 1 154 ? 3.615   -48.800 -36.295 1.00 21.86  ? 155 ALA B CB  1 
ATOM   5366 N N   . PHE B 1 155 ? 2.517   -51.629 -37.426 1.00 23.19  ? 156 PHE B N   1 
ATOM   5367 C CA  . PHE B 1 155 ? 1.840   -52.311 -38.535 1.00 22.84  ? 156 PHE B CA  1 
ATOM   5368 C C   . PHE B 1 155 ? 0.563   -53.002 -38.109 1.00 23.44  ? 156 PHE B C   1 
ATOM   5369 O O   . PHE B 1 155 ? -0.390  -53.097 -38.890 1.00 23.55  ? 156 PHE B O   1 
ATOM   5370 C CB  . PHE B 1 155 ? 2.798   -53.299 -39.210 1.00 24.11  ? 156 PHE B CB  1 
ATOM   5371 C CG  . PHE B 1 155 ? 4.124   -52.685 -39.529 1.00 28.61  ? 156 PHE B CG  1 
ATOM   5372 C CD1 . PHE B 1 155 ? 5.159   -52.730 -38.610 1.00 24.18  ? 156 PHE B CD1 1 
ATOM   5373 C CD2 . PHE B 1 155 ? 4.305   -51.987 -40.712 1.00 26.16  ? 156 PHE B CD2 1 
ATOM   5374 C CE1 . PHE B 1 155 ? 6.363   -52.128 -38.883 1.00 25.23  ? 156 PHE B CE1 1 
ATOM   5375 C CE2 . PHE B 1 155 ? 5.510   -51.387 -40.990 1.00 28.77  ? 156 PHE B CE2 1 
ATOM   5376 C CZ  . PHE B 1 155 ? 6.540   -51.457 -40.074 1.00 26.90  ? 156 PHE B CZ  1 
ATOM   5377 N N   . GLY B 1 156 ? 0.533   -53.465 -36.862 1.00 23.88  ? 157 GLY B N   1 
ATOM   5378 C CA  . GLY B 1 156 ? -0.623  -54.173 -36.356 1.00 20.37  ? 157 GLY B CA  1 
ATOM   5379 C C   . GLY B 1 156 ? -1.540  -53.339 -35.481 1.00 27.84  ? 157 GLY B C   1 
ATOM   5380 O O   . GLY B 1 156 ? -2.729  -53.664 -35.338 1.00 25.64  ? 157 GLY B O   1 
ATOM   5381 N N   . PHE B 1 157 ? -1.008  -52.266 -34.896 1.00 20.44  ? 158 PHE B N   1 
ATOM   5382 C CA  . PHE B 1 157 ? -1.750  -51.569 -33.843 1.00 27.77  ? 158 PHE B CA  1 
ATOM   5383 C C   . PHE B 1 157 ? -1.655  -50.048 -33.799 1.00 27.98  ? 158 PHE B C   1 
ATOM   5384 O O   . PHE B 1 157 ? -2.164  -49.437 -32.856 1.00 26.65  ? 158 PHE B O   1 
ATOM   5385 C CB  . PHE B 1 157 ? -1.396  -52.147 -32.464 1.00 22.84  ? 158 PHE B CB  1 
ATOM   5386 C CG  . PHE B 1 157 ? -1.759  -53.584 -32.322 1.00 22.49  ? 158 PHE B CG  1 
ATOM   5387 C CD1 . PHE B 1 157 ? -0.807  -54.573 -32.513 1.00 18.92  ? 158 PHE B CD1 1 
ATOM   5388 C CD2 . PHE B 1 157 ? -3.066  -53.952 -32.036 1.00 21.47  ? 158 PHE B CD2 1 
ATOM   5389 C CE1 . PHE B 1 157 ? -1.141  -55.910 -32.395 1.00 20.14  ? 158 PHE B CE1 1 
ATOM   5390 C CE2 . PHE B 1 157 ? -3.414  -55.285 -31.920 1.00 25.00  ? 158 PHE B CE2 1 
ATOM   5391 C CZ  . PHE B 1 157 ? -2.446  -56.271 -32.103 1.00 25.42  ? 158 PHE B CZ  1 
ATOM   5392 N N   . LEU B 1 158 ? -1.014  -49.429 -34.786 1.00 25.18  ? 159 LEU B N   1 
ATOM   5393 C CA  . LEU B 1 158 ? -1.065  -47.974 -34.852 1.00 28.45  ? 159 LEU B CA  1 
ATOM   5394 C C   . LEU B 1 158 ? -2.516  -47.601 -35.114 1.00 31.79  ? 159 LEU B C   1 
ATOM   5395 O O   . LEU B 1 158 ? -3.192  -48.231 -35.927 1.00 27.96  ? 159 LEU B O   1 
ATOM   5396 C CB  . LEU B 1 158 ? -0.125  -47.408 -35.916 1.00 25.61  ? 159 LEU B CB  1 
ATOM   5397 C CG  . LEU B 1 158 ? -0.080  -45.887 -36.116 1.00 33.02  ? 159 LEU B CG  1 
ATOM   5398 C CD1 . LEU B 1 158 ? 1.301   -45.447 -36.577 1.00 27.77  ? 159 LEU B CD1 1 
ATOM   5399 C CD2 . LEU B 1 158 ? -1.132  -45.421 -37.129 1.00 27.00  ? 159 LEU B CD2 1 
ATOM   5400 N N   . ALA B 1 159 ? -3.011  -46.601 -34.395 1.00 30.93  ? 160 ALA B N   1 
ATOM   5401 C CA  . ALA B 1 159 ? -4.415  -46.240 -34.527 1.00 31.84  ? 160 ALA B CA  1 
ATOM   5402 C C   . ALA B 1 159 ? -4.627  -44.739 -34.610 1.00 33.39  ? 160 ALA B C   1 
ATOM   5403 O O   . ALA B 1 159 ? -4.111  -43.979 -33.795 1.00 30.26  ? 160 ALA B O   1 
ATOM   5404 C CB  . ALA B 1 159 ? -5.218  -46.821 -33.377 1.00 27.23  ? 160 ALA B CB  1 
ATOM   5405 N N   . LEU B 1 160 ? -5.374  -44.317 -35.621 1.00 34.74  ? 161 LEU B N   1 
ATOM   5406 C CA  . LEU B 1 160 ? -5.943  -42.979 -35.623 1.00 33.41  ? 161 LEU B CA  1 
ATOM   5407 C C   . LEU B 1 160 ? -7.441  -43.180 -35.525 1.00 30.41  ? 161 LEU B C   1 
ATOM   5408 O O   . LEU B 1 160 ? -8.130  -43.239 -36.542 1.00 33.31  ? 161 LEU B O   1 
ATOM   5409 C CB  . LEU B 1 160 ? -5.562  -42.220 -36.889 1.00 31.93  ? 161 LEU B CB  1 
ATOM   5410 C CG  . LEU B 1 160 ? -4.065  -41.930 -36.987 1.00 31.89  ? 161 LEU B CG  1 
ATOM   5411 C CD1 . LEU B 1 160 ? -3.713  -41.559 -38.398 1.00 35.00  ? 161 LEU B CD1 1 
ATOM   5412 C CD2 . LEU B 1 160 ? -3.677  -40.808 -36.032 1.00 24.58  ? 161 LEU B CD2 1 
ATOM   5413 N N   . PRO B 1 161 ? -7.945  -43.308 -34.288 1.00 31.00  ? 162 PRO B N   1 
ATOM   5414 C CA  . PRO B 1 161 ? -9.329  -43.738 -34.039 1.00 33.24  ? 162 PRO B CA  1 
ATOM   5415 C C   . PRO B 1 161 ? -10.320 -42.867 -34.794 1.00 35.66  ? 162 PRO B C   1 
ATOM   5416 O O   . PRO B 1 161 ? -10.164 -41.645 -34.809 1.00 33.65  ? 162 PRO B O   1 
ATOM   5417 C CB  . PRO B 1 161 ? -9.484  -43.577 -32.519 1.00 32.78  ? 162 PRO B CB  1 
ATOM   5418 C CG  . PRO B 1 161 ? -8.071  -43.681 -31.986 1.00 27.34  ? 162 PRO B CG  1 
ATOM   5419 C CD  . PRO B 1 161 ? -7.217  -43.018 -33.039 1.00 26.65  ? 162 PRO B CD  1 
ATOM   5420 N N   . GLY B 1 162 ? -11.295 -43.502 -35.442 1.00 36.02  ? 163 GLY B N   1 
ATOM   5421 C CA  . GLY B 1 162 ? -12.262 -42.799 -36.261 1.00 34.38  ? 163 GLY B CA  1 
ATOM   5422 C C   . GLY B 1 162 ? -11.993 -42.954 -37.748 1.00 37.51  ? 163 GLY B C   1 
ATOM   5423 O O   . GLY B 1 162 ? -12.914 -43.191 -38.525 1.00 49.41  ? 163 GLY B O   1 
ATOM   5424 N N   . SER B 1 163 ? -10.729 -42.824 -38.144 1.00 36.91  ? 164 SER B N   1 
ATOM   5425 C CA  . SER B 1 163 ? -10.342 -42.911 -39.552 1.00 39.42  ? 164 SER B CA  1 
ATOM   5426 C C   . SER B 1 163 ? -10.501 -44.315 -40.112 1.00 39.36  ? 164 SER B C   1 
ATOM   5427 O O   . SER B 1 163 ? -10.358 -45.301 -39.391 1.00 37.58  ? 164 SER B O   1 
ATOM   5428 C CB  . SER B 1 163 ? -8.886  -42.499 -39.726 1.00 42.21  ? 164 SER B CB  1 
ATOM   5429 O OG  . SER B 1 163 ? -8.032  -43.550 -39.315 1.00 39.15  ? 164 SER B OG  1 
ATOM   5430 N N   . ARG B 1 164 ? -10.771 -44.406 -41.409 1.00 43.69  ? 165 ARG B N   1 
ATOM   5431 C CA  . ARG B 1 164 ? -10.868 -45.708 -42.063 1.00 47.16  ? 165 ARG B CA  1 
ATOM   5432 C C   . ARG B 1 164 ? -9.484  -46.236 -42.447 1.00 37.59  ? 165 ARG B C   1 
ATOM   5433 O O   . ARG B 1 164 ? -9.314  -47.435 -42.689 1.00 38.56  ? 165 ARG B O   1 
ATOM   5434 C CB  . ARG B 1 164 ? -11.759 -45.635 -43.314 1.00 57.74  ? 165 ARG B CB  1 
ATOM   5435 C CG  . ARG B 1 164 ? -13.188 -45.144 -43.070 1.00 67.50  ? 165 ARG B CG  1 
ATOM   5436 C CD  . ARG B 1 164 ? -13.849 -45.821 -41.864 1.00 71.49  ? 165 ARG B CD  1 
ATOM   5437 N NE  . ARG B 1 164 ? -13.963 -47.273 -42.006 1.00 77.53  ? 165 ARG B NE  1 
ATOM   5438 C CZ  . ARG B 1 164 ? -14.982 -47.893 -42.597 1.00 85.22  ? 165 ARG B CZ  1 
ATOM   5439 N NH1 . ARG B 1 164 ? -15.979 -47.188 -43.116 1.00 82.67  ? 165 ARG B NH1 1 
ATOM   5440 N NH2 . ARG B 1 164 ? -15.003 -49.219 -42.674 1.00 81.99  ? 165 ARG B NH2 1 
ATOM   5441 N N   . GLU B 1 165 ? -8.502  -45.339 -42.490 1.00 31.46  ? 166 GLU B N   1 
ATOM   5442 C CA  . GLU B 1 165 ? -7.180  -45.662 -43.020 1.00 33.83  ? 166 GLU B CA  1 
ATOM   5443 C C   . GLU B 1 165 ? -6.214  -46.266 -41.994 1.00 39.33  ? 166 GLU B C   1 
ATOM   5444 O O   . GLU B 1 165 ? -5.208  -46.866 -42.368 1.00 36.59  ? 166 GLU B O   1 
ATOM   5445 C CB  . GLU B 1 165 ? -6.556  -44.428 -43.685 1.00 39.41  ? 166 GLU B CB  1 
ATOM   5446 C CG  . GLU B 1 165 ? -7.345  -43.901 -44.895 1.00 45.73  ? 166 GLU B CG  1 
ATOM   5447 C CD  . GLU B 1 165 ? -7.624  -44.983 -45.944 1.00 55.07  ? 166 GLU B CD  1 
ATOM   5448 O OE1 . GLU B 1 165 ? -6.746  -45.848 -46.186 1.00 49.56  ? 166 GLU B OE1 1 
ATOM   5449 O OE2 . GLU B 1 165 ? -8.734  -44.973 -46.523 1.00 66.20  ? 166 GLU B OE2 1 
ATOM   5450 N N   . ALA B 1 166 ? -6.513  -46.096 -40.709 1.00 34.95  ? 167 ALA B N   1 
ATOM   5451 C CA  . ALA B 1 166 ? -5.738  -46.731 -39.641 1.00 32.62  ? 167 ALA B CA  1 
ATOM   5452 C C   . ALA B 1 166 ? -6.603  -46.858 -38.408 1.00 29.84  ? 167 ALA B C   1 
ATOM   5453 O O   . ALA B 1 166 ? -6.358  -46.182 -37.412 1.00 28.19  ? 167 ALA B O   1 
ATOM   5454 C CB  . ALA B 1 166 ? -4.482  -45.924 -39.322 1.00 29.03  ? 167 ALA B CB  1 
ATOM   5455 N N   . PRO B 1 167 ? -7.619  -47.732 -38.473 1.00 34.58  ? 168 PRO B N   1 
ATOM   5456 C CA  . PRO B 1 167 ? -8.655  -47.829 -37.438 1.00 28.81  ? 168 PRO B CA  1 
ATOM   5457 C C   . PRO B 1 167 ? -8.146  -48.447 -36.140 1.00 35.00  ? 168 PRO B C   1 
ATOM   5458 O O   . PRO B 1 167 ? -8.844  -48.387 -35.120 1.00 31.63  ? 168 PRO B O   1 
ATOM   5459 C CB  . PRO B 1 167 ? -9.702  -48.746 -38.082 1.00 29.04  ? 168 PRO B CB  1 
ATOM   5460 C CG  . PRO B 1 167 ? -8.919  -49.597 -39.037 1.00 27.56  ? 168 PRO B CG  1 
ATOM   5461 C CD  . PRO B 1 167 ? -7.836  -48.700 -39.566 1.00 31.48  ? 168 PRO B CD  1 
ATOM   5462 N N   . GLY B 1 168 ? -6.949  -49.028 -36.189 1.00 30.42  ? 169 GLY B N   1 
ATOM   5463 C CA  . GLY B 1 168 ? -6.376  -49.733 -35.057 1.00 25.24  ? 169 GLY B CA  1 
ATOM   5464 C C   . GLY B 1 168 ? -6.835  -51.175 -34.961 1.00 26.00  ? 169 GLY B C   1 
ATOM   5465 O O   . GLY B 1 168 ? -7.756  -51.590 -35.670 1.00 28.93  ? 169 GLY B O   1 
ATOM   5466 N N   . ASN B 1 169 ? -6.176  -51.934 -34.086 1.00 26.31  ? 170 ASN B N   1 
ATOM   5467 C CA  . ASN B 1 169 ? -6.548  -53.315 -33.779 1.00 23.64  ? 170 ASN B CA  1 
ATOM   5468 C C   . ASN B 1 169 ? -6.460  -54.330 -34.934 1.00 24.36  ? 170 ASN B C   1 
ATOM   5469 O O   . ASN B 1 169 ? -7.012  -55.435 -34.840 1.00 25.15  ? 170 ASN B O   1 
ATOM   5470 C CB  . ASN B 1 169 ? -7.946  -53.373 -33.149 1.00 24.19  ? 170 ASN B CB  1 
ATOM   5471 C CG  . ASN B 1 169 ? -8.021  -52.673 -31.793 1.00 30.73  ? 170 ASN B CG  1 
ATOM   5472 O OD1 . ASN B 1 169 ? -7.003  -52.374 -31.165 1.00 27.43  ? 170 ASN B OD1 1 
ATOM   5473 N ND2 . ASN B 1 169 ? -9.241  -52.415 -31.337 1.00 30.73  ? 170 ASN B ND2 1 
ATOM   5474 N N   . VAL B 1 170 ? -5.763  -53.983 -36.011 1.00 23.55  ? 171 VAL B N   1 
ATOM   5475 C CA  . VAL B 1 170 ? -5.722  -54.885 -37.164 1.00 26.01  ? 171 VAL B CA  1 
ATOM   5476 C C   . VAL B 1 170 ? -4.962  -56.193 -36.867 1.00 24.20  ? 171 VAL B C   1 
ATOM   5477 O O   . VAL B 1 170 ? -5.289  -57.248 -37.417 1.00 22.33  ? 171 VAL B O   1 
ATOM   5478 C CB  . VAL B 1 170 ? -5.250  -54.175 -38.471 1.00 24.91  ? 171 VAL B CB  1 
ATOM   5479 C CG1 . VAL B 1 170 ? -6.181  -53.016 -38.782 1.00 24.27  ? 171 VAL B CG1 1 
ATOM   5480 C CG2 . VAL B 1 170 ? -3.803  -53.693 -38.369 1.00 22.49  ? 171 VAL B CG2 1 
ATOM   5481 N N   . GLY B 1 171 ? -3.986  -56.128 -35.964 1.00 23.39  ? 172 GLY B N   1 
ATOM   5482 C CA  . GLY B 1 171 ? -3.336  -57.332 -35.481 1.00 22.25  ? 172 GLY B CA  1 
ATOM   5483 C C   . GLY B 1 171 ? -4.314  -58.301 -34.825 1.00 26.45  ? 172 GLY B C   1 
ATOM   5484 O O   . GLY B 1 171 ? -4.177  -59.521 -34.965 1.00 26.49  ? 172 GLY B O   1 
ATOM   5485 N N   . LEU B 1 172 ? -5.303  -57.772 -34.106 1.00 20.76  ? 173 LEU B N   1 
ATOM   5486 C CA  . LEU B 1 172 ? -6.315  -58.639 -33.492 1.00 25.30  ? 173 LEU B CA  1 
ATOM   5487 C C   . LEU B 1 172 ? -7.254  -59.171 -34.569 1.00 22.09  ? 173 LEU B C   1 
ATOM   5488 O O   . LEU B 1 172 ? -7.753  -60.293 -34.470 1.00 22.84  ? 173 LEU B O   1 
ATOM   5489 C CB  . LEU B 1 172 ? -7.125  -57.913 -32.408 1.00 24.48  ? 173 LEU B CB  1 
ATOM   5490 C CG  . LEU B 1 172 ? -6.489  -57.621 -31.053 1.00 26.66  ? 173 LEU B CG  1 
ATOM   5491 C CD1 . LEU B 1 172 ? -7.390  -56.686 -30.244 1.00 21.95  ? 173 LEU B CD1 1 
ATOM   5492 C CD2 . LEU B 1 172 ? -6.213  -58.919 -30.293 1.00 22.75  ? 173 LEU B CD2 1 
ATOM   5493 N N   . LEU B 1 173 ? -7.487  -58.371 -35.605 1.00 23.46  ? 174 LEU B N   1 
ATOM   5494 C CA  . LEU B 1 173 ? -8.268  -58.851 -36.751 1.00 26.63  ? 174 LEU B CA  1 
ATOM   5495 C C   . LEU B 1 173 ? -7.525  -59.936 -37.531 1.00 23.95  ? 174 LEU B C   1 
ATOM   5496 O O   . LEU B 1 173 ? -8.152  -60.876 -38.035 1.00 24.75  ? 174 LEU B O   1 
ATOM   5497 C CB  . LEU B 1 173 ? -8.703  -57.706 -37.669 1.00 25.73  ? 174 LEU B CB  1 
ATOM   5498 C CG  . LEU B 1 173 ? -9.742  -56.736 -37.088 1.00 28.97  ? 174 LEU B CG  1 
ATOM   5499 C CD1 . LEU B 1 173 ? -10.063 -55.646 -38.091 1.00 21.54  ? 174 LEU B CD1 1 
ATOM   5500 C CD2 . LEU B 1 173 ? -11.017 -57.461 -36.644 1.00 23.44  ? 174 LEU B CD2 1 
ATOM   5501 N N   . ASP B 1 174 ? -6.198  -59.830 -37.599 1.00 23.65  ? 175 ASP B N   1 
ATOM   5502 C CA  . ASP B 1 174 ? -5.391  -60.899 -38.198 1.00 24.76  ? 175 ASP B CA  1 
ATOM   5503 C C   . ASP B 1 174 ? -5.683  -62.200 -37.461 1.00 26.75  ? 175 ASP B C   1 
ATOM   5504 O O   . ASP B 1 174 ? -5.958  -63.246 -38.074 1.00 24.76  ? 175 ASP B O   1 
ATOM   5505 C CB  . ASP B 1 174 ? -3.884  -60.600 -38.120 1.00 18.78  ? 175 ASP B CB  1 
ATOM   5506 C CG  . ASP B 1 174 ? -3.471  -59.379 -38.927 1.00 24.88  ? 175 ASP B CG  1 
ATOM   5507 O OD1 . ASP B 1 174 ? -4.226  -58.967 -39.846 1.00 23.93  ? 175 ASP B OD1 1 
ATOM   5508 O OD2 . ASP B 1 174 ? -2.371  -58.840 -38.649 1.00 23.88  ? 175 ASP B OD2 1 
ATOM   5509 N N   . GLN B 1 175 ? -5.638  -62.120 -36.132 1.00 28.79  ? 176 GLN B N   1 
ATOM   5510 C CA  . GLN B 1 175 ? -5.896  -63.275 -35.286 1.00 25.15  ? 176 GLN B CA  1 
ATOM   5511 C C   . GLN B 1 175 ? -7.288  -63.841 -35.515 1.00 20.96  ? 176 GLN B C   1 
ATOM   5512 O O   . GLN B 1 175 ? -7.455  -65.053 -35.642 1.00 22.62  ? 176 GLN B O   1 
ATOM   5513 C CB  . GLN B 1 175 ? -5.725  -62.911 -33.813 1.00 28.76  ? 176 GLN B CB  1 
ATOM   5514 C CG  . GLN B 1 175 ? -4.321  -62.502 -33.429 1.00 22.75  ? 176 GLN B CG  1 
ATOM   5515 C CD  . GLN B 1 175 ? -4.257  -62.056 -31.981 1.00 24.19  ? 176 GLN B CD  1 
ATOM   5516 O OE1 . GLN B 1 175 ? -5.208  -62.263 -31.226 1.00 23.15  ? 176 GLN B OE1 1 
ATOM   5517 N NE2 . GLN B 1 175 ? -3.144  -61.427 -31.591 1.00 18.86  ? 176 GLN B NE2 1 
ATOM   5518 N N   . ARG B 1 176 ? -8.288  -62.967 -35.565 1.00 24.89  ? 177 ARG B N   1 
ATOM   5519 C CA  . ARG B 1 176 ? -9.662  -63.424 -35.777 1.00 25.63  ? 177 ARG B CA  1 
ATOM   5520 C C   . ARG B 1 176 ? -9.825  -64.115 -37.128 1.00 26.18  ? 177 ARG B C   1 
ATOM   5521 O O   . ARG B 1 176 ? -10.479 -65.158 -37.214 1.00 27.38  ? 177 ARG B O   1 
ATOM   5522 C CB  . ARG B 1 176 ? -10.658 -62.269 -35.652 1.00 30.75  ? 177 ARG B CB  1 
ATOM   5523 C CG  . ARG B 1 176 ? -12.099 -62.654 -36.014 1.00 35.52  ? 177 ARG B CG  1 
ATOM   5524 C CD  . ARG B 1 176 ? -13.044 -61.467 -35.857 1.00 36.50  ? 177 ARG B CD  1 
ATOM   5525 N NE  . ARG B 1 176 ? -13.257 -61.125 -34.452 1.00 41.03  ? 177 ARG B NE  1 
ATOM   5526 C CZ  . ARG B 1 176 ? -13.703 -59.946 -34.022 1.00 41.20  ? 177 ARG B CZ  1 
ATOM   5527 N NH1 . ARG B 1 176 ? -13.978 -58.974 -34.886 1.00 33.39  ? 177 ARG B NH1 1 
ATOM   5528 N NH2 . ARG B 1 176 ? -13.868 -59.737 -32.721 1.00 37.69  ? 177 ARG B NH2 1 
ATOM   5529 N N   . LEU B 1 177 ? -9.226  -63.537 -38.174 1.00 25.11  ? 178 LEU B N   1 
ATOM   5530 C CA  . LEU B 1 177 ? -9.322  -64.105 -39.519 1.00 27.17  ? 178 LEU B CA  1 
ATOM   5531 C C   . LEU B 1 177 ? -8.781  -65.529 -39.511 1.00 27.51  ? 178 LEU B C   1 
ATOM   5532 O O   . LEU B 1 177 ? -9.390  -66.446 -40.084 1.00 24.27  ? 178 LEU B O   1 
ATOM   5533 C CB  . LEU B 1 177 ? -8.578  -63.235 -40.547 1.00 26.95  ? 178 LEU B CB  1 
ATOM   5534 C CG  . LEU B 1 177 ? -8.631  -63.693 -42.014 1.00 32.55  ? 178 LEU B CG  1 
ATOM   5535 C CD1 . LEU B 1 177 ? -10.070 -63.804 -42.494 1.00 28.11  ? 178 LEU B CD1 1 
ATOM   5536 C CD2 . LEU B 1 177 ? -7.826  -62.784 -42.950 1.00 24.29  ? 178 LEU B CD2 1 
ATOM   5537 N N   . ALA B 1 178 ? -7.655  -65.715 -38.822 1.00 24.63  ? 179 ALA B N   1 
ATOM   5538 C CA  . ALA B 1 178 ? -7.052  -67.035 -38.692 1.00 26.25  ? 179 ALA B CA  1 
ATOM   5539 C C   . ALA B 1 178 ? -7.995  -67.991 -37.976 1.00 27.41  ? 179 ALA B C   1 
ATOM   5540 O O   . ALA B 1 178 ? -8.086  -69.174 -38.333 1.00 27.99  ? 179 ALA B O   1 
ATOM   5541 C CB  . ALA B 1 178 ? -5.724  -66.946 -37.959 1.00 22.75  ? 179 ALA B CB  1 
ATOM   5542 N N   . LEU B 1 179 ? -8.698  -67.473 -36.969 1.00 24.46  ? 180 LEU B N   1 
ATOM   5543 C CA  . LEU B 1 179 ? -9.661  -68.270 -36.214 1.00 30.05  ? 180 LEU B CA  1 
ATOM   5544 C C   . LEU B 1 179 ? -10.833 -68.693 -37.098 1.00 29.03  ? 180 LEU B C   1 
ATOM   5545 O O   . LEU B 1 179 ? -11.307 -69.829 -37.013 1.00 30.85  ? 180 LEU B O   1 
ATOM   5546 C CB  . LEU B 1 179 ? -10.168 -67.507 -34.978 1.00 26.09  ? 180 LEU B CB  1 
ATOM   5547 C CG  . LEU B 1 179 ? -9.168  -67.328 -33.836 1.00 26.70  ? 180 LEU B CG  1 
ATOM   5548 C CD1 . LEU B 1 179 ? -9.808  -66.645 -32.640 1.00 30.94  ? 180 LEU B CD1 1 
ATOM   5549 C CD2 . LEU B 1 179 ? -8.573  -68.664 -33.428 1.00 29.95  ? 180 LEU B CD2 1 
ATOM   5550 N N   . GLN B 1 180 ? -11.304 -67.770 -37.932 1.00 28.50  ? 181 GLN B N   1 
ATOM   5551 C CA  . GLN B 1 180 ? -12.327 -68.081 -38.936 1.00 32.03  ? 181 GLN B CA  1 
ATOM   5552 C C   . GLN B 1 180 ? -11.821 -69.136 -39.912 1.00 28.58  ? 181 GLN B C   1 
ATOM   5553 O O   . GLN B 1 180 ? -12.567 -70.025 -40.333 1.00 31.31  ? 181 GLN B O   1 
ATOM   5554 C CB  . GLN B 1 180 ? -12.739 -66.814 -39.694 1.00 30.00  ? 181 GLN B CB  1 
ATOM   5555 C CG  . GLN B 1 180 ? -13.427 -65.772 -38.814 1.00 36.39  ? 181 GLN B CG  1 
ATOM   5556 C CD  . GLN B 1 180 ? -13.585 -64.419 -39.494 1.00 40.77  ? 181 GLN B CD  1 
ATOM   5557 O OE1 . GLN B 1 180 ? -12.819 -64.066 -40.392 1.00 44.16  ? 181 GLN B OE1 1 
ATOM   5558 N NE2 . GLN B 1 180 ? -14.580 -63.655 -39.062 1.00 33.58  ? 181 GLN B NE2 1 
ATOM   5559 N N   . TRP B 1 181 ? -10.544 -69.041 -40.259 1.00 26.40  ? 182 TRP B N   1 
ATOM   5560 C CA  . TRP B 1 181 ? -9.921  -70.025 -41.139 1.00 29.05  ? 182 TRP B CA  1 
ATOM   5561 C C   . TRP B 1 181 ? -9.938  -71.402 -40.473 1.00 29.41  ? 182 TRP B C   1 
ATOM   5562 O O   . TRP B 1 181 ? -10.142 -72.424 -41.136 1.00 27.65  ? 182 TRP B O   1 
ATOM   5563 C CB  . TRP B 1 181 ? -8.488  -69.589 -41.478 1.00 29.94  ? 182 TRP B CB  1 
ATOM   5564 C CG  . TRP B 1 181 ? -7.813  -70.429 -42.496 1.00 30.30  ? 182 TRP B CG  1 
ATOM   5565 C CD1 . TRP B 1 181 ? -7.679  -70.156 -43.836 1.00 31.62  ? 182 TRP B CD1 1 
ATOM   5566 C CD2 . TRP B 1 181 ? -7.153  -71.681 -42.273 1.00 30.92  ? 182 TRP B CD2 1 
ATOM   5567 N NE1 . TRP B 1 181 ? -6.985  -71.164 -44.452 1.00 28.32  ? 182 TRP B NE1 1 
ATOM   5568 C CE2 . TRP B 1 181 ? -6.655  -72.116 -43.520 1.00 28.13  ? 182 TRP B CE2 1 
ATOM   5569 C CE3 . TRP B 1 181 ? -6.938  -72.479 -41.142 1.00 25.41  ? 182 TRP B CE3 1 
ATOM   5570 C CZ2 . TRP B 1 181 ? -5.960  -73.314 -43.668 1.00 25.43  ? 182 TRP B CZ2 1 
ATOM   5571 C CZ3 . TRP B 1 181 ? -6.251  -73.670 -41.293 1.00 29.34  ? 182 TRP B CZ3 1 
ATOM   5572 C CH2 . TRP B 1 181 ? -5.770  -74.077 -42.548 1.00 30.06  ? 182 TRP B CH2 1 
ATOM   5573 N N   . VAL B 1 182 ? -9.722  -71.430 -39.158 1.00 27.59  ? 183 VAL B N   1 
ATOM   5574 C CA  . VAL B 1 182 ? -9.764  -72.687 -38.411 1.00 26.31  ? 183 VAL B CA  1 
ATOM   5575 C C   . VAL B 1 182 ? -11.163 -73.317 -38.480 1.00 31.62  ? 183 VAL B C   1 
ATOM   5576 O O   . VAL B 1 182 ? -11.306 -74.519 -38.727 1.00 32.02  ? 183 VAL B O   1 
ATOM   5577 C CB  . VAL B 1 182 ? -9.302  -72.504 -36.945 1.00 26.52  ? 183 VAL B CB  1 
ATOM   5578 C CG1 . VAL B 1 182 ? -9.578  -73.755 -36.124 1.00 26.84  ? 183 VAL B CG1 1 
ATOM   5579 C CG2 . VAL B 1 182 ? -7.827  -72.159 -36.898 1.00 25.53  ? 183 VAL B CG2 1 
ATOM   5580 N N   . GLN B 1 183 ? -12.191 -72.496 -38.297 1.00 30.15  ? 184 GLN B N   1 
ATOM   5581 C CA  . GLN B 1 183 ? -13.572 -72.954 -38.425 1.00 31.30  ? 184 GLN B CA  1 
ATOM   5582 C C   . GLN B 1 183 ? -13.868 -73.535 -39.805 1.00 34.05  ? 184 GLN B C   1 
ATOM   5583 O O   . GLN B 1 183 ? -14.416 -74.633 -39.928 1.00 34.66  ? 184 GLN B O   1 
ATOM   5584 C CB  . GLN B 1 183 ? -14.544 -71.809 -38.126 1.00 31.95  ? 184 GLN B CB  1 
ATOM   5585 C CG  . GLN B 1 183 ? -14.664 -71.492 -36.649 1.00 34.57  ? 184 GLN B CG  1 
ATOM   5586 C CD  . GLN B 1 183 ? -15.142 -72.680 -35.850 1.00 36.03  ? 184 GLN B CD  1 
ATOM   5587 O OE1 . GLN B 1 183 ? -16.205 -73.238 -36.128 1.00 37.25  ? 184 GLN B OE1 1 
ATOM   5588 N NE2 . GLN B 1 183 ? -14.353 -73.090 -34.860 1.00 31.62  ? 184 GLN B NE2 1 
ATOM   5589 N N   . GLU B 1 184 ? -13.508 -72.802 -40.848 1.00 34.13  ? 185 GLU B N   1 
ATOM   5590 C CA  . GLU B 1 184 ? -13.791 -73.262 -42.203 1.00 37.02  ? 185 GLU B CA  1 
ATOM   5591 C C   . GLU B 1 184 ? -12.930 -74.447 -42.636 1.00 31.98  ? 185 GLU B C   1 
ATOM   5592 O O   . GLU B 1 184 ? -13.375 -75.281 -43.417 1.00 36.50  ? 185 GLU B O   1 
ATOM   5593 C CB  . GLU B 1 184 ? -13.644 -72.112 -43.197 1.00 41.56  ? 185 GLU B CB  1 
ATOM   5594 C CG  . GLU B 1 184 ? -14.542 -70.921 -42.876 1.00 49.38  ? 185 GLU B CG  1 
ATOM   5595 C CD  . GLU B 1 184 ? -14.584 -69.892 -43.992 1.00 66.18  ? 185 GLU B CD  1 
ATOM   5596 O OE1 . GLU B 1 184 ? -13.698 -69.929 -44.880 1.00 69.28  ? 185 GLU B OE1 1 
ATOM   5597 O OE2 . GLU B 1 184 ? -15.510 -69.048 -43.981 1.00 62.36  ? 185 GLU B OE2 1 
ATOM   5598 N N   . ASN B 1 185 ? -11.712 -74.547 -42.107 1.00 33.46  ? 186 ASN B N   1 
ATOM   5599 C CA  . ASN B 1 185 ? -10.726 -75.454 -42.698 1.00 27.44  ? 186 ASN B CA  1 
ATOM   5600 C C   . ASN B 1 185 ? -10.131 -76.572 -41.848 1.00 29.71  ? 186 ASN B C   1 
ATOM   5601 O O   . ASN B 1 185 ? -9.548  -77.498 -42.404 1.00 31.25  ? 186 ASN B O   1 
ATOM   5602 C CB  . ASN B 1 185 ? -9.589  -74.643 -43.336 1.00 29.92  ? 186 ASN B CB  1 
ATOM   5603 C CG  . ASN B 1 185 ? -10.062 -73.811 -44.517 1.00 31.01  ? 186 ASN B CG  1 
ATOM   5604 O OD1 . ASN B 1 185 ? -10.605 -74.344 -45.482 1.00 34.48  ? 186 ASN B OD1 1 
ATOM   5605 N ND2 . ASN B 1 185 ? -9.882  -72.498 -44.431 1.00 25.57  ? 186 ASN B ND2 1 
ATOM   5606 N N   . VAL B 1 186 ? -10.258 -76.508 -40.523 1.00 30.00  ? 187 VAL B N   1 
ATOM   5607 C CA  . VAL B 1 186 ? -9.494  -77.424 -39.676 1.00 23.83  ? 187 VAL B CA  1 
ATOM   5608 C C   . VAL B 1 186 ? -9.977  -78.875 -39.803 1.00 29.71  ? 187 VAL B C   1 
ATOM   5609 O O   . VAL B 1 186 ? -9.230  -79.828 -39.530 1.00 29.36  ? 187 VAL B O   1 
ATOM   5610 C CB  . VAL B 1 186 ? -9.472  -76.969 -38.181 1.00 31.75  ? 187 VAL B CB  1 
ATOM   5611 C CG1 . VAL B 1 186 ? -10.708 -77.473 -37.427 1.00 26.36  ? 187 VAL B CG1 1 
ATOM   5612 C CG2 . VAL B 1 186 ? -8.196  -77.449 -37.489 1.00 27.86  ? 187 VAL B CG2 1 
ATOM   5613 N N   . ALA B 1 187 ? -11.229 -79.041 -40.218 1.00 31.75  ? 188 ALA B N   1 
ATOM   5614 C CA  . ALA B 1 187 ? -11.794 -80.376 -40.407 1.00 35.22  ? 188 ALA B CA  1 
ATOM   5615 C C   . ALA B 1 187 ? -11.020 -81.144 -41.473 1.00 30.95  ? 188 ALA B C   1 
ATOM   5616 O O   . ALA B 1 187 ? -10.812 -82.356 -41.350 1.00 32.67  ? 188 ALA B O   1 
ATOM   5617 C CB  . ALA B 1 187 ? -13.261 -80.287 -40.774 1.00 32.11  ? 188 ALA B CB  1 
ATOM   5618 N N   . ALA B 1 188 ? -10.562 -80.425 -42.497 1.00 28.07  ? 189 ALA B N   1 
ATOM   5619 C CA  . ALA B 1 188 ? -9.785  -81.037 -43.581 1.00 37.85  ? 189 ALA B CA  1 
ATOM   5620 C C   . ALA B 1 188 ? -8.499  -81.689 -43.081 1.00 36.41  ? 189 ALA B C   1 
ATOM   5621 O O   . ALA B 1 188 ? -7.941  -82.561 -43.753 1.00 36.53  ? 189 ALA B O   1 
ATOM   5622 C CB  . ALA B 1 188 ? -9.480  -80.019 -44.684 1.00 28.93  ? 189 ALA B CB  1 
ATOM   5623 N N   . PHE B 1 189 ? -8.037  -81.273 -41.902 1.00 33.61  ? 190 PHE B N   1 
ATOM   5624 C CA  . PHE B 1 189 ? -6.849  -81.866 -41.283 1.00 30.40  ? 190 PHE B CA  1 
ATOM   5625 C C   . PHE B 1 189 ? -7.218  -82.875 -40.205 1.00 36.16  ? 190 PHE B C   1 
ATOM   5626 O O   . PHE B 1 189 ? -6.338  -83.426 -39.536 1.00 36.61  ? 190 PHE B O   1 
ATOM   5627 C CB  . PHE B 1 189 ? -5.952  -80.790 -40.672 1.00 28.06  ? 190 PHE B CB  1 
ATOM   5628 C CG  . PHE B 1 189 ? -5.508  -79.739 -41.651 1.00 36.15  ? 190 PHE B CG  1 
ATOM   5629 C CD1 . PHE B 1 189 ? -6.340  -78.681 -41.977 1.00 29.86  ? 190 PHE B CD1 1 
ATOM   5630 C CD2 . PHE B 1 189 ? -4.252  -79.801 -42.232 1.00 30.66  ? 190 PHE B CD2 1 
ATOM   5631 C CE1 . PHE B 1 189 ? -5.929  -77.716 -42.870 1.00 32.10  ? 190 PHE B CE1 1 
ATOM   5632 C CE2 . PHE B 1 189 ? -3.843  -78.840 -43.114 1.00 28.56  ? 190 PHE B CE2 1 
ATOM   5633 C CZ  . PHE B 1 189 ? -4.681  -77.797 -43.438 1.00 24.62  ? 190 PHE B CZ  1 
ATOM   5634 N N   . GLY B 1 190 ? -8.514  -83.117 -40.030 1.00 35.05  ? 191 GLY B N   1 
ATOM   5635 C CA  . GLY B 1 190 ? -8.968  -84.046 -39.005 1.00 35.73  ? 191 GLY B CA  1 
ATOM   5636 C C   . GLY B 1 190 ? -9.298  -83.383 -37.672 1.00 38.02  ? 191 GLY B C   1 
ATOM   5637 O O   . GLY B 1 190 ? -9.483  -84.058 -36.662 1.00 39.68  ? 191 GLY B O   1 
ATOM   5638 N N   . GLY B 1 191 ? -9.381  -82.056 -37.674 1.00 35.03  ? 192 GLY B N   1 
ATOM   5639 C CA  . GLY B 1 191 ? -9.681  -81.309 -36.468 1.00 30.03  ? 192 GLY B CA  1 
ATOM   5640 C C   . GLY B 1 191 ? -11.162 -81.025 -36.286 1.00 37.64  ? 192 GLY B C   1 
ATOM   5641 O O   . GLY B 1 191 ? -11.934 -80.995 -37.248 1.00 39.99  ? 192 GLY B O   1 
ATOM   5642 N N   . ASP B 1 192 ? -11.553 -80.814 -35.033 1.00 40.70  ? 193 ASP B N   1 
ATOM   5643 C CA  . ASP B 1 192 ? -12.937 -80.559 -34.671 1.00 33.77  ? 193 ASP B CA  1 
ATOM   5644 C C   . ASP B 1 192 ? -13.161 -79.069 -34.441 1.00 33.00  ? 193 ASP B C   1 
ATOM   5645 O O   . ASP B 1 192 ? -12.733 -78.527 -33.425 1.00 37.65  ? 193 ASP B O   1 
ATOM   5646 C CB  . ASP B 1 192 ? -13.261 -81.329 -33.393 1.00 36.40  ? 193 ASP B CB  1 
ATOM   5647 C CG  . ASP B 1 192 ? -14.733 -81.304 -33.047 1.00 36.17  ? 193 ASP B CG  1 
ATOM   5648 O OD1 . ASP B 1 192 ? -15.481 -80.471 -33.605 1.00 36.92  ? 193 ASP B OD1 1 
ATOM   5649 O OD2 . ASP B 1 192 ? -15.145 -82.122 -32.203 1.00 39.03  ? 193 ASP B OD2 1 
ATOM   5650 N N   . PRO B 1 193 ? -13.848 -78.402 -35.378 1.00 34.88  ? 194 PRO B N   1 
ATOM   5651 C CA  . PRO B 1 193 ? -14.140 -76.972 -35.212 1.00 38.96  ? 194 PRO B CA  1 
ATOM   5652 C C   . PRO B 1 193 ? -15.112 -76.696 -34.064 1.00 37.98  ? 194 PRO B C   1 
ATOM   5653 O O   . PRO B 1 193 ? -15.286 -75.535 -33.683 1.00 35.74  ? 194 PRO B O   1 
ATOM   5654 C CB  . PRO B 1 193 ? -14.757 -76.569 -36.562 1.00 30.83  ? 194 PRO B CB  1 
ATOM   5655 C CG  . PRO B 1 193 ? -15.221 -77.849 -37.173 1.00 29.65  ? 194 PRO B CG  1 
ATOM   5656 C CD  . PRO B 1 193 ? -14.279 -78.911 -36.693 1.00 35.20  ? 194 PRO B CD  1 
ATOM   5657 N N   . THR B 1 194 ? -15.728 -77.743 -33.521 1.00 37.43  ? 195 THR B N   1 
ATOM   5658 C CA  . THR B 1 194 ? -16.623 -77.584 -32.375 1.00 39.50  ? 195 THR B CA  1 
ATOM   5659 C C   . THR B 1 194 ? -15.869 -77.735 -31.054 1.00 36.74  ? 195 THR B C   1 
ATOM   5660 O O   . THR B 1 194 ? -16.435 -77.504 -29.988 1.00 43.60  ? 195 THR B O   1 
ATOM   5661 C CB  . THR B 1 194 ? -17.810 -78.575 -32.407 1.00 30.48  ? 195 THR B CB  1 
ATOM   5662 O OG1 . THR B 1 194 ? -17.321 -79.914 -32.287 1.00 35.58  ? 195 THR B OG1 1 
ATOM   5663 C CG2 . THR B 1 194 ? -18.589 -78.443 -33.705 1.00 36.32  ? 195 THR B CG2 1 
ATOM   5664 N N   . SER B 1 195 ? -14.594 -78.111 -31.128 1.00 34.38  ? 196 SER B N   1 
ATOM   5665 C CA  . SER B 1 195 ? -13.740 -78.151 -29.940 1.00 36.20  ? 196 SER B CA  1 
ATOM   5666 C C   . SER B 1 195 ? -12.416 -77.395 -30.142 1.00 32.87  ? 196 SER B C   1 
ATOM   5667 O O   . SER B 1 195 ? -11.361 -77.996 -30.371 1.00 34.23  ? 196 SER B O   1 
ATOM   5668 C CB  . SER B 1 195 ? -13.470 -79.594 -29.504 1.00 35.35  ? 196 SER B CB  1 
ATOM   5669 O OG  . SER B 1 195 ? -12.757 -79.616 -28.273 1.00 35.78  ? 196 SER B OG  1 
ATOM   5670 N N   . VAL B 1 196 ? -12.473 -76.074 -30.050 1.00 29.86  ? 197 VAL B N   1 
ATOM   5671 C CA  . VAL B 1 196 ? -11.285 -75.259 -30.257 1.00 31.26  ? 197 VAL B CA  1 
ATOM   5672 C C   . VAL B 1 196 ? -10.894 -74.481 -29.008 1.00 32.40  ? 197 VAL B C   1 
ATOM   5673 O O   . VAL B 1 196 ? -11.687 -73.701 -28.472 1.00 29.82  ? 197 VAL B O   1 
ATOM   5674 C CB  . VAL B 1 196 ? -11.475 -74.285 -31.433 1.00 31.07  ? 197 VAL B CB  1 
ATOM   5675 C CG1 . VAL B 1 196 ? -10.340 -73.257 -31.464 1.00 28.08  ? 197 VAL B CG1 1 
ATOM   5676 C CG2 . VAL B 1 196 ? -11.568 -75.060 -32.747 1.00 24.38  ? 197 VAL B CG2 1 
ATOM   5677 N N   . THR B 1 197 ? -9.659  -74.693 -28.563 1.00 32.08  ? 198 THR B N   1 
ATOM   5678 C CA  . THR B 1 197 ? -9.150  -74.070 -27.348 1.00 25.85  ? 198 THR B CA  1 
ATOM   5679 C C   . THR B 1 197 ? -8.014  -73.106 -27.681 1.00 31.67  ? 198 THR B C   1 
ATOM   5680 O O   . THR B 1 197 ? -6.966  -73.515 -28.188 1.00 30.12  ? 198 THR B O   1 
ATOM   5681 C CB  . THR B 1 197 ? -8.637  -75.139 -26.347 1.00 28.85  ? 198 THR B CB  1 
ATOM   5682 O OG1 . THR B 1 197 ? -9.703  -76.033 -25.990 1.00 30.16  ? 198 THR B OG1 1 
ATOM   5683 C CG2 . THR B 1 197 ? -8.066  -74.492 -25.079 1.00 20.92  ? 198 THR B CG2 1 
ATOM   5684 N N   . LEU B 1 198 ? -8.226  -71.825 -27.395 1.00 28.85  ? 199 LEU B N   1 
ATOM   5685 C CA  . LEU B 1 198 ? -7.183  -70.822 -27.562 1.00 28.21  ? 199 LEU B CA  1 
ATOM   5686 C C   . LEU B 1 198 ? -6.221  -70.845 -26.387 1.00 25.78  ? 199 LEU B C   1 
ATOM   5687 O O   . LEU B 1 198 ? -6.635  -70.953 -25.242 1.00 31.23  ? 199 LEU B O   1 
ATOM   5688 C CB  . LEU B 1 198 ? -7.785  -69.423 -27.642 1.00 26.79  ? 199 LEU B CB  1 
ATOM   5689 C CG  . LEU B 1 198 ? -8.857  -69.131 -28.677 1.00 28.43  ? 199 LEU B CG  1 
ATOM   5690 C CD1 . LEU B 1 198 ? -9.141  -67.640 -28.700 1.00 27.79  ? 199 LEU B CD1 1 
ATOM   5691 C CD2 . LEU B 1 198 ? -8.413  -69.624 -30.044 1.00 28.55  ? 199 LEU B CD2 1 
ATOM   5692 N N   . PHE B 1 199 ? -4.932  -70.744 -26.668 1.00 27.71  ? 200 PHE B N   1 
ATOM   5693 C CA  . PHE B 1 199 ? -3.975  -70.472 -25.611 1.00 21.14  ? 200 PHE B CA  1 
ATOM   5694 C C   . PHE B 1 199 ? -2.892  -69.501 -26.055 1.00 24.76  ? 200 PHE B C   1 
ATOM   5695 O O   . PHE B 1 199 ? -2.482  -69.491 -27.216 1.00 24.32  ? 200 PHE B O   1 
ATOM   5696 C CB  . PHE B 1 199 ? -3.429  -71.750 -24.936 1.00 25.17  ? 200 PHE B CB  1 
ATOM   5697 C CG  . PHE B 1 199 ? -2.505  -72.598 -25.783 1.00 25.68  ? 200 PHE B CG  1 
ATOM   5698 C CD1 . PHE B 1 199 ? -2.805  -72.912 -27.100 1.00 22.40  ? 200 PHE B CD1 1 
ATOM   5699 C CD2 . PHE B 1 199 ? -1.346  -73.127 -25.219 1.00 24.37  ? 200 PHE B CD2 1 
ATOM   5700 C CE1 . PHE B 1 199 ? -1.957  -73.726 -27.849 1.00 23.17  ? 200 PHE B CE1 1 
ATOM   5701 C CE2 . PHE B 1 199 ? -0.485  -73.934 -25.963 1.00 30.49  ? 200 PHE B CE2 1 
ATOM   5702 C CZ  . PHE B 1 199 ? -0.792  -74.232 -27.287 1.00 23.03  ? 200 PHE B CZ  1 
ATOM   5703 N N   . GLY B 1 200 ? -2.462  -68.659 -25.125 1.00 23.38  ? 201 GLY B N   1 
ATOM   5704 C CA  . GLY B 1 200 ? -1.442  -67.671 -25.411 1.00 21.65  ? 201 GLY B CA  1 
ATOM   5705 C C   . GLY B 1 200 ? -0.721  -67.262 -24.144 1.00 24.39  ? 201 GLY B C   1 
ATOM   5706 O O   . GLY B 1 200 ? -1.180  -67.543 -23.040 1.00 22.70  ? 201 GLY B O   1 
ATOM   5707 N N   . GLU B 1 201 ? 0.410   -66.589 -24.302 1.00 21.22  ? 202 GLU B N   1 
ATOM   5708 C CA  . GLU B 1 201 ? 1.212   -66.183 -23.161 1.00 23.74  ? 202 GLU B CA  1 
ATOM   5709 C C   . GLU B 1 201 ? 1.518   -64.708 -23.336 1.00 25.55  ? 202 GLU B C   1 
ATOM   5710 O O   . GLU B 1 201 ? 1.660   -64.252 -24.464 1.00 23.07  ? 202 GLU B O   1 
ATOM   5711 C CB  . GLU B 1 201 ? 2.492   -67.029 -23.078 1.00 23.46  ? 202 GLU B CB  1 
ATOM   5712 C CG  . GLU B 1 201 ? 3.380   -66.752 -21.895 1.00 17.97  ? 202 GLU B CG  1 
ATOM   5713 C CD  . GLU B 1 201 ? 4.343   -65.593 -22.120 1.00 25.50  ? 202 GLU B CD  1 
ATOM   5714 O OE1 . GLU B 1 201 ? 4.486   -65.145 -23.278 1.00 24.46  ? 202 GLU B OE1 1 
ATOM   5715 O OE2 . GLU B 1 201 ? 4.950   -65.120 -21.128 1.00 25.07  ? 202 GLU B OE2 1 
ATOM   5716 N N   . SER B 1 202 ? 1.627   -63.988 -22.216 1.00 25.48  ? 203 SER B N   1 
ATOM   5717 C CA  . SER B 1 202 ? 1.717   -62.525 -22.181 1.00 22.36  ? 203 SER B CA  1 
ATOM   5718 C C   . SER B 1 202 ? 0.728   -61.833 -23.127 1.00 21.84  ? 203 SER B C   1 
ATOM   5719 O O   . SER B 1 202 ? -0.481  -61.961 -22.957 1.00 25.62  ? 203 SER B O   1 
ATOM   5720 C CB  . SER B 1 202 ? 3.157   -62.032 -22.382 1.00 24.41  ? 203 SER B CB  1 
ATOM   5721 O OG  . SER B 1 202 ? 3.644   -62.342 -23.671 1.00 35.27  ? 203 SER B OG  1 
ATOM   5722 N N   . ALA B 1 203 ? 1.234   -61.113 -24.124 1.00 22.57  ? 204 ALA B N   1 
ATOM   5723 C CA  . ALA B 1 203 ? 0.355   -60.430 -25.086 1.00 25.54  ? 204 ALA B CA  1 
ATOM   5724 C C   . ALA B 1 203 ? -0.593  -61.388 -25.818 1.00 21.07  ? 204 ALA B C   1 
ATOM   5725 O O   . ALA B 1 203 ? -1.697  -61.000 -26.226 1.00 20.34  ? 204 ALA B O   1 
ATOM   5726 C CB  . ALA B 1 203 ? 1.171   -59.607 -26.085 1.00 24.47  ? 204 ALA B CB  1 
ATOM   5727 N N   . GLY B 1 204 ? -0.164  -62.637 -25.979 1.00 22.97  ? 205 GLY B N   1 
ATOM   5728 C CA  . GLY B 1 204 ? -1.014  -63.662 -26.562 1.00 19.18  ? 205 GLY B CA  1 
ATOM   5729 C C   . GLY B 1 204 ? -2.151  -64.019 -25.621 1.00 24.22  ? 205 GLY B C   1 
ATOM   5730 O O   . GLY B 1 204 ? -3.284  -64.238 -26.049 1.00 25.12  ? 205 GLY B O   1 
ATOM   5731 N N   . ALA B 1 205 ? -1.845  -64.069 -24.329 1.00 22.32  ? 206 ALA B N   1 
ATOM   5732 C CA  . ALA B 1 205 ? -2.855  -64.339 -23.315 1.00 24.32  ? 206 ALA B CA  1 
ATOM   5733 C C   . ALA B 1 205 ? -3.855  -63.186 -23.275 1.00 25.91  ? 206 ALA B C   1 
ATOM   5734 O O   . ALA B 1 205 ? -5.076  -63.394 -23.192 1.00 23.02  ? 206 ALA B O   1 
ATOM   5735 C CB  . ALA B 1 205 ? -2.202  -64.529 -21.947 1.00 21.41  ? 206 ALA B CB  1 
ATOM   5736 N N   . ALA B 1 206 ? -3.329  -61.969 -23.336 1.00 23.29  ? 207 ALA B N   1 
ATOM   5737 C CA  . ALA B 1 206 ? -4.171  -60.782 -23.385 1.00 23.78  ? 207 ALA B CA  1 
ATOM   5738 C C   . ALA B 1 206 ? -5.041  -60.798 -24.648 1.00 28.17  ? 207 ALA B C   1 
ATOM   5739 O O   . ALA B 1 206 ? -6.219  -60.424 -24.602 1.00 30.50  ? 207 ALA B O   1 
ATOM   5740 C CB  . ALA B 1 206 ? -3.317  -59.535 -23.327 1.00 20.77  ? 207 ALA B CB  1 
ATOM   5741 N N   . SER B 1 207 ? -4.469  -61.253 -25.765 1.00 21.99  ? 208 SER B N   1 
ATOM   5742 C CA  . SER B 1 207 ? -5.242  -61.427 -26.996 1.00 25.70  ? 208 SER B CA  1 
ATOM   5743 C C   . SER B 1 207 ? -6.359  -62.444 -26.793 1.00 22.95  ? 208 SER B C   1 
ATOM   5744 O O   . SER B 1 207 ? -7.492  -62.220 -27.218 1.00 20.77  ? 208 SER B O   1 
ATOM   5745 C CB  . SER B 1 207 ? -4.351  -61.880 -28.166 1.00 22.24  ? 208 SER B CB  1 
ATOM   5746 O OG  . SER B 1 207 ? -3.409  -60.882 -28.526 1.00 20.76  ? 208 SER B OG  1 
ATOM   5747 N N   . VAL B 1 208 ? -6.034  -63.566 -26.157 1.00 20.14  ? 209 VAL B N   1 
ATOM   5748 C CA  . VAL B 1 208 ? -7.036  -64.593 -25.908 1.00 22.87  ? 209 VAL B CA  1 
ATOM   5749 C C   . VAL B 1 208 ? -8.200  -63.988 -25.132 1.00 27.87  ? 209 VAL B C   1 
ATOM   5750 O O   . VAL B 1 208 ? -9.359  -64.205 -25.482 1.00 24.92  ? 209 VAL B O   1 
ATOM   5751 C CB  . VAL B 1 208 ? -6.470  -65.801 -25.139 1.00 21.84  ? 209 VAL B CB  1 
ATOM   5752 C CG1 . VAL B 1 208 ? -7.598  -66.698 -24.651 1.00 23.70  ? 209 VAL B CG1 1 
ATOM   5753 C CG2 . VAL B 1 208 ? -5.520  -66.606 -26.012 1.00 23.39  ? 209 VAL B CG2 1 
ATOM   5754 N N   . GLY B 1 209 ? -7.876  -63.201 -24.103 1.00 26.33  ? 210 GLY B N   1 
ATOM   5755 C CA  . GLY B 1 209 ? -8.880  -62.551 -23.277 1.00 24.83  ? 210 GLY B CA  1 
ATOM   5756 C C   . GLY B 1 209 ? -9.740  -61.570 -24.059 1.00 28.72  ? 210 GLY B C   1 
ATOM   5757 O O   . GLY B 1 209 ? -10.951 -61.477 -23.850 1.00 24.71  ? 210 GLY B O   1 
ATOM   5758 N N   . MET B 1 210 ? -9.121  -60.838 -24.976 1.00 27.86  ? 211 MET B N   1 
ATOM   5759 C CA  . MET B 1 210 ? -9.878  -59.908 -25.797 1.00 26.13  ? 211 MET B CA  1 
ATOM   5760 C C   . MET B 1 210 ? -10.838 -60.625 -26.740 1.00 29.15  ? 211 MET B C   1 
ATOM   5761 O O   . MET B 1 210 ? -11.956 -60.167 -26.947 1.00 31.42  ? 211 MET B O   1 
ATOM   5762 C CB  . MET B 1 210 ? -8.946  -58.965 -26.547 1.00 30.36  ? 211 MET B CB  1 
ATOM   5763 C CG  . MET B 1 210 ? -8.260  -57.987 -25.617 1.00 24.27  ? 211 MET B CG  1 
ATOM   5764 S SD  . MET B 1 210 ? -6.999  -57.051 -26.461 1.00 32.16  ? 211 MET B SD  1 
ATOM   5765 C CE  . MET B 1 210 ? -5.998  -56.491 -25.070 1.00 21.79  ? 211 MET B CE  1 
ATOM   5766 N N   . HIS B 1 211 ? -10.426 -61.762 -27.288 1.00 26.22  ? 212 HIS B N   1 
ATOM   5767 C CA  . HIS B 1 211 ? -11.348 -62.544 -28.103 1.00 28.92  ? 212 HIS B CA  1 
ATOM   5768 C C   . HIS B 1 211 ? -12.551 -62.985 -27.265 1.00 33.76  ? 212 HIS B C   1 
ATOM   5769 O O   . HIS B 1 211 ? -13.677 -63.021 -27.764 1.00 34.43  ? 212 HIS B O   1 
ATOM   5770 C CB  . HIS B 1 211 ? -10.644 -63.740 -28.763 1.00 26.92  ? 212 HIS B CB  1 
ATOM   5771 C CG  . HIS B 1 211 ? -9.671  -63.340 -29.828 1.00 30.55  ? 212 HIS B CG  1 
ATOM   5772 N ND1 . HIS B 1 211 ? -10.068 -62.769 -31.020 1.00 28.59  ? 212 HIS B ND1 1 
ATOM   5773 C CD2 . HIS B 1 211 ? -8.319  -63.404 -29.871 1.00 21.52  ? 212 HIS B CD2 1 
ATOM   5774 C CE1 . HIS B 1 211 ? -9.001  -62.497 -31.749 1.00 29.77  ? 212 HIS B CE1 1 
ATOM   5775 N NE2 . HIS B 1 211 ? -7.927  -62.874 -31.075 1.00 28.34  ? 212 HIS B NE2 1 
ATOM   5776 N N   . LEU B 1 212 ? -12.305 -63.294 -25.990 1.00 27.85  ? 213 LEU B N   1 
ATOM   5777 C CA  . LEU B 1 212 ? -13.376 -63.618 -25.045 1.00 34.15  ? 213 LEU B CA  1 
ATOM   5778 C C   . LEU B 1 212 ? -14.369 -62.473 -24.868 1.00 30.72  ? 213 LEU B C   1 
ATOM   5779 O O   . LEU B 1 212 ? -15.560 -62.703 -24.696 1.00 34.22  ? 213 LEU B O   1 
ATOM   5780 C CB  . LEU B 1 212 ? -12.801 -63.990 -23.678 1.00 33.79  ? 213 LEU B CB  1 
ATOM   5781 C CG  . LEU B 1 212 ? -12.332 -65.430 -23.497 1.00 38.94  ? 213 LEU B CG  1 
ATOM   5782 C CD1 . LEU B 1 212 ? -11.581 -65.577 -22.178 1.00 33.89  ? 213 LEU B CD1 1 
ATOM   5783 C CD2 . LEU B 1 212 ? -13.522 -66.371 -23.551 1.00 35.87  ? 213 LEU B CD2 1 
ATOM   5784 N N   . LEU B 1 213 ? -13.868 -61.243 -24.915 1.00 31.32  ? 214 LEU B N   1 
ATOM   5785 C CA  . LEU B 1 213 ? -14.673 -60.058 -24.634 1.00 27.27  ? 214 LEU B CA  1 
ATOM   5786 C C   . LEU B 1 213 ? -15.234 -59.401 -25.891 1.00 33.02  ? 214 LEU B C   1 
ATOM   5787 O O   . LEU B 1 213 ? -15.830 -58.326 -25.823 1.00 37.61  ? 214 LEU B O   1 
ATOM   5788 C CB  . LEU B 1 213 ? -13.832 -59.047 -23.856 1.00 25.87  ? 214 LEU B CB  1 
ATOM   5789 C CG  . LEU B 1 213 ? -13.240 -59.598 -22.557 1.00 33.12  ? 214 LEU B CG  1 
ATOM   5790 C CD1 . LEU B 1 213 ? -12.299 -58.593 -21.914 1.00 29.51  ? 214 LEU B CD1 1 
ATOM   5791 C CD2 . LEU B 1 213 ? -14.356 -60.006 -21.600 1.00 30.04  ? 214 LEU B CD2 1 
ATOM   5792 N N   . SER B 1 214 ? -15.034 -60.042 -27.037 1.00 30.80  ? 215 SER B N   1 
ATOM   5793 C CA  . SER B 1 214 ? -15.476 -59.482 -28.313 1.00 34.12  ? 215 SER B CA  1 
ATOM   5794 C C   . SER B 1 214 ? -16.375 -60.492 -29.011 1.00 34.64  ? 215 SER B C   1 
ATOM   5795 O O   . SER B 1 214 ? -15.901 -61.533 -29.467 1.00 36.71  ? 215 SER B O   1 
ATOM   5796 C CB  . SER B 1 214 ? -14.273 -59.141 -29.198 1.00 34.79  ? 215 SER B CB  1 
ATOM   5797 O OG  . SER B 1 214 ? -14.669 -58.518 -30.411 1.00 36.67  ? 215 SER B OG  1 
ATOM   5798 N N   . PRO B 1 215 ? -17.680 -60.200 -29.071 1.00 37.62  ? 216 PRO B N   1 
ATOM   5799 C CA  . PRO B 1 215 ? -18.682 -61.127 -29.618 1.00 39.09  ? 216 PRO B CA  1 
ATOM   5800 C C   . PRO B 1 215 ? -18.338 -61.805 -30.958 1.00 36.55  ? 216 PRO B C   1 
ATOM   5801 O O   . PRO B 1 215 ? -18.480 -63.028 -31.025 1.00 37.11  ? 216 PRO B O   1 
ATOM   5802 C CB  . PRO B 1 215 ? -19.939 -60.256 -29.714 1.00 36.17  ? 216 PRO B CB  1 
ATOM   5803 C CG  . PRO B 1 215 ? -19.798 -59.332 -28.536 1.00 34.46  ? 216 PRO B CG  1 
ATOM   5804 C CD  . PRO B 1 215 ? -18.312 -59.009 -28.472 1.00 39.83  ? 216 PRO B CD  1 
ATOM   5805 N N   . PRO B 1 216 ? -17.873 -61.058 -31.984 1.00 32.19  ? 217 PRO B N   1 
ATOM   5806 C CA  . PRO B 1 216 ? -17.592 -61.776 -33.239 1.00 32.79  ? 217 PRO B CA  1 
ATOM   5807 C C   . PRO B 1 216 ? -16.491 -62.832 -33.106 1.00 36.32  ? 217 PRO B C   1 
ATOM   5808 O O   . PRO B 1 216 ? -16.453 -63.762 -33.908 1.00 45.14  ? 217 PRO B O   1 
ATOM   5809 C CB  . PRO B 1 216 ? -17.145 -60.661 -34.197 1.00 28.64  ? 217 PRO B CB  1 
ATOM   5810 C CG  . PRO B 1 216 ? -17.660 -59.394 -33.595 1.00 28.06  ? 217 PRO B CG  1 
ATOM   5811 C CD  . PRO B 1 216 ? -17.585 -59.619 -32.110 1.00 33.44  ? 217 PRO B CD  1 
ATOM   5812 N N   . SER B 1 217 ? -15.615 -62.705 -32.113 1.00 33.50  ? 218 SER B N   1 
ATOM   5813 C CA  . SER B 1 217 ? -14.593 -63.727 -31.892 1.00 31.68  ? 218 SER B CA  1 
ATOM   5814 C C   . SER B 1 217 ? -15.148 -64.897 -31.112 1.00 36.48  ? 218 SER B C   1 
ATOM   5815 O O   . SER B 1 217 ? -14.694 -66.028 -31.274 1.00 33.15  ? 218 SER B O   1 
ATOM   5816 C CB  . SER B 1 217 ? -13.377 -63.166 -31.149 1.00 30.19  ? 218 SER B CB  1 
ATOM   5817 O OG  . SER B 1 217 ? -12.652 -62.244 -31.945 1.00 33.50  ? 218 SER B OG  1 
ATOM   5818 N N   . ARG B 1 218 ? -16.135 -64.615 -30.264 1.00 44.50  ? 219 ARG B N   1 
ATOM   5819 C CA  . ARG B 1 218 ? -16.570 -65.554 -29.233 1.00 39.76  ? 219 ARG B CA  1 
ATOM   5820 C C   . ARG B 1 218 ? -17.175 -66.817 -29.830 1.00 35.68  ? 219 ARG B C   1 
ATOM   5821 O O   . ARG B 1 218 ? -17.141 -67.881 -29.212 1.00 41.23  ? 219 ARG B O   1 
ATOM   5822 C CB  . ARG B 1 218 ? -17.562 -64.887 -28.263 1.00 44.00  ? 219 ARG B CB  1 
ATOM   5823 C CG  . ARG B 1 218 ? -17.162 -64.936 -26.788 1.00 38.73  ? 219 ARG B CG  1 
ATOM   5824 C CD  . ARG B 1 218 ? -16.318 -66.169 -26.463 1.00 47.42  ? 219 ARG B CD  1 
ATOM   5825 N NE  . ARG B 1 218 ? -16.821 -66.969 -25.345 1.00 48.28  ? 219 ARG B NE  1 
ATOM   5826 C CZ  . ARG B 1 218 ? -16.938 -68.297 -25.381 1.00 48.83  ? 219 ARG B CZ  1 
ATOM   5827 N NH1 . ARG B 1 218 ? -16.599 -68.966 -26.480 1.00 37.19  ? 219 ARG B NH1 1 
ATOM   5828 N NH2 . ARG B 1 218 ? -17.399 -68.960 -24.329 1.00 38.74  ? 219 ARG B NH2 1 
ATOM   5829 N N   . GLY B 1 219 ? -17.722 -66.700 -31.034 1.00 38.45  ? 220 GLY B N   1 
ATOM   5830 C CA  . GLY B 1 219 ? -18.280 -67.853 -31.720 1.00 36.66  ? 220 GLY B CA  1 
ATOM   5831 C C   . GLY B 1 219 ? -17.247 -68.772 -32.348 1.00 40.11  ? 220 GLY B C   1 
ATOM   5832 O O   . GLY B 1 219 ? -17.588 -69.858 -32.818 1.00 45.29  ? 220 GLY B O   1 
ATOM   5833 N N   . LEU B 1 220 ? -15.982 -68.354 -32.346 1.00 37.49  ? 221 LEU B N   1 
ATOM   5834 C CA  . LEU B 1 220 ? -14.934 -69.099 -33.050 1.00 37.79  ? 221 LEU B CA  1 
ATOM   5835 C C   . LEU B 1 220 ? -14.151 -70.078 -32.168 1.00 41.57  ? 221 LEU B C   1 
ATOM   5836 O O   . LEU B 1 220 ? -13.285 -70.796 -32.658 1.00 35.53  ? 221 LEU B O   1 
ATOM   5837 C CB  . LEU B 1 220 ? -13.972 -68.130 -33.747 1.00 30.16  ? 221 LEU B CB  1 
ATOM   5838 C CG  . LEU B 1 220 ? -14.678 -67.035 -34.553 1.00 36.19  ? 221 LEU B CG  1 
ATOM   5839 C CD1 . LEU B 1 220 ? -13.705 -65.985 -35.043 1.00 29.11  ? 221 LEU B CD1 1 
ATOM   5840 C CD2 . LEU B 1 220 ? -15.441 -67.645 -35.713 1.00 32.23  ? 221 LEU B CD2 1 
ATOM   5841 N N   . PHE B 1 221 ? -14.438 -70.098 -30.870 1.00 37.86  ? 222 PHE B N   1 
ATOM   5842 C CA  . PHE B 1 221 ? -13.753 -71.025 -29.971 1.00 35.10  ? 222 PHE B CA  1 
ATOM   5843 C C   . PHE B 1 221 ? -14.613 -71.374 -28.758 1.00 34.17  ? 222 PHE B C   1 
ATOM   5844 O O   . PHE B 1 221 ? -15.710 -70.843 -28.592 1.00 33.01  ? 222 PHE B O   1 
ATOM   5845 C CB  . PHE B 1 221 ? -12.393 -70.469 -29.534 1.00 36.18  ? 222 PHE B CB  1 
ATOM   5846 C CG  . PHE B 1 221 ? -12.481 -69.214 -28.721 1.00 33.13  ? 222 PHE B CG  1 
ATOM   5847 C CD1 . PHE B 1 221 ? -12.771 -68.000 -29.324 1.00 34.47  ? 222 PHE B CD1 1 
ATOM   5848 C CD2 . PHE B 1 221 ? -12.275 -69.247 -27.353 1.00 34.39  ? 222 PHE B CD2 1 
ATOM   5849 C CE1 . PHE B 1 221 ? -12.859 -66.837 -28.578 1.00 33.92  ? 222 PHE B CE1 1 
ATOM   5850 C CE2 . PHE B 1 221 ? -12.356 -68.092 -26.601 1.00 34.72  ? 222 PHE B CE2 1 
ATOM   5851 C CZ  . PHE B 1 221 ? -12.651 -66.882 -27.215 1.00 35.92  ? 222 PHE B CZ  1 
ATOM   5852 N N   . HIS B 1 222 ? -14.107 -72.269 -27.914 1.00 30.91  ? 223 HIS B N   1 
ATOM   5853 C CA  . HIS B 1 222 ? -14.909 -72.832 -26.834 1.00 39.44  ? 223 HIS B CA  1 
ATOM   5854 C C   . HIS B 1 222 ? -14.252 -72.729 -25.462 1.00 35.61  ? 223 HIS B C   1 
ATOM   5855 O O   . HIS B 1 222 ? -14.929 -72.681 -24.443 1.00 39.61  ? 223 HIS B O   1 
ATOM   5856 C CB  . HIS B 1 222 ? -15.244 -74.284 -27.172 1.00 34.54  ? 223 HIS B CB  1 
ATOM   5857 C CG  . HIS B 1 222 ? -15.812 -74.438 -28.543 1.00 40.94  ? 223 HIS B CG  1 
ATOM   5858 N ND1 . HIS B 1 222 ? -15.021 -74.601 -29.660 1.00 39.91  ? 223 HIS B ND1 1 
ATOM   5859 C CD2 . HIS B 1 222 ? -17.088 -74.378 -28.989 1.00 40.05  ? 223 HIS B CD2 1 
ATOM   5860 C CE1 . HIS B 1 222 ? -15.787 -74.657 -30.733 1.00 38.29  ? 223 HIS B CE1 1 
ATOM   5861 N NE2 . HIS B 1 222 ? -17.046 -74.532 -30.353 1.00 45.38  ? 223 HIS B NE2 1 
ATOM   5862 N N   . ARG B 1 223 ? -12.928 -72.712 -25.443 1.00 36.18  ? 224 ARG B N   1 
ATOM   5863 C CA  . ARG B 1 223 ? -12.191 -72.652 -24.193 1.00 35.79  ? 224 ARG B CA  1 
ATOM   5864 C C   . ARG B 1 223 ? -11.000 -71.728 -24.346 1.00 35.93  ? 224 ARG B C   1 
ATOM   5865 O O   . ARG B 1 223 ? -10.562 -71.442 -25.465 1.00 38.59  ? 224 ARG B O   1 
ATOM   5866 C CB  . ARG B 1 223 ? -11.733 -74.045 -23.771 1.00 34.41  ? 224 ARG B CB  1 
ATOM   5867 C CG  . ARG B 1 223 ? -12.860 -74.930 -23.297 1.00 35.47  ? 224 ARG B CG  1 
ATOM   5868 C CD  . ARG B 1 223 ? -12.408 -76.364 -23.132 1.00 34.79  ? 224 ARG B CD  1 
ATOM   5869 N NE  . ARG B 1 223 ? -13.409 -77.276 -23.671 1.00 41.42  ? 224 ARG B NE  1 
ATOM   5870 C CZ  . ARG B 1 223 ? -13.474 -77.631 -24.949 1.00 44.21  ? 224 ARG B CZ  1 
ATOM   5871 N NH1 . ARG B 1 223 ? -12.589 -77.156 -25.813 1.00 47.19  ? 224 ARG B NH1 1 
ATOM   5872 N NH2 . ARG B 1 223 ? -14.415 -78.465 -25.370 1.00 54.62  ? 224 ARG B NH2 1 
ATOM   5873 N N   . ALA B 1 224 ? -10.474 -71.266 -23.220 1.00 32.04  ? 225 ALA B N   1 
ATOM   5874 C CA  . ALA B 1 224 ? -9.404  -70.288 -23.238 1.00 27.64  ? 225 ALA B CA  1 
ATOM   5875 C C   . ALA B 1 224 ? -8.335  -70.615 -22.203 1.00 27.79  ? 225 ALA B C   1 
ATOM   5876 O O   . ALA B 1 224 ? -8.645  -71.122 -21.128 1.00 31.61  ? 225 ALA B O   1 
ATOM   5877 C CB  . ALA B 1 224 ? -9.971  -68.909 -23.001 1.00 27.83  ? 225 ALA B CB  1 
ATOM   5878 N N   . VAL B 1 225 ? -7.078  -70.337 -22.549 1.00 24.39  ? 226 VAL B N   1 
ATOM   5879 C CA  . VAL B 1 225 ? -5.951  -70.477 -21.632 1.00 25.57  ? 226 VAL B CA  1 
ATOM   5880 C C   . VAL B 1 225 ? -5.101  -69.206 -21.688 1.00 29.02  ? 226 VAL B C   1 
ATOM   5881 O O   . VAL B 1 225 ? -4.620  -68.819 -22.751 1.00 34.08  ? 226 VAL B O   1 
ATOM   5882 C CB  . VAL B 1 225 ? -5.088  -71.697 -21.988 1.00 28.17  ? 226 VAL B CB  1 
ATOM   5883 C CG1 . VAL B 1 225 ? -3.819  -71.761 -21.133 1.00 23.80  ? 226 VAL B CG1 1 
ATOM   5884 C CG2 . VAL B 1 225 ? -5.901  -72.977 -21.882 1.00 27.01  ? 226 VAL B CG2 1 
ATOM   5885 N N   . LEU B 1 226 ? -4.942  -68.546 -20.544 1.00 28.15  ? 227 LEU B N   1 
ATOM   5886 C CA  . LEU B 1 226 ? -4.196  -67.292 -20.466 1.00 25.02  ? 227 LEU B CA  1 
ATOM   5887 C C   . LEU B 1 226 ? -2.992  -67.460 -19.565 1.00 26.84  ? 227 LEU B C   1 
ATOM   5888 O O   . LEU B 1 226 ? -3.135  -67.580 -18.346 1.00 27.21  ? 227 LEU B O   1 
ATOM   5889 C CB  . LEU B 1 226 ? -5.071  -66.160 -19.927 1.00 21.42  ? 227 LEU B CB  1 
ATOM   5890 C CG  . LEU B 1 226 ? -6.240  -65.717 -20.804 1.00 25.20  ? 227 LEU B CG  1 
ATOM   5891 C CD1 . LEU B 1 226 ? -7.449  -66.644 -20.677 1.00 25.29  ? 227 LEU B CD1 1 
ATOM   5892 C CD2 . LEU B 1 226 ? -6.615  -64.288 -20.480 1.00 21.64  ? 227 LEU B CD2 1 
ATOM   5893 N N   . GLN B 1 227 ? -1.807  -67.466 -20.168 1.00 22.13  ? 228 GLN B N   1 
ATOM   5894 C CA  . GLN B 1 227 ? -0.570  -67.651 -19.427 1.00 22.32  ? 228 GLN B CA  1 
ATOM   5895 C C   . GLN B 1 227 ? 0.143   -66.313 -19.220 1.00 23.41  ? 228 GLN B C   1 
ATOM   5896 O O   . GLN B 1 227 ? 0.559   -65.662 -20.186 1.00 23.31  ? 228 GLN B O   1 
ATOM   5897 C CB  . GLN B 1 227 ? 0.335   -68.660 -20.156 1.00 23.44  ? 228 GLN B CB  1 
ATOM   5898 C CG  . GLN B 1 227 ? -0.363  -69.986 -20.518 1.00 22.23  ? 228 GLN B CG  1 
ATOM   5899 C CD  . GLN B 1 227 ? 0.467   -70.887 -21.451 1.00 32.14  ? 228 GLN B CD  1 
ATOM   5900 O OE1 . GLN B 1 227 ? -0.079  -71.757 -22.140 1.00 24.48  ? 228 GLN B OE1 1 
ATOM   5901 N NE2 . GLN B 1 227 ? 1.787   -70.696 -21.456 1.00 26.34  ? 228 GLN B NE2 1 
ATOM   5902 N N   . SER B 1 228 ? 0.280   -65.899 -17.962 1.00 21.86  ? 229 SER B N   1 
ATOM   5903 C CA  . SER B 1 228 ? 1.019   -64.675 -17.625 1.00 20.41  ? 229 SER B CA  1 
ATOM   5904 C C   . SER B 1 228 ? 0.551   -63.443 -18.409 1.00 22.87  ? 229 SER B C   1 
ATOM   5905 O O   . SER B 1 228 ? 1.373   -62.667 -18.910 1.00 22.89  ? 229 SER B O   1 
ATOM   5906 C CB  . SER B 1 228 ? 2.522   -64.866 -17.869 1.00 23.02  ? 229 SER B CB  1 
ATOM   5907 O OG  . SER B 1 228 ? 3.033   -65.974 -17.157 1.00 24.70  ? 229 SER B OG  1 
ATOM   5908 N N   . GLY B 1 229 ? -0.759  -63.273 -18.546 1.00 18.46  ? 230 GLY B N   1 
ATOM   5909 C CA  . GLY B 1 229 ? -1.269  -62.116 -19.254 1.00 16.01  ? 230 GLY B CA  1 
ATOM   5910 C C   . GLY B 1 229 ? -2.780  -62.070 -19.204 1.00 19.17  ? 230 GLY B C   1 
ATOM   5911 O O   . GLY B 1 229 ? -3.428  -63.095 -19.029 1.00 18.70  ? 230 GLY B O   1 
ATOM   5912 N N   . ALA B 1 230 ? -3.332  -60.873 -19.366 1.00 18.81  ? 231 ALA B N   1 
ATOM   5913 C CA  . ALA B 1 230 ? -4.758  -60.639 -19.237 1.00 24.29  ? 231 ALA B CA  1 
ATOM   5914 C C   . ALA B 1 230 ? -5.098  -59.399 -20.054 1.00 26.35  ? 231 ALA B C   1 
ATOM   5915 O O   . ALA B 1 230 ? -4.281  -58.483 -20.154 1.00 24.27  ? 231 ALA B O   1 
ATOM   5916 C CB  . ALA B 1 230 ? -5.142  -60.437 -17.740 1.00 19.60  ? 231 ALA B CB  1 
ATOM   5917 N N   . PRO B 1 231 ? -6.307  -59.357 -20.638 1.00 26.85  ? 232 PRO B N   1 
ATOM   5918 C CA  . PRO B 1 231 ? -6.688  -58.209 -21.468 1.00 23.13  ? 232 PRO B CA  1 
ATOM   5919 C C   . PRO B 1 231 ? -6.782  -56.920 -20.658 1.00 31.44  ? 232 PRO B C   1 
ATOM   5920 O O   . PRO B 1 231 ? -6.610  -55.832 -21.235 1.00 27.61  ? 232 PRO B O   1 
ATOM   5921 C CB  . PRO B 1 231 ? -8.068  -58.608 -22.000 1.00 23.76  ? 232 PRO B CB  1 
ATOM   5922 C CG  . PRO B 1 231 ? -8.595  -59.581 -20.986 1.00 24.60  ? 232 PRO B CG  1 
ATOM   5923 C CD  . PRO B 1 231 ? -7.399  -60.340 -20.515 1.00 24.30  ? 232 PRO B CD  1 
ATOM   5924 N N   . ASN B 1 232 ? -7.038  -57.050 -19.350 1.00 23.83  ? 233 ASN B N   1 
ATOM   5925 C CA  . ASN B 1 232 ? -7.106  -55.909 -18.429 1.00 26.30  ? 233 ASN B CA  1 
ATOM   5926 C C   . ASN B 1 232 ? -5.768  -55.404 -17.854 1.00 28.18  ? 233 ASN B C   1 
ATOM   5927 O O   . ASN B 1 232 ? -5.753  -54.474 -17.046 1.00 32.82  ? 233 ASN B O   1 
ATOM   5928 C CB  . ASN B 1 232 ? -8.072  -56.210 -17.269 1.00 27.83  ? 233 ASN B CB  1 
ATOM   5929 C CG  . ASN B 1 232 ? -7.850  -57.586 -16.662 1.00 25.40  ? 233 ASN B CG  1 
ATOM   5930 O OD1 . ASN B 1 232 ? -7.810  -58.581 -17.377 1.00 26.95  ? 233 ASN B OD1 1 
ATOM   5931 N ND2 . ASN B 1 232 ? -7.694  -57.647 -15.342 1.00 25.21  ? 233 ASN B ND2 1 
ATOM   5932 N N   . GLY B 1 233 ? -4.648  -56.010 -18.235 1.00 26.08  ? 234 GLY B N   1 
ATOM   5933 C CA  . GLY B 1 233 ? -3.355  -55.465 -17.835 1.00 35.35  ? 234 GLY B CA  1 
ATOM   5934 C C   . GLY B 1 233 ? -3.133  -54.021 -18.308 1.00 37.53  ? 234 GLY B C   1 
ATOM   5935 O O   . GLY B 1 233 ? -3.505  -53.679 -19.432 1.00 38.98  ? 234 GLY B O   1 
ATOM   5936 N N   . PRO B 1 234 ? -2.499  -53.175 -17.470 1.00 27.97  ? 235 PRO B N   1 
ATOM   5937 C CA  . PRO B 1 234 ? -2.257  -51.758 -17.788 1.00 25.01  ? 235 PRO B CA  1 
ATOM   5938 C C   . PRO B 1 234 ? -1.337  -51.504 -19.001 1.00 23.43  ? 235 PRO B C   1 
ATOM   5939 O O   . PRO B 1 234 ? -1.146  -50.346 -19.368 1.00 24.30  ? 235 PRO B O   1 
ATOM   5940 C CB  . PRO B 1 234 ? -1.576  -51.231 -16.526 1.00 18.87  ? 235 PRO B CB  1 
ATOM   5941 C CG  . PRO B 1 234 ? -0.879  -52.420 -15.976 1.00 26.78  ? 235 PRO B CG  1 
ATOM   5942 C CD  . PRO B 1 234 ? -1.789  -53.586 -16.247 1.00 23.68  ? 235 PRO B CD  1 
ATOM   5943 N N   . TRP B 1 235 ? -0.785  -52.554 -19.602 1.00 20.68  ? 236 TRP B N   1 
ATOM   5944 C CA  . TRP B 1 235 ? 0.071   -52.416 -20.783 1.00 23.17  ? 236 TRP B CA  1 
ATOM   5945 C C   . TRP B 1 235 ? -0.653  -52.882 -22.048 1.00 24.14  ? 236 TRP B C   1 
ATOM   5946 O O   . TRP B 1 235 ? -0.218  -52.580 -23.166 1.00 25.78  ? 236 TRP B O   1 
ATOM   5947 C CB  . TRP B 1 235 ? 1.342   -53.252 -20.608 1.00 18.76  ? 236 TRP B CB  1 
ATOM   5948 C CG  . TRP B 1 235 ? 1.020   -54.647 -20.176 1.00 23.36  ? 236 TRP B CG  1 
ATOM   5949 C CD1 . TRP B 1 235 ? 0.926   -55.103 -18.894 1.00 23.68  ? 236 TRP B CD1 1 
ATOM   5950 C CD2 . TRP B 1 235 ? 0.705   -55.761 -21.020 1.00 19.66  ? 236 TRP B CD2 1 
ATOM   5951 N NE1 . TRP B 1 235 ? 0.584   -56.433 -18.887 1.00 23.40  ? 236 TRP B NE1 1 
ATOM   5952 C CE2 . TRP B 1 235 ? 0.442   -56.862 -20.177 1.00 21.44  ? 236 TRP B CE2 1 
ATOM   5953 C CE3 . TRP B 1 235 ? 0.640   -55.941 -22.404 1.00 22.90  ? 236 TRP B CE3 1 
ATOM   5954 C CZ2 . TRP B 1 235 ? 0.115   -58.121 -20.671 1.00 23.28  ? 236 TRP B CZ2 1 
ATOM   5955 C CZ3 . TRP B 1 235 ? 0.304   -57.195 -22.896 1.00 20.87  ? 236 TRP B CZ3 1 
ATOM   5956 C CH2 . TRP B 1 235 ? 0.049   -58.266 -22.032 1.00 27.57  ? 236 TRP B CH2 1 
ATOM   5957 N N   . ALA B 1 236 ? -1.754  -53.607 -21.854 1.00 21.50  ? 237 ALA B N   1 
ATOM   5958 C CA  . ALA B 1 236 ? -2.392  -54.389 -22.916 1.00 25.19  ? 237 ALA B CA  1 
ATOM   5959 C C   . ALA B 1 236 ? -3.373  -53.603 -23.773 1.00 30.07  ? 237 ALA B C   1 
ATOM   5960 O O   . ALA B 1 236 ? -3.730  -54.037 -24.877 1.00 28.53  ? 237 ALA B O   1 
ATOM   5961 C CB  . ALA B 1 236 ? -3.076  -55.630 -22.340 1.00 21.58  ? 237 ALA B CB  1 
ATOM   5962 N N   . THR B 1 237 ? -3.827  -52.462 -23.270 1.00 22.39  ? 238 THR B N   1 
ATOM   5963 C CA  . THR B 1 237 ? -4.651  -51.584 -24.088 1.00 22.54  ? 238 THR B CA  1 
ATOM   5964 C C   . THR B 1 237 ? -4.264  -50.148 -23.850 1.00 23.71  ? 238 THR B C   1 
ATOM   5965 O O   . THR B 1 237 ? -3.548  -49.824 -22.901 1.00 21.98  ? 238 THR B O   1 
ATOM   5966 C CB  . THR B 1 237 ? -6.152  -51.696 -23.770 1.00 25.54  ? 238 THR B CB  1 
ATOM   5967 O OG1 . THR B 1 237 ? -6.369  -51.334 -22.399 1.00 26.18  ? 238 THR B OG1 1 
ATOM   5968 C CG2 . THR B 1 237 ? -6.669  -53.099 -24.030 1.00 21.51  ? 238 THR B CG2 1 
ATOM   5969 N N   . VAL B 1 238 ? -4.765  -49.283 -24.718 1.00 23.14  ? 239 VAL B N   1 
ATOM   5970 C CA  . VAL B 1 238 ? -4.513  -47.868 -24.596 1.00 20.64  ? 239 VAL B CA  1 
ATOM   5971 C C   . VAL B 1 238 ? -5.807  -47.150 -24.990 1.00 26.69  ? 239 VAL B C   1 
ATOM   5972 O O   . VAL B 1 238 ? -6.621  -47.697 -25.749 1.00 25.36  ? 239 VAL B O   1 
ATOM   5973 C CB  . VAL B 1 238 ? -3.309  -47.478 -25.491 1.00 25.45  ? 239 VAL B CB  1 
ATOM   5974 C CG1 . VAL B 1 238 ? -3.736  -47.275 -26.945 1.00 22.44  ? 239 VAL B CG1 1 
ATOM   5975 C CG2 . VAL B 1 238 ? -2.598  -46.263 -24.948 1.00 29.20  ? 239 VAL B CG2 1 
ATOM   5976 N N   . GLY B 1 239 ? -6.022  -45.951 -24.452 1.00 28.94  ? 240 GLY B N   1 
ATOM   5977 C CA  . GLY B 1 239 ? -7.200  -45.172 -24.804 1.00 22.68  ? 240 GLY B CA  1 
ATOM   5978 C C   . GLY B 1 239 ? -7.106  -44.548 -26.195 1.00 31.39  ? 240 GLY B C   1 
ATOM   5979 O O   . GLY B 1 239 ? -6.023  -44.507 -26.791 1.00 25.06  ? 240 GLY B O   1 
ATOM   5980 N N   . MET B 1 240 ? -8.238  -44.059 -26.708 1.00 29.62  ? 241 MET B N   1 
ATOM   5981 C CA  . MET B 1 240 ? -8.307  -43.490 -28.057 1.00 30.37  ? 241 MET B CA  1 
ATOM   5982 C C   . MET B 1 240 ? -7.361  -42.314 -28.239 1.00 31.15  ? 241 MET B C   1 
ATOM   5983 O O   . MET B 1 240 ? -6.657  -42.222 -29.248 1.00 27.44  ? 241 MET B O   1 
ATOM   5984 C CB  . MET B 1 240 ? -9.741  -43.062 -28.402 1.00 27.70  ? 241 MET B CB  1 
ATOM   5985 C CG  . MET B 1 240 ? -10.638 -44.208 -28.829 1.00 35.80  ? 241 MET B CG  1 
ATOM   5986 S SD  . MET B 1 240 ? -12.395 -43.802 -28.902 1.00 41.11  ? 241 MET B SD  1 
ATOM   5987 C CE  . MET B 1 240 ? -12.710 -43.389 -27.195 1.00 46.60  ? 241 MET B CE  1 
ATOM   5988 N N   . GLY B 1 241 ? -7.342  -41.425 -27.252 1.00 28.30  ? 242 GLY B N   1 
ATOM   5989 C CA  . GLY B 1 241 ? -6.581  -40.196 -27.342 1.00 24.86  ? 242 GLY B CA  1 
ATOM   5990 C C   . GLY B 1 241 ? -5.087  -40.420 -27.237 1.00 32.74  ? 242 GLY B C   1 
ATOM   5991 O O   . GLY B 1 241 ? -4.305  -39.791 -27.952 1.00 31.30  ? 242 GLY B O   1 
ATOM   5992 N N   . GLU B 1 242 ? -4.683  -41.310 -26.335 1.00 29.77  ? 243 GLU B N   1 
ATOM   5993 C CA  . GLU B 1 242 ? -3.273  -41.637 -26.194 1.00 32.06  ? 243 GLU B CA  1 
ATOM   5994 C C   . GLU B 1 242 ? -2.755  -42.371 -27.443 1.00 28.68  ? 243 GLU B C   1 
ATOM   5995 O O   . GLU B 1 242 ? -1.625  -42.151 -27.879 1.00 26.91  ? 243 GLU B O   1 
ATOM   5996 C CB  . GLU B 1 242 ? -3.020  -42.447 -24.909 1.00 27.80  ? 243 GLU B CB  1 
ATOM   5997 C CG  . GLU B 1 242 ? -1.572  -42.914 -24.715 1.00 21.09  ? 243 GLU B CG  1 
ATOM   5998 C CD  . GLU B 1 242 ? -0.568  -41.773 -24.645 1.00 28.04  ? 243 GLU B CD  1 
ATOM   5999 O OE1 . GLU B 1 242 ? -0.981  -40.606 -24.471 1.00 35.10  ? 243 GLU B OE1 1 
ATOM   6000 O OE2 . GLU B 1 242 ? 0.648   -42.044 -24.745 1.00 27.83  ? 243 GLU B OE2 1 
ATOM   6001 N N   . ALA B 1 243 ? -3.593  -43.226 -28.019 1.00 25.16  ? 244 ALA B N   1 
ATOM   6002 C CA  . ALA B 1 243 ? -3.235  -43.940 -29.244 1.00 29.26  ? 244 ALA B CA  1 
ATOM   6003 C C   . ALA B 1 243 ? -3.001  -42.956 -30.388 1.00 32.71  ? 244 ALA B C   1 
ATOM   6004 O O   . ALA B 1 243 ? -2.020  -43.077 -31.135 1.00 30.99  ? 244 ALA B O   1 
ATOM   6005 C CB  . ALA B 1 243 ? -4.310  -44.941 -29.616 1.00 22.12  ? 244 ALA B CB  1 
ATOM   6006 N N   . ARG B 1 244 ? -3.890  -41.972 -30.503 1.00 28.84  ? 245 ARG B N   1 
ATOM   6007 C CA  . ARG B 1 244 ? -3.760  -40.934 -31.523 1.00 29.77  ? 245 ARG B CA  1 
ATOM   6008 C C   . ARG B 1 244 ? -2.496  -40.108 -31.312 1.00 29.77  ? 245 ARG B C   1 
ATOM   6009 O O   . ARG B 1 244 ? -1.807  -39.749 -32.264 1.00 33.82  ? 245 ARG B O   1 
ATOM   6010 C CB  . ARG B 1 244 ? -4.997  -40.027 -31.531 1.00 33.59  ? 245 ARG B CB  1 
ATOM   6011 C CG  . ARG B 1 244 ? -4.830  -38.745 -32.335 1.00 30.64  ? 245 ARG B CG  1 
ATOM   6012 C CD  . ARG B 1 244 ? -6.171  -38.098 -32.647 1.00 31.43  ? 245 ARG B CD  1 
ATOM   6013 N NE  . ARG B 1 244 ? -7.035  -38.951 -33.458 1.00 30.14  ? 245 ARG B NE  1 
ATOM   6014 C CZ  . ARG B 1 244 ? -7.028  -38.973 -34.792 1.00 32.24  ? 245 ARG B CZ  1 
ATOM   6015 N NH1 . ARG B 1 244 ? -6.198  -38.189 -35.471 1.00 25.20  ? 245 ARG B NH1 1 
ATOM   6016 N NH2 . ARG B 1 244 ? -7.853  -39.775 -35.449 1.00 26.84  ? 245 ARG B NH2 1 
ATOM   6017 N N   . ARG B 1 245 ? -2.189  -39.817 -30.058 1.00 28.28  ? 246 ARG B N   1 
ATOM   6018 C CA  . ARG B 1 245 ? -1.014  -39.023 -29.739 1.00 33.46  ? 246 ARG B CA  1 
ATOM   6019 C C   . ARG B 1 245 ? 0.260   -39.754 -30.159 1.00 32.55  ? 246 ARG B C   1 
ATOM   6020 O O   . ARG B 1 245 ? 1.169   -39.154 -30.746 1.00 31.46  ? 246 ARG B O   1 
ATOM   6021 C CB  . ARG B 1 245 ? -0.960  -38.695 -28.237 1.00 29.51  ? 246 ARG B CB  1 
ATOM   6022 C CG  . ARG B 1 245 ? 0.153   -37.725 -27.886 1.00 26.11  ? 246 ARG B CG  1 
ATOM   6023 C CD  . ARG B 1 245 ? 0.490   -37.729 -26.410 1.00 33.93  ? 246 ARG B CD  1 
ATOM   6024 N NE  . ARG B 1 245 ? 1.074   -38.993 -25.974 1.00 36.66  ? 246 ARG B NE  1 
ATOM   6025 C CZ  . ARG B 1 245 ? 2.305   -39.396 -26.280 1.00 41.35  ? 246 ARG B CZ  1 
ATOM   6026 N NH1 . ARG B 1 245 ? 3.091   -38.637 -27.038 1.00 31.85  ? 246 ARG B NH1 1 
ATOM   6027 N NH2 . ARG B 1 245 ? 2.750   -40.564 -25.827 1.00 38.05  ? 246 ARG B NH2 1 
ATOM   6028 N N   . ARG B 1 246 ? 0.320   -41.048 -29.849 1.00 31.38  ? 247 ARG B N   1 
ATOM   6029 C CA  . ARG B 1 246 ? 1.462   -41.881 -30.220 1.00 32.30  ? 247 ARG B CA  1 
ATOM   6030 C C   . ARG B 1 246 ? 1.583   -42.011 -31.746 1.00 32.84  ? 247 ARG B C   1 
ATOM   6031 O O   . ARG B 1 246 ? 2.672   -41.894 -32.310 1.00 29.95  ? 247 ARG B O   1 
ATOM   6032 C CB  . ARG B 1 246 ? 1.350   -43.261 -29.565 1.00 29.66  ? 247 ARG B CB  1 
ATOM   6033 C CG  . ARG B 1 246 ? 1.457   -43.221 -28.036 1.00 27.89  ? 247 ARG B CG  1 
ATOM   6034 C CD  . ARG B 1 246 ? 1.311   -44.608 -27.420 1.00 27.36  ? 247 ARG B CD  1 
ATOM   6035 N NE  . ARG B 1 246 ? 1.290   -44.566 -25.958 1.00 25.64  ? 247 ARG B NE  1 
ATOM   6036 C CZ  . ARG B 1 246 ? 1.291   -45.645 -25.180 1.00 28.80  ? 247 ARG B CZ  1 
ATOM   6037 N NH1 . ARG B 1 246 ? 1.324   -46.856 -25.724 1.00 24.43  ? 247 ARG B NH1 1 
ATOM   6038 N NH2 . ARG B 1 246 ? 1.257   -45.519 -23.856 1.00 28.33  ? 247 ARG B NH2 1 
ATOM   6039 N N   . ALA B 1 247 ? 0.454   -42.240 -32.400 1.00 28.18  ? 248 ALA B N   1 
ATOM   6040 C CA  . ALA B 1 247 ? 0.414   -42.347 -33.853 1.00 31.74  ? 248 ALA B CA  1 
ATOM   6041 C C   . ALA B 1 247 ? 0.933   -41.059 -34.462 1.00 36.26  ? 248 ALA B C   1 
ATOM   6042 O O   . ALA B 1 247 ? 1.805   -41.071 -35.336 1.00 31.69  ? 248 ALA B O   1 
ATOM   6043 C CB  . ALA B 1 247 ? -1.016  -42.616 -34.321 1.00 22.95  ? 248 ALA B CB  1 
ATOM   6044 N N   . THR B 1 248 ? 0.398   -39.944 -33.973 1.00 36.64  ? 249 THR B N   1 
ATOM   6045 C CA  . THR B 1 248 ? 0.746   -38.628 -34.497 1.00 34.11  ? 249 THR B CA  1 
ATOM   6046 C C   . THR B 1 248 ? 2.223   -38.306 -34.258 1.00 35.51  ? 249 THR B C   1 
ATOM   6047 O O   . THR B 1 248 ? 2.900   -37.776 -35.150 1.00 37.29  ? 249 THR B O   1 
ATOM   6048 C CB  . THR B 1 248 ? -0.164  -37.531 -33.901 1.00 32.59  ? 249 THR B CB  1 
ATOM   6049 O OG1 . THR B 1 248 ? -1.524  -37.795 -34.267 1.00 35.65  ? 249 THR B OG1 1 
ATOM   6050 C CG2 . THR B 1 248 ? 0.227   -36.162 -34.409 1.00 34.16  ? 249 THR B CG2 1 
ATOM   6051 N N   . GLN B 1 249 ? 2.725   -38.640 -33.070 1.00 31.80  ? 250 GLN B N   1 
ATOM   6052 C CA  . GLN B 1 249 ? 4.137   -38.412 -32.775 1.00 33.35  ? 250 GLN B CA  1 
ATOM   6053 C C   . GLN B 1 249 ? 5.055   -39.248 -33.671 1.00 36.18  ? 250 GLN B C   1 
ATOM   6054 O O   . GLN B 1 249 ? 6.115   -38.774 -34.082 1.00 32.69  ? 250 GLN B O   1 
ATOM   6055 C CB  . GLN B 1 249 ? 4.485   -38.664 -31.304 1.00 28.37  ? 250 GLN B CB  1 
ATOM   6056 C CG  . GLN B 1 249 ? 5.933   -38.244 -30.991 1.00 33.54  ? 250 GLN B CG  1 
ATOM   6057 C CD  . GLN B 1 249 ? 6.367   -38.486 -29.554 1.00 44.99  ? 250 GLN B CD  1 
ATOM   6058 O OE1 . GLN B 1 249 ? 5.615   -39.018 -28.735 1.00 40.05  ? 250 GLN B OE1 1 
ATOM   6059 N NE2 . GLN B 1 249 ? 7.600   -38.091 -29.242 1.00 52.32  ? 250 GLN B NE2 1 
ATOM   6060 N N   . LEU B 1 250 ? 4.656   -40.488 -33.952 1.00 33.20  ? 251 LEU B N   1 
ATOM   6061 C CA  . LEU B 1 250 ? 5.437   -41.355 -34.827 1.00 33.91  ? 251 LEU B CA  1 
ATOM   6062 C C   . LEU B 1 250 ? 5.542   -40.719 -36.213 1.00 35.35  ? 251 LEU B C   1 
ATOM   6063 O O   . LEU B 1 250 ? 6.633   -40.566 -36.749 1.00 32.67  ? 251 LEU B O   1 
ATOM   6064 C CB  . LEU B 1 250 ? 4.806   -42.744 -34.947 1.00 31.02  ? 251 LEU B CB  1 
ATOM   6065 C CG  . LEU B 1 250 ? 5.610   -43.695 -35.845 1.00 34.10  ? 251 LEU B CG  1 
ATOM   6066 C CD1 . LEU B 1 250 ? 6.921   -44.090 -35.170 1.00 30.22  ? 251 LEU B CD1 1 
ATOM   6067 C CD2 . LEU B 1 250 ? 4.829   -44.930 -36.236 1.00 29.13  ? 251 LEU B CD2 1 
ATOM   6068 N N   . ALA B 1 251 ? 4.395   -40.345 -36.771 1.00 32.05  ? 252 ALA B N   1 
ATOM   6069 C CA  . ALA B 1 251 ? 4.334   -39.687 -38.065 1.00 37.22  ? 252 ALA B CA  1 
ATOM   6070 C C   . ALA B 1 251 ? 5.243   -38.469 -38.074 1.00 39.44  ? 252 ALA B C   1 
ATOM   6071 O O   . ALA B 1 251 ? 6.065   -38.302 -38.976 1.00 37.14  ? 252 ALA B O   1 
ATOM   6072 C CB  . ALA B 1 251 ? 2.894   -39.292 -38.390 1.00 38.94  ? 252 ALA B CB  1 
ATOM   6073 N N   . HIS B 1 252 ? 5.112   -37.640 -37.044 1.00 40.63  ? 253 HIS B N   1 
ATOM   6074 C CA  . HIS B 1 252 ? 5.941   -36.453 -36.917 1.00 38.04  ? 253 HIS B CA  1 
ATOM   6075 C C   . HIS B 1 252 ? 7.431   -36.790 -36.942 1.00 38.11  ? 253 HIS B C   1 
ATOM   6076 O O   . HIS B 1 252 ? 8.213   -36.140 -37.640 1.00 39.46  ? 253 HIS B O   1 
ATOM   6077 C CB  . HIS B 1 252 ? 5.598   -35.690 -35.637 1.00 43.01  ? 253 HIS B CB  1 
ATOM   6078 C CG  . HIS B 1 252 ? 6.505   -34.527 -35.372 1.00 42.90  ? 253 HIS B CG  1 
ATOM   6079 N ND1 . HIS B 1 252 ? 6.300   -33.281 -35.927 1.00 46.04  ? 253 HIS B ND1 1 
ATOM   6080 C CD2 . HIS B 1 252 ? 7.628   -34.425 -34.621 1.00 44.89  ? 253 HIS B CD2 1 
ATOM   6081 C CE1 . HIS B 1 252 ? 7.254   -32.460 -35.523 1.00 49.15  ? 253 HIS B CE1 1 
ATOM   6082 N NE2 . HIS B 1 252 ? 8.073   -33.129 -34.731 1.00 52.60  ? 253 HIS B NE2 1 
ATOM   6083 N N   . LEU B 1 253 ? 7.821   -37.810 -36.184 1.00 37.75  ? 254 LEU B N   1 
ATOM   6084 C CA  . LEU B 1 253 ? 9.233   -38.179 -36.078 1.00 36.84  ? 254 LEU B CA  1 
ATOM   6085 C C   . LEU B 1 253 ? 9.816   -38.698 -37.396 1.00 40.70  ? 254 LEU B C   1 
ATOM   6086 O O   . LEU B 1 253 ? 11.030  -38.714 -37.574 1.00 39.58  ? 254 LEU B O   1 
ATOM   6087 C CB  . LEU B 1 253 ? 9.444   -39.208 -34.969 1.00 38.02  ? 254 LEU B CB  1 
ATOM   6088 C CG  . LEU B 1 253 ? 9.287   -38.689 -33.540 1.00 42.34  ? 254 LEU B CG  1 
ATOM   6089 C CD1 . LEU B 1 253 ? 9.205   -39.851 -32.560 1.00 32.20  ? 254 LEU B CD1 1 
ATOM   6090 C CD2 . LEU B 1 253 ? 10.435  -37.761 -33.187 1.00 35.48  ? 254 LEU B CD2 1 
ATOM   6091 N N   . VAL B 1 254 ? 8.949   -39.115 -38.313 1.00 38.31  ? 255 VAL B N   1 
ATOM   6092 C CA  . VAL B 1 254 ? 9.390   -39.618 -39.608 1.00 40.78  ? 255 VAL B CA  1 
ATOM   6093 C C   . VAL B 1 254 ? 8.955   -38.691 -40.754 1.00 44.27  ? 255 VAL B C   1 
ATOM   6094 O O   . VAL B 1 254 ? 8.938   -39.095 -41.914 1.00 46.30  ? 255 VAL B O   1 
ATOM   6095 C CB  . VAL B 1 254 ? 8.884   -41.064 -39.856 1.00 33.93  ? 255 VAL B CB  1 
ATOM   6096 C CG1 . VAL B 1 254 ? 9.350   -41.989 -38.737 1.00 30.33  ? 255 VAL B CG1 1 
ATOM   6097 C CG2 . VAL B 1 254 ? 7.374   -41.094 -39.967 1.00 35.72  ? 255 VAL B CG2 1 
ATOM   6098 N N   . GLY B 1 255 ? 8.583   -37.457 -40.414 1.00 43.72  ? 256 GLY B N   1 
ATOM   6099 C CA  . GLY B 1 255 ? 8.299   -36.431 -41.404 1.00 37.23  ? 256 GLY B CA  1 
ATOM   6100 C C   . GLY B 1 255 ? 6.885   -36.325 -41.945 1.00 45.59  ? 256 GLY B C   1 
ATOM   6101 O O   . GLY B 1 255 ? 6.671   -35.763 -43.017 1.00 54.60  ? 256 GLY B O   1 
ATOM   6102 N N   . CYS B 1 256 ? 5.914   -36.850 -41.215 1.00 41.29  ? 257 CYS B N   1 
ATOM   6103 C CA  . CYS B 1 256 ? 4.531   -36.825 -41.673 1.00 43.34  ? 257 CYS B CA  1 
ATOM   6104 C C   . CYS B 1 256 ? 3.637   -36.036 -40.713 1.00 54.60  ? 257 CYS B C   1 
ATOM   6105 O O   . CYS B 1 256 ? 3.590   -36.332 -39.523 1.00 56.16  ? 257 CYS B O   1 
ATOM   6106 C CB  . CYS B 1 256 ? 3.993   -38.250 -41.820 1.00 35.06  ? 257 CYS B CB  1 
ATOM   6107 S SG  . CYS B 1 256 ? 4.952   -39.313 -42.913 1.00 45.36  ? 257 CYS B SG  1 
ATOM   6108 N N   . PRO B 1 257 ? 2.923   -35.021 -41.228 1.00 70.08  ? 258 PRO B N   1 
ATOM   6109 C CA  . PRO B 1 257 ? 3.013   -34.571 -42.618 1.00 61.05  ? 258 PRO B CA  1 
ATOM   6110 C C   . PRO B 1 257 ? 4.145   -33.559 -42.719 1.00 66.10  ? 258 PRO B C   1 
ATOM   6111 O O   . PRO B 1 257 ? 4.620   -33.083 -41.681 1.00 62.41  ? 258 PRO B O   1 
ATOM   6112 C CB  . PRO B 1 257 ? 1.673   -33.871 -42.825 1.00 53.96  ? 258 PRO B CB  1 
ATOM   6113 C CG  . PRO B 1 257 ? 1.405   -33.247 -41.490 1.00 59.79  ? 258 PRO B CG  1 
ATOM   6114 C CD  . PRO B 1 257 ? 1.927   -34.240 -40.466 1.00 59.98  ? 258 PRO B CD  1 
ATOM   6115 N N   . PRO B 1 258 ? 4.588   -33.244 -43.946 1.00 66.11  ? 259 PRO B N   1 
ATOM   6116 C CA  . PRO B 1 258 ? 5.613   -32.209 -44.127 1.00 62.12  ? 259 PRO B CA  1 
ATOM   6117 C C   . PRO B 1 258 ? 5.056   -30.827 -43.789 1.00 58.41  ? 259 PRO B C   1 
ATOM   6118 O O   . PRO B 1 258 ? 5.686   -30.080 -43.041 1.00 61.68  ? 259 PRO B O   1 
ATOM   6119 C CB  . PRO B 1 258 ? 5.938   -32.291 -45.628 1.00 70.81  ? 259 PRO B CB  1 
ATOM   6120 C CG  . PRO B 1 258 ? 5.415   -33.631 -46.082 1.00 66.51  ? 259 PRO B CG  1 
ATOM   6121 C CD  . PRO B 1 258 ? 4.221   -33.895 -45.217 1.00 64.73  ? 259 PRO B CD  1 
ATOM   6122 N N   . THR B 1 261 ? 2.486   -31.972 -38.035 1.00 61.56  ? 262 THR B N   1 
ATOM   6123 C CA  . THR B 1 261 ? 1.781   -32.712 -36.985 1.00 69.14  ? 262 THR B CA  1 
ATOM   6124 C C   . THR B 1 261 ? 0.271   -32.780 -37.233 1.00 52.33  ? 262 THR B C   1 
ATOM   6125 O O   . THR B 1 261 ? -0.407  -31.758 -37.310 1.00 59.30  ? 262 THR B O   1 
ATOM   6126 C CB  . THR B 1 261 ? 2.071   -32.125 -35.567 1.00 63.18  ? 262 THR B CB  1 
ATOM   6127 O OG1 . THR B 1 261 ? 3.367   -32.550 -35.124 1.00 61.51  ? 262 THR B OG1 1 
ATOM   6128 C CG2 . THR B 1 261 ? 1.031   -32.594 -34.552 1.00 53.23  ? 262 THR B CG2 1 
ATOM   6129 N N   . GLY B 1 262 ? -0.247  -33.993 -37.370 1.00 54.23  ? 263 GLY B N   1 
ATOM   6130 C CA  . GLY B 1 262 ? -1.677  -34.193 -37.515 1.00 53.42  ? 263 GLY B CA  1 
ATOM   6131 C C   . GLY B 1 262 ? -2.209  -33.811 -38.882 1.00 61.82  ? 263 GLY B C   1 
ATOM   6132 O O   . GLY B 1 262 ? -1.646  -34.200 -39.911 1.00 57.33  ? 263 GLY B O   1 
ATOM   6133 N N   . GLY B 1 263 ? -3.299  -33.045 -38.891 1.00 58.58  ? 264 GLY B N   1 
ATOM   6134 C CA  . GLY B 1 263 ? -3.970  -32.672 -40.125 1.00 55.20  ? 264 GLY B CA  1 
ATOM   6135 C C   . GLY B 1 263 ? -4.991  -33.716 -40.539 1.00 55.48  ? 264 GLY B C   1 
ATOM   6136 O O   . GLY B 1 263 ? -5.564  -34.399 -39.684 1.00 49.06  ? 264 GLY B O   1 
ATOM   6137 N N   . ASN B 1 264 ? -5.224  -33.824 -41.848 1.00 50.92  ? 265 ASN B N   1 
ATOM   6138 C CA  . ASN B 1 264 ? -6.081  -34.856 -42.427 1.00 47.50  ? 265 ASN B CA  1 
ATOM   6139 C C   . ASN B 1 264 ? -5.529  -36.232 -42.048 1.00 45.27  ? 265 ASN B C   1 
ATOM   6140 O O   . ASN B 1 264 ? -4.338  -36.489 -42.240 1.00 44.58  ? 265 ASN B O   1 
ATOM   6141 C CB  . ASN B 1 264 ? -6.090  -34.692 -43.959 1.00 52.68  ? 265 ASN B CB  1 
ATOM   6142 C CG  . ASN B 1 264 ? -7.231  -35.447 -44.646 1.00 57.26  ? 265 ASN B CG  1 
ATOM   6143 O OD1 . ASN B 1 264 ? -7.540  -36.593 -44.304 1.00 47.63  ? 265 ASN B OD1 1 
ATOM   6144 N ND2 . ASN B 1 264 ? -7.857  -34.792 -45.636 1.00 66.08  ? 265 ASN B ND2 1 
ATOM   6145 N N   . ASP B 1 265 ? -6.372  -37.107 -41.500 1.00 38.00  ? 266 ASP B N   1 
ATOM   6146 C CA  . ASP B 1 265 ? -5.926  -38.461 -41.175 1.00 36.32  ? 266 ASP B CA  1 
ATOM   6147 C C   . ASP B 1 265 ? -5.516  -39.215 -42.440 1.00 42.37  ? 266 ASP B C   1 
ATOM   6148 O O   . ASP B 1 265 ? -4.446  -39.831 -42.492 1.00 37.57  ? 266 ASP B O   1 
ATOM   6149 C CB  . ASP B 1 265 ? -7.005  -39.242 -40.424 1.00 32.16  ? 266 ASP B CB  1 
ATOM   6150 C CG  . ASP B 1 265 ? -6.917  -39.071 -38.906 1.00 37.50  ? 266 ASP B CG  1 
ATOM   6151 O OD1 . ASP B 1 265 ? -5.846  -38.685 -38.381 1.00 35.05  ? 266 ASP B OD1 1 
ATOM   6152 O OD2 . ASP B 1 265 ? -7.935  -39.330 -38.232 1.00 38.36  ? 266 ASP B OD2 1 
ATOM   6153 N N   . THR B 1 266 ? -6.374  -39.148 -43.457 1.00 45.95  ? 267 THR B N   1 
ATOM   6154 C CA  . THR B 1 266 ? -6.138  -39.806 -44.743 1.00 39.98  ? 267 THR B CA  1 
ATOM   6155 C C   . THR B 1 266 ? -4.759  -39.485 -45.311 1.00 36.96  ? 267 THR B C   1 
ATOM   6156 O O   . THR B 1 266 ? -4.043  -40.377 -45.773 1.00 41.19  ? 267 THR B O   1 
ATOM   6157 C CB  . THR B 1 266 ? -7.230  -39.438 -45.763 1.00 42.52  ? 267 THR B CB  1 
ATOM   6158 O OG1 . THR B 1 266 ? -8.443  -40.115 -45.416 1.00 39.88  ? 267 THR B OG1 1 
ATOM   6159 C CG2 . THR B 1 266 ? -6.821  -39.845 -47.174 1.00 39.86  ? 267 THR B CG2 1 
ATOM   6160 N N   . GLU B 1 267 ? -4.378  -38.217 -45.240 1.00 37.22  ? 268 GLU B N   1 
ATOM   6161 C CA  . GLU B 1 267 ? -3.081  -37.790 -45.741 1.00 40.68  ? 268 GLU B CA  1 
ATOM   6162 C C   . GLU B 1 267 ? -1.942  -38.228 -44.836 1.00 39.72  ? 268 GLU B C   1 
ATOM   6163 O O   . GLU B 1 267 ? -0.899  -38.653 -45.324 1.00 38.73  ? 268 GLU B O   1 
ATOM   6164 C CB  . GLU B 1 267 ? -3.052  -36.274 -45.950 1.00 39.22  ? 268 GLU B CB  1 
ATOM   6165 C CG  . GLU B 1 267 ? -3.988  -35.816 -47.069 1.00 60.13  ? 268 GLU B CG  1 
ATOM   6166 C CD  . GLU B 1 267 ? -4.132  -34.304 -47.143 1.00 77.31  ? 268 GLU B CD  1 
ATOM   6167 O OE1 . GLU B 1 267 ? -3.254  -33.591 -46.607 1.00 73.98  ? 268 GLU B OE1 1 
ATOM   6168 O OE2 . GLU B 1 267 ? -5.131  -33.831 -47.732 1.00 77.32  ? 268 GLU B OE2 1 
ATOM   6169 N N   . LEU B 1 268 ? -2.140  -38.125 -43.523 1.00 44.49  ? 269 LEU B N   1 
ATOM   6170 C CA  . LEU B 1 268 ? -1.114  -38.541 -42.572 1.00 37.58  ? 269 LEU B CA  1 
ATOM   6171 C C   . LEU B 1 268 ? -0.801  -40.018 -42.750 1.00 33.86  ? 269 LEU B C   1 
ATOM   6172 O O   . LEU B 1 268 ? 0.362   -40.414 -42.755 1.00 30.65  ? 269 LEU B O   1 
ATOM   6173 C CB  . LEU B 1 268 ? -1.536  -38.259 -41.130 1.00 36.02  ? 269 LEU B CB  1 
ATOM   6174 C CG  . LEU B 1 268 ? -0.436  -38.494 -40.088 1.00 41.22  ? 269 LEU B CG  1 
ATOM   6175 C CD1 . LEU B 1 268 ? -0.500  -37.462 -38.989 1.00 47.33  ? 269 LEU B CD1 1 
ATOM   6176 C CD2 . LEU B 1 268 ? -0.548  -39.886 -39.489 1.00 44.86  ? 269 LEU B CD2 1 
ATOM   6177 N N   . VAL B 1 269 ? -1.839  -40.831 -42.908 1.00 28.31  ? 270 VAL B N   1 
ATOM   6178 C CA  . VAL B 1 269 ? -1.627  -42.255 -43.093 1.00 37.20  ? 270 VAL B CA  1 
ATOM   6179 C C   . VAL B 1 269 ? -0.950  -42.522 -44.437 1.00 40.05  ? 270 VAL B C   1 
ATOM   6180 O O   . VAL B 1 269 ? -0.010  -43.321 -44.517 1.00 34.87  ? 270 VAL B O   1 
ATOM   6181 C CB  . VAL B 1 269 ? -2.935  -43.062 -42.988 1.00 37.84  ? 270 VAL B CB  1 
ATOM   6182 C CG1 . VAL B 1 269 ? -2.671  -44.523 -43.285 1.00 34.87  ? 270 VAL B CG1 1 
ATOM   6183 C CG2 . VAL B 1 269 ? -3.531  -42.918 -41.602 1.00 38.52  ? 270 VAL B CG2 1 
ATOM   6184 N N   . ALA B 1 270 ? -1.416  -41.842 -45.483 1.00 38.45  ? 271 ALA B N   1 
ATOM   6185 C CA  . ALA B 1 270 ? -0.820  -41.994 -46.810 1.00 33.92  ? 271 ALA B CA  1 
ATOM   6186 C C   . ALA B 1 270 ? 0.677   -41.664 -46.790 1.00 31.69  ? 271 ALA B C   1 
ATOM   6187 O O   . ALA B 1 270 ? 1.481   -42.389 -47.366 1.00 36.47  ? 271 ALA B O   1 
ATOM   6188 C CB  . ALA B 1 270 ? -1.553  -41.154 -47.824 1.00 35.20  ? 271 ALA B CB  1 
ATOM   6189 N N   . CYS B 1 271 ? 1.056   -40.601 -46.090 1.00 32.96  ? 272 CYS B N   1 
ATOM   6190 C CA  . CYS B 1 271 ? 2.472   -40.297 -45.912 1.00 31.34  ? 272 CYS B CA  1 
ATOM   6191 C C   . CYS B 1 271 ? 3.194   -41.415 -45.137 1.00 41.81  ? 272 CYS B C   1 
ATOM   6192 O O   . CYS B 1 271 ? 4.349   -41.736 -45.438 1.00 39.24  ? 272 CYS B O   1 
ATOM   6193 C CB  . CYS B 1 271 ? 2.665   -38.935 -45.228 1.00 26.13  ? 272 CYS B CB  1 
ATOM   6194 S SG  . CYS B 1 271 ? 4.386   -38.551 -44.741 1.00 57.61  ? 272 CYS B SG  1 
ATOM   6195 N N   . LEU B 1 272 ? 2.519   -42.012 -44.153 1.00 34.39  ? 273 LEU B N   1 
ATOM   6196 C CA  . LEU B 1 272 ? 3.130   -43.092 -43.373 1.00 36.03  ? 273 LEU B CA  1 
ATOM   6197 C C   . LEU B 1 272 ? 3.345   -44.334 -44.230 1.00 35.12  ? 273 LEU B C   1 
ATOM   6198 O O   . LEU B 1 272 ? 4.335   -45.047 -44.063 1.00 37.30  ? 273 LEU B O   1 
ATOM   6199 C CB  . LEU B 1 272 ? 2.290   -43.456 -42.143 1.00 28.58  ? 273 LEU B CB  1 
ATOM   6200 C CG  . LEU B 1 272 ? 2.408   -42.592 -40.887 1.00 32.30  ? 273 LEU B CG  1 
ATOM   6201 C CD1 . LEU B 1 272 ? 1.350   -43.020 -39.876 1.00 31.34  ? 273 LEU B CD1 1 
ATOM   6202 C CD2 . LEU B 1 272 ? 3.791   -42.683 -40.271 1.00 26.55  ? 273 LEU B CD2 1 
ATOM   6203 N N   . ARG B 1 273 ? 2.418   -44.589 -45.148 1.00 29.91  ? 274 ARG B N   1 
ATOM   6204 C CA  . ARG B 1 273 ? 2.518   -45.758 -46.010 1.00 36.16  ? 274 ARG B CA  1 
ATOM   6205 C C   . ARG B 1 273 ? 3.718   -45.720 -46.960 1.00 37.55  ? 274 ARG B C   1 
ATOM   6206 O O   . ARG B 1 273 ? 4.111   -46.757 -47.490 1.00 34.41  ? 274 ARG B O   1 
ATOM   6207 C CB  . ARG B 1 273 ? 1.207   -46.001 -46.769 1.00 31.00  ? 274 ARG B CB  1 
ATOM   6208 C CG  . ARG B 1 273 ? 0.144   -46.651 -45.873 1.00 36.07  ? 274 ARG B CG  1 
ATOM   6209 C CD  . ARG B 1 273 ? -1.045  -47.193 -46.647 1.00 34.13  ? 274 ARG B CD  1 
ATOM   6210 N NE  . ARG B 1 273 ? -2.131  -46.224 -46.714 1.00 46.82  ? 274 ARG B NE  1 
ATOM   6211 C CZ  . ARG B 1 273 ? -3.306  -46.360 -46.103 1.00 50.74  ? 274 ARG B CZ  1 
ATOM   6212 N NH1 . ARG B 1 273 ? -3.570  -47.437 -45.372 1.00 43.78  ? 274 ARG B NH1 1 
ATOM   6213 N NH2 . ARG B 1 273 ? -4.227  -45.414 -46.230 1.00 54.61  ? 274 ARG B NH2 1 
ATOM   6214 N N   . THR B 1 274 ? 4.311   -44.541 -47.148 1.00 32.49  ? 275 THR B N   1 
ATOM   6215 C CA  . THR B 1 274 ? 5.421   -44.400 -48.085 1.00 40.76  ? 275 THR B CA  1 
ATOM   6216 C C   . THR B 1 274 ? 6.750   -44.598 -47.389 1.00 40.28  ? 275 THR B C   1 
ATOM   6217 O O   . THR B 1 274 ? 7.793   -44.641 -48.035 1.00 43.89  ? 275 THR B O   1 
ATOM   6218 C CB  . THR B 1 274 ? 5.471   -43.014 -48.765 1.00 33.70  ? 275 THR B CB  1 
ATOM   6219 O OG1 . THR B 1 274 ? 5.998   -42.045 -47.847 1.00 32.68  ? 275 THR B OG1 1 
ATOM   6220 C CG2 . THR B 1 274 ? 4.094   -42.591 -49.269 1.00 26.03  ? 275 THR B CG2 1 
ATOM   6221 N N   . ARG B 1 275 ? 6.718   -44.698 -46.068 1.00 34.91  ? 276 ARG B N   1 
ATOM   6222 C CA  . ARG B 1 275 ? 7.948   -44.899 -45.309 1.00 33.99  ? 276 ARG B CA  1 
ATOM   6223 C C   . ARG B 1 275 ? 8.329   -46.378 -45.290 1.00 34.02  ? 276 ARG B C   1 
ATOM   6224 O O   . ARG B 1 275 ? 7.462   -47.246 -45.138 1.00 34.64  ? 276 ARG B O   1 
ATOM   6225 C CB  . ARG B 1 275 ? 7.782   -44.370 -43.876 1.00 36.94  ? 276 ARG B CB  1 
ATOM   6226 C CG  . ARG B 1 275 ? 7.519   -42.870 -43.794 1.00 36.67  ? 276 ARG B CG  1 
ATOM   6227 C CD  . ARG B 1 275 ? 8.747   -42.094 -44.236 1.00 42.76  ? 276 ARG B CD  1 
ATOM   6228 N NE  . ARG B 1 275 ? 8.594   -40.645 -44.127 1.00 43.69  ? 276 ARG B NE  1 
ATOM   6229 C CZ  . ARG B 1 275 ? 8.080   -39.868 -45.080 1.00 45.84  ? 276 ARG B CZ  1 
ATOM   6230 N NH1 . ARG B 1 275 ? 7.643   -40.398 -46.221 1.00 42.35  ? 276 ARG B NH1 1 
ATOM   6231 N NH2 . ARG B 1 275 ? 7.995   -38.558 -44.888 1.00 35.75  ? 276 ARG B NH2 1 
ATOM   6232 N N   . PRO B 1 276 ? 9.627   -46.675 -45.449 1.00 33.74  ? 277 PRO B N   1 
ATOM   6233 C CA  . PRO B 1 276 ? 10.086  -48.062 -45.316 1.00 32.12  ? 277 PRO B CA  1 
ATOM   6234 C C   . PRO B 1 276 ? 9.739   -48.592 -43.921 1.00 39.20  ? 277 PRO B C   1 
ATOM   6235 O O   . PRO B 1 276 ? 9.813   -47.829 -42.943 1.00 30.63  ? 277 PRO B O   1 
ATOM   6236 C CB  . PRO B 1 276 ? 11.606  -47.946 -45.452 1.00 30.05  ? 277 PRO B CB  1 
ATOM   6237 C CG  . PRO B 1 276 ? 11.846  -46.614 -46.121 1.00 33.44  ? 277 PRO B CG  1 
ATOM   6238 C CD  . PRO B 1 276 ? 10.742  -45.731 -45.638 1.00 36.32  ? 277 PRO B CD  1 
ATOM   6239 N N   . ALA B 1 277 ? 9.362   -49.868 -43.843 1.00 33.04  ? 278 ALA B N   1 
ATOM   6240 C CA  . ALA B 1 277 ? 9.012   -50.505 -42.577 1.00 34.46  ? 278 ALA B CA  1 
ATOM   6241 C C   . ALA B 1 277 ? 10.037  -50.221 -41.495 1.00 35.27  ? 278 ALA B C   1 
ATOM   6242 O O   . ALA B 1 277 ? 9.685   -49.813 -40.380 1.00 33.69  ? 278 ALA B O   1 
ATOM   6243 C CB  . ALA B 1 277 ? 8.850   -51.999 -42.761 1.00 29.85  ? 278 ALA B CB  1 
ATOM   6244 N N   . GLN B 1 278 ? 11.307  -50.403 -41.832 1.00 31.38  ? 279 GLN B N   1 
ATOM   6245 C CA  . GLN B 1 278 ? 12.370  -50.260 -40.844 1.00 31.30  ? 279 GLN B CA  1 
ATOM   6246 C C   . GLN B 1 278 ? 12.445  -48.851 -40.264 1.00 33.85  ? 279 GLN B C   1 
ATOM   6247 O O   . GLN B 1 278 ? 12.873  -48.667 -39.123 1.00 34.60  ? 279 GLN B O   1 
ATOM   6248 C CB  . GLN B 1 278 ? 13.723  -50.659 -41.442 1.00 30.98  ? 279 GLN B CB  1 
ATOM   6249 C CG  . GLN B 1 278 ? 14.821  -50.830 -40.403 1.00 32.52  ? 279 GLN B CG  1 
ATOM   6250 C CD  . GLN B 1 278 ? 14.490  -51.903 -39.358 1.00 37.52  ? 279 GLN B CD  1 
ATOM   6251 O OE1 . GLN B 1 278 ? 14.166  -53.043 -39.696 1.00 39.02  ? 279 GLN B OE1 1 
ATOM   6252 N NE2 . GLN B 1 278 ? 14.569  -51.531 -38.086 1.00 30.59  ? 279 GLN B NE2 1 
ATOM   6253 N N   . VAL B 1 279 ? 12.046  -47.853 -41.048 1.00 34.19  ? 280 VAL B N   1 
ATOM   6254 C CA  . VAL B 1 279 ? 12.059  -46.475 -40.550 1.00 35.95  ? 280 VAL B CA  1 
ATOM   6255 C C   . VAL B 1 279 ? 11.028  -46.289 -39.430 1.00 32.56  ? 280 VAL B C   1 
ATOM   6256 O O   . VAL B 1 279 ? 11.319  -45.642 -38.428 1.00 28.27  ? 280 VAL B O   1 
ATOM   6257 C CB  . VAL B 1 279 ? 11.848  -45.435 -41.677 1.00 37.56  ? 280 VAL B CB  1 
ATOM   6258 C CG1 . VAL B 1 279 ? 11.531  -44.061 -41.096 1.00 27.35  ? 280 VAL B CG1 1 
ATOM   6259 C CG2 . VAL B 1 279 ? 13.082  -45.369 -42.593 1.00 32.12  ? 280 VAL B CG2 1 
ATOM   6260 N N   . LEU B 1 280 ? 9.838   -46.872 -39.595 1.00 29.90  ? 281 LEU B N   1 
ATOM   6261 C CA  . LEU B 1 280 ? 8.813   -46.803 -38.555 1.00 32.30  ? 281 LEU B CA  1 
ATOM   6262 C C   . LEU B 1 280 ? 9.321   -47.457 -37.264 1.00 33.87  ? 281 LEU B C   1 
ATOM   6263 O O   . LEU B 1 280 ? 9.297   -46.843 -36.184 1.00 31.04  ? 281 LEU B O   1 
ATOM   6264 C CB  . LEU B 1 280 ? 7.498   -47.440 -39.026 1.00 22.49  ? 281 LEU B CB  1 
ATOM   6265 C CG  . LEU B 1 280 ? 6.874   -46.750 -40.241 1.00 28.37  ? 281 LEU B CG  1 
ATOM   6266 C CD1 . LEU B 1 280 ? 5.462   -47.249 -40.537 1.00 23.74  ? 281 LEU B CD1 1 
ATOM   6267 C CD2 . LEU B 1 280 ? 6.892   -45.229 -40.075 1.00 24.83  ? 281 LEU B CD2 1 
ATOM   6268 N N   . VAL B 1 281 ? 9.808   -48.688 -37.406 1.00 29.10  ? 282 VAL B N   1 
ATOM   6269 C CA  . VAL B 1 281 ? 10.383  -49.466 -36.310 1.00 31.78  ? 282 VAL B CA  1 
ATOM   6270 C C   . VAL B 1 281 ? 11.500  -48.735 -35.560 1.00 33.24  ? 282 VAL B C   1 
ATOM   6271 O O   . VAL B 1 281 ? 11.611  -48.854 -34.338 1.00 36.25  ? 282 VAL B O   1 
ATOM   6272 C CB  . VAL B 1 281 ? 10.888  -50.845 -36.822 1.00 28.77  ? 282 VAL B CB  1 
ATOM   6273 C CG1 . VAL B 1 281 ? 11.698  -51.570 -35.766 1.00 25.56  ? 282 VAL B CG1 1 
ATOM   6274 C CG2 . VAL B 1 281 ? 9.710   -51.695 -37.263 1.00 27.98  ? 282 VAL B CG2 1 
ATOM   6275 N N   . ASN B 1 282 ? 12.315  -47.967 -36.277 1.00 34.37  ? 283 ASN B N   1 
ATOM   6276 C CA  . ASN B 1 282 ? 13.439  -47.270 -35.642 1.00 33.02  ? 283 ASN B CA  1 
ATOM   6277 C C   . ASN B 1 282 ? 13.009  -46.185 -34.674 1.00 35.78  ? 283 ASN B C   1 
ATOM   6278 O O   . ASN B 1 282 ? 13.801  -45.755 -33.833 1.00 31.77  ? 283 ASN B O   1 
ATOM   6279 C CB  . ASN B 1 282 ? 14.393  -46.671 -36.678 1.00 35.34  ? 283 ASN B CB  1 
ATOM   6280 C CG  . ASN B 1 282 ? 15.202  -47.726 -37.397 1.00 43.77  ? 283 ASN B CG  1 
ATOM   6281 O OD1 . ASN B 1 282 ? 15.368  -48.849 -36.903 1.00 39.48  ? 283 ASN B OD1 1 
ATOM   6282 N ND2 . ASN B 1 282 ? 15.700  -47.381 -38.579 1.00 43.02  ? 283 ASN B ND2 1 
ATOM   6283 N N   . HIS B 1 283 ? 11.761  -45.739 -34.798 1.00 33.85  ? 284 HIS B N   1 
ATOM   6284 C CA  . HIS B 1 283 ? 11.262  -44.667 -33.942 1.00 35.42  ? 284 HIS B CA  1 
ATOM   6285 C C   . HIS B 1 283 ? 10.177  -45.128 -32.976 1.00 36.73  ? 284 HIS B C   1 
ATOM   6286 O O   . HIS B 1 283 ? 9.651   -44.324 -32.211 1.00 40.02  ? 284 HIS B O   1 
ATOM   6287 C CB  . HIS B 1 283 ? 10.753  -43.496 -34.787 1.00 32.38  ? 284 HIS B CB  1 
ATOM   6288 C CG  . HIS B 1 283 ? 11.822  -42.823 -35.588 1.00 41.11  ? 284 HIS B CG  1 
ATOM   6289 N ND1 . HIS B 1 283 ? 12.051  -43.113 -36.920 1.00 46.82  ? 284 HIS B ND1 1 
ATOM   6290 C CD2 . HIS B 1 283 ? 12.738  -41.889 -35.243 1.00 36.35  ? 284 HIS B CD2 1 
ATOM   6291 C CE1 . HIS B 1 283 ? 13.056  -42.378 -37.361 1.00 40.61  ? 284 HIS B CE1 1 
ATOM   6292 N NE2 . HIS B 1 283 ? 13.488  -41.623 -36.363 1.00 44.88  ? 284 HIS B NE2 1 
ATOM   6293 N N   . GLU B 1 284 ? 9.860   -46.421 -33.006 1.00 34.72  ? 285 GLU B N   1 
ATOM   6294 C CA  . GLU B 1 284 ? 8.756   -46.970 -32.230 1.00 31.19  ? 285 GLU B CA  1 
ATOM   6295 C C   . GLU B 1 284 ? 8.821   -46.646 -30.728 1.00 35.94  ? 285 GLU B C   1 
ATOM   6296 O O   . GLU B 1 284 ? 7.851   -46.164 -30.147 1.00 34.68  ? 285 GLU B O   1 
ATOM   6297 C CB  . GLU B 1 284 ? 8.680   -48.482 -32.428 1.00 32.83  ? 285 GLU B CB  1 
ATOM   6298 C CG  . GLU B 1 284 ? 7.551   -49.136 -31.658 1.00 33.66  ? 285 GLU B CG  1 
ATOM   6299 C CD  . GLU B 1 284 ? 7.570   -50.646 -31.764 1.00 37.42  ? 285 GLU B CD  1 
ATOM   6300 O OE1 . GLU B 1 284 ? 7.862   -51.165 -32.866 1.00 30.09  ? 285 GLU B OE1 1 
ATOM   6301 O OE2 . GLU B 1 284 ? 7.302   -51.311 -30.736 1.00 31.78  ? 285 GLU B OE2 1 
ATOM   6302 N N   . TRP B 1 285 ? 9.963   -46.903 -30.105 1.00 34.71  ? 286 TRP B N   1 
ATOM   6303 C CA  . TRP B 1 285 ? 10.091  -46.704 -28.664 1.00 35.95  ? 286 TRP B CA  1 
ATOM   6304 C C   . TRP B 1 285 ? 10.067  -45.237 -28.243 1.00 35.54  ? 286 TRP B C   1 
ATOM   6305 O O   . TRP B 1 285 ? 9.862   -44.929 -27.065 1.00 35.80  ? 286 TRP B O   1 
ATOM   6306 C CB  . TRP B 1 285 ? 11.333  -47.421 -28.132 1.00 26.50  ? 286 TRP B CB  1 
ATOM   6307 C CG  . TRP B 1 285 ? 11.219  -48.907 -28.315 1.00 35.60  ? 286 TRP B CG  1 
ATOM   6308 C CD1 . TRP B 1 285 ? 11.704  -49.647 -29.357 1.00 31.83  ? 286 TRP B CD1 1 
ATOM   6309 C CD2 . TRP B 1 285 ? 10.540  -49.829 -27.450 1.00 32.63  ? 286 TRP B CD2 1 
ATOM   6310 N NE1 . TRP B 1 285 ? 11.383  -50.976 -29.188 1.00 31.17  ? 286 TRP B NE1 1 
ATOM   6311 C CE2 . TRP B 1 285 ? 10.670  -51.115 -28.026 1.00 33.93  ? 286 TRP B CE2 1 
ATOM   6312 C CE3 . TRP B 1 285 ? 9.845   -49.695 -26.243 1.00 28.80  ? 286 TRP B CE3 1 
ATOM   6313 C CZ2 . TRP B 1 285 ? 10.127  -52.260 -27.434 1.00 28.49  ? 286 TRP B CZ2 1 
ATOM   6314 C CZ3 . TRP B 1 285 ? 9.305   -50.837 -25.650 1.00 26.57  ? 286 TRP B CZ3 1 
ATOM   6315 C CH2 . TRP B 1 285 ? 9.451   -52.101 -26.246 1.00 29.42  ? 286 TRP B CH2 1 
ATOM   6316 N N   . HIS B 1 286 ? 10.244  -44.340 -29.208 1.00 35.79  ? 287 HIS B N   1 
ATOM   6317 C CA  . HIS B 1 286 ? 10.296  -42.905 -28.930 1.00 34.85  ? 287 HIS B CA  1 
ATOM   6318 C C   . HIS B 1 286 ? 8.936   -42.282 -28.586 1.00 36.72  ? 287 HIS B C   1 
ATOM   6319 O O   . HIS B 1 286 ? 8.878   -41.193 -28.019 1.00 34.52  ? 287 HIS B O   1 
ATOM   6320 C CB  . HIS B 1 286 ? 10.934  -42.159 -30.108 1.00 38.28  ? 287 HIS B CB  1 
ATOM   6321 C CG  . HIS B 1 286 ? 12.361  -42.540 -30.362 1.00 44.26  ? 287 HIS B CG  1 
ATOM   6322 N ND1 . HIS B 1 286 ? 13.319  -42.542 -29.370 1.00 52.59  ? 287 HIS B ND1 1 
ATOM   6323 C CD2 . HIS B 1 286 ? 12.993  -42.929 -31.494 1.00 45.28  ? 287 HIS B CD2 1 
ATOM   6324 C CE1 . HIS B 1 286 ? 14.478  -42.921 -29.879 1.00 49.08  ? 287 HIS B CE1 1 
ATOM   6325 N NE2 . HIS B 1 286 ? 14.307  -43.162 -31.167 1.00 46.00  ? 287 HIS B NE2 1 
ATOM   6326 N N   . VAL B 1 287 ? 7.842   -42.962 -28.919 1.00 29.88  ? 288 VAL B N   1 
ATOM   6327 C CA  . VAL B 1 287 ? 6.532   -42.380 -28.676 1.00 32.29  ? 288 VAL B CA  1 
ATOM   6328 C C   . VAL B 1 287 ? 5.978   -42.660 -27.274 1.00 34.46  ? 288 VAL B C   1 
ATOM   6329 O O   . VAL B 1 287 ? 4.925   -42.154 -26.919 1.00 36.75  ? 288 VAL B O   1 
ATOM   6330 C CB  . VAL B 1 287 ? 5.501   -42.766 -29.767 1.00 32.95  ? 288 VAL B CB  1 
ATOM   6331 C CG1 . VAL B 1 287 ? 6.035   -42.395 -31.141 1.00 32.13  ? 288 VAL B CG1 1 
ATOM   6332 C CG2 . VAL B 1 287 ? 5.157   -44.241 -29.703 1.00 27.13  ? 288 VAL B CG2 1 
ATOM   6333 N N   . LEU B 1 288 ? 6.683   -43.457 -26.477 1.00 39.23  ? 289 LEU B N   1 
ATOM   6334 C CA  . LEU B 1 288 ? 6.273   -43.666 -25.091 1.00 38.38  ? 289 LEU B CA  1 
ATOM   6335 C C   . LEU B 1 288 ? 6.485   -42.372 -24.308 1.00 38.44  ? 289 LEU B C   1 
ATOM   6336 O O   . LEU B 1 288 ? 7.581   -41.811 -24.308 1.00 40.90  ? 289 LEU B O   1 
ATOM   6337 C CB  . LEU B 1 288 ? 7.023   -44.838 -24.449 1.00 26.92  ? 289 LEU B CB  1 
ATOM   6338 C CG  . LEU B 1 288 ? 6.652   -46.237 -24.969 1.00 34.37  ? 289 LEU B CG  1 
ATOM   6339 C CD1 . LEU B 1 288 ? 7.429   -47.325 -24.248 1.00 25.62  ? 289 LEU B CD1 1 
ATOM   6340 C CD2 . LEU B 1 288 ? 5.155   -46.508 -24.884 1.00 27.25  ? 289 LEU B CD2 1 
ATOM   6341 N N   . PRO B 1 289 ? 5.428   -41.895 -23.639 1.00 40.15  ? 290 PRO B N   1 
ATOM   6342 C CA  . PRO B 1 289 ? 5.421   -40.580 -22.982 1.00 40.39  ? 290 PRO B CA  1 
ATOM   6343 C C   . PRO B 1 289 ? 6.410   -40.461 -21.815 1.00 45.40  ? 290 PRO B C   1 
ATOM   6344 O O   . PRO B 1 289 ? 6.966   -39.383 -21.604 1.00 48.91  ? 290 PRO B O   1 
ATOM   6345 C CB  . PRO B 1 289 ? 3.975   -40.443 -22.490 1.00 39.82  ? 290 PRO B CB  1 
ATOM   6346 C CG  . PRO B 1 289 ? 3.505   -41.855 -22.307 1.00 39.30  ? 290 PRO B CG  1 
ATOM   6347 C CD  . PRO B 1 289 ? 4.184   -42.649 -23.396 1.00 40.90  ? 290 PRO B CD  1 
ATOM   6348 N N   . GLN B 1 290 ? 6.634   -41.543 -21.077 1.00 36.07  ? 291 GLN B N   1 
ATOM   6349 C CA  . GLN B 1 290 ? 7.555   -41.504 -19.945 1.00 41.27  ? 291 GLN B CA  1 
ATOM   6350 C C   . GLN B 1 290 ? 8.482   -42.712 -19.921 1.00 38.46  ? 291 GLN B C   1 
ATOM   6351 O O   . GLN B 1 290 ? 8.187   -43.758 -20.499 1.00 36.10  ? 291 GLN B O   1 
ATOM   6352 C CB  . GLN B 1 290 ? 6.795   -41.431 -18.607 1.00 41.33  ? 291 GLN B CB  1 
ATOM   6353 C CG  . GLN B 1 290 ? 5.838   -40.238 -18.468 1.00 54.14  ? 291 GLN B CG  1 
ATOM   6354 C CD  . GLN B 1 290 ? 6.548   -38.896 -18.280 1.00 57.04  ? 291 GLN B CD  1 
ATOM   6355 O OE1 . GLN B 1 290 ? 7.649   -38.828 -17.725 1.00 55.72  ? 291 GLN B OE1 1 
ATOM   6356 N NE2 . GLN B 1 290 ? 5.909   -37.824 -18.737 1.00 48.33  ? 291 GLN B NE2 1 
ATOM   6357 N N   . GLU B 1 291 ? 9.605   -42.540 -19.241 1.00 30.91  ? 292 GLU B N   1 
ATOM   6358 C CA  . GLU B 1 291 ? 10.536  -43.617 -18.957 1.00 40.02  ? 292 GLU B CA  1 
ATOM   6359 C C   . GLU B 1 291 ? 9.786   -44.781 -18.282 1.00 37.14  ? 292 GLU B C   1 
ATOM   6360 O O   . GLU B 1 291 ? 9.030   -44.567 -17.333 1.00 35.19  ? 292 GLU B O   1 
ATOM   6361 C CB  . GLU B 1 291 ? 11.607  -43.057 -18.028 1.00 42.58  ? 292 GLU B CB  1 
ATOM   6362 C CG  . GLU B 1 291 ? 12.912  -43.797 -18.001 1.00 51.48  ? 292 GLU B CG  1 
ATOM   6363 C CD  . GLU B 1 291 ? 13.891  -43.155 -17.034 1.00 54.39  ? 292 GLU B CD  1 
ATOM   6364 O OE1 . GLU B 1 291 ? 13.955  -41.907 -17.005 1.00 61.38  ? 292 GLU B OE1 1 
ATOM   6365 O OE2 . GLU B 1 291 ? 14.579  -43.893 -16.295 1.00 42.33  ? 292 GLU B OE2 1 
ATOM   6366 N N   . SER B 1 292 ? 9.977   -46.005 -18.771 1.00 28.79  ? 293 SER B N   1 
ATOM   6367 C CA  . SER B 1 292 ? 9.185   -47.130 -18.289 1.00 26.66  ? 293 SER B CA  1 
ATOM   6368 C C   . SER B 1 292 ? 9.837   -48.483 -18.564 1.00 31.01  ? 293 SER B C   1 
ATOM   6369 O O   . SER B 1 292 ? 10.845  -48.562 -19.261 1.00 32.72  ? 293 SER B O   1 
ATOM   6370 C CB  . SER B 1 292 ? 7.803   -47.108 -18.945 1.00 28.22  ? 293 SER B CB  1 
ATOM   6371 O OG  . SER B 1 292 ? 7.895   -47.431 -20.327 1.00 31.24  ? 293 SER B OG  1 
ATOM   6372 N N   . VAL B 1 293 ? 9.263   -49.538 -17.984 1.00 24.24  ? 294 VAL B N   1 
ATOM   6373 C CA  . VAL B 1 293 ? 9.450   -50.906 -18.464 1.00 23.09  ? 294 VAL B CA  1 
ATOM   6374 C C   . VAL B 1 293 ? 8.061   -51.531 -18.537 1.00 30.95  ? 294 VAL B C   1 
ATOM   6375 O O   . VAL B 1 293 ? 7.118   -51.026 -17.910 1.00 25.40  ? 294 VAL B O   1 
ATOM   6376 C CB  . VAL B 1 293 ? 10.351  -51.762 -17.555 1.00 26.34  ? 294 VAL B CB  1 
ATOM   6377 C CG1 . VAL B 1 293 ? 11.783  -51.235 -17.568 1.00 23.24  ? 294 VAL B CG1 1 
ATOM   6378 C CG2 . VAL B 1 293 ? 9.789   -51.819 -16.130 1.00 24.25  ? 294 VAL B CG2 1 
ATOM   6379 N N   . PHE B 1 294 ? 7.927   -52.604 -19.314 1.00 22.73  ? 295 PHE B N   1 
ATOM   6380 C CA  . PHE B 1 294 ? 6.641   -53.282 -19.475 1.00 24.64  ? 295 PHE B CA  1 
ATOM   6381 C C   . PHE B 1 294 ? 5.581   -52.349 -20.068 1.00 25.17  ? 295 PHE B C   1 
ATOM   6382 O O   . PHE B 1 294 ? 4.393   -52.467 -19.754 1.00 25.06  ? 295 PHE B O   1 
ATOM   6383 C CB  . PHE B 1 294 ? 6.151   -53.873 -18.134 1.00 24.20  ? 295 PHE B CB  1 
ATOM   6384 C CG  . PHE B 1 294 ? 5.496   -55.221 -18.268 1.00 22.41  ? 295 PHE B CG  1 
ATOM   6385 C CD1 . PHE B 1 294 ? 4.652   -55.500 -19.342 1.00 23.30  ? 295 PHE B CD1 1 
ATOM   6386 C CD2 . PHE B 1 294 ? 5.744   -56.219 -17.339 1.00 20.86  ? 295 PHE B CD2 1 
ATOM   6387 C CE1 . PHE B 1 294 ? 4.054   -56.749 -19.479 1.00 20.16  ? 295 PHE B CE1 1 
ATOM   6388 C CE2 . PHE B 1 294 ? 5.146   -57.470 -17.463 1.00 20.90  ? 295 PHE B CE2 1 
ATOM   6389 C CZ  . PHE B 1 294 ? 4.306   -57.736 -18.537 1.00 21.64  ? 295 PHE B CZ  1 
ATOM   6390 N N   . ARG B 1 295 ? 6.017   -51.413 -20.906 1.00 22.46  ? 296 ARG B N   1 
ATOM   6391 C CA  . ARG B 1 295 ? 5.094   -50.583 -21.677 1.00 23.01  ? 296 ARG B CA  1 
ATOM   6392 C C   . ARG B 1 295 ? 5.492   -50.622 -23.139 1.00 29.23  ? 296 ARG B C   1 
ATOM   6393 O O   . ARG B 1 295 ? 6.682   -50.550 -23.472 1.00 24.39  ? 296 ARG B O   1 
ATOM   6394 C CB  . ARG B 1 295 ? 5.090   -49.138 -21.192 1.00 22.20  ? 296 ARG B CB  1 
ATOM   6395 C CG  . ARG B 1 295 ? 4.433   -48.934 -19.839 1.00 29.43  ? 296 ARG B CG  1 
ATOM   6396 C CD  . ARG B 1 295 ? 2.977   -49.411 -19.812 1.00 24.32  ? 296 ARG B CD  1 
ATOM   6397 N NE  . ARG B 1 295 ? 2.402   -49.145 -18.493 1.00 35.21  ? 296 ARG B NE  1 
ATOM   6398 C CZ  . ARG B 1 295 ? 2.441   -49.991 -17.465 1.00 27.60  ? 296 ARG B CZ  1 
ATOM   6399 N NH1 . ARG B 1 295 ? 3.005   -51.191 -17.591 1.00 22.31  ? 296 ARG B NH1 1 
ATOM   6400 N NH2 . ARG B 1 295 ? 1.905   -49.638 -16.310 1.00 29.87  ? 296 ARG B NH2 1 
ATOM   6401 N N   . PHE B 1 296 ? 4.493   -50.724 -24.009 1.00 24.32  ? 297 PHE B N   1 
ATOM   6402 C CA  . PHE B 1 296 ? 4.741   -50.927 -25.432 1.00 24.79  ? 297 PHE B CA  1 
ATOM   6403 C C   . PHE B 1 296 ? 3.918   -49.934 -26.252 1.00 25.78  ? 297 PHE B C   1 
ATOM   6404 O O   . PHE B 1 296 ? 2.754   -49.677 -25.953 1.00 27.39  ? 297 PHE B O   1 
ATOM   6405 C CB  . PHE B 1 296 ? 4.427   -52.380 -25.811 1.00 21.92  ? 297 PHE B CB  1 
ATOM   6406 C CG  . PHE B 1 296 ? 4.809   -53.369 -24.741 1.00 23.53  ? 297 PHE B CG  1 
ATOM   6407 C CD1 . PHE B 1 296 ? 6.141   -53.644 -24.477 1.00 23.28  ? 297 PHE B CD1 1 
ATOM   6408 C CD2 . PHE B 1 296 ? 3.835   -54.001 -23.975 1.00 21.73  ? 297 PHE B CD2 1 
ATOM   6409 C CE1 . PHE B 1 296 ? 6.500   -54.542 -23.475 1.00 23.44  ? 297 PHE B CE1 1 
ATOM   6410 C CE2 . PHE B 1 296 ? 4.187   -54.895 -22.976 1.00 19.93  ? 297 PHE B CE2 1 
ATOM   6411 C CZ  . PHE B 1 296 ? 5.524   -55.168 -22.731 1.00 19.89  ? 297 PHE B CZ  1 
ATOM   6412 N N   . SER B 1 297 ? 4.531   -49.380 -27.287 1.00 26.43  ? 298 SER B N   1 
ATOM   6413 C CA  . SER B 1 297 ? 3.970   -48.222 -27.980 1.00 29.64  ? 298 SER B CA  1 
ATOM   6414 C C   . SER B 1 297 ? 2.616   -48.456 -28.638 1.00 27.67  ? 298 SER B C   1 
ATOM   6415 O O   . SER B 1 297 ? 1.694   -47.660 -28.470 1.00 27.72  ? 298 SER B O   1 
ATOM   6416 C CB  . SER B 1 297 ? 4.971   -47.689 -29.007 1.00 24.39  ? 298 SER B CB  1 
ATOM   6417 O OG  . SER B 1 297 ? 6.139   -47.224 -28.352 1.00 26.48  ? 298 SER B OG  1 
ATOM   6418 N N   . PHE B 1 298 ? 2.498   -49.535 -29.396 1.00 19.89  ? 299 PHE B N   1 
ATOM   6419 C CA  . PHE B 1 298 ? 1.279   -49.764 -30.154 1.00 24.22  ? 299 PHE B CA  1 
ATOM   6420 C C   . PHE B 1 298 ? 0.604   -51.056 -29.728 1.00 26.77  ? 299 PHE B C   1 
ATOM   6421 O O   . PHE B 1 298 ? 1.090   -52.160 -29.989 1.00 25.61  ? 299 PHE B O   1 
ATOM   6422 C CB  . PHE B 1 298 ? 1.556   -49.712 -31.673 1.00 24.87  ? 299 PHE B CB  1 
ATOM   6423 C CG  . PHE B 1 298 ? 2.196   -48.419 -32.113 1.00 28.17  ? 299 PHE B CG  1 
ATOM   6424 C CD1 . PHE B 1 298 ? 1.430   -47.265 -32.257 1.00 24.42  ? 299 PHE B CD1 1 
ATOM   6425 C CD2 . PHE B 1 298 ? 3.573   -48.345 -32.340 1.00 28.67  ? 299 PHE B CD2 1 
ATOM   6426 C CE1 . PHE B 1 298 ? 2.015   -46.069 -32.636 1.00 23.56  ? 299 PHE B CE1 1 
ATOM   6427 C CE2 . PHE B 1 298 ? 4.173   -47.146 -32.718 1.00 22.85  ? 299 PHE B CE2 1 
ATOM   6428 C CZ  . PHE B 1 298 ? 3.392   -46.007 -32.871 1.00 26.75  ? 299 PHE B CZ  1 
ATOM   6429 N N   . VAL B 1 299 ? -0.523  -50.899 -29.046 1.00 22.89  ? 300 VAL B N   1 
ATOM   6430 C CA  . VAL B 1 299 ? -1.222  -52.016 -28.440 1.00 19.15  ? 300 VAL B CA  1 
ATOM   6431 C C   . VAL B 1 299 ? -2.701  -51.865 -28.799 1.00 21.32  ? 300 VAL B C   1 
ATOM   6432 O O   . VAL B 1 299 ? -3.080  -50.847 -29.381 1.00 21.30  ? 300 VAL B O   1 
ATOM   6433 C CB  . VAL B 1 299 ? -0.974  -52.038 -26.905 1.00 23.71  ? 300 VAL B CB  1 
ATOM   6434 C CG1 . VAL B 1 299 ? 0.505   -52.204 -26.622 1.00 18.28  ? 300 VAL B CG1 1 
ATOM   6435 C CG2 . VAL B 1 299 ? -1.500  -50.760 -26.235 1.00 20.09  ? 300 VAL B CG2 1 
ATOM   6436 N N   . PRO B 1 300 ? -3.533  -52.881 -28.503 1.00 19.63  ? 301 PRO B N   1 
ATOM   6437 C CA  . PRO B 1 300 ? -4.966  -52.721 -28.781 1.00 24.51  ? 301 PRO B CA  1 
ATOM   6438 C C   . PRO B 1 300 ? -5.555  -51.422 -28.234 1.00 25.42  ? 301 PRO B C   1 
ATOM   6439 O O   . PRO B 1 300 ? -5.161  -50.956 -27.165 1.00 26.39  ? 301 PRO B O   1 
ATOM   6440 C CB  . PRO B 1 300 ? -5.584  -53.930 -28.078 1.00 21.92  ? 301 PRO B CB  1 
ATOM   6441 C CG  . PRO B 1 300 ? -4.544  -54.990 -28.266 1.00 20.74  ? 301 PRO B CG  1 
ATOM   6442 C CD  . PRO B 1 300 ? -3.209  -54.274 -28.137 1.00 19.64  ? 301 PRO B CD  1 
ATOM   6443 N N   . VAL B 1 301 ? -6.468  -50.833 -28.995 1.00 27.44  ? 302 VAL B N   1 
ATOM   6444 C CA  . VAL B 1 301 ? -7.106  -49.586 -28.611 1.00 25.01  ? 302 VAL B CA  1 
ATOM   6445 C C   . VAL B 1 301 ? -8.554  -49.863 -28.224 1.00 28.53  ? 302 VAL B C   1 
ATOM   6446 O O   . VAL B 1 301 ? -9.237  -50.658 -28.872 1.00 28.29  ? 302 VAL B O   1 
ATOM   6447 C CB  . VAL B 1 301 ? -7.032  -48.533 -29.752 1.00 28.32  ? 302 VAL B CB  1 
ATOM   6448 C CG1 . VAL B 1 301 ? -7.793  -49.003 -30.992 1.00 25.28  ? 302 VAL B CG1 1 
ATOM   6449 C CG2 . VAL B 1 301 ? -7.553  -47.189 -29.278 1.00 31.89  ? 302 VAL B CG2 1 
ATOM   6450 N N   . VAL B 1 302 ? -9.000  -49.242 -27.133 1.00 34.95  ? 303 VAL B N   1 
ATOM   6451 C CA  . VAL B 1 302 ? -10.402 -49.299 -26.737 1.00 34.88  ? 303 VAL B CA  1 
ATOM   6452 C C   . VAL B 1 302 ? -11.103 -48.205 -27.514 1.00 38.36  ? 303 VAL B C   1 
ATOM   6453 O O   . VAL B 1 302 ? -10.964 -47.020 -27.200 1.00 38.97  ? 303 VAL B O   1 
ATOM   6454 C CB  . VAL B 1 302 ? -10.594 -49.034 -25.223 1.00 34.97  ? 303 VAL B CB  1 
ATOM   6455 C CG1 . VAL B 1 302 ? -12.040 -49.318 -24.811 1.00 28.91  ? 303 VAL B CG1 1 
ATOM   6456 C CG2 . VAL B 1 302 ? -9.635  -49.879 -24.413 1.00 28.49  ? 303 VAL B CG2 1 
ATOM   6457 N N   . ASP B 1 303 ? -11.840 -48.593 -28.545 1.00 37.66  ? 304 ASP B N   1 
ATOM   6458 C CA  . ASP B 1 303 ? -12.414 -47.602 -29.437 1.00 42.02  ? 304 ASP B CA  1 
ATOM   6459 C C   . ASP B 1 303 ? -13.901 -47.837 -29.677 1.00 43.48  ? 304 ASP B C   1 
ATOM   6460 O O   . ASP B 1 303 ? -14.521 -47.141 -30.478 1.00 49.19  ? 304 ASP B O   1 
ATOM   6461 C CB  . ASP B 1 303 ? -11.664 -47.608 -30.763 1.00 42.75  ? 304 ASP B CB  1 
ATOM   6462 C CG  . ASP B 1 303 ? -11.914 -48.865 -31.554 1.00 44.82  ? 304 ASP B CG  1 
ATOM   6463 O OD1 . ASP B 1 303 ? -12.211 -49.911 -30.933 1.00 41.62  ? 304 ASP B OD1 1 
ATOM   6464 O OD2 . ASP B 1 303 ? -11.826 -48.802 -32.799 1.00 56.41  ? 304 ASP B OD2 1 
ATOM   6465 N N   . GLY B 1 304 ? -14.468 -48.821 -28.987 1.00 38.42  ? 305 GLY B N   1 
ATOM   6466 C CA  . GLY B 1 304 ? -15.886 -49.094 -29.105 1.00 38.98  ? 305 GLY B CA  1 
ATOM   6467 C C   . GLY B 1 304 ? -16.232 -50.088 -30.199 1.00 46.30  ? 305 GLY B C   1 
ATOM   6468 O O   . GLY B 1 304 ? -17.402 -50.423 -30.388 1.00 53.28  ? 305 GLY B O   1 
ATOM   6469 N N   . ASP B 1 305 ? -15.225 -50.568 -30.922 1.00 43.79  ? 306 ASP B N   1 
ATOM   6470 C CA  . ASP B 1 305 ? -15.475 -51.513 -32.010 1.00 42.11  ? 306 ASP B CA  1 
ATOM   6471 C C   . ASP B 1 305 ? -15.124 -52.950 -31.598 1.00 40.97  ? 306 ASP B C   1 
ATOM   6472 O O   . ASP B 1 305 ? -16.006 -53.700 -31.178 1.00 42.01  ? 306 ASP B O   1 
ATOM   6473 C CB  . ASP B 1 305 ? -14.731 -51.089 -33.281 1.00 40.39  ? 306 ASP B CB  1 
ATOM   6474 C CG  . ASP B 1 305 ? -15.147 -51.896 -34.505 1.00 44.29  ? 306 ASP B CG  1 
ATOM   6475 O OD1 . ASP B 1 305 ? -15.960 -52.833 -34.363 1.00 46.26  ? 306 ASP B OD1 1 
ATOM   6476 O OD2 . ASP B 1 305 ? -14.650 -51.596 -35.612 1.00 47.78  ? 306 ASP B OD2 1 
ATOM   6477 N N   . PHE B 1 306 ? -13.852 -53.335 -31.717 1.00 42.38  ? 307 PHE B N   1 
ATOM   6478 C CA  . PHE B 1 306 ? -13.429 -54.677 -31.306 1.00 39.24  ? 307 PHE B CA  1 
ATOM   6479 C C   . PHE B 1 306 ? -13.711 -54.855 -29.817 1.00 35.27  ? 307 PHE B C   1 
ATOM   6480 O O   . PHE B 1 306 ? -14.203 -55.894 -29.385 1.00 32.38  ? 307 PHE B O   1 
ATOM   6481 C CB  . PHE B 1 306 ? -11.939 -54.899 -31.591 1.00 33.71  ? 307 PHE B CB  1 
ATOM   6482 C CG  . PHE B 1 306 ? -11.514 -56.348 -31.535 1.00 33.13  ? 307 PHE B CG  1 
ATOM   6483 C CD1 . PHE B 1 306 ? -11.206 -56.954 -30.325 1.00 33.36  ? 307 PHE B CD1 1 
ATOM   6484 C CD2 . PHE B 1 306 ? -11.408 -57.097 -32.695 1.00 34.19  ? 307 PHE B CD2 1 
ATOM   6485 C CE1 . PHE B 1 306 ? -10.817 -58.287 -30.269 1.00 31.67  ? 307 PHE B CE1 1 
ATOM   6486 C CE2 . PHE B 1 306 ? -11.009 -58.428 -32.649 1.00 33.51  ? 307 PHE B CE2 1 
ATOM   6487 C CZ  . PHE B 1 306 ? -10.716 -59.024 -31.430 1.00 31.87  ? 307 PHE B CZ  1 
ATOM   6488 N N   . LEU B 1 307 ? -13.382 -53.816 -29.057 1.00 32.33  ? 308 LEU B N   1 
ATOM   6489 C CA  . LEU B 1 307 ? -13.676 -53.720 -27.636 1.00 39.03  ? 308 LEU B CA  1 
ATOM   6490 C C   . LEU B 1 307 ? -14.669 -52.578 -27.427 1.00 40.89  ? 308 LEU B C   1 
ATOM   6491 O O   . LEU B 1 307 ? -14.321 -51.403 -27.573 1.00 35.27  ? 308 LEU B O   1 
ATOM   6492 C CB  . LEU B 1 307 ? -12.390 -53.444 -26.850 1.00 31.35  ? 308 LEU B CB  1 
ATOM   6493 C CG  . LEU B 1 307 ? -11.305 -54.519 -26.941 1.00 31.34  ? 308 LEU B CG  1 
ATOM   6494 C CD1 . LEU B 1 307 ? -10.028 -54.043 -26.281 1.00 33.22  ? 308 LEU B CD1 1 
ATOM   6495 C CD2 . LEU B 1 307 ? -11.783 -55.829 -26.320 1.00 32.92  ? 308 LEU B CD2 1 
ATOM   6496 N N   . SER B 1 308 ? -15.908 -52.924 -27.094 1.00 43.00  ? 309 SER B N   1 
ATOM   6497 C CA  . SER B 1 308 ? -16.969 -51.928 -26.976 1.00 43.89  ? 309 SER B CA  1 
ATOM   6498 C C   . SER B 1 308 ? -16.824 -51.074 -25.713 1.00 42.32  ? 309 SER B C   1 
ATOM   6499 O O   . SER B 1 308 ? -17.432 -50.012 -25.595 1.00 50.03  ? 309 SER B O   1 
ATOM   6500 C CB  . SER B 1 308 ? -18.343 -52.602 -27.030 1.00 38.77  ? 309 SER B CB  1 
ATOM   6501 O OG  . SER B 1 308 ? -18.522 -53.471 -25.929 1.00 49.68  ? 309 SER B OG  1 
ATOM   6502 N N   . ASP B 1 309 ? -16.009 -51.545 -24.780 1.00 37.46  ? 310 ASP B N   1 
ATOM   6503 C CA  . ASP B 1 309 ? -15.687 -50.804 -23.570 1.00 39.63  ? 310 ASP B CA  1 
ATOM   6504 C C   . ASP B 1 309 ? -14.333 -51.340 -23.115 1.00 42.14  ? 310 ASP B C   1 
ATOM   6505 O O   . ASP B 1 309 ? -13.775 -52.230 -23.759 1.00 39.72  ? 310 ASP B O   1 
ATOM   6506 C CB  . ASP B 1 309 ? -16.757 -51.054 -22.498 1.00 47.62  ? 310 ASP B CB  1 
ATOM   6507 C CG  . ASP B 1 309 ? -16.765 -49.993 -21.389 1.00 46.76  ? 310 ASP B CG  1 
ATOM   6508 O OD1 . ASP B 1 309 ? -15.689 -49.581 -20.899 1.00 41.17  ? 310 ASP B OD1 1 
ATOM   6509 O OD2 . ASP B 1 309 ? -17.874 -49.582 -20.991 1.00 60.63  ? 310 ASP B OD2 1 
ATOM   6510 N N   . THR B 1 310 ? -13.805 -50.811 -22.015 1.00 40.30  ? 311 THR B N   1 
ATOM   6511 C CA  . THR B 1 310 ? -12.541 -51.292 -21.484 1.00 36.39  ? 311 THR B CA  1 
ATOM   6512 C C   . THR B 1 310 ? -12.660 -52.770 -21.129 1.00 40.00  ? 311 THR B C   1 
ATOM   6513 O O   . THR B 1 310 ? -13.752 -53.255 -20.826 1.00 38.61  ? 311 THR B O   1 
ATOM   6514 C CB  . THR B 1 310 ? -12.110 -50.496 -20.240 1.00 39.20  ? 311 THR B CB  1 
ATOM   6515 O OG1 . THR B 1 310 ? -12.931 -50.863 -19.126 1.00 46.87  ? 311 THR B OG1 1 
ATOM   6516 C CG2 . THR B 1 310 ? -12.217 -48.995 -20.498 1.00 34.51  ? 311 THR B CG2 1 
ATOM   6517 N N   . PRO B 1 311 ? -11.541 -53.501 -21.197 1.00 38.15  ? 312 PRO B N   1 
ATOM   6518 C CA  . PRO B 1 311 ? -11.587 -54.909 -20.799 1.00 35.67  ? 312 PRO B CA  1 
ATOM   6519 C C   . PRO B 1 311 ? -12.044 -55.052 -19.341 1.00 41.67  ? 312 PRO B C   1 
ATOM   6520 O O   . PRO B 1 311 ? -12.806 -55.964 -19.025 1.00 39.81  ? 312 PRO B O   1 
ATOM   6521 C CB  . PRO B 1 311 ? -10.134 -55.368 -20.961 1.00 32.54  ? 312 PRO B CB  1 
ATOM   6522 C CG  . PRO B 1 311 ? -9.542  -54.420 -21.963 1.00 35.42  ? 312 PRO B CG  1 
ATOM   6523 C CD  . PRO B 1 311 ? -10.229 -53.109 -21.744 1.00 34.24  ? 312 PRO B CD  1 
ATOM   6524 N N   . GLU B 1 312 ? -11.594 -54.152 -18.473 1.00 40.70  ? 313 GLU B N   1 
ATOM   6525 C CA  . GLU B 1 312 ? -12.018 -54.159 -17.074 1.00 44.02  ? 313 GLU B CA  1 
ATOM   6526 C C   . GLU B 1 312 ? -13.551 -54.124 -16.976 1.00 46.54  ? 313 GLU B C   1 
ATOM   6527 O O   . GLU B 1 312 ? -14.160 -55.019 -16.392 1.00 40.61  ? 313 GLU B O   1 
ATOM   6528 C CB  . GLU B 1 312 ? -11.383 -52.985 -16.324 1.00 46.24  ? 313 GLU B CB  1 
ATOM   6529 C CG  . GLU B 1 312 ? -11.016 -53.282 -14.873 1.00 56.61  ? 313 GLU B CG  1 
ATOM   6530 C CD  . GLU B 1 312 ? -12.046 -52.745 -13.886 1.00 72.74  ? 313 GLU B CD  1 
ATOM   6531 O OE1 . GLU B 1 312 ? -12.734 -51.752 -14.233 1.00 67.11  ? 313 GLU B OE1 1 
ATOM   6532 O OE2 . GLU B 1 312 ? -12.168 -53.315 -12.771 1.00 64.83  ? 313 GLU B OE2 1 
ATOM   6533 N N   . ALA B 1 313 ? -14.168 -53.113 -17.582 1.00 38.88  ? 314 ALA B N   1 
ATOM   6534 C CA  . ALA B 1 313 ? -15.625 -53.026 -17.650 1.00 37.54  ? 314 ALA B CA  1 
ATOM   6535 C C   . ALA B 1 313 ? -16.294 -54.277 -18.233 1.00 42.03  ? 314 ALA B C   1 
ATOM   6536 O O   . ALA B 1 313 ? -17.206 -54.833 -17.629 1.00 48.69  ? 314 ALA B O   1 
ATOM   6537 C CB  . ALA B 1 313 ? -16.041 -51.798 -18.449 1.00 40.42  ? 314 ALA B CB  1 
ATOM   6538 N N   . LEU B 1 314 ? -15.849 -54.707 -19.411 1.00 46.44  ? 315 LEU B N   1 
ATOM   6539 C CA  . LEU B 1 314 ? -16.442 -55.868 -20.083 1.00 39.65  ? 315 LEU B CA  1 
ATOM   6540 C C   . LEU B 1 314 ? -16.386 -57.131 -19.236 1.00 40.37  ? 315 LEU B C   1 
ATOM   6541 O O   . LEU B 1 314 ? -17.335 -57.914 -19.203 1.00 47.93  ? 315 LEU B O   1 
ATOM   6542 C CB  . LEU B 1 314 ? -15.764 -56.116 -21.429 1.00 42.52  ? 315 LEU B CB  1 
ATOM   6543 C CG  . LEU B 1 314 ? -16.130 -55.119 -22.525 1.00 41.10  ? 315 LEU B CG  1 
ATOM   6544 C CD1 . LEU B 1 314 ? -15.233 -55.294 -23.739 1.00 35.39  ? 315 LEU B CD1 1 
ATOM   6545 C CD2 . LEU B 1 314 ? -17.590 -55.298 -22.899 1.00 38.89  ? 315 LEU B CD2 1 
ATOM   6546 N N   . ILE B 1 315 ? -15.261 -57.326 -18.564 1.00 35.64  ? 316 ILE B N   1 
ATOM   6547 C CA  . ILE B 1 315 ? -15.104 -58.428 -17.638 1.00 40.85  ? 316 ILE B CA  1 
ATOM   6548 C C   . ILE B 1 315 ? -16.145 -58.315 -16.519 1.00 49.69  ? 316 ILE B C   1 
ATOM   6549 O O   . ILE B 1 315 ? -16.956 -59.221 -16.321 1.00 47.62  ? 316 ILE B O   1 
ATOM   6550 C CB  . ILE B 1 315 ? -13.681 -58.435 -17.046 1.00 43.01  ? 316 ILE B CB  1 
ATOM   6551 C CG1 . ILE B 1 315 ? -12.675 -58.919 -18.093 1.00 41.17  ? 316 ILE B CG1 1 
ATOM   6552 C CG2 . ILE B 1 315 ? -13.603 -59.315 -15.805 1.00 37.37  ? 316 ILE B CG2 1 
ATOM   6553 C CD1 . ILE B 1 315 ? -11.236 -58.526 -17.786 1.00 35.47  ? 316 ILE B CD1 1 
ATOM   6554 N N   . ASN B 1 316 ? -16.131 -57.184 -15.815 1.00 48.98  ? 317 ASN B N   1 
ATOM   6555 C CA  . ASN B 1 316 ? -17.016 -56.951 -14.673 1.00 54.11  ? 317 ASN B CA  1 
ATOM   6556 C C   . ASN B 1 316 ? -18.497 -57.154 -14.978 1.00 55.51  ? 317 ASN B C   1 
ATOM   6557 O O   . ASN B 1 316 ? -19.265 -57.562 -14.107 1.00 57.76  ? 317 ASN B O   1 
ATOM   6558 C CB  . ASN B 1 316 ? -16.804 -55.545 -14.106 1.00 42.91  ? 317 ASN B CB  1 
ATOM   6559 C CG  . ASN B 1 316 ? -15.464 -55.386 -13.429 1.00 48.87  ? 317 ASN B CG  1 
ATOM   6560 O OD1 . ASN B 1 316 ? -14.811 -56.370 -13.079 1.00 55.38  ? 317 ASN B OD1 1 
ATOM   6561 N ND2 . ASN B 1 316 ? -15.044 -54.142 -13.235 1.00 49.39  ? 317 ASN B ND2 1 
ATOM   6562 N N   . ALA B 1 317 ? -18.883 -56.888 -16.221 1.00 50.97  ? 318 ALA B N   1 
ATOM   6563 C CA  . ALA B 1 317 ? -20.288 -56.899 -16.606 1.00 53.30  ? 318 ALA B CA  1 
ATOM   6564 C C   . ALA B 1 317 ? -20.620 -57.966 -17.643 1.00 58.51  ? 318 ALA B C   1 
ATOM   6565 O O   . ALA B 1 317 ? -21.379 -57.705 -18.574 1.00 68.86  ? 318 ALA B O   1 
ATOM   6566 C CB  . ALA B 1 317 ? -20.678 -55.527 -17.138 1.00 51.00  ? 318 ALA B CB  1 
ATOM   6567 N N   . GLY B 1 318 ? -20.067 -59.164 -17.490 1.00 57.84  ? 319 GLY B N   1 
ATOM   6568 C CA  . GLY B 1 318 ? -20.272 -60.204 -18.484 1.00 43.72  ? 319 GLY B CA  1 
ATOM   6569 C C   . GLY B 1 318 ? -20.828 -61.500 -17.919 1.00 45.59  ? 319 GLY B C   1 
ATOM   6570 O O   . GLY B 1 318 ? -20.643 -61.807 -16.743 1.00 39.86  ? 319 GLY B O   1 
ATOM   6571 N N   . ASP B 1 319 ? -21.509 -62.260 -18.770 1.00 47.89  ? 320 ASP B N   1 
ATOM   6572 C CA  . ASP B 1 319 ? -22.023 -63.573 -18.406 1.00 46.79  ? 320 ASP B CA  1 
ATOM   6573 C C   . ASP B 1 319 ? -21.087 -64.621 -18.985 1.00 45.97  ? 320 ASP B C   1 
ATOM   6574 O O   . ASP B 1 319 ? -20.931 -64.716 -20.203 1.00 47.20  ? 320 ASP B O   1 
ATOM   6575 C CB  . ASP B 1 319 ? -23.429 -63.770 -18.981 1.00 46.35  ? 320 ASP B CB  1 
ATOM   6576 C CG  . ASP B 1 319 ? -24.143 -64.977 -18.393 1.00 57.85  ? 320 ASP B CG  1 
ATOM   6577 O OD1 . ASP B 1 319 ? -23.484 -65.839 -17.765 1.00 53.55  ? 320 ASP B OD1 1 
ATOM   6578 O OD2 . ASP B 1 319 ? -25.377 -65.064 -18.566 1.00 64.64  ? 320 ASP B OD2 1 
ATOM   6579 N N   . PHE B 1 320 ? -20.475 -65.416 -18.117 1.00 46.12  ? 321 PHE B N   1 
ATOM   6580 C CA  . PHE B 1 320 ? -19.469 -66.369 -18.558 1.00 39.13  ? 321 PHE B CA  1 
ATOM   6581 C C   . PHE B 1 320 ? -19.859 -67.811 -18.279 1.00 45.82  ? 321 PHE B C   1 
ATOM   6582 O O   . PHE B 1 320 ? -19.001 -68.696 -18.232 1.00 46.46  ? 321 PHE B O   1 
ATOM   6583 C CB  . PHE B 1 320 ? -18.114 -66.035 -17.929 1.00 38.06  ? 321 PHE B CB  1 
ATOM   6584 C CG  . PHE B 1 320 ? -17.582 -64.691 -18.335 1.00 41.69  ? 321 PHE B CG  1 
ATOM   6585 C CD1 . PHE B 1 320 ? -17.077 -64.489 -19.615 1.00 35.08  ? 321 PHE B CD1 1 
ATOM   6586 C CD2 . PHE B 1 320 ? -17.598 -63.625 -17.448 1.00 35.98  ? 321 PHE B CD2 1 
ATOM   6587 C CE1 . PHE B 1 320 ? -16.587 -63.252 -19.998 1.00 31.82  ? 321 PHE B CE1 1 
ATOM   6588 C CE2 . PHE B 1 320 ? -17.113 -62.381 -17.828 1.00 41.79  ? 321 PHE B CE2 1 
ATOM   6589 C CZ  . PHE B 1 320 ? -16.607 -62.196 -19.109 1.00 36.62  ? 321 PHE B CZ  1 
ATOM   6590 N N   . HIS B 1 321 ? -21.154 -68.047 -18.099 1.00 48.38  ? 322 HIS B N   1 
ATOM   6591 C CA  . HIS B 1 321 ? -21.653 -69.407 -17.943 1.00 50.02  ? 322 HIS B CA  1 
ATOM   6592 C C   . HIS B 1 321 ? -21.370 -70.217 -19.205 1.00 48.20  ? 322 HIS B C   1 
ATOM   6593 O O   . HIS B 1 321 ? -21.587 -69.737 -20.313 1.00 43.89  ? 322 HIS B O   1 
ATOM   6594 C CB  . HIS B 1 321 ? -23.152 -69.401 -17.639 1.00 49.16  ? 322 HIS B CB  1 
ATOM   6595 C CG  . HIS B 1 321 ? -23.478 -69.045 -16.223 1.00 48.27  ? 322 HIS B CG  1 
ATOM   6596 N ND1 . HIS B 1 321 ? -23.882 -67.782 -15.845 1.00 49.05  ? 322 HIS B ND1 1 
ATOM   6597 C CD2 . HIS B 1 321 ? -23.448 -69.786 -15.089 1.00 42.46  ? 322 HIS B CD2 1 
ATOM   6598 C CE1 . HIS B 1 321 ? -24.092 -67.761 -14.541 1.00 46.95  ? 322 HIS B CE1 1 
ATOM   6599 N NE2 . HIS B 1 321 ? -23.833 -68.963 -14.058 1.00 52.13  ? 322 HIS B NE2 1 
ATOM   6600 N N   . GLY B 1 322 ? -20.874 -71.440 -19.030 1.00 52.99  ? 323 GLY B N   1 
ATOM   6601 C CA  . GLY B 1 322 ? -20.584 -72.319 -20.151 1.00 45.91  ? 323 GLY B CA  1 
ATOM   6602 C C   . GLY B 1 322 ? -19.150 -72.209 -20.632 1.00 48.80  ? 323 GLY B C   1 
ATOM   6603 O O   . GLY B 1 322 ? -18.755 -72.837 -21.616 1.00 52.54  ? 323 GLY B O   1 
ATOM   6604 N N   . LEU B 1 323 ? -18.370 -71.400 -19.925 1.00 52.82  ? 324 LEU B N   1 
ATOM   6605 C CA  . LEU B 1 323 ? -16.985 -71.147 -20.278 1.00 41.38  ? 324 LEU B CA  1 
ATOM   6606 C C   . LEU B 1 323 ? -16.043 -71.836 -19.303 1.00 39.73  ? 324 LEU B C   1 
ATOM   6607 O O   . LEU B 1 323 ? -16.230 -71.753 -18.087 1.00 44.08  ? 324 LEU B O   1 
ATOM   6608 C CB  . LEU B 1 323 ? -16.715 -69.646 -20.250 1.00 41.26  ? 324 LEU B CB  1 
ATOM   6609 C CG  . LEU B 1 323 ? -15.289 -69.233 -20.601 1.00 42.12  ? 324 LEU B CG  1 
ATOM   6610 C CD1 . LEU B 1 323 ? -15.030 -69.514 -22.076 1.00 42.91  ? 324 LEU B CD1 1 
ATOM   6611 C CD2 . LEU B 1 323 ? -15.062 -67.768 -20.275 1.00 35.27  ? 324 LEU B CD2 1 
ATOM   6612 N N   . GLN B 1 324 ? -15.036 -72.522 -19.835 1.00 38.87  ? 325 GLN B N   1 
ATOM   6613 C CA  . GLN B 1 324 ? -13.954 -73.042 -19.005 1.00 36.11  ? 325 GLN B CA  1 
ATOM   6614 C C   . GLN B 1 324 ? -12.660 -72.296 -19.338 1.00 38.63  ? 325 GLN B C   1 
ATOM   6615 O O   . GLN B 1 324 ? -12.331 -72.090 -20.511 1.00 36.16  ? 325 GLN B O   1 
ATOM   6616 C CB  . GLN B 1 324 ? -13.771 -74.550 -19.186 1.00 38.74  ? 325 GLN B CB  1 
ATOM   6617 C CG  . GLN B 1 324 ? -14.992 -75.389 -18.831 1.00 40.14  ? 325 GLN B CG  1 
ATOM   6618 C CD  . GLN B 1 324 ? -15.899 -75.620 -20.023 1.00 47.51  ? 325 GLN B CD  1 
ATOM   6619 O OE1 . GLN B 1 324 ? -15.451 -75.616 -21.173 1.00 45.42  ? 325 GLN B OE1 1 
ATOM   6620 N NE2 . GLN B 1 324 ? -17.184 -75.810 -19.757 1.00 52.36  ? 325 GLN B NE2 1 
ATOM   6621 N N   . VAL B 1 325 ? -11.941 -71.865 -18.307 1.00 32.92  ? 326 VAL B N   1 
ATOM   6622 C CA  . VAL B 1 325 ? -10.721 -71.093 -18.506 1.00 32.14  ? 326 VAL B CA  1 
ATOM   6623 C C   . VAL B 1 325 ? -9.607  -71.623 -17.630 1.00 31.82  ? 326 VAL B C   1 
ATOM   6624 O O   . VAL B 1 325 ? -9.838  -71.981 -16.474 1.00 37.71  ? 326 VAL B O   1 
ATOM   6625 C CB  . VAL B 1 325 ? -10.923 -69.608 -18.172 1.00 36.91  ? 326 VAL B CB  1 
ATOM   6626 C CG1 . VAL B 1 325 ? -9.787  -68.798 -18.713 1.00 39.15  ? 326 VAL B CG1 1 
ATOM   6627 C CG2 . VAL B 1 325 ? -12.213 -69.099 -18.761 1.00 41.00  ? 326 VAL B CG2 1 
ATOM   6628 N N   . LEU B 1 326 ? -8.399  -71.677 -18.184 1.00 27.97  ? 327 LEU B N   1 
ATOM   6629 C CA  . LEU B 1 326 ? -7.204  -72.029 -17.418 1.00 25.09  ? 327 LEU B CA  1 
ATOM   6630 C C   . LEU B 1 326 ? -6.273  -70.820 -17.427 1.00 31.67  ? 327 LEU B C   1 
ATOM   6631 O O   . LEU B 1 326 ? -5.952  -70.292 -18.490 1.00 29.74  ? 327 LEU B O   1 
ATOM   6632 C CB  . LEU B 1 326 ? -6.518  -73.245 -18.038 1.00 29.85  ? 327 LEU B CB  1 
ATOM   6633 C CG  . LEU B 1 326 ? -5.178  -73.701 -17.456 1.00 33.07  ? 327 LEU B CG  1 
ATOM   6634 C CD1 . LEU B 1 326 ? -5.359  -74.111 -16.035 1.00 35.73  ? 327 LEU B CD1 1 
ATOM   6635 C CD2 . LEU B 1 326 ? -4.631  -74.864 -18.251 1.00 36.33  ? 327 LEU B CD2 1 
ATOM   6636 N N   . VAL B 1 327 ? -5.876  -70.349 -16.246 1.00 33.26  ? 328 VAL B N   1 
ATOM   6637 C CA  . VAL B 1 327 ? -5.039  -69.153 -16.151 1.00 23.63  ? 328 VAL B CA  1 
ATOM   6638 C C   . VAL B 1 327 ? -3.888  -69.378 -15.191 1.00 26.97  ? 328 VAL B C   1 
ATOM   6639 O O   . VAL B 1 327 ? -3.953  -70.240 -14.304 1.00 24.31  ? 328 VAL B O   1 
ATOM   6640 C CB  . VAL B 1 327 ? -5.831  -67.918 -15.679 1.00 29.13  ? 328 VAL B CB  1 
ATOM   6641 C CG1 . VAL B 1 327 ? -7.055  -67.692 -16.555 1.00 22.51  ? 328 VAL B CG1 1 
ATOM   6642 C CG2 . VAL B 1 327 ? -6.224  -68.060 -14.195 1.00 26.33  ? 328 VAL B CG2 1 
ATOM   6643 N N   . GLY B 1 328 ? -2.823  -68.604 -15.360 1.00 22.01  ? 329 GLY B N   1 
ATOM   6644 C CA  . GLY B 1 328 ? -1.695  -68.745 -14.464 1.00 18.12  ? 329 GLY B CA  1 
ATOM   6645 C C   . GLY B 1 328 ? -0.579  -67.759 -14.684 1.00 24.90  ? 329 GLY B C   1 
ATOM   6646 O O   . GLY B 1 328 ? -0.630  -66.920 -15.585 1.00 24.17  ? 329 GLY B O   1 
ATOM   6647 N N   . VAL B 1 329 ? 0.437   -67.865 -13.839 1.00 20.84  ? 330 VAL B N   1 
ATOM   6648 C CA  . VAL B 1 329 ? 1.549   -66.944 -13.859 1.00 18.94  ? 330 VAL B CA  1 
ATOM   6649 C C   . VAL B 1 329 ? 2.793   -67.744 -13.519 1.00 24.95  ? 330 VAL B C   1 
ATOM   6650 O O   . VAL B 1 329 ? 2.684   -68.854 -12.985 1.00 25.56  ? 330 VAL B O   1 
ATOM   6651 C CB  . VAL B 1 329 ? 1.351   -65.821 -12.815 1.00 25.35  ? 330 VAL B CB  1 
ATOM   6652 C CG1 . VAL B 1 329 ? 0.148   -64.950 -13.177 1.00 19.00  ? 330 VAL B CG1 1 
ATOM   6653 C CG2 . VAL B 1 329 ? 1.182   -66.413 -11.397 1.00 22.10  ? 330 VAL B CG2 1 
ATOM   6654 N N   . VAL B 1 330 ? 3.968   -67.210 -13.844 1.00 22.85  ? 331 VAL B N   1 
ATOM   6655 C CA  . VAL B 1 330 ? 5.212   -67.806 -13.368 1.00 21.44  ? 331 VAL B CA  1 
ATOM   6656 C C   . VAL B 1 330 ? 5.537   -67.229 -11.982 1.00 27.42  ? 331 VAL B C   1 
ATOM   6657 O O   . VAL B 1 330 ? 4.911   -66.263 -11.545 1.00 18.66  ? 331 VAL B O   1 
ATOM   6658 C CB  . VAL B 1 330 ? 6.380   -67.555 -14.326 1.00 21.92  ? 331 VAL B CB  1 
ATOM   6659 C CG1 . VAL B 1 330 ? 6.097   -68.180 -15.683 1.00 20.10  ? 331 VAL B CG1 1 
ATOM   6660 C CG2 . VAL B 1 330 ? 6.654   -66.067 -14.460 1.00 19.32  ? 331 VAL B CG2 1 
ATOM   6661 N N   . LYS B 1 331 ? 6.516   -67.814 -11.303 1.00 24.88  ? 332 LYS B N   1 
ATOM   6662 C CA  . LYS B 1 331 ? 6.834   -67.422 -9.932  1.00 29.79  ? 332 LYS B CA  1 
ATOM   6663 C C   . LYS B 1 331 ? 7.380   -65.990 -9.813  1.00 31.90  ? 332 LYS B C   1 
ATOM   6664 O O   . LYS B 1 331 ? 7.176   -65.319 -8.801  1.00 25.71  ? 332 LYS B O   1 
ATOM   6665 C CB  . LYS B 1 331 ? 7.822   -68.418 -9.318  1.00 28.57  ? 332 LYS B CB  1 
ATOM   6666 C CG  . LYS B 1 331 ? 8.107   -68.204 -7.830  1.00 31.61  ? 332 LYS B CG  1 
ATOM   6667 C CD  . LYS B 1 331 ? 8.956   -69.348 -7.270  1.00 36.10  ? 332 LYS B CD  1 
ATOM   6668 C CE  . LYS B 1 331 ? 9.207   -69.200 -5.772  1.00 38.53  ? 332 LYS B CE  1 
ATOM   6669 N NZ  . LYS B 1 331 ? 10.232  -68.166 -5.478  1.00 40.00  ? 332 LYS B NZ  1 
ATOM   6670 N N   . ASP B 1 332 ? 8.067   -65.522 -10.847 1.00 27.15  ? 333 ASP B N   1 
ATOM   6671 C CA  . ASP B 1 332 ? 8.688   -64.202 -10.799 1.00 23.44  ? 333 ASP B CA  1 
ATOM   6672 C C   . ASP B 1 332 ? 8.397   -63.400 -12.068 1.00 31.14  ? 333 ASP B C   1 
ATOM   6673 O O   . ASP B 1 332 ? 9.273   -63.193 -12.915 1.00 29.51  ? 333 ASP B O   1 
ATOM   6674 C CB  . ASP B 1 332 ? 10.184  -64.345 -10.571 1.00 24.44  ? 333 ASP B CB  1 
ATOM   6675 C CG  . ASP B 1 332 ? 10.499  -65.003 -9.240  1.00 33.19  ? 333 ASP B CG  1 
ATOM   6676 O OD1 . ASP B 1 332 ? 10.543  -64.280 -8.222  1.00 31.89  ? 333 ASP B OD1 1 
ATOM   6677 O OD2 . ASP B 1 332 ? 10.693  -66.239 -9.210  1.00 32.82  ? 333 ASP B OD2 1 
ATOM   6678 N N   . GLU B 1 333 ? 7.150   -62.957 -12.182 1.00 23.64  ? 334 GLU B N   1 
ATOM   6679 C CA  . GLU B 1 333 ? 6.682   -62.225 -13.339 1.00 25.52  ? 334 GLU B CA  1 
ATOM   6680 C C   . GLU B 1 333 ? 7.473   -60.950 -13.632 1.00 25.57  ? 334 GLU B C   1 
ATOM   6681 O O   . GLU B 1 333 ? 7.648   -60.588 -14.790 1.00 24.24  ? 334 GLU B O   1 
ATOM   6682 C CB  . GLU B 1 333 ? 5.193   -61.908 -13.174 1.00 20.19  ? 334 GLU B CB  1 
ATOM   6683 C CG  . GLU B 1 333 ? 4.306   -63.135 -13.231 1.00 19.04  ? 334 GLU B CG  1 
ATOM   6684 C CD  . GLU B 1 333 ? 4.203   -63.718 -14.642 1.00 29.21  ? 334 GLU B CD  1 
ATOM   6685 O OE1 . GLU B 1 333 ? 4.724   -63.097 -15.607 1.00 27.06  ? 334 GLU B OE1 1 
ATOM   6686 O OE2 . GLU B 1 333 ? 3.592   -64.801 -14.787 1.00 24.52  ? 334 GLU B OE2 1 
ATOM   6687 N N   . GLY B 1 334 ? 7.970   -60.289 -12.588 1.00 23.83  ? 335 GLY B N   1 
ATOM   6688 C CA  . GLY B 1 334 ? 8.540   -58.960 -12.735 1.00 20.22  ? 335 GLY B CA  1 
ATOM   6689 C C   . GLY B 1 334 ? 10.031  -58.835 -12.992 1.00 25.39  ? 335 GLY B C   1 
ATOM   6690 O O   . GLY B 1 334 ? 10.475  -57.861 -13.607 1.00 24.91  ? 335 GLY B O   1 
ATOM   6691 N N   . SER B 1 335 ? 10.809  -59.807 -12.527 1.00 29.06  ? 336 SER B N   1 
ATOM   6692 C CA  . SER B 1 335 ? 12.272  -59.698 -12.533 1.00 29.02  ? 336 SER B CA  1 
ATOM   6693 C C   . SER B 1 335 ? 12.872  -59.424 -13.922 1.00 31.31  ? 336 SER B C   1 
ATOM   6694 O O   . SER B 1 335 ? 13.770  -58.593 -14.061 1.00 28.64  ? 336 SER B O   1 
ATOM   6695 C CB  . SER B 1 335 ? 12.890  -60.958 -11.944 1.00 27.16  ? 336 SER B CB  1 
ATOM   6696 O OG  . SER B 1 335 ? 12.507  -62.086 -12.710 1.00 28.49  ? 336 SER B OG  1 
ATOM   6697 N N   . TYR B 1 336 ? 12.361  -60.120 -14.936 1.00 27.88  ? 337 TYR B N   1 
ATOM   6698 C CA  . TYR B 1 336 ? 12.849  -60.015 -16.313 1.00 27.00  ? 337 TYR B CA  1 
ATOM   6699 C C   . TYR B 1 336 ? 12.881  -58.571 -16.777 1.00 28.59  ? 337 TYR B C   1 
ATOM   6700 O O   . TYR B 1 336 ? 13.841  -58.122 -17.405 1.00 28.10  ? 337 TYR B O   1 
ATOM   6701 C CB  . TYR B 1 336 ? 11.911  -60.797 -17.226 1.00 25.97  ? 337 TYR B CB  1 
ATOM   6702 C CG  . TYR B 1 336 ? 12.507  -61.342 -18.501 1.00 25.82  ? 337 TYR B CG  1 
ATOM   6703 C CD1 . TYR B 1 336 ? 13.510  -60.660 -19.193 1.00 27.89  ? 337 TYR B CD1 1 
ATOM   6704 C CD2 . TYR B 1 336 ? 12.051  -62.549 -19.023 1.00 25.61  ? 337 TYR B CD2 1 
ATOM   6705 C CE1 . TYR B 1 336 ? 14.040  -61.173 -20.370 1.00 28.60  ? 337 TYR B CE1 1 
ATOM   6706 C CE2 . TYR B 1 336 ? 12.578  -63.074 -20.188 1.00 28.52  ? 337 TYR B CE2 1 
ATOM   6707 C CZ  . TYR B 1 336 ? 13.567  -62.386 -20.862 1.00 30.49  ? 337 TYR B CZ  1 
ATOM   6708 O OH  . TYR B 1 336 ? 14.074  -62.926 -22.024 1.00 26.91  ? 337 TYR B OH  1 
ATOM   6709 N N   . PHE B 1 337 ? 11.825  -57.840 -16.446 1.00 29.36  ? 338 PHE B N   1 
ATOM   6710 C CA  . PHE B 1 337 ? 11.633  -56.495 -16.970 1.00 26.66  ? 338 PHE B CA  1 
ATOM   6711 C C   . PHE B 1 337 ? 12.560  -55.445 -16.377 1.00 25.94  ? 338 PHE B C   1 
ATOM   6712 O O   . PHE B 1 337 ? 12.760  -54.384 -16.975 1.00 23.59  ? 338 PHE B O   1 
ATOM   6713 C CB  . PHE B 1 337 ? 10.170  -56.100 -16.829 1.00 22.33  ? 338 PHE B CB  1 
ATOM   6714 C CG  . PHE B 1 337 ? 9.275   -56.907 -17.700 1.00 21.57  ? 338 PHE B CG  1 
ATOM   6715 C CD1 . PHE B 1 337 ? 8.811   -58.142 -17.275 1.00 25.06  ? 338 PHE B CD1 1 
ATOM   6716 C CD2 . PHE B 1 337 ? 8.962   -56.475 -18.980 1.00 23.63  ? 338 PHE B CD2 1 
ATOM   6717 C CE1 . PHE B 1 337 ? 8.012   -58.914 -18.099 1.00 27.11  ? 338 PHE B CE1 1 
ATOM   6718 C CE2 . PHE B 1 337 ? 8.161   -57.240 -19.812 1.00 23.18  ? 338 PHE B CE2 1 
ATOM   6719 C CZ  . PHE B 1 337 ? 7.689   -58.466 -19.368 1.00 23.32  ? 338 PHE B CZ  1 
ATOM   6720 N N   . LEU B 1 338 ? 13.156  -55.754 -15.230 1.00 19.70  ? 339 LEU B N   1 
ATOM   6721 C CA  . LEU B 1 338 ? 13.945  -54.759 -14.517 1.00 24.67  ? 339 LEU B CA  1 
ATOM   6722 C C   . LEU B 1 338 ? 15.249  -54.396 -15.232 1.00 27.72  ? 339 LEU B C   1 
ATOM   6723 O O   . LEU B 1 338 ? 15.756  -53.289 -15.067 1.00 24.48  ? 339 LEU B O   1 
ATOM   6724 C CB  . LEU B 1 338 ? 14.203  -55.198 -13.072 1.00 24.05  ? 339 LEU B CB  1 
ATOM   6725 C CG  . LEU B 1 338 ? 12.911  -55.477 -12.298 1.00 28.22  ? 339 LEU B CG  1 
ATOM   6726 C CD1 . LEU B 1 338 ? 13.193  -55.910 -10.861 1.00 23.62  ? 339 LEU B CD1 1 
ATOM   6727 C CD2 . LEU B 1 338 ? 11.981  -54.260 -12.351 1.00 23.79  ? 339 LEU B CD2 1 
ATOM   6728 N N   . VAL B 1 339 ? 15.780  -55.307 -16.044 1.00 26.39  ? 340 VAL B N   1 
ATOM   6729 C CA  . VAL B 1 339 ? 17.046  -55.027 -16.712 1.00 27.59  ? 340 VAL B CA  1 
ATOM   6730 C C   . VAL B 1 339 ? 16.835  -54.213 -17.978 1.00 27.96  ? 340 VAL B C   1 
ATOM   6731 O O   . VAL B 1 339 ? 17.775  -53.924 -18.708 1.00 30.01  ? 340 VAL B O   1 
ATOM   6732 C CB  . VAL B 1 339 ? 17.867  -56.306 -17.010 1.00 32.35  ? 340 VAL B CB  1 
ATOM   6733 C CG1 . VAL B 1 339 ? 18.212  -57.008 -15.716 1.00 27.25  ? 340 VAL B CG1 1 
ATOM   6734 C CG2 . VAL B 1 339 ? 17.126  -57.240 -17.981 1.00 29.22  ? 340 VAL B CG2 1 
ATOM   6735 N N   . TYR B 1 340 ? 15.591  -53.829 -18.228 1.00 30.14  ? 341 TYR B N   1 
ATOM   6736 C CA  . TYR B 1 340 ? 15.286  -53.017 -19.392 1.00 25.13  ? 341 TYR B CA  1 
ATOM   6737 C C   . TYR B 1 340 ? 15.058  -51.549 -19.042 1.00 27.06  ? 341 TYR B C   1 
ATOM   6738 O O   . TYR B 1 340 ? 14.468  -50.811 -19.837 1.00 30.55  ? 341 TYR B O   1 
ATOM   6739 C CB  . TYR B 1 340 ? 14.075  -53.590 -20.136 1.00 23.89  ? 341 TYR B CB  1 
ATOM   6740 C CG  . TYR B 1 340 ? 14.411  -54.807 -20.977 1.00 28.41  ? 341 TYR B CG  1 
ATOM   6741 C CD1 . TYR B 1 340 ? 14.663  -54.685 -22.345 1.00 26.96  ? 341 TYR B CD1 1 
ATOM   6742 C CD2 . TYR B 1 340 ? 14.490  -56.073 -20.406 1.00 23.87  ? 341 TYR B CD2 1 
ATOM   6743 C CE1 . TYR B 1 340 ? 14.977  -55.787 -23.118 1.00 23.48  ? 341 TYR B CE1 1 
ATOM   6744 C CE2 . TYR B 1 340 ? 14.806  -57.187 -21.170 1.00 27.85  ? 341 TYR B CE2 1 
ATOM   6745 C CZ  . TYR B 1 340 ? 15.050  -57.037 -22.527 1.00 33.06  ? 341 TYR B CZ  1 
ATOM   6746 O OH  . TYR B 1 340 ? 15.369  -58.137 -23.289 1.00 25.22  ? 341 TYR B OH  1 
ATOM   6747 N N   . GLY B 1 341 ? 15.504  -51.116 -17.862 1.00 25.77  ? 342 GLY B N   1 
ATOM   6748 C CA  . GLY B 1 341 ? 15.346  -49.714 -17.504 1.00 25.90  ? 342 GLY B CA  1 
ATOM   6749 C C   . GLY B 1 341 ? 15.313  -49.309 -16.038 1.00 25.00  ? 342 GLY B C   1 
ATOM   6750 O O   . GLY B 1 341 ? 15.438  -48.129 -15.730 1.00 30.67  ? 342 GLY B O   1 
ATOM   6751 N N   . ALA B 1 342 ? 15.135  -50.251 -15.124 1.00 28.64  ? 343 ALA B N   1 
ATOM   6752 C CA  . ALA B 1 342 ? 15.199  -49.905 -13.703 1.00 26.71  ? 343 ALA B CA  1 
ATOM   6753 C C   . ALA B 1 342 ? 16.650  -49.646 -13.311 1.00 30.37  ? 343 ALA B C   1 
ATOM   6754 O O   . ALA B 1 342 ? 17.519  -50.483 -13.561 1.00 33.02  ? 343 ALA B O   1 
ATOM   6755 C CB  . ALA B 1 342 ? 14.601  -51.010 -12.850 1.00 21.66  ? 343 ALA B CB  1 
ATOM   6756 N N   . PRO B 1 343 ? 16.918  -48.479 -12.705 1.00 32.56  ? 344 PRO B N   1 
ATOM   6757 C CA  . PRO B 1 343 ? 18.278  -48.109 -12.290 1.00 31.22  ? 344 PRO B CA  1 
ATOM   6758 C C   . PRO B 1 343 ? 18.898  -49.135 -11.353 1.00 34.46  ? 344 PRO B C   1 
ATOM   6759 O O   . PRO B 1 343 ? 18.233  -49.619 -10.427 1.00 32.39  ? 344 PRO B O   1 
ATOM   6760 C CB  . PRO B 1 343 ? 18.080  -46.768 -11.562 1.00 30.22  ? 344 PRO B CB  1 
ATOM   6761 C CG  . PRO B 1 343 ? 16.598  -46.679 -11.277 1.00 28.81  ? 344 PRO B CG  1 
ATOM   6762 C CD  . PRO B 1 343 ? 15.939  -47.421 -12.397 1.00 30.66  ? 344 PRO B CD  1 
ATOM   6763 N N   . GLY B 1 344 ? 20.157  -49.476 -11.616 1.00 37.77  ? 345 GLY B N   1 
ATOM   6764 C CA  . GLY B 1 344 ? 20.903  -50.396 -10.776 1.00 35.93  ? 345 GLY B CA  1 
ATOM   6765 C C   . GLY B 1 344 ? 20.840  -51.856 -11.193 1.00 33.39  ? 345 GLY B C   1 
ATOM   6766 O O   . GLY B 1 344 ? 21.533  -52.700 -10.629 1.00 35.87  ? 345 GLY B O   1 
ATOM   6767 N N   . PHE B 1 345 ? 20.011  -52.168 -12.181 1.00 32.58  ? 346 PHE B N   1 
ATOM   6768 C CA  . PHE B 1 345 ? 19.817  -53.566 -12.563 1.00 34.81  ? 346 PHE B CA  1 
ATOM   6769 C C   . PHE B 1 345 ? 20.705  -54.031 -13.712 1.00 35.84  ? 346 PHE B C   1 
ATOM   6770 O O   . PHE B 1 345 ? 20.991  -53.273 -14.649 1.00 41.72  ? 346 PHE B O   1 
ATOM   6771 C CB  . PHE B 1 345 ? 18.345  -53.838 -12.886 1.00 30.77  ? 346 PHE B CB  1 
ATOM   6772 C CG  . PHE B 1 345 ? 17.490  -53.980 -11.673 1.00 29.91  ? 346 PHE B CG  1 
ATOM   6773 C CD1 . PHE B 1 345 ? 17.240  -55.235 -11.132 1.00 24.29  ? 346 PHE B CD1 1 
ATOM   6774 C CD2 . PHE B 1 345 ? 16.957  -52.860 -11.052 1.00 27.90  ? 346 PHE B CD2 1 
ATOM   6775 C CE1 . PHE B 1 345 ? 16.467  -55.377 -10.007 1.00 24.06  ? 346 PHE B CE1 1 
ATOM   6776 C CE2 . PHE B 1 345 ? 16.172  -52.990 -9.921  1.00 28.74  ? 346 PHE B CE2 1 
ATOM   6777 C CZ  . PHE B 1 345 ? 15.927  -54.251 -9.393  1.00 28.90  ? 346 PHE B CZ  1 
ATOM   6778 N N   . SER B 1 346 ? 21.131  -55.288 -13.626 1.00 35.46  ? 347 SER B N   1 
ATOM   6779 C CA  . SER B 1 346 ? 21.905  -55.930 -14.681 1.00 35.21  ? 347 SER B CA  1 
ATOM   6780 C C   . SER B 1 346 ? 21.762  -57.437 -14.555 1.00 32.10  ? 347 SER B C   1 
ATOM   6781 O O   . SER B 1 346 ? 21.656  -57.952 -13.444 1.00 34.98  ? 347 SER B O   1 
ATOM   6782 C CB  . SER B 1 346 ? 23.379  -55.544 -14.561 1.00 39.34  ? 347 SER B CB  1 
ATOM   6783 O OG  . SER B 1 346 ? 24.166  -56.190 -15.546 1.00 43.26  ? 347 SER B OG  1 
ATOM   6784 N N   . LYS B 1 347 ? 21.762  -58.157 -15.675 1.00 29.96  ? 348 LYS B N   1 
ATOM   6785 C CA  . LYS B 1 347 ? 21.802  -59.619 -15.592 1.00 35.16  ? 348 LYS B CA  1 
ATOM   6786 C C   . LYS B 1 347 ? 23.181  -60.086 -15.111 1.00 34.18  ? 348 LYS B C   1 
ATOM   6787 O O   . LYS B 1 347 ? 23.334  -61.193 -14.589 1.00 36.09  ? 348 LYS B O   1 
ATOM   6788 C CB  . LYS B 1 347 ? 21.470  -60.267 -16.940 1.00 35.09  ? 348 LYS B CB  1 
ATOM   6789 C CG  . LYS B 1 347 ? 22.649  -60.356 -17.900 1.00 28.30  ? 348 LYS B CG  1 
ATOM   6790 C CD  . LYS B 1 347 ? 22.250  -60.981 -19.227 1.00 37.74  ? 348 LYS B CD  1 
ATOM   6791 C CE  . LYS B 1 347 ? 23.472  -61.234 -20.137 1.00 35.08  ? 348 LYS B CE  1 
ATOM   6792 N NZ  . LYS B 1 347 ? 24.399  -62.259 -19.546 1.00 33.71  ? 348 LYS B NZ  1 
ATOM   6793 N N   . ASP B 1 348 ? 24.177  -59.220 -15.279 1.00 34.16  ? 349 ASP B N   1 
ATOM   6794 C CA  . ASP B 1 348 ? 25.567  -59.579 -15.020 1.00 35.22  ? 349 ASP B CA  1 
ATOM   6795 C C   . ASP B 1 348 ? 26.032  -59.314 -13.594 1.00 37.89  ? 349 ASP B C   1 
ATOM   6796 O O   . ASP B 1 348 ? 27.150  -59.669 -13.238 1.00 50.32  ? 349 ASP B O   1 
ATOM   6797 C CB  . ASP B 1 348 ? 26.501  -58.887 -16.019 1.00 35.24  ? 349 ASP B CB  1 
ATOM   6798 C CG  . ASP B 1 348 ? 26.300  -59.380 -17.439 1.00 36.26  ? 349 ASP B CG  1 
ATOM   6799 O OD1 . ASP B 1 348 ? 26.049  -60.593 -17.627 1.00 35.97  ? 349 ASP B OD1 1 
ATOM   6800 O OD2 . ASP B 1 348 ? 26.376  -58.548 -18.367 1.00 39.40  ? 349 ASP B OD2 1 
ATOM   6801 N N   . ASN B 1 349 ? 25.194  -58.688 -12.775 1.00 39.07  ? 350 ASN B N   1 
ATOM   6802 C CA  . ASN B 1 349 ? 25.479  -58.649 -11.337 1.00 37.73  ? 350 ASN B CA  1 
ATOM   6803 C C   . ASN B 1 349 ? 24.254  -58.955 -10.477 1.00 35.09  ? 350 ASN B C   1 
ATOM   6804 O O   . ASN B 1 349 ? 23.182  -59.265 -10.996 1.00 37.91  ? 350 ASN B O   1 
ATOM   6805 C CB  . ASN B 1 349 ? 26.232  -57.368 -10.892 1.00 31.85  ? 350 ASN B CB  1 
ATOM   6806 C CG  . ASN B 1 349 ? 25.420  -56.081 -11.068 1.00 38.25  ? 350 ASN B CG  1 
ATOM   6807 O OD1 . ASN B 1 349 ? 24.201  -56.061 -10.887 1.00 43.57  ? 350 ASN B OD1 1 
ATOM   6808 N ND2 . ASN B 1 349 ? 26.119  -54.988 -11.400 1.00 48.04  ? 350 ASN B ND2 1 
ATOM   6809 N N   . GLU B 1 350 ? 24.427  -58.884 -9.165  1.00 35.97  ? 351 GLU B N   1 
ATOM   6810 C CA  . GLU B 1 350 ? 23.379  -59.272 -8.233  1.00 36.37  ? 351 GLU B CA  1 
ATOM   6811 C C   . GLU B 1 350 ? 22.225  -58.277 -8.181  1.00 34.69  ? 351 GLU B C   1 
ATOM   6812 O O   . GLU B 1 350 ? 21.178  -58.577 -7.608  1.00 37.23  ? 351 GLU B O   1 
ATOM   6813 C CB  . GLU B 1 350 ? 23.964  -59.481 -6.832  1.00 36.85  ? 351 GLU B CB  1 
ATOM   6814 C CG  . GLU B 1 350 ? 24.726  -60.784 -6.691  1.00 40.81  ? 351 GLU B CG  1 
ATOM   6815 C CD  . GLU B 1 350 ? 23.849  -61.979 -6.992  1.00 55.93  ? 351 GLU B CD  1 
ATOM   6816 O OE1 . GLU B 1 350 ? 23.895  -62.480 -8.137  1.00 51.72  ? 351 GLU B OE1 1 
ATOM   6817 O OE2 . GLU B 1 350 ? 23.099  -62.406 -6.085  1.00 59.57  ? 351 GLU B OE2 1 
ATOM   6818 N N   . SER B 1 351 ? 22.413  -57.105 -8.782  1.00 33.51  ? 352 SER B N   1 
ATOM   6819 C CA  . SER B 1 351 ? 21.370  -56.081 -8.800  1.00 36.40  ? 352 SER B CA  1 
ATOM   6820 C C   . SER B 1 351 ? 20.887  -55.743 -7.387  1.00 32.61  ? 352 SER B C   1 
ATOM   6821 O O   . SER B 1 351 ? 19.695  -55.562 -7.149  1.00 32.66  ? 352 SER B O   1 
ATOM   6822 C CB  . SER B 1 351 ? 20.192  -56.515 -9.681  1.00 30.73  ? 352 SER B CB  1 
ATOM   6823 O OG  . SER B 1 351 ? 20.544  -56.474 -11.053 1.00 31.06  ? 352 SER B OG  1 
ATOM   6824 N N   . LEU B 1 352 ? 21.829  -55.672 -6.455  1.00 34.25  ? 353 LEU B N   1 
ATOM   6825 C CA  . LEU B 1 352 ? 21.532  -55.305 -5.081  1.00 33.96  ? 353 LEU B CA  1 
ATOM   6826 C C   . LEU B 1 352 ? 21.389  -53.787 -4.971  1.00 35.31  ? 353 LEU B C   1 
ATOM   6827 O O   . LEU B 1 352 ? 22.338  -53.092 -4.613  1.00 43.16  ? 353 LEU B O   1 
ATOM   6828 C CB  . LEU B 1 352 ? 22.642  -55.810 -4.167  1.00 26.43  ? 353 LEU B CB  1 
ATOM   6829 C CG  . LEU B 1 352 ? 22.801  -57.332 -4.118  1.00 33.89  ? 353 LEU B CG  1 
ATOM   6830 C CD1 . LEU B 1 352 ? 24.126  -57.741 -3.465  1.00 28.58  ? 353 LEU B CD1 1 
ATOM   6831 C CD2 . LEU B 1 352 ? 21.630  -57.962 -3.383  1.00 30.29  ? 353 LEU B CD2 1 
ATOM   6832 N N   . ILE B 1 353 ? 20.193  -53.282 -5.268  1.00 27.52  ? 354 ILE B N   1 
ATOM   6833 C CA  . ILE B 1 353 ? 19.959  -51.841 -5.384  1.00 28.11  ? 354 ILE B CA  1 
ATOM   6834 C C   . ILE B 1 353 ? 19.840  -51.078 -4.060  1.00 32.00  ? 354 ILE B C   1 
ATOM   6835 O O   . ILE B 1 353 ? 19.541  -51.645 -3.004  1.00 27.22  ? 354 ILE B O   1 
ATOM   6836 C CB  . ILE B 1 353 ? 18.687  -51.559 -6.209  1.00 31.54  ? 354 ILE B CB  1 
ATOM   6837 C CG1 . ILE B 1 353 ? 17.462  -52.164 -5.504  1.00 26.08  ? 354 ILE B CG1 1 
ATOM   6838 C CG2 . ILE B 1 353 ? 18.850  -52.106 -7.624  1.00 24.82  ? 354 ILE B CG2 1 
ATOM   6839 C CD1 . ILE B 1 353 ? 16.152  -51.899 -6.192  1.00 22.65  ? 354 ILE B CD1 1 
ATOM   6840 N N   . SER B 1 354 ? 20.065  -49.773 -4.140  1.00 32.04  ? 355 SER B N   1 
ATOM   6841 C CA  . SER B 1 354 ? 19.894  -48.894 -2.994  1.00 29.74  ? 355 SER B CA  1 
ATOM   6842 C C   . SER B 1 354 ? 18.430  -48.478 -2.862  1.00 34.02  ? 355 SER B C   1 
ATOM   6843 O O   . SER B 1 354 ? 17.620  -48.660 -3.785  1.00 29.16  ? 355 SER B O   1 
ATOM   6844 C CB  . SER B 1 354 ? 20.760  -47.645 -3.157  1.00 28.48  ? 355 SER B CB  1 
ATOM   6845 O OG  . SER B 1 354 ? 20.303  -46.837 -4.241  1.00 32.43  ? 355 SER B OG  1 
ATOM   6846 N N   . ARG B 1 355 ? 18.100  -47.895 -1.717  1.00 28.21  ? 356 ARG B N   1 
ATOM   6847 C CA  . ARG B 1 355 ? 16.760  -47.389 -1.486  1.00 27.48  ? 356 ARG B CA  1 
ATOM   6848 C C   . ARG B 1 355 ? 16.413  -46.331 -2.526  1.00 31.02  ? 356 ARG B C   1 
ATOM   6849 O O   . ARG B 1 355 ? 15.309  -46.317 -3.075  1.00 29.85  ? 356 ARG B O   1 
ATOM   6850 C CB  . ARG B 1 355 ? 16.661  -46.811 -0.084  1.00 34.76  ? 356 ARG B CB  1 
ATOM   6851 C CG  . ARG B 1 355 ? 15.339  -46.174 0.217   1.00 34.12  ? 356 ARG B CG  1 
ATOM   6852 C CD  . ARG B 1 355 ? 14.319  -47.202 0.602   1.00 37.40  ? 356 ARG B CD  1 
ATOM   6853 N NE  . ARG B 1 355 ? 13.040  -46.589 0.939   1.00 37.71  ? 356 ARG B NE  1 
ATOM   6854 C CZ  . ARG B 1 355 ? 11.927  -47.281 1.132   1.00 29.30  ? 356 ARG B CZ  1 
ATOM   6855 N NH1 . ARG B 1 355 ? 11.957  -48.602 1.024   1.00 26.23  ? 356 ARG B NH1 1 
ATOM   6856 N NH2 . ARG B 1 355 ? 10.796  -46.658 1.425   1.00 28.19  ? 356 ARG B NH2 1 
ATOM   6857 N N   . ALA B 1 356 ? 17.369  -45.459 -2.818  1.00 30.60  ? 357 ALA B N   1 
ATOM   6858 C CA  . ALA B 1 356 ? 17.143  -44.420 -3.812  1.00 29.12  ? 357 ALA B CA  1 
ATOM   6859 C C   . ALA B 1 356 ? 16.828  -45.017 -5.186  1.00 30.08  ? 357 ALA B C   1 
ATOM   6860 O O   . ALA B 1 356 ? 15.975  -44.501 -5.918  1.00 29.44  ? 357 ALA B O   1 
ATOM   6861 C CB  . ALA B 1 356 ? 18.342  -43.502 -3.889  1.00 25.35  ? 357 ALA B CB  1 
ATOM   6862 N N   . GLU B 1 357 ? 17.517  -46.103 -5.529  1.00 25.17  ? 358 GLU B N   1 
ATOM   6863 C CA  . GLU B 1 357 ? 17.314  -46.759 -6.814  1.00 29.16  ? 358 GLU B CA  1 
ATOM   6864 C C   . GLU B 1 357 ? 15.969  -47.470 -6.845  1.00 30.60  ? 358 GLU B C   1 
ATOM   6865 O O   . GLU B 1 357 ? 15.305  -47.521 -7.880  1.00 27.93  ? 358 GLU B O   1 
ATOM   6866 C CB  . GLU B 1 357 ? 18.446  -47.751 -7.111  1.00 31.58  ? 358 GLU B CB  1 
ATOM   6867 C CG  . GLU B 1 357 ? 19.754  -47.084 -7.494  1.00 32.50  ? 358 GLU B CG  1 
ATOM   6868 C CD  . GLU B 1 357 ? 20.909  -48.069 -7.607  1.00 42.56  ? 358 GLU B CD  1 
ATOM   6869 O OE1 . GLU B 1 357 ? 20.893  -49.095 -6.887  1.00 36.80  ? 358 GLU B OE1 1 
ATOM   6870 O OE2 . GLU B 1 357 ? 21.829  -47.812 -8.420  1.00 39.38  ? 358 GLU B OE2 1 
ATOM   6871 N N   . PHE B 1 358 ? 15.575  -48.022 -5.701  1.00 29.91  ? 359 PHE B N   1 
ATOM   6872 C CA  . PHE B 1 358 ? 14.261  -48.620 -5.562  1.00 26.50  ? 359 PHE B CA  1 
ATOM   6873 C C   . PHE B 1 358 ? 13.161  -47.591 -5.831  1.00 29.63  ? 359 PHE B C   1 
ATOM   6874 O O   . PHE B 1 358 ? 12.237  -47.857 -6.605  1.00 25.91  ? 359 PHE B O   1 
ATOM   6875 C CB  . PHE B 1 358 ? 14.092  -49.217 -4.165  1.00 27.19  ? 359 PHE B CB  1 
ATOM   6876 C CG  . PHE B 1 358 ? 12.688  -49.651 -3.857  1.00 27.28  ? 359 PHE B CG  1 
ATOM   6877 C CD1 . PHE B 1 358 ? 12.204  -50.864 -4.321  1.00 24.82  ? 359 PHE B CD1 1 
ATOM   6878 C CD2 . PHE B 1 358 ? 11.849  -48.843 -3.098  1.00 28.15  ? 359 PHE B CD2 1 
ATOM   6879 C CE1 . PHE B 1 358 ? 10.905  -51.264 -4.034  1.00 26.80  ? 359 PHE B CE1 1 
ATOM   6880 C CE2 . PHE B 1 358 ? 10.556  -49.237 -2.803  1.00 25.30  ? 359 PHE B CE2 1 
ATOM   6881 C CZ  . PHE B 1 358 ? 10.084  -50.451 -3.268  1.00 28.75  ? 359 PHE B CZ  1 
ATOM   6882 N N   . LEU B 1 359 ? 13.267  -46.429 -5.183  1.00 27.94  ? 360 LEU B N   1 
ATOM   6883 C CA  . LEU B 1 359 ? 12.271  -45.368 -5.315  1.00 26.18  ? 360 LEU B CA  1 
ATOM   6884 C C   . LEU B 1 359 ? 12.172  -44.900 -6.753  1.00 30.70  ? 360 LEU B C   1 
ATOM   6885 O O   . LEU B 1 359 ? 11.078  -44.651 -7.255  1.00 34.75  ? 360 LEU B O   1 
ATOM   6886 C CB  . LEU B 1 359 ? 12.595  -44.178 -4.406  1.00 24.86  ? 360 LEU B CB  1 
ATOM   6887 C CG  . LEU B 1 359 ? 12.581  -44.403 -2.885  1.00 29.90  ? 360 LEU B CG  1 
ATOM   6888 C CD1 . LEU B 1 359 ? 12.902  -43.112 -2.144  1.00 24.56  ? 360 LEU B CD1 1 
ATOM   6889 C CD2 . LEU B 1 359 ? 11.253  -44.974 -2.406  1.00 24.65  ? 360 LEU B CD2 1 
ATOM   6890 N N   . ALA B 1 360 ? 13.316  -44.782 -7.417  1.00 30.59  ? 361 ALA B N   1 
ATOM   6891 C CA  . ALA B 1 360 ? 13.331  -44.373 -8.812  1.00 29.15  ? 361 ALA B CA  1 
ATOM   6892 C C   . ALA B 1 360 ? 12.737  -45.464 -9.691  1.00 32.33  ? 361 ALA B C   1 
ATOM   6893 O O   . ALA B 1 360 ? 12.024  -45.174 -10.647 1.00 35.63  ? 361 ALA B O   1 
ATOM   6894 C CB  . ALA B 1 360 ? 14.743  -44.041 -9.261  1.00 29.67  ? 361 ALA B CB  1 
ATOM   6895 N N   . GLY B 1 361 ? 13.039  -46.717 -9.364  1.00 32.48  ? 362 GLY B N   1 
ATOM   6896 C CA  . GLY B 1 361 ? 12.517  -47.852 -10.103 1.00 25.27  ? 362 GLY B CA  1 
ATOM   6897 C C   . GLY B 1 361 ? 11.002  -47.923 -10.044 1.00 25.58  ? 362 GLY B C   1 
ATOM   6898 O O   . GLY B 1 361 ? 10.348  -48.287 -11.023 1.00 26.74  ? 362 GLY B O   1 
ATOM   6899 N N   . VAL B 1 362 ? 10.441  -47.561 -8.896  1.00 27.98  ? 363 VAL B N   1 
ATOM   6900 C CA  . VAL B 1 362 ? 8.990   -47.544 -8.729  1.00 26.41  ? 363 VAL B CA  1 
ATOM   6901 C C   . VAL B 1 362 ? 8.290   -46.670 -9.785  1.00 26.35  ? 363 VAL B C   1 
ATOM   6902 O O   . VAL B 1 362 ? 7.282   -47.091 -10.361 1.00 26.87  ? 363 VAL B O   1 
ATOM   6903 C CB  . VAL B 1 362 ? 8.593   -47.154 -7.279  1.00 26.15  ? 363 VAL B CB  1 
ATOM   6904 C CG1 . VAL B 1 362 ? 7.106   -46.759 -7.181  1.00 20.01  ? 363 VAL B CG1 1 
ATOM   6905 C CG2 . VAL B 1 362 ? 8.907   -48.303 -6.332  1.00 18.33  ? 363 VAL B CG2 1 
ATOM   6906 N N   . ARG B 1 363 ? 8.840   -45.486 -10.068 1.00 23.60  ? 364 ARG B N   1 
ATOM   6907 C CA  . ARG B 1 363 ? 8.263   -44.604 -11.092 1.00 32.94  ? 364 ARG B CA  1 
ATOM   6908 C C   . ARG B 1 363 ? 8.444   -45.171 -12.499 1.00 30.91  ? 364 ARG B C   1 
ATOM   6909 O O   . ARG B 1 363 ? 7.665   -44.874 -13.402 1.00 28.03  ? 364 ARG B O   1 
ATOM   6910 C CB  . ARG B 1 363 ? 8.862   -43.186 -11.055 1.00 30.08  ? 364 ARG B CB  1 
ATOM   6911 C CG  . ARG B 1 363 ? 8.771   -42.459 -9.735  1.00 29.72  ? 364 ARG B CG  1 
ATOM   6912 C CD  . ARG B 1 363 ? 7.402   -42.614 -9.085  1.00 33.92  ? 364 ARG B CD  1 
ATOM   6913 N NE  . ARG B 1 363 ? 6.322   -41.852 -9.724  1.00 36.98  ? 364 ARG B NE  1 
ATOM   6914 C CZ  . ARG B 1 363 ? 5.955   -40.623 -9.363  1.00 33.30  ? 364 ARG B CZ  1 
ATOM   6915 N NH1 . ARG B 1 363 ? 6.608   -39.986 -8.393  1.00 29.80  ? 364 ARG B NH1 1 
ATOM   6916 N NH2 . ARG B 1 363 ? 4.943   -40.021 -9.976  1.00 30.37  ? 364 ARG B NH2 1 
ATOM   6917 N N   . VAL B 1 364 ? 9.493   -45.963 -12.689 1.00 31.10  ? 365 VAL B N   1 
ATOM   6918 C CA  . VAL B 1 364 ? 9.742   -46.580 -13.987 1.00 32.71  ? 365 VAL B CA  1 
ATOM   6919 C C   . VAL B 1 364 ? 8.781   -47.743 -14.188 1.00 29.38  ? 365 VAL B C   1 
ATOM   6920 O O   . VAL B 1 364 ? 8.237   -47.932 -15.278 1.00 23.49  ? 365 VAL B O   1 
ATOM   6921 C CB  . VAL B 1 364 ? 11.201  -47.071 -14.107 1.00 31.61  ? 365 VAL B CB  1 
ATOM   6922 C CG1 . VAL B 1 364 ? 11.414  -47.833 -15.415 1.00 25.90  ? 365 VAL B CG1 1 
ATOM   6923 C CG2 . VAL B 1 364 ? 12.161  -45.883 -14.005 1.00 30.88  ? 365 VAL B CG2 1 
ATOM   6924 N N   . GLY B 1 365 ? 8.560   -48.499 -13.113 1.00 25.64  ? 366 GLY B N   1 
ATOM   6925 C CA  . GLY B 1 365 ? 7.723   -49.685 -13.155 1.00 23.53  ? 366 GLY B CA  1 
ATOM   6926 C C   . GLY B 1 365 ? 6.244   -49.386 -13.050 1.00 25.84  ? 366 GLY B C   1 
ATOM   6927 O O   . GLY B 1 365 ? 5.400   -50.212 -13.395 1.00 27.41  ? 366 GLY B O   1 
ATOM   6928 N N   . VAL B 1 366 ? 5.918   -48.204 -12.548 1.00 27.48  ? 367 VAL B N   1 
ATOM   6929 C CA  . VAL B 1 366 ? 4.529   -47.785 -12.471 1.00 29.02  ? 367 VAL B CA  1 
ATOM   6930 C C   . VAL B 1 366 ? 4.471   -46.378 -13.040 1.00 30.25  ? 367 VAL B C   1 
ATOM   6931 O O   . VAL B 1 366 ? 4.270   -45.407 -12.303 1.00 27.74  ? 367 VAL B O   1 
ATOM   6932 C CB  . VAL B 1 366 ? 3.991   -47.809 -11.011 1.00 31.92  ? 367 VAL B CB  1 
ATOM   6933 C CG1 . VAL B 1 366 ? 2.469   -47.741 -10.997 1.00 22.78  ? 367 VAL B CG1 1 
ATOM   6934 C CG2 . VAL B 1 366 ? 4.456   -49.060 -10.297 1.00 23.18  ? 367 VAL B CG2 1 
ATOM   6935 N N   . PRO B 1 367 ? 4.652   -46.263 -14.368 1.00 28.47  ? 368 PRO B N   1 
ATOM   6936 C CA  . PRO B 1 367 ? 4.803   -44.944 -14.979 1.00 25.40  ? 368 PRO B CA  1 
ATOM   6937 C C   . PRO B 1 367 ? 3.474   -44.207 -15.098 1.00 30.46  ? 368 PRO B C   1 
ATOM   6938 O O   . PRO B 1 367 ? 2.397   -44.826 -15.091 1.00 31.50  ? 368 PRO B O   1 
ATOM   6939 C CB  . PRO B 1 367 ? 5.374   -45.274 -16.362 1.00 33.74  ? 368 PRO B CB  1 
ATOM   6940 C CG  . PRO B 1 367 ? 4.782   -46.606 -16.687 1.00 32.11  ? 368 PRO B CG  1 
ATOM   6941 C CD  . PRO B 1 367 ? 4.709   -47.346 -15.370 1.00 27.78  ? 368 PRO B CD  1 
ATOM   6942 N N   . GLN B 1 368 ? 3.565   -42.884 -15.191 1.00 26.00  ? 369 GLN B N   1 
ATOM   6943 C CA  . GLN B 1 368 ? 2.394   -42.023 -15.366 1.00 36.14  ? 369 GLN B CA  1 
ATOM   6944 C C   . GLN B 1 368 ? 1.275   -42.180 -14.327 1.00 39.83  ? 369 GLN B C   1 
ATOM   6945 O O   . GLN B 1 368 ? 0.094   -42.264 -14.680 1.00 33.27  ? 369 GLN B O   1 
ATOM   6946 C CB  . GLN B 1 368 ? 1.828   -42.174 -16.774 1.00 35.60  ? 369 GLN B CB  1 
ATOM   6947 C CG  . GLN B 1 368 ? 2.726   -41.586 -17.842 1.00 36.55  ? 369 GLN B CG  1 
ATOM   6948 C CD  . GLN B 1 368 ? 1.981   -41.305 -19.128 1.00 43.60  ? 369 GLN B CD  1 
ATOM   6949 O OE1 . GLN B 1 368 ? 1.377   -42.201 -19.725 1.00 40.27  ? 369 GLN B OE1 1 
ATOM   6950 N NE2 . GLN B 1 368 ? 2.005   -40.048 -19.556 1.00 40.48  ? 369 GLN B NE2 1 
ATOM   6951 N N   . VAL B 1 369 ? 1.651   -42.216 -13.050 1.00 37.42  ? 370 VAL B N   1 
ATOM   6952 C CA  . VAL B 1 369 ? 0.679   -42.099 -11.968 1.00 26.86  ? 370 VAL B CA  1 
ATOM   6953 C C   . VAL B 1 369 ? 1.093   -40.948 -11.064 1.00 28.69  ? 370 VAL B C   1 
ATOM   6954 O O   . VAL B 1 369 ? 2.237   -40.490 -11.108 1.00 32.13  ? 370 VAL B O   1 
ATOM   6955 C CB  . VAL B 1 369 ? 0.540   -43.396 -11.145 1.00 29.08  ? 370 VAL B CB  1 
ATOM   6956 C CG1 . VAL B 1 369 ? 0.125   -44.549 -12.035 1.00 28.22  ? 370 VAL B CG1 1 
ATOM   6957 C CG2 . VAL B 1 369 ? 1.835   -43.719 -10.404 1.00 23.49  ? 370 VAL B CG2 1 
ATOM   6958 N N   . SER B 1 370 ? 0.163   -40.485 -10.239 1.00 34.33  ? 371 SER B N   1 
ATOM   6959 C CA  . SER B 1 370 ? 0.417   -39.349 -9.358  1.00 31.55  ? 371 SER B CA  1 
ATOM   6960 C C   . SER B 1 370 ? 1.482   -39.665 -8.314  1.00 29.82  ? 371 SER B C   1 
ATOM   6961 O O   . SER B 1 370 ? 1.736   -40.833 -8.005  1.00 29.29  ? 371 SER B O   1 
ATOM   6962 C CB  . SER B 1 370 ? -0.878  -38.929 -8.665  1.00 35.03  ? 371 SER B CB  1 
ATOM   6963 O OG  . SER B 1 370 ? -1.357  -39.958 -7.812  1.00 35.54  ? 371 SER B OG  1 
ATOM   6964 N N   . ASP B 1 371 ? 2.108   -38.622 -7.776  1.00 29.40  ? 372 ASP B N   1 
ATOM   6965 C CA  . ASP B 1 371 ? 3.057   -38.802 -6.686  1.00 32.07  ? 372 ASP B CA  1 
ATOM   6966 C C   . ASP B 1 371 ? 2.388   -39.534 -5.524  1.00 31.95  ? 372 ASP B C   1 
ATOM   6967 O O   . ASP B 1 371 ? 3.000   -40.382 -4.879  1.00 33.24  ? 372 ASP B O   1 
ATOM   6968 C CB  . ASP B 1 371 ? 3.639   -37.462 -6.227  1.00 34.89  ? 372 ASP B CB  1 
ATOM   6969 C CG  . ASP B 1 371 ? 4.486   -36.791 -7.299  1.00 43.33  ? 372 ASP B CG  1 
ATOM   6970 O OD1 . ASP B 1 371 ? 4.802   -37.440 -8.324  1.00 39.61  ? 372 ASP B OD1 1 
ATOM   6971 O OD2 . ASP B 1 371 ? 4.839   -35.608 -7.120  1.00 53.75  ? 372 ASP B OD2 1 
ATOM   6972 N N   . LEU B 1 372 ? 1.120   -39.233 -5.283  1.00 28.79  ? 373 LEU B N   1 
ATOM   6973 C CA  . LEU B 1 372 ? 0.400   -39.895 -4.206  1.00 36.16  ? 373 LEU B CA  1 
ATOM   6974 C C   . LEU B 1 372 ? 0.291   -41.396 -4.476  1.00 32.93  ? 373 LEU B C   1 
ATOM   6975 O O   . LEU B 1 372 ? 0.518   -42.219 -3.576  1.00 27.55  ? 373 LEU B O   1 
ATOM   6976 C CB  . LEU B 1 372 ? -0.986  -39.277 -4.000  1.00 28.93  ? 373 LEU B CB  1 
ATOM   6977 C CG  . LEU B 1 372 ? -1.750  -39.936 -2.846  1.00 33.01  ? 373 LEU B CG  1 
ATOM   6978 C CD1 . LEU B 1 372 ? -1.159  -39.526 -1.511  1.00 27.44  ? 373 LEU B CD1 1 
ATOM   6979 C CD2 . LEU B 1 372 ? -3.237  -39.618 -2.904  1.00 32.20  ? 373 LEU B CD2 1 
ATOM   6980 N N   . ALA B 1 373 ? -0.053  -41.742 -5.717  1.00 29.77  ? 374 ALA B N   1 
ATOM   6981 C CA  . ALA B 1 373 ? -0.162  -43.144 -6.129  1.00 29.37  ? 374 ALA B CA  1 
ATOM   6982 C C   . ALA B 1 373 ? 1.160   -43.881 -5.914  1.00 24.58  ? 374 ALA B C   1 
ATOM   6983 O O   . ALA B 1 373 ? 1.193   -44.968 -5.335  1.00 24.99  ? 374 ALA B O   1 
ATOM   6984 C CB  . ALA B 1 373 ? -0.605  -43.245 -7.591  1.00 31.43  ? 374 ALA B CB  1 
ATOM   6985 N N   . ALA B 1 374 ? 2.248   -43.265 -6.358  1.00 22.79  ? 375 ALA B N   1 
ATOM   6986 C CA  . ALA B 1 374 ? 3.582   -43.826 -6.155  1.00 26.56  ? 375 ALA B CA  1 
ATOM   6987 C C   . ALA B 1 374 ? 3.883   -44.030 -4.667  1.00 31.51  ? 375 ALA B C   1 
ATOM   6988 O O   . ALA B 1 374 ? 4.392   -45.089 -4.272  1.00 31.21  ? 375 ALA B O   1 
ATOM   6989 C CB  . ALA B 1 374 ? 4.633   -42.940 -6.799  1.00 23.95  ? 375 ALA B CB  1 
ATOM   6990 N N   . GLU B 1 375 ? 3.562   -43.028 -3.847  1.00 28.19  ? 376 GLU B N   1 
ATOM   6991 C CA  . GLU B 1 375 ? 3.777   -43.128 -2.406  1.00 30.79  ? 376 GLU B CA  1 
ATOM   6992 C C   . GLU B 1 375 ? 3.010   -44.321 -1.846  1.00 29.03  ? 376 GLU B C   1 
ATOM   6993 O O   . GLU B 1 375 ? 3.515   -45.042 -0.990  1.00 28.55  ? 376 GLU B O   1 
ATOM   6994 C CB  . GLU B 1 375 ? 3.357   -41.844 -1.682  1.00 33.63  ? 376 GLU B CB  1 
ATOM   6995 C CG  . GLU B 1 375 ? 4.169   -40.601 -2.039  1.00 34.73  ? 376 GLU B CG  1 
ATOM   6996 C CD  . GLU B 1 375 ? 5.550   -40.572 -1.400  1.00 49.78  ? 376 GLU B CD  1 
ATOM   6997 O OE1 . GLU B 1 375 ? 5.938   -41.562 -0.737  1.00 48.45  ? 376 GLU B OE1 1 
ATOM   6998 O OE2 . GLU B 1 375 ? 6.249   -39.545 -1.559  1.00 52.46  ? 376 GLU B OE2 1 
ATOM   6999 N N   . ALA B 1 376 ? 1.795   -44.533 -2.345  1.00 28.35  ? 377 ALA B N   1 
ATOM   7000 C CA  . ALA B 1 376 ? 1.003   -45.686 -1.931  1.00 26.48  ? 377 ALA B CA  1 
ATOM   7001 C C   . ALA B 1 376 ? 1.697   -47.002 -2.290  1.00 28.19  ? 377 ALA B C   1 
ATOM   7002 O O   . ALA B 1 376 ? 1.645   -47.960 -1.520  1.00 29.16  ? 377 ALA B O   1 
ATOM   7003 C CB  . ALA B 1 376 ? -0.399  -45.628 -2.534  1.00 25.39  ? 377 ALA B CB  1 
ATOM   7004 N N   . VAL B 1 377 ? 2.346   -47.045 -3.454  1.00 26.36  ? 378 VAL B N   1 
ATOM   7005 C CA  . VAL B 1 377 ? 3.097   -48.230 -3.858  1.00 24.18  ? 378 VAL B CA  1 
ATOM   7006 C C   . VAL B 1 377 ? 4.298   -48.471 -2.932  1.00 23.74  ? 378 VAL B C   1 
ATOM   7007 O O   . VAL B 1 377 ? 4.553   -49.594 -2.498  1.00 23.36  ? 378 VAL B O   1 
ATOM   7008 C CB  . VAL B 1 377 ? 3.595   -48.138 -5.328  1.00 25.24  ? 378 VAL B CB  1 
ATOM   7009 C CG1 . VAL B 1 377 ? 4.465   -49.347 -5.669  1.00 20.34  ? 378 VAL B CG1 1 
ATOM   7010 C CG2 . VAL B 1 377 ? 2.427   -48.019 -6.299  1.00 17.06  ? 378 VAL B CG2 1 
ATOM   7011 N N   . VAL B 1 378 ? 5.036   -47.408 -2.642  1.00 26.03  ? 379 VAL B N   1 
ATOM   7012 C CA  . VAL B 1 378 ? 6.187   -47.491 -1.749  1.00 28.93  ? 379 VAL B CA  1 
ATOM   7013 C C   . VAL B 1 378 ? 5.781   -47.983 -0.359  1.00 31.09  ? 379 VAL B C   1 
ATOM   7014 O O   . VAL B 1 378 ? 6.460   -48.818 0.231   1.00 29.73  ? 379 VAL B O   1 
ATOM   7015 C CB  . VAL B 1 378 ? 6.901   -46.134 -1.645  1.00 30.38  ? 379 VAL B CB  1 
ATOM   7016 C CG1 . VAL B 1 378 ? 7.928   -46.152 -0.535  1.00 28.53  ? 379 VAL B CG1 1 
ATOM   7017 C CG2 . VAL B 1 378 ? 7.552   -45.800 -2.970  1.00 24.15  ? 379 VAL B CG2 1 
ATOM   7018 N N   . LEU B 1 379 ? 4.656   -47.485 0.138   1.00 27.60  ? 380 LEU B N   1 
ATOM   7019 C CA  . LEU B 1 379 ? 4.117   -47.930 1.411   1.00 28.76  ? 380 LEU B CA  1 
ATOM   7020 C C   . LEU B 1 379 ? 3.907   -49.436 1.454   1.00 32.05  ? 380 LEU B C   1 
ATOM   7021 O O   . LEU B 1 379 ? 4.379   -50.119 2.370   1.00 31.56  ? 380 LEU B O   1 
ATOM   7022 C CB  . LEU B 1 379 ? 2.772   -47.253 1.699   1.00 26.02  ? 380 LEU B CB  1 
ATOM   7023 C CG  . LEU B 1 379 ? 2.105   -47.832 2.955   1.00 33.10  ? 380 LEU B CG  1 
ATOM   7024 C CD1 . LEU B 1 379 ? 2.882   -47.445 4.217   1.00 21.15  ? 380 LEU B CD1 1 
ATOM   7025 C CD2 . LEU B 1 379 ? 0.646   -47.421 3.057   1.00 32.26  ? 380 LEU B CD2 1 
ATOM   7026 N N   A HIS B 1 380 ? 3.204   -49.960 0.458   0.51 30.36  ? 381 HIS B N   1 
ATOM   7027 N N   B HIS B 1 380 ? 3.187   -49.946 0.461   0.49 30.33  ? 381 HIS B N   1 
ATOM   7028 C CA  A HIS B 1 380 ? 2.813   -51.366 0.474   0.51 29.80  ? 381 HIS B CA  1 
ATOM   7029 C CA  B HIS B 1 380 ? 2.812   -51.352 0.439   0.49 29.77  ? 381 HIS B CA  1 
ATOM   7030 C C   A HIS B 1 380 ? 3.953   -52.332 0.153   0.51 29.56  ? 381 HIS B C   1 
ATOM   7031 C C   B HIS B 1 380 ? 4.034   -52.258 0.307   0.49 29.48  ? 381 HIS B C   1 
ATOM   7032 O O   A HIS B 1 380 ? 3.887   -53.505 0.522   0.51 31.23  ? 381 HIS B O   1 
ATOM   7033 O O   B HIS B 1 380 ? 4.110   -53.299 0.960   0.49 30.51  ? 381 HIS B O   1 
ATOM   7034 C CB  A HIS B 1 380 ? 1.600   -51.605 -0.439  0.51 28.16  ? 381 HIS B CB  1 
ATOM   7035 C CB  B HIS B 1 380 ? 1.808   -51.630 -0.691  0.49 27.80  ? 381 HIS B CB  1 
ATOM   7036 C CG  A HIS B 1 380 ? 0.339   -50.979 0.075   0.51 32.09  ? 381 HIS B CG  1 
ATOM   7037 C CG  B HIS B 1 380 ? 1.116   -52.952 -0.568  0.49 29.08  ? 381 HIS B CG  1 
ATOM   7038 N ND1 A HIS B 1 380 ? -0.442  -51.571 1.045   0.51 29.75  ? 381 HIS B ND1 1 
ATOM   7039 N ND1 B HIS B 1 380 ? -0.102  -53.104 0.060   0.49 29.97  ? 381 HIS B ND1 1 
ATOM   7040 C CD2 A HIS B 1 380 ? -0.258  -49.800 -0.221  0.51 30.55  ? 381 HIS B CD2 1 
ATOM   7041 C CD2 B HIS B 1 380 ? 1.483   -54.188 -0.980  0.49 29.70  ? 381 HIS B CD2 1 
ATOM   7042 C CE1 A HIS B 1 380 ? -1.471  -50.789 1.315   0.51 29.94  ? 381 HIS B CE1 1 
ATOM   7043 C CE1 B HIS B 1 380 ? -0.457  -54.376 0.027   0.49 30.55  ? 381 HIS B CE1 1 
ATOM   7044 N NE2 A HIS B 1 380 ? -1.385  -49.710 0.558   0.51 30.60  ? 381 HIS B NE2 1 
ATOM   7045 N NE2 B HIS B 1 380 ? 0.491   -55.057 -0.593  0.49 32.70  ? 381 HIS B NE2 1 
ATOM   7046 N N   . TYR B 1 381 ? 4.996   -51.846 -0.519  1.00 26.39  ? 382 TYR B N   1 
ATOM   7047 C CA  . TYR B 1 381 ? 6.126   -52.713 -0.877  1.00 25.18  ? 382 TYR B CA  1 
ATOM   7048 C C   . TYR B 1 381 ? 7.405   -52.492 -0.066  1.00 28.17  ? 382 TYR B C   1 
ATOM   7049 O O   . TYR B 1 381 ? 8.404   -53.159 -0.289  1.00 30.47  ? 382 TYR B O   1 
ATOM   7050 C CB  . TYR B 1 381 ? 6.413   -52.672 -2.389  1.00 20.63  ? 382 TYR B CB  1 
ATOM   7051 C CG  . TYR B 1 381 ? 5.357   -53.402 -3.175  1.00 25.37  ? 382 TYR B CG  1 
ATOM   7052 C CD1 . TYR B 1 381 ? 5.525   -54.736 -3.536  1.00 20.04  ? 382 TYR B CD1 1 
ATOM   7053 C CD2 . TYR B 1 381 ? 4.168   -52.768 -3.526  1.00 24.01  ? 382 TYR B CD2 1 
ATOM   7054 C CE1 . TYR B 1 381 ? 4.543   -55.412 -4.238  1.00 20.08  ? 382 TYR B CE1 1 
ATOM   7055 C CE2 . TYR B 1 381 ? 3.184   -53.433 -4.226  1.00 22.08  ? 382 TYR B CE2 1 
ATOM   7056 C CZ  . TYR B 1 381 ? 3.374   -54.749 -4.580  1.00 22.45  ? 382 TYR B CZ  1 
ATOM   7057 O OH  . TYR B 1 381 ? 2.382   -55.398 -5.272  1.00 23.75  ? 382 TYR B OH  1 
ATOM   7058 N N   . THR B 1 382 ? 7.371   -51.568 0.881   1.00 26.58  ? 383 THR B N   1 
ATOM   7059 C CA  . THR B 1 382 ? 8.499   -51.391 1.777   1.00 27.43  ? 383 THR B CA  1 
ATOM   7060 C C   . THR B 1 382 ? 8.305   -52.228 3.039   1.00 28.86  ? 383 THR B C   1 
ATOM   7061 O O   . THR B 1 382 ? 7.210   -52.262 3.601   1.00 28.52  ? 383 THR B O   1 
ATOM   7062 C CB  . THR B 1 382 ? 8.660   -49.912 2.138   1.00 31.06  ? 383 THR B CB  1 
ATOM   7063 O OG1 . THR B 1 382 ? 9.037   -49.184 0.958   1.00 26.07  ? 383 THR B OG1 1 
ATOM   7064 C CG2 . THR B 1 382 ? 9.713   -49.724 3.229   1.00 26.91  ? 383 THR B CG2 1 
ATOM   7065 N N   . ASP B 1 383 ? 9.350   -52.939 3.457   1.00 29.33  ? 384 ASP B N   1 
ATOM   7066 C CA  . ASP B 1 383 ? 9.349   -53.593 4.764   1.00 27.11  ? 384 ASP B CA  1 
ATOM   7067 C C   . ASP B 1 383 ? 9.932   -52.575 5.731   1.00 29.42  ? 384 ASP B C   1 
ATOM   7068 O O   . ASP B 1 383 ? 11.116  -52.254 5.660   1.00 25.44  ? 384 ASP B O   1 
ATOM   7069 C CB  . ASP B 1 383 ? 10.204  -54.866 4.748   1.00 31.51  ? 384 ASP B CB  1 
ATOM   7070 C CG  . ASP B 1 383 ? 10.213  -55.601 6.104   1.00 37.51  ? 384 ASP B CG  1 
ATOM   7071 O OD1 . ASP B 1 383 ? 9.859   -55.000 7.147   1.00 30.80  ? 384 ASP B OD1 1 
ATOM   7072 O OD2 . ASP B 1 383 ? 10.587  -56.794 6.126   1.00 34.44  ? 384 ASP B OD2 1 
ATOM   7073 N N   . TRP B 1 384 ? 9.107   -52.058 6.633   1.00 25.85  ? 385 TRP B N   1 
ATOM   7074 C CA  . TRP B 1 384 ? 9.546   -50.933 7.447   1.00 26.80  ? 385 TRP B CA  1 
ATOM   7075 C C   . TRP B 1 384 ? 10.453  -51.314 8.624   1.00 29.73  ? 385 TRP B C   1 
ATOM   7076 O O   . TRP B 1 384 ? 10.935  -50.446 9.356   1.00 28.59  ? 385 TRP B O   1 
ATOM   7077 C CB  . TRP B 1 384 ? 8.357   -50.068 7.860   1.00 26.78  ? 385 TRP B CB  1 
ATOM   7078 C CG  . TRP B 1 384 ? 7.707   -49.468 6.661   1.00 27.65  ? 385 TRP B CG  1 
ATOM   7079 C CD1 . TRP B 1 384 ? 6.634   -49.960 5.971   1.00 24.47  ? 385 TRP B CD1 1 
ATOM   7080 C CD2 . TRP B 1 384 ? 8.125   -48.289 5.967   1.00 28.70  ? 385 TRP B CD2 1 
ATOM   7081 N NE1 . TRP B 1 384 ? 6.342   -49.141 4.905   1.00 27.50  ? 385 TRP B NE1 1 
ATOM   7082 C CE2 . TRP B 1 384 ? 7.243   -48.109 4.879   1.00 26.50  ? 385 TRP B CE2 1 
ATOM   7083 C CE3 . TRP B 1 384 ? 9.153   -47.361 6.166   1.00 28.00  ? 385 TRP B CE3 1 
ATOM   7084 C CZ2 . TRP B 1 384 ? 7.363   -47.046 3.988   1.00 28.06  ? 385 TRP B CZ2 1 
ATOM   7085 C CZ3 . TRP B 1 384 ? 9.262   -46.298 5.292   1.00 31.94  ? 385 TRP B CZ3 1 
ATOM   7086 C CH2 . TRP B 1 384 ? 8.372   -46.150 4.211   1.00 28.90  ? 385 TRP B CH2 1 
ATOM   7087 N N   . LEU B 1 385 ? 10.703  -52.608 8.782   1.00 28.59  ? 386 LEU B N   1 
ATOM   7088 C CA  . LEU B 1 385 ? 11.749  -53.071 9.690   1.00 29.44  ? 386 LEU B CA  1 
ATOM   7089 C C   . LEU B 1 385 ? 13.083  -53.207 8.949   1.00 33.62  ? 386 LEU B C   1 
ATOM   7090 O O   . LEU B 1 385 ? 14.143  -53.231 9.571   1.00 30.93  ? 386 LEU B O   1 
ATOM   7091 C CB  . LEU B 1 385 ? 11.356  -54.398 10.338  1.00 29.05  ? 386 LEU B CB  1 
ATOM   7092 C CG  . LEU B 1 385 ? 10.207  -54.292 11.349  1.00 35.56  ? 386 LEU B CG  1 
ATOM   7093 C CD1 . LEU B 1 385 ? 9.858   -55.654 11.947  1.00 32.88  ? 386 LEU B CD1 1 
ATOM   7094 C CD2 . LEU B 1 385 ? 10.564  -53.302 12.442  1.00 30.58  ? 386 LEU B CD2 1 
ATOM   7095 N N   . HIS B 1 386 ? 13.015  -53.297 7.619   1.00 28.95  ? 387 HIS B N   1 
ATOM   7096 C CA  . HIS B 1 386 ? 14.206  -53.376 6.769   1.00 31.30  ? 387 HIS B CA  1 
ATOM   7097 C C   . HIS B 1 386 ? 14.049  -52.488 5.528   1.00 33.64  ? 387 HIS B C   1 
ATOM   7098 O O   . HIS B 1 386 ? 14.043  -52.986 4.407   1.00 30.08  ? 387 HIS B O   1 
ATOM   7099 C CB  . HIS B 1 386 ? 14.452  -54.821 6.321   1.00 31.96  ? 387 HIS B CB  1 
ATOM   7100 C CG  . HIS B 1 386 ? 14.484  -55.810 7.445   1.00 31.18  ? 387 HIS B CG  1 
ATOM   7101 N ND1 . HIS B 1 386 ? 15.600  -56.011 8.228   1.00 32.40  ? 387 HIS B ND1 1 
ATOM   7102 C CD2 . HIS B 1 386 ? 13.538  -56.658 7.914   1.00 34.11  ? 387 HIS B CD2 1 
ATOM   7103 C CE1 . HIS B 1 386 ? 15.339  -56.934 9.137   1.00 30.89  ? 387 HIS B CE1 1 
ATOM   7104 N NE2 . HIS B 1 386 ? 14.093  -57.340 8.972   1.00 37.63  ? 387 HIS B NE2 1 
ATOM   7105 N N   . PRO B 1 387 ? 13.921  -51.164 5.723   1.00 39.64  ? 388 PRO B N   1 
ATOM   7106 C CA  . PRO B 1 387 ? 13.574  -50.310 4.579   1.00 26.17  ? 388 PRO B CA  1 
ATOM   7107 C C   . PRO B 1 387 ? 14.687  -50.173 3.546   1.00 30.26  ? 388 PRO B C   1 
ATOM   7108 O O   . PRO B 1 387 ? 14.415  -49.745 2.418   1.00 33.47  ? 388 PRO B O   1 
ATOM   7109 C CB  . PRO B 1 387 ? 13.291  -48.950 5.231   1.00 29.34  ? 388 PRO B CB  1 
ATOM   7110 C CG  . PRO B 1 387 ? 14.109  -48.961 6.487   1.00 30.07  ? 388 PRO B CG  1 
ATOM   7111 C CD  . PRO B 1 387 ? 14.082  -50.387 6.969   1.00 27.55  ? 388 PRO B CD  1 
ATOM   7112 N N   . GLU B 1 388 ? 15.911  -50.540 3.905   1.00 30.94  ? 389 GLU B N   1 
ATOM   7113 C CA  . GLU B 1 388 ? 17.041  -50.289 3.012   1.00 32.99  ? 389 GLU B CA  1 
ATOM   7114 C C   . GLU B 1 388 ? 17.857  -51.513 2.627   1.00 28.89  ? 389 GLU B C   1 
ATOM   7115 O O   . GLU B 1 388 ? 18.927  -51.381 2.057   1.00 31.68  ? 389 GLU B O   1 
ATOM   7116 C CB  . GLU B 1 388 ? 17.947  -49.215 3.605   1.00 34.40  ? 389 GLU B CB  1 
ATOM   7117 C CG  . GLU B 1 388 ? 17.226  -47.899 3.739   1.00 35.46  ? 389 GLU B CG  1 
ATOM   7118 C CD  . GLU B 1 388 ? 18.131  -46.786 4.149   1.00 48.61  ? 389 GLU B CD  1 
ATOM   7119 O OE1 . GLU B 1 388 ? 18.470  -46.714 5.350   1.00 69.29  ? 389 GLU B OE1 1 
ATOM   7120 O OE2 . GLU B 1 388 ? 18.498  -45.980 3.268   1.00 64.55  ? 389 GLU B OE2 1 
ATOM   7121 N N   . ASP B 1 389 ? 17.344  -52.700 2.922   1.00 26.99  ? 390 ASP B N   1 
ATOM   7122 C CA  . ASP B 1 389 ? 18.066  -53.921 2.611   1.00 29.87  ? 390 ASP B CA  1 
ATOM   7123 C C   . ASP B 1 389 ? 18.041  -54.215 1.104   1.00 31.62  ? 390 ASP B C   1 
ATOM   7124 O O   . ASP B 1 389 ? 16.993  -54.532 0.544   1.00 28.79  ? 390 ASP B O   1 
ATOM   7125 C CB  . ASP B 1 389 ? 17.474  -55.087 3.388   1.00 27.58  ? 390 ASP B CB  1 
ATOM   7126 C CG  . ASP B 1 389 ? 18.156  -56.386 3.066   1.00 39.86  ? 390 ASP B CG  1 
ATOM   7127 O OD1 . ASP B 1 389 ? 19.389  -56.362 2.883   1.00 47.77  ? 390 ASP B OD1 1 
ATOM   7128 O OD2 . ASP B 1 389 ? 17.469  -57.424 2.980   1.00 43.47  ? 390 ASP B OD2 1 
ATOM   7129 N N   . PRO B 1 390 ? 19.206  -54.123 0.450   1.00 32.27  ? 391 PRO B N   1 
ATOM   7130 C CA  . PRO B 1 390 ? 19.320  -54.241 -1.013  1.00 28.54  ? 391 PRO B CA  1 
ATOM   7131 C C   . PRO B 1 390 ? 18.596  -55.449 -1.623  1.00 28.84  ? 391 PRO B C   1 
ATOM   7132 O O   . PRO B 1 390 ? 17.854  -55.272 -2.590  1.00 27.81  ? 391 PRO B O   1 
ATOM   7133 C CB  . PRO B 1 390 ? 20.828  -54.346 -1.235  1.00 30.60  ? 391 PRO B CB  1 
ATOM   7134 C CG  . PRO B 1 390 ? 21.415  -53.596 -0.061  1.00 31.03  ? 391 PRO B CG  1 
ATOM   7135 C CD  . PRO B 1 390 ? 20.519  -53.948 1.096   1.00 25.13  ? 391 PRO B CD  1 
ATOM   7136 N N   . ALA B 1 391 ? 18.782  -56.642 -1.067  1.00 27.02  ? 392 ALA B N   1 
ATOM   7137 C CA  . ALA B 1 391 ? 18.167  -57.834 -1.649  1.00 31.90  ? 392 ALA B CA  1 
ATOM   7138 C C   . ALA B 1 391 ? 16.650  -57.759 -1.588  1.00 33.07  ? 392 ALA B C   1 
ATOM   7139 O O   . ALA B 1 391 ? 15.962  -58.091 -2.559  1.00 32.61  ? 392 ALA B O   1 
ATOM   7140 C CB  . ALA B 1 391 ? 18.668  -59.097 -0.965  1.00 25.11  ? 392 ALA B CB  1 
ATOM   7141 N N   . ARG B 1 392 ? 16.141  -57.313 -0.443  1.00 31.26  ? 393 ARG B N   1 
ATOM   7142 C CA  . ARG B 1 392 ? 14.709  -57.145 -0.229  1.00 30.81  ? 393 ARG B CA  1 
ATOM   7143 C C   . ARG B 1 392 ? 14.121  -56.102 -1.170  1.00 30.51  ? 393 ARG B C   1 
ATOM   7144 O O   . ARG B 1 392 ? 13.013  -56.276 -1.677  1.00 29.21  ? 393 ARG B O   1 
ATOM   7145 C CB  . ARG B 1 392 ? 14.426  -56.738 1.218   1.00 25.68  ? 393 ARG B CB  1 
ATOM   7146 C CG  . ARG B 1 392 ? 14.360  -57.886 2.212   1.00 26.47  ? 393 ARG B CG  1 
ATOM   7147 C CD  . ARG B 1 392 ? 14.128  -57.299 3.603   1.00 31.51  ? 393 ARG B CD  1 
ATOM   7148 N NE  . ARG B 1 392 ? 13.927  -58.279 4.664   1.00 27.46  ? 393 ARG B NE  1 
ATOM   7149 C CZ  . ARG B 1 392 ? 14.896  -58.736 5.452   1.00 34.51  ? 393 ARG B CZ  1 
ATOM   7150 N NH1 . ARG B 1 392 ? 16.145  -58.318 5.284   1.00 37.63  ? 393 ARG B NH1 1 
ATOM   7151 N NH2 . ARG B 1 392 ? 14.617  -59.611 6.410   1.00 34.50  ? 393 ARG B NH2 1 
ATOM   7152 N N   . LEU B 1 393 ? 14.859  -55.013 -1.375  1.00 25.52  ? 394 LEU B N   1 
ATOM   7153 C CA  . LEU B 1 393 ? 14.463  -53.963 -2.311  1.00 26.39  ? 394 LEU B CA  1 
ATOM   7154 C C   . LEU B 1 393 ? 14.384  -54.498 -3.740  1.00 32.95  ? 394 LEU B C   1 
ATOM   7155 O O   . LEU B 1 393 ? 13.431  -54.215 -4.468  1.00 30.60  ? 394 LEU B O   1 
ATOM   7156 C CB  . LEU B 1 393 ? 15.448  -52.791 -2.238  1.00 28.44  ? 394 LEU B CB  1 
ATOM   7157 C CG  . LEU B 1 393 ? 15.390  -51.949 -0.953  1.00 33.32  ? 394 LEU B CG  1 
ATOM   7158 C CD1 . LEU B 1 393 ? 16.622  -51.082 -0.830  1.00 29.42  ? 394 LEU B CD1 1 
ATOM   7159 C CD2 . LEU B 1 393 ? 14.152  -51.070 -0.961  1.00 26.42  ? 394 LEU B CD2 1 
ATOM   7160 N N   . ARG B 1 394 ? 15.387  -55.278 -4.133  1.00 32.55  ? 395 ARG B N   1 
ATOM   7161 C CA  . ARG B 1 394 ? 15.398  -55.931 -5.439  1.00 30.38  ? 395 ARG B CA  1 
ATOM   7162 C C   . ARG B 1 394 ? 14.165  -56.819 -5.625  1.00 28.27  ? 395 ARG B C   1 
ATOM   7163 O O   . ARG B 1 394 ? 13.476  -56.737 -6.641  1.00 27.63  ? 395 ARG B O   1 
ATOM   7164 C CB  . ARG B 1 394 ? 16.682  -56.753 -5.609  1.00 27.36  ? 395 ARG B CB  1 
ATOM   7165 C CG  . ARG B 1 394 ? 16.859  -57.382 -6.973  1.00 32.67  ? 395 ARG B CG  1 
ATOM   7166 C CD  . ARG B 1 394 ? 17.980  -58.407 -6.965  1.00 29.03  ? 395 ARG B CD  1 
ATOM   7167 N NE  . ARG B 1 394 ? 17.708  -59.484 -6.022  1.00 35.31  ? 395 ARG B NE  1 
ATOM   7168 C CZ  . ARG B 1 394 ? 18.647  -60.239 -5.460  1.00 32.75  ? 395 ARG B CZ  1 
ATOM   7169 N NH1 . ARG B 1 394 ? 19.923  -60.039 -5.747  1.00 34.04  ? 395 ARG B NH1 1 
ATOM   7170 N NH2 . ARG B 1 394 ? 18.309  -61.190 -4.611  1.00 31.00  ? 395 ARG B NH2 1 
ATOM   7171 N N   . GLU B 1 395 ? 13.890  -57.666 -4.640  1.00 28.58  ? 396 GLU B N   1 
ATOM   7172 C CA  . GLU B 1 395 ? 12.728  -58.546 -4.699  1.00 30.94  ? 396 GLU B CA  1 
ATOM   7173 C C   . GLU B 1 395 ? 11.430  -57.733 -4.715  1.00 27.98  ? 396 GLU B C   1 
ATOM   7174 O O   . GLU B 1 395 ? 10.489  -58.068 -5.434  1.00 27.15  ? 396 GLU B O   1 
ATOM   7175 C CB  . GLU B 1 395 ? 12.729  -59.521 -3.517  1.00 31.01  ? 396 GLU B CB  1 
ATOM   7176 C CG  . GLU B 1 395 ? 13.145  -60.952 -3.838  1.00 39.31  ? 396 GLU B CG  1 
ATOM   7177 C CD  . GLU B 1 395 ? 14.627  -61.092 -4.169  1.00 48.24  ? 396 GLU B CD  1 
ATOM   7178 O OE1 . GLU B 1 395 ? 15.038  -60.699 -5.291  1.00 53.59  ? 396 GLU B OE1 1 
ATOM   7179 O OE2 . GLU B 1 395 ? 15.380  -61.607 -3.312  1.00 42.58  ? 396 GLU B OE2 1 
ATOM   7180 N N   . ALA B 1 396 ? 11.395  -56.661 -3.928  1.00 26.29  ? 397 ALA B N   1 
ATOM   7181 C CA  . ALA B 1 396 ? 10.223  -55.788 -3.858  1.00 30.93  ? 397 ALA B CA  1 
ATOM   7182 C C   . ALA B 1 396 ? 9.907   -55.125 -5.191  1.00 25.53  ? 397 ALA B C   1 
ATOM   7183 O O   . ALA B 1 396 ? 8.756   -55.122 -5.625  1.00 29.16  ? 397 ALA B O   1 
ATOM   7184 C CB  . ALA B 1 396 ? 10.390  -54.725 -2.765  1.00 24.49  ? 397 ALA B CB  1 
ATOM   7185 N N   . LEU B 1 397 ? 10.916  -54.556 -5.839  1.00 23.96  ? 398 LEU B N   1 
ATOM   7186 C CA  . LEU B 1 397 ? 10.680  -53.922 -7.133  1.00 27.78  ? 398 LEU B CA  1 
ATOM   7187 C C   . LEU B 1 397 ? 10.170  -54.938 -8.143  1.00 24.34  ? 398 LEU B C   1 
ATOM   7188 O O   . LEU B 1 397 ? 9.278   -54.632 -8.939  1.00 27.75  ? 398 LEU B O   1 
ATOM   7189 C CB  . LEU B 1 397 ? 11.928  -53.220 -7.673  1.00 30.65  ? 398 LEU B CB  1 
ATOM   7190 C CG  . LEU B 1 397 ? 11.581  -52.298 -8.847  1.00 28.65  ? 398 LEU B CG  1 
ATOM   7191 C CD1 . LEU B 1 397 ? 10.492  -51.304 -8.429  1.00 25.44  ? 398 LEU B CD1 1 
ATOM   7192 C CD2 . LEU B 1 397 ? 12.800  -51.569 -9.362  1.00 25.10  ? 398 LEU B CD2 1 
ATOM   7193 N N   . SER B 1 398 ? 10.732  -56.144 -8.097  1.00 27.24  ? 399 SER B N   1 
ATOM   7194 C CA  . SER B 1 398 ? 10.259  -57.246 -8.929  1.00 27.01  ? 399 SER B CA  1 
ATOM   7195 C C   . SER B 1 398 ? 8.774   -57.504 -8.710  1.00 27.85  ? 399 SER B C   1 
ATOM   7196 O O   . SER B 1 398 ? 8.008   -57.626 -9.673  1.00 29.22  ? 399 SER B O   1 
ATOM   7197 C CB  . SER B 1 398 ? 11.037  -58.531 -8.651  1.00 24.62  ? 399 SER B CB  1 
ATOM   7198 O OG  . SER B 1 398 ? 10.545  -59.583 -9.474  1.00 26.26  ? 399 SER B OG  1 
ATOM   7199 N N   . ASP B 1 399 ? 8.375   -57.583 -7.445  1.00 20.84  ? 400 ASP B N   1 
ATOM   7200 C CA  . ASP B 1 399 ? 6.985   -57.821 -7.089  1.00 21.35  ? 400 ASP B CA  1 
ATOM   7201 C C   . ASP B 1 399 ? 6.098   -56.692 -7.580  1.00 23.05  ? 400 ASP B C   1 
ATOM   7202 O O   . ASP B 1 399 ? 5.012   -56.943 -8.101  1.00 23.53  ? 400 ASP B O   1 
ATOM   7203 C CB  . ASP B 1 399 ? 6.816   -57.966 -5.569  1.00 28.93  ? 400 ASP B CB  1 
ATOM   7204 C CG  . ASP B 1 399 ? 7.335   -59.290 -5.043  1.00 32.59  ? 400 ASP B CG  1 
ATOM   7205 O OD1 . ASP B 1 399 ? 7.418   -60.252 -5.836  1.00 42.72  ? 400 ASP B OD1 1 
ATOM   7206 O OD2 . ASP B 1 399 ? 7.653   -59.372 -3.831  1.00 42.49  ? 400 ASP B OD2 1 
ATOM   7207 N N   . VAL B 1 400 ? 6.547   -55.451 -7.405  1.00 20.32  ? 401 VAL B N   1 
ATOM   7208 C CA  . VAL B 1 400 ? 5.789   -54.308 -7.912  1.00 24.20  ? 401 VAL B CA  1 
ATOM   7209 C C   . VAL B 1 400 ? 5.466   -54.470 -9.401  1.00 24.80  ? 401 VAL B C   1 
ATOM   7210 O O   . VAL B 1 400 ? 4.295   -54.435 -9.807  1.00 20.11  ? 401 VAL B O   1 
ATOM   7211 C CB  . VAL B 1 400 ? 6.542   -52.975 -7.711  1.00 27.05  ? 401 VAL B CB  1 
ATOM   7212 C CG1 . VAL B 1 400 ? 5.863   -51.861 -8.496  1.00 21.23  ? 401 VAL B CG1 1 
ATOM   7213 C CG2 . VAL B 1 400 ? 6.617   -52.622 -6.232  1.00 20.25  ? 401 VAL B CG2 1 
ATOM   7214 N N   . VAL B 1 401 ? 6.505   -54.672 -10.206 1.00 24.55  ? 402 VAL B N   1 
ATOM   7215 C CA  . VAL B 1 401 ? 6.336   -54.769 -11.654 1.00 24.41  ? 402 VAL B CA  1 
ATOM   7216 C C   . VAL B 1 401 ? 5.502   -55.998 -12.013 1.00 24.45  ? 402 VAL B C   1 
ATOM   7217 O O   . VAL B 1 401 ? 4.579   -55.923 -12.831 1.00 22.97  ? 402 VAL B O   1 
ATOM   7218 C CB  . VAL B 1 401 ? 7.704   -54.797 -12.372 1.00 24.47  ? 402 VAL B CB  1 
ATOM   7219 C CG1 . VAL B 1 401 ? 7.539   -55.133 -13.838 1.00 21.21  ? 402 VAL B CG1 1 
ATOM   7220 C CG2 . VAL B 1 401 ? 8.407   -53.457 -12.203 1.00 24.30  ? 402 VAL B CG2 1 
ATOM   7221 N N   . GLY B 1 402 ? 5.799   -57.120 -11.362 1.00 24.54  ? 403 GLY B N   1 
ATOM   7222 C CA  . GLY B 1 402 ? 5.090   -58.359 -11.630 1.00 20.22  ? 403 GLY B CA  1 
ATOM   7223 C C   . GLY B 1 402 ? 3.640   -58.333 -11.198 1.00 25.15  ? 403 GLY B C   1 
ATOM   7224 O O   . GLY B 1 402 ? 2.777   -58.817 -11.930 1.00 25.60  ? 403 GLY B O   1 
ATOM   7225 N N   . ASP B 1 403 ? 3.361   -57.782 -10.011 1.00 22.98  ? 404 ASP B N   1 
ATOM   7226 C CA  . ASP B 1 403 ? 1.984   -57.735 -9.498  1.00 21.43  ? 404 ASP B CA  1 
ATOM   7227 C C   . ASP B 1 403 ? 1.114   -56.841 -10.353 1.00 20.96  ? 404 ASP B C   1 
ATOM   7228 O O   . ASP B 1 403 ? 0.030   -57.229 -10.783 1.00 23.66  ? 404 ASP B O   1 
ATOM   7229 C CB  . ASP B 1 403 ? 1.929   -57.221 -8.047  1.00 23.05  ? 404 ASP B CB  1 
ATOM   7230 C CG  . ASP B 1 403 ? 2.597   -58.165 -7.060  1.00 21.97  ? 404 ASP B CG  1 
ATOM   7231 O OD1 . ASP B 1 403 ? 2.954   -59.295 -7.451  1.00 29.68  ? 404 ASP B OD1 1 
ATOM   7232 O OD2 . ASP B 1 403 ? 2.776   -57.774 -5.894  1.00 28.39  ? 404 ASP B OD2 1 
ATOM   7233 N N   . HIS B 1 404 ? 1.608   -55.628 -10.568 1.00 23.34  ? 405 HIS B N   1 
ATOM   7234 C CA  . HIS B 1 404 ? 0.907   -54.577 -11.290 1.00 21.67  ? 405 HIS B CA  1 
ATOM   7235 C C   . HIS B 1 404 ? 0.618   -54.973 -12.741 1.00 24.95  ? 405 HIS B C   1 
ATOM   7236 O O   . HIS B 1 404 ? -0.497  -54.773 -13.236 1.00 21.31  ? 405 HIS B O   1 
ATOM   7237 C CB  . HIS B 1 404 ? 1.753   -53.301 -11.219 1.00 21.10  ? 405 HIS B CB  1 
ATOM   7238 C CG  . HIS B 1 404 ? 1.314   -52.208 -12.140 1.00 25.79  ? 405 HIS B CG  1 
ATOM   7239 N ND1 . HIS B 1 404 ? 0.048   -51.661 -12.107 1.00 28.56  ? 405 HIS B ND1 1 
ATOM   7240 C CD2 . HIS B 1 404 ? 1.988   -51.536 -13.105 1.00 29.41  ? 405 HIS B CD2 1 
ATOM   7241 C CE1 . HIS B 1 404 ? -0.040  -50.706 -13.016 1.00 24.34  ? 405 HIS B CE1 1 
ATOM   7242 N NE2 . HIS B 1 404 ? 1.122   -50.611 -13.637 1.00 30.37  ? 405 HIS B NE2 1 
ATOM   7243 N N   . ASN B 1 405 ? 1.608   -55.550 -13.418 1.00 22.46  ? 406 ASN B N   1 
ATOM   7244 C CA  . ASN B 1 405 ? 1.439   -55.891 -14.837 1.00 23.54  ? 406 ASN B CA  1 
ATOM   7245 C C   . ASN B 1 405 ? 0.786   -57.249 -15.138 1.00 22.43  ? 406 ASN B C   1 
ATOM   7246 O O   . ASN B 1 405 ? 0.094   -57.374 -16.141 1.00 20.99  ? 406 ASN B O   1 
ATOM   7247 C CB  . ASN B 1 405 ? 2.762   -55.756 -15.609 1.00 16.04  ? 406 ASN B CB  1 
ATOM   7248 C CG  . ASN B 1 405 ? 3.220   -54.311 -15.740 1.00 23.71  ? 406 ASN B CG  1 
ATOM   7249 O OD1 . ASN B 1 405 ? 2.598   -53.517 -16.442 1.00 23.43  ? 406 ASN B OD1 1 
ATOM   7250 N ND2 . ASN B 1 405 ? 4.328   -53.967 -15.079 1.00 22.94  ? 406 ASN B ND2 1 
ATOM   7251 N N   . VAL B 1 406 ? 0.999   -58.254 -14.285 1.00 19.14  ? 407 VAL B N   1 
ATOM   7252 C CA  . VAL B 1 406 ? 0.566   -59.622 -14.602 1.00 21.86  ? 407 VAL B CA  1 
ATOM   7253 C C   . VAL B 1 406 ? -0.300  -60.322 -13.542 1.00 23.23  ? 407 VAL B C   1 
ATOM   7254 O O   . VAL B 1 406 ? -1.452  -60.678 -13.815 1.00 24.17  ? 407 VAL B O   1 
ATOM   7255 C CB  . VAL B 1 406 ? 1.776   -60.552 -14.917 1.00 23.96  ? 407 VAL B CB  1 
ATOM   7256 C CG1 . VAL B 1 406 ? 1.292   -61.949 -15.285 1.00 20.22  ? 407 VAL B CG1 1 
ATOM   7257 C CG2 . VAL B 1 406 ? 2.620   -59.981 -16.037 1.00 26.56  ? 407 VAL B CG2 1 
ATOM   7258 N N   . VAL B 1 407 ? 0.256   -60.543 -12.350 1.00 19.99  ? 408 VAL B N   1 
ATOM   7259 C CA  . VAL B 1 407 ? -0.435  -61.338 -11.325 1.00 21.73  ? 408 VAL B CA  1 
ATOM   7260 C C   . VAL B 1 407 ? -1.801  -60.765 -10.947 1.00 25.64  ? 408 VAL B C   1 
ATOM   7261 O O   . VAL B 1 407 ? -2.810  -61.476 -10.961 1.00 28.55  ? 408 VAL B O   1 
ATOM   7262 C CB  . VAL B 1 407 ? 0.403   -61.503 -10.036 1.00 30.02  ? 408 VAL B CB  1 
ATOM   7263 C CG1 . VAL B 1 407 ? -0.321  -62.420 -9.053  1.00 21.03  ? 408 VAL B CG1 1 
ATOM   7264 C CG2 . VAL B 1 407 ? 1.808   -62.037 -10.360 1.00 20.56  ? 408 VAL B CG2 1 
ATOM   7265 N N   . CYS B 1 408 ? -1.849  -59.480 -10.626 1.00 21.52  ? 409 CYS B N   1 
ATOM   7266 C CA  . CYS B 1 408 ? -3.118  -58.885 -10.214 1.00 21.20  ? 409 CYS B CA  1 
ATOM   7267 C C   . CYS B 1 408 ? -4.170  -58.762 -11.345 1.00 26.40  ? 409 CYS B C   1 
ATOM   7268 O O   . CYS B 1 408 ? -5.348  -59.085 -11.129 1.00 27.22  ? 409 CYS B O   1 
ATOM   7269 C CB  . CYS B 1 408 ? -2.886  -57.574 -9.454  1.00 20.61  ? 409 CYS B CB  1 
ATOM   7270 S SG  . CYS B 1 408 ? -1.844  -57.798 -7.972  1.00 27.75  ? 409 CYS B SG  1 
ATOM   7271 N N   . PRO B 1 409 ? -3.759  -58.329 -12.557 1.00 26.36  ? 410 PRO B N   1 
ATOM   7272 C CA  . PRO B 1 409 ? -4.734  -58.440 -13.659 1.00 24.70  ? 410 PRO B CA  1 
ATOM   7273 C C   . PRO B 1 409 ? -5.249  -59.876 -13.903 1.00 24.79  ? 410 PRO B C   1 
ATOM   7274 O O   . PRO B 1 409 ? -6.451  -60.060 -14.131 1.00 24.10  ? 410 PRO B O   1 
ATOM   7275 C CB  . PRO B 1 409 ? -3.952  -57.927 -14.878 1.00 24.96  ? 410 PRO B CB  1 
ATOM   7276 C CG  . PRO B 1 409 ? -2.948  -56.974 -14.298 1.00 23.71  ? 410 PRO B CG  1 
ATOM   7277 C CD  . PRO B 1 409 ? -2.550  -57.580 -12.962 1.00 22.27  ? 410 PRO B CD  1 
ATOM   7278 N N   . VAL B 1 410 ? -4.368  -60.872 -13.856 1.00 22.64  ? 411 VAL B N   1 
ATOM   7279 C CA  . VAL B 1 410 ? -4.805  -62.264 -13.981 1.00 22.77  ? 411 VAL B CA  1 
ATOM   7280 C C   . VAL B 1 410 ? -5.756  -62.659 -12.835 1.00 28.77  ? 411 VAL B C   1 
ATOM   7281 O O   . VAL B 1 410 ? -6.812  -63.256 -13.070 1.00 24.77  ? 411 VAL B O   1 
ATOM   7282 C CB  . VAL B 1 410 ? -3.598  -63.234 -14.058 1.00 23.35  ? 411 VAL B CB  1 
ATOM   7283 C CG1 . VAL B 1 410 ? -4.038  -64.693 -13.867 1.00 21.34  ? 411 VAL B CG1 1 
ATOM   7284 C CG2 . VAL B 1 410 ? -2.865  -63.055 -15.385 1.00 25.63  ? 411 VAL B CG2 1 
ATOM   7285 N N   . ALA B 1 411 ? -5.391  -62.304 -11.603 1.00 26.46  ? 412 ALA B N   1 
ATOM   7286 C CA  . ALA B 1 411 ? -6.240  -62.589 -10.438 1.00 24.10  ? 412 ALA B CA  1 
ATOM   7287 C C   . ALA B 1 411 ? -7.625  -61.955 -10.563 1.00 25.12  ? 412 ALA B C   1 
ATOM   7288 O O   . ALA B 1 411 ? -8.640  -62.593 -10.281 1.00 26.45  ? 412 ALA B O   1 
ATOM   7289 C CB  . ALA B 1 411 ? -5.558  -62.127 -9.144  1.00 27.03  ? 412 ALA B CB  1 
ATOM   7290 N N   . GLN B 1 412 ? -7.665  -60.699 -10.989 1.00 24.24  ? 413 GLN B N   1 
ATOM   7291 C CA  . GLN B 1 412 ? -8.933  -60.024 -11.177 1.00 24.23  ? 413 GLN B CA  1 
ATOM   7292 C C   . GLN B 1 412 ? -9.806  -60.724 -12.224 1.00 33.98  ? 413 GLN B C   1 
ATOM   7293 O O   . GLN B 1 412 ? -11.009 -60.913 -12.012 1.00 32.95  ? 413 GLN B O   1 
ATOM   7294 C CB  . GLN B 1 412 ? -8.720  -58.567 -11.564 1.00 22.53  ? 413 GLN B CB  1 
ATOM   7295 C CG  . GLN B 1 412 ? -9.960  -57.942 -12.158 1.00 32.12  ? 413 GLN B CG  1 
ATOM   7296 C CD  . GLN B 1 412 ? -10.334 -56.634 -11.513 1.00 47.03  ? 413 GLN B CD  1 
ATOM   7297 O OE1 . GLN B 1 412 ? -9.704  -55.601 -11.764 1.00 52.20  ? 413 GLN B OE1 1 
ATOM   7298 N NE2 . GLN B 1 412 ? -11.369 -56.665 -10.670 1.00 48.43  ? 413 GLN B NE2 1 
ATOM   7299 N N   . LEU B 1 413 ? -9.202  -61.105 -13.348 1.00 28.30  ? 414 LEU B N   1 
ATOM   7300 C CA  . LEU B 1 413 ? -9.936  -61.806 -14.391 1.00 29.29  ? 414 LEU B CA  1 
ATOM   7301 C C   . LEU B 1 413 ? -10.448 -63.130 -13.845 1.00 27.25  ? 414 LEU B C   1 
ATOM   7302 O O   . LEU B 1 413 ? -11.601 -63.481 -14.055 1.00 31.75  ? 414 LEU B O   1 
ATOM   7303 C CB  . LEU B 1 413 ? -9.054  -62.051 -15.625 1.00 29.02  ? 414 LEU B CB  1 
ATOM   7304 C CG  . LEU B 1 413 ? -9.705  -62.847 -16.762 1.00 31.74  ? 414 LEU B CG  1 
ATOM   7305 C CD1 . LEU B 1 413 ? -10.902 -62.095 -17.307 1.00 42.07  ? 414 LEU B CD1 1 
ATOM   7306 C CD2 . LEU B 1 413 ? -8.722  -63.107 -17.882 1.00 31.78  ? 414 LEU B CD2 1 
ATOM   7307 N N   . ALA B 1 414 ? -9.590  -63.855 -13.136 1.00 21.99  ? 415 ALA B N   1 
ATOM   7308 C CA  . ALA B 1 414 ? -9.949  -65.169 -12.614 1.00 30.01  ? 415 ALA B CA  1 
ATOM   7309 C C   . ALA B 1 414 ? -11.139 -65.088 -11.659 1.00 33.26  ? 415 ALA B C   1 
ATOM   7310 O O   . ALA B 1 414 ? -12.086 -65.879 -11.753 1.00 29.48  ? 415 ALA B O   1 
ATOM   7311 C CB  . ALA B 1 414 ? -8.749  -65.813 -11.916 1.00 28.30  ? 415 ALA B CB  1 
ATOM   7312 N N   . GLY B 1 415 ? -11.088 -64.118 -10.752 1.00 30.00  ? 416 GLY B N   1 
ATOM   7313 C CA  . GLY B 1 415 ? -12.133 -63.940 -9.759  1.00 33.02  ? 416 GLY B CA  1 
ATOM   7314 C C   . GLY B 1 415 ? -13.454 -63.520 -10.366 1.00 33.86  ? 416 GLY B C   1 
ATOM   7315 O O   . GLY B 1 415 ? -14.494 -64.088 -10.046 1.00 34.79  ? 416 GLY B O   1 
ATOM   7316 N N   . ARG B 1 416 ? -13.422 -62.533 -11.254 1.00 30.89  ? 417 ARG B N   1 
ATOM   7317 C CA  . ARG B 1 416 ? -14.649 -62.096 -11.901 1.00 38.54  ? 417 ARG B CA  1 
ATOM   7318 C C   . ARG B 1 416 ? -15.265 -63.185 -12.774 1.00 38.29  ? 417 ARG B C   1 
ATOM   7319 O O   . ARG B 1 416 ? -16.486 -63.343 -12.799 1.00 39.92  ? 417 ARG B O   1 
ATOM   7320 C CB  . ARG B 1 416 ? -14.428 -60.823 -12.719 1.00 36.29  ? 417 ARG B CB  1 
ATOM   7321 C CG  . ARG B 1 416 ? -14.140 -59.592 -11.879 1.00 39.23  ? 417 ARG B CG  1 
ATOM   7322 C CD  . ARG B 1 416 ? -15.028 -59.555 -10.640 1.00 47.57  ? 417 ARG B CD  1 
ATOM   7323 N NE  . ARG B 1 416 ? -15.511 -58.210 -10.343 1.00 49.57  ? 417 ARG B NE  1 
ATOM   7324 C CZ  . ARG B 1 416 ? -16.669 -57.723 -10.778 1.00 51.15  ? 417 ARG B CZ  1 
ATOM   7325 N NH1 . ARG B 1 416 ? -17.466 -58.471 -11.530 1.00 54.15  ? 417 ARG B NH1 1 
ATOM   7326 N NH2 . ARG B 1 416 ? -17.033 -56.490 -10.462 1.00 51.07  ? 417 ARG B NH2 1 
ATOM   7327 N N   . LEU B 1 417 ? -14.426 -63.932 -13.487 1.00 36.44  ? 418 LEU B N   1 
ATOM   7328 C CA  . LEU B 1 417 ? -14.923 -64.999 -14.359 1.00 37.53  ? 418 LEU B CA  1 
ATOM   7329 C C   . LEU B 1 417 ? -15.597 -66.093 -13.534 1.00 33.83  ? 418 LEU B C   1 
ATOM   7330 O O   . LEU B 1 417 ? -16.680 -66.558 -13.875 1.00 35.58  ? 418 LEU B O   1 
ATOM   7331 C CB  . LEU B 1 417 ? -13.803 -65.610 -15.224 1.00 30.95  ? 418 LEU B CB  1 
ATOM   7332 C CG  . LEU B 1 417 ? -13.194 -64.808 -16.383 1.00 38.54  ? 418 LEU B CG  1 
ATOM   7333 C CD1 . LEU B 1 417 ? -12.347 -65.693 -17.275 1.00 37.32  ? 418 LEU B CD1 1 
ATOM   7334 C CD2 . LEU B 1 417 ? -14.241 -64.106 -17.197 1.00 34.47  ? 418 LEU B CD2 1 
ATOM   7335 N N   . ALA B 1 418 ? -14.936 -66.509 -12.459 1.00 36.67  ? 419 ALA B N   1 
ATOM   7336 C CA  . ALA B 1 418 ? -15.476 -67.539 -11.580 1.00 39.21  ? 419 ALA B CA  1 
ATOM   7337 C C   . ALA B 1 418 ? -16.817 -67.098 -11.005 1.00 40.31  ? 419 ALA B C   1 
ATOM   7338 O O   . ALA B 1 418 ? -17.814 -67.817 -11.106 1.00 40.52  ? 419 ALA B O   1 
ATOM   7339 C CB  . ALA B 1 418 ? -14.498 -67.845 -10.459 1.00 31.30  ? 419 ALA B CB  1 
ATOM   7340 N N   . ALA B 1 419 ? -16.835 -65.901 -10.425 1.00 34.57  ? 420 ALA B N   1 
ATOM   7341 C CA  . ALA B 1 419 ? -18.029 -65.373 -9.773  1.00 34.64  ? 420 ALA B CA  1 
ATOM   7342 C C   . ALA B 1 419 ? -19.181 -65.134 -10.746 1.00 39.53  ? 420 ALA B C   1 
ATOM   7343 O O   . ALA B 1 419 ? -20.310 -64.904 -10.326 1.00 40.22  ? 420 ALA B O   1 
ATOM   7344 C CB  . ALA B 1 419 ? -17.698 -64.095 -9.023  1.00 29.26  ? 420 ALA B CB  1 
ATOM   7345 N N   . GLN B 1 420 ? -18.908 -65.198 -12.046 1.00 40.35  ? 421 GLN B N   1 
ATOM   7346 C CA  . GLN B 1 420 ? -19.946 -64.923 -13.034 1.00 31.57  ? 421 GLN B CA  1 
ATOM   7347 C C   . GLN B 1 420 ? -20.221 -66.070 -13.999 1.00 37.27  ? 421 GLN B C   1 
ATOM   7348 O O   . GLN B 1 420 ? -20.690 -65.848 -15.119 1.00 37.24  ? 421 GLN B O   1 
ATOM   7349 C CB  . GLN B 1 420 ? -19.636 -63.636 -13.789 1.00 37.18  ? 421 GLN B CB  1 
ATOM   7350 C CG  . GLN B 1 420 ? -19.710 -62.412 -12.900 1.00 37.76  ? 421 GLN B CG  1 
ATOM   7351 C CD  . GLN B 1 420 ? -18.882 -61.264 -13.424 1.00 45.57  ? 421 GLN B CD  1 
ATOM   7352 O OE1 . GLN B 1 420 ? -18.237 -60.551 -12.655 1.00 43.75  ? 421 GLN B OE1 1 
ATOM   7353 N NE2 . GLN B 1 420 ? -18.897 -61.072 -14.741 1.00 45.46  ? 421 GLN B NE2 1 
ATOM   7354 N N   . GLY B 1 421 ? -19.936 -67.293 -13.563 1.00 38.13  ? 422 GLY B N   1 
ATOM   7355 C CA  . GLY B 1 421 ? -20.390 -68.465 -14.292 1.00 42.79  ? 422 GLY B CA  1 
ATOM   7356 C C   . GLY B 1 421 ? -19.328 -69.408 -14.824 1.00 49.90  ? 422 GLY B C   1 
ATOM   7357 O O   . GLY B 1 421 ? -19.607 -70.586 -15.059 1.00 50.25  ? 422 GLY B O   1 
ATOM   7358 N N   . ALA B 1 422 ? -18.113 -68.904 -15.017 1.00 42.50  ? 423 ALA B N   1 
ATOM   7359 C CA  . ALA B 1 422 ? -17.063 -69.692 -15.652 1.00 41.81  ? 423 ALA B CA  1 
ATOM   7360 C C   . ALA B 1 422 ? -16.452 -70.672 -14.676 1.00 35.14  ? 423 ALA B C   1 
ATOM   7361 O O   . ALA B 1 422 ? -16.309 -70.359 -13.498 1.00 44.72  ? 423 ALA B O   1 
ATOM   7362 C CB  . ALA B 1 422 ? -15.986 -68.773 -16.215 1.00 38.34  ? 423 ALA B CB  1 
ATOM   7363 N N   . ARG B 1 423 ? -16.096 -71.860 -15.151 1.00 30.77  ? 424 ARG B N   1 
ATOM   7364 C CA  . ARG B 1 423 ? -15.253 -72.737 -14.347 1.00 35.86  ? 424 ARG B CA  1 
ATOM   7365 C C   . ARG B 1 423 ? -13.807 -72.357 -14.640 1.00 39.94  ? 424 ARG B C   1 
ATOM   7366 O O   . ARG B 1 423 ? -13.378 -72.381 -15.798 1.00 30.91  ? 424 ARG B O   1 
ATOM   7367 C CB  . ARG B 1 423 ? -15.493 -74.222 -14.655 1.00 37.72  ? 424 ARG B CB  1 
ATOM   7368 C CG  . ARG B 1 423 ? -14.751 -75.158 -13.682 1.00 42.92  ? 424 ARG B CG  1 
ATOM   7369 C CD  . ARG B 1 423 ? -15.331 -76.583 -13.631 1.00 55.06  ? 424 ARG B CD  1 
ATOM   7370 N NE  . ARG B 1 423 ? -14.949 -77.402 -14.787 1.00 61.40  ? 424 ARG B NE  1 
ATOM   7371 C CZ  . ARG B 1 423 ? -15.785 -77.780 -15.756 1.00 73.08  ? 424 ARG B CZ  1 
ATOM   7372 N NH1 . ARG B 1 423 ? -17.066 -77.416 -15.717 1.00 72.39  ? 424 ARG B NH1 1 
ATOM   7373 N NH2 . ARG B 1 423 ? -15.346 -78.527 -16.768 1.00 60.72  ? 424 ARG B NH2 1 
ATOM   7374 N N   . VAL B 1 424 ? -13.068 -71.994 -13.594 1.00 32.39  ? 425 VAL B N   1 
ATOM   7375 C CA  . VAL B 1 424 ? -11.721 -71.449 -13.741 1.00 30.59  ? 425 VAL B CA  1 
ATOM   7376 C C   . VAL B 1 424 ? -10.692 -72.335 -13.051 1.00 29.37  ? 425 VAL B C   1 
ATOM   7377 O O   . VAL B 1 424 ? -10.940 -72.841 -11.963 1.00 34.94  ? 425 VAL B O   1 
ATOM   7378 C CB  . VAL B 1 424 ? -11.630 -70.011 -13.142 1.00 32.24  ? 425 VAL B CB  1 
ATOM   7379 C CG1 . VAL B 1 424 ? -10.238 -69.422 -13.347 1.00 24.58  ? 425 VAL B CG1 1 
ATOM   7380 C CG2 . VAL B 1 424 ? -12.694 -69.091 -13.747 1.00 23.86  ? 425 VAL B CG2 1 
ATOM   7381 N N   . TYR B 1 425 ? -9.542  -72.537 -13.690 1.00 30.44  ? 426 TYR B N   1 
ATOM   7382 C CA  . TYR B 1 425 ? -8.417  -73.227 -13.061 1.00 26.35  ? 426 TYR B CA  1 
ATOM   7383 C C   . TYR B 1 425 ? -7.184  -72.329 -13.065 1.00 31.87  ? 426 TYR B C   1 
ATOM   7384 O O   . TYR B 1 425 ? -6.920  -71.626 -14.047 1.00 32.72  ? 426 TYR B O   1 
ATOM   7385 C CB  . TYR B 1 425 ? -8.116  -74.552 -13.761 1.00 29.66  ? 426 TYR B CB  1 
ATOM   7386 C CG  . TYR B 1 425 ? -9.236  -75.562 -13.656 1.00 34.47  ? 426 TYR B CG  1 
ATOM   7387 C CD1 . TYR B 1 425 ? -9.248  -76.508 -12.639 1.00 31.85  ? 426 TYR B CD1 1 
ATOM   7388 C CD2 . TYR B 1 425 ? -10.284 -75.567 -14.571 1.00 34.89  ? 426 TYR B CD2 1 
ATOM   7389 C CE1 . TYR B 1 425 ? -10.270 -77.429 -12.536 1.00 36.40  ? 426 TYR B CE1 1 
ATOM   7390 C CE2 . TYR B 1 425 ? -11.313 -76.484 -14.476 1.00 34.54  ? 426 TYR B CE2 1 
ATOM   7391 C CZ  . TYR B 1 425 ? -11.303 -77.411 -13.454 1.00 36.82  ? 426 TYR B CZ  1 
ATOM   7392 O OH  . TYR B 1 425 ? -12.324 -78.329 -13.346 1.00 40.60  ? 426 TYR B OH  1 
ATOM   7393 N N   . ALA B 1 426 ? -6.429  -72.344 -11.971 1.00 28.70  ? 427 ALA B N   1 
ATOM   7394 C CA  . ALA B 1 426 ? -5.309  -71.421 -11.836 1.00 26.20  ? 427 ALA B CA  1 
ATOM   7395 C C   . ALA B 1 426 ? -4.047  -72.102 -11.350 1.00 27.40  ? 427 ALA B C   1 
ATOM   7396 O O   . ALA B 1 426 ? -4.099  -72.973 -10.487 1.00 31.04  ? 427 ALA B O   1 
ATOM   7397 C CB  . ALA B 1 426 ? -5.676  -70.252 -10.930 1.00 25.40  ? 427 ALA B CB  1 
ATOM   7398 N N   . TYR B 1 427 ? -2.912  -71.698 -11.913 1.00 24.76  ? 428 TYR B N   1 
ATOM   7399 C CA  . TYR B 1 427 ? -1.636  -72.277 -11.540 1.00 23.15  ? 428 TYR B CA  1 
ATOM   7400 C C   . TYR B 1 427 ? -0.630  -71.173 -11.262 1.00 28.72  ? 428 TYR B C   1 
ATOM   7401 O O   . TYR B 1 427 ? -0.825  -70.021 -11.663 1.00 24.81  ? 428 TYR B O   1 
ATOM   7402 C CB  . TYR B 1 427 ? -1.094  -73.185 -12.658 1.00 25.69  ? 428 TYR B CB  1 
ATOM   7403 C CG  . TYR B 1 427 ? -0.734  -72.424 -13.930 1.00 27.59  ? 428 TYR B CG  1 
ATOM   7404 C CD1 . TYR B 1 427 ? 0.513   -71.828 -14.083 1.00 21.70  ? 428 TYR B CD1 1 
ATOM   7405 C CD2 . TYR B 1 427 ? -1.654  -72.287 -14.962 1.00 20.49  ? 428 TYR B CD2 1 
ATOM   7406 C CE1 . TYR B 1 427 ? 0.833   -71.118 -15.225 1.00 24.03  ? 428 TYR B CE1 1 
ATOM   7407 C CE2 . TYR B 1 427 ? -1.339  -71.589 -16.119 1.00 25.92  ? 428 TYR B CE2 1 
ATOM   7408 C CZ  . TYR B 1 427 ? -0.093  -71.000 -16.240 1.00 27.57  ? 428 TYR B CZ  1 
ATOM   7409 O OH  . TYR B 1 427 ? 0.219   -70.283 -17.372 1.00 27.12  ? 428 TYR B OH  1 
ATOM   7410 N N   . VAL B 1 428 ? 0.446   -71.544 -10.575 1.00 22.32  ? 429 VAL B N   1 
ATOM   7411 C CA  . VAL B 1 428 ? 1.651   -70.742 -10.512 1.00 22.76  ? 429 VAL B CA  1 
ATOM   7412 C C   . VAL B 1 428 ? 2.774   -71.694 -10.902 1.00 31.38  ? 429 VAL B C   1 
ATOM   7413 O O   . VAL B 1 428 ? 2.879   -72.799 -10.365 1.00 29.70  ? 429 VAL B O   1 
ATOM   7414 C CB  . VAL B 1 428 ? 1.885   -70.148 -9.105  1.00 33.20  ? 429 VAL B CB  1 
ATOM   7415 C CG1 . VAL B 1 428 ? 3.234   -69.432 -9.029  1.00 21.49  ? 429 VAL B CG1 1 
ATOM   7416 C CG2 . VAL B 1 428 ? 0.755   -69.184 -8.756  1.00 28.77  ? 429 VAL B CG2 1 
ATOM   7417 N N   . PHE B 1 429 ? 3.583   -71.284 -11.871 1.00 29.73  ? 430 PHE B N   1 
ATOM   7418 C CA  . PHE B 1 429 ? 4.607   -72.151 -12.421 1.00 23.57  ? 430 PHE B CA  1 
ATOM   7419 C C   . PHE B 1 429 ? 5.915   -71.853 -11.714 1.00 24.58  ? 430 PHE B C   1 
ATOM   7420 O O   . PHE B 1 429 ? 6.403   -70.724 -11.755 1.00 23.54  ? 430 PHE B O   1 
ATOM   7421 C CB  . PHE B 1 429 ? 4.728   -71.920 -13.928 1.00 24.05  ? 430 PHE B CB  1 
ATOM   7422 C CG  . PHE B 1 429 ? 5.742   -72.798 -14.600 1.00 23.16  ? 430 PHE B CG  1 
ATOM   7423 C CD1 . PHE B 1 429 ? 5.370   -74.022 -15.129 1.00 23.09  ? 430 PHE B CD1 1 
ATOM   7424 C CD2 . PHE B 1 429 ? 7.067   -72.398 -14.711 1.00 25.28  ? 430 PHE B CD2 1 
ATOM   7425 C CE1 . PHE B 1 429 ? 6.297   -74.838 -15.767 1.00 29.19  ? 430 PHE B CE1 1 
ATOM   7426 C CE2 . PHE B 1 429 ? 8.004   -73.209 -15.340 1.00 31.12  ? 430 PHE B CE2 1 
ATOM   7427 C CZ  . PHE B 1 429 ? 7.617   -74.435 -15.869 1.00 25.94  ? 430 PHE B CZ  1 
ATOM   7428 N N   . GLU B 1 430 ? 6.483   -72.863 -11.062 1.00 24.27  ? 431 GLU B N   1 
ATOM   7429 C CA  . GLU B 1 430 ? 7.552   -72.609 -10.096 1.00 33.25  ? 431 GLU B CA  1 
ATOM   7430 C C   . GLU B 1 430 ? 8.836   -73.341 -10.402 1.00 30.53  ? 431 GLU B C   1 
ATOM   7431 O O   . GLU B 1 430 ? 9.741   -73.387 -9.570  1.00 34.49  ? 431 GLU B O   1 
ATOM   7432 C CB  . GLU B 1 430 ? 7.105   -72.957 -8.674  1.00 24.85  ? 431 GLU B CB  1 
ATOM   7433 C CG  . GLU B 1 430 ? 5.929   -72.134 -8.185  1.00 35.14  ? 431 GLU B CG  1 
ATOM   7434 C CD  . GLU B 1 430 ? 5.746   -72.220 -6.677  1.00 38.11  ? 431 GLU B CD  1 
ATOM   7435 O OE1 . GLU B 1 430 ? 6.004   -73.297 -6.095  1.00 53.00  ? 431 GLU B OE1 1 
ATOM   7436 O OE2 . GLU B 1 430 ? 5.362   -71.202 -6.070  1.00 40.92  ? 431 GLU B OE2 1 
ATOM   7437 N N   . HIS B 1 431 ? 8.919   -73.923 -11.589 1.00 31.78  ? 432 HIS B N   1 
ATOM   7438 C CA  . HIS B 1 431 ? 10.138  -74.614 -11.965 1.00 30.91  ? 432 HIS B CA  1 
ATOM   7439 C C   . HIS B 1 431 ? 11.074  -73.726 -12.768 1.00 31.02  ? 432 HIS B C   1 
ATOM   7440 O O   . HIS B 1 431 ? 10.689  -73.149 -13.780 1.00 32.07  ? 432 HIS B O   1 
ATOM   7441 C CB  . HIS B 1 431 ? 9.853   -75.904 -12.741 1.00 25.20  ? 432 HIS B CB  1 
ATOM   7442 C CG  . HIS B 1 431 ? 11.095  -76.553 -13.257 1.00 31.54  ? 432 HIS B CG  1 
ATOM   7443 N ND1 . HIS B 1 431 ? 12.046  -77.094 -12.421 1.00 28.30  ? 432 HIS B ND1 1 
ATOM   7444 C CD2 . HIS B 1 431 ? 11.576  -76.688 -14.515 1.00 31.94  ? 432 HIS B CD2 1 
ATOM   7445 C CE1 . HIS B 1 431 ? 13.050  -77.557 -13.143 1.00 28.54  ? 432 HIS B CE1 1 
ATOM   7446 N NE2 . HIS B 1 431 ? 12.789  -77.324 -14.416 1.00 31.82  ? 432 HIS B NE2 1 
ATOM   7447 N N   . ARG B 1 432 ? 12.312  -73.630 -12.313 1.00 29.90  ? 433 ARG B N   1 
ATOM   7448 C CA  . ARG B 1 432 ? 13.329  -72.917 -13.057 1.00 31.02  ? 433 ARG B CA  1 
ATOM   7449 C C   . ARG B 1 432 ? 14.125  -73.896 -13.932 1.00 33.62  ? 433 ARG B C   1 
ATOM   7450 O O   . ARG B 1 432 ? 14.834  -74.763 -13.416 1.00 31.59  ? 433 ARG B O   1 
ATOM   7451 C CB  . ARG B 1 432 ? 14.256  -72.185 -12.088 1.00 30.08  ? 433 ARG B CB  1 
ATOM   7452 C CG  . ARG B 1 432 ? 15.310  -71.361 -12.773 1.00 35.21  ? 433 ARG B CG  1 
ATOM   7453 C CD  . ARG B 1 432 ? 16.213  -70.674 -11.777 1.00 29.47  ? 433 ARG B CD  1 
ATOM   7454 N NE  . ARG B 1 432 ? 17.439  -70.258 -12.446 1.00 37.05  ? 433 ARG B NE  1 
ATOM   7455 C CZ  . ARG B 1 432 ? 17.702  -69.015 -12.832 1.00 37.24  ? 433 ARG B CZ  1 
ATOM   7456 N NH1 . ARG B 1 432 ? 16.830  -68.034 -12.604 1.00 30.70  ? 433 ARG B NH1 1 
ATOM   7457 N NH2 . ARG B 1 432 ? 18.850  -68.755 -13.442 1.00 34.42  ? 433 ARG B NH2 1 
ATOM   7458 N N   . ALA B 1 433 ? 14.000  -73.755 -15.251 1.00 34.70  ? 434 ALA B N   1 
ATOM   7459 C CA  . ALA B 1 433 ? 14.656  -74.664 -16.192 1.00 35.76  ? 434 ALA B CA  1 
ATOM   7460 C C   . ALA B 1 433 ? 16.154  -74.819 -15.931 1.00 36.27  ? 434 ALA B C   1 
ATOM   7461 O O   . ALA B 1 433 ? 16.857  -73.841 -15.669 1.00 33.48  ? 434 ALA B O   1 
ATOM   7462 C CB  . ALA B 1 433 ? 14.418  -74.209 -17.625 1.00 31.65  ? 434 ALA B CB  1 
ATOM   7463 N N   . SER B 1 434 ? 16.643  -76.053 -16.021 1.00 36.56  ? 435 SER B N   1 
ATOM   7464 C CA  . SER B 1 434 ? 18.054  -76.340 -15.771 1.00 37.30  ? 435 SER B CA  1 
ATOM   7465 C C   . SER B 1 434 ? 18.933  -75.606 -16.767 1.00 36.32  ? 435 SER B C   1 
ATOM   7466 O O   . SER B 1 434 ? 20.107  -75.349 -16.501 1.00 38.75  ? 435 SER B O   1 
ATOM   7467 C CB  . SER B 1 434 ? 18.326  -77.843 -15.851 1.00 35.57  ? 435 SER B CB  1 
ATOM   7468 O OG  . SER B 1 434 ? 17.975  -78.358 -17.127 1.00 40.72  ? 435 SER B OG  1 
ATOM   7469 N N   . THR B 1 435 ? 18.350  -75.254 -17.907 1.00 32.78  ? 436 THR B N   1 
ATOM   7470 C CA  . THR B 1 435 ? 19.104  -74.663 -19.009 1.00 40.86  ? 436 THR B CA  1 
ATOM   7471 C C   . THR B 1 435 ? 19.017  -73.143 -19.035 1.00 38.78  ? 436 THR B C   1 
ATOM   7472 O O   . THR B 1 435 ? 19.549  -72.504 -19.942 1.00 45.22  ? 436 THR B O   1 
ATOM   7473 C CB  . THR B 1 435 ? 18.610  -75.200 -20.364 1.00 34.37  ? 436 THR B CB  1 
ATOM   7474 O OG1 . THR B 1 435 ? 17.183  -75.081 -20.426 1.00 39.02  ? 436 THR B OG1 1 
ATOM   7475 C CG2 . THR B 1 435 ? 18.978  -76.660 -20.521 1.00 39.27  ? 436 THR B CG2 1 
ATOM   7476 N N   . LEU B 1 436 ? 18.354  -72.564 -18.040 1.00 35.12  ? 437 LEU B N   1 
ATOM   7477 C CA  . LEU B 1 436 ? 18.124  -71.124 -18.029 1.00 38.63  ? 437 LEU B CA  1 
ATOM   7478 C C   . LEU B 1 436 ? 19.436  -70.356 -17.923 1.00 36.32  ? 437 LEU B C   1 
ATOM   7479 O O   . LEU B 1 436 ? 20.244  -70.616 -17.039 1.00 42.91  ? 437 LEU B O   1 
ATOM   7480 C CB  . LEU B 1 436 ? 17.176  -70.730 -16.890 1.00 34.90  ? 437 LEU B CB  1 
ATOM   7481 C CG  . LEU B 1 436 ? 16.640  -69.296 -16.933 1.00 34.65  ? 437 LEU B CG  1 
ATOM   7482 C CD1 . LEU B 1 436 ? 15.863  -69.046 -18.210 1.00 27.95  ? 437 LEU B CD1 1 
ATOM   7483 C CD2 . LEU B 1 436 ? 15.763  -69.015 -15.727 1.00 39.96  ? 437 LEU B CD2 1 
ATOM   7484 N N   . SER B 1 437 ? 19.641  -69.410 -18.830 1.00 34.18  ? 438 SER B N   1 
ATOM   7485 C CA  . SER B 1 437 ? 20.873  -68.636 -18.851 1.00 37.62  ? 438 SER B CA  1 
ATOM   7486 C C   . SER B 1 437 ? 20.765  -67.290 -18.125 1.00 36.10  ? 438 SER B C   1 
ATOM   7487 O O   . SER B 1 437 ? 21.778  -66.631 -17.888 1.00 37.17  ? 438 SER B O   1 
ATOM   7488 C CB  . SER B 1 437 ? 21.326  -68.417 -20.293 1.00 39.53  ? 438 SER B CB  1 
ATOM   7489 O OG  . SER B 1 437 ? 20.288  -67.818 -21.052 1.00 45.91  ? 438 SER B OG  1 
ATOM   7490 N N   . TRP B 1 438 ? 19.546  -66.869 -17.790 1.00 34.19  ? 439 TRP B N   1 
ATOM   7491 C CA  . TRP B 1 438 ? 19.365  -65.651 -16.997 1.00 33.19  ? 439 TRP B CA  1 
ATOM   7492 C C   . TRP B 1 438 ? 19.823  -65.896 -15.555 1.00 31.19  ? 439 TRP B C   1 
ATOM   7493 O O   . TRP B 1 438 ? 19.754  -67.019 -15.064 1.00 30.77  ? 439 TRP B O   1 
ATOM   7494 C CB  . TRP B 1 438 ? 17.912  -65.164 -17.050 1.00 31.73  ? 439 TRP B CB  1 
ATOM   7495 C CG  . TRP B 1 438 ? 17.497  -64.647 -18.405 1.00 25.71  ? 439 TRP B CG  1 
ATOM   7496 C CD1 . TRP B 1 438 ? 16.767  -65.311 -19.347 1.00 25.97  ? 439 TRP B CD1 1 
ATOM   7497 C CD2 . TRP B 1 438 ? 17.791  -63.355 -18.963 1.00 28.64  ? 439 TRP B CD2 1 
ATOM   7498 N NE1 . TRP B 1 438 ? 16.580  -64.512 -20.456 1.00 25.23  ? 439 TRP B NE1 1 
ATOM   7499 C CE2 . TRP B 1 438 ? 17.203  -63.310 -20.247 1.00 24.87  ? 439 TRP B CE2 1 
ATOM   7500 C CE3 . TRP B 1 438 ? 18.498  -62.236 -18.504 1.00 23.20  ? 439 TRP B CE3 1 
ATOM   7501 C CZ2 . TRP B 1 438 ? 17.303  -62.193 -21.077 1.00 25.36  ? 439 TRP B CZ2 1 
ATOM   7502 C CZ3 . TRP B 1 438 ? 18.596  -61.128 -19.330 1.00 31.28  ? 439 TRP B CZ3 1 
ATOM   7503 C CH2 . TRP B 1 438 ? 17.999  -61.115 -20.605 1.00 26.36  ? 439 TRP B CH2 1 
ATOM   7504 N N   . PRO B 1 439 ? 20.311  -64.849 -14.874 1.00 33.48  ? 440 PRO B N   1 
ATOM   7505 C CA  . PRO B 1 439 ? 20.911  -65.068 -13.552 1.00 34.74  ? 440 PRO B CA  1 
ATOM   7506 C C   . PRO B 1 439 ? 19.918  -65.592 -12.514 1.00 34.51  ? 440 PRO B C   1 
ATOM   7507 O O   . PRO B 1 439 ? 18.704  -65.488 -12.702 1.00 30.46  ? 440 PRO B O   1 
ATOM   7508 C CB  . PRO B 1 439 ? 21.419  -63.675 -13.162 1.00 32.70  ? 440 PRO B CB  1 
ATOM   7509 C CG  . PRO B 1 439 ? 20.563  -62.737 -13.925 1.00 33.12  ? 440 PRO B CG  1 
ATOM   7510 C CD  . PRO B 1 439 ? 20.294  -63.423 -15.241 1.00 32.96  ? 440 PRO B CD  1 
ATOM   7511 N N   . LEU B 1 440 ? 20.449  -66.156 -11.432 1.00 34.70  ? 441 LEU B N   1 
ATOM   7512 C CA  . LEU B 1 440 ? 19.644  -66.794 -10.401 1.00 33.89  ? 441 LEU B CA  1 
ATOM   7513 C C   . LEU B 1 440 ? 18.683  -65.812 -9.725  1.00 33.32  ? 441 LEU B C   1 
ATOM   7514 O O   . LEU B 1 440 ? 17.559  -66.178 -9.376  1.00 28.78  ? 441 LEU B O   1 
ATOM   7515 C CB  . LEU B 1 440 ? 20.555  -67.438 -9.353  1.00 38.96  ? 441 LEU B CB  1 
ATOM   7516 C CG  . LEU B 1 440 ? 20.225  -68.864 -8.904  1.00 41.97  ? 441 LEU B CG  1 
ATOM   7517 C CD1 . LEU B 1 440 ? 20.495  -69.854 -10.024 1.00 36.75  ? 441 LEU B CD1 1 
ATOM   7518 C CD2 . LEU B 1 440 ? 21.026  -69.237 -7.674  1.00 42.30  ? 441 LEU B CD2 1 
ATOM   7519 N N   . TRP B 1 441 ? 19.113  -64.567 -9.541  1.00 28.57  ? 442 TRP B N   1 
ATOM   7520 C CA  . TRP B 1 441 ? 18.251  -63.587 -8.877  1.00 29.53  ? 442 TRP B CA  1 
ATOM   7521 C C   . TRP B 1 441 ? 16.902  -63.365 -9.576  1.00 33.22  ? 442 TRP B C   1 
ATOM   7522 O O   . TRP B 1 441 ? 15.940  -62.953 -8.933  1.00 35.01  ? 442 TRP B O   1 
ATOM   7523 C CB  . TRP B 1 441 ? 18.973  -62.253 -8.594  1.00 28.56  ? 442 TRP B CB  1 
ATOM   7524 C CG  . TRP B 1 441 ? 19.258  -61.378 -9.785  1.00 29.05  ? 442 TRP B CG  1 
ATOM   7525 C CD1 . TRP B 1 441 ? 20.456  -61.229 -10.417 1.00 31.80  ? 442 TRP B CD1 1 
ATOM   7526 C CD2 . TRP B 1 441 ? 18.341  -60.498 -10.453 1.00 29.86  ? 442 TRP B CD2 1 
ATOM   7527 N NE1 . TRP B 1 441 ? 20.341  -60.326 -11.448 1.00 32.13  ? 442 TRP B NE1 1 
ATOM   7528 C CE2 . TRP B 1 441 ? 19.053  -59.865 -11.495 1.00 26.41  ? 442 TRP B CE2 1 
ATOM   7529 C CE3 . TRP B 1 441 ? 16.987  -60.191 -10.279 1.00 29.30  ? 442 TRP B CE3 1 
ATOM   7530 C CZ2 . TRP B 1 441 ? 18.458  -58.948 -12.363 1.00 28.10  ? 442 TRP B CZ2 1 
ATOM   7531 C CZ3 . TRP B 1 441 ? 16.394  -59.279 -11.143 1.00 27.80  ? 442 TRP B CZ3 1 
ATOM   7532 C CH2 . TRP B 1 441 ? 17.132  -58.670 -12.173 1.00 28.33  ? 442 TRP B CH2 1 
ATOM   7533 N N   . MET B 1 442 ? 16.819  -63.654 -10.875 1.00 29.59  ? 443 MET B N   1 
ATOM   7534 C CA  . MET B 1 442 ? 15.552  -63.488 -11.592 1.00 23.49  ? 443 MET B CA  1 
ATOM   7535 C C   . MET B 1 442 ? 14.516  -64.582 -11.290 1.00 26.95  ? 443 MET B C   1 
ATOM   7536 O O   . MET B 1 442 ? 13.356  -64.464 -11.694 1.00 29.72  ? 443 MET B O   1 
ATOM   7537 C CB  . MET B 1 442 ? 15.780  -63.396 -13.101 1.00 26.10  ? 443 MET B CB  1 
ATOM   7538 C CG  . MET B 1 442 ? 16.327  -62.063 -13.597 1.00 28.86  ? 443 MET B CG  1 
ATOM   7539 S SD  . MET B 1 442 ? 16.442  -62.045 -15.414 1.00 31.41  ? 443 MET B SD  1 
ATOM   7540 C CE  . MET B 1 442 ? 17.100  -60.402 -15.680 1.00 29.56  ? 443 MET B CE  1 
ATOM   7541 N N   . GLY B 1 443 ? 14.927  -65.637 -10.586 1.00 25.81  ? 444 GLY B N   1 
ATOM   7542 C CA  . GLY B 1 443 ? 14.032  -66.743 -10.268 1.00 20.59  ? 444 GLY B CA  1 
ATOM   7543 C C   . GLY B 1 443 ? 13.471  -67.458 -11.496 1.00 28.09  ? 444 GLY B C   1 
ATOM   7544 O O   . GLY B 1 443 ? 14.219  -67.876 -12.385 1.00 28.60  ? 444 GLY B O   1 
ATOM   7545 N N   . VAL B 1 444 ? 12.151  -67.618 -11.532 1.00 24.85  ? 445 VAL B N   1 
ATOM   7546 C CA  . VAL B 1 444 ? 11.454  -68.157 -12.700 1.00 29.67  ? 445 VAL B CA  1 
ATOM   7547 C C   . VAL B 1 444 ? 10.804  -67.007 -13.464 1.00 25.69  ? 445 VAL B C   1 
ATOM   7548 O O   . VAL B 1 444 ? 9.701   -66.600 -13.133 1.00 26.13  ? 445 VAL B O   1 
ATOM   7549 C CB  . VAL B 1 444 ? 10.344  -69.152 -12.296 1.00 34.94  ? 445 VAL B CB  1 
ATOM   7550 C CG1 . VAL B 1 444 ? 9.721   -69.801 -13.536 1.00 26.31  ? 445 VAL B CG1 1 
ATOM   7551 C CG2 . VAL B 1 444 ? 10.884  -70.210 -11.332 1.00 25.68  ? 445 VAL B CG2 1 
ATOM   7552 N N   . PRO B 1 445 ? 11.488  -66.487 -14.498 1.00 30.45  ? 446 PRO B N   1 
ATOM   7553 C CA  . PRO B 1 445 ? 11.064  -65.243 -15.149 1.00 27.09  ? 446 PRO B CA  1 
ATOM   7554 C C   . PRO B 1 445 ? 9.943   -65.415 -16.162 1.00 27.35  ? 446 PRO B C   1 
ATOM   7555 O O   . PRO B 1 445 ? 9.621   -66.522 -16.604 1.00 27.10  ? 446 PRO B O   1 
ATOM   7556 C CB  . PRO B 1 445 ? 12.336  -64.772 -15.879 1.00 30.17  ? 446 PRO B CB  1 
ATOM   7557 C CG  . PRO B 1 445 ? 13.456  -65.722 -15.415 1.00 25.39  ? 446 PRO B CG  1 
ATOM   7558 C CD  . PRO B 1 445 ? 12.747  -66.989 -15.072 1.00 28.48  ? 446 PRO B CD  1 
ATOM   7559 N N   . HIS B 1 446 ? 9.355   -64.279 -16.508 1.00 21.26  ? 447 HIS B N   1 
ATOM   7560 C CA  . HIS B 1 446 ? 8.321   -64.165 -17.520 1.00 22.97  ? 447 HIS B CA  1 
ATOM   7561 C C   . HIS B 1 446 ? 8.711   -64.914 -18.805 1.00 25.17  ? 447 HIS B C   1 
ATOM   7562 O O   . HIS B 1 446 ? 9.816   -64.734 -19.325 1.00 22.27  ? 447 HIS B O   1 
ATOM   7563 C CB  . HIS B 1 446 ? 8.151   -62.678 -17.811 1.00 23.25  ? 447 HIS B CB  1 
ATOM   7564 C CG  . HIS B 1 446 ? 6.942   -62.346 -18.617 1.00 26.81  ? 447 HIS B CG  1 
ATOM   7565 N ND1 . HIS B 1 446 ? 5.663   -62.522 -18.142 1.00 27.13  ? 447 HIS B ND1 1 
ATOM   7566 C CD2 . HIS B 1 446 ? 6.820   -61.820 -19.860 1.00 19.35  ? 447 HIS B CD2 1 
ATOM   7567 C CE1 . HIS B 1 446 ? 4.800   -62.124 -19.062 1.00 22.56  ? 447 HIS B CE1 1 
ATOM   7568 N NE2 . HIS B 1 446 ? 5.478   -61.698 -20.112 1.00 25.60  ? 447 HIS B NE2 1 
ATOM   7569 N N   . GLY B 1 447 ? 7.817   -65.770 -19.294 1.00 23.16  ? 448 GLY B N   1 
ATOM   7570 C CA  . GLY B 1 447 ? 8.057   -66.506 -20.521 1.00 22.21  ? 448 GLY B CA  1 
ATOM   7571 C C   . GLY B 1 447 ? 8.639   -67.909 -20.398 1.00 26.22  ? 448 GLY B C   1 
ATOM   7572 O O   . GLY B 1 447 ? 8.601   -68.683 -21.356 1.00 26.36  ? 448 GLY B O   1 
ATOM   7573 N N   . TYR B 1 448 ? 9.168   -68.269 -19.237 1.00 25.13  ? 449 TYR B N   1 
ATOM   7574 C CA  . TYR B 1 448 ? 9.919   -69.524 -19.164 1.00 25.08  ? 449 TYR B CA  1 
ATOM   7575 C C   . TYR B 1 448 ? 9.152   -70.788 -18.768 1.00 24.21  ? 449 TYR B C   1 
ATOM   7576 O O   . TYR B 1 448 ? 9.753   -71.820 -18.477 1.00 26.12  ? 449 TYR B O   1 
ATOM   7577 C CB  . TYR B 1 448 ? 11.229  -69.343 -18.390 1.00 21.80  ? 449 TYR B CB  1 
ATOM   7578 C CG  . TYR B 1 448 ? 12.211  -68.591 -19.254 1.00 33.23  ? 449 TYR B CG  1 
ATOM   7579 C CD1 . TYR B 1 448 ? 12.871  -69.238 -20.295 1.00 26.99  ? 449 TYR B CD1 1 
ATOM   7580 C CD2 . TYR B 1 448 ? 12.432  -67.227 -19.081 1.00 25.35  ? 449 TYR B CD2 1 
ATOM   7581 C CE1 . TYR B 1 448 ? 13.744  -68.569 -21.113 1.00 28.19  ? 449 TYR B CE1 1 
ATOM   7582 C CE2 . TYR B 1 448 ? 13.316  -66.544 -19.906 1.00 30.73  ? 449 TYR B CE2 1 
ATOM   7583 C CZ  . TYR B 1 448 ? 13.963  -67.229 -20.925 1.00 31.36  ? 449 TYR B CZ  1 
ATOM   7584 O OH  . TYR B 1 448 ? 14.836  -66.586 -21.768 1.00 32.61  ? 449 TYR B OH  1 
ATOM   7585 N N   . GLU B 1 449 ? 7.827   -70.719 -18.793 1.00 23.26  ? 450 GLU B N   1 
ATOM   7586 C CA  . GLU B 1 449 ? 7.025   -71.928 -18.647 1.00 24.89  ? 450 GLU B CA  1 
ATOM   7587 C C   . GLU B 1 449 ? 6.658   -72.488 -20.025 1.00 28.42  ? 450 GLU B C   1 
ATOM   7588 O O   . GLU B 1 449 ? 6.332   -73.675 -20.150 1.00 27.36  ? 450 GLU B O   1 
ATOM   7589 C CB  . GLU B 1 449 ? 5.746   -71.650 -17.848 1.00 19.83  ? 450 GLU B CB  1 
ATOM   7590 C CG  . GLU B 1 449 ? 4.562   -71.192 -18.699 1.00 23.55  ? 450 GLU B CG  1 
ATOM   7591 C CD  . GLU B 1 449 ? 4.686   -69.750 -19.213 1.00 24.08  ? 450 GLU B CD  1 
ATOM   7592 O OE1 . GLU B 1 449 ? 5.781   -69.138 -19.147 1.00 23.33  ? 450 GLU B OE1 1 
ATOM   7593 O OE2 . GLU B 1 449 ? 3.658   -69.216 -19.668 1.00 27.11  ? 450 GLU B OE2 1 
ATOM   7594 N N   . ILE B 1 450 ? 6.716   -71.635 -21.052 1.00 27.35  ? 451 ILE B N   1 
ATOM   7595 C CA  . ILE B 1 450 ? 6.213   -71.980 -22.385 1.00 25.99  ? 451 ILE B CA  1 
ATOM   7596 C C   . ILE B 1 450 ? 6.872   -73.230 -22.949 1.00 29.05  ? 451 ILE B C   1 
ATOM   7597 O O   . ILE B 1 450 ? 6.192   -74.138 -23.447 1.00 23.26  ? 451 ILE B O   1 
ATOM   7598 C CB  . ILE B 1 450 ? 6.433   -70.839 -23.389 1.00 26.75  ? 451 ILE B CB  1 
ATOM   7599 C CG1 . ILE B 1 450 ? 5.656   -69.582 -22.965 1.00 28.06  ? 451 ILE B CG1 1 
ATOM   7600 C CG2 . ILE B 1 450 ? 6.024   -71.285 -24.776 1.00 21.93  ? 451 ILE B CG2 1 
ATOM   7601 C CD1 . ILE B 1 450 ? 6.018   -68.328 -23.783 1.00 22.05  ? 451 ILE B CD1 1 
ATOM   7602 N N   . GLU B 1 451 ? 8.197   -73.272 -22.846 1.00 24.52  ? 452 GLU B N   1 
ATOM   7603 C CA  . GLU B 1 451 ? 8.979   -74.364 -23.409 1.00 28.46  ? 452 GLU B CA  1 
ATOM   7604 C C   . GLU B 1 451 ? 8.550   -75.709 -22.822 1.00 28.23  ? 452 GLU B C   1 
ATOM   7605 O O   . GLU B 1 451 ? 8.623   -76.744 -23.495 1.00 28.36  ? 452 GLU B O   1 
ATOM   7606 C CB  . GLU B 1 451 ? 10.483  -74.114 -23.213 1.00 28.25  ? 452 GLU B CB  1 
ATOM   7607 C CG  . GLU B 1 451 ? 10.910  -73.949 -21.752 1.00 28.25  ? 452 GLU B CG  1 
ATOM   7608 C CD  . GLU B 1 451 ? 12.249  -73.230 -21.612 1.00 38.64  ? 452 GLU B CD  1 
ATOM   7609 O OE1 . GLU B 1 451 ? 13.254  -73.880 -21.247 1.00 37.34  ? 452 GLU B OE1 1 
ATOM   7610 O OE2 . GLU B 1 451 ? 12.298  -72.006 -21.862 1.00 40.70  ? 452 GLU B OE2 1 
ATOM   7611 N N   . PHE B 1 452 ? 8.072   -75.682 -21.582 1.00 24.87  ? 453 PHE B N   1 
ATOM   7612 C CA  . PHE B 1 452 ? 7.594   -76.892 -20.919 1.00 23.33  ? 453 PHE B CA  1 
ATOM   7613 C C   . PHE B 1 452 ? 6.196   -77.285 -21.393 1.00 23.47  ? 453 PHE B C   1 
ATOM   7614 O O   . PHE B 1 452 ? 5.913   -78.466 -21.567 1.00 28.38  ? 453 PHE B O   1 
ATOM   7615 C CB  . PHE B 1 452 ? 7.642   -76.739 -19.380 1.00 26.51  ? 453 PHE B CB  1 
ATOM   7616 C CG  . PHE B 1 452 ? 9.033   -76.739 -18.829 1.00 29.57  ? 453 PHE B CG  1 
ATOM   7617 C CD1 . PHE B 1 452 ? 9.742   -75.554 -18.700 1.00 26.38  ? 453 PHE B CD1 1 
ATOM   7618 C CD2 . PHE B 1 452 ? 9.655   -77.932 -18.486 1.00 28.31  ? 453 PHE B CD2 1 
ATOM   7619 C CE1 . PHE B 1 452 ? 11.036  -75.561 -18.220 1.00 29.28  ? 453 PHE B CE1 1 
ATOM   7620 C CE2 . PHE B 1 452 ? 10.951  -77.943 -18.009 1.00 29.33  ? 453 PHE B CE2 1 
ATOM   7621 C CZ  . PHE B 1 452 ? 11.643  -76.758 -17.874 1.00 29.87  ? 453 PHE B CZ  1 
ATOM   7622 N N   . ILE B 1 453 ? 5.324   -76.295 -21.583 1.00 23.66  ? 454 ILE B N   1 
ATOM   7623 C CA  . ILE B 1 453 ? 3.969   -76.529 -22.088 1.00 23.31  ? 454 ILE B CA  1 
ATOM   7624 C C   . ILE B 1 453 ? 4.015   -77.137 -23.497 1.00 28.20  ? 454 ILE B C   1 
ATOM   7625 O O   . ILE B 1 453 ? 3.183   -77.971 -23.856 1.00 31.28  ? 454 ILE B O   1 
ATOM   7626 C CB  . ILE B 1 453 ? 3.136   -75.206 -22.136 1.00 23.63  ? 454 ILE B CB  1 
ATOM   7627 C CG1 . ILE B 1 453 ? 3.068   -74.539 -20.748 1.00 26.79  ? 454 ILE B CG1 1 
ATOM   7628 C CG2 . ILE B 1 453 ? 1.735   -75.444 -22.685 1.00 22.56  ? 454 ILE B CG2 1 
ATOM   7629 C CD1 . ILE B 1 453 ? 2.586   -75.432 -19.675 1.00 25.81  ? 454 ILE B CD1 1 
ATOM   7630 N N   . PHE B 1 454 ? 4.993   -76.713 -24.291 1.00 27.15  ? 455 PHE B N   1 
ATOM   7631 C CA  . PHE B 1 454 ? 5.135   -77.198 -25.659 1.00 31.02  ? 455 PHE B CA  1 
ATOM   7632 C C   . PHE B 1 454 ? 5.927   -78.500 -25.725 1.00 31.35  ? 455 PHE B C   1 
ATOM   7633 O O   . PHE B 1 454 ? 6.064   -79.090 -26.793 1.00 31.24  ? 455 PHE B O   1 
ATOM   7634 C CB  . PHE B 1 454 ? 5.784   -76.134 -26.556 1.00 23.98  ? 455 PHE B CB  1 
ATOM   7635 C CG  . PHE B 1 454 ? 4.805   -75.175 -27.157 1.00 25.21  ? 455 PHE B CG  1 
ATOM   7636 C CD1 . PHE B 1 454 ? 4.379   -74.061 -26.449 1.00 26.03  ? 455 PHE B CD1 1 
ATOM   7637 C CD2 . PHE B 1 454 ? 4.302   -75.387 -28.430 1.00 23.71  ? 455 PHE B CD2 1 
ATOM   7638 C CE1 . PHE B 1 454 ? 3.469   -73.168 -27.006 1.00 24.10  ? 455 PHE B CE1 1 
ATOM   7639 C CE2 . PHE B 1 454 ? 3.389   -74.508 -28.989 1.00 24.52  ? 455 PHE B CE2 1 
ATOM   7640 C CZ  . PHE B 1 454 ? 2.971   -73.398 -28.281 1.00 27.46  ? 455 PHE B CZ  1 
ATOM   7641 N N   . GLY B 1 455 ? 6.456   -78.940 -24.587 1.00 29.00  ? 456 GLY B N   1 
ATOM   7642 C CA  . GLY B 1 455 ? 7.192   -80.192 -24.539 1.00 30.26  ? 456 GLY B CA  1 
ATOM   7643 C C   . GLY B 1 455 ? 8.578   -80.135 -25.163 1.00 34.23  ? 456 GLY B C   1 
ATOM   7644 O O   . GLY B 1 455 ? 9.166   -81.171 -25.478 1.00 32.40  ? 456 GLY B O   1 
ATOM   7645 N N   . ILE B 1 456 ? 9.110   -78.926 -25.330 1.00 32.88  ? 457 ILE B N   1 
ATOM   7646 C CA  . ILE B 1 456 ? 10.471  -78.741 -25.832 1.00 28.37  ? 457 ILE B CA  1 
ATOM   7647 C C   . ILE B 1 456 ? 11.542  -79.633 -25.157 1.00 32.73  ? 457 ILE B C   1 
ATOM   7648 O O   . ILE B 1 456 ? 12.476  -80.067 -25.824 1.00 31.32  ? 457 ILE B O   1 
ATOM   7649 C CB  . ILE B 1 456 ? 10.897  -77.241 -25.798 1.00 32.37  ? 457 ILE B CB  1 
ATOM   7650 C CG1 . ILE B 1 456 ? 9.843   -76.358 -26.483 1.00 32.21  ? 457 ILE B CG1 1 
ATOM   7651 C CG2 . ILE B 1 456 ? 12.265  -77.034 -26.434 1.00 28.42  ? 457 ILE B CG2 1 
ATOM   7652 C CD1 . ILE B 1 456 ? 9.536   -76.725 -27.931 1.00 28.64  ? 457 ILE B CD1 1 
ATOM   7653 N N   . PRO B 1 457 ? 11.417  -79.915 -23.841 1.00 33.34  ? 458 PRO B N   1 
ATOM   7654 C CA  . PRO B 1 457 ? 12.424  -80.826 -23.277 1.00 32.36  ? 458 PRO B CA  1 
ATOM   7655 C C   . PRO B 1 457 ? 12.495  -82.226 -23.908 1.00 32.21  ? 458 PRO B C   1 
ATOM   7656 O O   . PRO B 1 457 ? 13.495  -82.917 -23.712 1.00 32.42  ? 458 PRO B O   1 
ATOM   7657 C CB  . PRO B 1 457 ? 12.020  -80.927 -21.797 1.00 36.15  ? 458 PRO B CB  1 
ATOM   7658 C CG  . PRO B 1 457 ? 11.368  -79.641 -21.506 1.00 31.57  ? 458 PRO B CG  1 
ATOM   7659 C CD  . PRO B 1 457 ? 10.657  -79.229 -22.775 1.00 27.36  ? 458 PRO B CD  1 
ATOM   7660 N N   . LEU B 1 458 ? 11.469  -82.642 -24.641 1.00 33.54  ? 459 LEU B N   1 
ATOM   7661 C CA  . LEU B 1 458 ? 11.533  -83.920 -25.345 1.00 33.73  ? 459 LEU B CA  1 
ATOM   7662 C C   . LEU B 1 458 ? 12.446  -83.863 -26.574 1.00 35.86  ? 459 LEU B C   1 
ATOM   7663 O O   . LEU B 1 458 ? 12.693  -84.876 -27.218 1.00 40.52  ? 459 LEU B O   1 
ATOM   7664 C CB  . LEU B 1 458 ? 10.141  -84.381 -25.776 1.00 33.00  ? 459 LEU B CB  1 
ATOM   7665 C CG  . LEU B 1 458 ? 9.140   -84.578 -24.653 1.00 31.73  ? 459 LEU B CG  1 
ATOM   7666 C CD1 . LEU B 1 458 ? 7.855   -85.132 -25.214 1.00 31.88  ? 459 LEU B CD1 1 
ATOM   7667 C CD2 . LEU B 1 458 ? 9.719   -85.494 -23.594 1.00 36.37  ? 459 LEU B CD2 1 
ATOM   7668 N N   . ASP B 1 459 ? 12.927  -82.676 -26.911 1.00 37.79  ? 460 ASP B N   1 
ATOM   7669 C CA  . ASP B 1 459 ? 13.809  -82.519 -28.058 1.00 43.78  ? 460 ASP B CA  1 
ATOM   7670 C C   . ASP B 1 459 ? 15.188  -83.081 -27.708 1.00 48.72  ? 460 ASP B C   1 
ATOM   7671 O O   . ASP B 1 459 ? 15.883  -82.538 -26.849 1.00 44.01  ? 460 ASP B O   1 
ATOM   7672 C CB  . ASP B 1 459 ? 13.904  -81.042 -28.433 1.00 44.08  ? 460 ASP B CB  1 
ATOM   7673 C CG  . ASP B 1 459 ? 14.693  -80.801 -29.703 1.00 46.14  ? 460 ASP B CG  1 
ATOM   7674 O OD1 . ASP B 1 459 ? 15.410  -81.714 -30.161 1.00 44.90  ? 460 ASP B OD1 1 
ATOM   7675 O OD2 . ASP B 1 459 ? 14.606  -79.674 -30.230 1.00 51.96  ? 460 ASP B OD2 1 
ATOM   7676 N N   . PRO B 1 460 ? 15.593  -84.164 -28.393 1.00 52.60  ? 461 PRO B N   1 
ATOM   7677 C CA  . PRO B 1 460 ? 16.843  -84.877 -28.100 1.00 52.47  ? 461 PRO B CA  1 
ATOM   7678 C C   . PRO B 1 460 ? 18.067  -83.966 -28.139 1.00 57.02  ? 461 PRO B C   1 
ATOM   7679 O O   . PRO B 1 460 ? 18.924  -84.068 -27.257 1.00 62.20  ? 461 PRO B O   1 
ATOM   7680 C CB  . PRO B 1 460 ? 16.923  -85.917 -29.219 1.00 52.60  ? 461 PRO B CB  1 
ATOM   7681 C CG  . PRO B 1 460 ? 15.501  -86.121 -29.645 1.00 62.04  ? 461 PRO B CG  1 
ATOM   7682 C CD  . PRO B 1 460 ? 14.865  -84.768 -29.523 1.00 52.98  ? 461 PRO B CD  1 
ATOM   7683 N N   . SER B 1 461 ? 18.128  -83.073 -29.123 1.00 47.06  ? 462 SER B N   1 
ATOM   7684 C CA  . SER B 1 461 ? 19.269  -82.172 -29.282 1.00 45.32  ? 462 SER B CA  1 
ATOM   7685 C C   . SER B 1 461 ? 19.448  -81.205 -28.114 1.00 48.79  ? 462 SER B C   1 
ATOM   7686 O O   . SER B 1 461 ? 20.477  -80.541 -28.005 1.00 54.45  ? 462 SER B O   1 
ATOM   7687 C CB  . SER B 1 461 ? 19.149  -81.377 -30.584 1.00 47.42  ? 462 SER B CB  1 
ATOM   7688 O OG  . SER B 1 461 ? 18.095  -80.434 -30.503 1.00 53.30  ? 462 SER B OG  1 
ATOM   7689 N N   . ARG B 1 462 ? 18.450  -81.110 -27.244 1.00 49.68  ? 463 ARG B N   1 
ATOM   7690 C CA  . ARG B 1 462 ? 18.564  -80.216 -26.097 1.00 52.59  ? 463 ARG B CA  1 
ATOM   7691 C C   . ARG B 1 462 ? 18.956  -80.970 -24.823 1.00 48.99  ? 463 ARG B C   1 
ATOM   7692 O O   . ARG B 1 462 ? 18.875  -82.197 -24.770 1.00 47.34  ? 463 ARG B O   1 
ATOM   7693 C CB  . ARG B 1 462 ? 17.289  -79.390 -25.924 1.00 43.36  ? 463 ARG B CB  1 
ATOM   7694 C CG  . ARG B 1 462 ? 17.150  -78.342 -27.012 1.00 37.66  ? 463 ARG B CG  1 
ATOM   7695 C CD  . ARG B 1 462 ? 15.782  -77.715 -27.045 1.00 39.14  ? 463 ARG B CD  1 
ATOM   7696 N NE  . ARG B 1 462 ? 15.473  -77.242 -28.391 1.00 50.65  ? 463 ARG B NE  1 
ATOM   7697 C CZ  . ARG B 1 462 ? 15.747  -76.020 -28.836 1.00 52.98  ? 463 ARG B CZ  1 
ATOM   7698 N NH1 . ARG B 1 462 ? 16.331  -75.136 -28.033 1.00 52.13  ? 463 ARG B NH1 1 
ATOM   7699 N NH2 . ARG B 1 462 ? 15.433  -75.683 -30.084 1.00 46.24  ? 463 ARG B NH2 1 
ATOM   7700 N N   . ASN B 1 463 ? 19.399  -80.234 -23.809 1.00 36.87  ? 464 ASN B N   1 
ATOM   7701 C CA  . ASN B 1 463 ? 20.015  -80.864 -22.649 1.00 42.87  ? 464 ASN B CA  1 
ATOM   7702 C C   . ASN B 1 463 ? 19.207  -80.723 -21.368 1.00 36.74  ? 464 ASN B C   1 
ATOM   7703 O O   . ASN B 1 463 ? 19.744  -80.334 -20.339 1.00 41.69  ? 464 ASN B O   1 
ATOM   7704 C CB  . ASN B 1 463 ? 21.438  -80.325 -22.447 1.00 44.77  ? 464 ASN B CB  1 
ATOM   7705 C CG  . ASN B 1 463 ? 22.293  -80.464 -23.699 1.00 54.64  ? 464 ASN B CG  1 
ATOM   7706 O OD1 . ASN B 1 463 ? 22.319  -81.523 -24.331 1.00 55.28  ? 464 ASN B OD1 1 
ATOM   7707 N ND2 . ASN B 1 463 ? 22.981  -79.390 -24.072 1.00 61.39  ? 464 ASN B ND2 1 
ATOM   7708 N N   . TYR B 1 464 ? 17.919  -81.041 -21.437 1.00 32.63  ? 465 TYR B N   1 
ATOM   7709 C CA  . TYR B 1 464 ? 17.068  -81.016 -20.256 1.00 34.75  ? 465 TYR B CA  1 
ATOM   7710 C C   . TYR B 1 464 ? 17.282  -82.302 -19.467 1.00 38.88  ? 465 TYR B C   1 
ATOM   7711 O O   . TYR B 1 464 ? 17.659  -83.328 -20.043 1.00 33.34  ? 465 TYR B O   1 
ATOM   7712 C CB  . TYR B 1 464 ? 15.594  -80.886 -20.649 1.00 33.54  ? 465 TYR B CB  1 
ATOM   7713 C CG  . TYR B 1 464 ? 15.201  -79.518 -21.167 1.00 37.43  ? 465 TYR B CG  1 
ATOM   7714 C CD1 . TYR B 1 464 ? 15.338  -79.197 -22.513 1.00 33.33  ? 465 TYR B CD1 1 
ATOM   7715 C CD2 . TYR B 1 464 ? 14.686  -78.549 -20.308 1.00 33.91  ? 465 TYR B CD2 1 
ATOM   7716 C CE1 . TYR B 1 464 ? 14.972  -77.955 -22.994 1.00 34.53  ? 465 TYR B CE1 1 
ATOM   7717 C CE2 . TYR B 1 464 ? 14.324  -77.298 -20.778 1.00 34.42  ? 465 TYR B CE2 1 
ATOM   7718 C CZ  . TYR B 1 464 ? 14.467  -77.008 -22.124 1.00 39.97  ? 465 TYR B CZ  1 
ATOM   7719 O OH  . TYR B 1 464 ? 14.107  -75.768 -22.602 1.00 36.47  ? 465 TYR B OH  1 
ATOM   7720 N N   . THR B 1 465 ? 17.047  -82.249 -18.157 1.00 30.94  ? 466 THR B N   1 
ATOM   7721 C CA  . THR B 1 465 ? 17.136  -83.445 -17.323 1.00 31.43  ? 466 THR B CA  1 
ATOM   7722 C C   . THR B 1 465 ? 15.980  -84.383 -17.639 1.00 28.60  ? 466 THR B C   1 
ATOM   7723 O O   . THR B 1 465 ? 15.010  -83.994 -18.295 1.00 32.13  ? 466 THR B O   1 
ATOM   7724 C CB  . THR B 1 465 ? 17.023  -83.104 -15.829 1.00 33.07  ? 466 THR B CB  1 
ATOM   7725 O OG1 . THR B 1 465 ? 15.667  -82.748 -15.532 1.00 35.93  ? 466 THR B OG1 1 
ATOM   7726 C CG2 . THR B 1 465 ? 17.949  -81.961 -15.455 1.00 28.47  ? 466 THR B CG2 1 
ATOM   7727 N N   . ALA B 1 466 ? 16.076  -85.616 -17.159 1.00 28.65  ? 467 ALA B N   1 
ATOM   7728 C CA  . ALA B 1 466 ? 14.982  -86.579 -17.290 1.00 33.54  ? 467 ALA B CA  1 
ATOM   7729 C C   . ALA B 1 466 ? 13.702  -86.126 -16.579 1.00 34.44  ? 467 ALA B C   1 
ATOM   7730 O O   . ALA B 1 466 ? 12.594  -86.335 -17.094 1.00 36.02  ? 467 ALA B O   1 
ATOM   7731 C CB  . ALA B 1 466 ? 15.412  -87.946 -16.778 1.00 31.05  ? 467 ALA B CB  1 
ATOM   7732 N N   . GLU B 1 467 ? 13.854  -85.531 -15.393 1.00 32.85  ? 468 GLU B N   1 
ATOM   7733 C CA  . GLU B 1 467 ? 12.713  -85.048 -14.604 1.00 32.19  ? 468 GLU B CA  1 
ATOM   7734 C C   . GLU B 1 467 ? 11.982  -83.958 -15.373 1.00 31.98  ? 468 GLU B C   1 
ATOM   7735 O O   . GLU B 1 467 ? 10.744  -83.929 -15.441 1.00 33.15  ? 468 GLU B O   1 
ATOM   7736 C CB  . GLU B 1 467 ? 13.179  -84.436 -13.284 1.00 38.17  ? 468 GLU B CB  1 
ATOM   7737 C CG  . GLU B 1 467 ? 13.987  -85.319 -12.369 1.00 38.11  ? 468 GLU B CG  1 
ATOM   7738 C CD  . GLU B 1 467 ? 14.515  -84.527 -11.177 1.00 67.49  ? 468 GLU B CD  1 
ATOM   7739 O OE1 . GLU B 1 467 ? 15.399  -83.663 -11.389 1.00 69.40  ? 468 GLU B OE1 1 
ATOM   7740 O OE2 . GLU B 1 467 ? 14.031  -84.741 -10.039 1.00 58.59  ? 468 GLU B OE2 1 
ATOM   7741 N N   . GLU B 1 468 ? 12.756  -83.046 -15.950 1.00 26.43  ? 469 GLU B N   1 
ATOM   7742 C CA  . GLU B 1 468 ? 12.167  -82.006 -16.779 1.00 29.83  ? 469 GLU B CA  1 
ATOM   7743 C C   . GLU B 1 468 ? 11.377  -82.621 -17.941 1.00 35.28  ? 469 GLU B C   1 
ATOM   7744 O O   . GLU B 1 468 ? 10.325  -82.094 -18.325 1.00 34.52  ? 469 GLU B O   1 
ATOM   7745 C CB  . GLU B 1 468 ? 13.237  -81.022 -17.249 1.00 31.62  ? 469 GLU B CB  1 
ATOM   7746 C CG  . GLU B 1 468 ? 13.855  -80.236 -16.099 1.00 27.27  ? 469 GLU B CG  1 
ATOM   7747 C CD  . GLU B 1 468 ? 14.930  -79.265 -16.544 1.00 35.17  ? 469 GLU B CD  1 
ATOM   7748 O OE1 . GLU B 1 468 ? 15.898  -79.695 -17.211 1.00 37.92  ? 469 GLU B OE1 1 
ATOM   7749 O OE2 . GLU B 1 468 ? 14.809  -78.065 -16.216 1.00 35.55  ? 469 GLU B OE2 1 
ATOM   7750 N N   . LYS B 1 469 ? 11.847  -83.754 -18.468 1.00 27.12  ? 470 LYS B N   1 
ATOM   7751 C CA  . LYS B 1 469 ? 11.096  -84.443 -19.523 1.00 33.24  ? 470 LYS B CA  1 
ATOM   7752 C C   . LYS B 1 469 ? 9.778   -84.998 -18.991 1.00 28.32  ? 470 LYS B C   1 
ATOM   7753 O O   . LYS B 1 469 ? 8.730   -84.859 -19.625 1.00 30.13  ? 470 LYS B O   1 
ATOM   7754 C CB  . LYS B 1 469 ? 11.940  -85.540 -20.188 1.00 34.23  ? 470 LYS B CB  1 
ATOM   7755 C CG  . LYS B 1 469 ? 13.039  -84.982 -21.079 1.00 37.13  ? 470 LYS B CG  1 
ATOM   7756 C CD  . LYS B 1 469 ? 14.123  -85.996 -21.405 1.00 34.36  ? 470 LYS B CD  1 
ATOM   7757 C CE  . LYS B 1 469 ? 15.294  -85.300 -22.076 1.00 32.26  ? 470 LYS B CE  1 
ATOM   7758 N NZ  . LYS B 1 469 ? 16.384  -86.220 -22.475 1.00 32.20  ? 470 LYS B NZ  1 
ATOM   7759 N N   . ILE B 1 470 ? 9.835   -85.602 -17.809 1.00 31.35  ? 471 ILE B N   1 
ATOM   7760 C CA  . ILE B 1 470 ? 8.636   -86.092 -17.123 1.00 31.03  ? 471 ILE B CA  1 
ATOM   7761 C C   . ILE B 1 470 ? 7.658   -84.948 -16.822 1.00 31.69  ? 471 ILE B C   1 
ATOM   7762 O O   . ILE B 1 470 ? 6.457   -85.057 -17.085 1.00 35.00  ? 471 ILE B O   1 
ATOM   7763 C CB  . ILE B 1 470 ? 9.015   -86.821 -15.804 1.00 34.28  ? 471 ILE B CB  1 
ATOM   7764 C CG1 . ILE B 1 470 ? 9.824   -88.084 -16.107 1.00 32.22  ? 471 ILE B CG1 1 
ATOM   7765 C CG2 . ILE B 1 470 ? 7.776   -87.142 -14.978 1.00 23.79  ? 471 ILE B CG2 1 
ATOM   7766 C CD1 . ILE B 1 470 ? 9.103   -89.056 -17.031 1.00 31.83  ? 471 ILE B CD1 1 
ATOM   7767 N N   . PHE B 1 471 ? 8.185   -83.854 -16.272 1.00 30.27  ? 472 PHE B N   1 
ATOM   7768 C CA  . PHE B 1 471 ? 7.404   -82.647 -15.978 1.00 29.51  ? 472 PHE B CA  1 
ATOM   7769 C C   . PHE B 1 471 ? 6.702   -82.106 -17.226 1.00 26.96  ? 472 PHE B C   1 
ATOM   7770 O O   . PHE B 1 471 ? 5.505   -81.797 -17.200 1.00 32.75  ? 472 PHE B O   1 
ATOM   7771 C CB  . PHE B 1 471 ? 8.341   -81.583 -15.399 1.00 34.48  ? 472 PHE B CB  1 
ATOM   7772 C CG  . PHE B 1 471 ? 7.652   -80.318 -14.955 1.00 35.49  ? 472 PHE B CG  1 
ATOM   7773 C CD1 . PHE B 1 471 ? 6.487   -80.365 -14.203 1.00 28.83  ? 472 PHE B CD1 1 
ATOM   7774 C CD2 . PHE B 1 471 ? 8.202   -79.076 -15.258 1.00 34.06  ? 472 PHE B CD2 1 
ATOM   7775 C CE1 . PHE B 1 471 ? 5.867   -79.199 -13.790 1.00 28.76  ? 472 PHE B CE1 1 
ATOM   7776 C CE2 . PHE B 1 471 ? 7.592   -77.902 -14.838 1.00 28.02  ? 472 PHE B CE2 1 
ATOM   7777 C CZ  . PHE B 1 471 ? 6.426   -77.964 -14.101 1.00 31.27  ? 472 PHE B CZ  1 
ATOM   7778 N N   . ALA B 1 472 ? 7.443   -82.001 -18.324 1.00 25.65  ? 473 ALA B N   1 
ATOM   7779 C CA  . ALA B 1 472 ? 6.865   -81.544 -19.592 1.00 27.83  ? 473 ALA B CA  1 
ATOM   7780 C C   . ALA B 1 472 ? 5.667   -82.393 -20.012 1.00 27.64  ? 473 ALA B C   1 
ATOM   7781 O O   . ALA B 1 472 ? 4.618   -81.872 -20.419 1.00 29.52  ? 473 ALA B O   1 
ATOM   7782 C CB  . ALA B 1 472 ? 7.925   -81.536 -20.687 1.00 31.48  ? 473 ALA B CB  1 
ATOM   7783 N N   . GLN B 1 473 ? 5.817   -83.706 -19.890 1.00 30.00  ? 474 GLN B N   1 
ATOM   7784 C CA  . GLN B 1 473 ? 4.739   -84.623 -20.235 1.00 31.74  ? 474 GLN B CA  1 
ATOM   7785 C C   . GLN B 1 473 ? 3.494   -84.409 -19.379 1.00 29.97  ? 474 GLN B C   1 
ATOM   7786 O O   . GLN B 1 473 ? 2.371   -84.498 -19.883 1.00 31.77  ? 474 GLN B O   1 
ATOM   7787 C CB  . GLN B 1 473 ? 5.231   -86.070 -20.169 1.00 33.97  ? 474 GLN B CB  1 
ATOM   7788 C CG  . GLN B 1 473 ? 6.143   -86.422 -21.337 1.00 35.25  ? 474 GLN B CG  1 
ATOM   7789 C CD  . GLN B 1 473 ? 6.797   -87.783 -21.206 1.00 40.29  ? 474 GLN B CD  1 
ATOM   7790 O OE1 . GLN B 1 473 ? 6.816   -88.381 -20.131 1.00 46.43  ? 474 GLN B OE1 1 
ATOM   7791 N NE2 . GLN B 1 473 ? 7.355   -88.271 -22.304 1.00 37.48  ? 474 GLN B NE2 1 
ATOM   7792 N N   . ARG B 1 474 ? 3.695   -84.111 -18.093 1.00 29.27  ? 475 ARG B N   1 
ATOM   7793 C CA  . ARG B 1 474 ? 2.582   -83.810 -17.190 1.00 30.20  ? 475 ARG B CA  1 
ATOM   7794 C C   . ARG B 1 474 ? 1.831   -82.569 -17.647 1.00 25.28  ? 475 ARG B C   1 
ATOM   7795 O O   . ARG B 1 474 ? 0.604   -82.569 -17.740 1.00 26.84  ? 475 ARG B O   1 
ATOM   7796 C CB  . ARG B 1 474 ? 3.074   -83.589 -15.749 1.00 31.13  ? 475 ARG B CB  1 
ATOM   7797 C CG  . ARG B 1 474 ? 3.437   -84.850 -14.986 1.00 39.02  ? 475 ARG B CG  1 
ATOM   7798 C CD  . ARG B 1 474 ? 3.814   -84.540 -13.533 1.00 45.08  ? 475 ARG B CD  1 
ATOM   7799 N NE  . ARG B 1 474 ? 2.830   -83.663 -12.905 1.00 41.11  ? 475 ARG B NE  1 
ATOM   7800 C CZ  . ARG B 1 474 ? 3.130   -82.644 -12.104 1.00 35.25  ? 475 ARG B CZ  1 
ATOM   7801 N NH1 . ARG B 1 474 ? 4.395   -82.365 -11.812 1.00 27.57  ? 475 ARG B NH1 1 
ATOM   7802 N NH2 . ARG B 1 474 ? 2.152   -81.903 -11.596 1.00 31.98  ? 475 ARG B NH2 1 
ATOM   7803 N N   . LEU B 1 475 ? 2.577   -81.503 -17.917 1.00 28.28  ? 476 LEU B N   1 
ATOM   7804 C CA  . LEU B 1 475 ? 1.973   -80.241 -18.334 1.00 30.19  ? 476 LEU B CA  1 
ATOM   7805 C C   . LEU B 1 475 ? 1.182   -80.388 -19.624 1.00 28.19  ? 476 LEU B C   1 
ATOM   7806 O O   . LEU B 1 475 ? 0.036   -79.923 -19.713 1.00 29.30  ? 476 LEU B O   1 
ATOM   7807 C CB  . LEU B 1 475 ? 3.036   -79.149 -18.473 1.00 26.56  ? 476 LEU B CB  1 
ATOM   7808 C CG  . LEU B 1 475 ? 3.726   -78.855 -17.140 1.00 27.59  ? 476 LEU B CG  1 
ATOM   7809 C CD1 . LEU B 1 475 ? 4.959   -78.000 -17.330 1.00 34.21  ? 476 LEU B CD1 1 
ATOM   7810 C CD2 . LEU B 1 475 ? 2.755   -78.182 -16.194 1.00 30.23  ? 476 LEU B CD2 1 
ATOM   7811 N N   . MET B 1 476 ? 1.784   -81.044 -20.614 1.00 25.75  ? 477 MET B N   1 
ATOM   7812 C CA  . MET B 1 476 ? 1.105   -81.259 -21.888 1.00 27.65  ? 477 MET B CA  1 
ATOM   7813 C C   . MET B 1 476 ? -0.210  -82.002 -21.653 1.00 32.43  ? 477 MET B C   1 
ATOM   7814 O O   . MET B 1 476 ? -1.244  -81.696 -22.276 1.00 28.24  ? 477 MET B O   1 
ATOM   7815 C CB  . MET B 1 476 ? 1.998   -82.035 -22.863 1.00 29.41  ? 477 MET B CB  1 
ATOM   7816 C CG  . MET B 1 476 ? 3.154   -81.220 -23.441 1.00 29.85  ? 477 MET B CG  1 
ATOM   7817 S SD  . MET B 1 476 ? 3.993   -82.042 -24.824 1.00 33.30  ? 477 MET B SD  1 
ATOM   7818 C CE  . MET B 1 476 ? 5.010   -83.221 -23.934 1.00 31.97  ? 477 MET B CE  1 
ATOM   7819 N N   . ARG B 1 477 ? -0.164  -82.960 -20.728 1.00 29.15  ? 478 ARG B N   1 
ATOM   7820 C CA  . ARG B 1 477 ? -1.346  -83.732 -20.363 1.00 31.18  ? 478 ARG B CA  1 
ATOM   7821 C C   . ARG B 1 477 ? -2.433  -82.835 -19.767 1.00 30.49  ? 478 ARG B C   1 
ATOM   7822 O O   . ARG B 1 477 ? -3.589  -82.907 -20.190 1.00 31.23  ? 478 ARG B O   1 
ATOM   7823 C CB  . ARG B 1 477 ? -0.980  -84.881 -19.411 1.00 31.66  ? 478 ARG B CB  1 
ATOM   7824 C CG  . ARG B 1 477 ? -2.184  -85.646 -18.865 1.00 33.52  ? 478 ARG B CG  1 
ATOM   7825 C CD  . ARG B 1 477 ? -3.070  -86.185 -19.980 1.00 40.65  ? 478 ARG B CD  1 
ATOM   7826 N NE  . ARG B 1 477 ? -2.295  -87.004 -20.903 1.00 38.11  ? 478 ARG B NE  1 
ATOM   7827 C CZ  . ARG B 1 477 ? -1.975  -88.272 -20.676 1.00 44.88  ? 478 ARG B CZ  1 
ATOM   7828 N NH1 . ARG B 1 477 ? -2.379  -88.863 -19.559 1.00 50.38  ? 478 ARG B NH1 1 
ATOM   7829 N NH2 . ARG B 1 477 ? -1.252  -88.947 -21.561 1.00 37.24  ? 478 ARG B NH2 1 
ATOM   7830 N N   . TYR B 1 478 ? -2.056  -81.987 -18.805 1.00 28.44  ? 479 TYR B N   1 
ATOM   7831 C CA  . TYR B 1 478 ? -2.989  -81.024 -18.203 1.00 29.05  ? 479 TYR B CA  1 
ATOM   7832 C C   . TYR B 1 478 ? -3.636  -80.136 -19.262 1.00 27.82  ? 479 TYR B C   1 
ATOM   7833 O O   . TYR B 1 478 ? -4.864  -80.034 -19.337 1.00 30.55  ? 479 TYR B O   1 
ATOM   7834 C CB  . TYR B 1 478 ? -2.278  -80.107 -17.202 1.00 32.44  ? 479 TYR B CB  1 
ATOM   7835 C CG  . TYR B 1 478 ? -1.810  -80.734 -15.904 1.00 26.98  ? 479 TYR B CG  1 
ATOM   7836 C CD1 . TYR B 1 478 ? -2.565  -81.696 -15.242 1.00 33.91  ? 479 TYR B CD1 1 
ATOM   7837 C CD2 . TYR B 1 478 ? -0.615  -80.339 -15.330 1.00 30.44  ? 479 TYR B CD2 1 
ATOM   7838 C CE1 . TYR B 1 478 ? -2.122  -82.255 -14.045 1.00 34.10  ? 479 TYR B CE1 1 
ATOM   7839 C CE2 . TYR B 1 478 ? -0.166  -80.887 -14.144 1.00 32.45  ? 479 TYR B CE2 1 
ATOM   7840 C CZ  . TYR B 1 478 ? -0.918  -81.841 -13.506 1.00 31.00  ? 479 TYR B CZ  1 
ATOM   7841 O OH  . TYR B 1 478 ? -0.442  -82.369 -12.333 1.00 34.18  ? 479 TYR B OH  1 
ATOM   7842 N N   . TRP B 1 479 ? -2.801  -79.478 -20.069 1.00 28.86  ? 480 TRP B N   1 
ATOM   7843 C CA  . TRP B 1 479 ? -3.298  -78.590 -21.123 1.00 28.43  ? 480 TRP B CA  1 
ATOM   7844 C C   . TRP B 1 479 ? -4.227  -79.301 -22.112 1.00 27.30  ? 480 TRP B C   1 
ATOM   7845 O O   . TRP B 1 479 ? -5.270  -78.760 -22.487 1.00 27.46  ? 480 TRP B O   1 
ATOM   7846 C CB  . TRP B 1 479 ? -2.144  -77.918 -21.874 1.00 28.68  ? 480 TRP B CB  1 
ATOM   7847 C CG  . TRP B 1 479 ? -1.758  -76.539 -21.361 1.00 31.09  ? 480 TRP B CG  1 
ATOM   7848 C CD1 . TRP B 1 479 ? -1.722  -75.375 -22.085 1.00 29.73  ? 480 TRP B CD1 1 
ATOM   7849 C CD2 . TRP B 1 479 ? -1.345  -76.192 -20.030 1.00 27.33  ? 480 TRP B CD2 1 
ATOM   7850 N NE1 . TRP B 1 479 ? -1.315  -74.330 -21.288 1.00 30.93  ? 480 TRP B NE1 1 
ATOM   7851 C CE2 . TRP B 1 479 ? -1.077  -74.803 -20.023 1.00 29.26  ? 480 TRP B CE2 1 
ATOM   7852 C CE3 . TRP B 1 479 ? -1.168  -76.920 -18.845 1.00 29.50  ? 480 TRP B CE3 1 
ATOM   7853 C CZ2 . TRP B 1 479 ? -0.648  -74.127 -18.875 1.00 27.84  ? 480 TRP B CZ2 1 
ATOM   7854 C CZ3 . TRP B 1 479 ? -0.744  -76.247 -17.705 1.00 34.28  ? 480 TRP B CZ3 1 
ATOM   7855 C CH2 . TRP B 1 479 ? -0.492  -74.863 -17.728 1.00 30.79  ? 480 TRP B CH2 1 
ATOM   7856 N N   . ALA B 1 480 ? -3.861  -80.512 -22.527 1.00 24.55  ? 481 ALA B N   1 
ATOM   7857 C CA  . ALA B 1 480 ? -4.669  -81.220 -23.525 1.00 30.43  ? 481 ALA B CA  1 
ATOM   7858 C C   . ALA B 1 480 ? -5.964  -81.742 -22.914 1.00 33.17  ? 481 ALA B C   1 
ATOM   7859 O O   . ALA B 1 480 ? -7.020  -81.735 -23.566 1.00 29.80  ? 481 ALA B O   1 
ATOM   7860 C CB  . ALA B 1 480 ? -3.881  -82.354 -24.159 1.00 28.89  ? 481 ALA B CB  1 
ATOM   7861 N N   . ASN B 1 481 ? -5.878  -82.197 -21.664 1.00 29.77  ? 482 ASN B N   1 
ATOM   7862 C CA  . ASN B 1 481 ? -7.073  -82.594 -20.925 1.00 30.23  ? 482 ASN B CA  1 
ATOM   7863 C C   . ASN B 1 481 ? -8.049  -81.431 -20.856 1.00 33.03  ? 482 ASN B C   1 
ATOM   7864 O O   . ASN B 1 481 ? -9.249  -81.595 -21.107 1.00 36.27  ? 482 ASN B O   1 
ATOM   7865 C CB  . ASN B 1 481 ? -6.724  -83.059 -19.510 1.00 35.97  ? 482 ASN B CB  1 
ATOM   7866 C CG  . ASN B 1 481 ? -6.208  -84.486 -19.466 1.00 39.32  ? 482 ASN B CG  1 
ATOM   7867 O OD1 . ASN B 1 481 ? -6.312  -85.237 -20.437 1.00 37.03  ? 482 ASN B OD1 1 
ATOM   7868 N ND2 . ASN B 1 481 ? -5.657  -84.869 -18.325 1.00 41.75  ? 482 ASN B ND2 1 
ATOM   7869 N N   . PHE B 1 482 ? -7.530  -80.251 -20.529 1.00 28.65  ? 483 PHE B N   1 
ATOM   7870 C CA  . PHE B 1 482 ? -8.365  -79.063 -20.489 1.00 30.29  ? 483 PHE B CA  1 
ATOM   7871 C C   . PHE B 1 482 ? -8.939  -78.752 -21.871 1.00 31.38  ? 483 PHE B C   1 
ATOM   7872 O O   . PHE B 1 482 ? -10.121 -78.418 -22.002 1.00 32.54  ? 483 PHE B O   1 
ATOM   7873 C CB  . PHE B 1 482 ? -7.588  -77.856 -19.960 1.00 30.05  ? 483 PHE B CB  1 
ATOM   7874 C CG  . PHE B 1 482 ? -8.379  -76.590 -19.995 1.00 30.37  ? 483 PHE B CG  1 
ATOM   7875 C CD1 . PHE B 1 482 ? -9.314  -76.317 -19.002 1.00 27.87  ? 483 PHE B CD1 1 
ATOM   7876 C CD2 . PHE B 1 482 ? -8.221  -75.682 -21.036 1.00 21.47  ? 483 PHE B CD2 1 
ATOM   7877 C CE1 . PHE B 1 482 ? -10.069 -75.155 -19.037 1.00 27.97  ? 483 PHE B CE1 1 
ATOM   7878 C CE2 . PHE B 1 482 ? -8.971  -74.514 -21.074 1.00 27.81  ? 483 PHE B CE2 1 
ATOM   7879 C CZ  . PHE B 1 482 ? -9.897  -74.249 -20.069 1.00 29.42  ? 483 PHE B CZ  1 
ATOM   7880 N N   . ALA B 1 483 ? -8.097  -78.843 -22.898 1.00 32.76  ? 484 ALA B N   1 
ATOM   7881 C CA  . ALA B 1 483 ? -8.553  -78.647 -24.275 1.00 32.25  ? 484 ALA B CA  1 
ATOM   7882 C C   . ALA B 1 483 ? -9.680  -79.622 -24.591 1.00 28.99  ? 484 ALA B C   1 
ATOM   7883 O O   . ALA B 1 483 ? -10.722 -79.226 -25.095 1.00 29.17  ? 484 ALA B O   1 
ATOM   7884 C CB  . ALA B 1 483 ? -7.403  -78.829 -25.256 1.00 26.97  ? 484 ALA B CB  1 
ATOM   7885 N N   . ARG B 1 484 ? -9.472  -80.894 -24.265 1.00 26.98  ? 485 ARG B N   1 
ATOM   7886 C CA  . ARG B 1 484 ? -10.477 -81.923 -24.532 1.00 31.57  ? 485 ARG B CA  1 
ATOM   7887 C C   . ARG B 1 484 ? -11.759 -81.803 -23.706 1.00 36.56  ? 485 ARG B C   1 
ATOM   7888 O O   . ARG B 1 484 ? -12.850 -81.897 -24.260 1.00 38.56  ? 485 ARG B O   1 
ATOM   7889 C CB  . ARG B 1 484 ? -9.883  -83.321 -24.356 1.00 28.46  ? 485 ARG B CB  1 
ATOM   7890 C CG  . ARG B 1 484 ? -8.904  -83.710 -25.447 1.00 31.61  ? 485 ARG B CG  1 
ATOM   7891 C CD  . ARG B 1 484 ? -8.383  -85.114 -25.232 1.00 33.25  ? 485 ARG B CD  1 
ATOM   7892 N NE  . ARG B 1 484 ? -7.505  -85.188 -24.072 1.00 33.24  ? 485 ARG B NE  1 
ATOM   7893 C CZ  . ARG B 1 484 ? -6.185  -85.270 -24.157 1.00 31.54  ? 485 ARG B CZ  1 
ATOM   7894 N NH1 . ARG B 1 484 ? -5.609  -85.299 -25.348 1.00 30.12  ? 485 ARG B NH1 1 
ATOM   7895 N NH2 . ARG B 1 484 ? -5.445  -85.325 -23.060 1.00 30.18  ? 485 ARG B NH2 1 
ATOM   7896 N N   . THR B 1 485 ? -11.629 -81.584 -22.396 1.00 34.57  ? 486 THR B N   1 
ATOM   7897 C CA  . THR B 1 485 ? -12.768 -81.715 -21.479 1.00 33.63  ? 486 THR B CA  1 
ATOM   7898 C C   . THR B 1 485 ? -13.149 -80.440 -20.724 1.00 40.33  ? 486 THR B C   1 
ATOM   7899 O O   . THR B 1 485 ? -14.202 -80.390 -20.086 1.00 38.60  ? 486 THR B O   1 
ATOM   7900 C CB  . THR B 1 485 ? -12.487 -82.771 -20.397 1.00 33.34  ? 486 THR B CB  1 
ATOM   7901 O OG1 . THR B 1 485 ? -11.571 -82.229 -19.443 1.00 34.03  ? 486 THR B OG1 1 
ATOM   7902 C CG2 . THR B 1 485 ? -11.891 -84.040 -20.998 1.00 30.02  ? 486 THR B CG2 1 
ATOM   7903 N N   . GLY B 1 486 ? -12.296 -79.421 -20.778 1.00 39.51  ? 487 GLY B N   1 
ATOM   7904 C CA  . GLY B 1 486 ? -12.513 -78.212 -20.002 1.00 32.25  ? 487 GLY B CA  1 
ATOM   7905 C C   . GLY B 1 486 ? -12.058 -78.411 -18.566 1.00 36.45  ? 487 GLY B C   1 
ATOM   7906 O O   . GLY B 1 486 ? -12.347 -77.601 -17.693 1.00 35.41  ? 487 GLY B O   1 
ATOM   7907 N N   . ASP B 1 487 ? -11.332 -79.499 -18.333 1.00 33.82  ? 488 ASP B N   1 
ATOM   7908 C CA  . ASP B 1 487 ? -10.882 -79.877 -17.003 1.00 35.89  ? 488 ASP B CA  1 
ATOM   7909 C C   . ASP B 1 487 ? -9.521  -80.543 -17.139 1.00 31.35  ? 488 ASP B C   1 
ATOM   7910 O O   . ASP B 1 487 ? -9.403  -81.582 -17.776 1.00 32.08  ? 488 ASP B O   1 
ATOM   7911 C CB  . ASP B 1 487 ? -11.889 -80.855 -16.385 1.00 39.52  ? 488 ASP B CB  1 
ATOM   7912 C CG  . ASP B 1 487 ? -11.554 -81.243 -14.941 1.00 41.42  ? 488 ASP B CG  1 
ATOM   7913 O OD1 . ASP B 1 487 ? -10.359 -81.276 -14.552 1.00 36.86  ? 488 ASP B OD1 1 
ATOM   7914 O OD2 . ASP B 1 487 ? -12.512 -81.547 -14.194 1.00 46.86  ? 488 ASP B OD2 1 
ATOM   7915 N N   . PRO B 1 488 ? -8.491  -79.958 -16.513 1.00 34.82  ? 489 PRO B N   1 
ATOM   7916 C CA  . PRO B 1 488 ? -7.123  -80.485 -16.637 1.00 36.08  ? 489 PRO B CA  1 
ATOM   7917 C C   . PRO B 1 488 ? -6.901  -81.789 -15.875 1.00 37.99  ? 489 PRO B C   1 
ATOM   7918 O O   . PRO B 1 488 ? -5.870  -82.427 -16.077 1.00 42.11  ? 489 PRO B O   1 
ATOM   7919 C CB  . PRO B 1 488 ? -6.267  -79.374 -16.014 1.00 31.04  ? 489 PRO B CB  1 
ATOM   7920 C CG  . PRO B 1 488 ? -7.184  -78.735 -14.996 1.00 30.17  ? 489 PRO B CG  1 
ATOM   7921 C CD  . PRO B 1 488 ? -8.557  -78.774 -15.635 1.00 31.37  ? 489 PRO B CD  1 
ATOM   7922 N N   . ASN B 1 489 ? -7.837  -82.170 -15.009 1.00 38.18  ? 490 ASN B N   1 
ATOM   7923 C CA  . ASN B 1 489 ? -7.663  -83.360 -14.181 1.00 39.65  ? 490 ASN B CA  1 
ATOM   7924 C C   . ASN B 1 489 ? -7.793  -84.666 -14.949 1.00 45.21  ? 490 ASN B C   1 
ATOM   7925 O O   . ASN B 1 489 ? -8.653  -84.802 -15.824 1.00 44.90  ? 490 ASN B O   1 
ATOM   7926 C CB  . ASN B 1 489 ? -8.656  -83.365 -13.019 1.00 45.74  ? 490 ASN B CB  1 
ATOM   7927 C CG  . ASN B 1 489 ? -8.380  -82.274 -12.015 1.00 40.33  ? 490 ASN B CG  1 
ATOM   7928 O OD1 . ASN B 1 489 ? -7.422  -82.356 -11.245 1.00 37.83  ? 490 ASN B OD1 1 
ATOM   7929 N ND2 . ASN B 1 489 ? -9.224  -81.242 -12.011 1.00 35.03  ? 490 ASN B ND2 1 
ATOM   7930 N N   . GLU B 1 490 ? -6.941  -85.623 -14.589 1.00 55.33  ? 491 GLU B N   1 
ATOM   7931 C CA  . GLU B 1 490 ? -6.911  -86.948 -15.208 1.00 69.63  ? 491 GLU B CA  1 
ATOM   7932 C C   . GLU B 1 490 ? -8.223  -87.714 -15.037 1.00 78.82  ? 491 GLU B C   1 
ATOM   7933 O O   . GLU B 1 490 ? -8.550  -88.151 -13.925 1.00 79.15  ? 491 GLU B O   1 
ATOM   7934 C CB  . GLU B 1 490 ? -5.748  -87.772 -14.641 1.00 71.44  ? 491 GLU B CB  1 
ATOM   7935 C CG  . GLU B 1 490 ? -4.364  -87.310 -15.090 1.00 66.98  ? 491 GLU B CG  1 
ATOM   7936 C CD  . GLU B 1 490 ? -3.985  -87.828 -16.475 1.00 72.35  ? 491 GLU B CD  1 
ATOM   7937 O OE1 . GLU B 1 490 ? -4.876  -87.948 -17.354 1.00 55.13  ? 491 GLU B OE1 1 
ATOM   7938 O OE2 . GLU B 1 490 ? -2.786  -88.123 -16.677 1.00 74.59  ? 491 GLU B OE2 1 
ATOM   7939 N N   . PRO B 1 491 ? -8.966  -87.890 -16.147 1.00 73.11  ? 492 PRO B N   1 
ATOM   7940 C CA  . PRO B 1 491 ? -10.289 -88.524 -16.145 1.00 75.66  ? 492 PRO B CA  1 
ATOM   7941 C C   . PRO B 1 491 ? -10.242 -89.959 -15.625 1.00 84.39  ? 492 PRO B C   1 
ATOM   7942 O O   . PRO B 1 491 ? -10.436 -90.166 -14.424 1.00 81.79  ? 492 PRO B O   1 
ATOM   7943 C CB  . PRO B 1 491 ? -10.685 -88.505 -17.625 1.00 69.90  ? 492 PRO B CB  1 
ATOM   7944 C CG  . PRO B 1 491 ? -9.872  -87.394 -18.225 1.00 67.01  ? 492 PRO B CG  1 
ATOM   7945 C CD  . PRO B 1 491 ? -8.567  -87.468 -17.503 1.00 68.56  ? 492 PRO B CD  1 
ATOM   7946 N N   . PRO B 1 494 ? -7.465  -90.444 -10.794 1.00 93.58  ? 495 PRO B N   1 
ATOM   7947 C CA  . PRO B 1 494 ? -7.195  -91.627 -9.965  1.00 93.56  ? 495 PRO B CA  1 
ATOM   7948 C C   . PRO B 1 494 ? -6.749  -91.260 -8.544  1.00 92.41  ? 495 PRO B C   1 
ATOM   7949 O O   . PRO B 1 494 ? -7.474  -90.566 -7.828  1.00 86.42  ? 495 PRO B O   1 
ATOM   7950 C CB  . PRO B 1 494 ? -6.060  -92.332 -10.720 1.00 93.54  ? 495 PRO B CB  1 
ATOM   7951 C CG  . PRO B 1 494 ? -5.427  -91.257 -11.565 1.00 82.16  ? 495 PRO B CG  1 
ATOM   7952 C CD  . PRO B 1 494 ? -6.554  -90.350 -11.950 1.00 83.30  ? 495 PRO B CD  1 
ATOM   7953 N N   . LYS B 1 495 ? -5.569  -91.732 -8.148  1.00 95.82  ? 496 LYS B N   1 
ATOM   7954 C CA  . LYS B 1 495 ? -5.007  -91.419 -6.836  1.00 92.71  ? 496 LYS B CA  1 
ATOM   7955 C C   . LYS B 1 495 ? -4.252  -90.095 -6.883  1.00 94.78  ? 496 LYS B C   1 
ATOM   7956 O O   . LYS B 1 495 ? -3.937  -89.509 -5.841  1.00 88.13  ? 496 LYS B O   1 
ATOM   7957 C CB  . LYS B 1 495 ? -4.057  -92.529 -6.381  1.00 99.58  ? 496 LYS B CB  1 
ATOM   7958 C CG  . LYS B 1 495 ? -4.622  -93.934 -6.517  1.00 106.37 ? 496 LYS B CG  1 
ATOM   7959 C CD  . LYS B 1 495 ? -3.606  -94.984 -6.093  1.00 103.35 ? 496 LYS B CD  1 
ATOM   7960 C CE  . LYS B 1 495 ? -4.119  -96.390 -6.359  1.00 99.27  ? 496 LYS B CE  1 
ATOM   7961 N NZ  . LYS B 1 495 ? -4.321  -96.643 -7.813  1.00 103.74 ? 496 LYS B NZ  1 
ATOM   7962 N N   . ALA B 1 496 ? -3.961  -89.642 -8.102  1.00 94.80  ? 497 ALA B N   1 
ATOM   7963 C CA  . ALA B 1 496 ? -3.260  -88.382 -8.344  1.00 85.36  ? 497 ALA B CA  1 
ATOM   7964 C C   . ALA B 1 496 ? -3.964  -87.203 -7.674  1.00 80.54  ? 497 ALA B C   1 
ATOM   7965 O O   . ALA B 1 496 ? -5.200  -87.135 -7.676  1.00 75.82  ? 497 ALA B O   1 
ATOM   7966 C CB  . ALA B 1 496 ? -3.124  -88.134 -9.848  1.00 74.35  ? 497 ALA B CB  1 
ATOM   7967 N N   . PRO B 1 497 ? -3.179  -86.274 -7.094  1.00 74.59  ? 498 PRO B N   1 
ATOM   7968 C CA  . PRO B 1 497 ? -3.739  -85.085 -6.430  1.00 66.98  ? 498 PRO B CA  1 
ATOM   7969 C C   . PRO B 1 497 ? -4.560  -84.253 -7.407  1.00 56.40  ? 498 PRO B C   1 
ATOM   7970 O O   . PRO B 1 497 ? -4.172  -84.090 -8.567  1.00 57.18  ? 498 PRO B O   1 
ATOM   7971 C CB  . PRO B 1 497 ? -2.499  -84.311 -5.968  1.00 60.00  ? 498 PRO B CB  1 
ATOM   7972 C CG  . PRO B 1 497 ? -1.367  -84.844 -6.805  1.00 60.62  ? 498 PRO B CG  1 
ATOM   7973 C CD  . PRO B 1 497 ? -1.705  -86.277 -7.083  1.00 66.47  ? 498 PRO B CD  1 
ATOM   7974 N N   . GLN B 1 498 ? -5.699  -83.754 -6.945  1.00 54.59  ? 499 GLN B N   1 
ATOM   7975 C CA  . GLN B 1 498 ? -6.618  -83.056 -7.827  1.00 49.15  ? 499 GLN B CA  1 
ATOM   7976 C C   . GLN B 1 498 ? -6.344  -81.559 -7.897  1.00 47.24  ? 499 GLN B C   1 
ATOM   7977 O O   . GLN B 1 498 ? -5.898  -80.945 -6.931  1.00 42.86  ? 499 GLN B O   1 
ATOM   7978 C CB  . GLN B 1 498 ? -8.074  -83.315 -7.422  1.00 47.31  ? 499 GLN B CB  1 
ATOM   7979 C CG  . GLN B 1 498 ? -8.555  -84.733 -7.714  1.00 52.53  ? 499 GLN B CG  1 
ATOM   7980 C CD  . GLN B 1 498 ? -8.407  -85.117 -9.181  1.00 57.98  ? 499 GLN B CD  1 
ATOM   7981 O OE1 . GLN B 1 498 ? -7.399  -85.708 -9.582  1.00 56.52  ? 499 GLN B OE1 1 
ATOM   7982 N NE2 . GLN B 1 498 ? -9.418  -84.785 -9.988  1.00 48.44  ? 499 GLN B NE2 1 
ATOM   7983 N N   . TRP B 1 499 ? -6.623  -80.989 -9.061  1.00 38.86  ? 500 TRP B N   1 
ATOM   7984 C CA  . TRP B 1 499 ? -6.502  -79.566 -9.297  1.00 34.69  ? 500 TRP B CA  1 
ATOM   7985 C C   . TRP B 1 499 ? -7.907  -78.969 -9.180  1.00 34.65  ? 500 TRP B C   1 
ATOM   7986 O O   . TRP B 1 499 ? -8.733  -79.131 -10.079 1.00 37.69  ? 500 TRP B O   1 
ATOM   7987 C CB  . TRP B 1 499 ? -5.918  -79.369 -10.698 1.00 41.55  ? 500 TRP B CB  1 
ATOM   7988 C CG  . TRP B 1 499 ? -5.628  -77.960 -11.135 1.00 38.22  ? 500 TRP B CG  1 
ATOM   7989 C CD1 . TRP B 1 499 ? -6.144  -76.803 -10.622 1.00 34.25  ? 500 TRP B CD1 1 
ATOM   7990 C CD2 . TRP B 1 499 ? -4.754  -77.571 -12.202 1.00 39.65  ? 500 TRP B CD2 1 
ATOM   7991 N NE1 . TRP B 1 499 ? -5.641  -75.719 -11.300 1.00 34.90  ? 500 TRP B NE1 1 
ATOM   7992 C CE2 . TRP B 1 499 ? -4.787  -76.164 -12.277 1.00 37.05  ? 500 TRP B CE2 1 
ATOM   7993 C CE3 . TRP B 1 499 ? -3.945  -78.280 -13.100 1.00 35.02  ? 500 TRP B CE3 1 
ATOM   7994 C CZ2 . TRP B 1 499 ? -4.033  -75.452 -13.205 1.00 30.75  ? 500 TRP B CZ2 1 
ATOM   7995 C CZ3 . TRP B 1 499 ? -3.204  -77.574 -14.023 1.00 34.86  ? 500 TRP B CZ3 1 
ATOM   7996 C CH2 . TRP B 1 499 ? -3.251  -76.173 -14.069 1.00 36.96  ? 500 TRP B CH2 1 
ATOM   7997 N N   . PRO B 1 500 ? -8.189  -78.287 -8.060  1.00 31.64  ? 501 PRO B N   1 
ATOM   7998 C CA  . PRO B 1 500 ? -9.540  -77.776 -7.815  1.00 30.45  ? 501 PRO B CA  1 
ATOM   7999 C C   . PRO B 1 500 ? -9.778  -76.488 -8.566  1.00 31.33  ? 501 PRO B C   1 
ATOM   8000 O O   . PRO B 1 500 ? -8.821  -75.780 -8.855  1.00 32.68  ? 501 PRO B O   1 
ATOM   8001 C CB  . PRO B 1 500 ? -9.533  -77.487 -6.307  1.00 33.24  ? 501 PRO B CB  1 
ATOM   8002 C CG  . PRO B 1 500 ? -8.130  -77.170 -6.001  1.00 28.56  ? 501 PRO B CG  1 
ATOM   8003 C CD  . PRO B 1 500 ? -7.289  -78.033 -6.921  1.00 35.36  ? 501 PRO B CD  1 
ATOM   8004 N N   . PRO B 1 501 ? -11.042 -76.185 -8.879  1.00 28.84  ? 502 PRO B N   1 
ATOM   8005 C CA  . PRO B 1 501 ? -11.390 -74.898 -9.481  1.00 27.44  ? 502 PRO B CA  1 
ATOM   8006 C C   . PRO B 1 501 ? -10.953 -73.717 -8.627  1.00 32.99  ? 502 PRO B C   1 
ATOM   8007 O O   . PRO B 1 501 ? -10.860 -73.824 -7.407  1.00 35.77  ? 502 PRO B O   1 
ATOM   8008 C CB  . PRO B 1 501 ? -12.914 -74.951 -9.554  1.00 29.79  ? 502 PRO B CB  1 
ATOM   8009 C CG  . PRO B 1 501 ? -13.222 -76.406 -9.663  1.00 33.68  ? 502 PRO B CG  1 
ATOM   8010 C CD  . PRO B 1 501 ? -12.193 -77.103 -8.824  1.00 24.49  ? 502 PRO B CD  1 
ATOM   8011 N N   . TYR B 1 502 ? -10.670 -72.597 -9.282  1.00 35.80  ? 503 TYR B N   1 
ATOM   8012 C CA  . TYR B 1 502 ? -10.371 -71.360 -8.590  1.00 33.47  ? 503 TYR B CA  1 
ATOM   8013 C C   . TYR B 1 502 ? -11.695 -70.621 -8.393  1.00 36.89  ? 503 TYR B C   1 
ATOM   8014 O O   . TYR B 1 502 ? -12.530 -70.590 -9.293  1.00 33.91  ? 503 TYR B O   1 
ATOM   8015 C CB  . TYR B 1 502 ? -9.379  -70.523 -9.410  1.00 30.39  ? 503 TYR B CB  1 
ATOM   8016 C CG  . TYR B 1 502 ? -9.063  -69.164 -8.822  1.00 23.65  ? 503 TYR B CG  1 
ATOM   8017 C CD1 . TYR B 1 502 ? -9.891  -68.077 -9.063  1.00 25.89  ? 503 TYR B CD1 1 
ATOM   8018 C CD2 . TYR B 1 502 ? -7.928  -68.967 -8.042  1.00 22.72  ? 503 TYR B CD2 1 
ATOM   8019 C CE1 . TYR B 1 502 ? -9.617  -66.838 -8.539  1.00 27.82  ? 503 TYR B CE1 1 
ATOM   8020 C CE2 . TYR B 1 502 ? -7.644  -67.721 -7.504  1.00 31.74  ? 503 TYR B CE2 1 
ATOM   8021 C CZ  . TYR B 1 502 ? -8.497  -66.658 -7.758  1.00 31.04  ? 503 TYR B CZ  1 
ATOM   8022 O OH  . TYR B 1 502 ? -8.237  -65.410 -7.234  1.00 29.50  ? 503 TYR B OH  1 
ATOM   8023 N N   . THR B 1 503 ? -11.895 -70.040 -7.212  1.00 33.36  ? 504 THR B N   1 
ATOM   8024 C CA  . THR B 1 503 ? -13.127 -69.299 -6.917  1.00 37.07  ? 504 THR B CA  1 
ATOM   8025 C C   . THR B 1 503 ? -12.785 -68.000 -6.197  1.00 32.66  ? 504 THR B C   1 
ATOM   8026 O O   . THR B 1 503 ? -11.712 -67.888 -5.607  1.00 37.26  ? 504 THR B O   1 
ATOM   8027 C CB  . THR B 1 503 ? -14.083 -70.123 -6.033  1.00 36.25  ? 504 THR B CB  1 
ATOM   8028 O OG1 . THR B 1 503 ? -13.404 -70.502 -4.830  1.00 37.37  ? 504 THR B OG1 1 
ATOM   8029 C CG2 . THR B 1 503 ? -14.535 -71.381 -6.769  1.00 34.66  ? 504 THR B CG2 1 
ATOM   8030 N N   . ALA B 1 504 ? -13.690 -67.025 -6.240  1.00 32.36  ? 505 ALA B N   1 
ATOM   8031 C CA  . ALA B 1 504 ? -13.436 -65.721 -5.623  1.00 32.22  ? 505 ALA B CA  1 
ATOM   8032 C C   . ALA B 1 504 ? -13.166 -65.810 -4.118  1.00 34.97  ? 505 ALA B C   1 
ATOM   8033 O O   . ALA B 1 504 ? -12.400 -65.013 -3.568  1.00 42.44  ? 505 ALA B O   1 
ATOM   8034 C CB  . ALA B 1 504 ? -14.583 -64.763 -5.903  1.00 30.32  ? 505 ALA B CB  1 
ATOM   8035 N N   . GLY B 1 505 ? -13.777 -66.786 -3.451  1.00 37.48  ? 506 GLY B N   1 
ATOM   8036 C CA  . GLY B 1 505 ? -13.607 -66.928 -2.011  1.00 28.51  ? 506 GLY B CA  1 
ATOM   8037 C C   . GLY B 1 505 ? -12.413 -67.777 -1.622  1.00 32.56  ? 506 GLY B C   1 
ATOM   8038 O O   . GLY B 1 505 ? -11.454 -67.280 -1.033  1.00 36.27  ? 506 GLY B O   1 
ATOM   8039 N N   . ALA B 1 506 ? -12.460 -69.066 -1.944  1.00 30.47  ? 507 ALA B N   1 
ATOM   8040 C CA  . ALA B 1 506 ? -11.356 -69.950 -1.582  1.00 26.11  ? 507 ALA B CA  1 
ATOM   8041 C C   . ALA B 1 506 ? -10.058 -69.600 -2.327  1.00 32.67  ? 507 ALA B C   1 
ATOM   8042 O O   . ALA B 1 506 ? -8.961  -69.788 -1.787  1.00 30.93  ? 507 ALA B O   1 
ATOM   8043 C CB  . ALA B 1 506 ? -11.743 -71.415 -1.797  1.00 25.21  ? 507 ALA B CB  1 
ATOM   8044 N N   . GLN B 1 507 ? -10.189 -69.099 -3.562  1.00 30.55  ? 508 GLN B N   1 
ATOM   8045 C CA  . GLN B 1 507 ? -9.038  -68.648 -4.350  1.00 29.79  ? 508 GLN B CA  1 
ATOM   8046 C C   . GLN B 1 507 ? -7.941  -69.712 -4.496  1.00 27.63  ? 508 GLN B C   1 
ATOM   8047 O O   . GLN B 1 507 ? -6.749  -69.412 -4.394  1.00 28.51  ? 508 GLN B O   1 
ATOM   8048 C CB  . GLN B 1 507 ? -8.447  -67.369 -3.740  1.00 27.28  ? 508 GLN B CB  1 
ATOM   8049 C CG  . GLN B 1 507 ? -9.380  -66.159 -3.787  1.00 27.26  ? 508 GLN B CG  1 
ATOM   8050 C CD  . GLN B 1 507 ? -8.937  -65.056 -2.836  1.00 37.73  ? 508 GLN B CD  1 
ATOM   8051 O OE1 . GLN B 1 507 ? -7.865  -64.470 -2.996  1.00 39.71  ? 508 GLN B OE1 1 
ATOM   8052 N NE2 . GLN B 1 507 ? -9.753  -64.787 -1.823  1.00 38.04  ? 508 GLN B NE2 1 
ATOM   8053 N N   . GLN B 1 508 ? -8.338  -70.956 -4.721  1.00 23.10  ? 509 GLN B N   1 
ATOM   8054 C CA  . GLN B 1 508 ? -7.362  -72.041 -4.801  1.00 31.41  ? 509 GLN B CA  1 
ATOM   8055 C C   . GLN B 1 508 ? -6.646  -72.129 -6.156  1.00 27.99  ? 509 GLN B C   1 
ATOM   8056 O O   . GLN B 1 508 ? -7.261  -71.966 -7.209  1.00 28.20  ? 509 GLN B O   1 
ATOM   8057 C CB  . GLN B 1 508 ? -8.033  -73.378 -4.491  1.00 34.21  ? 509 GLN B CB  1 
ATOM   8058 C CG  . GLN B 1 508 ? -8.465  -73.538 -3.048  1.00 37.13  ? 509 GLN B CG  1 
ATOM   8059 C CD  . GLN B 1 508 ? -9.354  -74.748 -2.849  1.00 34.77  ? 509 GLN B CD  1 
ATOM   8060 O OE1 . GLN B 1 508 ? -10.475 -74.808 -3.370  1.00 32.82  ? 509 GLN B OE1 1 
ATOM   8061 N NE2 . GLN B 1 508 ? -8.858  -75.722 -2.099  1.00 34.65  ? 509 GLN B NE2 1 
ATOM   8062 N N   . TYR B 1 509 ? -5.346  -72.399 -6.116  1.00 31.23  ? 510 TYR B N   1 
ATOM   8063 C CA  . TYR B 1 509 ? -4.562  -72.632 -7.328  1.00 31.43  ? 510 TYR B CA  1 
ATOM   8064 C C   . TYR B 1 509 ? -3.547  -73.730 -7.031  1.00 32.56  ? 510 TYR B C   1 
ATOM   8065 O O   . TYR B 1 509 ? -3.327  -74.069 -5.869  1.00 29.90  ? 510 TYR B O   1 
ATOM   8066 C CB  . TYR B 1 509 ? -3.848  -71.351 -7.762  1.00 26.39  ? 510 TYR B CB  1 
ATOM   8067 C CG  . TYR B 1 509 ? -2.780  -70.887 -6.802  1.00 29.83  ? 510 TYR B CG  1 
ATOM   8068 C CD1 . TYR B 1 509 ? -3.086  -70.027 -5.741  1.00 27.82  ? 510 TYR B CD1 1 
ATOM   8069 C CD2 . TYR B 1 509 ? -1.462  -71.305 -6.950  1.00 28.70  ? 510 TYR B CD2 1 
ATOM   8070 C CE1 . TYR B 1 509 ? -2.098  -69.602 -4.855  1.00 24.99  ? 510 TYR B CE1 1 
ATOM   8071 C CE2 . TYR B 1 509 ? -0.479  -70.899 -6.067  1.00 29.64  ? 510 TYR B CE2 1 
ATOM   8072 C CZ  . TYR B 1 509 ? -0.798  -70.041 -5.026  1.00 31.32  ? 510 TYR B CZ  1 
ATOM   8073 O OH  . TYR B 1 509 ? 0.201   -69.639 -4.159  1.00 35.33  ? 510 TYR B OH  1 
ATOM   8074 N N   . VAL B 1 510 ? -2.923  -74.285 -8.064  1.00 29.74  ? 511 VAL B N   1 
ATOM   8075 C CA  . VAL B 1 510 ? -1.872  -75.279 -7.844  1.00 29.67  ? 511 VAL B CA  1 
ATOM   8076 C C   . VAL B 1 510 ? -0.492  -74.766 -8.251  1.00 32.62  ? 511 VAL B C   1 
ATOM   8077 O O   . VAL B 1 510 ? -0.351  -73.955 -9.168  1.00 29.52  ? 511 VAL B O   1 
ATOM   8078 C CB  . VAL B 1 510 ? -2.141  -76.613 -8.590  1.00 32.29  ? 511 VAL B CB  1 
ATOM   8079 C CG1 . VAL B 1 510 ? -3.408  -77.281 -8.065  1.00 30.45  ? 511 VAL B CG1 1 
ATOM   8080 C CG2 . VAL B 1 510 ? -2.216  -76.376 -10.104 1.00 27.65  ? 511 VAL B CG2 1 
ATOM   8081 N N   . SER B 1 511 ? 0.525   -75.247 -7.551  1.00 28.64  ? 512 SER B N   1 
ATOM   8082 C CA  . SER B 1 511 ? 1.896   -75.006 -7.938  1.00 34.11  ? 512 SER B CA  1 
ATOM   8083 C C   . SER B 1 511 ? 2.317   -76.074 -8.957  1.00 36.00  ? 512 SER B C   1 
ATOM   8084 O O   . SER B 1 511 ? 2.051   -77.264 -8.775  1.00 30.27  ? 512 SER B O   1 
ATOM   8085 C CB  . SER B 1 511 ? 2.798   -75.054 -6.706  1.00 34.02  ? 512 SER B CB  1 
ATOM   8086 O OG  . SER B 1 511 ? 2.723   -76.327 -6.093  1.00 43.32  ? 512 SER B OG  1 
ATOM   8087 N N   . LEU B 1 512 ? 2.944   -75.643 -10.043 1.00 28.39  ? 513 LEU B N   1 
ATOM   8088 C CA  . LEU B 1 512 ? 3.435   -76.574 -11.041 1.00 25.34  ? 513 LEU B CA  1 
ATOM   8089 C C   . LEU B 1 512 ? 4.942   -76.554 -10.987 1.00 29.67  ? 513 LEU B C   1 
ATOM   8090 O O   . LEU B 1 512 ? 5.570   -75.532 -11.287 1.00 28.61  ? 513 LEU B O   1 
ATOM   8091 C CB  . LEU B 1 512 ? 2.964   -76.184 -12.435 1.00 26.14  ? 513 LEU B CB  1 
ATOM   8092 C CG  . LEU B 1 512 ? 1.458   -76.185 -12.688 1.00 29.14  ? 513 LEU B CG  1 
ATOM   8093 C CD1 . LEU B 1 512 ? 1.161   -75.578 -14.056 1.00 23.25  ? 513 LEU B CD1 1 
ATOM   8094 C CD2 . LEU B 1 512 ? 0.881   -77.587 -12.574 1.00 22.31  ? 513 LEU B CD2 1 
ATOM   8095 N N   . ASP B 1 513 ? 5.513   -77.675 -10.564 1.00 27.00  ? 514 ASP B N   1 
ATOM   8096 C CA  . ASP B 1 513 ? 6.957   -77.872 -10.587 1.00 33.36  ? 514 ASP B CA  1 
ATOM   8097 C C   . ASP B 1 513 ? 7.257   -79.369 -10.597 1.00 27.21  ? 514 ASP B C   1 
ATOM   8098 O O   . ASP B 1 513 ? 6.361   -80.183 -10.844 1.00 29.02  ? 514 ASP B O   1 
ATOM   8099 C CB  . ASP B 1 513 ? 7.668   -77.142 -9.424  1.00 32.96  ? 514 ASP B CB  1 
ATOM   8100 C CG  . ASP B 1 513 ? 7.145   -77.547 -8.040  1.00 40.22  ? 514 ASP B CG  1 
ATOM   8101 O OD1 . ASP B 1 513 ? 6.402   -78.549 -7.915  1.00 39.08  ? 514 ASP B OD1 1 
ATOM   8102 O OD2 . ASP B 1 513 ? 7.495   -76.853 -7.056  1.00 50.79  ? 514 ASP B OD2 1 
ATOM   8103 N N   . LEU B 1 514 ? 8.503   -79.729 -10.321 1.00 28.77  ? 515 LEU B N   1 
ATOM   8104 C CA  . LEU B 1 514 ? 8.897   -81.140 -10.289 1.00 37.83  ? 515 LEU B CA  1 
ATOM   8105 C C   . LEU B 1 514 ? 8.137   -81.973 -9.245  1.00 36.15  ? 515 LEU B C   1 
ATOM   8106 O O   . LEU B 1 514 ? 7.860   -83.144 -9.483  1.00 42.00  ? 515 LEU B O   1 
ATOM   8107 C CB  . LEU B 1 514 ? 10.416  -81.274 -10.099 1.00 28.53  ? 515 LEU B CB  1 
ATOM   8108 C CG  . LEU B 1 514 ? 11.228  -80.505 -11.142 1.00 25.93  ? 515 LEU B CG  1 
ATOM   8109 C CD1 . LEU B 1 514 ? 12.723  -80.723 -10.941 1.00 26.42  ? 515 LEU B CD1 1 
ATOM   8110 C CD2 . LEU B 1 514 ? 10.790  -80.884 -12.566 1.00 29.61  ? 515 LEU B CD2 1 
ATOM   8111 N N   . ARG B 1 515 ? 7.807   -81.372 -8.101  1.00 38.07  ? 516 ARG B N   1 
ATOM   8112 C CA  . ARG B 1 515 ? 7.035   -82.053 -7.049  1.00 40.63  ? 516 ARG B CA  1 
ATOM   8113 C C   . ARG B 1 515 ? 5.581   -82.196 -7.494  1.00 37.74  ? 516 ARG B C   1 
ATOM   8114 O O   . ARG B 1 515 ? 5.163   -81.512 -8.426  1.00 38.51  ? 516 ARG B O   1 
ATOM   8115 C CB  . ARG B 1 515 ? 7.096   -81.255 -5.738  1.00 37.33  ? 516 ARG B CB  1 
ATOM   8116 C CG  . ARG B 1 515 ? 8.491   -81.071 -5.165  1.00 42.14  ? 516 ARG B CG  1 
ATOM   8117 C CD  . ARG B 1 515 ? 8.477   -80.073 -4.003  1.00 58.06  ? 516 ARG B CD  1 
ATOM   8118 N NE  . ARG B 1 515 ? 7.834   -78.811 -4.378  1.00 64.11  ? 516 ARG B NE  1 
ATOM   8119 C CZ  . ARG B 1 515 ? 6.686   -78.367 -3.869  1.00 65.75  ? 516 ARG B CZ  1 
ATOM   8120 N NH1 . ARG B 1 515 ? 6.046   -79.073 -2.937  1.00 57.72  ? 516 ARG B NH1 1 
ATOM   8121 N NH2 . ARG B 1 515 ? 6.180   -77.208 -4.286  1.00 57.96  ? 516 ARG B NH2 1 
ATOM   8122 N N   . PRO B 1 516 ? 4.802   -83.079 -6.835  1.00 38.64  ? 517 PRO B N   1 
ATOM   8123 C CA  . PRO B 1 516 ? 3.375   -83.226 -7.177  1.00 39.89  ? 517 PRO B CA  1 
ATOM   8124 C C   . PRO B 1 516 ? 2.577   -81.952 -6.905  1.00 41.61  ? 517 PRO B C   1 
ATOM   8125 O O   . PRO B 1 516 ? 3.076   -81.080 -6.191  1.00 42.18  ? 517 PRO B O   1 
ATOM   8126 C CB  . PRO B 1 516 ? 2.897   -84.337 -6.233  1.00 40.53  ? 517 PRO B CB  1 
ATOM   8127 C CG  . PRO B 1 516 ? 4.122   -85.106 -5.890  1.00 31.52  ? 517 PRO B CG  1 
ATOM   8128 C CD  . PRO B 1 516 ? 5.236   -84.093 -5.855  1.00 37.04  ? 517 PRO B CD  1 
ATOM   8129 N N   . LEU B 1 517 ? 1.370   -81.850 -7.463  1.00 37.26  ? 518 LEU B N   1 
ATOM   8130 C CA  . LEU B 1 517 ? 0.500   -80.696 -7.225  1.00 38.89  ? 518 LEU B CA  1 
ATOM   8131 C C   . LEU B 1 517 ? 0.334   -80.413 -5.745  1.00 42.05  ? 518 LEU B C   1 
ATOM   8132 O O   . LEU B 1 517 ? -0.050  -81.290 -4.973  1.00 45.10  ? 518 LEU B O   1 
ATOM   8133 C CB  . LEU B 1 517 ? -0.895  -80.900 -7.820  1.00 37.06  ? 518 LEU B CB  1 
ATOM   8134 C CG  . LEU B 1 517 ? -1.042  -81.003 -9.335  1.00 41.98  ? 518 LEU B CG  1 
ATOM   8135 C CD1 . LEU B 1 517 ? -2.512  -81.081 -9.713  1.00 41.15  ? 518 LEU B CD1 1 
ATOM   8136 C CD2 . LEU B 1 517 ? -0.368  -79.834 -10.016 1.00 37.89  ? 518 LEU B CD2 1 
ATOM   8137 N N   . GLU B 1 518 ? 0.628   -79.179 -5.364  1.00 41.93  ? 519 GLU B N   1 
ATOM   8138 C CA  . GLU B 1 518 ? 0.314   -78.679 -4.039  1.00 45.13  ? 519 GLU B CA  1 
ATOM   8139 C C   . GLU B 1 518 ? -0.736  -77.583 -4.210  1.00 38.52  ? 519 GLU B C   1 
ATOM   8140 O O   . GLU B 1 518 ? -0.569  -76.692 -5.036  1.00 34.81  ? 519 GLU B O   1 
ATOM   8141 C CB  . GLU B 1 518 ? 1.573   -78.136 -3.363  1.00 36.91  ? 519 GLU B CB  1 
ATOM   8142 C CG  . GLU B 1 518 ? 1.318   -77.508 -2.001  1.00 57.06  ? 519 GLU B CG  1 
ATOM   8143 C CD  . GLU B 1 518 ? 2.460   -76.609 -1.544  1.00 64.90  ? 519 GLU B CD  1 
ATOM   8144 O OE1 . GLU B 1 518 ? 3.562   -76.693 -2.134  1.00 63.24  ? 519 GLU B OE1 1 
ATOM   8145 O OE2 . GLU B 1 518 ? 2.250   -75.814 -0.598  1.00 69.42  ? 519 GLU B OE2 1 
ATOM   8146 N N   . VAL B 1 519 ? -1.830  -77.670 -3.460  1.00 38.15  ? 520 VAL B N   1 
ATOM   8147 C CA  . VAL B 1 519 ? -2.901  -76.677 -3.546  1.00 32.51  ? 520 VAL B CA  1 
ATOM   8148 C C   . VAL B 1 519 ? -2.615  -75.528 -2.584  1.00 36.06  ? 520 VAL B C   1 
ATOM   8149 O O   . VAL B 1 519 ? -2.184  -75.751 -1.448  1.00 38.35  ? 520 VAL B O   1 
ATOM   8150 C CB  . VAL B 1 519 ? -4.269  -77.297 -3.194  1.00 27.93  ? 520 VAL B CB  1 
ATOM   8151 C CG1 . VAL B 1 519 ? -5.371  -76.260 -3.293  1.00 27.67  ? 520 VAL B CG1 1 
ATOM   8152 C CG2 . VAL B 1 519 ? -4.570  -78.471 -4.098  1.00 26.70  ? 520 VAL B CG2 1 
ATOM   8153 N N   . ARG B 1 520 ? -2.839  -74.298 -3.038  1.00 33.77  ? 521 ARG B N   1 
ATOM   8154 C CA  . ARG B 1 520 ? -2.603  -73.117 -2.209  1.00 29.99  ? 521 ARG B CA  1 
ATOM   8155 C C   . ARG B 1 520 ? -3.712  -72.090 -2.371  1.00 29.56  ? 521 ARG B C   1 
ATOM   8156 O O   . ARG B 1 520 ? -4.569  -72.225 -3.241  1.00 31.05  ? 521 ARG B O   1 
ATOM   8157 C CB  . ARG B 1 520 ? -1.257  -72.481 -2.540  1.00 30.83  ? 521 ARG B CB  1 
ATOM   8158 C CG  . ARG B 1 520 ? -0.084  -73.438 -2.444  1.00 36.99  ? 521 ARG B CG  1 
ATOM   8159 C CD  . ARG B 1 520 ? 1.202   -72.728 -2.761  1.00 38.55  ? 521 ARG B CD  1 
ATOM   8160 N NE  . ARG B 1 520 ? 2.334   -73.639 -2.864  1.00 42.30  ? 521 ARG B NE  1 
ATOM   8161 C CZ  . ARG B 1 520 ? 3.456   -73.339 -3.509  1.00 47.38  ? 521 ARG B CZ  1 
ATOM   8162 N NH1 . ARG B 1 520 ? 3.574   -72.163 -4.114  1.00 46.77  ? 521 ARG B NH1 1 
ATOM   8163 N NH2 . ARG B 1 520 ? 4.453   -74.212 -3.560  1.00 52.47  ? 521 ARG B NH2 1 
ATOM   8164 N N   . ARG B 1 521 ? -3.693  -71.059 -1.529  1.00 34.20  ? 522 ARG B N   1 
ATOM   8165 C CA  . ARG B 1 521 ? -4.747  -70.046 -1.544  1.00 30.40  ? 522 ARG B CA  1 
ATOM   8166 C C   . ARG B 1 521 ? -4.217  -68.661 -1.860  1.00 31.88  ? 522 ARG B C   1 
ATOM   8167 O O   . ARG B 1 521 ? -3.168  -68.251 -1.346  1.00 35.14  ? 522 ARG B O   1 
ATOM   8168 C CB  . ARG B 1 521 ? -5.481  -69.995 -0.198  1.00 39.60  ? 522 ARG B CB  1 
ATOM   8169 C CG  . ARG B 1 521 ? -6.422  -71.152 0.072   1.00 34.34  ? 522 ARG B CG  1 
ATOM   8170 C CD  . ARG B 1 521 ? -7.345  -70.835 1.242   1.00 28.43  ? 522 ARG B CD  1 
ATOM   8171 N NE  . ARG B 1 521 ? -8.352  -69.849 0.860   1.00 28.84  ? 522 ARG B NE  1 
ATOM   8172 C CZ  . ARG B 1 521 ? -8.676  -68.780 1.581   1.00 34.99  ? 522 ARG B CZ  1 
ATOM   8173 N NH1 . ARG B 1 521 ? -8.073  -68.554 2.743   1.00 34.69  ? 522 ARG B NH1 1 
ATOM   8174 N NH2 . ARG B 1 521 ? -9.605  -67.938 1.137   1.00 31.94  ? 522 ARG B NH2 1 
ATOM   8175 N N   . GLY B 1 522 ? -4.961  -67.942 -2.697  1.00 27.28  ? 523 GLY B N   1 
ATOM   8176 C CA  . GLY B 1 522 ? -4.683  -66.549 -2.980  1.00 32.57  ? 523 GLY B CA  1 
ATOM   8177 C C   . GLY B 1 522 ? -3.561  -66.301 -3.973  1.00 32.36  ? 523 GLY B C   1 
ATOM   8178 O O   . GLY B 1 522 ? -2.416  -66.705 -3.758  1.00 35.33  ? 523 GLY B O   1 
ATOM   8179 N N   . LEU B 1 523 ? -3.895  -65.617 -5.061  1.00 27.40  ? 524 LEU B N   1 
ATOM   8180 C CA  . LEU B 1 523 ? -2.908  -65.189 -6.043  1.00 30.94  ? 524 LEU B CA  1 
ATOM   8181 C C   . LEU B 1 523 ? -2.372  -63.817 -5.621  1.00 28.15  ? 524 LEU B C   1 
ATOM   8182 O O   . LEU B 1 523 ? -2.862  -62.782 -6.086  1.00 28.75  ? 524 LEU B O   1 
ATOM   8183 C CB  . LEU B 1 523 ? -3.549  -65.124 -7.440  1.00 27.60  ? 524 LEU B CB  1 
ATOM   8184 C CG  . LEU B 1 523 ? -3.886  -66.445 -8.154  1.00 32.30  ? 524 LEU B CG  1 
ATOM   8185 C CD1 . LEU B 1 523 ? -4.697  -66.208 -9.431  1.00 25.81  ? 524 LEU B CD1 1 
ATOM   8186 C CD2 . LEU B 1 523 ? -2.614  -67.233 -8.480  1.00 29.08  ? 524 LEU B CD2 1 
ATOM   8187 N N   A ARG B 1 524 ? -1.372  -63.805 -4.741  0.55 29.50  ? 525 ARG B N   1 
ATOM   8188 N N   B ARG B 1 524 ? -1.370  -63.835 -4.742  0.45 29.47  ? 525 ARG B N   1 
ATOM   8189 C CA  A ARG B 1 524 ? -0.860  -62.553 -4.171  0.55 30.60  ? 525 ARG B CA  1 
ATOM   8190 C CA  B ARG B 1 524 ? -0.847  -62.626 -4.096  0.45 30.58  ? 525 ARG B CA  1 
ATOM   8191 C C   A ARG B 1 524 ? -2.007  -61.687 -3.625  0.55 29.94  ? 525 ARG B C   1 
ATOM   8192 C C   B ARG B 1 524 ? -1.986  -61.711 -3.620  0.45 29.94  ? 525 ARG B C   1 
ATOM   8193 O O   A ARG B 1 524 ? -2.091  -60.490 -3.924  0.55 28.95  ? 525 ARG B O   1 
ATOM   8194 O O   B ARG B 1 524 ? -2.045  -60.522 -3.952  0.45 28.96  ? 525 ARG B O   1 
ATOM   8195 C CB  A ARG B 1 524 ? -0.052  -61.771 -5.220  0.55 29.30  ? 525 ARG B CB  1 
ATOM   8196 C CB  B ARG B 1 524 ? 0.165   -61.912 -5.007  0.45 29.48  ? 525 ARG B CB  1 
ATOM   8197 C CG  A ARG B 1 524 ? 1.219   -62.463 -5.706  0.55 28.49  ? 525 ARG B CG  1 
ATOM   8198 C CG  B ARG B 1 524 ? 1.388   -62.785 -5.306  0.45 28.61  ? 525 ARG B CG  1 
ATOM   8199 C CD  A ARG B 1 524 ? 2.388   -62.243 -4.758  0.55 26.39  ? 525 ARG B CD  1 
ATOM   8200 C CD  B ARG B 1 524 ? 2.520   -62.072 -6.045  0.45 27.06  ? 525 ARG B CD  1 
ATOM   8201 N NE  A ARG B 1 524 ? 2.772   -60.838 -4.693  0.55 30.41  ? 525 ARG B NE  1 
ATOM   8202 N NE  B ARG B 1 524 ? 3.665   -62.970 -6.219  0.45 30.68  ? 525 ARG B NE  1 
ATOM   8203 C CZ  A ARG B 1 524 ? 3.510   -60.307 -3.724  0.55 28.63  ? 525 ARG B CZ  1 
ATOM   8204 C CZ  B ARG B 1 524 ? 4.896   -62.581 -6.546  0.45 29.84  ? 525 ARG B CZ  1 
ATOM   8205 N NH1 A ARG B 1 524 ? 3.952   -61.066 -2.729  0.55 30.14  ? 525 ARG B NH1 1 
ATOM   8206 N NH1 B ARG B 1 524 ? 5.164   -61.296 -6.751  0.45 26.88  ? 525 ARG B NH1 1 
ATOM   8207 N NH2 A ARG B 1 524 ? 3.798   -59.016 -3.748  0.55 17.52  ? 525 ARG B NH2 1 
ATOM   8208 N NH2 B ARG B 1 524 ? 5.866   -63.482 -6.666  0.45 25.72  ? 525 ARG B NH2 1 
ATOM   8209 N N   . ALA B 1 525 ? -2.890  -62.301 -2.841  1.00 30.15  ? 526 ALA B N   1 
ATOM   8210 C CA  . ALA B 1 525 ? -4.144  -61.655 -2.430  1.00 27.59  ? 526 ALA B CA  1 
ATOM   8211 C C   . ALA B 1 525 ? -4.016  -60.292 -1.742  1.00 30.46  ? 526 ALA B C   1 
ATOM   8212 O O   . ALA B 1 525 ? -4.749  -59.357 -2.079  1.00 28.44  ? 526 ALA B O   1 
ATOM   8213 C CB  . ALA B 1 525 ? -4.965  -62.604 -1.574  1.00 30.58  ? 526 ALA B CB  1 
ATOM   8214 N N   . GLN B 1 526 ? -3.096  -60.179 -0.786  1.00 30.84  ? 527 GLN B N   1 
ATOM   8215 C CA  . GLN B 1 526 ? -2.900  -58.920 -0.076  1.00 31.45  ? 527 GLN B CA  1 
ATOM   8216 C C   . GLN B 1 526 ? -2.378  -57.859 -1.023  1.00 30.65  ? 527 GLN B C   1 
ATOM   8217 O O   . GLN B 1 526 ? -2.836  -56.721 -0.997  1.00 32.59  ? 527 GLN B O   1 
ATOM   8218 C CB  . GLN B 1 526 ? -1.931  -59.082 1.101   1.00 29.61  ? 527 GLN B CB  1 
ATOM   8219 C CG  . GLN B 1 526 ? -2.325  -60.150 2.085   1.00 32.23  ? 527 GLN B CG  1 
ATOM   8220 C CD  . GLN B 1 526 ? -3.662  -59.881 2.761   1.00 37.10  ? 527 GLN B CD  1 
ATOM   8221 O OE1 . GLN B 1 526 ? -4.439  -60.807 3.001   1.00 44.10  ? 527 GLN B OE1 1 
ATOM   8222 N NE2 . GLN B 1 526 ? -3.925  -58.621 3.095   1.00 27.30  ? 527 GLN B NE2 1 
ATOM   8223 N N   . ALA B 1 527 ? -1.410  -58.234 -1.854  1.00 28.78  ? 528 ALA B N   1 
ATOM   8224 C CA  . ALA B 1 527 ? -0.877  -57.314 -2.851  1.00 26.11  ? 528 ALA B CA  1 
ATOM   8225 C C   . ALA B 1 527 ? -1.956  -56.927 -3.848  1.00 28.82  ? 528 ALA B C   1 
ATOM   8226 O O   . ALA B 1 527 ? -2.151  -55.747 -4.140  1.00 29.79  ? 528 ALA B O   1 
ATOM   8227 C CB  . ALA B 1 527 ? 0.309   -57.929 -3.571  1.00 28.41  ? 528 ALA B CB  1 
ATOM   8228 N N   . CYS B 1 528 ? -2.679  -57.915 -4.357  1.00 25.66  ? 529 CYS B N   1 
ATOM   8229 C CA  . CYS B 1 528 ? -3.656  -57.636 -5.404  1.00 23.71  ? 529 CYS B CA  1 
ATOM   8230 C C   . CYS B 1 528 ? -4.890  -56.850 -4.950  1.00 29.33  ? 529 CYS B C   1 
ATOM   8231 O O   . CYS B 1 528 ? -5.560  -56.211 -5.771  1.00 21.59  ? 529 CYS B O   1 
ATOM   8232 C CB  . CYS B 1 528 ? -4.022  -58.917 -6.149  1.00 27.25  ? 529 CYS B CB  1 
ATOM   8233 S SG  . CYS B 1 528 ? -2.599  -59.490 -7.129  1.00 29.55  ? 529 CYS B SG  1 
ATOM   8234 N N   . ALA B 1 529 ? -5.174  -56.875 -3.647  1.00 25.92  ? 530 ALA B N   1 
ATOM   8235 C CA  . ALA B 1 529 ? -6.238  -56.046 -3.107  1.00 21.79  ? 530 ALA B CA  1 
ATOM   8236 C C   . ALA B 1 529 ? -5.848  -54.586 -3.283  1.00 21.03  ? 530 ALA B C   1 
ATOM   8237 O O   . ALA B 1 529 ? -6.675  -53.751 -3.624  1.00 24.06  ? 530 ALA B O   1 
ATOM   8238 C CB  . ALA B 1 529 ? -6.485  -56.374 -1.641  1.00 24.61  ? 530 ALA B CB  1 
ATOM   8239 N N   . PHE B 1 530 ? -4.571  -54.285 -3.080  1.00 21.50  ? 531 PHE B N   1 
ATOM   8240 C CA  . PHE B 1 530 ? -4.074  -52.940 -3.343  1.00 23.21  ? 531 PHE B CA  1 
ATOM   8241 C C   . PHE B 1 530 ? -4.292  -52.516 -4.802  1.00 26.85  ? 531 PHE B C   1 
ATOM   8242 O O   . PHE B 1 530 ? -4.878  -51.461 -5.059  1.00 28.96  ? 531 PHE B O   1 
ATOM   8243 C CB  . PHE B 1 530 ? -2.594  -52.815 -2.957  1.00 22.05  ? 531 PHE B CB  1 
ATOM   8244 C CG  . PHE B 1 530 ? -1.943  -51.559 -3.463  1.00 25.12  ? 531 PHE B CG  1 
ATOM   8245 C CD1 . PHE B 1 530 ? -2.152  -50.345 -2.822  1.00 26.79  ? 531 PHE B CD1 1 
ATOM   8246 C CD2 . PHE B 1 530 ? -1.130  -51.588 -4.589  1.00 27.28  ? 531 PHE B CD2 1 
ATOM   8247 C CE1 . PHE B 1 530 ? -1.564  -49.176 -3.289  1.00 29.28  ? 531 PHE B CE1 1 
ATOM   8248 C CE2 . PHE B 1 530 ? -0.537  -50.425 -5.068  1.00 29.83  ? 531 PHE B CE2 1 
ATOM   8249 C CZ  . PHE B 1 530 ? -0.756  -49.213 -4.414  1.00 31.27  ? 531 PHE B CZ  1 
ATOM   8250 N N   . TRP B 1 531 ? -3.837  -53.331 -5.755  1.00 22.82  ? 532 TRP B N   1 
ATOM   8251 C CA  . TRP B 1 531 ? -3.919  -52.948 -7.174  1.00 27.71  ? 532 TRP B CA  1 
ATOM   8252 C C   . TRP B 1 531 ? -5.340  -52.984 -7.736  1.00 25.09  ? 532 TRP B C   1 
ATOM   8253 O O   . TRP B 1 531 ? -5.725  -52.126 -8.531  1.00 26.70  ? 532 TRP B O   1 
ATOM   8254 C CB  . TRP B 1 531 ? -3.000  -53.816 -8.049  1.00 25.48  ? 532 TRP B CB  1 
ATOM   8255 C CG  . TRP B 1 531 ? -1.557  -53.705 -7.692  1.00 26.25  ? 532 TRP B CG  1 
ATOM   8256 C CD1 . TRP B 1 531 ? -0.834  -54.576 -6.934  1.00 20.77  ? 532 TRP B CD1 1 
ATOM   8257 C CD2 . TRP B 1 531 ? -0.656  -52.649 -8.065  1.00 26.03  ? 532 TRP B CD2 1 
ATOM   8258 N NE1 . TRP B 1 531 ? 0.463   -54.132 -6.812  1.00 24.01  ? 532 TRP B NE1 1 
ATOM   8259 C CE2 . TRP B 1 531 ? 0.600   -52.953 -7.497  1.00 22.33  ? 532 TRP B CE2 1 
ATOM   8260 C CE3 . TRP B 1 531 ? -0.789  -51.480 -8.825  1.00 20.09  ? 532 TRP B CE3 1 
ATOM   8261 C CZ2 . TRP B 1 531 ? 1.721   -52.129 -7.664  1.00 22.92  ? 532 TRP B CZ2 1 
ATOM   8262 C CZ3 . TRP B 1 531 ? 0.323   -50.661 -8.988  1.00 21.65  ? 532 TRP B CZ3 1 
ATOM   8263 C CH2 . TRP B 1 531 ? 1.561   -50.991 -8.412  1.00 24.25  ? 532 TRP B CH2 1 
ATOM   8264 N N   . ASN B 1 532 ? -6.116  -53.978 -7.322  1.00 27.98  ? 533 ASN B N   1 
ATOM   8265 C CA  . ASN B 1 532 ? -7.451  -54.171 -7.881  1.00 27.36  ? 533 ASN B CA  1 
ATOM   8266 C C   . ASN B 1 532 ? -8.598  -53.452 -7.150  1.00 32.99  ? 533 ASN B C   1 
ATOM   8267 O O   . ASN B 1 532 ? -9.610  -53.119 -7.766  1.00 25.34  ? 533 ASN B O   1 
ATOM   8268 C CB  . ASN B 1 532 ? -7.757  -55.666 -7.990  1.00 28.30  ? 533 ASN B CB  1 
ATOM   8269 C CG  . ASN B 1 532 ? -6.788  -56.387 -8.898  1.00 25.89  ? 533 ASN B CG  1 
ATOM   8270 O OD1 . ASN B 1 532 ? -6.229  -55.786 -9.804  1.00 32.07  ? 533 ASN B OD1 1 
ATOM   8271 N ND2 . ASN B 1 532 ? -6.582  -57.678 -8.658  1.00 25.94  ? 533 ASN B ND2 1 
ATOM   8272 N N   . ARG B 1 533 ? -8.455  -53.223 -5.844  1.00 29.50  ? 534 ARG B N   1 
ATOM   8273 C CA  . ARG B 1 533 ? -9.555  -52.634 -5.077  1.00 29.71  ? 534 ARG B CA  1 
ATOM   8274 C C   . ARG B 1 533 ? -9.306  -51.202 -4.624  1.00 31.41  ? 534 ARG B C   1 
ATOM   8275 O O   . ARG B 1 533 ? -10.209 -50.373 -4.677  1.00 36.63  ? 534 ARG B O   1 
ATOM   8276 C CB  . ARG B 1 533 ? -9.897  -53.490 -3.861  1.00 27.70  ? 534 ARG B CB  1 
ATOM   8277 C CG  . ARG B 1 533 ? -10.146 -54.924 -4.188  1.00 30.17  ? 534 ARG B CG  1 
ATOM   8278 C CD  . ARG B 1 533 ? -10.399 -55.743 -2.946  1.00 30.39  ? 534 ARG B CD  1 
ATOM   8279 N NE  . ARG B 1 533 ? -10.589 -57.141 -3.310  1.00 35.73  ? 534 ARG B NE  1 
ATOM   8280 C CZ  . ARG B 1 533 ? -11.775 -57.690 -3.547  1.00 42.27  ? 534 ARG B CZ  1 
ATOM   8281 N NH1 . ARG B 1 533 ? -12.877 -56.954 -3.431  1.00 38.91  ? 534 ARG B NH1 1 
ATOM   8282 N NH2 . ARG B 1 533 ? -11.859 -58.972 -3.894  1.00 36.09  ? 534 ARG B NH2 1 
ATOM   8283 N N   . PHE B 1 534 ? -8.095  -50.907 -4.165  1.00 30.01  ? 535 PHE B N   1 
ATOM   8284 C CA  . PHE B 1 534 ? -7.828  -49.581 -3.619  1.00 27.00  ? 535 PHE B CA  1 
ATOM   8285 C C   . PHE B 1 534 ? -7.269  -48.551 -4.594  1.00 27.04  ? 535 PHE B C   1 
ATOM   8286 O O   . PHE B 1 534 ? -7.828  -47.463 -4.727  1.00 30.88  ? 535 PHE B O   1 
ATOM   8287 C CB  . PHE B 1 534 ? -6.926  -49.634 -2.371  1.00 22.55  ? 535 PHE B CB  1 
ATOM   8288 C CG  . PHE B 1 534 ? -6.557  -48.266 -1.868  1.00 26.33  ? 535 PHE B CG  1 
ATOM   8289 C CD1 . PHE B 1 534 ? -7.486  -47.496 -1.179  1.00 24.34  ? 535 PHE B CD1 1 
ATOM   8290 C CD2 . PHE B 1 534 ? -5.311  -47.723 -2.134  1.00 23.08  ? 535 PHE B CD2 1 
ATOM   8291 C CE1 . PHE B 1 534 ? -7.167  -46.221 -0.735  1.00 25.08  ? 535 PHE B CE1 1 
ATOM   8292 C CE2 . PHE B 1 534 ? -4.983  -46.447 -1.689  1.00 28.44  ? 535 PHE B CE2 1 
ATOM   8293 C CZ  . PHE B 1 534 ? -5.914  -45.697 -0.985  1.00 29.29  ? 535 PHE B CZ  1 
ATOM   8294 N N   . LEU B 1 535 ? -6.138  -48.870 -5.220  1.00 28.50  ? 536 LEU B N   1 
ATOM   8295 C CA  . LEU B 1 535 ? -5.463  -47.939 -6.134  1.00 34.44  ? 536 LEU B CA  1 
ATOM   8296 C C   . LEU B 1 535 ? -6.368  -47.266 -7.186  1.00 33.69  ? 536 LEU B C   1 
ATOM   8297 O O   . LEU B 1 535 ? -6.226  -46.062 -7.444  1.00 33.85  ? 536 LEU B O   1 
ATOM   8298 C CB  . LEU B 1 535 ? -4.250  -48.596 -6.812  1.00 35.39  ? 536 LEU B CB  1 
ATOM   8299 C CG  . LEU B 1 535 ? -3.366  -47.630 -7.614  1.00 41.88  ? 536 LEU B CG  1 
ATOM   8300 C CD1 . LEU B 1 535 ? -2.928  -46.448 -6.752  1.00 43.40  ? 536 LEU B CD1 1 
ATOM   8301 C CD2 . LEU B 1 535 ? -2.156  -48.340 -8.160  1.00 35.35  ? 536 LEU B CD2 1 
ATOM   8302 N N   . PRO B 1 536 ? -7.296  -48.025 -7.797  1.00 32.42  ? 537 PRO B N   1 
ATOM   8303 C CA  . PRO B 1 536 ? -8.197  -47.352 -8.746  1.00 35.04  ? 537 PRO B CA  1 
ATOM   8304 C C   . PRO B 1 536 ? -9.053  -46.259 -8.098  1.00 39.34  ? 537 PRO B C   1 
ATOM   8305 O O   . PRO B 1 536 ? -9.370  -45.268 -8.760  1.00 40.20  ? 537 PRO B O   1 
ATOM   8306 C CB  . PRO B 1 536 ? -9.093  -48.492 -9.242  1.00 29.90  ? 537 PRO B CB  1 
ATOM   8307 C CG  . PRO B 1 536 ? -8.249  -49.718 -9.090  1.00 29.87  ? 537 PRO B CG  1 
ATOM   8308 C CD  . PRO B 1 536 ? -7.473  -49.490 -7.822  1.00 30.50  ? 537 PRO B CD  1 
ATOM   8309 N N   . LYS B 1 537 ? -9.421  -46.437 -6.828  1.00 39.79  ? 538 LYS B N   1 
ATOM   8310 C CA  . LYS B 1 537 ? -10.190 -45.418 -6.106  1.00 39.14  ? 538 LYS B CA  1 
ATOM   8311 C C   . LYS B 1 537 ? -9.333  -44.186 -5.852  1.00 34.14  ? 538 LYS B C   1 
ATOM   8312 O O   . LYS B 1 537 ? -9.814  -43.062 -5.900  1.00 43.03  ? 538 LYS B O   1 
ATOM   8313 C CB  . LYS B 1 537 ? -10.741 -45.969 -4.791  1.00 38.71  ? 538 LYS B CB  1 
ATOM   8314 C CG  . LYS B 1 537 ? -11.800 -47.042 -4.968  1.00 36.74  ? 538 LYS B CG  1 
ATOM   8315 C CD  . LYS B 1 537 ? -12.320 -47.527 -3.632  1.00 38.47  ? 538 LYS B CD  1 
ATOM   8316 C CE  . LYS B 1 537 ? -13.513 -48.458 -3.806  1.00 44.02  ? 538 LYS B CE  1 
ATOM   8317 N NZ  . LYS B 1 537 ? -13.120 -49.871 -4.092  1.00 51.43  ? 538 LYS B NZ  1 
ATOM   8318 N N   . LEU B 1 538 ? -8.052  -44.411 -5.605  1.00 39.22  ? 539 LEU B N   1 
ATOM   8319 C CA  . LEU B 1 538 ? -7.110  -43.322 -5.399  1.00 44.60  ? 539 LEU B CA  1 
ATOM   8320 C C   . LEU B 1 538 ? -6.914  -42.524 -6.681  1.00 42.00  ? 539 LEU B C   1 
ATOM   8321 O O   . LEU B 1 538 ? -6.730  -41.312 -6.634  1.00 46.16  ? 539 LEU B O   1 
ATOM   8322 C CB  . LEU B 1 538 ? -5.766  -43.855 -4.876  1.00 39.25  ? 539 LEU B CB  1 
ATOM   8323 C CG  . LEU B 1 538 ? -4.717  -42.844 -4.400  1.00 42.47  ? 539 LEU B CG  1 
ATOM   8324 C CD1 . LEU B 1 538 ? -3.796  -43.455 -3.349  1.00 36.10  ? 539 LEU B CD1 1 
ATOM   8325 C CD2 . LEU B 1 538 ? -3.895  -42.335 -5.557  1.00 36.12  ? 539 LEU B CD2 1 
ATOM   8326 N N   . LEU B 1 539 ? -6.945  -43.201 -7.825  1.00 47.38  ? 540 LEU B N   1 
ATOM   8327 C CA  . LEU B 1 539 ? -6.758  -42.516 -9.107  1.00 52.04  ? 540 LEU B CA  1 
ATOM   8328 C C   . LEU B 1 539 ? -7.999  -41.707 -9.544  1.00 58.18  ? 540 LEU B C   1 
ATOM   8329 O O   . LEU B 1 539 ? -7.880  -40.715 -10.265 1.00 57.50  ? 540 LEU B O   1 
ATOM   8330 C CB  . LEU B 1 539 ? -6.300  -43.495 -10.198 1.00 50.22  ? 540 LEU B CB  1 
ATOM   8331 C CG  . LEU B 1 539 ? -4.884  -44.079 -10.036 1.00 48.74  ? 540 LEU B CG  1 
ATOM   8332 C CD1 . LEU B 1 539 ? -4.626  -45.185 -11.046 1.00 35.35  ? 540 LEU B CD1 1 
ATOM   8333 C CD2 . LEU B 1 539 ? -3.803  -43.007 -10.142 1.00 40.65  ? 540 LEU B CD2 1 
ATOM   8334 N N   . SER B 1 540 ? -9.180  -42.122 -9.086  1.00 56.60  ? 541 SER B N   1 
ATOM   8335 C CA  . SER B 1 540 ? -10.416 -41.375 -9.333  1.00 54.61  ? 541 SER B CA  1 
ATOM   8336 C C   . SER B 1 540 ? -10.544 -40.122 -8.457  1.00 66.26  ? 541 SER B C   1 
ATOM   8337 O O   . SER B 1 540 ? -11.415 -39.284 -8.694  1.00 63.32  ? 541 SER B O   1 
ATOM   8338 C CB  . SER B 1 540 ? -11.630 -42.268 -9.086  1.00 52.61  ? 541 SER B CB  1 
ATOM   8339 O OG  . SER B 1 540 ? -11.508 -43.493 -9.781  1.00 62.33  ? 541 SER B OG  1 
ATOM   8340 N N   . ALA B 1 541 ? -9.689  -40.005 -7.441  1.00 64.39  ? 542 ALA B N   1 
ATOM   8341 C CA  . ALA B 1 541 ? -9.786  -38.917 -6.466  1.00 61.77  ? 542 ALA B CA  1 
ATOM   8342 C C   . ALA B 1 541 ? -8.456  -38.187 -6.241  1.00 64.88  ? 542 ALA B C   1 
ATOM   8343 O O   . ALA B 1 541 ? -7.616  -38.090 -7.141  1.00 64.64  ? 542 ALA B O   1 
ATOM   8344 C CB  . ALA B 1 541 ? -10.336 -39.448 -5.139  1.00 52.07  ? 542 ALA B CB  1 
HETATM 8345 C C1  . NAG C 2 .   ? -23.082 -59.119 21.560  1.00 42.92  ? 1   NAG C C1  1 
HETATM 8346 C C2  . NAG C 2 .   ? -23.842 -59.659 20.334  1.00 48.77  ? 1   NAG C C2  1 
HETATM 8347 C C3  . NAG C 2 .   ? -24.448 -58.576 19.440  1.00 44.87  ? 1   NAG C C3  1 
HETATM 8348 C C4  . NAG C 2 .   ? -25.047 -57.411 20.212  1.00 50.89  ? 1   NAG C C4  1 
HETATM 8349 C C5  . NAG C 2 .   ? -24.074 -56.979 21.306  1.00 48.29  ? 1   NAG C C5  1 
HETATM 8350 C C6  . NAG C 2 .   ? -24.616 -55.837 22.162  1.00 57.13  ? 1   NAG C C6  1 
HETATM 8351 C C7  . NAG C 2 .   ? -22.962 -61.801 19.577  1.00 70.79  ? 1   NAG C C7  1 
HETATM 8352 C C8  . NAG C 2 .   ? -24.310 -62.467 19.657  1.00 51.72  ? 1   NAG C C8  1 
HETATM 8353 N N2  . NAG C 2 .   ? -22.965 -60.469 19.507  1.00 58.29  ? 1   NAG C N2  1 
HETATM 8354 O O3  . NAG C 2 .   ? -25.436 -59.150 18.615  1.00 52.49  ? 1   NAG C O3  1 
HETATM 8355 O O4  . NAG C 2 .   ? -25.294 -56.376 19.284  1.00 57.50  ? 1   NAG C O4  1 
HETATM 8356 O O5  . NAG C 2 .   ? -23.829 -58.078 22.149  1.00 44.14  ? 1   NAG C O5  1 
HETATM 8357 O O6  . NAG C 2 .   ? -25.960 -56.119 22.481  1.00 61.87  ? 1   NAG C O6  1 
HETATM 8358 O O7  . NAG C 2 .   ? -21.917 -62.467 19.584  1.00 69.34  ? 1   NAG C O7  1 
HETATM 8359 C C1  . NAG C 2 .   ? -26.658 -55.842 19.405  1.00 67.79  ? 2   NAG C C1  1 
HETATM 8360 C C2  . NAG C 2 .   ? -26.703 -54.415 18.847  1.00 71.96  ? 2   NAG C C2  1 
HETATM 8361 C C3  . NAG C 2 .   ? -28.117 -53.830 18.742  1.00 78.82  ? 2   NAG C C3  1 
HETATM 8362 C C4  . NAG C 2 .   ? -29.197 -54.869 18.419  1.00 88.03  ? 2   NAG C C4  1 
HETATM 8363 C C5  . NAG C 2 .   ? -28.933 -56.171 19.170  1.00 83.40  ? 2   NAG C C5  1 
HETATM 8364 C C6  . NAG C 2 .   ? -29.984 -57.238 18.885  1.00 77.00  ? 2   NAG C C6  1 
HETATM 8365 C C7  . NAG C 2 .   ? -24.720 -53.049 19.227  1.00 58.04  ? 2   NAG C C7  1 
HETATM 8366 C C8  . NAG C 2 .   ? -23.756 -52.564 20.273  1.00 48.19  ? 2   NAG C C8  1 
HETATM 8367 N N2  . NAG C 2 .   ? -25.876 -53.548 19.669  1.00 65.09  ? 2   NAG C N2  1 
HETATM 8368 O O3  . NAG C 2 .   ? -28.113 -52.836 17.738  1.00 81.80  ? 2   NAG C O3  1 
HETATM 8369 O O4  . NAG C 2 .   ? -30.475 -54.372 18.769  1.00 84.95  ? 2   NAG C O4  1 
HETATM 8370 O O5  . NAG C 2 .   ? -27.652 -56.650 18.815  1.00 79.70  ? 2   NAG C O5  1 
HETATM 8371 O O6  . NAG C 2 .   ? -29.831 -58.268 19.837  1.00 77.57  ? 2   NAG C O6  1 
HETATM 8372 O O7  . NAG C 2 .   ? -24.429 -52.983 18.032  1.00 47.62  ? 2   NAG C O7  1 
HETATM 8373 C C1  . FUC C 2 .   ? -26.254 -55.845 23.860  1.00 62.43  ? 3   FUC C C1  1 
HETATM 8374 C C2  . FUC C 2 .   ? -27.769 -55.907 23.992  1.00 67.64  ? 3   FUC C C2  1 
HETATM 8375 C C3  . FUC C 2 .   ? -28.235 -57.351 23.753  1.00 66.39  ? 3   FUC C C3  1 
HETATM 8376 C C4  . FUC C 2 .   ? -27.565 -58.270 24.789  1.00 70.74  ? 3   FUC C C4  1 
HETATM 8377 C C5  . FUC C 2 .   ? -26.045 -58.144 24.637  1.00 61.03  ? 3   FUC C C5  1 
HETATM 8378 C C6  . FUC C 2 .   ? -25.246 -58.967 25.649  1.00 42.65  ? 3   FUC C C6  1 
HETATM 8379 O O2  . FUC C 2 .   ? -28.415 -55.008 23.094  1.00 69.60  ? 3   FUC C O2  1 
HETATM 8380 O O3  . FUC C 2 .   ? -29.651 -57.471 23.884  1.00 78.55  ? 3   FUC C O3  1 
HETATM 8381 O O4  . FUC C 2 .   ? -27.947 -57.882 26.110  1.00 71.41  ? 3   FUC C O4  1 
HETATM 8382 O O5  . FUC C 2 .   ? -25.615 -56.745 24.743  1.00 60.21  ? 3   FUC C O5  1 
HETATM 8383 C C1  . NAG D 2 .   ? 25.273  -53.796 -11.679 1.00 47.23  ? 1   NAG D C1  1 
HETATM 8384 C C2  . NAG D 2 .   ? 25.935  -52.667 -10.883 1.00 52.56  ? 1   NAG D C2  1 
HETATM 8385 C C3  . NAG D 2 .   ? 25.296  -51.313 -11.190 1.00 51.51  ? 1   NAG D C3  1 
HETATM 8386 C C4  . NAG D 2 .   ? 25.315  -51.046 -12.689 1.00 57.90  ? 1   NAG D C4  1 
HETATM 8387 C C5  . NAG D 2 .   ? 24.639  -52.233 -13.379 1.00 54.55  ? 1   NAG D C5  1 
HETATM 8388 C C6  . NAG D 2 .   ? 24.611  -52.064 -14.897 1.00 61.13  ? 1   NAG D C6  1 
HETATM 8389 C C7  . NAG D 2 .   ? 26.974  -53.155 -8.742  1.00 59.31  ? 1   NAG D C7  1 
HETATM 8390 C C8  . NAG D 2 .   ? 28.286  -53.180 -9.477  1.00 57.67  ? 1   NAG D C8  1 
HETATM 8391 N N2  . NAG D 2 .   ? 25.873  -52.942 -9.461  1.00 52.36  ? 1   NAG D N2  1 
HETATM 8392 O O3  . NAG D 2 .   ? 25.948  -50.282 -10.486 1.00 56.24  ? 1   NAG D O3  1 
HETATM 8393 O O4  . NAG D 2 .   ? 24.627  -49.834 -12.932 1.00 67.56  ? 1   NAG D O4  1 
HETATM 8394 O O5  . NAG D 2 .   ? 25.284  -53.454 -13.050 1.00 51.32  ? 1   NAG D O5  1 
HETATM 8395 O O6  . NAG D 2 .   ? 25.877  -51.622 -15.332 1.00 72.03  ? 1   NAG D O6  1 
HETATM 8396 O O7  . NAG D 2 .   ? 26.938  -53.327 -7.524  1.00 63.99  ? 1   NAG D O7  1 
HETATM 8397 C C1  . NAG D 2 .   ? 25.413  -48.869 -13.727 1.00 68.69  ? 2   NAG D C1  1 
HETATM 8398 C C2  . NAG D 2 .   ? 24.456  -47.895 -14.408 1.00 71.17  ? 2   NAG D C2  1 
HETATM 8399 C C3  . NAG D 2 .   ? 25.207  -46.956 -15.348 1.00 77.87  ? 2   NAG D C3  1 
HETATM 8400 C C4  . NAG D 2 .   ? 26.389  -46.313 -14.625 1.00 84.89  ? 2   NAG D C4  1 
HETATM 8401 C C5  . NAG D 2 .   ? 27.208  -47.343 -13.842 1.00 82.26  ? 2   NAG D C5  1 
HETATM 8402 C C6  . NAG D 2 .   ? 28.271  -46.646 -13.000 1.00 78.74  ? 2   NAG D C6  1 
HETATM 8403 C C7  . NAG D 2 .   ? 22.178  -48.660 -14.598 1.00 57.11  ? 2   NAG D C7  1 
HETATM 8404 C C8  . NAG D 2 .   ? 21.189  -49.539 -15.307 1.00 47.19  ? 2   NAG D C8  1 
HETATM 8405 N N2  . NAG D 2 .   ? 23.405  -48.606 -15.111 1.00 66.49  ? 2   NAG D N2  1 
HETATM 8406 O O3  . NAG D 2 .   ? 24.330  -45.948 -15.802 1.00 67.02  ? 2   NAG D O3  1 
HETATM 8407 O O4  . NAG D 2 .   ? 27.220  -45.658 -15.559 1.00 83.33  ? 2   NAG D O4  1 
HETATM 8408 O O5  . NAG D 2 .   ? 26.382  -48.136 -13.004 1.00 78.02  ? 2   NAG D O5  1 
HETATM 8409 O O6  . NAG D 2 .   ? 28.938  -47.599 -12.204 1.00 77.55  ? 2   NAG D O6  1 
HETATM 8410 O O7  . NAG D 2 .   ? 21.848  -48.034 -13.589 1.00 47.09  ? 2   NAG D O7  1 
HETATM 8411 C C1  . FUC D 2 .   ? 26.386  -52.449 -16.406 1.00 67.89  ? 3   FUC D C1  1 
HETATM 8412 C C2  . FUC D 2 .   ? 27.610  -51.737 -16.951 1.00 74.68  ? 3   FUC D C2  1 
HETATM 8413 C C3  . FUC D 2 .   ? 28.737  -51.753 -15.905 1.00 77.24  ? 3   FUC D C3  1 
HETATM 8414 C C4  . FUC D 2 .   ? 29.081  -53.207 -15.524 1.00 76.94  ? 3   FUC D C4  1 
HETATM 8415 C C5  . FUC D 2 .   ? 27.789  -53.961 -15.087 1.00 65.14  ? 3   FUC D C5  1 
HETATM 8416 C C6  . FUC D 2 .   ? 27.978  -55.468 -14.918 1.00 50.56  ? 3   FUC D C6  1 
HETATM 8417 O O2  . FUC D 2 .   ? 27.294  -50.410 -17.321 1.00 73.91  ? 3   FUC D O2  1 
HETATM 8418 O O3  . FUC D 2 .   ? 29.917  -51.156 -16.423 1.00 86.57  ? 3   FUC D O3  1 
HETATM 8419 O O4  . FUC D 2 .   ? 29.703  -53.869 -16.627 1.00 72.73  ? 3   FUC D O4  1 
HETATM 8420 O O5  . FUC D 2 .   ? 26.673  -53.778 -16.020 1.00 62.67  ? 3   FUC D O5  1 
HETATM 8421 C C1  . E20 E 3 .   ? -18.530 -41.928 24.258  1.00 28.11  ? 604 E20 A C1  1 
HETATM 8422 C C2  . E20 E 3 .   ? -18.970 -41.862 25.566  1.00 29.82  ? 604 E20 A C2  1 
HETATM 8423 C C3  . E20 E 3 .   ? -18.125 -42.222 26.615  1.00 27.24  ? 604 E20 A C3  1 
HETATM 8424 C C4  . E20 E 3 .   ? -16.817 -42.659 26.338  1.00 28.88  ? 604 E20 A C4  1 
HETATM 8425 C C5  . E20 E 3 .   ? -16.370 -42.740 25.037  1.00 21.11  ? 604 E20 A C5  1 
HETATM 8426 C C6  . E20 E 3 .   ? -17.234 -42.369 23.979  1.00 24.23  ? 604 E20 A C6  1 
HETATM 8427 C C7  . E20 E 3 .   ? -14.962 -43.221 24.996  1.00 21.45  ? 604 E20 A C7  1 
HETATM 8428 C C8  . E20 E 3 .   ? -14.502 -43.478 26.419  1.00 21.95  ? 604 E20 A C8  1 
HETATM 8429 C C9  . E20 E 3 .   ? -15.710 -43.107 27.282  1.00 23.11  ? 604 E20 A C9  1 
HETATM 8430 C C10 . E20 E 3 .   ? -13.970 -44.894 26.642  1.00 23.90  ? 604 E20 A C10 1 
HETATM 8431 C C11 . E20 E 3 .   ? -12.925 -44.965 27.776  1.00 26.06  ? 604 E20 A C11 1 
HETATM 8432 C C12 . E20 E 3 .   ? -13.505 -44.756 29.141  1.00 22.17  ? 604 E20 A C12 1 
HETATM 8433 C C13 . E20 E 3 .   ? -12.529 -44.933 30.274  1.00 19.70  ? 604 E20 A C13 1 
HETATM 8434 N N14 . E20 E 3 .   ? -11.729 -46.166 30.212  1.00 27.35  ? 604 E20 A N14 1 
HETATM 8435 C C15 . E20 E 3 .   ? -11.189 -46.351 28.862  1.00 27.09  ? 604 E20 A C15 1 
HETATM 8436 C C16 . E20 E 3 .   ? -12.257 -46.328 27.808  1.00 24.83  ? 604 E20 A C16 1 
HETATM 8437 C C17 . E20 E 3 .   ? -10.962 -46.545 31.395  1.00 28.49  ? 604 E20 A C17 1 
HETATM 8438 C C18 . E20 E 3 .   ? -9.698  -45.708 31.539  1.00 25.74  ? 604 E20 A C18 1 
HETATM 8439 C C19 . E20 E 3 .   ? -9.740  -44.445 32.158  1.00 21.81  ? 604 E20 A C19 1 
HETATM 8440 C C20 . E20 E 3 .   ? -8.576  -43.676 32.286  1.00 22.22  ? 604 E20 A C20 1 
HETATM 8441 C C21 . E20 E 3 .   ? -7.363  -44.171 31.800  1.00 25.11  ? 604 E20 A C21 1 
HETATM 8442 C C22 . E20 E 3 .   ? -7.317  -45.434 31.176  1.00 27.03  ? 604 E20 A C22 1 
HETATM 8443 C C23 . E20 E 3 .   ? -8.475  -46.200 31.051  1.00 23.15  ? 604 E20 A C23 1 
HETATM 8444 O O24 . E20 E 3 .   ? -14.278 -43.362 23.959  1.00 20.32  ? 604 E20 A O24 1 
HETATM 8445 O O25 . E20 E 3 .   ? -19.387 -41.562 23.244  1.00 34.07  ? 604 E20 A O25 1 
HETATM 8446 C C26 . E20 E 3 .   ? -18.995 -41.561 21.931  1.00 26.33  ? 604 E20 A C26 1 
HETATM 8447 O O27 . E20 E 3 .   ? -20.264 -41.407 25.839  1.00 29.28  ? 604 E20 A O27 1 
HETATM 8448 C C28 . E20 E 3 .   ? -20.658 -41.266 27.175  1.00 26.93  ? 604 E20 A C28 1 
HETATM 8449 C C1  . EDO F 4 .   ? -9.528  -59.167 9.477   1.00 29.76  ? 605 EDO A C1  1 
HETATM 8450 O O1  . EDO F 4 .   ? -8.422  -58.355 9.070   1.00 30.89  ? 605 EDO A O1  1 
HETATM 8451 C C2  . EDO F 4 .   ? -10.475 -59.425 8.308   1.00 36.98  ? 605 EDO A C2  1 
HETATM 8452 O O2  . EDO F 4 .   ? -9.815  -60.000 7.175   1.00 28.99  ? 605 EDO A O2  1 
HETATM 8453 C C1  . EDO G 4 .   ? 8.519   -47.308 11.178  1.00 31.85  ? 606 EDO A C1  1 
HETATM 8454 O O1  . EDO G 4 .   ? 9.561   -46.397 10.801  1.00 32.77  ? 606 EDO A O1  1 
HETATM 8455 C C2  . EDO G 4 .   ? 7.283   -47.074 10.309  1.00 31.64  ? 606 EDO A C2  1 
HETATM 8456 O O2  . EDO G 4 .   ? 6.832   -45.710 10.420  1.00 30.08  ? 606 EDO A O2  1 
HETATM 8457 C C1  . NAG H 5 .   ? -8.505  -35.706 -46.608 1.00 67.26  ? 604 NAG B C1  1 
HETATM 8458 C C2  . NAG H 5 .   ? -9.950  -35.229 -46.764 1.00 71.26  ? 604 NAG B C2  1 
HETATM 8459 C C3  . NAG H 5 .   ? -10.693 -36.151 -47.723 1.00 77.78  ? 604 NAG B C3  1 
HETATM 8460 C C4  . NAG H 5 .   ? -9.977  -36.148 -49.070 1.00 86.65  ? 604 NAG B C4  1 
HETATM 8461 C C5  . NAG H 5 .   ? -8.505  -36.539 -48.865 1.00 83.93  ? 604 NAG B C5  1 
HETATM 8462 C C6  . NAG H 5 .   ? -7.697  -36.586 -50.174 1.00 72.43  ? 604 NAG B C6  1 
HETATM 8463 C C7  . NAG H 5 .   ? -10.976 -33.941 -44.962 1.00 75.12  ? 604 NAG B C7  1 
HETATM 8464 C C8  . NAG H 5 .   ? -12.096 -33.936 -43.957 1.00 65.81  ? 604 NAG B C8  1 
HETATM 8465 N N2  . NAG H 5 .   ? -10.632 -35.127 -45.484 1.00 71.63  ? 604 NAG B N2  1 
HETATM 8466 O O3  . NAG H 5 .   ? -12.030 -35.730 -47.872 1.00 82.63  ? 604 NAG B O3  1 
HETATM 8467 O O4  . NAG H 5 .   ? -10.640 -37.021 -49.967 1.00 81.47  ? 604 NAG B O4  1 
HETATM 8468 O O5  . NAG H 5 .   ? -7.874  -35.712 -47.883 1.00 72.83  ? 604 NAG B O5  1 
HETATM 8469 O O6  . NAG H 5 .   ? -8.037  -35.538 -51.059 1.00 74.40  ? 604 NAG B O6  1 
HETATM 8470 O O7  . NAG H 5 .   ? -10.419 -32.881 -45.261 1.00 62.24  ? 604 NAG B O7  1 
HETATM 8471 C C1  . E20 I 3 .   ? 12.109  -50.789 -23.466 1.00 29.79  ? 605 E20 B C1  1 
HETATM 8472 C C2  . E20 I 3 .   ? 12.683  -51.328 -24.592 1.00 28.52  ? 605 E20 B C2  1 
HETATM 8473 C C3  . E20 I 3 .   ? 12.524  -52.674 -24.884 1.00 30.89  ? 605 E20 B C3  1 
HETATM 8474 C C4  . E20 I 3 .   ? 11.772  -53.498 -24.029 1.00 29.58  ? 605 E20 B C4  1 
HETATM 8475 C C5  . E20 I 3 .   ? 11.189  -52.974 -22.899 1.00 31.34  ? 605 E20 B C5  1 
HETATM 8476 C C6  . E20 I 3 .   ? 11.353  -51.594 -22.599 1.00 27.37  ? 605 E20 B C6  1 
HETATM 8477 C C7  . E20 I 3 .   ? 10.450  -54.051 -22.177 1.00 28.47  ? 605 E20 B C7  1 
HETATM 8478 C C8  . E20 I 3 .   ? 10.622  -55.368 -22.910 1.00 29.22  ? 605 E20 B C8  1 
HETATM 8479 C C9  . E20 I 3 .   ? 11.461  -54.991 -24.131 1.00 25.79  ? 605 E20 B C9  1 
HETATM 8480 C C10 . E20 I 3 .   ? 11.207  -56.479 -22.031 1.00 29.24  ? 605 E20 B C10 1 
HETATM 8481 C C11 . E20 I 3 .   ? 10.842  -57.908 -22.490 1.00 28.44  ? 605 E20 B C11 1 
HETATM 8482 C C12 . E20 I 3 .   ? 11.549  -58.340 -23.738 1.00 24.92  ? 605 E20 B C12 1 
HETATM 8483 C C13 . E20 I 3 .   ? 11.247  -59.752 -24.146 1.00 22.14  ? 605 E20 B C13 1 
HETATM 8484 N N14 . E20 I 3 .   ? 11.395  -60.754 -23.074 1.00 30.27  ? 605 E20 B N14 1 
HETATM 8485 C C15 . E20 I 3 .   ? 10.813  -60.282 -21.813 1.00 28.67  ? 605 E20 B C15 1 
HETATM 8486 C C16 . E20 I 3 .   ? 11.269  -58.905 -21.430 1.00 29.64  ? 605 E20 B C16 1 
HETATM 8487 C C17 . E20 I 3 .   ? 11.312  -62.157 -23.464 1.00 32.32  ? 605 E20 B C17 1 
HETATM 8488 C C18 . E20 I 3 .   ? 9.889   -62.585 -23.794 1.00 28.11  ? 605 E20 B C18 1 
HETATM 8489 C C19 . E20 I 3 .   ? 9.388   -62.434 -25.093 1.00 24.72  ? 605 E20 B C19 1 
HETATM 8490 C C20 . E20 I 3 .   ? 8.076   -62.832 -25.400 1.00 25.42  ? 605 E20 B C20 1 
HETATM 8491 C C21 . E20 I 3 .   ? 7.269   -63.381 -24.400 1.00 31.18  ? 605 E20 B C21 1 
HETATM 8492 C C22 . E20 I 3 .   ? 7.764   -63.540 -23.089 1.00 27.30  ? 605 E20 B C22 1 
HETATM 8493 C C23 . E20 I 3 .   ? 9.067   -63.145 -22.793 1.00 28.90  ? 605 E20 B C23 1 
HETATM 8494 O O24 . E20 I 3 .   ? 9.795   -53.895 -21.144 1.00 28.84  ? 605 E20 B O24 1 
HETATM 8495 O O25 . E20 I 3 .   ? 12.308  -49.446 -23.249 1.00 33.15  ? 605 E20 B O25 1 
HETATM 8496 C C26 . E20 I 3 .   ? 11.684  -48.786 -22.226 1.00 31.06  ? 605 E20 B C26 1 
HETATM 8497 O O27 . E20 I 3 .   ? 13.437  -50.506 -25.438 1.00 33.43  ? 605 E20 B O27 1 
HETATM 8498 C C28 . E20 I 3 .   ? 13.999  -51.047 -26.602 1.00 34.92  ? 605 E20 B C28 1 
HETATM 8499 C C1  . EDO J 4 .   ? 12.454  -52.930 1.450   1.00 34.72  ? 606 EDO B C1  1 
HETATM 8500 O O1  . EDO J 4 .   ? 11.903  -52.705 2.755   1.00 30.39  ? 606 EDO B O1  1 
HETATM 8501 C C2  . EDO J 4 .   ? 11.848  -54.160 0.776   1.00 32.28  ? 606 EDO B C2  1 
HETATM 8502 O O2  . EDO J 4 .   ? 10.419  -54.164 0.909   1.00 34.04  ? 606 EDO B O2  1 
HETATM 8503 N N   . NO3 K 6 .   ? -9.163  -39.944 -31.016 0.77 32.95  ? 607 NO3 B N   1 
HETATM 8504 O O1  . NO3 K 6 .   ? -10.503 -40.340 -30.891 0.77 40.48  ? 607 NO3 B O1  1 
HETATM 8505 O O2  . NO3 K 6 .   ? -8.529  -39.267 -29.971 0.77 29.77  ? 607 NO3 B O2  1 
HETATM 8506 O O3  . NO3 K 6 .   ? -8.464  -40.219 -32.193 0.77 37.58  ? 607 NO3 B O3  1 
HETATM 8507 N N   . NO3 L 6 .   ? -8.476  -60.028 -3.557  0.83 41.80  ? 608 NO3 B N   1 
HETATM 8508 O O1  . NO3 L 6 .   ? -8.653  -58.733 -4.085  0.83 31.77  ? 608 NO3 B O1  1 
HETATM 8509 O O2  . NO3 L 6 .   ? -7.208  -60.386 -3.095  0.83 36.21  ? 608 NO3 B O2  1 
HETATM 8510 O O3  . NO3 L 6 .   ? -9.529  -60.965 -3.478  0.83 31.76  ? 608 NO3 B O3  1 
HETATM 8511 O O   . HOH M 7 .   ? -16.419 -34.310 31.946  1.00 20.12  ? 701 HOH A O   1 
HETATM 8512 O O   . HOH M 7 .   ? 13.508  -49.504 24.076  1.00 22.90  ? 702 HOH A O   1 
HETATM 8513 O O   . HOH M 7 .   ? -2.536  -47.800 29.452  1.00 21.64  ? 703 HOH A O   1 
HETATM 8514 O O   . HOH M 7 .   ? -7.794  -51.151 25.055  1.00 19.91  ? 704 HOH A O   1 
HETATM 8515 O O   . HOH M 7 .   ? -2.536  -36.566 38.636  0.98 21.74  ? 705 HOH A O   1 
HETATM 8516 O O   . HOH M 7 .   ? -7.935  -36.659 31.790  1.00 18.58  ? 706 HOH A O   1 
HETATM 8517 O O   . HOH M 7 .   ? 1.268   -48.053 28.932  1.00 21.50  ? 707 HOH A O   1 
HETATM 8518 O O   . HOH M 7 .   ? 8.707   -48.681 15.318  1.00 26.62  ? 708 HOH A O   1 
HETATM 8519 O O   . HOH M 7 .   ? -8.490  -25.918 25.348  0.94 26.05  ? 709 HOH A O   1 
HETATM 8520 O O   . HOH M 7 .   ? -10.351 -21.464 28.823  1.00 28.61  ? 710 HOH A O   1 
HETATM 8521 O O   . HOH M 7 .   ? 13.101  -37.916 39.357  0.93 32.48  ? 711 HOH A O   1 
HETATM 8522 O O   . HOH M 7 .   ? -7.485  -25.022 45.810  1.00 19.37  ? 712 HOH A O   1 
HETATM 8523 O O   . HOH M 7 .   ? 17.287  -43.520 21.951  1.00 26.60  ? 713 HOH A O   1 
HETATM 8524 O O   . HOH M 7 .   ? -13.433 -29.022 47.740  1.00 27.39  ? 714 HOH A O   1 
HETATM 8525 O O   . HOH M 7 .   ? -12.719 -23.448 34.948  1.00 24.45  ? 715 HOH A O   1 
HETATM 8526 O O   . HOH M 7 .   ? -10.764 -35.467 21.305  0.95 26.54  ? 716 HOH A O   1 
HETATM 8527 O O   . HOH M 7 .   ? -4.261  -50.327 36.287  1.00 21.04  ? 717 HOH A O   1 
HETATM 8528 O O   . HOH M 7 .   ? 9.029   -58.678 31.136  1.00 30.23  ? 718 HOH A O   1 
HETATM 8529 O O   . HOH M 7 .   ? -10.545 -51.126 -0.402  1.00 35.96  ? 719 HOH A O   1 
HETATM 8530 O O   . HOH M 7 .   ? -2.385  -39.830 42.916  0.98 24.60  ? 720 HOH A O   1 
HETATM 8531 O O   . HOH M 7 .   ? -14.377 -32.923 27.100  1.00 25.70  ? 721 HOH A O   1 
HETATM 8532 O O   . HOH M 7 .   ? -7.819  -41.085 35.676  1.00 22.25  ? 722 HOH A O   1 
HETATM 8533 O O   . HOH M 7 .   ? -13.302 -30.254 35.687  1.00 21.65  ? 723 HOH A O   1 
HETATM 8534 O O   . HOH M 7 .   ? -11.914 -34.041 27.086  1.00 18.03  ? 724 HOH A O   1 
HETATM 8535 O O   . HOH M 7 .   ? -9.049  -47.077 41.136  1.00 28.98  ? 725 HOH A O   1 
HETATM 8536 O O   . HOH M 7 .   ? 9.076   -45.032 54.148  1.00 26.99  ? 726 HOH A O   1 
HETATM 8537 O O   . HOH M 7 .   ? -14.008 -25.243 23.147  0.95 26.04  ? 727 HOH A O   1 
HETATM 8538 O O   . HOH M 7 .   ? -15.788 -40.562 21.262  1.00 23.14  ? 728 HOH A O   1 
HETATM 8539 O O   . HOH M 7 .   ? -4.476  -42.323 33.874  1.00 17.57  ? 729 HOH A O   1 
HETATM 8540 O O   . HOH M 7 .   ? 11.258  -46.242 52.391  1.00 33.01  ? 730 HOH A O   1 
HETATM 8541 O O   . HOH M 7 .   ? -10.428 -41.878 35.549  1.00 20.27  ? 731 HOH A O   1 
HETATM 8542 O O   . HOH M 7 .   ? -4.855  -42.213 44.926  0.87 21.40  ? 732 HOH A O   1 
HETATM 8543 O O   . HOH M 7 .   ? -10.856 -45.665 42.820  1.00 25.12  ? 733 HOH A O   1 
HETATM 8544 O O   . HOH M 7 .   ? -11.576 -34.280 18.942  1.00 25.80  ? 734 HOH A O   1 
HETATM 8545 O O   . HOH M 7 .   ? 8.434   -29.254 39.310  0.96 22.87  ? 735 HOH A O   1 
HETATM 8546 O O   . HOH M 7 .   ? -13.294 -27.891 22.008  0.93 26.38  ? 736 HOH A O   1 
HETATM 8547 O O   . HOH M 7 .   ? -12.123 -41.882 33.185  0.96 21.84  ? 737 HOH A O   1 
HETATM 8548 O O   . HOH M 7 .   ? -2.907  -33.881 18.750  0.90 22.93  ? 738 HOH A O   1 
HETATM 8549 O O   . HOH M 7 .   ? 9.083   -60.868 28.414  0.92 38.98  ? 739 HOH A O   1 
HETATM 8550 O O   . HOH M 7 .   ? -11.119 -43.701 17.452  0.67 18.62  ? 740 HOH A O   1 
HETATM 8551 O O   . HOH M 7 .   ? -23.582 -28.449 39.675  1.00 34.59  ? 741 HOH A O   1 
HETATM 8552 O O   . HOH M 7 .   ? -22.064 -26.616 15.435  1.00 40.69  ? 742 HOH A O   1 
HETATM 8553 O O   . HOH M 7 .   ? -19.046 -20.120 37.056  0.96 28.33  ? 743 HOH A O   1 
HETATM 8554 O O   . HOH M 7 .   ? -17.564 -30.726 30.545  1.00 29.48  ? 744 HOH A O   1 
HETATM 8555 O O   . HOH M 7 .   ? 15.857  -60.410 23.933  1.00 42.08  ? 745 HOH A O   1 
HETATM 8556 O O   . HOH M 7 .   ? -2.578  -58.365 46.055  0.91 36.59  ? 746 HOH A O   1 
HETATM 8557 O O   . HOH M 7 .   ? -11.164 -27.438 23.505  0.99 22.56  ? 747 HOH A O   1 
HETATM 8558 O O   . HOH M 7 .   ? -7.307  -59.824 12.785  0.97 30.39  ? 748 HOH A O   1 
HETATM 8559 O O   . HOH M 7 .   ? -16.304 -31.799 33.047  1.00 23.45  ? 749 HOH A O   1 
HETATM 8560 O O   . HOH M 7 .   ? 6.458   -47.802 14.164  0.92 28.89  ? 750 HOH A O   1 
HETATM 8561 O O   . HOH M 7 .   ? -8.044  -43.983 46.875  0.92 28.08  ? 751 HOH A O   1 
HETATM 8562 O O   . HOH M 7 .   ? -2.397  -41.949 13.928  1.00 28.26  ? 752 HOH A O   1 
HETATM 8563 O O   . HOH M 7 .   ? -21.393 -35.945 36.406  1.00 24.76  ? 753 HOH A O   1 
HETATM 8564 O O   . HOH M 7 .   ? -15.928 -35.644 25.845  1.00 27.27  ? 754 HOH A O   1 
HETATM 8565 O O   . HOH M 7 .   ? -19.277 -29.694 28.802  0.77 24.15  ? 755 HOH A O   1 
HETATM 8566 O O   . HOH M 7 .   ? 8.227   -53.653 47.625  0.89 27.23  ? 756 HOH A O   1 
HETATM 8567 O O   . HOH M 7 .   ? 0.020   -24.010 48.604  0.90 29.38  ? 757 HOH A O   1 
HETATM 8568 O O   . HOH M 7 .   ? -13.873 -63.696 28.946  1.00 37.24  ? 758 HOH A O   1 
HETATM 8569 O O   . HOH M 7 .   ? 9.827   -44.798 14.915  0.98 32.36  ? 759 HOH A O   1 
HETATM 8570 O O   . HOH M 7 .   ? 12.546  -49.439 50.849  0.95 33.80  ? 760 HOH A O   1 
HETATM 8571 O O   . HOH M 7 .   ? -21.983 -14.499 34.627  1.00 38.44  ? 761 HOH A O   1 
HETATM 8572 O O   . HOH M 7 .   ? 12.973  -51.823 46.560  0.84 27.60  ? 762 HOH A O   1 
HETATM 8573 O O   . HOH M 7 .   ? 8.518   -24.299 50.792  1.00 33.07  ? 763 HOH A O   1 
HETATM 8574 O O   . HOH M 7 .   ? -2.534  -46.850 56.416  1.00 36.73  ? 764 HOH A O   1 
HETATM 8575 O O   . HOH M 7 .   ? -18.306 -41.597 12.467  1.00 26.10  ? 765 HOH A O   1 
HETATM 8576 O O   . HOH M 7 .   ? -9.581  -25.290 44.228  0.92 25.32  ? 766 HOH A O   1 
HETATM 8577 O O   . HOH M 7 .   ? -14.844 -41.278 8.925   1.00 30.22  ? 767 HOH A O   1 
HETATM 8578 O O   . HOH M 7 .   ? -6.654  -60.293 10.211  1.00 29.80  ? 768 HOH A O   1 
HETATM 8579 O O   . HOH M 7 .   ? 3.456   -50.017 57.667  0.74 27.30  ? 769 HOH A O   1 
HETATM 8580 O O   . HOH M 7 .   ? 13.599  -47.230 10.006  0.97 34.19  ? 770 HOH A O   1 
HETATM 8581 O O   . HOH M 7 .   ? 11.292  -45.398 12.715  0.91 29.65  ? 771 HOH A O   1 
HETATM 8582 O O   . HOH M 7 .   ? 15.396  -43.135 45.112  1.00 39.67  ? 772 HOH A O   1 
HETATM 8583 O O   . HOH M 7 .   ? -13.722 -63.090 25.822  1.00 35.33  ? 773 HOH A O   1 
HETATM 8584 O O   . HOH M 7 .   ? -8.462  -23.785 48.326  0.79 28.74  ? 774 HOH A O   1 
HETATM 8585 O O   . HOH M 7 .   ? 7.800   -30.894 62.066  0.84 37.58  ? 775 HOH A O   1 
HETATM 8586 O O   . HOH M 7 .   ? -16.503 -30.352 12.831  0.93 35.62  ? 776 HOH A O   1 
HETATM 8587 O O   . HOH M 7 .   ? -24.721 -13.258 29.248  0.96 39.22  ? 777 HOH A O   1 
HETATM 8588 O O   . HOH M 7 .   ? 4.968   -24.377 22.316  0.97 39.01  ? 778 HOH A O   1 
HETATM 8589 O O   . HOH M 7 .   ? 19.030  -45.645 40.211  1.00 36.67  ? 779 HOH A O   1 
HETATM 8590 O O   . HOH M 7 .   ? -20.996 -51.778 7.091   0.79 32.61  ? 780 HOH A O   1 
HETATM 8591 O O   . HOH M 7 .   ? -1.754  -40.824 21.708  0.67 20.63  ? 781 HOH A O   1 
HETATM 8592 O O   . HOH M 7 .   ? 12.475  -44.927 56.286  1.00 31.68  ? 782 HOH A O   1 
HETATM 8593 O O   . HOH M 7 .   ? -10.815 -61.350 -0.767  1.00 35.54  ? 783 HOH A O   1 
HETATM 8594 O O   . HOH M 7 .   ? 3.818   -60.906 22.164  1.00 42.86  ? 784 HOH A O   1 
HETATM 8595 O O   . HOH M 7 .   ? -18.113 -52.498 14.646  1.00 32.23  ? 785 HOH A O   1 
HETATM 8596 O O   . HOH M 7 .   ? 5.463   -62.443 46.155  1.00 42.55  ? 786 HOH A O   1 
HETATM 8597 O O   . HOH M 7 .   ? 14.268  -59.342 32.816  1.00 47.63  ? 787 HOH A O   1 
HETATM 8598 O O   . HOH M 7 .   ? -6.243  -34.136 46.788  1.00 28.19  ? 788 HOH A O   1 
HETATM 8599 O O   . HOH M 7 .   ? -20.318 -46.343 10.952  1.00 34.45  ? 789 HOH A O   1 
HETATM 8600 O O   . HOH M 7 .   ? -10.491 -67.181 13.320  1.00 47.20  ? 790 HOH A O   1 
HETATM 8601 O O   . HOH M 7 .   ? -8.508  -39.830 51.800  1.00 30.56  ? 791 HOH A O   1 
HETATM 8602 O O   . HOH M 7 .   ? -2.864  -47.389 0.761   0.71 33.54  ? 792 HOH A O   1 
HETATM 8603 O O   . HOH M 7 .   ? -20.929 -38.252 21.312  0.88 33.62  ? 793 HOH A O   1 
HETATM 8604 O O   . HOH M 7 .   ? 22.467  -49.173 31.257  1.00 48.26  ? 794 HOH A O   1 
HETATM 8605 O O   . HOH M 7 .   ? 2.658   -27.463 60.382  1.00 30.57  ? 795 HOH A O   1 
HETATM 8606 O O   . HOH M 7 .   ? -14.216 -34.630 49.455  1.00 37.32  ? 796 HOH A O   1 
HETATM 8607 O O   . HOH M 7 .   ? -19.214 -30.104 12.326  1.00 42.02  ? 797 HOH A O   1 
HETATM 8608 O O   . HOH M 7 .   ? 21.282  -45.931 21.382  1.00 42.30  ? 798 HOH A O   1 
HETATM 8609 O O   . HOH M 7 .   ? -17.316 -41.884 -2.076  0.94 45.62  ? 799 HOH A O   1 
HETATM 8610 O O   . HOH M 7 .   ? -2.847  -42.966 50.008  1.00 35.18  ? 800 HOH A O   1 
HETATM 8611 O O   . HOH M 7 .   ? -15.135 -39.972 35.609  0.86 27.88  ? 801 HOH A O   1 
HETATM 8612 O O   . HOH M 7 .   ? -7.544  -29.480 52.040  0.89 32.84  ? 802 HOH A O   1 
HETATM 8613 O O   . HOH M 7 .   ? -9.075  -23.775 12.805  1.00 44.48  ? 803 HOH A O   1 
HETATM 8614 O O   . HOH M 7 .   ? 2.358   -46.575 44.746  1.00 23.89  ? 804 HOH A O   1 
HETATM 8615 O O   . HOH M 7 .   ? -19.431 -39.434 19.011  0.89 28.45  ? 805 HOH A O   1 
HETATM 8616 O O   . HOH M 7 .   ? -11.049 -48.619 48.120  1.00 44.47  ? 806 HOH A O   1 
HETATM 8617 O O   . HOH M 7 .   ? -14.119 -24.256 37.296  0.98 24.33  ? 807 HOH A O   1 
HETATM 8618 O O   . HOH M 7 .   ? 11.466  -26.962 46.705  1.00 30.26  ? 808 HOH A O   1 
HETATM 8619 O O   . HOH M 7 .   ? -0.955  -62.180 30.753  1.00 35.89  ? 809 HOH A O   1 
HETATM 8620 O O   . HOH M 7 .   ? -12.495 -39.753 38.189  0.85 20.89  ? 810 HOH A O   1 
HETATM 8621 O O   . HOH M 7 .   ? -5.302  -43.702 47.275  0.86 28.26  ? 811 HOH A O   1 
HETATM 8622 O O   . HOH M 7 .   ? -16.038 -22.342 14.211  1.00 36.79  ? 812 HOH A O   1 
HETATM 8623 O O   . HOH M 7 .   ? 19.913  -48.761 20.881  1.00 36.04  ? 813 HOH A O   1 
HETATM 8624 O O   . HOH M 7 .   ? -3.502  -51.383 18.687  0.86 31.03  ? 814 HOH A O   1 
HETATM 8625 O O   . HOH M 7 .   ? -5.502  -53.004 19.872  0.88 28.62  ? 815 HOH A O   1 
HETATM 8626 O O   . HOH M 7 .   ? -14.491 -13.652 34.780  0.98 45.46  ? 816 HOH A O   1 
HETATM 8627 O O   . HOH M 7 .   ? -16.618 -24.291 12.213  1.00 45.47  ? 817 HOH A O   1 
HETATM 8628 O O   . HOH M 7 .   ? -9.935  -35.957 44.087  0.98 31.96  ? 818 HOH A O   1 
HETATM 8629 O O   . HOH M 7 .   ? -14.001 -49.779 42.148  1.00 39.38  ? 819 HOH A O   1 
HETATM 8630 O O   . HOH M 7 .   ? -6.108  -63.323 41.310  1.00 40.97  ? 820 HOH A O   1 
HETATM 8631 O O   . HOH M 7 .   ? -1.178  -15.982 27.569  1.00 51.49  ? 821 HOH A O   1 
HETATM 8632 O O   . HOH M 7 .   ? -3.942  -55.436 19.750  0.89 31.32  ? 822 HOH A O   1 
HETATM 8633 O O   . HOH M 7 .   ? -18.452 -21.949 38.979  0.93 30.26  ? 823 HOH A O   1 
HETATM 8634 O O   . HOH M 7 .   ? -16.043 -48.011 5.741   1.00 31.97  ? 824 HOH A O   1 
HETATM 8635 O O   . HOH M 7 .   ? -10.268 -37.191 5.001   0.79 31.51  ? 825 HOH A O   1 
HETATM 8636 O O   . HOH M 7 .   ? -7.655  -32.478 52.842  0.86 31.65  ? 826 HOH A O   1 
HETATM 8637 O O   . HOH M 7 .   ? 8.591   -61.010 36.639  1.00 46.50  ? 827 HOH A O   1 
HETATM 8638 O O   . HOH M 7 .   ? 0.901   -55.382 20.829  0.89 33.71  ? 828 HOH A O   1 
HETATM 8639 O O   . HOH M 7 .   ? -21.076 -57.260 34.893  1.00 37.07  ? 829 HOH A O   1 
HETATM 8640 O O   . HOH M 7 .   ? -5.415  -62.577 9.539   1.00 32.91  ? 830 HOH A O   1 
HETATM 8641 O O   . HOH M 7 .   ? 7.545   -39.426 10.222  1.00 47.20  ? 831 HOH A O   1 
HETATM 8642 O O   . HOH M 7 .   ? 20.809  -47.705 28.408  1.00 38.45  ? 832 HOH A O   1 
HETATM 8643 O O   . HOH M 7 .   ? -7.172  -18.819 22.945  1.00 43.48  ? 833 HOH A O   1 
HETATM 8644 O O   . HOH M 7 .   ? -5.554  -57.309 18.189  1.00 35.72  ? 834 HOH A O   1 
HETATM 8645 O O   . HOH M 7 .   ? -18.595 -38.717 43.617  0.94 31.44  ? 835 HOH A O   1 
HETATM 8646 O O   . HOH M 7 .   ? -9.385  -43.383 49.263  1.00 34.90  ? 836 HOH A O   1 
HETATM 8647 O O   . HOH M 7 .   ? 18.798  -41.344 20.291  0.96 35.26  ? 837 HOH A O   1 
HETATM 8648 O O   . HOH M 7 .   ? 17.324  -38.457 53.493  1.00 51.22  ? 838 HOH A O   1 
HETATM 8649 O O   . HOH M 7 .   ? -20.555 -43.234 19.097  0.90 31.16  ? 839 HOH A O   1 
HETATM 8650 O O   . HOH M 7 .   ? 10.797  -25.732 50.009  1.00 40.43  ? 840 HOH A O   1 
HETATM 8651 O O   . HOH M 7 .   ? 22.485  -51.308 29.429  1.00 48.73  ? 841 HOH A O   1 
HETATM 8652 O O   . HOH M 7 .   ? -29.867 -17.779 30.681  1.00 42.98  ? 842 HOH A O   1 
HETATM 8653 O O   . HOH M 7 .   ? 3.332   -63.281 48.126  1.00 47.13  ? 843 HOH A O   1 
HETATM 8654 O O   . HOH M 7 .   ? -19.379 -65.363 25.943  1.00 47.36  ? 844 HOH A O   1 
HETATM 8655 O O   . HOH M 7 .   ? 15.692  -54.834 45.989  1.00 44.60  ? 845 HOH A O   1 
HETATM 8656 O O   . HOH M 7 .   ? 9.755   -57.801 14.510  1.00 47.80  ? 846 HOH A O   1 
HETATM 8657 O O   . HOH M 7 .   ? 14.956  -28.820 32.965  0.75 35.34  ? 847 HOH A O   1 
HETATM 8658 O O   . HOH M 7 .   ? -19.795 -24.096 12.257  1.00 49.77  ? 848 HOH A O   1 
HETATM 8659 O O   . HOH M 7 .   ? 8.719   -23.424 53.481  0.95 36.88  ? 849 HOH A O   1 
HETATM 8660 O O   . HOH M 7 .   ? -4.150  -18.192 29.002  1.00 37.21  ? 850 HOH A O   1 
HETATM 8661 O O   . HOH M 7 .   ? 6.219   -22.791 60.401  0.97 45.12  ? 851 HOH A O   1 
HETATM 8662 O O   . HOH M 7 .   ? 9.960   -60.805 17.998  0.96 51.11  ? 852 HOH A O   1 
HETATM 8663 O O   . HOH M 7 .   ? -24.804 -53.898 14.692  1.00 50.19  ? 853 HOH A O   1 
HETATM 8664 O O   . HOH M 7 .   ? -6.580  -61.396 49.336  1.00 52.75  ? 854 HOH A O   1 
HETATM 8665 O O   . HOH M 7 .   ? -10.052 -34.403 39.183  1.00 22.20  ? 855 HOH A O   1 
HETATM 8666 O O   . HOH M 7 .   ? -14.989 -45.750 33.428  1.00 28.22  ? 856 HOH A O   1 
HETATM 8667 O O   . HOH M 7 .   ? 16.587  -49.387 19.004  1.00 26.89  ? 857 HOH A O   1 
HETATM 8668 O O   . HOH M 7 .   ? 6.197   -45.280 13.003  1.00 29.38  ? 858 HOH A O   1 
HETATM 8669 O O   . HOH M 7 .   ? 0.127   -41.131 14.493  1.00 28.88  ? 859 HOH A O   1 
HETATM 8670 O O   . HOH M 7 .   ? -2.728  -21.580 24.969  1.00 34.12  ? 860 HOH A O   1 
HETATM 8671 O O   . HOH M 7 .   ? -11.266 -37.721 51.483  1.00 34.76  ? 861 HOH A O   1 
HETATM 8672 O O   . HOH M 7 .   ? 5.270   -27.096 60.016  1.00 31.62  ? 862 HOH A O   1 
HETATM 8673 O O   . HOH M 7 .   ? -7.548  -19.938 40.442  0.97 32.14  ? 863 HOH A O   1 
HETATM 8674 O O   . HOH M 7 .   ? -11.540 -36.503 14.743  1.00 35.85  ? 864 HOH A O   1 
HETATM 8675 O O   . HOH M 7 .   ? -15.474 -48.439 3.474   1.00 36.45  ? 865 HOH A O   1 
HETATM 8676 O O   . HOH M 7 .   ? -22.421 -25.986 40.223  1.00 30.16  ? 866 HOH A O   1 
HETATM 8677 O O   . HOH M 7 .   ? 6.563   -54.147 13.716  1.00 32.22  ? 867 HOH A O   1 
HETATM 8678 O O   . HOH M 7 .   ? -21.652 -24.441 17.027  1.00 38.49  ? 868 HOH A O   1 
HETATM 8679 O O   . HOH M 7 .   ? -9.156  -19.335 37.626  0.84 33.75  ? 869 HOH A O   1 
HETATM 8680 O O   . HOH M 7 .   ? -15.032 -26.563 12.657  1.00 31.03  ? 870 HOH A O   1 
HETATM 8681 O O   . HOH M 7 .   ? 2.509   -53.126 19.986  1.00 32.38  ? 871 HOH A O   1 
HETATM 8682 O O   . HOH M 7 .   ? -13.252 -32.770 15.032  1.00 31.08  ? 872 HOH A O   1 
HETATM 8683 O O   . HOH M 7 .   ? -11.377 -23.752 49.298  1.00 33.12  ? 873 HOH A O   1 
HETATM 8684 O O   . HOH M 7 .   ? -18.492 -26.983 42.677  1.00 31.82  ? 874 HOH A O   1 
HETATM 8685 O O   . HOH M 7 .   ? -0.363  -21.264 58.249  0.99 41.25  ? 875 HOH A O   1 
HETATM 8686 O O   . HOH M 7 .   ? 6.753   -21.494 34.192  1.00 34.99  ? 876 HOH A O   1 
HETATM 8687 O O   . HOH M 7 .   ? 2.647   -57.336 21.423  1.00 37.89  ? 877 HOH A O   1 
HETATM 8688 O O   . HOH M 7 .   ? -19.842 -25.365 41.099  0.90 25.45  ? 878 HOH A O   1 
HETATM 8689 O O   . HOH M 7 .   ? -7.849  -18.559 49.443  1.00 43.99  ? 879 HOH A O   1 
HETATM 8690 O O   . HOH M 7 .   ? 15.829  -49.055 45.024  1.00 34.76  ? 880 HOH A O   1 
HETATM 8691 O O   . HOH M 7 .   ? -14.795 -42.418 33.954  1.00 29.93  ? 881 HOH A O   1 
HETATM 8692 O O   . HOH M 7 .   ? -5.196  -48.259 47.092  1.00 41.43  ? 882 HOH A O   1 
HETATM 8693 O O   . HOH M 7 .   ? -13.823 -17.256 42.688  1.00 36.51  ? 883 HOH A O   1 
HETATM 8694 O O   . HOH M 7 .   ? -1.189  -40.021 61.107  1.00 36.93  ? 884 HOH A O   1 
HETATM 8695 O O   . HOH M 7 .   ? -9.645  -30.147 15.054  1.00 28.39  ? 885 HOH A O   1 
HETATM 8696 O O   . HOH M 7 .   ? -10.998 -54.861 37.095  1.00 43.29  ? 886 HOH A O   1 
HETATM 8697 O O   . HOH M 7 .   ? -28.025 -34.235 36.149  1.00 32.78  ? 887 HOH A O   1 
HETATM 8698 O O   . HOH M 7 .   ? -14.333 -66.093 13.873  1.00 39.08  ? 888 HOH A O   1 
HETATM 8699 O O   . HOH M 7 .   ? -5.312  -24.210 15.118  1.00 39.51  ? 889 HOH A O   1 
HETATM 8700 O O   . HOH M 7 .   ? -25.603 -14.238 31.631  1.00 40.12  ? 890 HOH A O   1 
HETATM 8701 O O   . HOH M 7 .   ? -2.360  -40.225 10.183  0.76 28.03  ? 891 HOH A O   1 
HETATM 8702 O O   . HOH M 7 .   ? 0.738   -18.362 56.006  0.90 35.72  ? 892 HOH A O   1 
HETATM 8703 O O   . HOH M 7 .   ? -2.523  -29.927 63.511  1.00 43.26  ? 893 HOH A O   1 
HETATM 8704 O O   . HOH M 7 .   ? 20.143  -43.727 22.080  0.98 40.51  ? 894 HOH A O   1 
HETATM 8705 O O   . HOH M 7 .   ? 14.038  -25.689 47.147  1.00 45.14  ? 895 HOH A O   1 
HETATM 8706 O O   . HOH M 7 .   ? -12.988 -39.702 -0.458  1.00 43.85  ? 896 HOH A O   1 
HETATM 8707 O O   . HOH M 7 .   ? 2.868   -57.816 49.865  1.00 40.09  ? 897 HOH A O   1 
HETATM 8708 O O   . HOH M 7 .   ? 2.246   -26.479 62.800  1.00 43.88  ? 898 HOH A O   1 
HETATM 8709 O O   . HOH M 7 .   ? 13.487  -31.182 54.184  1.00 41.49  ? 899 HOH A O   1 
HETATM 8710 O O   . HOH M 7 .   ? -23.792 -36.232 32.672  0.86 30.40  ? 900 HOH A O   1 
HETATM 8711 O O   . HOH M 7 .   ? 13.613  -24.230 44.159  1.00 47.21  ? 901 HOH A O   1 
HETATM 8712 O O   . HOH M 7 .   ? -3.761  -65.279 6.613   1.00 47.18  ? 902 HOH A O   1 
HETATM 8713 O O   . HOH M 7 .   ? 7.151   -59.909 46.556  1.00 47.37  ? 903 HOH A O   1 
HETATM 8714 O O   . HOH M 7 .   ? 17.807  -36.569 44.131  1.00 47.17  ? 904 HOH A O   1 
HETATM 8715 O O   . HOH M 7 .   ? -2.864  -57.406 16.439  1.00 43.34  ? 905 HOH A O   1 
HETATM 8716 O O   . HOH M 7 .   ? -0.073  -64.511 37.866  1.00 40.76  ? 906 HOH A O   1 
HETATM 8717 O O   . HOH M 7 .   ? 1.056   -38.739 15.047  1.00 32.06  ? 907 HOH A O   1 
HETATM 8718 O O   . HOH M 7 .   ? 4.542   -21.482 46.015  0.92 38.41  ? 908 HOH A O   1 
HETATM 8719 O O   . HOH M 7 .   ? -17.951 -62.462 27.732  1.00 47.94  ? 909 HOH A O   1 
HETATM 8720 O O   . HOH M 7 .   ? 11.475  -58.547 16.885  0.98 47.89  ? 910 HOH A O   1 
HETATM 8721 O O   . HOH M 7 .   ? -18.325 -21.147 15.442  1.00 40.82  ? 911 HOH A O   1 
HETATM 8722 O O   . HOH M 7 .   ? -19.315 -15.580 19.994  1.00 45.39  ? 912 HOH A O   1 
HETATM 8723 O O   . HOH M 7 .   ? -22.236 -47.110 13.028  1.00 47.08  ? 913 HOH A O   1 
HETATM 8724 O O   . HOH M 7 .   ? 5.383   -54.672 57.592  0.91 35.02  ? 914 HOH A O   1 
HETATM 8725 O O   . HOH M 7 .   ? -20.710 -64.320 21.621  1.00 50.98  ? 915 HOH A O   1 
HETATM 8726 O O   . HOH M 7 .   ? -18.535 -27.833 10.902  1.00 46.64  ? 916 HOH A O   1 
HETATM 8727 O O   . HOH M 7 .   ? -20.581 -22.371 15.303  1.00 44.29  ? 917 HOH A O   1 
HETATM 8728 O O   . HOH M 7 .   ? 18.518  -29.377 23.031  1.00 49.38  ? 918 HOH A O   1 
HETATM 8729 O O   . HOH M 7 .   ? 0.609   -63.880 47.449  1.00 52.49  ? 919 HOH A O   1 
HETATM 8730 O O   . HOH M 7 .   ? -2.602  -37.003 61.221  1.00 48.30  ? 920 HOH A O   1 
HETATM 8731 O O   . HOH M 7 .   ? 8.745   -26.407 21.729  0.91 36.70  ? 921 HOH A O   1 
HETATM 8732 O O   . HOH M 7 .   ? 19.830  -54.842 21.830  1.00 51.65  ? 922 HOH A O   1 
HETATM 8733 O O   . HOH M 7 .   ? 14.988  -50.034 9.964   0.86 32.89  ? 923 HOH A O   1 
HETATM 8734 O O   . HOH M 7 .   ? 5.395   -59.052 48.673  1.00 47.41  ? 924 HOH A O   1 
HETATM 8735 O O   . HOH M 7 .   ? -4.661  -65.903 9.268   1.00 51.89  ? 925 HOH A O   1 
HETATM 8736 O O   . HOH M 7 .   ? -24.753 -24.863 17.751  1.00 43.24  ? 926 HOH A O   1 
HETATM 8737 O O   . HOH M 7 .   ? -2.064  -17.777 30.428  0.82 44.94  ? 927 HOH A O   1 
HETATM 8738 O O   . HOH M 7 .   ? -21.258 -48.210 41.680  1.00 55.46  ? 928 HOH A O   1 
HETATM 8739 O O   . HOH M 7 .   ? -0.225  -13.087 28.442  1.00 54.02  ? 929 HOH A O   1 
HETATM 8740 O O   . HOH M 7 .   ? -19.265 -40.870 3.799   0.96 47.90  ? 930 HOH A O   1 
HETATM 8741 O O   . HOH M 7 .   ? -14.036 -47.773 31.428  1.00 32.32  ? 931 HOH A O   1 
HETATM 8742 O O   . HOH M 7 .   ? -2.113  -52.357 20.934  1.00 24.64  ? 932 HOH A O   1 
HETATM 8743 O O   . HOH M 7 .   ? -7.531  -56.950 20.847  1.00 39.08  ? 933 HOH A O   1 
HETATM 8744 O O   . HOH M 7 .   ? -14.049 -28.716 37.932  0.86 26.35  ? 934 HOH A O   1 
HETATM 8745 O O   . HOH M 7 .   ? 7.282   -55.945 16.546  1.00 32.18  ? 935 HOH A O   1 
HETATM 8746 O O   . HOH M 7 .   ? 7.783   -42.937 13.054  1.00 29.19  ? 936 HOH A O   1 
HETATM 8747 O O   . HOH M 7 .   ? 2.548   -23.137 49.429  1.00 30.66  ? 937 HOH A O   1 
HETATM 8748 O O   . HOH M 7 .   ? -27.630 -32.410 24.938  1.00 36.23  ? 938 HOH A O   1 
HETATM 8749 O O   . HOH M 7 .   ? 10.577  -52.012 43.512  1.00 26.19  ? 939 HOH A O   1 
HETATM 8750 O O   . HOH M 7 .   ? -30.752 -28.428 25.130  1.00 30.26  ? 940 HOH A O   1 
HETATM 8751 O O   . HOH M 7 .   ? -3.513  -59.805 23.970  0.93 31.43  ? 941 HOH A O   1 
HETATM 8752 O O   . HOH M 7 .   ? -7.285  -62.498 33.572  1.00 38.90  ? 942 HOH A O   1 
HETATM 8753 O O   . HOH M 7 .   ? -13.726 -64.927 5.500   1.00 31.12  ? 943 HOH A O   1 
HETATM 8754 O O   . HOH M 7 .   ? -14.658 -54.256 1.664   1.00 39.79  ? 944 HOH A O   1 
HETATM 8755 O O   . HOH M 7 .   ? -10.135 -26.620 13.506  1.00 31.88  ? 945 HOH A O   1 
HETATM 8756 O O   . HOH M 7 .   ? 0.461   -21.847 44.223  1.00 31.14  ? 946 HOH A O   1 
HETATM 8757 O O   . HOH M 7 .   ? 3.431   -22.015 43.324  1.00 37.40  ? 947 HOH A O   1 
HETATM 8758 O O   . HOH M 7 .   ? -8.179  -54.535 37.988  1.00 36.49  ? 948 HOH A O   1 
HETATM 8759 O O   . HOH M 7 .   ? -22.373 -37.534 34.447  0.91 31.76  ? 949 HOH A O   1 
HETATM 8760 O O   . HOH M 7 .   ? 11.000  -53.534 45.991  1.00 28.69  ? 950 HOH A O   1 
HETATM 8761 O O   . HOH M 7 .   ? -6.887  -40.479 26.988  0.55 27.41  ? 951 HOH A O   1 
HETATM 8762 O O   . HOH M 7 .   ? -20.370 -43.969 29.648  0.88 33.30  ? 952 HOH A O   1 
HETATM 8763 O O   . HOH M 7 .   ? -21.692 -39.902 23.269  0.98 41.06  ? 953 HOH A O   1 
HETATM 8764 O O   . HOH M 7 .   ? -15.473 -42.318 31.296  0.82 24.27  ? 954 HOH A O   1 
HETATM 8765 O O   . HOH M 7 .   ? -11.091 -42.055 29.620  0.77 30.12  ? 955 HOH A O   1 
HETATM 8766 O O   . HOH M 7 .   ? -9.088  -42.479 28.090  1.00 31.10  ? 956 HOH A O   1 
HETATM 8767 O O   . HOH M 7 .   ? -13.406 -44.791 41.510  0.93 24.74  ? 957 HOH A O   1 
HETATM 8768 O O   . HOH M 7 .   ? 11.422  -58.318 41.555  0.91 35.07  ? 958 HOH A O   1 
HETATM 8769 O O   . HOH M 7 .   ? 13.049  -55.841 42.312  1.00 38.77  ? 959 HOH A O   1 
HETATM 8770 O O   . HOH M 7 .   ? 4.624   -52.954 4.676   1.00 31.39  ? 960 HOH A O   1 
HETATM 8771 O O   . HOH M 7 .   ? -7.064  -22.439 52.943  1.00 39.10  ? 961 HOH A O   1 
HETATM 8772 O O   . HOH M 7 .   ? -21.126 -59.522 17.755  0.93 44.68  ? 962 HOH A O   1 
HETATM 8773 O O   . HOH M 7 .   ? -1.691  -55.284 5.169   1.00 42.47  ? 963 HOH A O   1 
HETATM 8774 O O   . HOH M 7 .   ? -14.358 -36.257 15.675  1.00 36.39  ? 964 HOH A O   1 
HETATM 8775 O O   . HOH M 7 .   ? -16.291 -37.044 16.592  1.00 27.69  ? 965 HOH A O   1 
HETATM 8776 O O   . HOH M 7 .   ? -4.425  -67.850 6.003   1.00 49.86  ? 966 HOH A O   1 
HETATM 8777 O O   . HOH M 7 .   ? -13.063 -26.495 38.316  0.88 23.47  ? 967 HOH A O   1 
HETATM 8778 O O   . HOH M 7 .   ? -2.019  -23.289 22.314  1.00 32.72  ? 968 HOH A O   1 
HETATM 8779 O O   . HOH M 7 .   ? 14.856  -30.957 25.331  1.00 40.23  ? 969 HOH A O   1 
HETATM 8780 O O   . HOH M 7 .   ? -3.280  -56.290 32.838  0.82 25.28  ? 970 HOH A O   1 
HETATM 8781 O O   . HOH M 7 .   ? -16.822 -58.741 31.898  1.00 32.93  ? 971 HOH A O   1 
HETATM 8782 O O   . HOH M 7 .   ? 17.221  -42.806 16.076  1.00 35.45  ? 972 HOH A O   1 
HETATM 8783 O O   . HOH M 7 .   ? 2.565   -53.931 11.909  1.00 29.88  ? 973 HOH A O   1 
HETATM 8784 O O   . HOH M 7 .   ? -9.691  -58.241 20.406  0.90 39.43  ? 974 HOH A O   1 
HETATM 8785 O O   . HOH M 7 .   ? -23.051 -39.882 34.331  0.90 32.98  ? 975 HOH A O   1 
HETATM 8786 O O   . HOH M 7 .   ? -20.500 -50.593 21.307  1.00 33.70  ? 976 HOH A O   1 
HETATM 8787 O O   . HOH M 7 .   ? -17.244 -39.704 10.520  1.00 44.46  ? 977 HOH A O   1 
HETATM 8788 O O   . HOH M 7 .   ? -10.131 -38.745 12.824  1.00 39.71  ? 978 HOH A O   1 
HETATM 8789 O O   . HOH M 7 .   ? -7.043  -40.935 54.600  1.00 40.60  ? 979 HOH A O   1 
HETATM 8790 O O   . HOH M 7 .   ? -7.431  -15.291 30.066  1.00 39.91  ? 980 HOH A O   1 
HETATM 8791 O O   . HOH M 7 .   ? -22.219 -31.906 17.125  1.00 39.16  ? 981 HOH A O   1 
HETATM 8792 O O   . HOH M 7 .   ? -20.655 -35.557 43.698  1.00 32.32  ? 982 HOH A O   1 
HETATM 8793 O O   . HOH M 7 .   ? -18.081 -41.015 45.134  1.00 44.00  ? 983 HOH A O   1 
HETATM 8794 O O   . HOH M 7 .   ? -5.932  -18.515 51.568  0.88 37.37  ? 984 HOH A O   1 
HETATM 8795 O O   . HOH M 7 .   ? -7.606  -27.888 56.676  1.00 41.95  ? 985 HOH A O   1 
HETATM 8796 O O   . HOH M 7 .   ? -18.491 -13.668 33.464  1.00 41.28  ? 986 HOH A O   1 
HETATM 8797 O O   . HOH M 7 .   ? 2.052   -20.336 32.165  0.89 37.86  ? 987 HOH A O   1 
HETATM 8798 O O   . HOH M 7 .   ? 13.845  -41.480 55.624  1.00 39.57  ? 988 HOH A O   1 
HETATM 8799 O O   . HOH M 7 .   ? 19.782  -47.590 35.505  0.86 32.66  ? 989 HOH A O   1 
HETATM 8800 O O   . HOH N 7 .   ? 5.045   -66.617 -18.883 1.00 23.00  ? 701 HOH B O   1 
HETATM 8801 O O   . HOH N 7 .   ? 10.013  -62.007 -15.056 1.00 22.51  ? 702 HOH B O   1 
HETATM 8802 O O   . HOH N 7 .   ? 3.390   -53.124 -28.947 1.00 23.73  ? 703 HOH B O   1 
HETATM 8803 O O   . HOH N 7 .   ? 1.692   -50.696 -23.623 1.00 21.95  ? 704 HOH B O   1 
HETATM 8804 O O   . HOH N 7 .   ? 14.498  -60.605 -26.387 1.00 28.49  ? 705 HOH B O   1 
HETATM 8805 O O   . HOH N 7 .   ? 4.006   -71.971 -33.470 1.00 21.42  ? 706 HOH B O   1 
HETATM 8806 O O   . HOH N 7 .   ? 4.769   -79.027 -29.058 0.89 29.35  ? 707 HOH B O   1 
HETATM 8807 O O   . HOH N 7 .   ? 3.146   -59.828 -29.333 1.00 18.39  ? 708 HOH B O   1 
HETATM 8808 O O   . HOH N 7 .   ? 4.447   -51.321 -30.437 1.00 25.38  ? 709 HOH B O   1 
HETATM 8809 O O   . HOH N 7 .   ? 9.172   -63.000 -29.166 1.00 22.89  ? 710 HOH B O   1 
HETATM 8810 O O   . HOH N 7 .   ? -1.413  -45.422 -32.234 1.00 29.33  ? 711 HOH B O   1 
HETATM 8811 O O   . HOH N 7 .   ? 2.360   -68.728 -17.159 1.00 23.43  ? 712 HOH B O   1 
HETATM 8812 O O   . HOH N 7 .   ? 4.430   -71.405 -47.736 1.00 24.16  ? 713 HOH B O   1 
HETATM 8813 O O   . HOH N 7 .   ? -10.867 -72.205 -5.044  1.00 34.63  ? 714 HOH B O   1 
HETATM 8814 O O   . HOH N 7 .   ? -6.404  -64.597 -5.231  1.00 30.33  ? 715 HOH B O   1 
HETATM 8815 O O   . HOH N 7 .   ? 9.874   -71.036 -22.543 0.85 26.69  ? 716 HOH B O   1 
HETATM 8816 O O   . HOH N 7 .   ? 5.487   -62.302 -36.586 0.93 25.27  ? 717 HOH B O   1 
HETATM 8817 O O   . HOH N 7 .   ? 15.031  -53.272 -34.678 1.00 28.73  ? 718 HOH B O   1 
HETATM 8818 O O   . HOH N 7 .   ? 8.108   -60.724 -9.684  1.00 31.16  ? 719 HOH B O   1 
HETATM 8819 O O   . HOH N 7 .   ? -5.952  -53.261 -20.451 1.00 26.29  ? 720 HOH B O   1 
HETATM 8820 O O   . HOH N 7 .   ? 8.521   -50.083 -21.433 1.00 26.52  ? 721 HOH B O   1 
HETATM 8821 O O   . HOH N 7 .   ? -4.965  -58.218 -46.147 1.00 35.83  ? 722 HOH B O   1 
HETATM 8822 O O   . HOH N 7 .   ? -9.734  -62.932 -7.408  1.00 39.13  ? 723 HOH B O   1 
HETATM 8823 O O   . HOH N 7 .   ? 15.578  -49.618 -9.581  1.00 30.97  ? 724 HOH B O   1 
HETATM 8824 O O   . HOH N 7 .   ? 4.393   -65.910 -26.101 1.00 21.89  ? 725 HOH B O   1 
HETATM 8825 O O   . HOH N 7 .   ? -11.768 -71.470 -34.748 0.94 30.73  ? 726 HOH B O   1 
HETATM 8826 O O   . HOH N 7 .   ? -4.248  -66.264 -54.397 1.00 42.58  ? 727 HOH B O   1 
HETATM 8827 O O   . HOH N 7 .   ? 8.758   -42.941 -15.098 1.00 33.81  ? 728 HOH B O   1 
HETATM 8828 O O   . HOH N 7 .   ? -11.740 -51.889 -32.773 1.00 35.39  ? 729 HOH B O   1 
HETATM 8829 O O   . HOH N 7 .   ? 13.696  -48.988 -32.299 0.96 33.31  ? 730 HOH B O   1 
HETATM 8830 O O   . HOH N 7 .   ? 14.625  -46.285 -17.551 0.99 31.43  ? 731 HOH B O   1 
HETATM 8831 O O   . HOH N 7 .   ? 9.918   -45.733 -21.719 1.00 29.86  ? 732 HOH B O   1 
HETATM 8832 O O   . HOH N 7 .   ? -6.030  -70.309 -47.118 0.95 35.34  ? 733 HOH B O   1 
HETATM 8833 O O   . HOH N 7 .   ? 9.830   -60.753 -27.922 0.88 20.64  ? 734 HOH B O   1 
HETATM 8834 O O   . HOH N 7 .   ? -0.313  -53.243 -41.586 0.92 27.20  ? 735 HOH B O   1 
HETATM 8835 O O   . HOH N 7 .   ? 16.687  -61.860 -35.068 1.00 28.81  ? 736 HOH B O   1 
HETATM 8836 O O   . HOH N 7 .   ? 6.949   -53.312 -35.723 1.00 25.03  ? 737 HOH B O   1 
HETATM 8837 O O   . HOH N 7 .   ? -10.017 -78.101 -27.841 1.00 27.86  ? 738 HOH B O   1 
HETATM 8838 O O   . HOH N 7 .   ? -10.585 -44.916 -25.316 1.00 35.76  ? 739 HOH B O   1 
HETATM 8839 O O   . HOH N 7 .   ? 7.664   -72.965 -33.939 1.00 28.72  ? 740 HOH B O   1 
HETATM 8840 O O   . HOH N 7 .   ? 5.777   -51.682 -15.506 0.97 23.52  ? 741 HOH B O   1 
HETATM 8841 O O   . HOH N 7 .   ? 10.267  -58.257 8.365   1.00 41.23  ? 742 HOH B O   1 
HETATM 8842 O O   . HOH N 7 .   ? 17.432  -53.893 -33.399 1.00 30.69  ? 743 HOH B O   1 
HETATM 8843 O O   . HOH N 7 .   ? 14.820  -66.989 -32.197 0.85 28.25  ? 744 HOH B O   1 
HETATM 8844 O O   . HOH N 7 .   ? -12.920 -78.127 -43.761 0.88 36.39  ? 745 HOH B O   1 
HETATM 8845 O O   . HOH N 7 .   ? -4.943  -49.720 -38.050 0.84 26.57  ? 746 HOH B O   1 
HETATM 8846 O O   . HOH N 7 .   ? 10.298  -62.761 -32.967 0.75 25.46  ? 747 HOH B O   1 
HETATM 8847 O O   . HOH N 7 .   ? -0.083  -64.597 -49.492 1.00 27.02  ? 748 HOH B O   1 
HETATM 8848 O O   . HOH N 7 .   ? 2.959   -49.258 -47.237 1.00 28.20  ? 749 HOH B O   1 
HETATM 8849 O O   . HOH N 7 .   ? 13.236  -47.052 -19.472 1.00 29.31  ? 750 HOH B O   1 
HETATM 8850 O O   . HOH N 7 .   ? 13.721  -69.551 -32.104 0.93 28.55  ? 751 HOH B O   1 
HETATM 8851 O O   . HOH N 7 .   ? -7.351  -73.628 -9.459  0.90 28.72  ? 752 HOH B O   1 
HETATM 8852 O O   . HOH N 7 .   ? 14.065  -54.320 -36.798 1.00 30.63  ? 753 HOH B O   1 
HETATM 8853 O O   . HOH N 7 .   ? 16.134  -82.219 -23.703 1.00 33.86  ? 754 HOH B O   1 
HETATM 8854 O O   . HOH N 7 .   ? 7.110   -63.281 -46.755 0.88 28.10  ? 755 HOH B O   1 
HETATM 8855 O O   . HOH N 7 .   ? 11.689  -59.351 -31.891 0.94 28.12  ? 756 HOH B O   1 
HETATM 8856 O O   . HOH N 7 .   ? 4.199   -51.695 -47.466 1.00 31.33  ? 757 HOH B O   1 
HETATM 8857 O O   . HOH N 7 .   ? 12.955  -69.947 -29.414 1.00 30.92  ? 758 HOH B O   1 
HETATM 8858 O O   . HOH N 7 .   ? 12.859  -46.414 -31.057 0.98 36.07  ? 759 HOH B O   1 
HETATM 8859 O O   . HOH N 7 .   ? 14.926  -50.480 -34.490 1.00 35.81  ? 760 HOH B O   1 
HETATM 8860 O O   . HOH N 7 .   ? 10.002  -74.890 -34.815 0.89 28.69  ? 761 HOH B O   1 
HETATM 8861 O O   . HOH N 7 .   ? 12.585  -42.744 -11.952 0.92 32.02  ? 762 HOH B O   1 
HETATM 8862 O O   . HOH N 7 .   ? 7.075   -82.736 -48.244 1.00 40.87  ? 763 HOH B O   1 
HETATM 8863 O O   . HOH N 7 .   ? -8.854  -66.584 -45.185 1.00 38.58  ? 764 HOH B O   1 
HETATM 8864 O O   . HOH N 7 .   ? 14.277  -60.819 -23.468 1.00 29.41  ? 765 HOH B O   1 
HETATM 8865 O O   . HOH N 7 .   ? -4.552  -50.660 -32.037 1.00 27.25  ? 766 HOH B O   1 
HETATM 8866 O O   . HOH N 7 .   ? 11.210  -47.769 9.087   0.95 30.71  ? 767 HOH B O   1 
HETATM 8867 O O   . HOH N 7 .   ? -4.326  -44.862 -22.329 1.00 30.85  ? 768 HOH B O   1 
HETATM 8868 O O   . HOH N 7 .   ? 15.245  -41.808 -5.986  1.00 33.62  ? 769 HOH B O   1 
HETATM 8869 O O   . HOH N 7 .   ? -10.948 -46.536 -34.829 1.00 34.79  ? 770 HOH B O   1 
HETATM 8870 O O   . HOH N 7 .   ? 18.353  -59.813 3.000   0.99 43.67  ? 771 HOH B O   1 
HETATM 8871 O O   . HOH N 7 .   ? 19.968  -59.031 -27.348 0.89 39.88  ? 772 HOH B O   1 
HETATM 8872 O O   . HOH N 7 .   ? -4.082  -38.956 -7.143  1.00 41.38  ? 773 HOH B O   1 
HETATM 8873 O O   . HOH N 7 .   ? 19.650  -45.061 -1.044  1.00 39.23  ? 774 HOH B O   1 
HETATM 8874 O O   . HOH N 7 .   ? 0.937   -84.096 -9.355  0.97 41.76  ? 775 HOH B O   1 
HETATM 8875 O O   . HOH N 7 .   ? -9.019  -83.611 -45.989 1.00 37.30  ? 776 HOH B O   1 
HETATM 8876 O O   . HOH N 7 .   ? 10.949  -45.729 -24.425 1.00 42.25  ? 777 HOH B O   1 
HETATM 8877 O O   . HOH N 7 .   ? 11.867  -67.762 -7.271  1.00 34.71  ? 778 HOH B O   1 
HETATM 8878 O O   . HOH N 7 .   ? 24.024  -54.912 -17.880 0.98 46.85  ? 779 HOH B O   1 
HETATM 8879 O O   . HOH N 7 .   ? 6.717   -71.163 -46.452 1.00 24.69  ? 780 HOH B O   1 
HETATM 8880 O O   . HOH N 7 .   ? 8.411   -69.616 -47.431 0.80 22.65  ? 781 HOH B O   1 
HETATM 8881 O O   . HOH N 7 .   ? -2.136  -34.972 -42.404 1.00 42.10  ? 782 HOH B O   1 
HETATM 8882 O O   . HOH N 7 .   ? 13.345  -47.372 -24.853 1.00 38.12  ? 783 HOH B O   1 
HETATM 8883 O O   . HOH N 7 .   ? 12.962  -74.449 -9.644  0.94 40.61  ? 784 HOH B O   1 
HETATM 8884 O O   . HOH N 7 .   ? 24.039  -51.836 -2.494  1.00 45.18  ? 785 HOH B O   1 
HETATM 8885 O O   . HOH N 7 .   ? 5.081   -60.148 -0.235  1.00 47.74  ? 786 HOH B O   1 
HETATM 8886 O O   . HOH N 7 .   ? -16.768 -46.631 -32.063 1.00 36.81  ? 787 HOH B O   1 
HETATM 8887 O O   . HOH N 7 .   ? 13.094  -45.054 -21.285 1.00 37.90  ? 788 HOH B O   1 
HETATM 8888 O O   . HOH N 7 .   ? 11.153  -57.967 -0.660  1.00 29.94  ? 789 HOH B O   1 
HETATM 8889 O O   . HOH N 7 .   ? 17.952  -69.262 -21.791 1.00 43.82  ? 790 HOH B O   1 
HETATM 8890 O O   . HOH N 7 .   ? 8.948   -40.595 -6.918  0.93 38.41  ? 791 HOH B O   1 
HETATM 8891 O O   . HOH N 7 .   ? -3.302  -59.087 -52.615 1.00 50.04  ? 792 HOH B O   1 
HETATM 8892 O O   . HOH N 7 .   ? 0.587   -59.394 -52.786 0.85 39.83  ? 793 HOH B O   1 
HETATM 8893 O O   . HOH N 7 .   ? 4.343   -69.777 -41.104 1.00 21.28  ? 794 HOH B O   1 
HETATM 8894 O O   . HOH N 7 .   ? -16.421 -55.917 -27.192 1.00 43.38  ? 795 HOH B O   1 
HETATM 8895 O O   . HOH N 7 .   ? -12.185 -40.369 -32.886 0.81 31.00  ? 796 HOH B O   1 
HETATM 8896 O O   . HOH N 7 .   ? -12.491 -80.175 -11.398 1.00 43.97  ? 797 HOH B O   1 
HETATM 8897 O O   . HOH N 7 .   ? -13.366 -77.116 -40.275 0.95 30.59  ? 798 HOH B O   1 
HETATM 8898 O O   . HOH N 7 .   ? 5.174   -60.695 -9.168  0.95 33.33  ? 799 HOH B O   1 
HETATM 8899 O O   . HOH N 7 .   ? 6.005   -41.519 -14.884 1.00 41.42  ? 800 HOH B O   1 
HETATM 8900 O O   . HOH N 7 .   ? 4.821   -42.558 -12.226 1.00 33.09  ? 801 HOH B O   1 
HETATM 8901 O O   . HOH N 7 .   ? -12.082 -76.860 -46.129 1.00 40.31  ? 802 HOH B O   1 
HETATM 8902 O O   . HOH N 7 .   ? -1.871  -71.300 0.939   0.88 34.83  ? 803 HOH B O   1 
HETATM 8903 O O   . HOH N 7 .   ? 9.869   -40.336 -17.734 1.00 47.97  ? 804 HOH B O   1 
HETATM 8904 O O   . HOH N 7 .   ? 12.028  -58.846 10.630  1.00 45.99  ? 805 HOH B O   1 
HETATM 8905 O O   . HOH N 7 .   ? 0.791   -71.701 0.726   1.00 52.74  ? 806 HOH B O   1 
HETATM 8906 O O   . HOH N 7 .   ? 6.776   -64.448 -29.118 1.00 23.22  ? 807 HOH B O   1 
HETATM 8907 O O   . HOH N 7 .   ? 11.754  -72.996 -35.125 0.96 27.64  ? 808 HOH B O   1 
HETATM 8908 O O   . HOH N 7 .   ? -5.654  -61.936 -5.656  1.00 30.70  ? 809 HOH B O   1 
HETATM 8909 O O   . HOH N 7 .   ? 6.984   -50.685 -28.316 1.00 26.53  ? 810 HOH B O   1 
HETATM 8910 O O   . HOH N 7 .   ? 1.023   -46.983 -15.114 1.00 33.25  ? 811 HOH B O   1 
HETATM 8911 O O   . HOH N 7 .   ? -2.249  -44.242 -48.957 1.00 46.75  ? 812 HOH B O   1 
HETATM 8912 O O   . HOH N 7 .   ? 4.288   -56.242 -37.889 0.99 20.53  ? 813 HOH B O   1 
HETATM 8913 O O   . HOH N 7 .   ? 1.138   -46.505 -18.198 1.00 36.01  ? 814 HOH B O   1 
HETATM 8914 O O   . HOH N 7 .   ? -18.396 -70.890 -28.726 1.00 42.45  ? 815 HOH B O   1 
HETATM 8915 O O   . HOH N 7 .   ? -1.365  -54.683 -51.556 0.99 45.21  ? 816 HOH B O   1 
HETATM 8916 O O   . HOH N 7 .   ? 8.183   -35.225 -45.397 1.00 63.84  ? 817 HOH B O   1 
HETATM 8917 O O   . HOH N 7 .   ? -14.431 -71.820 -10.970 1.00 29.75  ? 818 HOH B O   1 
HETATM 8918 O O   . HOH N 7 .   ? 15.040  -71.377 -28.065 1.00 37.05  ? 819 HOH B O   1 
HETATM 8919 O O   . HOH N 7 .   ? -10.846 -50.177 -34.620 0.91 37.23  ? 820 HOH B O   1 
HETATM 8920 O O   . HOH N 7 .   ? -16.088 -47.985 -34.840 1.00 46.35  ? 821 HOH B O   1 
HETATM 8921 O O   . HOH N 7 .   ? 4.391   -81.643 -3.565  1.00 47.55  ? 822 HOH B O   1 
HETATM 8922 O O   . HOH N 7 .   ? -5.368  -76.017 -59.269 0.85 42.95  ? 823 HOH B O   1 
HETATM 8923 O O   . HOH N 7 .   ? -18.343 -48.908 -33.916 1.00 47.34  ? 824 HOH B O   1 
HETATM 8924 O O   . HOH N 7 .   ? -17.947 -71.496 -37.139 0.93 45.84  ? 825 HOH B O   1 
HETATM 8925 O O   . HOH N 7 .   ? 7.390   -66.582 -38.761 1.00 29.00  ? 826 HOH B O   1 
HETATM 8926 O O   . HOH N 7 .   ? 0.723   -48.104 -22.842 1.00 20.98  ? 827 HOH B O   1 
HETATM 8927 O O   . HOH N 7 .   ? 10.528  -57.070 1.741   1.00 27.62  ? 828 HOH B O   1 
HETATM 8928 O O   . HOH N 7 .   ? 1.950   -54.314 -42.928 1.00 32.88  ? 829 HOH B O   1 
HETATM 8929 O O   . HOH N 7 .   ? 15.759  -72.585 -20.967 1.00 39.33  ? 830 HOH B O   1 
HETATM 8930 O O   . HOH N 7 .   ? 15.045  -59.555 -41.965 1.00 36.47  ? 831 HOH B O   1 
HETATM 8931 O O   . HOH N 7 .   ? 8.026   -56.092 -46.319 1.00 32.77  ? 832 HOH B O   1 
HETATM 8932 O O   . HOH N 7 .   ? -13.462 -81.805 -26.860 0.99 38.75  ? 833 HOH B O   1 
HETATM 8933 O O   . HOH N 7 .   ? 12.307  -51.785 -44.464 1.00 37.46  ? 834 HOH B O   1 
HETATM 8934 O O   . HOH N 7 .   ? 23.143  -66.263 -11.291 1.00 35.12  ? 835 HOH B O   1 
HETATM 8935 O O   . HOH N 7 .   ? 16.302  -55.712 -38.093 1.00 34.83  ? 836 HOH B O   1 
HETATM 8936 O O   . HOH N 7 .   ? 18.416  -84.314 -22.503 0.85 36.41  ? 837 HOH B O   1 
HETATM 8937 O O   . HOH N 7 .   ? -16.364 -67.582 -7.265  1.00 38.20  ? 838 HOH B O   1 
HETATM 8938 O O   . HOH N 7 .   ? 24.297  -66.990 -24.633 1.00 39.94  ? 839 HOH B O   1 
HETATM 8939 O O   . HOH N 7 .   ? 5.031   -66.105 -7.006  1.00 36.99  ? 840 HOH B O   1 
HETATM 8940 O O   . HOH N 7 .   ? -2.706  -38.821 -24.051 0.89 33.23  ? 841 HOH B O   1 
HETATM 8941 O O   . HOH N 7 .   ? 2.922   -35.914 -28.299 1.00 42.43  ? 842 HOH B O   1 
HETATM 8942 O O   . HOH N 7 .   ? 22.141  -45.166 -5.316  1.00 48.31  ? 843 HOH B O   1 
HETATM 8943 O O   . HOH N 7 .   ? -2.882  -81.070 -52.160 0.76 31.87  ? 844 HOH B O   1 
HETATM 8944 O O   . HOH N 7 .   ? -18.497 -75.269 -17.109 1.00 42.97  ? 845 HOH B O   1 
HETATM 8945 O O   . HOH N 7 .   ? 3.937   -35.089 -32.146 1.00 43.28  ? 846 HOH B O   1 
HETATM 8946 O O   . HOH N 7 .   ? -5.120  -82.162 -51.602 0.90 33.16  ? 847 HOH B O   1 
HETATM 8947 O O   . HOH N 7 .   ? 8.708   -42.241 -0.397  1.00 52.89  ? 848 HOH B O   1 
HETATM 8948 O O   . HOH N 7 .   ? 1.728   -36.389 -30.743 0.87 33.78  ? 849 HOH B O   1 
HETATM 8949 O O   . HOH N 7 .   ? 2.898   -63.380 -51.785 1.00 53.34  ? 850 HOH B O   1 
HETATM 8950 O O   . HOH N 7 .   ? -11.785 -52.103 -38.701 0.94 38.65  ? 851 HOH B O   1 
HETATM 8951 O O   . HOH N 7 .   ? 15.360  -89.345 -12.987 1.00 50.47  ? 852 HOH B O   1 
HETATM 8952 O O   . HOH N 7 .   ? 23.221  -53.375 -28.516 0.93 44.89  ? 853 HOH B O   1 
HETATM 8953 O O   . HOH N 7 .   ? 8.507   -75.425 -3.370  1.00 50.00  ? 854 HOH B O   1 
HETATM 8954 O O   . HOH N 7 .   ? 9.872   -87.673 -41.640 1.00 53.28  ? 855 HOH B O   1 
HETATM 8955 O O   . HOH N 7 .   ? 5.748   -51.890 -49.780 1.00 45.90  ? 856 HOH B O   1 
HETATM 8956 O O   . HOH N 7 .   ? -1.406  -48.399 -21.727 1.00 27.27  ? 857 HOH B O   1 
HETATM 8957 O O   . HOH N 7 .   ? 6.722   -50.704 -35.060 1.00 30.44  ? 858 HOH B O   1 
HETATM 8958 O O   . HOH N 7 .   ? -7.373  -60.024 -6.502  1.00 34.07  ? 859 HOH B O   1 
HETATM 8959 O O   . HOH N 7 .   ? -9.867  -60.167 -7.680  1.00 32.82  ? 860 HOH B O   1 
HETATM 8960 O O   . HOH N 7 .   ? 4.521   -69.120 -49.193 1.00 25.06  ? 861 HOH B O   1 
HETATM 8961 O O   . HOH N 7 .   ? -19.566 -72.573 -17.016 1.00 47.81  ? 862 HOH B O   1 
HETATM 8962 O O   . HOH N 7 .   ? 3.608   -79.636 -9.577  0.95 33.45  ? 863 HOH B O   1 
HETATM 8963 O O   . HOH N 7 .   ? 8.910   -43.075 -5.988  1.00 31.91  ? 864 HOH B O   1 
HETATM 8964 O O   . HOH N 7 .   ? 14.816  -71.528 -22.862 1.00 41.60  ? 865 HOH B O   1 
HETATM 8965 O O   . HOH N 7 .   ? 2.480   -65.657 -7.242  1.00 37.72  ? 866 HOH B O   1 
HETATM 8966 O O   . HOH N 7 .   ? -11.193 -67.480 -43.850 1.00 39.82  ? 867 HOH B O   1 
HETATM 8967 O O   . HOH N 7 .   ? 4.728   -56.294 -40.676 0.88 24.73  ? 868 HOH B O   1 
HETATM 8968 O O   . HOH N 7 .   ? -9.018  -36.599 -41.346 1.00 43.42  ? 869 HOH B O   1 
HETATM 8969 O O   . HOH N 7 .   ? 23.201  -52.737 -8.360  1.00 41.06  ? 870 HOH B O   1 
HETATM 8970 O O   . HOH N 7 .   ? 12.195  -59.788 -28.874 1.00 33.93  ? 871 HOH B O   1 
HETATM 8971 O O   . HOH N 7 .   ? 15.293  -61.758 -39.621 0.97 33.75  ? 872 HOH B O   1 
HETATM 8972 O O   . HOH N 7 .   ? -4.292  -36.713 -35.014 0.95 36.83  ? 873 HOH B O   1 
HETATM 8973 O O   . HOH N 7 .   ? 10.645  -43.706 1.968   1.00 42.95  ? 874 HOH B O   1 
HETATM 8974 O O   . HOH N 7 .   ? 21.863  -64.157 -9.515  1.00 37.97  ? 875 HOH B O   1 
HETATM 8975 O O   . HOH N 7 .   ? -18.669 -73.886 -32.711 1.00 41.74  ? 876 HOH B O   1 
HETATM 8976 O O   . HOH N 7 .   ? -19.007 -58.215 -21.233 0.98 38.86  ? 877 HOH B O   1 
HETATM 8977 O O   . HOH N 7 .   ? -4.538  -36.470 -38.053 1.00 43.70  ? 878 HOH B O   1 
HETATM 8978 O O   . HOH N 7 .   ? 6.621   -39.216 -26.385 1.00 40.07  ? 879 HOH B O   1 
HETATM 8979 O O   . HOH N 7 .   ? -14.434 -46.467 -34.058 1.00 45.15  ? 880 HOH B O   1 
HETATM 8980 O O   . HOH N 7 .   ? 10.167  -61.111 -5.869  1.00 37.86  ? 881 HOH B O   1 
HETATM 8981 O O   . HOH N 7 .   ? -12.667 -61.116 -39.583 1.00 40.26  ? 882 HOH B O   1 
HETATM 8982 O O   . HOH N 7 .   ? -1.171  -57.738 -51.360 0.97 41.12  ? 883 HOH B O   1 
HETATM 8983 O O   . HOH N 7 .   ? 19.769  -84.613 -25.018 1.00 44.84  ? 884 HOH B O   1 
HETATM 8984 O O   . HOH N 7 .   ? -9.066  -85.692 -21.709 1.00 42.74  ? 885 HOH B O   1 
HETATM 8985 O O   . HOH N 7 .   ? 12.006  -57.492 -27.337 0.75 28.25  ? 886 HOH B O   1 
HETATM 8986 O O   . HOH N 7 .   ? 12.574  -80.071 -38.346 1.00 44.56  ? 887 HOH B O   1 
HETATM 8987 O O   . HOH N 7 .   ? -18.665 -53.098 -30.271 1.00 46.00  ? 888 HOH B O   1 
HETATM 8988 O O   . HOH N 7 .   ? -10.719 -58.044 -8.330  1.00 50.45  ? 889 HOH B O   1 
HETATM 8989 O O   . HOH N 7 .   ? 5.826   -86.033 -28.128 1.00 47.08  ? 890 HOH B O   1 
HETATM 8990 O O   . HOH N 7 .   ? 1.632   -36.096 -8.695  1.00 45.22  ? 891 HOH B O   1 
HETATM 8991 O O   . HOH N 7 .   ? 2.389   -65.965 -50.568 0.99 43.23  ? 892 HOH B O   1 
HETATM 8992 O O   . HOH N 7 .   ? 12.609  -60.370 -0.450  0.95 37.80  ? 893 HOH B O   1 
HETATM 8993 O O   . HOH N 7 .   ? -15.635 -78.237 -40.950 0.94 46.81  ? 894 HOH B O   1 
HETATM 8994 O O   . HOH N 7 .   ? 10.234  -74.181 -40.816 0.72 28.87  ? 895 HOH B O   1 
HETATM 8995 O O   . HOH N 7 .   ? -2.561  -30.040 -38.711 1.00 47.25  ? 896 HOH B O   1 
HETATM 8996 O O   . HOH N 7 .   ? 7.741   -62.081 -3.667  1.00 46.36  ? 897 HOH B O   1 
HETATM 8997 O O   . HOH N 7 .   ? -12.495 -63.547 -0.857  0.92 42.61  ? 898 HOH B O   1 
HETATM 8998 O O   . HOH N 7 .   ? 6.529   -70.881 -3.481  1.00 47.29  ? 899 HOH B O   1 
HETATM 8999 O O   . HOH N 7 .   ? 10.191  -61.451 -2.308  1.00 51.76  ? 900 HOH B O   1 
HETATM 9000 O O   . HOH N 7 .   ? -0.463  -36.648 -6.213  1.00 45.28  ? 901 HOH B O   1 
HETATM 9001 O O   . HOH N 7 .   ? 2.129   -79.497 -58.030 0.96 44.64  ? 902 HOH B O   1 
HETATM 9002 O O   . HOH N 7 .   ? -1.696  -84.422 -10.687 1.00 49.36  ? 903 HOH B O   1 
HETATM 9003 O O   . HOH N 7 .   ? 11.826  -83.825 -38.527 1.00 46.07  ? 904 HOH B O   1 
HETATM 9004 O O   . HOH N 7 .   ? -4.137  -66.313 -57.394 1.00 48.75  ? 905 HOH B O   1 
HETATM 9005 O O   . HOH N 7 .   ? -1.928  -43.448 -17.545 1.00 53.10  ? 906 HOH B O   1 
HETATM 9006 O O   . HOH N 7 .   ? -14.764 -87.222 -32.395 1.00 50.69  ? 907 HOH B O   1 
HETATM 9007 O O   . HOH N 7 .   ? -19.365 -75.967 -22.434 1.00 54.48  ? 908 HOH B O   1 
HETATM 9008 O O   . HOH N 7 .   ? -12.915 -54.228 -35.468 1.00 48.37  ? 909 HOH B O   1 
HETATM 9009 O O   . HOH N 7 .   ? -5.171  -89.311 -45.854 1.00 56.79  ? 910 HOH B O   1 
HETATM 9010 O O   . HOH N 7 .   ? -12.342 -83.281 -11.611 1.00 53.48  ? 911 HOH B O   1 
HETATM 9011 O O   . HOH N 7 .   ? 14.628  -72.734 -25.184 1.00 51.47  ? 912 HOH B O   1 
HETATM 9012 O O   . HOH N 7 .   ? 21.635  -76.436 -14.227 1.00 50.90  ? 913 HOH B O   1 
HETATM 9013 O O   . HOH N 7 .   ? 4.820   -85.512 -9.542  1.00 47.79  ? 914 HOH B O   1 
HETATM 9014 O O   . HOH N 7 .   ? 0.819   -67.554 -32.681 1.00 19.50  ? 915 HOH B O   1 
HETATM 9015 O O   . HOH N 7 .   ? 17.171  -51.527 6.234   1.00 25.87  ? 916 HOH B O   1 
HETATM 9016 O O   . HOH N 7 .   ? 8.016   -53.714 -33.177 0.97 27.64  ? 917 HOH B O   1 
HETATM 9017 O O   . HOH N 7 .   ? -2.229  -48.416 -30.330 1.00 22.74  ? 918 HOH B O   1 
HETATM 9018 O O   . HOH N 7 .   ? -0.855  -46.459 -29.582 1.00 21.58  ? 919 HOH B O   1 
HETATM 9019 O O   . HOH N 7 .   ? 4.352   -78.693 -6.377  0.95 36.36  ? 920 HOH B O   1 
HETATM 9020 O O   . HOH N 7 .   ? 1.765   -85.595 -22.425 1.00 30.56  ? 921 HOH B O   1 
HETATM 9021 O O   . HOH N 7 .   ? 10.840  -58.231 3.988   0.94 26.63  ? 922 HOH B O   1 
HETATM 9022 O O   . HOH N 7 .   ? -0.499  -67.714 -1.863  1.00 31.18  ? 923 HOH B O   1 
HETATM 9023 O O   . HOH N 7 .   ? -13.309 -83.510 -31.018 0.96 39.22  ? 924 HOH B O   1 
HETATM 9024 O O   . HOH N 7 .   ? 15.718  -54.323 -26.595 1.00 39.44  ? 925 HOH B O   1 
HETATM 9025 O O   . HOH N 7 .   ? 8.037   -53.498 -46.536 1.00 26.74  ? 926 HOH B O   1 
HETATM 9026 O O   . HOH N 7 .   ? 9.520   -51.439 -46.167 1.00 35.96  ? 927 HOH B O   1 
HETATM 9027 O O   . HOH N 7 .   ? -6.470  -41.419 -23.956 1.00 29.46  ? 928 HOH B O   1 
HETATM 9028 O O   . HOH N 7 .   ? 12.644  -61.849 -8.198  1.00 38.64  ? 929 HOH B O   1 
HETATM 9029 O O   . HOH N 7 .   ? -10.666 -39.275 -38.985 1.00 41.59  ? 930 HOH B O   1 
HETATM 9030 O O   . HOH N 7 .   ? -2.719  -53.831 -11.840 0.91 25.31  ? 931 HOH B O   1 
HETATM 9031 O O   . HOH N 7 .   ? 11.815  -72.116 -16.244 0.87 28.49  ? 932 HOH B O   1 
HETATM 9032 O O   . HOH N 7 .   ? -5.027  -55.114 -12.115 1.00 28.74  ? 933 HOH B O   1 
HETATM 9033 O O   . HOH N 7 .   ? -5.350  -75.096 -55.882 1.00 29.78  ? 934 HOH B O   1 
HETATM 9034 O O   . HOH N 7 .   ? 9.330   -77.004 -36.835 1.00 35.25  ? 935 HOH B O   1 
HETATM 9035 O O   . HOH N 7 .   ? 7.421   -78.065 -36.355 1.00 28.69  ? 936 HOH B O   1 
HETATM 9036 O O   . HOH N 7 .   ? 3.675   -59.012 -23.498 0.68 30.17  ? 937 HOH B O   1 
HETATM 9037 O O   . HOH N 7 .   ? 6.463   -59.408 -23.497 1.00 37.88  ? 938 HOH B O   1 
HETATM 9038 O O   . HOH N 7 .   ? -3.793  -56.752 4.092   1.00 29.58  ? 939 HOH B O   1 
HETATM 9039 O O   . HOH N 7 .   ? 1.845   -89.581 -34.555 1.00 51.60  ? 940 HOH B O   1 
HETATM 9040 O O   . HOH N 7 .   ? -1.927  -64.673 -0.954  1.00 40.31  ? 941 HOH B O   1 
HETATM 9041 O O   . HOH N 7 .   ? 21.351  -45.608 -10.164 1.00 41.41  ? 942 HOH B O   1 
HETATM 9042 O O   . HOH N 7 .   ? -0.347  -63.940 -46.682 1.00 24.49  ? 943 HOH B O   1 
HETATM 9043 O O   . HOH N 7 .   ? 0.872   -62.066 -45.917 1.00 19.70  ? 944 HOH B O   1 
HETATM 9044 O O   . HOH N 7 .   ? 2.527   -56.789 -0.665  1.00 35.04  ? 945 HOH B O   1 
HETATM 9045 O O   . HOH N 7 .   ? -0.769  -68.178 -53.549 1.00 42.53  ? 946 HOH B O   1 
HETATM 9046 O O   . HOH N 7 .   ? 0.483   -60.990 -1.188  1.00 32.57  ? 947 HOH B O   1 
HETATM 9047 O O   . HOH N 7 .   ? -6.782  -54.933 -13.752 1.00 31.31  ? 948 HOH B O   1 
HETATM 9048 O O   . HOH N 7 .   ? 18.027  -51.332 -16.383 1.00 32.07  ? 949 HOH B O   1 
HETATM 9049 O O   . HOH N 7 .   ? 20.998  -53.517 -17.541 1.00 44.98  ? 950 HOH B O   1 
HETATM 9050 O O   . HOH N 7 .   ? -11.977 -51.445 -29.424 0.97 37.69  ? 951 HOH B O   1 
HETATM 9051 O O   . HOH N 7 .   ? -8.528  -71.220 -47.580 1.00 35.14  ? 952 HOH B O   1 
HETATM 9052 O O   . HOH N 7 .   ? -2.337  -80.015 -1.731  1.00 35.46  ? 953 HOH B O   1 
HETATM 9053 O O   . HOH N 7 .   ? -8.718  -33.539 -40.979 1.00 39.96  ? 954 HOH B O   1 
HETATM 9054 O O   . HOH N 7 .   ? 0.229   -43.613 -21.676 1.00 34.80  ? 955 HOH B O   1 
HETATM 9055 O O   . HOH N 7 .   ? -4.628  -55.275 -45.111 0.97 33.28  ? 956 HOH B O   1 
HETATM 9056 O O   . HOH N 7 .   ? -14.179 -59.012 -37.407 1.00 44.61  ? 957 HOH B O   1 
HETATM 9057 O O   . HOH N 7 .   ? -2.899  -82.433 -54.583 1.00 39.73  ? 958 HOH B O   1 
HETATM 9058 O O   . HOH N 7 .   ? -12.448 -55.741 -7.759  1.00 50.48  ? 959 HOH B O   1 
HETATM 9059 O O   . HOH N 7 .   ? -8.096  -82.584 -48.537 1.00 38.49  ? 960 HOH B O   1 
HETATM 9060 O O   . HOH N 7 .   ? 21.763  -61.810 -4.373  1.00 47.02  ? 961 HOH B O   1 
HETATM 9061 O O   . HOH N 7 .   ? 18.964  -72.552 -13.774 1.00 41.68  ? 962 HOH B O   1 
HETATM 9062 O O   . HOH N 7 .   ? -9.161  -52.480 -18.544 1.00 44.35  ? 963 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   2   ?   ?   ?   A . n 
A 1 2   ARG 2   3   ?   ?   ?   A . n 
A 1 3   GLU 3   4   4   GLU GLU A . n 
A 1 4   ASP 4   5   5   ASP ASP A . n 
A 1 5   ALA 5   6   6   ALA ALA A . n 
A 1 6   GLU 6   7   7   GLU GLU A . n 
A 1 7   LEU 7   8   8   LEU LEU A . n 
A 1 8   LEU 8   9   9   LEU LEU A . n 
A 1 9   VAL 9   10  10  VAL VAL A . n 
A 1 10  THR 10  11  11  THR THR A . n 
A 1 11  VAL 11  12  12  VAL VAL A . n 
A 1 12  ARG 12  13  13  ARG ARG A . n 
A 1 13  GLY 13  14  14  GLY GLY A . n 
A 1 14  GLY 14  15  15  GLY GLY A . n 
A 1 15  ARG 15  16  16  ARG ARG A . n 
A 1 16  LEU 16  17  17  LEU LEU A . n 
A 1 17  ARG 17  18  18  ARG ARG A . n 
A 1 18  GLY 18  19  19  GLY GLY A . n 
A 1 19  ILE 19  20  20  ILE ILE A . n 
A 1 20  ARG 20  21  21  ARG ARG A . n 
A 1 21  LEU 21  22  22  LEU LEU A . n 
A 1 22  LYS 22  23  23  LYS LYS A . n 
A 1 23  THR 23  24  24  THR THR A . n 
A 1 24  PRO 24  25  25  PRO PRO A . n 
A 1 25  GLY 25  26  26  GLY GLY A . n 
A 1 26  GLY 26  27  27  GLY GLY A . n 
A 1 27  PRO 27  28  28  PRO PRO A . n 
A 1 28  VAL 28  29  29  VAL VAL A . n 
A 1 29  SER 29  30  30  SER SER A . n 
A 1 30  ALA 30  31  31  ALA ALA A . n 
A 1 31  PHE 31  32  32  PHE PHE A . n 
A 1 32  LEU 32  33  33  LEU LEU A . n 
A 1 33  GLY 33  34  34  GLY GLY A . n 
A 1 34  ILE 34  35  35  ILE ILE A . n 
A 1 35  PRO 35  36  36  PRO PRO A . n 
A 1 36  PHE 36  37  37  PHE PHE A . n 
A 1 37  ALA 37  38  38  ALA ALA A . n 
A 1 38  GLU 38  39  39  GLU GLU A . n 
A 1 39  PRO 39  40  40  PRO PRO A . n 
A 1 40  PRO 40  41  41  PRO PRO A . n 
A 1 41  MET 41  42  42  MET MET A . n 
A 1 42  GLY 42  43  43  GLY GLY A . n 
A 1 43  PRO 43  44  44  PRO PRO A . n 
A 1 44  ARG 44  45  45  ARG ARG A . n 
A 1 45  ARG 45  46  46  ARG ARG A . n 
A 1 46  PHE 46  47  47  PHE PHE A . n 
A 1 47  LEU 47  48  48  LEU LEU A . n 
A 1 48  PRO 48  49  49  PRO PRO A . n 
A 1 49  PRO 49  50  50  PRO PRO A . n 
A 1 50  GLU 50  51  51  GLU GLU A . n 
A 1 51  PRO 51  52  52  PRO PRO A . n 
A 1 52  LYS 52  53  53  LYS LYS A . n 
A 1 53  GLN 53  54  54  GLN GLN A . n 
A 1 54  PRO 54  55  55  PRO PRO A . n 
A 1 55  TRP 55  56  56  TRP TRP A . n 
A 1 56  SER 56  57  57  SER SER A . n 
A 1 57  GLY 57  58  58  GLY GLY A . n 
A 1 58  VAL 58  59  59  VAL VAL A . n 
A 1 59  VAL 59  60  60  VAL VAL A . n 
A 1 60  ASP 60  61  61  ASP ASP A . n 
A 1 61  ALA 61  62  62  ALA ALA A . n 
A 1 62  THR 62  63  63  THR THR A . n 
A 1 63  THR 63  64  64  THR THR A . n 
A 1 64  PHE 64  65  65  PHE PHE A . n 
A 1 65  GLN 65  66  66  GLN GLN A . n 
A 1 66  SER 66  67  67  SER SER A . n 
A 1 67  VAL 67  68  68  VAL VAL A . n 
A 1 68  CYS 68  69  69  CYS CYS A . n 
A 1 69  TYR 69  70  70  TYR TYR A . n 
A 1 70  GLN 70  71  71  GLN GLN A . n 
A 1 71  TYR 71  72  72  TYR TYR A . n 
A 1 72  VAL 72  73  73  VAL VAL A . n 
A 1 73  ASP 73  74  74  ASP ASP A . n 
A 1 74  THR 74  75  75  THR THR A . n 
A 1 75  LEU 75  76  76  LEU LEU A . n 
A 1 76  TYR 76  77  77  TYR TYR A . n 
A 1 77  PRO 77  78  78  PRO PRO A . n 
A 1 78  GLY 78  79  79  GLY GLY A . n 
A 1 79  PHE 79  80  80  PHE PHE A . n 
A 1 80  GLU 80  81  81  GLU GLU A . n 
A 1 81  GLY 81  82  82  GLY GLY A . n 
A 1 82  THR 82  83  83  THR THR A . n 
A 1 83  GLU 83  84  84  GLU GLU A . n 
A 1 84  MET 84  85  85  MET MET A . n 
A 1 85  TRP 85  86  86  TRP TRP A . n 
A 1 86  ASN 86  87  87  ASN ASN A . n 
A 1 87  PRO 87  88  88  PRO PRO A . n 
A 1 88  ASN 88  89  89  ASN ASN A . n 
A 1 89  ARG 89  90  90  ARG ARG A . n 
A 1 90  GLU 90  91  91  GLU GLU A . n 
A 1 91  LEU 91  92  92  LEU LEU A . n 
A 1 92  SER 92  93  93  SER SER A . n 
A 1 93  GLU 93  94  94  GLU GLU A . n 
A 1 94  ASP 94  95  95  ASP ASP A . n 
A 1 95  CYS 95  96  96  CYS CYS A . n 
A 1 96  LEU 96  97  97  LEU LEU A . n 
A 1 97  TYR 97  98  98  TYR TYR A . n 
A 1 98  LEU 98  99  99  LEU LEU A . n 
A 1 99  ASN 99  100 100 ASN ASN A . n 
A 1 100 VAL 100 101 101 VAL VAL A . n 
A 1 101 TRP 101 102 102 TRP TRP A . n 
A 1 102 THR 102 103 103 THR THR A . n 
A 1 103 PRO 103 104 104 PRO PRO A . n 
A 1 104 TYR 104 105 105 TYR TYR A . n 
A 1 105 PRO 105 106 106 PRO PRO A . n 
A 1 106 ARG 106 107 107 ARG ARG A . n 
A 1 107 PRO 107 108 108 PRO PRO A . n 
A 1 108 THR 108 109 109 THR THR A . n 
A 1 109 SER 109 110 110 SER SER A . n 
A 1 110 PRO 110 111 111 PRO PRO A . n 
A 1 111 THR 111 112 112 THR THR A . n 
A 1 112 PRO 112 113 113 PRO PRO A . n 
A 1 113 VAL 113 114 114 VAL VAL A . n 
A 1 114 LEU 114 115 115 LEU LEU A . n 
A 1 115 VAL 115 116 116 VAL VAL A . n 
A 1 116 TRP 116 117 117 TRP TRP A . n 
A 1 117 ILE 117 118 118 ILE ILE A . n 
A 1 118 TYR 118 119 119 TYR TYR A . n 
A 1 119 GLY 119 120 120 GLY GLY A . n 
A 1 120 GLY 120 121 121 GLY GLY A . n 
A 1 121 GLY 121 122 122 GLY GLY A . n 
A 1 122 PHE 122 123 123 PHE PHE A . n 
A 1 123 TYR 123 124 124 TYR TYR A . n 
A 1 124 SER 124 125 125 SER SER A . n 
A 1 125 GLY 125 126 126 GLY GLY A . n 
A 1 126 ALA 126 127 127 ALA ALA A . n 
A 1 127 SER 127 128 128 SER SER A . n 
A 1 128 SER 128 129 129 SER SER A . n 
A 1 129 LEU 129 130 130 LEU LEU A . n 
A 1 130 ASP 130 131 131 ASP ASP A . n 
A 1 131 VAL 131 132 132 VAL VAL A . n 
A 1 132 TYR 132 133 133 TYR TYR A . n 
A 1 133 ASP 133 134 134 ASP ASP A . n 
A 1 134 GLY 134 135 135 GLY GLY A . n 
A 1 135 ARG 135 136 136 ARG ARG A . n 
A 1 136 PHE 136 137 137 PHE PHE A . n 
A 1 137 LEU 137 138 138 LEU LEU A . n 
A 1 138 VAL 138 139 139 VAL VAL A . n 
A 1 139 GLN 139 140 140 GLN GLN A . n 
A 1 140 ALA 140 141 141 ALA ALA A . n 
A 1 141 GLU 141 142 142 GLU GLU A . n 
A 1 142 ARG 142 143 143 ARG ARG A . n 
A 1 143 THR 143 144 144 THR THR A . n 
A 1 144 VAL 144 145 145 VAL VAL A . n 
A 1 145 LEU 145 146 146 LEU LEU A . n 
A 1 146 VAL 146 147 147 VAL VAL A . n 
A 1 147 SER 147 148 148 SER SER A . n 
A 1 148 MET 148 149 149 MET MET A . n 
A 1 149 ASN 149 150 150 ASN ASN A . n 
A 1 150 TYR 150 151 151 TYR TYR A . n 
A 1 151 ARG 151 152 152 ARG ARG A . n 
A 1 152 VAL 152 153 153 VAL VAL A . n 
A 1 153 GLY 153 154 154 GLY GLY A . n 
A 1 154 ALA 154 155 155 ALA ALA A . n 
A 1 155 PHE 155 156 156 PHE PHE A . n 
A 1 156 GLY 156 157 157 GLY GLY A . n 
A 1 157 PHE 157 158 158 PHE PHE A . n 
A 1 158 LEU 158 159 159 LEU LEU A . n 
A 1 159 ALA 159 160 160 ALA ALA A . n 
A 1 160 LEU 160 161 161 LEU LEU A . n 
A 1 161 PRO 161 162 162 PRO PRO A . n 
A 1 162 GLY 162 163 163 GLY GLY A . n 
A 1 163 SER 163 164 164 SER SER A . n 
A 1 164 ARG 164 165 165 ARG ARG A . n 
A 1 165 GLU 165 166 166 GLU GLU A . n 
A 1 166 ALA 166 167 167 ALA ALA A . n 
A 1 167 PRO 167 168 168 PRO PRO A . n 
A 1 168 GLY 168 169 169 GLY GLY A . n 
A 1 169 ASN 169 170 170 ASN ASN A . n 
A 1 170 VAL 170 171 171 VAL VAL A . n 
A 1 171 GLY 171 172 172 GLY GLY A . n 
A 1 172 LEU 172 173 173 LEU LEU A . n 
A 1 173 LEU 173 174 174 LEU LEU A . n 
A 1 174 ASP 174 175 175 ASP ASP A . n 
A 1 175 GLN 175 176 176 GLN GLN A . n 
A 1 176 ARG 176 177 177 ARG ARG A . n 
A 1 177 LEU 177 178 178 LEU LEU A . n 
A 1 178 ALA 178 179 179 ALA ALA A . n 
A 1 179 LEU 179 180 180 LEU LEU A . n 
A 1 180 GLN 180 181 181 GLN GLN A . n 
A 1 181 TRP 181 182 182 TRP TRP A . n 
A 1 182 VAL 182 183 183 VAL VAL A . n 
A 1 183 GLN 183 184 184 GLN GLN A . n 
A 1 184 GLU 184 185 185 GLU GLU A . n 
A 1 185 ASN 185 186 186 ASN ASN A . n 
A 1 186 VAL 186 187 187 VAL VAL A . n 
A 1 187 ALA 187 188 188 ALA ALA A . n 
A 1 188 ALA 188 189 189 ALA ALA A . n 
A 1 189 PHE 189 190 190 PHE PHE A . n 
A 1 190 GLY 190 191 191 GLY GLY A . n 
A 1 191 GLY 191 192 192 GLY GLY A . n 
A 1 192 ASP 192 193 193 ASP ASP A . n 
A 1 193 PRO 193 194 194 PRO PRO A . n 
A 1 194 THR 194 195 195 THR THR A . n 
A 1 195 SER 195 196 196 SER SER A . n 
A 1 196 VAL 196 197 197 VAL VAL A . n 
A 1 197 THR 197 198 198 THR THR A . n 
A 1 198 LEU 198 199 199 LEU LEU A . n 
A 1 199 PHE 199 200 200 PHE PHE A . n 
A 1 200 GLY 200 201 201 GLY GLY A . n 
A 1 201 GLU 201 202 202 GLU GLU A . n 
A 1 202 SER 202 203 203 SER SER A . n 
A 1 203 ALA 203 204 204 ALA ALA A . n 
A 1 204 GLY 204 205 205 GLY GLY A . n 
A 1 205 ALA 205 206 206 ALA ALA A . n 
A 1 206 ALA 206 207 207 ALA ALA A . n 
A 1 207 SER 207 208 208 SER SER A . n 
A 1 208 VAL 208 209 209 VAL VAL A . n 
A 1 209 GLY 209 210 210 GLY GLY A . n 
A 1 210 MET 210 211 211 MET MET A . n 
A 1 211 HIS 211 212 212 HIS HIS A . n 
A 1 212 LEU 212 213 213 LEU LEU A . n 
A 1 213 LEU 213 214 214 LEU LEU A . n 
A 1 214 SER 214 215 215 SER SER A . n 
A 1 215 PRO 215 216 216 PRO PRO A . n 
A 1 216 PRO 216 217 217 PRO PRO A . n 
A 1 217 SER 217 218 218 SER SER A . n 
A 1 218 ARG 218 219 219 ARG ARG A . n 
A 1 219 GLY 219 220 220 GLY GLY A . n 
A 1 220 LEU 220 221 221 LEU LEU A . n 
A 1 221 PHE 221 222 222 PHE PHE A . n 
A 1 222 HIS 222 223 223 HIS HIS A . n 
A 1 223 ARG 223 224 224 ARG ARG A . n 
A 1 224 ALA 224 225 225 ALA ALA A . n 
A 1 225 VAL 225 226 226 VAL VAL A . n 
A 1 226 LEU 226 227 227 LEU LEU A . n 
A 1 227 GLN 227 228 228 GLN GLN A . n 
A 1 228 SER 228 229 229 SER SER A . n 
A 1 229 GLY 229 230 230 GLY GLY A . n 
A 1 230 ALA 230 231 231 ALA ALA A . n 
A 1 231 PRO 231 232 232 PRO PRO A . n 
A 1 232 ASN 232 233 233 ASN ASN A . n 
A 1 233 GLY 233 234 234 GLY GLY A . n 
A 1 234 PRO 234 235 235 PRO PRO A . n 
A 1 235 TRP 235 236 236 TRP TRP A . n 
A 1 236 ALA 236 237 237 ALA ALA A . n 
A 1 237 THR 237 238 238 THR THR A . n 
A 1 238 VAL 238 239 239 VAL VAL A . n 
A 1 239 GLY 239 240 240 GLY GLY A . n 
A 1 240 MET 240 241 241 MET MET A . n 
A 1 241 GLY 241 242 242 GLY GLY A . n 
A 1 242 GLU 242 243 243 GLU GLU A . n 
A 1 243 ALA 243 244 244 ALA ALA A . n 
A 1 244 ARG 244 245 245 ARG ARG A . n 
A 1 245 ARG 245 246 246 ARG ARG A . n 
A 1 246 ARG 246 247 247 ARG ARG A . n 
A 1 247 ALA 247 248 248 ALA ALA A . n 
A 1 248 THR 248 249 249 THR THR A . n 
A 1 249 GLN 249 250 250 GLN GLN A . n 
A 1 250 LEU 250 251 251 LEU LEU A . n 
A 1 251 ALA 251 252 252 ALA ALA A . n 
A 1 252 HIS 252 253 253 HIS HIS A . n 
A 1 253 LEU 253 254 254 LEU LEU A . n 
A 1 254 VAL 254 255 255 VAL VAL A . n 
A 1 255 GLY 255 256 256 GLY GLY A . n 
A 1 256 CYS 256 257 257 CYS CYS A . n 
A 1 257 PRO 257 258 258 PRO PRO A . n 
A 1 258 PRO 258 259 ?   ?   ?   A . n 
A 1 259 GLY 259 260 ?   ?   ?   A . n 
A 1 260 GLY 260 261 ?   ?   ?   A . n 
A 1 261 THR 261 262 ?   ?   ?   A . n 
A 1 262 GLY 262 263 ?   ?   ?   A . n 
A 1 263 GLY 263 264 ?   ?   ?   A . n 
A 1 264 ASN 264 265 265 ASN ASN A . n 
A 1 265 ASP 265 266 266 ASP ASP A . n 
A 1 266 THR 266 267 267 THR THR A . n 
A 1 267 GLU 267 268 268 GLU GLU A . n 
A 1 268 LEU 268 269 269 LEU LEU A . n 
A 1 269 VAL 269 270 270 VAL VAL A . n 
A 1 270 ALA 270 271 271 ALA ALA A . n 
A 1 271 CYS 271 272 272 CYS CYS A . n 
A 1 272 LEU 272 273 273 LEU LEU A . n 
A 1 273 ARG 273 274 274 ARG ARG A . n 
A 1 274 THR 274 275 275 THR THR A . n 
A 1 275 ARG 275 276 276 ARG ARG A . n 
A 1 276 PRO 276 277 277 PRO PRO A . n 
A 1 277 ALA 277 278 278 ALA ALA A . n 
A 1 278 GLN 278 279 279 GLN GLN A . n 
A 1 279 VAL 279 280 280 VAL VAL A . n 
A 1 280 LEU 280 281 281 LEU LEU A . n 
A 1 281 VAL 281 282 282 VAL VAL A . n 
A 1 282 ASN 282 283 283 ASN ASN A . n 
A 1 283 HIS 283 284 284 HIS HIS A . n 
A 1 284 GLU 284 285 285 GLU GLU A . n 
A 1 285 TRP 285 286 286 TRP TRP A . n 
A 1 286 HIS 286 287 287 HIS HIS A . n 
A 1 287 VAL 287 288 288 VAL VAL A . n 
A 1 288 LEU 288 289 289 LEU LEU A . n 
A 1 289 PRO 289 290 290 PRO PRO A . n 
A 1 290 GLN 290 291 291 GLN GLN A . n 
A 1 291 GLU 291 292 292 GLU GLU A . n 
A 1 292 SER 292 293 293 SER SER A . n 
A 1 293 VAL 293 294 294 VAL VAL A . n 
A 1 294 PHE 294 295 295 PHE PHE A . n 
A 1 295 ARG 295 296 296 ARG ARG A . n 
A 1 296 PHE 296 297 297 PHE PHE A . n 
A 1 297 SER 297 298 298 SER SER A . n 
A 1 298 PHE 298 299 299 PHE PHE A . n 
A 1 299 VAL 299 300 300 VAL VAL A . n 
A 1 300 PRO 300 301 301 PRO PRO A . n 
A 1 301 VAL 301 302 302 VAL VAL A . n 
A 1 302 VAL 302 303 303 VAL VAL A . n 
A 1 303 ASP 303 304 304 ASP ASP A . n 
A 1 304 GLY 304 305 305 GLY GLY A . n 
A 1 305 ASP 305 306 306 ASP ASP A . n 
A 1 306 PHE 306 307 307 PHE PHE A . n 
A 1 307 LEU 307 308 308 LEU LEU A . n 
A 1 308 SER 308 309 309 SER SER A . n 
A 1 309 ASP 309 310 310 ASP ASP A . n 
A 1 310 THR 310 311 311 THR THR A . n 
A 1 311 PRO 311 312 312 PRO PRO A . n 
A 1 312 GLU 312 313 313 GLU GLU A . n 
A 1 313 ALA 313 314 314 ALA ALA A . n 
A 1 314 LEU 314 315 315 LEU LEU A . n 
A 1 315 ILE 315 316 316 ILE ILE A . n 
A 1 316 ASN 316 317 317 ASN ASN A . n 
A 1 317 ALA 317 318 318 ALA ALA A . n 
A 1 318 GLY 318 319 319 GLY GLY A . n 
A 1 319 ASP 319 320 320 ASP ASP A . n 
A 1 320 PHE 320 321 321 PHE PHE A . n 
A 1 321 HIS 321 322 322 HIS HIS A . n 
A 1 322 GLY 322 323 323 GLY GLY A . n 
A 1 323 LEU 323 324 324 LEU LEU A . n 
A 1 324 GLN 324 325 325 GLN GLN A . n 
A 1 325 VAL 325 326 326 VAL VAL A . n 
A 1 326 LEU 326 327 327 LEU LEU A . n 
A 1 327 VAL 327 328 328 VAL VAL A . n 
A 1 328 GLY 328 329 329 GLY GLY A . n 
A 1 329 VAL 329 330 330 VAL VAL A . n 
A 1 330 VAL 330 331 331 VAL VAL A . n 
A 1 331 LYS 331 332 332 LYS LYS A . n 
A 1 332 ASP 332 333 333 ASP ASP A . n 
A 1 333 GLU 333 334 334 GLU GLU A . n 
A 1 334 GLY 334 335 335 GLY GLY A . n 
A 1 335 SER 335 336 336 SER SER A . n 
A 1 336 TYR 336 337 337 TYR TYR A . n 
A 1 337 PHE 337 338 338 PHE PHE A . n 
A 1 338 LEU 338 339 339 LEU LEU A . n 
A 1 339 VAL 339 340 340 VAL VAL A . n 
A 1 340 TYR 340 341 341 TYR TYR A . n 
A 1 341 GLY 341 342 342 GLY GLY A . n 
A 1 342 ALA 342 343 343 ALA ALA A . n 
A 1 343 PRO 343 344 344 PRO PRO A . n 
A 1 344 GLY 344 345 345 GLY GLY A . n 
A 1 345 PHE 345 346 346 PHE PHE A . n 
A 1 346 SER 346 347 347 SER SER A . n 
A 1 347 LYS 347 348 348 LYS LYS A . n 
A 1 348 ASP 348 349 349 ASP ASP A . n 
A 1 349 ASN 349 350 350 ASN ASN A . n 
A 1 350 GLU 350 351 351 GLU GLU A . n 
A 1 351 SER 351 352 352 SER SER A . n 
A 1 352 LEU 352 353 353 LEU LEU A . n 
A 1 353 ILE 353 354 354 ILE ILE A . n 
A 1 354 SER 354 355 355 SER SER A . n 
A 1 355 ARG 355 356 356 ARG ARG A . n 
A 1 356 ALA 356 357 357 ALA ALA A . n 
A 1 357 GLU 357 358 358 GLU GLU A . n 
A 1 358 PHE 358 359 359 PHE PHE A . n 
A 1 359 LEU 359 360 360 LEU LEU A . n 
A 1 360 ALA 360 361 361 ALA ALA A . n 
A 1 361 GLY 361 362 362 GLY GLY A . n 
A 1 362 VAL 362 363 363 VAL VAL A . n 
A 1 363 ARG 363 364 364 ARG ARG A . n 
A 1 364 VAL 364 365 365 VAL VAL A . n 
A 1 365 GLY 365 366 366 GLY GLY A . n 
A 1 366 VAL 366 367 367 VAL VAL A . n 
A 1 367 PRO 367 368 368 PRO PRO A . n 
A 1 368 GLN 368 369 369 GLN GLN A . n 
A 1 369 VAL 369 370 370 VAL VAL A . n 
A 1 370 SER 370 371 371 SER SER A . n 
A 1 371 ASP 371 372 372 ASP ASP A . n 
A 1 372 LEU 372 373 373 LEU LEU A . n 
A 1 373 ALA 373 374 374 ALA ALA A . n 
A 1 374 ALA 374 375 375 ALA ALA A . n 
A 1 375 GLU 375 376 376 GLU GLU A . n 
A 1 376 ALA 376 377 377 ALA ALA A . n 
A 1 377 VAL 377 378 378 VAL VAL A . n 
A 1 378 VAL 378 379 379 VAL VAL A . n 
A 1 379 LEU 379 380 380 LEU LEU A . n 
A 1 380 HIS 380 381 381 HIS HIS A . n 
A 1 381 TYR 381 382 382 TYR TYR A . n 
A 1 382 THR 382 383 383 THR THR A . n 
A 1 383 ASP 383 384 384 ASP ASP A . n 
A 1 384 TRP 384 385 385 TRP TRP A . n 
A 1 385 LEU 385 386 386 LEU LEU A . n 
A 1 386 HIS 386 387 387 HIS HIS A . n 
A 1 387 PRO 387 388 388 PRO PRO A . n 
A 1 388 GLU 388 389 389 GLU GLU A . n 
A 1 389 ASP 389 390 390 ASP ASP A . n 
A 1 390 PRO 390 391 391 PRO PRO A . n 
A 1 391 ALA 391 392 392 ALA ALA A . n 
A 1 392 ARG 392 393 393 ARG ARG A . n 
A 1 393 LEU 393 394 394 LEU LEU A . n 
A 1 394 ARG 394 395 395 ARG ARG A . n 
A 1 395 GLU 395 396 396 GLU GLU A . n 
A 1 396 ALA 396 397 397 ALA ALA A . n 
A 1 397 LEU 397 398 398 LEU LEU A . n 
A 1 398 SER 398 399 399 SER SER A . n 
A 1 399 ASP 399 400 400 ASP ASP A . n 
A 1 400 VAL 400 401 401 VAL VAL A . n 
A 1 401 VAL 401 402 402 VAL VAL A . n 
A 1 402 GLY 402 403 403 GLY GLY A . n 
A 1 403 ASP 403 404 404 ASP ASP A . n 
A 1 404 HIS 404 405 405 HIS HIS A . n 
A 1 405 ASN 405 406 406 ASN ASN A . n 
A 1 406 VAL 406 407 407 VAL VAL A . n 
A 1 407 VAL 407 408 408 VAL VAL A . n 
A 1 408 CYS 408 409 409 CYS CYS A . n 
A 1 409 PRO 409 410 410 PRO PRO A . n 
A 1 410 VAL 410 411 411 VAL VAL A . n 
A 1 411 ALA 411 412 412 ALA ALA A . n 
A 1 412 GLN 412 413 413 GLN GLN A . n 
A 1 413 LEU 413 414 414 LEU LEU A . n 
A 1 414 ALA 414 415 415 ALA ALA A . n 
A 1 415 GLY 415 416 416 GLY GLY A . n 
A 1 416 ARG 416 417 417 ARG ARG A . n 
A 1 417 LEU 417 418 418 LEU LEU A . n 
A 1 418 ALA 418 419 419 ALA ALA A . n 
A 1 419 ALA 419 420 420 ALA ALA A . n 
A 1 420 GLN 420 421 421 GLN GLN A . n 
A 1 421 GLY 421 422 422 GLY GLY A . n 
A 1 422 ALA 422 423 423 ALA ALA A . n 
A 1 423 ARG 423 424 424 ARG ARG A . n 
A 1 424 VAL 424 425 425 VAL VAL A . n 
A 1 425 TYR 425 426 426 TYR TYR A . n 
A 1 426 ALA 426 427 427 ALA ALA A . n 
A 1 427 TYR 427 428 428 TYR TYR A . n 
A 1 428 VAL 428 429 429 VAL VAL A . n 
A 1 429 PHE 429 430 430 PHE PHE A . n 
A 1 430 GLU 430 431 431 GLU GLU A . n 
A 1 431 HIS 431 432 432 HIS HIS A . n 
A 1 432 ARG 432 433 433 ARG ARG A . n 
A 1 433 ALA 433 434 434 ALA ALA A . n 
A 1 434 SER 434 435 435 SER SER A . n 
A 1 435 THR 435 436 436 THR THR A . n 
A 1 436 LEU 436 437 437 LEU LEU A . n 
A 1 437 SER 437 438 438 SER SER A . n 
A 1 438 TRP 438 439 439 TRP TRP A . n 
A 1 439 PRO 439 440 440 PRO PRO A . n 
A 1 440 LEU 440 441 441 LEU LEU A . n 
A 1 441 TRP 441 442 442 TRP TRP A . n 
A 1 442 MET 442 443 443 MET MET A . n 
A 1 443 GLY 443 444 444 GLY GLY A . n 
A 1 444 VAL 444 445 445 VAL VAL A . n 
A 1 445 PRO 445 446 446 PRO PRO A . n 
A 1 446 HIS 446 447 447 HIS HIS A . n 
A 1 447 GLY 447 448 448 GLY GLY A . n 
A 1 448 TYR 448 449 449 TYR TYR A . n 
A 1 449 GLU 449 450 450 GLU GLU A . n 
A 1 450 ILE 450 451 451 ILE ILE A . n 
A 1 451 GLU 451 452 452 GLU GLU A . n 
A 1 452 PHE 452 453 453 PHE PHE A . n 
A 1 453 ILE 453 454 454 ILE ILE A . n 
A 1 454 PHE 454 455 455 PHE PHE A . n 
A 1 455 GLY 455 456 456 GLY GLY A . n 
A 1 456 ILE 456 457 457 ILE ILE A . n 
A 1 457 PRO 457 458 458 PRO PRO A . n 
A 1 458 LEU 458 459 459 LEU LEU A . n 
A 1 459 ASP 459 460 460 ASP ASP A . n 
A 1 460 PRO 460 461 461 PRO PRO A . n 
A 1 461 SER 461 462 462 SER SER A . n 
A 1 462 ARG 462 463 463 ARG ARG A . n 
A 1 463 ASN 463 464 464 ASN ASN A . n 
A 1 464 TYR 464 465 465 TYR TYR A . n 
A 1 465 THR 465 466 466 THR THR A . n 
A 1 466 ALA 466 467 467 ALA ALA A . n 
A 1 467 GLU 467 468 468 GLU GLU A . n 
A 1 468 GLU 468 469 469 GLU GLU A . n 
A 1 469 LYS 469 470 470 LYS LYS A . n 
A 1 470 ILE 470 471 471 ILE ILE A . n 
A 1 471 PHE 471 472 472 PHE PHE A . n 
A 1 472 ALA 472 473 473 ALA ALA A . n 
A 1 473 GLN 473 474 474 GLN GLN A . n 
A 1 474 ARG 474 475 475 ARG ARG A . n 
A 1 475 LEU 475 476 476 LEU LEU A . n 
A 1 476 MET 476 477 477 MET MET A . n 
A 1 477 ARG 477 478 478 ARG ARG A . n 
A 1 478 TYR 478 479 479 TYR TYR A . n 
A 1 479 TRP 479 480 480 TRP TRP A . n 
A 1 480 ALA 480 481 481 ALA ALA A . n 
A 1 481 ASN 481 482 482 ASN ASN A . n 
A 1 482 PHE 482 483 483 PHE PHE A . n 
A 1 483 ALA 483 484 484 ALA ALA A . n 
A 1 484 ARG 484 485 485 ARG ARG A . n 
A 1 485 THR 485 486 486 THR THR A . n 
A 1 486 GLY 486 487 487 GLY GLY A . n 
A 1 487 ASP 487 488 488 ASP ASP A . n 
A 1 488 PRO 488 489 489 PRO PRO A . n 
A 1 489 ASN 489 490 490 ASN ASN A . n 
A 1 490 GLU 490 491 491 GLU GLU A . n 
A 1 491 PRO 491 492 492 PRO PRO A . n 
A 1 492 ARG 492 493 493 ARG ARG A . n 
A 1 493 ASP 493 494 494 ASP ASP A . n 
A 1 494 PRO 494 495 ?   ?   ?   A . n 
A 1 495 LYS 495 496 ?   ?   ?   A . n 
A 1 496 ALA 496 497 ?   ?   ?   A . n 
A 1 497 PRO 497 498 498 PRO PRO A . n 
A 1 498 GLN 498 499 499 GLN GLN A . n 
A 1 499 TRP 499 500 500 TRP TRP A . n 
A 1 500 PRO 500 501 501 PRO PRO A . n 
A 1 501 PRO 501 502 502 PRO PRO A . n 
A 1 502 TYR 502 503 503 TYR TYR A . n 
A 1 503 THR 503 504 504 THR THR A . n 
A 1 504 ALA 504 505 505 ALA ALA A . n 
A 1 505 GLY 505 506 506 GLY GLY A . n 
A 1 506 ALA 506 507 507 ALA ALA A . n 
A 1 507 GLN 507 508 508 GLN GLN A . n 
A 1 508 GLN 508 509 509 GLN GLN A . n 
A 1 509 TYR 509 510 510 TYR TYR A . n 
A 1 510 VAL 510 511 511 VAL VAL A . n 
A 1 511 SER 511 512 512 SER SER A . n 
A 1 512 LEU 512 513 513 LEU LEU A . n 
A 1 513 ASP 513 514 514 ASP ASP A . n 
A 1 514 LEU 514 515 515 LEU LEU A . n 
A 1 515 ARG 515 516 516 ARG ARG A . n 
A 1 516 PRO 516 517 517 PRO PRO A . n 
A 1 517 LEU 517 518 518 LEU LEU A . n 
A 1 518 GLU 518 519 519 GLU GLU A . n 
A 1 519 VAL 519 520 520 VAL VAL A . n 
A 1 520 ARG 520 521 521 ARG ARG A . n 
A 1 521 ARG 521 522 522 ARG ARG A . n 
A 1 522 GLY 522 523 523 GLY GLY A . n 
A 1 523 LEU 523 524 524 LEU LEU A . n 
A 1 524 ARG 524 525 525 ARG ARG A . n 
A 1 525 ALA 525 526 526 ALA ALA A . n 
A 1 526 GLN 526 527 527 GLN GLN A . n 
A 1 527 ALA 527 528 528 ALA ALA A . n 
A 1 528 CYS 528 529 529 CYS CYS A . n 
A 1 529 ALA 529 530 530 ALA ALA A . n 
A 1 530 PHE 530 531 531 PHE PHE A . n 
A 1 531 TRP 531 532 532 TRP TRP A . n 
A 1 532 ASN 532 533 533 ASN ASN A . n 
A 1 533 ARG 533 534 534 ARG ARG A . n 
A 1 534 PHE 534 535 535 PHE PHE A . n 
A 1 535 LEU 535 536 536 LEU LEU A . n 
A 1 536 PRO 536 537 537 PRO PRO A . n 
A 1 537 LYS 537 538 538 LYS LYS A . n 
A 1 538 LEU 538 539 539 LEU LEU A . n 
A 1 539 LEU 539 540 540 LEU LEU A . n 
A 1 540 SER 540 541 541 SER SER A . n 
A 1 541 ALA 541 542 542 ALA ALA A . n 
A 1 542 THR 542 543 ?   ?   ?   A . n 
B 1 1   GLY 1   2   ?   ?   ?   B . n 
B 1 2   ARG 2   3   ?   ?   ?   B . n 
B 1 3   GLU 3   4   4   GLU GLU B . n 
B 1 4   ASP 4   5   5   ASP ASP B . n 
B 1 5   ALA 5   6   6   ALA ALA B . n 
B 1 6   GLU 6   7   7   GLU GLU B . n 
B 1 7   LEU 7   8   8   LEU LEU B . n 
B 1 8   LEU 8   9   9   LEU LEU B . n 
B 1 9   VAL 9   10  10  VAL VAL B . n 
B 1 10  THR 10  11  11  THR THR B . n 
B 1 11  VAL 11  12  12  VAL VAL B . n 
B 1 12  ARG 12  13  13  ARG ARG B . n 
B 1 13  GLY 13  14  14  GLY GLY B . n 
B 1 14  GLY 14  15  15  GLY GLY B . n 
B 1 15  ARG 15  16  16  ARG ARG B . n 
B 1 16  LEU 16  17  17  LEU LEU B . n 
B 1 17  ARG 17  18  18  ARG ARG B . n 
B 1 18  GLY 18  19  19  GLY GLY B . n 
B 1 19  ILE 19  20  20  ILE ILE B . n 
B 1 20  ARG 20  21  21  ARG ARG B . n 
B 1 21  LEU 21  22  22  LEU LEU B . n 
B 1 22  LYS 22  23  23  LYS LYS B . n 
B 1 23  THR 23  24  24  THR THR B . n 
B 1 24  PRO 24  25  25  PRO PRO B . n 
B 1 25  GLY 25  26  26  GLY GLY B . n 
B 1 26  GLY 26  27  27  GLY GLY B . n 
B 1 27  PRO 27  28  28  PRO PRO B . n 
B 1 28  VAL 28  29  29  VAL VAL B . n 
B 1 29  SER 29  30  30  SER SER B . n 
B 1 30  ALA 30  31  31  ALA ALA B . n 
B 1 31  PHE 31  32  32  PHE PHE B . n 
B 1 32  LEU 32  33  33  LEU LEU B . n 
B 1 33  GLY 33  34  34  GLY GLY B . n 
B 1 34  ILE 34  35  35  ILE ILE B . n 
B 1 35  PRO 35  36  36  PRO PRO B . n 
B 1 36  PHE 36  37  37  PHE PHE B . n 
B 1 37  ALA 37  38  38  ALA ALA B . n 
B 1 38  GLU 38  39  39  GLU GLU B . n 
B 1 39  PRO 39  40  40  PRO PRO B . n 
B 1 40  PRO 40  41  41  PRO PRO B . n 
B 1 41  MET 41  42  42  MET MET B . n 
B 1 42  GLY 42  43  43  GLY GLY B . n 
B 1 43  PRO 43  44  44  PRO PRO B . n 
B 1 44  ARG 44  45  45  ARG ARG B . n 
B 1 45  ARG 45  46  46  ARG ARG B . n 
B 1 46  PHE 46  47  47  PHE PHE B . n 
B 1 47  LEU 47  48  48  LEU LEU B . n 
B 1 48  PRO 48  49  49  PRO PRO B . n 
B 1 49  PRO 49  50  50  PRO PRO B . n 
B 1 50  GLU 50  51  51  GLU GLU B . n 
B 1 51  PRO 51  52  52  PRO PRO B . n 
B 1 52  LYS 52  53  53  LYS LYS B . n 
B 1 53  GLN 53  54  54  GLN GLN B . n 
B 1 54  PRO 54  55  55  PRO PRO B . n 
B 1 55  TRP 55  56  56  TRP TRP B . n 
B 1 56  SER 56  57  57  SER SER B . n 
B 1 57  GLY 57  58  58  GLY GLY B . n 
B 1 58  VAL 58  59  59  VAL VAL B . n 
B 1 59  VAL 59  60  60  VAL VAL B . n 
B 1 60  ASP 60  61  61  ASP ASP B . n 
B 1 61  ALA 61  62  62  ALA ALA B . n 
B 1 62  THR 62  63  63  THR THR B . n 
B 1 63  THR 63  64  64  THR THR B . n 
B 1 64  PHE 64  65  65  PHE PHE B . n 
B 1 65  GLN 65  66  66  GLN GLN B . n 
B 1 66  SER 66  67  67  SER SER B . n 
B 1 67  VAL 67  68  68  VAL VAL B . n 
B 1 68  CYS 68  69  69  CYS CYS B . n 
B 1 69  TYR 69  70  70  TYR TYR B . n 
B 1 70  GLN 70  71  71  GLN GLN B . n 
B 1 71  TYR 71  72  72  TYR TYR B . n 
B 1 72  VAL 72  73  73  VAL VAL B . n 
B 1 73  ASP 73  74  74  ASP ASP B . n 
B 1 74  THR 74  75  75  THR THR B . n 
B 1 75  LEU 75  76  76  LEU LEU B . n 
B 1 76  TYR 76  77  77  TYR TYR B . n 
B 1 77  PRO 77  78  78  PRO PRO B . n 
B 1 78  GLY 78  79  79  GLY GLY B . n 
B 1 79  PHE 79  80  80  PHE PHE B . n 
B 1 80  GLU 80  81  81  GLU GLU B . n 
B 1 81  GLY 81  82  82  GLY GLY B . n 
B 1 82  THR 82  83  83  THR THR B . n 
B 1 83  GLU 83  84  84  GLU GLU B . n 
B 1 84  MET 84  85  85  MET MET B . n 
B 1 85  TRP 85  86  86  TRP TRP B . n 
B 1 86  ASN 86  87  87  ASN ASN B . n 
B 1 87  PRO 87  88  88  PRO PRO B . n 
B 1 88  ASN 88  89  89  ASN ASN B . n 
B 1 89  ARG 89  90  90  ARG ARG B . n 
B 1 90  GLU 90  91  91  GLU GLU B . n 
B 1 91  LEU 91  92  92  LEU LEU B . n 
B 1 92  SER 92  93  93  SER SER B . n 
B 1 93  GLU 93  94  94  GLU GLU B . n 
B 1 94  ASP 94  95  95  ASP ASP B . n 
B 1 95  CYS 95  96  96  CYS CYS B . n 
B 1 96  LEU 96  97  97  LEU LEU B . n 
B 1 97  TYR 97  98  98  TYR TYR B . n 
B 1 98  LEU 98  99  99  LEU LEU B . n 
B 1 99  ASN 99  100 100 ASN ASN B . n 
B 1 100 VAL 100 101 101 VAL VAL B . n 
B 1 101 TRP 101 102 102 TRP TRP B . n 
B 1 102 THR 102 103 103 THR THR B . n 
B 1 103 PRO 103 104 104 PRO PRO B . n 
B 1 104 TYR 104 105 105 TYR TYR B . n 
B 1 105 PRO 105 106 106 PRO PRO B . n 
B 1 106 ARG 106 107 107 ARG ARG B . n 
B 1 107 PRO 107 108 108 PRO PRO B . n 
B 1 108 THR 108 109 109 THR THR B . n 
B 1 109 SER 109 110 110 SER SER B . n 
B 1 110 PRO 110 111 111 PRO PRO B . n 
B 1 111 THR 111 112 112 THR THR B . n 
B 1 112 PRO 112 113 113 PRO PRO B . n 
B 1 113 VAL 113 114 114 VAL VAL B . n 
B 1 114 LEU 114 115 115 LEU LEU B . n 
B 1 115 VAL 115 116 116 VAL VAL B . n 
B 1 116 TRP 116 117 117 TRP TRP B . n 
B 1 117 ILE 117 118 118 ILE ILE B . n 
B 1 118 TYR 118 119 119 TYR TYR B . n 
B 1 119 GLY 119 120 120 GLY GLY B . n 
B 1 120 GLY 120 121 121 GLY GLY B . n 
B 1 121 GLY 121 122 122 GLY GLY B . n 
B 1 122 PHE 122 123 123 PHE PHE B . n 
B 1 123 TYR 123 124 124 TYR TYR B . n 
B 1 124 SER 124 125 125 SER SER B . n 
B 1 125 GLY 125 126 126 GLY GLY B . n 
B 1 126 ALA 126 127 127 ALA ALA B . n 
B 1 127 SER 127 128 128 SER SER B . n 
B 1 128 SER 128 129 129 SER SER B . n 
B 1 129 LEU 129 130 130 LEU LEU B . n 
B 1 130 ASP 130 131 131 ASP ASP B . n 
B 1 131 VAL 131 132 132 VAL VAL B . n 
B 1 132 TYR 132 133 133 TYR TYR B . n 
B 1 133 ASP 133 134 134 ASP ASP B . n 
B 1 134 GLY 134 135 135 GLY GLY B . n 
B 1 135 ARG 135 136 136 ARG ARG B . n 
B 1 136 PHE 136 137 137 PHE PHE B . n 
B 1 137 LEU 137 138 138 LEU LEU B . n 
B 1 138 VAL 138 139 139 VAL VAL B . n 
B 1 139 GLN 139 140 140 GLN GLN B . n 
B 1 140 ALA 140 141 141 ALA ALA B . n 
B 1 141 GLU 141 142 142 GLU GLU B . n 
B 1 142 ARG 142 143 143 ARG ARG B . n 
B 1 143 THR 143 144 144 THR THR B . n 
B 1 144 VAL 144 145 145 VAL VAL B . n 
B 1 145 LEU 145 146 146 LEU LEU B . n 
B 1 146 VAL 146 147 147 VAL VAL B . n 
B 1 147 SER 147 148 148 SER SER B . n 
B 1 148 MET 148 149 149 MET MET B . n 
B 1 149 ASN 149 150 150 ASN ASN B . n 
B 1 150 TYR 150 151 151 TYR TYR B . n 
B 1 151 ARG 151 152 152 ARG ARG B . n 
B 1 152 VAL 152 153 153 VAL VAL B . n 
B 1 153 GLY 153 154 154 GLY GLY B . n 
B 1 154 ALA 154 155 155 ALA ALA B . n 
B 1 155 PHE 155 156 156 PHE PHE B . n 
B 1 156 GLY 156 157 157 GLY GLY B . n 
B 1 157 PHE 157 158 158 PHE PHE B . n 
B 1 158 LEU 158 159 159 LEU LEU B . n 
B 1 159 ALA 159 160 160 ALA ALA B . n 
B 1 160 LEU 160 161 161 LEU LEU B . n 
B 1 161 PRO 161 162 162 PRO PRO B . n 
B 1 162 GLY 162 163 163 GLY GLY B . n 
B 1 163 SER 163 164 164 SER SER B . n 
B 1 164 ARG 164 165 165 ARG ARG B . n 
B 1 165 GLU 165 166 166 GLU GLU B . n 
B 1 166 ALA 166 167 167 ALA ALA B . n 
B 1 167 PRO 167 168 168 PRO PRO B . n 
B 1 168 GLY 168 169 169 GLY GLY B . n 
B 1 169 ASN 169 170 170 ASN ASN B . n 
B 1 170 VAL 170 171 171 VAL VAL B . n 
B 1 171 GLY 171 172 172 GLY GLY B . n 
B 1 172 LEU 172 173 173 LEU LEU B . n 
B 1 173 LEU 173 174 174 LEU LEU B . n 
B 1 174 ASP 174 175 175 ASP ASP B . n 
B 1 175 GLN 175 176 176 GLN GLN B . n 
B 1 176 ARG 176 177 177 ARG ARG B . n 
B 1 177 LEU 177 178 178 LEU LEU B . n 
B 1 178 ALA 178 179 179 ALA ALA B . n 
B 1 179 LEU 179 180 180 LEU LEU B . n 
B 1 180 GLN 180 181 181 GLN GLN B . n 
B 1 181 TRP 181 182 182 TRP TRP B . n 
B 1 182 VAL 182 183 183 VAL VAL B . n 
B 1 183 GLN 183 184 184 GLN GLN B . n 
B 1 184 GLU 184 185 185 GLU GLU B . n 
B 1 185 ASN 185 186 186 ASN ASN B . n 
B 1 186 VAL 186 187 187 VAL VAL B . n 
B 1 187 ALA 187 188 188 ALA ALA B . n 
B 1 188 ALA 188 189 189 ALA ALA B . n 
B 1 189 PHE 189 190 190 PHE PHE B . n 
B 1 190 GLY 190 191 191 GLY GLY B . n 
B 1 191 GLY 191 192 192 GLY GLY B . n 
B 1 192 ASP 192 193 193 ASP ASP B . n 
B 1 193 PRO 193 194 194 PRO PRO B . n 
B 1 194 THR 194 195 195 THR THR B . n 
B 1 195 SER 195 196 196 SER SER B . n 
B 1 196 VAL 196 197 197 VAL VAL B . n 
B 1 197 THR 197 198 198 THR THR B . n 
B 1 198 LEU 198 199 199 LEU LEU B . n 
B 1 199 PHE 199 200 200 PHE PHE B . n 
B 1 200 GLY 200 201 201 GLY GLY B . n 
B 1 201 GLU 201 202 202 GLU GLU B . n 
B 1 202 SER 202 203 203 SER SER B . n 
B 1 203 ALA 203 204 204 ALA ALA B . n 
B 1 204 GLY 204 205 205 GLY GLY B . n 
B 1 205 ALA 205 206 206 ALA ALA B . n 
B 1 206 ALA 206 207 207 ALA ALA B . n 
B 1 207 SER 207 208 208 SER SER B . n 
B 1 208 VAL 208 209 209 VAL VAL B . n 
B 1 209 GLY 209 210 210 GLY GLY B . n 
B 1 210 MET 210 211 211 MET MET B . n 
B 1 211 HIS 211 212 212 HIS HIS B . n 
B 1 212 LEU 212 213 213 LEU LEU B . n 
B 1 213 LEU 213 214 214 LEU LEU B . n 
B 1 214 SER 214 215 215 SER SER B . n 
B 1 215 PRO 215 216 216 PRO PRO B . n 
B 1 216 PRO 216 217 217 PRO PRO B . n 
B 1 217 SER 217 218 218 SER SER B . n 
B 1 218 ARG 218 219 219 ARG ARG B . n 
B 1 219 GLY 219 220 220 GLY GLY B . n 
B 1 220 LEU 220 221 221 LEU LEU B . n 
B 1 221 PHE 221 222 222 PHE PHE B . n 
B 1 222 HIS 222 223 223 HIS HIS B . n 
B 1 223 ARG 223 224 224 ARG ARG B . n 
B 1 224 ALA 224 225 225 ALA ALA B . n 
B 1 225 VAL 225 226 226 VAL VAL B . n 
B 1 226 LEU 226 227 227 LEU LEU B . n 
B 1 227 GLN 227 228 228 GLN GLN B . n 
B 1 228 SER 228 229 229 SER SER B . n 
B 1 229 GLY 229 230 230 GLY GLY B . n 
B 1 230 ALA 230 231 231 ALA ALA B . n 
B 1 231 PRO 231 232 232 PRO PRO B . n 
B 1 232 ASN 232 233 233 ASN ASN B . n 
B 1 233 GLY 233 234 234 GLY GLY B . n 
B 1 234 PRO 234 235 235 PRO PRO B . n 
B 1 235 TRP 235 236 236 TRP TRP B . n 
B 1 236 ALA 236 237 237 ALA ALA B . n 
B 1 237 THR 237 238 238 THR THR B . n 
B 1 238 VAL 238 239 239 VAL VAL B . n 
B 1 239 GLY 239 240 240 GLY GLY B . n 
B 1 240 MET 240 241 241 MET MET B . n 
B 1 241 GLY 241 242 242 GLY GLY B . n 
B 1 242 GLU 242 243 243 GLU GLU B . n 
B 1 243 ALA 243 244 244 ALA ALA B . n 
B 1 244 ARG 244 245 245 ARG ARG B . n 
B 1 245 ARG 245 246 246 ARG ARG B . n 
B 1 246 ARG 246 247 247 ARG ARG B . n 
B 1 247 ALA 247 248 248 ALA ALA B . n 
B 1 248 THR 248 249 249 THR THR B . n 
B 1 249 GLN 249 250 250 GLN GLN B . n 
B 1 250 LEU 250 251 251 LEU LEU B . n 
B 1 251 ALA 251 252 252 ALA ALA B . n 
B 1 252 HIS 252 253 253 HIS HIS B . n 
B 1 253 LEU 253 254 254 LEU LEU B . n 
B 1 254 VAL 254 255 255 VAL VAL B . n 
B 1 255 GLY 255 256 256 GLY GLY B . n 
B 1 256 CYS 256 257 257 CYS CYS B . n 
B 1 257 PRO 257 258 258 PRO PRO B . n 
B 1 258 PRO 258 259 259 PRO PRO B . n 
B 1 259 GLY 259 260 ?   ?   ?   B . n 
B 1 260 GLY 260 261 ?   ?   ?   B . n 
B 1 261 THR 261 262 262 THR THR B . n 
B 1 262 GLY 262 263 263 GLY GLY B . n 
B 1 263 GLY 263 264 264 GLY GLY B . n 
B 1 264 ASN 264 265 265 ASN ASN B . n 
B 1 265 ASP 265 266 266 ASP ASP B . n 
B 1 266 THR 266 267 267 THR THR B . n 
B 1 267 GLU 267 268 268 GLU GLU B . n 
B 1 268 LEU 268 269 269 LEU LEU B . n 
B 1 269 VAL 269 270 270 VAL VAL B . n 
B 1 270 ALA 270 271 271 ALA ALA B . n 
B 1 271 CYS 271 272 272 CYS CYS B . n 
B 1 272 LEU 272 273 273 LEU LEU B . n 
B 1 273 ARG 273 274 274 ARG ARG B . n 
B 1 274 THR 274 275 275 THR THR B . n 
B 1 275 ARG 275 276 276 ARG ARG B . n 
B 1 276 PRO 276 277 277 PRO PRO B . n 
B 1 277 ALA 277 278 278 ALA ALA B . n 
B 1 278 GLN 278 279 279 GLN GLN B . n 
B 1 279 VAL 279 280 280 VAL VAL B . n 
B 1 280 LEU 280 281 281 LEU LEU B . n 
B 1 281 VAL 281 282 282 VAL VAL B . n 
B 1 282 ASN 282 283 283 ASN ASN B . n 
B 1 283 HIS 283 284 284 HIS HIS B . n 
B 1 284 GLU 284 285 285 GLU GLU B . n 
B 1 285 TRP 285 286 286 TRP TRP B . n 
B 1 286 HIS 286 287 287 HIS HIS B . n 
B 1 287 VAL 287 288 288 VAL VAL B . n 
B 1 288 LEU 288 289 289 LEU LEU B . n 
B 1 289 PRO 289 290 290 PRO PRO B . n 
B 1 290 GLN 290 291 291 GLN GLN B . n 
B 1 291 GLU 291 292 292 GLU GLU B . n 
B 1 292 SER 292 293 293 SER SER B . n 
B 1 293 VAL 293 294 294 VAL VAL B . n 
B 1 294 PHE 294 295 295 PHE PHE B . n 
B 1 295 ARG 295 296 296 ARG ARG B . n 
B 1 296 PHE 296 297 297 PHE PHE B . n 
B 1 297 SER 297 298 298 SER SER B . n 
B 1 298 PHE 298 299 299 PHE PHE B . n 
B 1 299 VAL 299 300 300 VAL VAL B . n 
B 1 300 PRO 300 301 301 PRO PRO B . n 
B 1 301 VAL 301 302 302 VAL VAL B . n 
B 1 302 VAL 302 303 303 VAL VAL B . n 
B 1 303 ASP 303 304 304 ASP ASP B . n 
B 1 304 GLY 304 305 305 GLY GLY B . n 
B 1 305 ASP 305 306 306 ASP ASP B . n 
B 1 306 PHE 306 307 307 PHE PHE B . n 
B 1 307 LEU 307 308 308 LEU LEU B . n 
B 1 308 SER 308 309 309 SER SER B . n 
B 1 309 ASP 309 310 310 ASP ASP B . n 
B 1 310 THR 310 311 311 THR THR B . n 
B 1 311 PRO 311 312 312 PRO PRO B . n 
B 1 312 GLU 312 313 313 GLU GLU B . n 
B 1 313 ALA 313 314 314 ALA ALA B . n 
B 1 314 LEU 314 315 315 LEU LEU B . n 
B 1 315 ILE 315 316 316 ILE ILE B . n 
B 1 316 ASN 316 317 317 ASN ASN B . n 
B 1 317 ALA 317 318 318 ALA ALA B . n 
B 1 318 GLY 318 319 319 GLY GLY B . n 
B 1 319 ASP 319 320 320 ASP ASP B . n 
B 1 320 PHE 320 321 321 PHE PHE B . n 
B 1 321 HIS 321 322 322 HIS HIS B . n 
B 1 322 GLY 322 323 323 GLY GLY B . n 
B 1 323 LEU 323 324 324 LEU LEU B . n 
B 1 324 GLN 324 325 325 GLN GLN B . n 
B 1 325 VAL 325 326 326 VAL VAL B . n 
B 1 326 LEU 326 327 327 LEU LEU B . n 
B 1 327 VAL 327 328 328 VAL VAL B . n 
B 1 328 GLY 328 329 329 GLY GLY B . n 
B 1 329 VAL 329 330 330 VAL VAL B . n 
B 1 330 VAL 330 331 331 VAL VAL B . n 
B 1 331 LYS 331 332 332 LYS LYS B . n 
B 1 332 ASP 332 333 333 ASP ASP B . n 
B 1 333 GLU 333 334 334 GLU GLU B . n 
B 1 334 GLY 334 335 335 GLY GLY B . n 
B 1 335 SER 335 336 336 SER SER B . n 
B 1 336 TYR 336 337 337 TYR TYR B . n 
B 1 337 PHE 337 338 338 PHE PHE B . n 
B 1 338 LEU 338 339 339 LEU LEU B . n 
B 1 339 VAL 339 340 340 VAL VAL B . n 
B 1 340 TYR 340 341 341 TYR TYR B . n 
B 1 341 GLY 341 342 342 GLY GLY B . n 
B 1 342 ALA 342 343 343 ALA ALA B . n 
B 1 343 PRO 343 344 344 PRO PRO B . n 
B 1 344 GLY 344 345 345 GLY GLY B . n 
B 1 345 PHE 345 346 346 PHE PHE B . n 
B 1 346 SER 346 347 347 SER SER B . n 
B 1 347 LYS 347 348 348 LYS LYS B . n 
B 1 348 ASP 348 349 349 ASP ASP B . n 
B 1 349 ASN 349 350 350 ASN ASN B . n 
B 1 350 GLU 350 351 351 GLU GLU B . n 
B 1 351 SER 351 352 352 SER SER B . n 
B 1 352 LEU 352 353 353 LEU LEU B . n 
B 1 353 ILE 353 354 354 ILE ILE B . n 
B 1 354 SER 354 355 355 SER SER B . n 
B 1 355 ARG 355 356 356 ARG ARG B . n 
B 1 356 ALA 356 357 357 ALA ALA B . n 
B 1 357 GLU 357 358 358 GLU GLU B . n 
B 1 358 PHE 358 359 359 PHE PHE B . n 
B 1 359 LEU 359 360 360 LEU LEU B . n 
B 1 360 ALA 360 361 361 ALA ALA B . n 
B 1 361 GLY 361 362 362 GLY GLY B . n 
B 1 362 VAL 362 363 363 VAL VAL B . n 
B 1 363 ARG 363 364 364 ARG ARG B . n 
B 1 364 VAL 364 365 365 VAL VAL B . n 
B 1 365 GLY 365 366 366 GLY GLY B . n 
B 1 366 VAL 366 367 367 VAL VAL B . n 
B 1 367 PRO 367 368 368 PRO PRO B . n 
B 1 368 GLN 368 369 369 GLN GLN B . n 
B 1 369 VAL 369 370 370 VAL VAL B . n 
B 1 370 SER 370 371 371 SER SER B . n 
B 1 371 ASP 371 372 372 ASP ASP B . n 
B 1 372 LEU 372 373 373 LEU LEU B . n 
B 1 373 ALA 373 374 374 ALA ALA B . n 
B 1 374 ALA 374 375 375 ALA ALA B . n 
B 1 375 GLU 375 376 376 GLU GLU B . n 
B 1 376 ALA 376 377 377 ALA ALA B . n 
B 1 377 VAL 377 378 378 VAL VAL B . n 
B 1 378 VAL 378 379 379 VAL VAL B . n 
B 1 379 LEU 379 380 380 LEU LEU B . n 
B 1 380 HIS 380 381 381 HIS HIS B . n 
B 1 381 TYR 381 382 382 TYR TYR B . n 
B 1 382 THR 382 383 383 THR THR B . n 
B 1 383 ASP 383 384 384 ASP ASP B . n 
B 1 384 TRP 384 385 385 TRP TRP B . n 
B 1 385 LEU 385 386 386 LEU LEU B . n 
B 1 386 HIS 386 387 387 HIS HIS B . n 
B 1 387 PRO 387 388 388 PRO PRO B . n 
B 1 388 GLU 388 389 389 GLU GLU B . n 
B 1 389 ASP 389 390 390 ASP ASP B . n 
B 1 390 PRO 390 391 391 PRO PRO B . n 
B 1 391 ALA 391 392 392 ALA ALA B . n 
B 1 392 ARG 392 393 393 ARG ARG B . n 
B 1 393 LEU 393 394 394 LEU LEU B . n 
B 1 394 ARG 394 395 395 ARG ARG B . n 
B 1 395 GLU 395 396 396 GLU GLU B . n 
B 1 396 ALA 396 397 397 ALA ALA B . n 
B 1 397 LEU 397 398 398 LEU LEU B . n 
B 1 398 SER 398 399 399 SER SER B . n 
B 1 399 ASP 399 400 400 ASP ASP B . n 
B 1 400 VAL 400 401 401 VAL VAL B . n 
B 1 401 VAL 401 402 402 VAL VAL B . n 
B 1 402 GLY 402 403 403 GLY GLY B . n 
B 1 403 ASP 403 404 404 ASP ASP B . n 
B 1 404 HIS 404 405 405 HIS HIS B . n 
B 1 405 ASN 405 406 406 ASN ASN B . n 
B 1 406 VAL 406 407 407 VAL VAL B . n 
B 1 407 VAL 407 408 408 VAL VAL B . n 
B 1 408 CYS 408 409 409 CYS CYS B . n 
B 1 409 PRO 409 410 410 PRO PRO B . n 
B 1 410 VAL 410 411 411 VAL VAL B . n 
B 1 411 ALA 411 412 412 ALA ALA B . n 
B 1 412 GLN 412 413 413 GLN GLN B . n 
B 1 413 LEU 413 414 414 LEU LEU B . n 
B 1 414 ALA 414 415 415 ALA ALA B . n 
B 1 415 GLY 415 416 416 GLY GLY B . n 
B 1 416 ARG 416 417 417 ARG ARG B . n 
B 1 417 LEU 417 418 418 LEU LEU B . n 
B 1 418 ALA 418 419 419 ALA ALA B . n 
B 1 419 ALA 419 420 420 ALA ALA B . n 
B 1 420 GLN 420 421 421 GLN GLN B . n 
B 1 421 GLY 421 422 422 GLY GLY B . n 
B 1 422 ALA 422 423 423 ALA ALA B . n 
B 1 423 ARG 423 424 424 ARG ARG B . n 
B 1 424 VAL 424 425 425 VAL VAL B . n 
B 1 425 TYR 425 426 426 TYR TYR B . n 
B 1 426 ALA 426 427 427 ALA ALA B . n 
B 1 427 TYR 427 428 428 TYR TYR B . n 
B 1 428 VAL 428 429 429 VAL VAL B . n 
B 1 429 PHE 429 430 430 PHE PHE B . n 
B 1 430 GLU 430 431 431 GLU GLU B . n 
B 1 431 HIS 431 432 432 HIS HIS B . n 
B 1 432 ARG 432 433 433 ARG ARG B . n 
B 1 433 ALA 433 434 434 ALA ALA B . n 
B 1 434 SER 434 435 435 SER SER B . n 
B 1 435 THR 435 436 436 THR THR B . n 
B 1 436 LEU 436 437 437 LEU LEU B . n 
B 1 437 SER 437 438 438 SER SER B . n 
B 1 438 TRP 438 439 439 TRP TRP B . n 
B 1 439 PRO 439 440 440 PRO PRO B . n 
B 1 440 LEU 440 441 441 LEU LEU B . n 
B 1 441 TRP 441 442 442 TRP TRP B . n 
B 1 442 MET 442 443 443 MET MET B . n 
B 1 443 GLY 443 444 444 GLY GLY B . n 
B 1 444 VAL 444 445 445 VAL VAL B . n 
B 1 445 PRO 445 446 446 PRO PRO B . n 
B 1 446 HIS 446 447 447 HIS HIS B . n 
B 1 447 GLY 447 448 448 GLY GLY B . n 
B 1 448 TYR 448 449 449 TYR TYR B . n 
B 1 449 GLU 449 450 450 GLU GLU B . n 
B 1 450 ILE 450 451 451 ILE ILE B . n 
B 1 451 GLU 451 452 452 GLU GLU B . n 
B 1 452 PHE 452 453 453 PHE PHE B . n 
B 1 453 ILE 453 454 454 ILE ILE B . n 
B 1 454 PHE 454 455 455 PHE PHE B . n 
B 1 455 GLY 455 456 456 GLY GLY B . n 
B 1 456 ILE 456 457 457 ILE ILE B . n 
B 1 457 PRO 457 458 458 PRO PRO B . n 
B 1 458 LEU 458 459 459 LEU LEU B . n 
B 1 459 ASP 459 460 460 ASP ASP B . n 
B 1 460 PRO 460 461 461 PRO PRO B . n 
B 1 461 SER 461 462 462 SER SER B . n 
B 1 462 ARG 462 463 463 ARG ARG B . n 
B 1 463 ASN 463 464 464 ASN ASN B . n 
B 1 464 TYR 464 465 465 TYR TYR B . n 
B 1 465 THR 465 466 466 THR THR B . n 
B 1 466 ALA 466 467 467 ALA ALA B . n 
B 1 467 GLU 467 468 468 GLU GLU B . n 
B 1 468 GLU 468 469 469 GLU GLU B . n 
B 1 469 LYS 469 470 470 LYS LYS B . n 
B 1 470 ILE 470 471 471 ILE ILE B . n 
B 1 471 PHE 471 472 472 PHE PHE B . n 
B 1 472 ALA 472 473 473 ALA ALA B . n 
B 1 473 GLN 473 474 474 GLN GLN B . n 
B 1 474 ARG 474 475 475 ARG ARG B . n 
B 1 475 LEU 475 476 476 LEU LEU B . n 
B 1 476 MET 476 477 477 MET MET B . n 
B 1 477 ARG 477 478 478 ARG ARG B . n 
B 1 478 TYR 478 479 479 TYR TYR B . n 
B 1 479 TRP 479 480 480 TRP TRP B . n 
B 1 480 ALA 480 481 481 ALA ALA B . n 
B 1 481 ASN 481 482 482 ASN ASN B . n 
B 1 482 PHE 482 483 483 PHE PHE B . n 
B 1 483 ALA 483 484 484 ALA ALA B . n 
B 1 484 ARG 484 485 485 ARG ARG B . n 
B 1 485 THR 485 486 486 THR THR B . n 
B 1 486 GLY 486 487 487 GLY GLY B . n 
B 1 487 ASP 487 488 488 ASP ASP B . n 
B 1 488 PRO 488 489 489 PRO PRO B . n 
B 1 489 ASN 489 490 490 ASN ASN B . n 
B 1 490 GLU 490 491 491 GLU GLU B . n 
B 1 491 PRO 491 492 492 PRO PRO B . n 
B 1 492 ARG 492 493 ?   ?   ?   B . n 
B 1 493 ASP 493 494 ?   ?   ?   B . n 
B 1 494 PRO 494 495 495 PRO PRO B . n 
B 1 495 LYS 495 496 496 LYS LYS B . n 
B 1 496 ALA 496 497 497 ALA ALA B . n 
B 1 497 PRO 497 498 498 PRO PRO B . n 
B 1 498 GLN 498 499 499 GLN GLN B . n 
B 1 499 TRP 499 500 500 TRP TRP B . n 
B 1 500 PRO 500 501 501 PRO PRO B . n 
B 1 501 PRO 501 502 502 PRO PRO B . n 
B 1 502 TYR 502 503 503 TYR TYR B . n 
B 1 503 THR 503 504 504 THR THR B . n 
B 1 504 ALA 504 505 505 ALA ALA B . n 
B 1 505 GLY 505 506 506 GLY GLY B . n 
B 1 506 ALA 506 507 507 ALA ALA B . n 
B 1 507 GLN 507 508 508 GLN GLN B . n 
B 1 508 GLN 508 509 509 GLN GLN B . n 
B 1 509 TYR 509 510 510 TYR TYR B . n 
B 1 510 VAL 510 511 511 VAL VAL B . n 
B 1 511 SER 511 512 512 SER SER B . n 
B 1 512 LEU 512 513 513 LEU LEU B . n 
B 1 513 ASP 513 514 514 ASP ASP B . n 
B 1 514 LEU 514 515 515 LEU LEU B . n 
B 1 515 ARG 515 516 516 ARG ARG B . n 
B 1 516 PRO 516 517 517 PRO PRO B . n 
B 1 517 LEU 517 518 518 LEU LEU B . n 
B 1 518 GLU 518 519 519 GLU GLU B . n 
B 1 519 VAL 519 520 520 VAL VAL B . n 
B 1 520 ARG 520 521 521 ARG ARG B . n 
B 1 521 ARG 521 522 522 ARG ARG B . n 
B 1 522 GLY 522 523 523 GLY GLY B . n 
B 1 523 LEU 523 524 524 LEU LEU B . n 
B 1 524 ARG 524 525 525 ARG ARG B . n 
B 1 525 ALA 525 526 526 ALA ALA B . n 
B 1 526 GLN 526 527 527 GLN GLN B . n 
B 1 527 ALA 527 528 528 ALA ALA B . n 
B 1 528 CYS 528 529 529 CYS CYS B . n 
B 1 529 ALA 529 530 530 ALA ALA B . n 
B 1 530 PHE 530 531 531 PHE PHE B . n 
B 1 531 TRP 531 532 532 TRP TRP B . n 
B 1 532 ASN 532 533 533 ASN ASN B . n 
B 1 533 ARG 533 534 534 ARG ARG B . n 
B 1 534 PHE 534 535 535 PHE PHE B . n 
B 1 535 LEU 535 536 536 LEU LEU B . n 
B 1 536 PRO 536 537 537 PRO PRO B . n 
B 1 537 LYS 537 538 538 LYS LYS B . n 
B 1 538 LEU 538 539 539 LEU LEU B . n 
B 1 539 LEU 539 540 540 LEU LEU B . n 
B 1 540 SER 540 541 541 SER SER B . n 
B 1 541 ALA 541 542 542 ALA ALA B . n 
B 1 542 THR 542 543 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 E20 1   604 1   E20 E20 A . 
F 4 EDO 1   605 1   EDO EDO A . 
G 4 EDO 1   606 3   EDO EDO A . 
H 5 NAG 1   604 4   NAG NAG B . 
I 3 E20 1   605 1   E20 E20 B . 
J 4 EDO 1   606 2   EDO EDO B . 
K 6 NO3 1   607 1   NO3 NO3 B . 
L 6 NO3 1   608 2   NO3 NO3 B . 
M 7 HOH 1   701 1   HOH HOH A . 
M 7 HOH 2   702 3   HOH HOH A . 
M 7 HOH 3   703 5   HOH HOH A . 
M 7 HOH 4   704 7   HOH HOH A . 
M 7 HOH 5   705 8   HOH HOH A . 
M 7 HOH 6   706 11  HOH HOH A . 
M 7 HOH 7   707 12  HOH HOH A . 
M 7 HOH 8   708 15  HOH HOH A . 
M 7 HOH 9   709 16  HOH HOH A . 
M 7 HOH 10  710 18  HOH HOH A . 
M 7 HOH 11  711 19  HOH HOH A . 
M 7 HOH 12  712 20  HOH HOH A . 
M 7 HOH 13  713 21  HOH HOH A . 
M 7 HOH 14  714 23  HOH HOH A . 
M 7 HOH 15  715 26  HOH HOH A . 
M 7 HOH 16  716 28  HOH HOH A . 
M 7 HOH 17  717 29  HOH HOH A . 
M 7 HOH 18  718 30  HOH HOH A . 
M 7 HOH 19  719 31  HOH HOH A . 
M 7 HOH 20  720 34  HOH HOH A . 
M 7 HOH 21  721 36  HOH HOH A . 
M 7 HOH 22  722 37  HOH HOH A . 
M 7 HOH 23  723 38  HOH HOH A . 
M 7 HOH 24  724 40  HOH HOH A . 
M 7 HOH 25  725 44  HOH HOH A . 
M 7 HOH 26  726 47  HOH HOH A . 
M 7 HOH 27  727 48  HOH HOH A . 
M 7 HOH 28  728 49  HOH HOH A . 
M 7 HOH 29  729 50  HOH HOH A . 
M 7 HOH 30  730 51  HOH HOH A . 
M 7 HOH 31  731 52  HOH HOH A . 
M 7 HOH 32  732 53  HOH HOH A . 
M 7 HOH 33  733 54  HOH HOH A . 
M 7 HOH 34  734 55  HOH HOH A . 
M 7 HOH 35  735 57  HOH HOH A . 
M 7 HOH 36  736 58  HOH HOH A . 
M 7 HOH 37  737 60  HOH HOH A . 
M 7 HOH 38  738 62  HOH HOH A . 
M 7 HOH 39  739 64  HOH HOH A . 
M 7 HOH 40  740 65  HOH HOH A . 
M 7 HOH 41  741 66  HOH HOH A . 
M 7 HOH 42  742 68  HOH HOH A . 
M 7 HOH 43  743 71  HOH HOH A . 
M 7 HOH 44  744 75  HOH HOH A . 
M 7 HOH 45  745 76  HOH HOH A . 
M 7 HOH 46  746 77  HOH HOH A . 
M 7 HOH 47  747 79  HOH HOH A . 
M 7 HOH 48  748 85  HOH HOH A . 
M 7 HOH 49  749 86  HOH HOH A . 
M 7 HOH 50  750 87  HOH HOH A . 
M 7 HOH 51  751 90  HOH HOH A . 
M 7 HOH 52  752 91  HOH HOH A . 
M 7 HOH 53  753 92  HOH HOH A . 
M 7 HOH 54  754 94  HOH HOH A . 
M 7 HOH 55  755 96  HOH HOH A . 
M 7 HOH 56  756 97  HOH HOH A . 
M 7 HOH 57  757 103 HOH HOH A . 
M 7 HOH 58  758 104 HOH HOH A . 
M 7 HOH 59  759 105 HOH HOH A . 
M 7 HOH 60  760 108 HOH HOH A . 
M 7 HOH 61  761 110 HOH HOH A . 
M 7 HOH 62  762 111 HOH HOH A . 
M 7 HOH 63  763 114 HOH HOH A . 
M 7 HOH 64  764 117 HOH HOH A . 
M 7 HOH 65  765 118 HOH HOH A . 
M 7 HOH 66  766 120 HOH HOH A . 
M 7 HOH 67  767 121 HOH HOH A . 
M 7 HOH 68  768 125 HOH HOH A . 
M 7 HOH 69  769 126 HOH HOH A . 
M 7 HOH 70  770 131 HOH HOH A . 
M 7 HOH 71  771 132 HOH HOH A . 
M 7 HOH 72  772 133 HOH HOH A . 
M 7 HOH 73  773 134 HOH HOH A . 
M 7 HOH 74  774 137 HOH HOH A . 
M 7 HOH 75  775 138 HOH HOH A . 
M 7 HOH 76  776 139 HOH HOH A . 
M 7 HOH 77  777 140 HOH HOH A . 
M 7 HOH 78  778 141 HOH HOH A . 
M 7 HOH 79  779 143 HOH HOH A . 
M 7 HOH 80  780 144 HOH HOH A . 
M 7 HOH 81  781 145 HOH HOH A . 
M 7 HOH 82  782 149 HOH HOH A . 
M 7 HOH 83  783 150 HOH HOH A . 
M 7 HOH 84  784 156 HOH HOH A . 
M 7 HOH 85  785 162 HOH HOH A . 
M 7 HOH 86  786 164 HOH HOH A . 
M 7 HOH 87  787 166 HOH HOH A . 
M 7 HOH 88  788 167 HOH HOH A . 
M 7 HOH 89  789 169 HOH HOH A . 
M 7 HOH 90  790 171 HOH HOH A . 
M 7 HOH 91  791 175 HOH HOH A . 
M 7 HOH 92  792 176 HOH HOH A . 
M 7 HOH 93  793 179 HOH HOH A . 
M 7 HOH 94  794 180 HOH HOH A . 
M 7 HOH 95  795 181 HOH HOH A . 
M 7 HOH 96  796 182 HOH HOH A . 
M 7 HOH 97  797 184 HOH HOH A . 
M 7 HOH 98  798 189 HOH HOH A . 
M 7 HOH 99  799 191 HOH HOH A . 
M 7 HOH 100 800 194 HOH HOH A . 
M 7 HOH 101 801 195 HOH HOH A . 
M 7 HOH 102 802 197 HOH HOH A . 
M 7 HOH 103 803 200 HOH HOH A . 
M 7 HOH 104 804 201 HOH HOH A . 
M 7 HOH 105 805 203 HOH HOH A . 
M 7 HOH 106 806 208 HOH HOH A . 
M 7 HOH 107 807 217 HOH HOH A . 
M 7 HOH 108 808 219 HOH HOH A . 
M 7 HOH 109 809 220 HOH HOH A . 
M 7 HOH 110 810 221 HOH HOH A . 
M 7 HOH 111 811 222 HOH HOH A . 
M 7 HOH 112 812 223 HOH HOH A . 
M 7 HOH 113 813 224 HOH HOH A . 
M 7 HOH 114 814 225 HOH HOH A . 
M 7 HOH 115 815 226 HOH HOH A . 
M 7 HOH 116 816 227 HOH HOH A . 
M 7 HOH 117 817 228 HOH HOH A . 
M 7 HOH 118 818 231 HOH HOH A . 
M 7 HOH 119 819 233 HOH HOH A . 
M 7 HOH 120 820 234 HOH HOH A . 
M 7 HOH 121 821 238 HOH HOH A . 
M 7 HOH 122 822 240 HOH HOH A . 
M 7 HOH 123 823 241 HOH HOH A . 
M 7 HOH 124 824 243 HOH HOH A . 
M 7 HOH 125 825 246 HOH HOH A . 
M 7 HOH 126 826 248 HOH HOH A . 
M 7 HOH 127 827 249 HOH HOH A . 
M 7 HOH 128 828 250 HOH HOH A . 
M 7 HOH 129 829 253 HOH HOH A . 
M 7 HOH 130 830 259 HOH HOH A . 
M 7 HOH 131 831 261 HOH HOH A . 
M 7 HOH 132 832 262 HOH HOH A . 
M 7 HOH 133 833 263 HOH HOH A . 
M 7 HOH 134 834 266 HOH HOH A . 
M 7 HOH 135 835 272 HOH HOH A . 
M 7 HOH 136 836 273 HOH HOH A . 
M 7 HOH 137 837 274 HOH HOH A . 
M 7 HOH 138 838 275 HOH HOH A . 
M 7 HOH 139 839 277 HOH HOH A . 
M 7 HOH 140 840 279 HOH HOH A . 
M 7 HOH 141 841 280 HOH HOH A . 
M 7 HOH 142 842 285 HOH HOH A . 
M 7 HOH 143 843 289 HOH HOH A . 
M 7 HOH 144 844 291 HOH HOH A . 
M 7 HOH 145 845 292 HOH HOH A . 
M 7 HOH 146 846 298 HOH HOH A . 
M 7 HOH 147 847 299 HOH HOH A . 
M 7 HOH 148 848 300 HOH HOH A . 
M 7 HOH 149 849 304 HOH HOH A . 
M 7 HOH 150 850 306 HOH HOH A . 
M 7 HOH 151 851 307 HOH HOH A . 
M 7 HOH 152 852 312 HOH HOH A . 
M 7 HOH 153 853 313 HOH HOH A . 
M 7 HOH 154 854 314 HOH HOH A . 
M 7 HOH 155 855 315 HOH HOH A . 
M 7 HOH 156 856 317 HOH HOH A . 
M 7 HOH 157 857 318 HOH HOH A . 
M 7 HOH 158 858 319 HOH HOH A . 
M 7 HOH 159 859 320 HOH HOH A . 
M 7 HOH 160 860 328 HOH HOH A . 
M 7 HOH 161 861 330 HOH HOH A . 
M 7 HOH 162 862 331 HOH HOH A . 
M 7 HOH 163 863 332 HOH HOH A . 
M 7 HOH 164 864 333 HOH HOH A . 
M 7 HOH 165 865 334 HOH HOH A . 
M 7 HOH 166 866 335 HOH HOH A . 
M 7 HOH 167 867 336 HOH HOH A . 
M 7 HOH 168 868 337 HOH HOH A . 
M 7 HOH 169 869 338 HOH HOH A . 
M 7 HOH 170 870 339 HOH HOH A . 
M 7 HOH 171 871 340 HOH HOH A . 
M 7 HOH 172 872 341 HOH HOH A . 
M 7 HOH 173 873 342 HOH HOH A . 
M 7 HOH 174 874 343 HOH HOH A . 
M 7 HOH 175 875 344 HOH HOH A . 
M 7 HOH 176 876 347 HOH HOH A . 
M 7 HOH 177 877 350 HOH HOH A . 
M 7 HOH 178 878 351 HOH HOH A . 
M 7 HOH 179 879 352 HOH HOH A . 
M 7 HOH 180 880 357 HOH HOH A . 
M 7 HOH 181 881 358 HOH HOH A . 
M 7 HOH 182 882 359 HOH HOH A . 
M 7 HOH 183 883 360 HOH HOH A . 
M 7 HOH 184 884 362 HOH HOH A . 
M 7 HOH 185 885 367 HOH HOH A . 
M 7 HOH 186 886 368 HOH HOH A . 
M 7 HOH 187 887 370 HOH HOH A . 
M 7 HOH 188 888 372 HOH HOH A . 
M 7 HOH 189 889 373 HOH HOH A . 
M 7 HOH 190 890 375 HOH HOH A . 
M 7 HOH 191 891 376 HOH HOH A . 
M 7 HOH 192 892 377 HOH HOH A . 
M 7 HOH 193 893 378 HOH HOH A . 
M 7 HOH 194 894 379 HOH HOH A . 
M 7 HOH 195 895 382 HOH HOH A . 
M 7 HOH 196 896 385 HOH HOH A . 
M 7 HOH 197 897 386 HOH HOH A . 
M 7 HOH 198 898 389 HOH HOH A . 
M 7 HOH 199 899 395 HOH HOH A . 
M 7 HOH 200 900 396 HOH HOH A . 
M 7 HOH 201 901 397 HOH HOH A . 
M 7 HOH 202 902 399 HOH HOH A . 
M 7 HOH 203 903 400 HOH HOH A . 
M 7 HOH 204 904 402 HOH HOH A . 
M 7 HOH 205 905 404 HOH HOH A . 
M 7 HOH 206 906 406 HOH HOH A . 
M 7 HOH 207 907 407 HOH HOH A . 
M 7 HOH 208 908 408 HOH HOH A . 
M 7 HOH 209 909 409 HOH HOH A . 
M 7 HOH 210 910 410 HOH HOH A . 
M 7 HOH 211 911 411 HOH HOH A . 
M 7 HOH 212 912 413 HOH HOH A . 
M 7 HOH 213 913 415 HOH HOH A . 
M 7 HOH 214 914 416 HOH HOH A . 
M 7 HOH 215 915 417 HOH HOH A . 
M 7 HOH 216 916 418 HOH HOH A . 
M 7 HOH 217 917 422 HOH HOH A . 
M 7 HOH 218 918 424 HOH HOH A . 
M 7 HOH 219 919 426 HOH HOH A . 
M 7 HOH 220 920 429 HOH HOH A . 
M 7 HOH 221 921 430 HOH HOH A . 
M 7 HOH 222 922 432 HOH HOH A . 
M 7 HOH 223 923 433 HOH HOH A . 
M 7 HOH 224 924 435 HOH HOH A . 
M 7 HOH 225 925 438 HOH HOH A . 
M 7 HOH 226 926 439 HOH HOH A . 
M 7 HOH 227 927 441 HOH HOH A . 
M 7 HOH 228 928 443 HOH HOH A . 
M 7 HOH 229 929 447 HOH HOH A . 
M 7 HOH 230 930 448 HOH HOH A . 
M 7 HOH 231 931 449 HOH HOH A . 
M 7 HOH 232 932 451 HOH HOH A . 
M 7 HOH 233 933 455 HOH HOH A . 
M 7 HOH 234 934 456 HOH HOH A . 
M 7 HOH 235 935 458 HOH HOH A . 
M 7 HOH 236 936 459 HOH HOH A . 
M 7 HOH 237 937 465 HOH HOH A . 
M 7 HOH 238 938 466 HOH HOH A . 
M 7 HOH 239 939 467 HOH HOH A . 
M 7 HOH 240 940 473 HOH HOH A . 
M 7 HOH 241 941 475 HOH HOH A . 
M 7 HOH 242 942 477 HOH HOH A . 
M 7 HOH 243 943 479 HOH HOH A . 
M 7 HOH 244 944 480 HOH HOH A . 
M 7 HOH 245 945 481 HOH HOH A . 
M 7 HOH 246 946 483 HOH HOH A . 
M 7 HOH 247 947 484 HOH HOH A . 
M 7 HOH 248 948 485 HOH HOH A . 
M 7 HOH 249 949 488 HOH HOH A . 
M 7 HOH 250 950 489 HOH HOH A . 
M 7 HOH 251 951 494 HOH HOH A . 
M 7 HOH 252 952 496 HOH HOH A . 
M 7 HOH 253 953 501 HOH HOH A . 
M 7 HOH 254 954 502 HOH HOH A . 
M 7 HOH 255 955 504 HOH HOH A . 
M 7 HOH 256 956 505 HOH HOH A . 
M 7 HOH 257 957 506 HOH HOH A . 
M 7 HOH 258 958 507 HOH HOH A . 
M 7 HOH 259 959 508 HOH HOH A . 
M 7 HOH 260 960 510 HOH HOH A . 
M 7 HOH 261 961 511 HOH HOH A . 
M 7 HOH 262 962 514 HOH HOH A . 
M 7 HOH 263 963 516 HOH HOH A . 
M 7 HOH 264 964 517 HOH HOH A . 
M 7 HOH 265 965 518 HOH HOH A . 
M 7 HOH 266 966 521 HOH HOH A . 
M 7 HOH 267 967 522 HOH HOH A . 
M 7 HOH 268 968 524 HOH HOH A . 
M 7 HOH 269 969 525 HOH HOH A . 
M 7 HOH 270 970 527 HOH HOH A . 
M 7 HOH 271 971 534 HOH HOH A . 
M 7 HOH 272 972 535 HOH HOH A . 
M 7 HOH 273 973 536 HOH HOH A . 
M 7 HOH 274 974 538 HOH HOH A . 
M 7 HOH 275 975 541 HOH HOH A . 
M 7 HOH 276 976 542 HOH HOH A . 
M 7 HOH 277 977 543 HOH HOH A . 
M 7 HOH 278 978 545 HOH HOH A . 
M 7 HOH 279 979 546 HOH HOH A . 
M 7 HOH 280 980 548 HOH HOH A . 
M 7 HOH 281 981 550 HOH HOH A . 
M 7 HOH 282 982 551 HOH HOH A . 
M 7 HOH 283 983 552 HOH HOH A . 
M 7 HOH 284 984 555 HOH HOH A . 
M 7 HOH 285 985 556 HOH HOH A . 
M 7 HOH 286 986 557 HOH HOH A . 
M 7 HOH 287 987 559 HOH HOH A . 
M 7 HOH 288 988 560 HOH HOH A . 
M 7 HOH 289 989 561 HOH HOH A . 
N 7 HOH 1   701 2   HOH HOH B . 
N 7 HOH 2   702 4   HOH HOH B . 
N 7 HOH 3   703 6   HOH HOH B . 
N 7 HOH 4   704 9   HOH HOH B . 
N 7 HOH 5   705 10  HOH HOH B . 
N 7 HOH 6   706 13  HOH HOH B . 
N 7 HOH 7   707 14  HOH HOH B . 
N 7 HOH 8   708 17  HOH HOH B . 
N 7 HOH 9   709 22  HOH HOH B . 
N 7 HOH 10  710 24  HOH HOH B . 
N 7 HOH 11  711 25  HOH HOH B . 
N 7 HOH 12  712 27  HOH HOH B . 
N 7 HOH 13  713 32  HOH HOH B . 
N 7 HOH 14  714 33  HOH HOH B . 
N 7 HOH 15  715 35  HOH HOH B . 
N 7 HOH 16  716 39  HOH HOH B . 
N 7 HOH 17  717 41  HOH HOH B . 
N 7 HOH 18  718 42  HOH HOH B . 
N 7 HOH 19  719 43  HOH HOH B . 
N 7 HOH 20  720 45  HOH HOH B . 
N 7 HOH 21  721 46  HOH HOH B . 
N 7 HOH 22  722 56  HOH HOH B . 
N 7 HOH 23  723 59  HOH HOH B . 
N 7 HOH 24  724 61  HOH HOH B . 
N 7 HOH 25  725 63  HOH HOH B . 
N 7 HOH 26  726 67  HOH HOH B . 
N 7 HOH 27  727 69  HOH HOH B . 
N 7 HOH 28  728 70  HOH HOH B . 
N 7 HOH 29  729 72  HOH HOH B . 
N 7 HOH 30  730 73  HOH HOH B . 
N 7 HOH 31  731 74  HOH HOH B . 
N 7 HOH 32  732 78  HOH HOH B . 
N 7 HOH 33  733 80  HOH HOH B . 
N 7 HOH 34  734 81  HOH HOH B . 
N 7 HOH 35  735 82  HOH HOH B . 
N 7 HOH 36  736 83  HOH HOH B . 
N 7 HOH 37  737 84  HOH HOH B . 
N 7 HOH 38  738 88  HOH HOH B . 
N 7 HOH 39  739 89  HOH HOH B . 
N 7 HOH 40  740 93  HOH HOH B . 
N 7 HOH 41  741 95  HOH HOH B . 
N 7 HOH 42  742 98  HOH HOH B . 
N 7 HOH 43  743 99  HOH HOH B . 
N 7 HOH 44  744 100 HOH HOH B . 
N 7 HOH 45  745 101 HOH HOH B . 
N 7 HOH 46  746 102 HOH HOH B . 
N 7 HOH 47  747 106 HOH HOH B . 
N 7 HOH 48  748 107 HOH HOH B . 
N 7 HOH 49  749 109 HOH HOH B . 
N 7 HOH 50  750 112 HOH HOH B . 
N 7 HOH 51  751 113 HOH HOH B . 
N 7 HOH 52  752 115 HOH HOH B . 
N 7 HOH 53  753 116 HOH HOH B . 
N 7 HOH 54  754 119 HOH HOH B . 
N 7 HOH 55  755 122 HOH HOH B . 
N 7 HOH 56  756 123 HOH HOH B . 
N 7 HOH 57  757 124 HOH HOH B . 
N 7 HOH 58  758 127 HOH HOH B . 
N 7 HOH 59  759 128 HOH HOH B . 
N 7 HOH 60  760 129 HOH HOH B . 
N 7 HOH 61  761 130 HOH HOH B . 
N 7 HOH 62  762 135 HOH HOH B . 
N 7 HOH 63  763 136 HOH HOH B . 
N 7 HOH 64  764 142 HOH HOH B . 
N 7 HOH 65  765 146 HOH HOH B . 
N 7 HOH 66  766 147 HOH HOH B . 
N 7 HOH 67  767 148 HOH HOH B . 
N 7 HOH 68  768 151 HOH HOH B . 
N 7 HOH 69  769 152 HOH HOH B . 
N 7 HOH 70  770 153 HOH HOH B . 
N 7 HOH 71  771 154 HOH HOH B . 
N 7 HOH 72  772 155 HOH HOH B . 
N 7 HOH 73  773 157 HOH HOH B . 
N 7 HOH 74  774 158 HOH HOH B . 
N 7 HOH 75  775 159 HOH HOH B . 
N 7 HOH 76  776 160 HOH HOH B . 
N 7 HOH 77  777 161 HOH HOH B . 
N 7 HOH 78  778 163 HOH HOH B . 
N 7 HOH 79  779 165 HOH HOH B . 
N 7 HOH 80  780 168 HOH HOH B . 
N 7 HOH 81  781 170 HOH HOH B . 
N 7 HOH 82  782 172 HOH HOH B . 
N 7 HOH 83  783 173 HOH HOH B . 
N 7 HOH 84  784 174 HOH HOH B . 
N 7 HOH 85  785 177 HOH HOH B . 
N 7 HOH 86  786 178 HOH HOH B . 
N 7 HOH 87  787 183 HOH HOH B . 
N 7 HOH 88  788 185 HOH HOH B . 
N 7 HOH 89  789 186 HOH HOH B . 
N 7 HOH 90  790 187 HOH HOH B . 
N 7 HOH 91  791 188 HOH HOH B . 
N 7 HOH 92  792 190 HOH HOH B . 
N 7 HOH 93  793 192 HOH HOH B . 
N 7 HOH 94  794 193 HOH HOH B . 
N 7 HOH 95  795 196 HOH HOH B . 
N 7 HOH 96  796 198 HOH HOH B . 
N 7 HOH 97  797 199 HOH HOH B . 
N 7 HOH 98  798 202 HOH HOH B . 
N 7 HOH 99  799 204 HOH HOH B . 
N 7 HOH 100 800 205 HOH HOH B . 
N 7 HOH 101 801 206 HOH HOH B . 
N 7 HOH 102 802 207 HOH HOH B . 
N 7 HOH 103 803 209 HOH HOH B . 
N 7 HOH 104 804 210 HOH HOH B . 
N 7 HOH 105 805 211 HOH HOH B . 
N 7 HOH 106 806 212 HOH HOH B . 
N 7 HOH 107 807 213 HOH HOH B . 
N 7 HOH 108 808 214 HOH HOH B . 
N 7 HOH 109 809 215 HOH HOH B . 
N 7 HOH 110 810 216 HOH HOH B . 
N 7 HOH 111 811 218 HOH HOH B . 
N 7 HOH 112 812 229 HOH HOH B . 
N 7 HOH 113 813 230 HOH HOH B . 
N 7 HOH 114 814 232 HOH HOH B . 
N 7 HOH 115 815 235 HOH HOH B . 
N 7 HOH 116 816 236 HOH HOH B . 
N 7 HOH 117 817 239 HOH HOH B . 
N 7 HOH 118 818 242 HOH HOH B . 
N 7 HOH 119 819 244 HOH HOH B . 
N 7 HOH 120 820 245 HOH HOH B . 
N 7 HOH 121 821 247 HOH HOH B . 
N 7 HOH 122 822 251 HOH HOH B . 
N 7 HOH 123 823 252 HOH HOH B . 
N 7 HOH 124 824 254 HOH HOH B . 
N 7 HOH 125 825 255 HOH HOH B . 
N 7 HOH 126 826 256 HOH HOH B . 
N 7 HOH 127 827 257 HOH HOH B . 
N 7 HOH 128 828 258 HOH HOH B . 
N 7 HOH 129 829 260 HOH HOH B . 
N 7 HOH 130 830 264 HOH HOH B . 
N 7 HOH 131 831 265 HOH HOH B . 
N 7 HOH 132 832 267 HOH HOH B . 
N 7 HOH 133 833 268 HOH HOH B . 
N 7 HOH 134 834 269 HOH HOH B . 
N 7 HOH 135 835 270 HOH HOH B . 
N 7 HOH 136 836 271 HOH HOH B . 
N 7 HOH 137 837 276 HOH HOH B . 
N 7 HOH 138 838 278 HOH HOH B . 
N 7 HOH 139 839 281 HOH HOH B . 
N 7 HOH 140 840 283 HOH HOH B . 
N 7 HOH 141 841 284 HOH HOH B . 
N 7 HOH 142 842 286 HOH HOH B . 
N 7 HOH 143 843 287 HOH HOH B . 
N 7 HOH 144 844 288 HOH HOH B . 
N 7 HOH 145 845 290 HOH HOH B . 
N 7 HOH 146 846 293 HOH HOH B . 
N 7 HOH 147 847 294 HOH HOH B . 
N 7 HOH 148 848 295 HOH HOH B . 
N 7 HOH 149 849 296 HOH HOH B . 
N 7 HOH 150 850 297 HOH HOH B . 
N 7 HOH 151 851 301 HOH HOH B . 
N 7 HOH 152 852 302 HOH HOH B . 
N 7 HOH 153 853 303 HOH HOH B . 
N 7 HOH 154 854 305 HOH HOH B . 
N 7 HOH 155 855 308 HOH HOH B . 
N 7 HOH 156 856 310 HOH HOH B . 
N 7 HOH 157 857 316 HOH HOH B . 
N 7 HOH 158 858 321 HOH HOH B . 
N 7 HOH 159 859 322 HOH HOH B . 
N 7 HOH 160 860 323 HOH HOH B . 
N 7 HOH 161 861 324 HOH HOH B . 
N 7 HOH 162 862 325 HOH HOH B . 
N 7 HOH 163 863 326 HOH HOH B . 
N 7 HOH 164 864 327 HOH HOH B . 
N 7 HOH 165 865 329 HOH HOH B . 
N 7 HOH 166 866 345 HOH HOH B . 
N 7 HOH 167 867 346 HOH HOH B . 
N 7 HOH 168 868 348 HOH HOH B . 
N 7 HOH 169 869 349 HOH HOH B . 
N 7 HOH 170 870 353 HOH HOH B . 
N 7 HOH 171 871 354 HOH HOH B . 
N 7 HOH 172 872 355 HOH HOH B . 
N 7 HOH 173 873 356 HOH HOH B . 
N 7 HOH 174 874 361 HOH HOH B . 
N 7 HOH 175 875 363 HOH HOH B . 
N 7 HOH 176 876 364 HOH HOH B . 
N 7 HOH 177 877 365 HOH HOH B . 
N 7 HOH 178 878 366 HOH HOH B . 
N 7 HOH 179 879 369 HOH HOH B . 
N 7 HOH 180 880 371 HOH HOH B . 
N 7 HOH 181 881 374 HOH HOH B . 
N 7 HOH 182 882 380 HOH HOH B . 
N 7 HOH 183 883 381 HOH HOH B . 
N 7 HOH 184 884 383 HOH HOH B . 
N 7 HOH 185 885 384 HOH HOH B . 
N 7 HOH 186 886 387 HOH HOH B . 
N 7 HOH 187 887 388 HOH HOH B . 
N 7 HOH 188 888 390 HOH HOH B . 
N 7 HOH 189 889 391 HOH HOH B . 
N 7 HOH 190 890 392 HOH HOH B . 
N 7 HOH 191 891 393 HOH HOH B . 
N 7 HOH 192 892 394 HOH HOH B . 
N 7 HOH 193 893 398 HOH HOH B . 
N 7 HOH 194 894 401 HOH HOH B . 
N 7 HOH 195 895 403 HOH HOH B . 
N 7 HOH 196 896 405 HOH HOH B . 
N 7 HOH 197 897 412 HOH HOH B . 
N 7 HOH 198 898 414 HOH HOH B . 
N 7 HOH 199 899 419 HOH HOH B . 
N 7 HOH 200 900 420 HOH HOH B . 
N 7 HOH 201 901 421 HOH HOH B . 
N 7 HOH 202 902 423 HOH HOH B . 
N 7 HOH 203 903 425 HOH HOH B . 
N 7 HOH 204 904 427 HOH HOH B . 
N 7 HOH 205 905 428 HOH HOH B . 
N 7 HOH 206 906 431 HOH HOH B . 
N 7 HOH 207 907 434 HOH HOH B . 
N 7 HOH 208 908 436 HOH HOH B . 
N 7 HOH 209 909 437 HOH HOH B . 
N 7 HOH 210 910 440 HOH HOH B . 
N 7 HOH 211 911 442 HOH HOH B . 
N 7 HOH 212 912 444 HOH HOH B . 
N 7 HOH 213 913 445 HOH HOH B . 
N 7 HOH 214 914 446 HOH HOH B . 
N 7 HOH 215 915 450 HOH HOH B . 
N 7 HOH 216 916 452 HOH HOH B . 
N 7 HOH 217 917 453 HOH HOH B . 
N 7 HOH 218 918 460 HOH HOH B . 
N 7 HOH 219 919 461 HOH HOH B . 
N 7 HOH 220 920 462 HOH HOH B . 
N 7 HOH 221 921 463 HOH HOH B . 
N 7 HOH 222 922 464 HOH HOH B . 
N 7 HOH 223 923 468 HOH HOH B . 
N 7 HOH 224 924 469 HOH HOH B . 
N 7 HOH 225 925 470 HOH HOH B . 
N 7 HOH 226 926 471 HOH HOH B . 
N 7 HOH 227 927 472 HOH HOH B . 
N 7 HOH 228 928 474 HOH HOH B . 
N 7 HOH 229 929 476 HOH HOH B . 
N 7 HOH 230 930 478 HOH HOH B . 
N 7 HOH 231 931 482 HOH HOH B . 
N 7 HOH 232 932 486 HOH HOH B . 
N 7 HOH 233 933 487 HOH HOH B . 
N 7 HOH 234 934 490 HOH HOH B . 
N 7 HOH 235 935 491 HOH HOH B . 
N 7 HOH 236 936 492 HOH HOH B . 
N 7 HOH 237 937 499 HOH HOH B . 
N 7 HOH 238 938 500 HOH HOH B . 
N 7 HOH 239 939 509 HOH HOH B . 
N 7 HOH 240 940 512 HOH HOH B . 
N 7 HOH 241 941 513 HOH HOH B . 
N 7 HOH 242 942 515 HOH HOH B . 
N 7 HOH 243 943 519 HOH HOH B . 
N 7 HOH 244 944 520 HOH HOH B . 
N 7 HOH 245 945 523 HOH HOH B . 
N 7 HOH 246 946 526 HOH HOH B . 
N 7 HOH 247 947 528 HOH HOH B . 
N 7 HOH 248 948 529 HOH HOH B . 
N 7 HOH 249 949 530 HOH HOH B . 
N 7 HOH 250 950 531 HOH HOH B . 
N 7 HOH 251 951 532 HOH HOH B . 
N 7 HOH 252 952 533 HOH HOH B . 
N 7 HOH 253 953 537 HOH HOH B . 
N 7 HOH 254 954 539 HOH HOH B . 
N 7 HOH 255 955 540 HOH HOH B . 
N 7 HOH 256 956 544 HOH HOH B . 
N 7 HOH 257 957 547 HOH HOH B . 
N 7 HOH 258 958 549 HOH HOH B . 
N 7 HOH 259 959 553 HOH HOH B . 
N 7 HOH 260 960 554 HOH HOH B . 
N 7 HOH 261 961 558 HOH HOH B . 
N 7 HOH 262 962 562 HOH HOH B . 
N 7 HOH 263 963 563 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 349 A ASN 350 ? ASN 'GLYCOSYLATION SITE' 
2 B ASN 264 B ASN 265 ? ASN 'GLYCOSYLATION SITE' 
3 B ASN 349 B ASN 350 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6810  ? 
1 MORE         28    ? 
1 'SSA (A^2)'  37610 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-10-17 
2 'Structure model' 1 1 2012-12-12 
3 'Structure model' 1 2 2017-11-15 
4 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Refinement description' 
3 4 'Structure model' 'Atomic model'           
4 4 'Structure model' 'Data collection'        
5 4 'Structure model' 'Derived calculations'   
6 4 'Structure model' 'Structure summary'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  3 'Structure model' software                      
2  4 'Structure model' atom_site                     
3  4 'Structure model' chem_comp                     
4  4 'Structure model' entity                        
5  4 'Structure model' pdbx_branch_scheme            
6  4 'Structure model' pdbx_chem_comp_identifier     
7  4 'Structure model' pdbx_entity_branch            
8  4 'Structure model' pdbx_entity_branch_descriptor 
9  4 'Structure model' pdbx_entity_branch_link       
10 4 'Structure model' pdbx_entity_branch_list       
11 4 'Structure model' pdbx_entity_nonpoly           
12 4 'Structure model' pdbx_nonpoly_scheme           
13 4 'Structure model' pdbx_struct_assembly_gen      
14 4 'Structure model' struct_asym                   
15 4 'Structure model' struct_conn                   
16 4 'Structure model' struct_site                   
17 4 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.B_iso_or_equiv'              
2  4 'Structure model' '_atom_site.Cartn_x'                     
3  4 'Structure model' '_atom_site.Cartn_y'                     
4  4 'Structure model' '_atom_site.Cartn_z'                     
5  4 'Structure model' '_atom_site.auth_asym_id'                
6  4 'Structure model' '_atom_site.auth_atom_id'                
7  4 'Structure model' '_atom_site.auth_comp_id'                
8  4 'Structure model' '_atom_site.auth_seq_id'                 
9  4 'Structure model' '_atom_site.label_asym_id'               
10 4 'Structure model' '_atom_site.label_atom_id'               
11 4 'Structure model' '_atom_site.label_comp_id'               
12 4 'Structure model' '_atom_site.label_entity_id'             
13 4 'Structure model' '_atom_site.type_symbol'                 
14 4 'Structure model' '_chem_comp.name'                        
15 4 'Structure model' '_chem_comp.type'                        
16 4 'Structure model' '_entity.formula_weight'                 
17 4 'Structure model' '_entity.pdbx_description'               
18 4 'Structure model' '_entity.pdbx_number_of_molecules'       
19 4 'Structure model' '_entity.src_method'                     
20 4 'Structure model' '_entity.type'                           
21 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 
22 4 'Structure model' '_struct_conn.pdbx_dist_value'           
23 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'    
24 4 'Structure model' '_struct_conn.pdbx_role'                 
25 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'        
26 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'        
27 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'         
28 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'       
29 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'       
30 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'       
31 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'        
32 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'        
33 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'        
34 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'         
35 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'       
36 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'       
37 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'       
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO       .        ?                package 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data reduction'  
http://www.hkl-xray.com/                  ?   ? 
2 SCALEPACK   .        ?                package 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data scaling'    
http://www.hkl-xray.com/                  ?   ? 
3 PHENIX      1.8_1069 ?                package 'Paul D. Adams'      PDAdams@lbl.gov          refinement        
http://www.phenix-online.org/             C++ ? 
4 PDB_EXTRACT 3.11     'April 22, 2011' package PDB                  deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 
5 HKL-2000    .        ?                ?       ?                    ?                        'data collection' ? ?   ? 
6 HKL-2000    .        ?                ?       ?                    ?                        'data reduction'  ? ?   ? 
7 HKL-2000    .        ?                ?       ?                    ?                        'data scaling'    ? ?   ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NE2 B GLN 527 ? ? O B HOH 939 ? ? 2.12 
2 1 OD1 A ASP 304 ? ? O A HOH 968 ? ? 2.13 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 47  ? ? 76.90   -4.43   
2  1 ALA A 62  ? ? -110.87 53.68   
3  1 ALA A 167 ? ? -151.48 76.10   
4  1 SER A 203 ? ? 44.35   -119.68 
5  1 ASP A 306 ? ? -95.34  -91.93  
6  1 HIS A 387 ? ? -143.57 58.15   
7  1 VAL A 407 ? ? -124.05 -62.18  
8  1 PRO B 25  ? ? -38.56  -34.43  
9  1 PHE B 47  ? ? 70.45   -1.19   
10 1 ALA B 167 ? ? -156.02 69.11   
11 1 SER B 203 ? ? 43.63   -116.46 
12 1 ASP B 306 ? ? -102.91 -84.43  
13 1 VAL B 407 ? ? -127.28 -62.96  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 2   ? A GLY 1   
2  1 Y 1 A ARG 3   ? A ARG 2   
3  1 Y 1 A PRO 259 ? A PRO 258 
4  1 Y 1 A GLY 260 ? A GLY 259 
5  1 Y 1 A GLY 261 ? A GLY 260 
6  1 Y 1 A THR 262 ? A THR 261 
7  1 Y 1 A GLY 263 ? A GLY 262 
8  1 Y 1 A GLY 264 ? A GLY 263 
9  1 Y 1 A PRO 495 ? A PRO 494 
10 1 Y 1 A LYS 496 ? A LYS 495 
11 1 Y 1 A ALA 497 ? A ALA 496 
12 1 Y 1 A THR 543 ? A THR 542 
13 1 Y 1 B GLY 2   ? B GLY 1   
14 1 Y 1 B ARG 3   ? B ARG 2   
15 1 Y 1 B GLY 260 ? B GLY 259 
16 1 Y 1 B GLY 261 ? B GLY 260 
17 1 Y 1 B ARG 493 ? B ARG 492 
18 1 Y 1 B ASP 494 ? B ASP 493 
19 1 Y 1 B THR 543 ? B THR 542 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
C 2 NAG 1 C NAG 1 C NAG 2 n 
C 2 NAG 2 C NAG 2 C NAG 3 n 
C 2 FUC 3 C FUC 3 C FUC 1 n 
D 2 NAG 1 D NAG 1 D NAG 2 n 
D 2 NAG 2 D NAG 2 D NAG 3 n 
D 2 FUC 3 D FUC 3 D FUC 1 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 LFucpa                         
FUC 'COMMON NAME'                         GMML     1.0 a-L-fucopyranose               
FUC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-L-Fucp                       
FUC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fuc                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 'DGlcpNAcb1-4[LFucpa1-6]DGlcpNAcb1-'                                         'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/2,3,2/[a2122h-1b_1-5_2*NCC/3=O][a1221m-1a_1-5]/1-1-2/a4-b1_a6-c1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}[(6+1)][a-L-Fucp]{}}}'        LINUCS                      PDB-CARE   ?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
2 2 3 FUC C1 O1 1 NAG O6 HO6 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
2 FUC 3 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 '1-BENZYL-4-[(5,6-DIMETHOXY-1-INDANON-2-YL)METHYL]PIPERIDINE' E20 
4 1,2-ETHANEDIOL                                                EDO 
5 2-acetamido-2-deoxy-beta-D-glucopyranose                      NAG 
6 'NITRATE ION'                                                 NO3 
7 water                                                         HOH 
#