data_4F4W
# 
_entry.id   4F4W 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.284 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4F4W         
NDB   NA1801       
RCSB  RCSB072458   
WWPDB D_1000072458 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4F4W . unspecified 
PDB 4F4X . unspecified 
PDB 4F4Y . unspecified 
PDB 4F4Z . unspecified 
PDB 4F50 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4F4W 
_pdbx_database_status.recvd_initial_deposition_date   2012-05-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pata, J.D.'   1 
'Wilson, R.C.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Y-family polymerase conformation is a major determinant of fidelity and translesion specificity.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            21 
_citation.page_first                20 
_citation.page_last                 31 
_citation.year                      2013 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23245850 
_citation.pdbx_database_id_DOI      10.1016/j.str.2012.11.005 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wilson, R.C.'  1 
primary 'Jackson, M.A.' 2 
primary 'Pata, J.D.'    3 
# 
_cell.entry_id           4F4W 
_cell.length_a           52.820 
_cell.length_b           99.655 
_cell.length_c           101.625 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.16 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4F4W 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase IV'                                                    41124.742 2   2.7.7.7 ? ? ?              
2 polymer     syn 
;DNA (5'-D(*GP*GP*CP*AP*CP*TP*GP*AP*TP*CP*GP*GP*C)-3')
;
3992.598  2   ?       ? ? 'Primer DNA'   
3 polymer     syn 
;DNA (5'-D(*TP*TP*AP*CP*GP*GP*CP*CP*GP*AP*TP*CP*AP*GP*TP*GP*CP*C)-3')
;
5492.554  2   ?       ? ? 'Template DNA' 
4 non-polymer syn "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE"                                     467.157   2   ?       ? ? ?              
5 non-polymer syn 'CALCIUM ION'                                                          40.078    4   ?       ? ? ?              
6 water       nat water                                                                  18.015    708 ?       ? ? ?              
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Pol IV' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MIVIFVDFDYFFAQVEEVLNPQYKGKPLVVCVYSGRTKTSGAVATANYEARKLGVKAGMPIIKAMQIAPSAIYVPMRKPI
YEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKEKITVTVGVAPNKILAKIIADKSK
PNGLGVIRPTEVQDFLNELDIDEIPGIGSVLARRLNELGIQKLRDILSKNYNELEKITGKAKALYLLKLAQDEYNEPIRT
RVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLL
QKILEEDERKIRRIGVRFSKFIEAIGLDKFFDTGGHHHHHH
;
;MIVIFVDFDYFFAQVEEVLNPQYKGKPLVVCVYSGRTKTSGAVATANYEARKLGVKAGMPIIKAMQIAPSAIYVPMRKPI
YEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKEKITVTVGVAPNKILAKIIADKSK
PNGLGVIRPTEVQDFLNELDIDEIPGIGSVLARRLNELGIQKLRDILSKNYNELEKITGKAKALYLLKLAQDEYNEPIRT
RVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLL
QKILEEDERKIRRIGVRFSKFIEAIGLDKFFDTGGHHHHHH
;
A,B ? 
2 polydeoxyribonucleotide no no '(DG)(DG)(DC)(DA)(DC)(DT)(DG)(DA)(DT)(DC)(DG)(DG)(DC)' GGCACTGATCGGC P,E ? 
3 polydeoxyribonucleotide no no '(DT)(DT)(DA)(DC)(DG)(DG)(DC)(DC)(DG)(DA)(DT)(DC)(DA)(DG)(DT)(DG)(DC)(DC)' TTACGGCCGATCAGTGCC T,F 
? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ILE n 
1 3   VAL n 
1 4   ILE n 
1 5   PHE n 
1 6   VAL n 
1 7   ASP n 
1 8   PHE n 
1 9   ASP n 
1 10  TYR n 
1 11  PHE n 
1 12  PHE n 
1 13  ALA n 
1 14  GLN n 
1 15  VAL n 
1 16  GLU n 
1 17  GLU n 
1 18  VAL n 
1 19  LEU n 
1 20  ASN n 
1 21  PRO n 
1 22  GLN n 
1 23  TYR n 
1 24  LYS n 
1 25  GLY n 
1 26  LYS n 
1 27  PRO n 
1 28  LEU n 
1 29  VAL n 
1 30  VAL n 
1 31  CYS n 
1 32  VAL n 
1 33  TYR n 
1 34  SER n 
1 35  GLY n 
1 36  ARG n 
1 37  THR n 
1 38  LYS n 
1 39  THR n 
1 40  SER n 
1 41  GLY n 
1 42  ALA n 
1 43  VAL n 
1 44  ALA n 
1 45  THR n 
1 46  ALA n 
1 47  ASN n 
1 48  TYR n 
1 49  GLU n 
1 50  ALA n 
1 51  ARG n 
1 52  LYS n 
1 53  LEU n 
1 54  GLY n 
1 55  VAL n 
1 56  LYS n 
1 57  ALA n 
1 58  GLY n 
1 59  MET n 
1 60  PRO n 
1 61  ILE n 
1 62  ILE n 
1 63  LYS n 
1 64  ALA n 
1 65  MET n 
1 66  GLN n 
1 67  ILE n 
1 68  ALA n 
1 69  PRO n 
1 70  SER n 
1 71  ALA n 
1 72  ILE n 
1 73  TYR n 
1 74  VAL n 
1 75  PRO n 
1 76  MET n 
1 77  ARG n 
1 78  LYS n 
1 79  PRO n 
1 80  ILE n 
1 81  TYR n 
1 82  GLU n 
1 83  ALA n 
1 84  PHE n 
1 85  SER n 
1 86  ASN n 
1 87  ARG n 
1 88  ILE n 
1 89  MET n 
1 90  ASN n 
1 91  LEU n 
1 92  LEU n 
1 93  ASN n 
1 94  LYS n 
1 95  HIS n 
1 96  ALA n 
1 97  ASP n 
1 98  LYS n 
1 99  ILE n 
1 100 GLU n 
1 101 VAL n 
1 102 ALA n 
1 103 SER n 
1 104 ILE n 
1 105 ASP n 
1 106 GLU n 
1 107 ALA n 
1 108 TYR n 
1 109 LEU n 
1 110 ASP n 
1 111 VAL n 
1 112 THR n 
1 113 ASN n 
1 114 LYS n 
1 115 VAL n 
1 116 GLU n 
1 117 GLY n 
1 118 ASN n 
1 119 PHE n 
1 120 GLU n 
1 121 ASN n 
1 122 GLY n 
1 123 ILE n 
1 124 GLU n 
1 125 LEU n 
1 126 ALA n 
1 127 ARG n 
1 128 LYS n 
1 129 ILE n 
1 130 LYS n 
1 131 GLN n 
1 132 GLU n 
1 133 ILE n 
1 134 LEU n 
1 135 GLU n 
1 136 LYS n 
1 137 GLU n 
1 138 LYS n 
1 139 ILE n 
1 140 THR n 
1 141 VAL n 
1 142 THR n 
1 143 VAL n 
1 144 GLY n 
1 145 VAL n 
1 146 ALA n 
1 147 PRO n 
1 148 ASN n 
1 149 LYS n 
1 150 ILE n 
1 151 LEU n 
1 152 ALA n 
1 153 LYS n 
1 154 ILE n 
1 155 ILE n 
1 156 ALA n 
1 157 ASP n 
1 158 LYS n 
1 159 SER n 
1 160 LYS n 
1 161 PRO n 
1 162 ASN n 
1 163 GLY n 
1 164 LEU n 
1 165 GLY n 
1 166 VAL n 
1 167 ILE n 
1 168 ARG n 
1 169 PRO n 
1 170 THR n 
1 171 GLU n 
1 172 VAL n 
1 173 GLN n 
1 174 ASP n 
1 175 PHE n 
1 176 LEU n 
1 177 ASN n 
1 178 GLU n 
1 179 LEU n 
1 180 ASP n 
1 181 ILE n 
1 182 ASP n 
1 183 GLU n 
1 184 ILE n 
1 185 PRO n 
1 186 GLY n 
1 187 ILE n 
1 188 GLY n 
1 189 SER n 
1 190 VAL n 
1 191 LEU n 
1 192 ALA n 
1 193 ARG n 
1 194 ARG n 
1 195 LEU n 
1 196 ASN n 
1 197 GLU n 
1 198 LEU n 
1 199 GLY n 
1 200 ILE n 
1 201 GLN n 
1 202 LYS n 
1 203 LEU n 
1 204 ARG n 
1 205 ASP n 
1 206 ILE n 
1 207 LEU n 
1 208 SER n 
1 209 LYS n 
1 210 ASN n 
1 211 TYR n 
1 212 ASN n 
1 213 GLU n 
1 214 LEU n 
1 215 GLU n 
1 216 LYS n 
1 217 ILE n 
1 218 THR n 
1 219 GLY n 
1 220 LYS n 
1 221 ALA n 
1 222 LYS n 
1 223 ALA n 
1 224 LEU n 
1 225 TYR n 
1 226 LEU n 
1 227 LEU n 
1 228 LYS n 
1 229 LEU n 
1 230 ALA n 
1 231 GLN n 
1 232 ASP n 
1 233 GLU n 
1 234 TYR n 
1 235 ASN n 
1 236 GLU n 
1 237 PRO n 
1 238 ILE n 
1 239 ARG n 
1 240 THR n 
1 241 ARG n 
1 242 VAL n 
1 243 ARG n 
1 244 LYS n 
1 245 SER n 
1 246 ILE n 
1 247 GLY n 
1 248 ARG n 
1 249 ILE n 
1 250 VAL n 
1 251 THR n 
1 252 MET n 
1 253 LYS n 
1 254 ARG n 
1 255 ASN n 
1 256 SER n 
1 257 ARG n 
1 258 ASN n 
1 259 LEU n 
1 260 GLU n 
1 261 GLU n 
1 262 ILE n 
1 263 LYS n 
1 264 PRO n 
1 265 TYR n 
1 266 LEU n 
1 267 PHE n 
1 268 ARG n 
1 269 ALA n 
1 270 ILE n 
1 271 GLU n 
1 272 GLU n 
1 273 SER n 
1 274 TYR n 
1 275 TYR n 
1 276 LYS n 
1 277 LEU n 
1 278 ASP n 
1 279 LYS n 
1 280 ARG n 
1 281 ILE n 
1 282 PRO n 
1 283 LYS n 
1 284 ALA n 
1 285 ILE n 
1 286 HIS n 
1 287 VAL n 
1 288 VAL n 
1 289 ALA n 
1 290 VAL n 
1 291 THR n 
1 292 GLU n 
1 293 ASP n 
1 294 LEU n 
1 295 ASP n 
1 296 ILE n 
1 297 VAL n 
1 298 SER n 
1 299 ARG n 
1 300 GLY n 
1 301 ARG n 
1 302 THR n 
1 303 PHE n 
1 304 PRO n 
1 305 HIS n 
1 306 GLY n 
1 307 ILE n 
1 308 SER n 
1 309 LYS n 
1 310 GLU n 
1 311 THR n 
1 312 ALA n 
1 313 TYR n 
1 314 SER n 
1 315 GLU n 
1 316 SER n 
1 317 VAL n 
1 318 LYS n 
1 319 LEU n 
1 320 LEU n 
1 321 GLN n 
1 322 LYS n 
1 323 ILE n 
1 324 LEU n 
1 325 GLU n 
1 326 GLU n 
1 327 ASP n 
1 328 GLU n 
1 329 ARG n 
1 330 LYS n 
1 331 ILE n 
1 332 ARG n 
1 333 ARG n 
1 334 ILE n 
1 335 GLY n 
1 336 VAL n 
1 337 ARG n 
1 338 PHE n 
1 339 SER n 
1 340 LYS n 
1 341 PHE n 
1 342 ILE n 
1 343 GLU n 
1 344 ALA n 
1 345 ILE n 
1 346 GLY n 
1 347 LEU n 
1 348 ASP n 
1 349 LYS n 
1 350 PHE n 
1 351 PHE n 
1 352 ASP n 
1 353 THR n 
1 354 GLY n 
1 355 GLY n 
1 356 HIS n 
1 357 HIS n 
1 358 HIS n 
1 359 HIS n 
1 360 HIS n 
1 361 HIS n 
2 1   DG  n 
2 2   DG  n 
2 3   DC  n 
2 4   DA  n 
2 5   DC  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DT  n 
2 10  DC  n 
2 11  DG  n 
2 12  DG  n 
2 13  DC  n 
3 1   DT  n 
3 2   DT  n 
3 3   DA  n 
3 4   DC  n 
3 5   DG  n 
3 6   DG  n 
3 7   DC  n 
3 8   DC  n 
3 9   DG  n 
3 10  DA  n 
3 11  DT  n 
3 12  DC  n 
3 13  DA  n 
3 14  DG  n 
3 15  DT  n 
3 16  DG  n 
3 17  DC  n 
3 18  DC  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 1   231 ? ? 
;dbh, dpo4, Dpo4 (S. solfataricus) and Dbh (S. acidocaldarius), Saci_0554, SSO24
48
;
? 'ATCC 35092 / DSM 1617 / JCM 11322 / P2' ? ? ? ? 'Sulfolobus acidocaldarius' 330779 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? 
? ? ? 'BLR(DE3)pLysS' ? ? ? ? ? ? ? pKKT7-H ? ? ? ? ? ? 
1 2 sample ? 232 353 ? ? 
;dbh, dpo4, Dpo4 (S. solfataricus) and Dbh (S. acidocaldarius), Saci_0554, SSO24
48
;
? 'ATCC 35092 / DSM 1617 / JCM 11322 / P2' ? ? ? ? 'Sulfolobus solfataricus'   273057 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? 
? ? ? 'BLR(DE3)pLysS' ? ? ? ? ? ? ? pKKT7-H ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPO4_SULAC Q4JB80 1 
;MIVIFVDFDYFFAQVEEVLNPQYKGKPLVVCVYSGRTKTSGAVATANYEARKLGVKAGMPIIKAMQIAPSAIYVPMRKPI
YEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKEKITVTVGVAPNKILAKIIADKSK
PNGLGVIRPTEVQDFLNELDIDEIPGIGSVLARRLNELGIQKLRDILSKNYNELEKITGKAKALYLLKLAQ
;
1   ? 
2 UNP DPO4_SULSO Q97W02 1 
;DEYNEPIRTRVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKET
AYSESVKLLQKILEEDERKIRRIGVRFSKFIEAIGLDKFFDT
;
231 ? 
3 PDB 4F4W       4F4W   2 GGCACTGATCGGC 1   ? 
4 PDB 4F4W       4F4W   3 TTACGGCCGATCAGTGCC 1   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4F4W A 1   ? 231 ? Q4JB80 1   ? 231 ? 1   231 
2 2 4F4W A 232 ? 353 ? Q97W02 231 ? 352 ? 232 353 
3 1 4F4W B 1   ? 231 ? Q4JB80 1   ? 231 ? 1   231 
4 2 4F4W B 232 ? 353 ? Q97W02 231 ? 352 ? 232 353 
5 3 4F4W P 1   ? 13  ? 4F4W   1   ? 13  ? 1   13  
6 3 4F4W E 1   ? 13  ? 4F4W   1   ? 13  ? 1   13  
7 4 4F4W T 1   ? 18  ? 4F4W   1   ? 18  ? 1   18  
8 4 4F4W F 1   ? 18  ? 4F4W   1   ? 18  ? 1   18  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 4F4W GLY A 354 ? UNP Q97W02 ? ? 'EXPRESSION TAG' 354 1  
2 4F4W GLY A 355 ? UNP Q97W02 ? ? 'EXPRESSION TAG' 355 2  
2 4F4W HIS A 356 ? UNP Q97W02 ? ? 'EXPRESSION TAG' 356 3  
2 4F4W HIS A 357 ? UNP Q97W02 ? ? 'EXPRESSION TAG' 357 4  
2 4F4W HIS A 358 ? UNP Q97W02 ? ? 'EXPRESSION TAG' 358 5  
2 4F4W HIS A 359 ? UNP Q97W02 ? ? 'EXPRESSION TAG' 359 6  
2 4F4W HIS A 360 ? UNP Q97W02 ? ? 'EXPRESSION TAG' 360 7  
2 4F4W HIS A 361 ? UNP Q97W02 ? ? 'EXPRESSION TAG' 361 8  
4 4F4W GLY B 354 ? UNP Q97W02 ? ? 'EXPRESSION TAG' 354 9  
4 4F4W GLY B 355 ? UNP Q97W02 ? ? 'EXPRESSION TAG' 355 10 
4 4F4W HIS B 356 ? UNP Q97W02 ? ? 'EXPRESSION TAG' 356 11 
4 4F4W HIS B 357 ? UNP Q97W02 ? ? 'EXPRESSION TAG' 357 12 
4 4F4W HIS B 358 ? UNP Q97W02 ? ? 'EXPRESSION TAG' 358 13 
4 4F4W HIS B 359 ? UNP Q97W02 ? ? 'EXPRESSION TAG' 359 14 
4 4F4W HIS B 360 ? UNP Q97W02 ? ? 'EXPRESSION TAG' 360 15 
4 4F4W HIS B 361 ? UNP Q97W02 ? ? 'EXPRESSION TAG' 361 16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'       133.103 
CA  non-polymer         . 'CALCIUM ION'                        ? 'Ca 2'             40.078  
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'   307.197 
DCP non-polymer         . "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE"   ? 'C9 H16 N3 O13 P3' 467.157 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'  322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'       119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          4F4W 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.64 
_exptl_crystal.density_percent_sol   53.45 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.9 
_exptl_crystal_grow.pdbx_details    
'10% PEG-3350, 100 mM Ca(OAc)2, 100 mM MES/Tris, 2.5% Glycerol, pH 5.9, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2012-02-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.075 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.075 
# 
_reflns.entry_id                     4F4W 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             30 
_reflns.d_resolution_high            1.898 
_reflns.number_obs                   80176 
_reflns.number_all                   83084 
_reflns.percent_possible_obs         96.5 
_reflns.pdbx_Rmerge_I_obs            0.039 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        28.5 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.9 
_reflns_shell.d_res_low              1.93 
_reflns_shell.percent_possible_all   81.1 
_reflns_shell.Rmerge_I_obs           0.166 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.8 
_reflns_shell.pdbx_redundancy        2.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3345 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4F4W 
_refine.ls_number_reflns_obs                     80155 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.54 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             28.014 
_refine.ls_d_res_high                            1.898 
_refine.ls_percent_reflns_obs                    96.52 
_refine.ls_R_factor_obs                          0.1873 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1865 
_refine.ls_R_factor_R_free                       0.2189 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.40 
_refine.ls_number_reflns_R_free                  1927 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -4.1495 
_refine.aniso_B[2][2]                            6.1347 
_refine.aniso_B[3][3]                            -1.9852 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -0.2172 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.385 
_refine.solvent_model_param_bsol                 48.200 
_refine.pdbx_solvent_vdw_probe_radii             1.10 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.86 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.25 
_refine.pdbx_overall_phase_error                 21.60 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5476 
_refine_hist.pdbx_number_atoms_nucleic_acid   1142 
_refine_hist.pdbx_number_atoms_ligand         60 
_refine_hist.number_atoms_solvent             708 
_refine_hist.number_atoms_total               7386 
_refine_hist.d_res_high                       1.898 
_refine_hist.d_res_low                        28.014 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.011  ? ? 6946 ? 'X-RAY DIFFRACTION' 
f_angle_d          1.493  ? ? 9617 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 18.228 ? ? 2801 ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.079  ? ? 1098 ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.006  ? ? 1023 ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 1.898  1.9458  4854 0.2190 83.00 0.2484 . . 124 . . . . 'X-RAY DIFFRACTION' 
. 1.9458 1.9983  5374 0.2049 94.00 0.2602 . . 129 . . . . 'X-RAY DIFFRACTION' 
. 1.9983 2.0571  5456 0.1945 95.00 0.2034 . . 138 . . . . 'X-RAY DIFFRACTION' 
. 2.0571 2.1235  5562 0.1937 96.00 0.2428 . . 140 . . . . 'X-RAY DIFFRACTION' 
. 2.1235 2.1994  5606 0.1948 97.00 0.2405 . . 131 . . . . 'X-RAY DIFFRACTION' 
. 2.1994 2.2874  5606 0.2003 97.00 0.2015 . . 139 . . . . 'X-RAY DIFFRACTION' 
. 2.2874 2.3914  5637 0.2009 98.00 0.2822 . . 131 . . . . 'X-RAY DIFFRACTION' 
. 2.3914 2.5175  5670 0.2004 98.00 0.2430 . . 142 . . . . 'X-RAY DIFFRACTION' 
. 2.5175 2.6751  5692 0.2009 99.00 0.2900 . . 139 . . . . 'X-RAY DIFFRACTION' 
. 2.6751 2.8814  5712 0.2084 99.00 0.2744 . . 135 . . . . 'X-RAY DIFFRACTION' 
. 2.8814 3.1710  5770 0.1987 99.00 0.2005 . . 139 . . . . 'X-RAY DIFFRACTION' 
. 3.1710 3.6290  5752 0.1813 99.00 0.2133 . . 143 . . . . 'X-RAY DIFFRACTION' 
. 3.6290 4.5690  5788 0.1586 99.00 0.1840 . . 148 . . . . 'X-RAY DIFFRACTION' 
. 4.5690 28.0171 5749 0.1754 98.00 0.1943 . . 149 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4F4W 
_struct.title                     'Y-family DNA polymerase chimera Dbh-Dpo4-Dpo4 #1' 
_struct.pdbx_descriptor           'DNA polymerase IV (E.C.2.7.7.7)/DNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4F4W 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'Y-family polymerase, TRANSFERASE-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 5 ? 
J N N 4 ? 
K N N 5 ? 
L N N 5 ? 
M N N 6 ? 
N N N 6 ? 
O N N 6 ? 
P N N 6 ? 
Q N N 6 ? 
R N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 10  ? ASN A 20  ? TYR A 10  ASN A 20  1 ? 11 
HELX_P HELX_P2  2  PRO A 21  ? LYS A 24  ? PRO A 21  LYS A 24  5 ? 4  
HELX_P HELX_P3  3  ASN A 47  ? LYS A 52  ? ASN A 47  LYS A 52  1 ? 6  
HELX_P HELX_P4  4  PRO A 60  ? ALA A 68  ? PRO A 60  ALA A 68  1 ? 9  
HELX_P HELX_P5  5  ARG A 77  ? LYS A 94  ? ARG A 77  LYS A 94  1 ? 18 
HELX_P HELX_P6  6  ASN A 118 ? LYS A 138 ? ASN A 118 LYS A 138 1 ? 21 
HELX_P HELX_P7  7  ASN A 148 ? LYS A 160 ? ASN A 148 LYS A 160 1 ? 13 
HELX_P HELX_P8  8  ARG A 168 ? THR A 170 ? ARG A 168 THR A 170 5 ? 3  
HELX_P HELX_P9  9  GLU A 171 ? LEU A 179 ? GLU A 171 LEU A 179 1 ? 9  
HELX_P HELX_P10 10 ASP A 180 ? ILE A 184 ? ASP A 180 ILE A 184 5 ? 5  
HELX_P HELX_P11 11 GLY A 188 ? LEU A 198 ? GLY A 188 LEU A 198 1 ? 11 
HELX_P HELX_P12 12 LYS A 202 ? LYS A 209 ? LYS A 202 LYS A 209 5 ? 8  
HELX_P HELX_P13 13 ASN A 210 ? GLY A 219 ? ASN A 210 GLY A 219 1 ? 10 
HELX_P HELX_P14 14 GLY A 219 ? GLN A 231 ? GLY A 219 GLN A 231 1 ? 13 
HELX_P HELX_P15 15 ASN A 258 ? ASP A 278 ? ASN A 258 ASP A 278 1 ? 21 
HELX_P HELX_P16 16 SER A 308 ? ASP A 327 ? SER A 308 ASP A 327 1 ? 20 
HELX_P HELX_P17 17 TYR D 10  ? ASN D 20  ? TYR B 10  ASN B 20  1 ? 11 
HELX_P HELX_P18 18 PRO D 21  ? LYS D 24  ? PRO B 21  LYS B 24  5 ? 4  
HELX_P HELX_P19 19 ASN D 47  ? LYS D 52  ? ASN B 47  LYS B 52  1 ? 6  
HELX_P HELX_P20 20 PRO D 60  ? ALA D 68  ? PRO B 60  ALA B 68  1 ? 9  
HELX_P HELX_P21 21 ARG D 77  ? LYS D 94  ? ARG B 77  LYS B 94  1 ? 18 
HELX_P HELX_P22 22 THR D 112 ? GLU D 116 ? THR B 112 GLU B 116 5 ? 5  
HELX_P HELX_P23 23 ASN D 118 ? LYS D 138 ? ASN B 118 LYS B 138 1 ? 21 
HELX_P HELX_P24 24 ASN D 148 ? SER D 159 ? ASN B 148 SER B 159 1 ? 12 
HELX_P HELX_P25 25 ARG D 168 ? THR D 170 ? ARG B 168 THR B 170 5 ? 3  
HELX_P HELX_P26 26 GLU D 171 ? LEU D 179 ? GLU B 171 LEU B 179 1 ? 9  
HELX_P HELX_P27 27 ASP D 180 ? ILE D 184 ? ASP B 180 ILE B 184 5 ? 5  
HELX_P HELX_P28 28 GLY D 188 ? LEU D 198 ? GLY B 188 LEU B 198 1 ? 11 
HELX_P HELX_P29 29 LYS D 202 ? LYS D 209 ? LYS B 202 LYS B 209 5 ? 8  
HELX_P HELX_P30 30 ASN D 210 ? GLY D 219 ? ASN B 210 GLY B 219 1 ? 10 
HELX_P HELX_P31 31 GLY D 219 ? GLN D 231 ? GLY B 219 GLN B 231 1 ? 13 
HELX_P HELX_P32 32 ASN D 258 ? ASP D 278 ? ASN B 258 ASP B 278 1 ? 21 
HELX_P HELX_P33 33 SER D 308 ? ASP D 327 ? SER B 308 ASP B 327 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? I CA  .   CA    ? ? ? 1_555 M HOH .  O  ? ? A CA  403 A HOH 510 1_555 ? ? ? ? ? ? ?            2.098 ? 
metalc2  metalc ? ? L CA  .   CA    ? ? ? 1_555 P HOH .  O  ? ? B CA  403 B HOH 512 1_555 ? ? ? ? ? ? ?            2.141 ? 
metalc3  metalc ? ? D ASP 7   OD1   ? ? ? 1_555 K CA  .  CA ? ? B ASP 7   B CA  402 1_555 ? ? ? ? ? ? ?            2.239 ? 
metalc4  metalc ? ? A ASP 7   OD2   ? ? ? 1_555 H CA  .  CA ? ? A ASP 7   A CA  402 1_555 ? ? ? ? ? ? ?            2.244 ? 
metalc5  metalc ? ? D ASP 105 OD2   ? ? ? 1_555 K CA  .  CA ? ? B ASP 105 B CA  402 1_555 ? ? ? ? ? ? ?            2.315 ? 
metalc6  metalc ? ? J DCP .   O3G   ? ? ? 1_555 K CA  .  CA ? ? B DCP 401 B CA  402 1_555 ? ? ? ? ? ? ?            2.347 ? 
metalc7  metalc ? ? G DCP .   O2A   ? ? ? 1_555 I CA  .  CA ? ? A DCP 401 A CA  403 1_555 ? ? ? ? ? ? ?            2.361 ? 
metalc8  metalc ? ? D PHE 8   O     ? ? ? 1_555 K CA  .  CA ? ? B PHE 8   B CA  402 1_555 ? ? ? ? ? ? ?            2.372 ? 
metalc9  metalc ? ? J DCP .   O1B   ? ? ? 1_555 K CA  .  CA ? ? B DCP 401 B CA  402 1_555 ? ? ? ? ? ? ?            2.372 ? 
metalc10 metalc ? ? G DCP .   O3G   ? ? ? 1_555 H CA  .  CA ? ? A DCP 401 A CA  402 1_555 ? ? ? ? ? ? ?            2.391 ? 
metalc11 metalc ? ? A PHE 8   O     ? ? ? 1_555 H CA  .  CA ? ? A PHE 8   A CA  402 1_555 ? ? ? ? ? ? ?            2.401 ? 
metalc12 metalc ? ? A ASP 105 OD2   ? ? ? 1_555 H CA  .  CA ? ? A ASP 105 A CA  402 1_555 ? ? ? ? ? ? ?            2.409 ? 
metalc13 metalc ? ? J DCP .   O2A   ? ? ? 1_555 L CA  .  CA ? ? B DCP 401 B CA  403 1_555 ? ? ? ? ? ? ?            2.411 ? 
metalc14 metalc ? ? A GLU 106 OE1   ? ? ? 1_555 I CA  .  CA ? ? A GLU 106 A CA  403 1_555 ? ? ? ? ? ? ?            2.424 ? 
metalc15 metalc ? ? G DCP .   O1B   ? ? ? 1_555 H CA  .  CA ? ? A DCP 401 A CA  402 1_555 ? ? ? ? ? ? ?            2.426 ? 
metalc16 metalc ? ? D GLU 106 OE1   ? ? ? 1_555 L CA  .  CA ? ? B GLU 106 B CA  403 1_555 ? ? ? ? ? ? ?            2.432 ? 
metalc17 metalc ? ? J DCP .   O2A   ? ? ? 1_555 K CA  .  CA ? ? B DCP 401 B CA  402 1_555 ? ? ? ? ? ? ?            2.477 ? 
metalc18 metalc ? ? G DCP .   O2A   ? ? ? 1_555 H CA  .  CA ? ? A DCP 401 A CA  402 1_555 ? ? ? ? ? ? ?            2.502 ? 
metalc19 metalc ? ? D ASP 105 OD1   ? ? ? 1_555 L CA  .  CA ? ? B ASP 105 B CA  403 1_555 ? ? ? ? ? ? ?            2.604 ? 
metalc20 metalc ? ? E DC  13  "O3'" ? ? ? 1_555 L CA  .  CA ? ? E DC  13  B CA  403 1_555 ? ? ? ? ? ? ?            2.651 ? 
metalc21 metalc ? ? B DC  13  "O3'" ? ? ? 1_555 I CA  .  CA ? ? P DC  13  A CA  403 1_555 ? ? ? ? ? ? ?            2.778 ? 
metalc22 metalc ? ? A ASP 7   OD1   ? ? ? 1_555 I CA  .  CA ? ? A ASP 7   A CA  403 1_555 ? ? ? ? ? ? ?            2.811 ? 
metalc23 metalc ? ? A ASP 105 OD1   ? ? ? 1_555 I CA  .  CA ? ? A ASP 105 A CA  403 1_555 ? ? ? ? ? ? ?            2.833 ? 
metalc24 metalc ? ? D ASP 7   OD2   ? ? ? 1_555 L CA  .  CA ? ? B ASP 7   B CA  403 1_555 ? ? ? ? ? ? ?            2.854 ? 
metalc25 metalc ? ? A ASP 7   OD2   ? ? ? 1_555 I CA  .  CA ? ? A ASP 7   A CA  403 1_555 ? ? ? ? ? ? ?            3.065 ? 
metalc26 metalc ? ? K CA  .   CA    ? ? ? 1_555 P HOH .  O  ? ? B CA  402 B HOH 612 1_555 ? ? ? ? ? ? ?            3.139 ? 
metalc27 metalc ? ? D ASP 7   OD1   ? ? ? 1_555 L CA  .  CA ? ? B ASP 7   B CA  403 1_555 ? ? ? ? ? ? ?            3.146 ? 
hydrog1  hydrog ? ? B DG  1   N1    ? ? ? 1_555 C DC  18 N3 ? ? P DG  1   T DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DG  1   N2    ? ? ? 1_555 C DC  18 O2 ? ? P DG  1   T DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DG  1   O6    ? ? ? 1_555 C DC  18 N4 ? ? P DG  1   T DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DG  2   N1    ? ? ? 1_555 C DC  17 N3 ? ? P DG  2   T DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  2   N2    ? ? ? 1_555 C DC  17 O2 ? ? P DG  2   T DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  2   O6    ? ? ? 1_555 C DC  17 N4 ? ? P DG  2   T DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DC  3   N3    ? ? ? 1_555 C DG  16 N1 ? ? P DC  3   T DG  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DC  3   N4    ? ? ? 1_555 C DG  16 O6 ? ? P DC  3   T DG  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DC  3   O2    ? ? ? 1_555 C DG  16 N2 ? ? P DC  3   T DG  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DA  4   N1    ? ? ? 1_555 C DT  15 N3 ? ? P DA  4   T DT  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DA  4   N6    ? ? ? 1_555 C DT  15 O4 ? ? P DA  4   T DT  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  5   N3    ? ? ? 1_555 C DG  14 N1 ? ? P DC  5   T DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DC  5   N4    ? ? ? 1_555 C DG  14 O6 ? ? P DC  5   T DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DC  5   O2    ? ? ? 1_555 C DG  14 N2 ? ? P DC  5   T DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  13 N1 ? ? P DT  6   T DA  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  13 N6 ? ? P DT  6   T DA  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DG  7   N1    ? ? ? 1_555 C DC  12 N3 ? ? P DG  7   T DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DG  7   N2    ? ? ? 1_555 C DC  12 O2 ? ? P DG  7   T DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DG  7   O6    ? ? ? 1_555 C DC  12 N4 ? ? P DG  7   T DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  11 N3 ? ? P DA  8   T DT  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  11 O4 ? ? P DA  8   T DT  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DT  9   N3    ? ? ? 1_555 C DA  10 N1 ? ? P DT  9   T DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DT  9   O4    ? ? ? 1_555 C DA  10 N6 ? ? P DT  9   T DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DC  10  N3    ? ? ? 1_555 C DG  9  N1 ? ? P DC  10  T DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DC  10  N4    ? ? ? 1_555 C DG  9  O6 ? ? P DC  10  T DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DC  10  O2    ? ? ? 1_555 C DG  9  N2 ? ? P DC  10  T DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DG  11  N1    ? ? ? 1_555 C DC  8  N3 ? ? P DG  11  T DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? B DG  11  N2    ? ? ? 1_555 C DC  8  O2 ? ? P DG  11  T DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? B DG  11  O6    ? ? ? 1_555 C DC  8  N4 ? ? P DG  11  T DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? B DG  12  N1    ? ? ? 1_555 C DC  7  N3 ? ? P DG  12  T DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? B DG  12  N2    ? ? ? 1_555 C DC  7  O2 ? ? P DG  12  T DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? B DG  12  O6    ? ? ? 1_555 C DC  7  N4 ? ? P DG  12  T DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? B DC  13  N3    ? ? ? 1_555 C DG  6  N1 ? ? P DC  13  T DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? B DC  13  N4    ? ? ? 1_555 C DG  6  O6 ? ? P DC  13  T DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? B DC  13  O2    ? ? ? 1_555 C DG  6  N2 ? ? P DC  13  T DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? E DG  1   N1    ? ? ? 1_555 F DC  18 N3 ? ? E DG  1   F DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? E DG  1   N2    ? ? ? 1_555 F DC  18 O2 ? ? E DG  1   F DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? E DG  1   O6    ? ? ? 1_555 F DC  18 N4 ? ? E DG  1   F DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? E DG  2   N1    ? ? ? 1_555 F DC  17 N3 ? ? E DG  2   F DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? E DG  2   N2    ? ? ? 1_555 F DC  17 O2 ? ? E DG  2   F DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? E DG  2   O6    ? ? ? 1_555 F DC  17 N4 ? ? E DG  2   F DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? E DC  3   N3    ? ? ? 1_555 F DG  16 N1 ? ? E DC  3   F DG  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? E DC  3   N4    ? ? ? 1_555 F DG  16 O6 ? ? E DC  3   F DG  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? E DC  3   O2    ? ? ? 1_555 F DG  16 N2 ? ? E DC  3   F DG  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? E DA  4   N1    ? ? ? 1_555 F DT  15 N3 ? ? E DA  4   F DT  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? E DA  4   N6    ? ? ? 1_555 F DT  15 O4 ? ? E DA  4   F DT  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? E DC  5   N3    ? ? ? 1_555 F DG  14 N1 ? ? E DC  5   F DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? E DC  5   N4    ? ? ? 1_555 F DG  14 O6 ? ? E DC  5   F DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? E DC  5   O2    ? ? ? 1_555 F DG  14 N2 ? ? E DC  5   F DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? E DT  6   N3    ? ? ? 1_555 F DA  13 N1 ? ? E DT  6   F DA  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? E DT  6   O4    ? ? ? 1_555 F DA  13 N6 ? ? E DT  6   F DA  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ? ? E DG  7   N1    ? ? ? 1_555 F DC  12 N3 ? ? E DG  7   F DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ? ? E DG  7   N2    ? ? ? 1_555 F DC  12 O2 ? ? E DG  7   F DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ? ? E DG  7   O6    ? ? ? 1_555 F DC  12 N4 ? ? E DG  7   F DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ? ? E DA  8   N1    ? ? ? 1_555 F DT  11 N3 ? ? E DA  8   F DT  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ? ? E DA  8   N6    ? ? ? 1_555 F DT  11 O4 ? ? E DA  8   F DT  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ? ? E DT  9   N3    ? ? ? 1_555 F DA  10 N1 ? ? E DT  9   F DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58 hydrog ? ? E DT  9   O4    ? ? ? 1_555 F DA  10 N6 ? ? E DT  9   F DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59 hydrog ? ? E DC  10  N3    ? ? ? 1_555 F DG  9  N1 ? ? E DC  10  F DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60 hydrog ? ? E DC  10  N4    ? ? ? 1_555 F DG  9  O6 ? ? E DC  10  F DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61 hydrog ? ? E DC  10  O2    ? ? ? 1_555 F DG  9  N2 ? ? E DC  10  F DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62 hydrog ? ? E DG  11  N1    ? ? ? 1_555 F DC  8  N3 ? ? E DG  11  F DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63 hydrog ? ? E DG  11  N2    ? ? ? 1_555 F DC  8  O2 ? ? E DG  11  F DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64 hydrog ? ? E DG  11  O6    ? ? ? 1_555 F DC  8  N4 ? ? E DG  11  F DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65 hydrog ? ? E DG  12  N1    ? ? ? 1_555 F DC  7  N3 ? ? E DG  12  F DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66 hydrog ? ? E DG  12  N2    ? ? ? 1_555 F DC  7  O2 ? ? E DG  12  F DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67 hydrog ? ? E DG  12  O6    ? ? ? 1_555 F DC  7  N4 ? ? E DG  12  F DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68 hydrog ? ? E DC  13  N3    ? ? ? 1_555 F DG  6  N1 ? ? E DC  13  F DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69 hydrog ? ? E DC  13  N4    ? ? ? 1_555 F DG  6  O6 ? ? E DC  13  F DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog70 hydrog ? ? E DC  13  O2    ? ? ? 1_555 F DG  6  N2 ? ? E DC  13  F DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 160 A . ? LYS 160 A PRO 161 A ? PRO 161 A 1 -2.51 
2 LYS 160 D . ? LYS 160 B PRO 161 D ? PRO 161 B 1 -0.34 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 4 ? 
D ? 5 ? 
E ? 3 ? 
F ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 98  ? SER A 103 ? LYS A 98  SER A 103 
A 2 GLU A 106 ? ASP A 110 ? GLU A 106 ASP A 110 
A 3 VAL A 3   ? PHE A 8   ? VAL A 3   PHE A 8   
A 4 VAL A 141 ? ALA A 146 ? VAL A 141 ALA A 146 
A 5 LEU A 164 ? VAL A 166 ? LEU A 164 VAL A 166 
B 1 GLY A 41  ? ALA A 46  ? GLY A 41  ALA A 46  
B 2 LEU A 28  ? TYR A 33  ? LEU A 28  TYR A 33  
B 3 ILE A 72  ? PRO A 75  ? ILE A 72  PRO A 75  
C 1 SER A 245 ? SER A 256 ? SER A 245 SER A 256 
C 2 ILE A 331 ? PHE A 341 ? ILE A 331 PHE A 341 
C 3 PRO A 282 ? THR A 291 ? PRO A 282 THR A 291 
C 4 ILE A 296 ? THR A 302 ? ILE A 296 THR A 302 
D 1 LYS D 98  ? SER D 103 ? LYS B 98  SER B 103 
D 2 GLU D 106 ? ASP D 110 ? GLU B 106 ASP B 110 
D 3 VAL D 3   ? PHE D 8   ? VAL B 3   PHE B 8   
D 4 VAL D 141 ? ALA D 146 ? VAL B 141 ALA B 146 
D 5 LEU D 164 ? VAL D 166 ? LEU B 164 VAL B 166 
E 1 GLY D 41  ? ALA D 46  ? GLY B 41  ALA B 46  
E 2 LEU D 28  ? TYR D 33  ? LEU B 28  TYR B 33  
E 3 ILE D 72  ? PRO D 75  ? ILE B 72  PRO B 75  
F 1 SER D 245 ? SER D 256 ? SER B 245 SER B 256 
F 2 ILE D 331 ? PHE D 341 ? ILE B 331 PHE B 341 
F 3 PRO D 282 ? THR D 291 ? PRO B 282 THR B 291 
F 4 ILE D 296 ? THR D 302 ? ILE B 296 THR B 302 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 100 ? N GLU A 100 O TYR A 108 ? O TYR A 108 
A 2 3 O LEU A 109 ? O LEU A 109 N ILE A 4   ? N ILE A 4   
A 3 4 N VAL A 3   ? N VAL A 3   O ALA A 146 ? O ALA A 146 
A 4 5 N VAL A 143 ? N VAL A 143 O GLY A 165 ? O GLY A 165 
B 1 2 O ALA A 42  ? O ALA A 42  N VAL A 32  ? N VAL A 32  
B 2 3 N CYS A 31  ? N CYS A 31  O VAL A 74  ? O VAL A 74  
C 1 2 N MET A 252 ? N MET A 252 O ARG A 332 ? O ARG A 332 
C 2 3 O ARG A 332 ? O ARG A 332 N VAL A 290 ? N VAL A 290 
C 3 4 N ALA A 289 ? N ALA A 289 O VAL A 297 ? O VAL A 297 
D 1 2 N GLU D 100 ? N GLU B 100 O TYR D 108 ? O TYR B 108 
D 2 3 O LEU D 109 ? O LEU B 109 N ILE D 4   ? N ILE B 4   
D 3 4 N VAL D 3   ? N VAL B 3   O ALA D 146 ? O ALA B 146 
D 4 5 N VAL D 143 ? N VAL B 143 O GLY D 165 ? O GLY B 165 
E 1 2 O ALA D 42  ? O ALA B 42  N VAL D 32  ? N VAL B 32  
E 2 3 N CYS D 31  ? N CYS B 31  O VAL D 74  ? O VAL B 74  
F 1 2 N ILE D 246 ? N ILE B 246 O PHE D 338 ? O PHE B 338 
F 2 3 O ARG D 332 ? O ARG B 332 N VAL D 290 ? N VAL B 290 
F 3 4 N ALA D 289 ? N ALA B 289 O VAL D 297 ? O VAL B 297 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE DCP A 401' 
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 402'  
AC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CA A 403'  
AC4 Software ? ? ? ? 26 'BINDING SITE FOR RESIDUE DCP B 401' 
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA B 402'  
AC6 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CA B 403'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 23 ASP A 7   ? ASP A 7   . ? 1_555 ? 
2  AC1 23 PHE A 8   ? PHE A 8   . ? 1_555 ? 
3  AC1 23 ASP A 9   ? ASP A 9   . ? 1_555 ? 
4  AC1 23 TYR A 10  ? TYR A 10  . ? 1_555 ? 
5  AC1 23 PHE A 11  ? PHE A 11  . ? 1_555 ? 
6  AC1 23 PHE A 12  ? PHE A 12  . ? 1_555 ? 
7  AC1 23 ALA A 44  ? ALA A 44  . ? 1_555 ? 
8  AC1 23 THR A 45  ? THR A 45  . ? 1_555 ? 
9  AC1 23 TYR A 48  ? TYR A 48  . ? 1_555 ? 
10 AC1 23 ARG A 51  ? ARG A 51  . ? 1_555 ? 
11 AC1 23 ASP A 105 ? ASP A 105 . ? 1_555 ? 
12 AC1 23 LYS A 160 ? LYS A 160 . ? 1_555 ? 
13 AC1 23 CA  H .   ? CA  A 402 . ? 1_555 ? 
14 AC1 23 CA  I .   ? CA  A 403 . ? 1_555 ? 
15 AC1 23 HOH M .   ? HOH A 510 . ? 1_555 ? 
16 AC1 23 HOH M .   ? HOH A 529 . ? 1_555 ? 
17 AC1 23 HOH M .   ? HOH A 531 . ? 1_555 ? 
18 AC1 23 HOH M .   ? HOH A 554 . ? 1_555 ? 
19 AC1 23 HOH M .   ? HOH A 570 . ? 1_555 ? 
20 AC1 23 HOH M .   ? HOH A 647 . ? 1_555 ? 
21 AC1 23 HOH M .   ? HOH A 651 . ? 1_555 ? 
22 AC1 23 DC  B 13  ? DC  P 13  . ? 1_555 ? 
23 AC1 23 DG  C 5   ? DG  T 5   . ? 1_555 ? 
24 AC2 5  ASP A 7   ? ASP A 7   . ? 1_555 ? 
25 AC2 5  PHE A 8   ? PHE A 8   . ? 1_555 ? 
26 AC2 5  ASP A 105 ? ASP A 105 . ? 1_555 ? 
27 AC2 5  DCP G .   ? DCP A 401 . ? 1_555 ? 
28 AC2 5  CA  I .   ? CA  A 403 . ? 1_555 ? 
29 AC3 7  ASP A 7   ? ASP A 7   . ? 1_555 ? 
30 AC3 7  ASP A 105 ? ASP A 105 . ? 1_555 ? 
31 AC3 7  GLU A 106 ? GLU A 106 . ? 1_555 ? 
32 AC3 7  DCP G .   ? DCP A 401 . ? 1_555 ? 
33 AC3 7  CA  H .   ? CA  A 402 . ? 1_555 ? 
34 AC3 7  HOH M .   ? HOH A 510 . ? 1_555 ? 
35 AC3 7  DC  B 13  ? DC  P 13  . ? 1_555 ? 
36 AC4 26 ASP D 7   ? ASP B 7   . ? 1_555 ? 
37 AC4 26 PHE D 8   ? PHE B 8   . ? 1_555 ? 
38 AC4 26 ASP D 9   ? ASP B 9   . ? 1_555 ? 
39 AC4 26 TYR D 10  ? TYR B 10  . ? 1_555 ? 
40 AC4 26 PHE D 11  ? PHE B 11  . ? 1_555 ? 
41 AC4 26 PHE D 12  ? PHE B 12  . ? 1_555 ? 
42 AC4 26 ALA D 44  ? ALA B 44  . ? 1_555 ? 
43 AC4 26 THR D 45  ? THR B 45  . ? 1_555 ? 
44 AC4 26 TYR D 48  ? TYR B 48  . ? 1_555 ? 
45 AC4 26 ARG D 51  ? ARG B 51  . ? 1_555 ? 
46 AC4 26 ASP D 105 ? ASP B 105 . ? 1_555 ? 
47 AC4 26 LYS D 160 ? LYS B 160 . ? 1_555 ? 
48 AC4 26 CA  K .   ? CA  B 402 . ? 1_555 ? 
49 AC4 26 CA  L .   ? CA  B 403 . ? 1_555 ? 
50 AC4 26 HOH P .   ? HOH B 512 . ? 1_555 ? 
51 AC4 26 HOH P .   ? HOH B 527 . ? 1_555 ? 
52 AC4 26 HOH P .   ? HOH B 535 . ? 1_555 ? 
53 AC4 26 HOH P .   ? HOH B 551 . ? 1_555 ? 
54 AC4 26 HOH P .   ? HOH B 568 . ? 1_555 ? 
55 AC4 26 HOH P .   ? HOH B 608 . ? 1_555 ? 
56 AC4 26 HOH P .   ? HOH B 612 . ? 1_555 ? 
57 AC4 26 HOH P .   ? HOH B 696 . ? 1_555 ? 
58 AC4 26 DC  E 13  ? DC  E 13  . ? 1_555 ? 
59 AC4 26 HOH Q .   ? HOH E 145 . ? 1_555 ? 
60 AC4 26 DG  F 5   ? DG  F 5   . ? 1_555 ? 
61 AC4 26 DG  F 6   ? DG  F 6   . ? 1_555 ? 
62 AC5 5  ASP D 7   ? ASP B 7   . ? 1_555 ? 
63 AC5 5  PHE D 8   ? PHE B 8   . ? 1_555 ? 
64 AC5 5  ASP D 105 ? ASP B 105 . ? 1_555 ? 
65 AC5 5  DCP J .   ? DCP B 401 . ? 1_555 ? 
66 AC5 5  CA  L .   ? CA  B 403 . ? 1_555 ? 
67 AC6 7  ASP D 7   ? ASP B 7   . ? 1_555 ? 
68 AC6 7  ASP D 105 ? ASP B 105 . ? 1_555 ? 
69 AC6 7  GLU D 106 ? GLU B 106 . ? 1_555 ? 
70 AC6 7  DCP J .   ? DCP B 401 . ? 1_555 ? 
71 AC6 7  CA  K .   ? CA  B 402 . ? 1_555 ? 
72 AC6 7  HOH P .   ? HOH B 512 . ? 1_555 ? 
73 AC6 7  DC  E 13  ? DC  E 13  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4F4W 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4F4W 
_atom_sites.fract_transf_matrix[1][1]   0.018932 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000053 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010035 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009840 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
H  
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . MET A 1 1   ? -9.670  -48.448 -43.168 1.00 57.01 ? 1   MET A N     1 
ATOM   2     C  CA    . MET A 1 1   ? -9.596  -47.252 -42.276 1.00 50.14 ? 1   MET A CA    1 
ATOM   3     C  C     . MET A 1 1   ? -10.979 -46.912 -41.716 1.00 35.76 ? 1   MET A C     1 
ATOM   4     O  O     . MET A 1 1   ? -11.974 -46.969 -42.422 1.00 33.36 ? 1   MET A O     1 
ATOM   5     C  CB    . MET A 1 1   ? -9.041  -46.060 -43.054 1.00 44.43 ? 1   MET A CB    1 
ATOM   6     C  CG    . MET A 1 1   ? -8.576  -44.889 -42.205 1.00 52.84 ? 1   MET A CG    1 
ATOM   7     S  SD    . MET A 1 1   ? -8.221  -43.407 -43.199 1.00 60.71 ? 1   MET A SD    1 
ATOM   8     C  CE    . MET A 1 1   ? -7.680  -44.131 -44.750 1.00 58.84 ? 1   MET A CE    1 
ATOM   9     H  H1    . MET A 1 1   ? -9.161  -48.285 -43.965 1.00 68.35 ? 1   MET A H1    1 
ATOM   10    H  H2    . MET A 1 1   ? -9.311  -49.212 -42.710 1.00 68.35 ? 1   MET A H2    1 
ATOM   11    H  H3    . MET A 1 1   ? -10.586 -48.616 -43.401 1.00 68.35 ? 1   MET A H3    1 
ATOM   12    H  HA    . MET A 1 1   ? -8.986  -47.443 -41.533 1.00 60.11 ? 1   MET A HA    1 
ATOM   13    H  HB2   . MET A 1 1   ? -8.281  -46.361 -43.576 1.00 53.26 ? 1   MET A HB2   1 
ATOM   14    H  HB3   . MET A 1 1   ? -9.733  -45.732 -43.649 1.00 53.26 ? 1   MET A HB3   1 
ATOM   15    H  HG2   . MET A 1 1   ? -9.272  -44.664 -41.568 1.00 63.35 ? 1   MET A HG2   1 
ATOM   16    H  HG3   . MET A 1 1   ? -7.765  -45.139 -41.737 1.00 63.35 ? 1   MET A HG3   1 
ATOM   17    H  HE1   . MET A 1 1   ? -7.461  -43.426 -45.364 1.00 70.54 ? 1   MET A HE1   1 
ATOM   18    H  HE2   . MET A 1 1   ? -6.906  -44.675 -44.586 1.00 70.54 ? 1   MET A HE2   1 
ATOM   19    H  HE3   . MET A 1 1   ? -8.390  -44.669 -45.107 1.00 70.54 ? 1   MET A HE3   1 
ATOM   20    N  N     . ILE A 1 2   ? -11.036 -46.576 -40.434 1.00 35.13 ? 2   ILE A N     1 
ATOM   21    C  CA    . ILE A 1 2   ? -12.262 -46.073 -39.849 1.00 25.24 ? 2   ILE A CA    1 
ATOM   22    C  C     . ILE A 1 2   ? -11.959 -44.678 -39.309 1.00 31.59 ? 2   ILE A C     1 
ATOM   23    O  O     . ILE A 1 2   ? -11.054 -44.508 -38.499 1.00 27.53 ? 2   ILE A O     1 
ATOM   24    C  CB    . ILE A 1 2   ? -12.783 -46.995 -38.743 1.00 32.41 ? 2   ILE A CB    1 
ATOM   25    C  CG1   . ILE A 1 2   ? -13.216 -48.327 -39.343 1.00 35.71 ? 2   ILE A CG1   1 
ATOM   26    C  CG2   . ILE A 1 2   ? -13.974 -46.387 -38.048 1.00 32.25 ? 2   ILE A CG2   1 
ATOM   27    C  CD1   . ILE A 1 2   ? -13.465 -49.395 -38.299 1.00 42.96 ? 2   ILE A CD1   1 
ATOM   28    H  H     . ILE A 1 2   ? -10.377 -46.632 -39.884 1.00 42.09 ? 2   ILE A H     1 
ATOM   29    H  HA    . ILE A 1 2   ? -12.950 -45.997 -40.542 1.00 30.23 ? 2   ILE A HA    1 
ATOM   30    H  HB    . ILE A 1 2   ? -12.078 -47.150 -38.095 1.00 38.83 ? 2   ILE A HB    1 
ATOM   31    H  HG12  . ILE A 1 2   ? -14.039 -48.197 -39.839 1.00 42.80 ? 2   ILE A HG12  1 
ATOM   32    H  HG13  . ILE A 1 2   ? -12.519 -48.647 -39.937 1.00 42.80 ? 2   ILE A HG13  1 
ATOM   33    H  HG21  . ILE A 1 2   ? -14.276 -46.987 -37.363 1.00 38.64 ? 2   ILE A HG21  1 
ATOM   34    H  HG22  . ILE A 1 2   ? -13.713 -45.549 -37.658 1.00 38.64 ? 2   ILE A HG22  1 
ATOM   35    H  HG23  . ILE A 1 2   ? -14.672 -46.245 -38.692 1.00 38.64 ? 2   ILE A HG23  1 
ATOM   36    H  HD11  . ILE A 1 2   ? -12.656 -49.543 -37.805 1.00 51.49 ? 2   ILE A HD11  1 
ATOM   37    H  HD12  . ILE A 1 2   ? -14.161 -49.097 -37.708 1.00 51.49 ? 2   ILE A HD12  1 
ATOM   38    H  HD13  . ILE A 1 2   ? -13.733 -50.205 -38.739 1.00 51.49 ? 2   ILE A HD13  1 
ATOM   39    N  N     . VAL A 1 3   ? -12.699 -43.688 -39.802 1.00 29.32 ? 3   VAL A N     1 
ATOM   40    C  CA    . VAL A 1 3   ? -12.469 -42.295 -39.444 1.00 29.35 ? 3   VAL A CA    1 
ATOM   41    C  C     . VAL A 1 3   ? -13.650 -41.717 -38.656 1.00 26.37 ? 3   VAL A C     1 
ATOM   42    O  O     . VAL A 1 3   ? -14.797 -41.929 -39.001 1.00 23.89 ? 3   VAL A O     1 
ATOM   43    C  CB    . VAL A 1 3   ? -12.280 -41.406 -40.698 1.00 29.44 ? 3   VAL A CB    1 
ATOM   44    C  CG1   . VAL A 1 3   ? -12.122 -39.933 -40.272 1.00 29.41 ? 3   VAL A CG1   1 
ATOM   45    C  CG2   . VAL A 1 3   ? -11.076 -41.865 -41.528 1.00 32.90 ? 3   VAL A CG2   1 
ATOM   46    H  H     . VAL A 1 3   ? -13.348 -43.801 -40.354 1.00 35.12 ? 3   VAL A H     1 
ATOM   47    H  HA    . VAL A 1 3   ? -11.663 -42.228 -38.890 1.00 35.16 ? 3   VAL A HA    1 
ATOM   48    H  HB    . VAL A 1 3   ? -13.079 -41.474 -41.261 1.00 35.27 ? 3   VAL A HB    1 
ATOM   49    H  HG11  . VAL A 1 3   ? -12.005 -39.392 -41.056 1.00 35.24 ? 3   VAL A HG11  1 
ATOM   50    H  HG12  . VAL A 1 3   ? -12.910 -39.659 -39.799 1.00 35.24 ? 3   VAL A HG12  1 
ATOM   51    H  HG13  . VAL A 1 3   ? -11.353 -39.854 -39.702 1.00 35.24 ? 3   VAL A HG13  1 
ATOM   52    H  HG21  . VAL A 1 3   ? -10.673 -42.623 -41.099 1.00 39.42 ? 3   VAL A HG21  1 
ATOM   53    H  HG22  . VAL A 1 3   ? -11.377 -42.107 -42.407 1.00 39.42 ? 3   VAL A HG22  1 
ATOM   54    H  HG23  . VAL A 1 3   ? -10.443 -41.145 -41.584 1.00 39.42 ? 3   VAL A HG23  1 
ATOM   55    N  N     . ILE A 1 4   ? -13.357 -40.962 -37.602 1.00 22.18 ? 4   ILE A N     1 
ATOM   56    C  CA    . ILE A 1 4   ? -14.374 -40.200 -36.884 1.00 23.14 ? 4   ILE A CA    1 
ATOM   57    C  C     . ILE A 1 4   ? -14.026 -38.731 -37.027 1.00 18.97 ? 4   ILE A C     1 
ATOM   58    O  O     . ILE A 1 4   ? -12.937 -38.332 -36.639 1.00 23.37 ? 4   ILE A O     1 
ATOM   59    C  CB    . ILE A 1 4   ? -14.415 -40.553 -35.377 1.00 27.07 ? 4   ILE A CB    1 
ATOM   60    C  CG1   . ILE A 1 4   ? -14.745 -42.031 -35.175 1.00 25.29 ? 4   ILE A CG1   1 
ATOM   61    C  CG2   . ILE A 1 4   ? -15.484 -39.703 -34.655 1.00 26.33 ? 4   ILE A CG2   1 
ATOM   62    C  CD1   . ILE A 1 4   ? -14.790 -42.464 -33.704 1.00 35.91 ? 4   ILE A CD1   1 
ATOM   63    H  H     . ILE A 1 4   ? -12.565 -40.874 -37.279 1.00 26.55 ? 4   ILE A H     1 
ATOM   64    H  HA    . ILE A 1 4   ? -15.257 -40.361 -37.277 1.00 27.70 ? 4   ILE A HA    1 
ATOM   65    H  HB    . ILE A 1 4   ? -13.547 -40.366 -34.985 1.00 32.42 ? 4   ILE A HB    1 
ATOM   66    H  HG12  . ILE A 1 4   ? -15.615 -42.213 -35.564 1.00 30.29 ? 4   ILE A HG12  1 
ATOM   67    H  HG13  . ILE A 1 4   ? -14.068 -42.565 -35.620 1.00 30.29 ? 4   ILE A HG13  1 
ATOM   68    H  HG21  . ILE A 1 4   ? -15.266 -38.774 -34.758 1.00 31.53 ? 4   ILE A HG21  1 
ATOM   69    H  HG22  . ILE A 1 4   ? -16.342 -39.883 -35.047 1.00 31.53 ? 4   ILE A HG22  1 
ATOM   70    H  HG23  . ILE A 1 4   ? -15.493 -39.938 -33.725 1.00 31.53 ? 4   ILE A HG23  1 
ATOM   71    H  HD11  . ILE A 1 4   ? -13.932 -42.303 -33.305 1.00 43.04 ? 4   ILE A HD11  1 
ATOM   72    H  HD12  . ILE A 1 4   ? -15.464 -41.953 -33.249 1.00 43.04 ? 4   ILE A HD12  1 
ATOM   73    H  HD13  . ILE A 1 4   ? -15.001 -43.399 -33.660 1.00 43.04 ? 4   ILE A HD13  1 
ATOM   74    N  N     . PHE A 1 5   ? -14.941 -37.950 -37.616 1.00 22.20 ? 5   PHE A N     1 
ATOM   75    C  CA    . PHE A 1 5   ? -14.758 -36.512 -37.773 1.00 20.78 ? 5   PHE A CA    1 
ATOM   76    C  C     . PHE A 1 5   ? -15.640 -35.812 -36.745 1.00 22.84 ? 5   PHE A C     1 
ATOM   77    O  O     . PHE A 1 5   ? -16.791 -36.201 -36.541 1.00 21.48 ? 5   PHE A O     1 
ATOM   78    C  CB    . PHE A 1 5   ? -15.112 -36.090 -39.221 1.00 20.70 ? 5   PHE A CB    1 
ATOM   79    C  CG    . PHE A 1 5   ? -15.192 -34.602 -39.428 1.00 17.90 ? 5   PHE A CG    1 
ATOM   80    C  CD1   . PHE A 1 5   ? -14.024 -33.840 -39.521 1.00 21.26 ? 5   PHE A CD1   1 
ATOM   81    C  CD2   . PHE A 1 5   ? -16.408 -33.964 -39.547 1.00 22.27 ? 5   PHE A CD2   1 
ATOM   82    C  CE1   . PHE A 1 5   ? -14.095 -32.479 -39.708 1.00 19.48 ? 5   PHE A CE1   1 
ATOM   83    C  CE2   . PHE A 1 5   ? -16.479 -32.592 -39.741 1.00 21.96 ? 5   PHE A CE2   1 
ATOM   84    C  CZ    . PHE A 1 5   ? -15.314 -31.856 -39.813 1.00 21.44 ? 5   PHE A CZ    1 
ATOM   85    H  H     . PHE A 1 5   ? -15.684 -38.240 -37.936 1.00 26.58 ? 5   PHE A H     1 
ATOM   86    H  HA    . PHE A 1 5   ? -13.824 -36.276 -37.597 1.00 24.87 ? 5   PHE A HA    1 
ATOM   87    H  HB2   . PHE A 1 5   ? -14.433 -36.436 -39.820 1.00 24.78 ? 5   PHE A HB2   1 
ATOM   88    H  HB3   . PHE A 1 5   ? -15.976 -36.467 -39.452 1.00 24.78 ? 5   PHE A HB3   1 
ATOM   89    H  HD1   . PHE A 1 5   ? -13.195 -34.253 -39.442 1.00 25.45 ? 5   PHE A HD1   1 
ATOM   90    H  HD2   . PHE A 1 5   ? -17.192 -34.460 -39.490 1.00 26.66 ? 5   PHE A HD2   1 
ATOM   91    H  HE1   . PHE A 1 5   ? -13.313 -31.979 -39.764 1.00 23.32 ? 5   PHE A HE1   1 
ATOM   92    H  HE2   . PHE A 1 5   ? -17.305 -32.171 -39.813 1.00 26.29 ? 5   PHE A HE2   1 
ATOM   93    H  HZ    . PHE A 1 5   ? -15.354 -30.937 -39.947 1.00 25.67 ? 5   PHE A HZ    1 
ATOM   94    N  N     . VAL A 1 6   ? -15.088 -34.797 -36.080 1.00 19.08 ? 6   VAL A N     1 
ATOM   95    C  CA    . VAL A 1 6   ? -15.815 -34.064 -35.059 1.00 16.85 ? 6   VAL A CA    1 
ATOM   96    C  C     . VAL A 1 6   ? -15.777 -32.567 -35.372 1.00 17.90 ? 6   VAL A C     1 
ATOM   97    O  O     . VAL A 1 6   ? -14.716 -32.007 -35.657 1.00 18.73 ? 6   VAL A O     1 
ATOM   98    C  CB    . VAL A 1 6   ? -15.210 -34.280 -33.638 1.00 18.14 ? 6   VAL A CB    1 
ATOM   99    C  CG1   . VAL A 1 6   ? -16.132 -33.700 -32.581 1.00 18.72 ? 6   VAL A CG1   1 
ATOM   100   C  CG2   . VAL A 1 6   ? -14.916 -35.750 -33.382 1.00 17.48 ? 6   VAL A CG2   1 
ATOM   101   H  H     . VAL A 1 6   ? -14.286 -34.514 -36.208 1.00 22.83 ? 6   VAL A H     1 
ATOM   102   H  HA    . VAL A 1 6   ? -16.750 -34.357 -35.048 1.00 20.15 ? 6   VAL A HA    1 
ATOM   103   H  HB    . VAL A 1 6   ? -14.360 -33.795 -33.585 1.00 21.70 ? 6   VAL A HB    1 
ATOM   104   H  HG11  . VAL A 1 6   ? -15.743 -33.842 -31.715 1.00 22.40 ? 6   VAL A HG11  1 
ATOM   105   H  HG12  . VAL A 1 6   ? -16.239 -32.759 -32.742 1.00 22.40 ? 6   VAL A HG12  1 
ATOM   106   H  HG13  . VAL A 1 6   ? -16.984 -34.140 -32.634 1.00 22.40 ? 6   VAL A HG13  1 
ATOM   107   H  HG21  . VAL A 1 6   ? -14.547 -35.846 -32.502 1.00 20.92 ? 6   VAL A HG21  1 
ATOM   108   H  HG22  . VAL A 1 6   ? -15.734 -36.248 -33.451 1.00 20.92 ? 6   VAL A HG22  1 
ATOM   109   H  HG23  . VAL A 1 6   ? -14.287 -36.061 -34.038 1.00 20.92 ? 6   VAL A HG23  1 
ATOM   110   N  N     . ASP A 1 7   ? -16.940 -31.934 -35.324 1.00 16.48 ? 7   ASP A N     1 
ATOM   111   C  CA    . ASP A 1 7   ? -17.090 -30.527 -35.672 1.00 17.25 ? 7   ASP A CA    1 
ATOM   112   C  C     . ASP A 1 7   ? -17.978 -29.898 -34.596 1.00 14.13 ? 7   ASP A C     1 
ATOM   113   O  O     . ASP A 1 7   ? -19.122 -30.337 -34.407 1.00 16.92 ? 7   ASP A O     1 
ATOM   114   C  CB    . ASP A 1 7   ? -17.724 -30.424 -37.043 1.00 18.59 ? 7   ASP A CB    1 
ATOM   115   C  CG    . ASP A 1 7   ? -17.694 -29.005 -37.605 1.00 31.91 ? 7   ASP A CG    1 
ATOM   116   O  OD1   . ASP A 1 7   ? -17.453 -28.818 -38.813 1.00 32.37 ? 7   ASP A OD1   1 
ATOM   117   O  OD2   . ASP A 1 7   ? -17.954 -28.082 -36.856 1.00 27.13 ? 7   ASP A OD2   1 
ATOM   118   H  H     . ASP A 1 7   ? -17.678 -32.308 -35.086 1.00 19.72 ? 7   ASP A H     1 
ATOM   119   H  HA    . ASP A 1 7   ? -16.217 -30.080 -35.680 1.00 20.64 ? 7   ASP A HA    1 
ATOM   120   H  HB2   . ASP A 1 7   ? -17.243 -31.000 -37.657 1.00 22.25 ? 7   ASP A HB2   1 
ATOM   121   H  HB3   . ASP A 1 7   ? -18.651 -30.703 -36.983 1.00 22.25 ? 7   ASP A HB3   1 
ATOM   122   N  N     . PHE A 1 8   ? -17.457 -28.916 -33.849 1.00 17.67 ? 8   PHE A N     1 
ATOM   123   C  CA    . PHE A 1 8   ? -18.174 -28.429 -32.659 1.00 15.92 ? 8   PHE A CA    1 
ATOM   124   C  C     . PHE A 1 8   ? -19.391 -27.591 -33.098 1.00 18.21 ? 8   PHE A C     1 
ATOM   125   O  O     . PHE A 1 8   ? -19.288 -26.808 -34.015 1.00 17.35 ? 8   PHE A O     1 
ATOM   126   C  CB    . PHE A 1 8   ? -17.259 -27.579 -31.747 1.00 16.18 ? 8   PHE A CB    1 
ATOM   127   C  CG    . PHE A 1 8   ? -15.947 -28.235 -31.379 1.00 16.06 ? 8   PHE A CG    1 
ATOM   128   C  CD1   . PHE A 1 8   ? -14.854 -27.455 -31.033 1.00 16.19 ? 8   PHE A CD1   1 
ATOM   129   C  CD2   . PHE A 1 8   ? -15.796 -29.602 -31.392 1.00 15.37 ? 8   PHE A CD2   1 
ATOM   130   C  CE1   . PHE A 1 8   ? -13.631 -28.037 -30.698 1.00 21.01 ? 8   PHE A CE1   1 
ATOM   131   C  CE2   . PHE A 1 8   ? -14.583 -30.186 -31.054 1.00 16.95 ? 8   PHE A CE2   1 
ATOM   132   C  CZ    . PHE A 1 8   ? -13.505 -29.405 -30.714 1.00 19.40 ? 8   PHE A CZ    1 
ATOM   133   H  H     . PHE A 1 8   ? -16.709 -28.522 -34.004 1.00 21.14 ? 8   PHE A H     1 
ATOM   134   H  HA    . PHE A 1 8   ? -18.498 -29.195 -32.141 1.00 19.05 ? 8   PHE A HA    1 
ATOM   135   H  HB2   . PHE A 1 8   ? -17.053 -26.748 -32.202 1.00 19.36 ? 8   PHE A HB2   1 
ATOM   136   H  HB3   . PHE A 1 8   ? -17.734 -27.390 -30.922 1.00 19.36 ? 8   PHE A HB3   1 
ATOM   137   H  HD1   . PHE A 1 8   ? -14.938 -26.529 -31.024 1.00 19.37 ? 8   PHE A HD1   1 
ATOM   138   H  HD2   . PHE A 1 8   ? -16.518 -30.141 -31.622 1.00 18.39 ? 8   PHE A HD2   1 
ATOM   139   H  HE1   . PHE A 1 8   ? -12.906 -27.502 -30.465 1.00 25.15 ? 8   PHE A HE1   1 
ATOM   140   H  HE2   . PHE A 1 8   ? -14.497 -31.112 -31.067 1.00 20.28 ? 8   PHE A HE2   1 
ATOM   141   H  HZ    . PHE A 1 8   ? -12.694 -29.802 -30.489 1.00 23.22 ? 8   PHE A HZ    1 
ATOM   142   N  N     . ASP A 1 9   ? -20.548 -27.713 -32.452 1.00 15.21 ? 9   ASP A N     1 
ATOM   143   C  CA    . ASP A 1 9   ? -21.701 -26.929 -32.930 1.00 18.82 ? 9   ASP A CA    1 
ATOM   144   C  C     . ASP A 1 9   ? -21.590 -25.428 -32.591 1.00 15.02 ? 9   ASP A C     1 
ATOM   145   O  O     . ASP A 1 9   ? -21.264 -25.079 -31.470 1.00 14.86 ? 9   ASP A O     1 
ATOM   146   C  CB    . ASP A 1 9   ? -23.015 -27.460 -32.335 1.00 19.32 ? 9   ASP A CB    1 
ATOM   147   C  CG    . ASP A 1 9   ? -23.315 -28.893 -32.743 1.00 26.75 ? 9   ASP A CG    1 
ATOM   148   O  OD1   . ASP A 1 9   ? -23.968 -29.593 -31.932 1.00 29.24 ? 9   ASP A OD1   1 
ATOM   149   O  OD2   . ASP A 1 9   ? -22.890 -29.314 -33.845 1.00 21.97 ? 9   ASP A OD2   1 
ATOM   150   H  H     . ASP A 1 9   ? -20.696 -28.214 -31.769 1.00 18.19 ? 9   ASP A H     1 
ATOM   151   H  HA    . ASP A 1 9   ? -21.757 -27.013 -33.905 1.00 22.52 ? 9   ASP A HA    1 
ATOM   152   H  HB2   . ASP A 1 9   ? -22.956 -27.430 -31.367 1.00 23.12 ? 9   ASP A HB2   1 
ATOM   153   H  HB3   . ASP A 1 9   ? -23.747 -26.902 -32.640 1.00 23.12 ? 9   ASP A HB3   1 
ATOM   154   N  N     . TYR A 1 10  ? -21.908 -24.571 -33.567 1.00 15.35 ? 10  TYR A N     1 
ATOM   155   C  CA    . TYR A 1 10  ? -21.959 -23.093 -33.430 1.00 15.35 ? 10  TYR A CA    1 
ATOM   156   C  C     . TYR A 1 10  ? -20.930 -22.593 -32.436 1.00 14.65 ? 10  TYR A C     1 
ATOM   157   O  O     . TYR A 1 10  ? -21.245 -21.875 -31.454 1.00 13.17 ? 10  TYR A O     1 
ATOM   158   C  CB    . TYR A 1 10  ? -23.393 -22.563 -33.138 1.00 16.05 ? 10  TYR A CB    1 
ATOM   159   C  CG    . TYR A 1 10  ? -24.058 -22.961 -31.819 1.00 18.15 ? 10  TYR A CG    1 
ATOM   160   C  CD1   . TYR A 1 10  ? -24.230 -22.045 -30.805 1.00 18.51 ? 10  TYR A CD1   1 
ATOM   161   C  CD2   . TYR A 1 10  ? -24.579 -24.242 -31.635 1.00 23.30 ? 10  TYR A CD2   1 
ATOM   162   C  CE1   . TYR A 1 10  ? -24.879 -22.401 -29.602 1.00 19.69 ? 10  TYR A CE1   1 
ATOM   163   C  CE2   . TYR A 1 10  ? -25.200 -24.610 -30.445 1.00 22.31 ? 10  TYR A CE2   1 
ATOM   164   C  CZ    . TYR A 1 10  ? -25.344 -23.690 -29.442 1.00 20.60 ? 10  TYR A CZ    1 
ATOM   165   O  OH    . TYR A 1 10  ? -25.981 -24.040 -28.281 1.00 20.30 ? 10  TYR A OH    1 
ATOM   166   H  H     . TYR A 1 10  ? -22.109 -24.830 -34.362 1.00 18.36 ? 10  TYR A H     1 
ATOM   167   H  HA    . TYR A 1 10  ? -21.703 -22.715 -34.297 1.00 18.35 ? 10  TYR A HA    1 
ATOM   168   H  HB2   . TYR A 1 10  ? -23.361 -21.594 -33.155 1.00 19.20 ? 10  TYR A HB2   1 
ATOM   169   H  HB3   . TYR A 1 10  ? -23.974 -22.872 -33.850 1.00 19.20 ? 10  TYR A HB3   1 
ATOM   170   H  HD1   . TYR A 1 10  ? -23.908 -21.179 -30.912 1.00 22.15 ? 10  TYR A HD1   1 
ATOM   171   H  HD2   . TYR A 1 10  ? -24.477 -24.875 -32.309 1.00 27.90 ? 10  TYR A HD2   1 
ATOM   172   H  HE1   . TYR A 1 10  ? -24.975 -21.779 -28.917 1.00 23.57 ? 10  TYR A HE1   1 
ATOM   173   H  HE2   . TYR A 1 10  ? -25.531 -25.473 -30.338 1.00 26.71 ? 10  TYR A HE2   1 
ATOM   174   H  HH    . TYR A 1 10  ? -25.575 -24.648 -27.910 1.00 24.30 ? 10  TYR A HH    1 
ATOM   175   N  N     . PHE A 1 11  ? -19.682 -22.996 -32.705 1.00 14.23 ? 11  PHE A N     1 
ATOM   176   C  CA    . PHE A 1 11  ? -18.676 -23.088 -31.628 1.00 12.41 ? 11  PHE A CA    1 
ATOM   177   C  C     . PHE A 1 11  ? -18.525 -21.857 -30.729 1.00 17.16 ? 11  PHE A C     1 
ATOM   178   O  O     . PHE A 1 11  ? -18.735 -21.952 -29.505 1.00 15.78 ? 11  PHE A O     1 
ATOM   179   C  CB    . PHE A 1 11  ? -17.328 -23.573 -32.172 1.00 11.59 ? 11  PHE A CB    1 
ATOM   180   C  CG    . PHE A 1 11  ? -16.310 -23.811 -31.093 1.00 13.34 ? 11  PHE A CG    1 
ATOM   181   C  CD1   . PHE A 1 11  ? -16.650 -24.511 -29.924 1.00 16.93 ? 11  PHE A CD1   1 
ATOM   182   C  CD2   . PHE A 1 11  ? -15.003 -23.374 -31.250 1.00 15.20 ? 11  PHE A CD2   1 
ATOM   183   C  CE1   . PHE A 1 11  ? -15.704 -24.722 -28.922 1.00 15.86 ? 11  PHE A CE1   1 
ATOM   184   C  CE2   . PHE A 1 11  ? -14.046 -23.598 -30.248 1.00 13.68 ? 11  PHE A CE2   1 
ATOM   185   C  CZ    . PHE A 1 11  ? -14.404 -24.272 -29.089 1.00 18.36 ? 11  PHE A CZ    1 
ATOM   186   H  H     . PHE A 1 11  ? -19.393 -23.218 -33.484 1.00 17.01 ? 11  PHE A H     1 
ATOM   187   H  HA    . PHE A 1 11  ? -18.984 -23.801 -31.031 1.00 14.83 ? 11  PHE A HA    1 
ATOM   188   H  HB2   . PHE A 1 11  ? -17.461 -24.409 -32.646 1.00 13.84 ? 11  PHE A HB2   1 
ATOM   189   H  HB3   . PHE A 1 11  ? -16.972 -22.903 -32.776 1.00 13.84 ? 11  PHE A HB3   1 
ATOM   190   H  HD1   . PHE A 1 11  ? -17.522 -24.809 -29.802 1.00 20.25 ? 11  PHE A HD1   1 
ATOM   191   H  HD2   . PHE A 1 11  ? -14.761 -22.916 -32.022 1.00 18.18 ? 11  PHE A HD2   1 
ATOM   192   H  HE1   . PHE A 1 11  ? -15.941 -25.181 -28.149 1.00 18.97 ? 11  PHE A HE1   1 
ATOM   193   H  HE2   . PHE A 1 11  ? -13.175 -23.293 -30.359 1.00 16.36 ? 11  PHE A HE2   1 
ATOM   194   H  HZ    . PHE A 1 11  ? -13.771 -24.423 -28.425 1.00 21.97 ? 11  PHE A HZ    1 
ATOM   195   N  N     . PHE A 1 12  ? -18.154 -20.708 -31.287 1.00 14.07 ? 12  PHE A N     1 
ATOM   196   C  CA    . PHE A 1 12  ? -17.848 -19.567 -30.428 1.00 16.62 ? 12  PHE A CA    1 
ATOM   197   C  C     . PHE A 1 12  ? -19.076 -19.130 -29.632 1.00 16.47 ? 12  PHE A C     1 
ATOM   198   O  O     . PHE A 1 12  ? -18.961 -18.772 -28.462 1.00 14.66 ? 12  PHE A O     1 
ATOM   199   C  CB    . PHE A 1 12  ? -17.332 -18.344 -31.207 1.00 18.03 ? 12  PHE A CB    1 
ATOM   200   C  CG    . PHE A 1 12  ? -16.008 -18.526 -31.890 1.00 15.22 ? 12  PHE A CG    1 
ATOM   201   C  CD1   . PHE A 1 12  ? -15.300 -19.729 -31.849 1.00 15.19 ? 12  PHE A CD1   1 
ATOM   202   C  CD2   . PHE A 1 12  ? -15.467 -17.458 -32.597 1.00 15.50 ? 12  PHE A CD2   1 
ATOM   203   C  CE1   . PHE A 1 12  ? -14.107 -19.869 -32.505 1.00 17.84 ? 12  PHE A CE1   1 
ATOM   204   C  CE2   . PHE A 1 12  ? -14.276 -17.578 -33.231 1.00 17.90 ? 12  PHE A CE2   1 
ATOM   205   C  CZ    . PHE A 1 12  ? -13.585 -18.791 -33.212 1.00 15.99 ? 12  PHE A CZ    1 
ATOM   206   H  H     . PHE A 1 12  ? -18.073 -20.565 -32.131 1.00 16.82 ? 12  PHE A H     1 
ATOM   207   H  HA    . PHE A 1 12  ? -17.153 -19.831 -29.789 1.00 19.88 ? 12  PHE A HA    1 
ATOM   208   H  HB2   . PHE A 1 12  ? -17.983 -18.117 -31.889 1.00 21.57 ? 12  PHE A HB2   1 
ATOM   209   H  HB3   . PHE A 1 12  ? -17.240 -17.602 -30.588 1.00 21.57 ? 12  PHE A HB3   1 
ATOM   210   H  HD1   . PHE A 1 12  ? -15.657 -20.454 -31.389 1.00 18.16 ? 12  PHE A HD1   1 
ATOM   211   H  HD2   . PHE A 1 12  ? -15.926 -16.650 -32.629 1.00 18.54 ? 12  PHE A HD2   1 
ATOM   212   H  HE1   . PHE A 1 12  ? -13.646 -20.676 -32.472 1.00 21.35 ? 12  PHE A HE1   1 
ATOM   213   H  HE2   . PHE A 1 12  ? -13.931 -16.856 -33.706 1.00 21.42 ? 12  PHE A HE2   1 
ATOM   214   H  HZ    . PHE A 1 12  ? -12.766 -18.870 -33.645 1.00 19.13 ? 12  PHE A HZ    1 
ATOM   215   N  N     . ALA A 1 13  ? -20.257 -19.136 -30.257 1.00 16.53 ? 13  ALA A N     1 
ATOM   216   C  CA    . ALA A 1 13  ? -21.482 -18.742 -29.559 1.00 15.64 ? 13  ALA A CA    1 
ATOM   217   C  C     . ALA A 1 13  ? -21.833 -19.753 -28.471 1.00 15.81 ? 13  ALA A C     1 
ATOM   218   O  O     . ALA A 1 13  ? -22.280 -19.371 -27.391 1.00 16.98 ? 13  ALA A O     1 
ATOM   219   C  CB    . ALA A 1 13  ? -22.676 -18.571 -30.550 1.00 15.83 ? 13  ALA A CB    1 
ATOM   220   H  H     . ALA A 1 13  ? -20.374 -19.363 -31.079 1.00 19.77 ? 13  ALA A H     1 
ATOM   221   H  HA    . ALA A 1 13  ? -21.331 -17.877 -29.124 1.00 18.71 ? 13  ALA A HA    1 
ATOM   222   H  HB1   . ALA A 1 13  ? -22.831 -19.406 -30.997 1.00 18.93 ? 13  ALA A HB1   1 
ATOM   223   H  HB2   . ALA A 1 13  ? -23.457 -18.314 -30.056 1.00 18.93 ? 13  ALA A HB2   1 
ATOM   224   H  HB3   . ALA A 1 13  ? -22.454 -17.892 -31.191 1.00 18.93 ? 13  ALA A HB3   1 
ATOM   225   N  N     . GLN A 1 14  ? -21.612 -21.030 -28.755 1.00 14.90 ? 14  GLN A N     1 
ATOM   226   C  CA    . GLN A 1 14  ? -21.894 -22.066 -27.784 1.00 18.36 ? 14  GLN A CA    1 
ATOM   227   C  C     . GLN A 1 14  ? -20.990 -21.932 -26.552 1.00 18.65 ? 14  GLN A C     1 
ATOM   228   O  O     . GLN A 1 14  ? -21.454 -22.047 -25.433 1.00 16.61 ? 14  GLN A O     1 
ATOM   229   C  CB    . GLN A 1 14  ? -21.792 -23.477 -28.385 1.00 18.27 ? 14  GLN A CB    1 
ATOM   230   C  CG    . GLN A 1 14  ? -22.359 -24.495 -27.401 1.00 16.93 ? 14  GLN A CG    1 
ATOM   231   C  CD    . GLN A 1 14  ? -22.321 -25.954 -27.809 1.00 21.98 ? 14  GLN A CD    1 
ATOM   232   O  OE1   . GLN A 1 14  ? -22.756 -26.803 -27.031 1.00 18.94 ? 14  GLN A OE1   1 
ATOM   233   N  NE2   . GLN A 1 14  ? -21.768 -26.273 -28.998 1.00 19.95 ? 14  GLN A NE2   1 
ATOM   234   H  H     . GLN A 1 14  ? -21.300 -21.319 -29.502 1.00 17.81 ? 14  GLN A H     1 
ATOM   235   H  HA    . GLN A 1 14  ? -22.817 -21.950 -27.477 1.00 21.97 ? 14  GLN A HA    1 
ATOM   236   H  HB2   . GLN A 1 14  ? -22.306 -23.520 -29.206 1.00 21.86 ? 14  GLN A HB2   1 
ATOM   237   H  HB3   . GLN A 1 14  ? -20.861 -23.694 -28.553 1.00 21.86 ? 14  GLN A HB3   1 
ATOM   238   H  HG2   . GLN A 1 14  ? -21.863 -24.419 -26.571 1.00 20.25 ? 14  GLN A HG2   1 
ATOM   239   H  HG3   . GLN A 1 14  ? -23.289 -24.270 -27.238 1.00 20.25 ? 14  GLN A HG3   1 
ATOM   240   H  HE21  . GLN A 1 14  ? -21.735 -27.095 -29.251 1.00 23.88 ? 14  GLN A HE21  1 
ATOM   241   H  HE22  . GLN A 1 14  ? -21.448 -25.655 -29.503 1.00 23.88 ? 14  GLN A HE22  1 
ATOM   242   N  N     . VAL A 1 15  ? -19.698 -21.684 -26.756 1.00 14.69 ? 15  VAL A N     1 
ATOM   243   C  CA    . VAL A 1 15  ? -18.833 -21.408 -25.613 1.00 16.47 ? 15  VAL A CA    1 
ATOM   244   C  C     . VAL A 1 15  ? -19.368 -20.209 -24.809 1.00 20.95 ? 15  VAL A C     1 
ATOM   245   O  O     . VAL A 1 15  ? -19.408 -20.242 -23.582 1.00 16.37 ? 15  VAL A O     1 
ATOM   246   C  CB    . VAL A 1 15  ? -17.396 -21.135 -26.024 1.00 18.92 ? 15  VAL A CB    1 
ATOM   247   C  CG1   . VAL A 1 15  ? -16.541 -20.710 -24.780 1.00 17.86 ? 15  VAL A CG1   1 
ATOM   248   C  CG2   . VAL A 1 15  ? -16.827 -22.341 -26.723 1.00 13.92 ? 15  VAL A CG2   1 
ATOM   249   H  H     . VAL A 1 15  ? -19.308 -21.670 -27.522 1.00 17.57 ? 15  VAL A H     1 
ATOM   250   H  HA    . VAL A 1 15  ? -18.833 -22.190 -25.022 1.00 19.70 ? 15  VAL A HA    1 
ATOM   251   H  HB    . VAL A 1 15  ? -17.387 -20.389 -26.660 1.00 22.65 ? 15  VAL A HB    1 
ATOM   252   H  HG11  . VAL A 1 15  ? -17.102 -20.708 -24.001 1.00 21.38 ? 15  VAL A HG11  1 
ATOM   253   H  HG12  . VAL A 1 15  ? -15.824 -21.338 -24.666 1.00 21.38 ? 15  VAL A HG12  1 
ATOM   254   H  HG13  . VAL A 1 15  ? -16.186 -19.831 -24.931 1.00 21.38 ? 15  VAL A HG13  1 
ATOM   255   H  HG21  . VAL A 1 15  ? -17.498 -23.026 -26.759 1.00 16.64 ? 15  VAL A HG21  1 
ATOM   256   H  HG22  . VAL A 1 15  ? -16.565 -22.091 -27.612 1.00 16.64 ? 15  VAL A HG22  1 
ATOM   257   H  HG23  . VAL A 1 15  ? -16.064 -22.655 -26.233 1.00 16.64 ? 15  VAL A HG23  1 
ATOM   258   N  N     . GLU A 1 16  ? -19.802 -19.163 -25.488 1.00 16.86 ? 16  GLU A N     1 
ATOM   259   C  CA    . GLU A 1 16  ? -20.323 -17.998 -24.779 1.00 17.34 ? 16  GLU A CA    1 
ATOM   260   C  C     . GLU A 1 16  ? -21.575 -18.385 -23.979 1.00 17.74 ? 16  GLU A C     1 
ATOM   261   O  O     . GLU A 1 16  ? -21.792 -17.862 -22.876 1.00 18.52 ? 16  GLU A O     1 
ATOM   262   C  CB    . GLU A 1 16  ? -20.602 -16.854 -25.759 1.00 19.67 ? 16  GLU A CB    1 
ATOM   263   C  CG    . GLU A 1 16  ? -19.340 -16.202 -26.337 1.00 17.54 ? 16  GLU A CG    1 
ATOM   264   C  CD    . GLU A 1 16  ? -18.578 -15.363 -25.306 1.00 24.02 ? 16  GLU A CD    1 
ATOM   265   O  OE1   . GLU A 1 16  ? -17.430 -14.937 -25.573 1.00 22.94 ? 16  GLU A OE1   1 
ATOM   266   O  OE2   . GLU A 1 16  ? -19.124 -15.131 -24.214 1.00 28.01 ? 16  GLU A OE2   1 
ATOM   267   H  H     . GLU A 1 16  ? -19.809 -19.097 -26.345 1.00 20.17 ? 16  GLU A H     1 
ATOM   268   H  HA    . GLU A 1 16  ? -19.646 -17.687 -24.143 1.00 20.75 ? 16  GLU A HA    1 
ATOM   269   H  HB2   . GLU A 1 16  ? -21.122 -17.200 -26.501 1.00 23.54 ? 16  GLU A HB2   1 
ATOM   270   H  HB3   . GLU A 1 16  ? -21.106 -16.166 -25.298 1.00 23.54 ? 16  GLU A HB3   1 
ATOM   271   H  HG2   . GLU A 1 16  ? -18.744 -16.897 -26.657 1.00 20.98 ? 16  GLU A HG2   1 
ATOM   272   H  HG3   . GLU A 1 16  ? -19.594 -15.619 -27.069 1.00 20.98 ? 16  GLU A HG3   1 
ATOM   273   N  N     . GLU A 1 17  ? -22.377 -19.317 -24.510 1.00 17.23 ? 17  GLU A N     1 
ATOM   274   C  CA    . GLU A 1 17  ? -23.549 -19.828 -23.780 1.00 17.47 ? 17  GLU A CA    1 
ATOM   275   C  C     . GLU A 1 17  ? -23.154 -20.651 -22.547 1.00 20.84 ? 17  GLU A C     1 
ATOM   276   O  O     . GLU A 1 17  ? -23.831 -20.621 -21.529 1.00 21.72 ? 17  GLU A O     1 
ATOM   277   C  CB    . GLU A 1 17  ? -24.416 -20.719 -24.659 1.00 15.94 ? 17  GLU A CB    1 
ATOM   278   C  CG    . GLU A 1 17  ? -25.211 -19.967 -25.735 1.00 16.73 ? 17  GLU A CG    1 
ATOM   279   C  CD    . GLU A 1 17  ? -26.019 -20.888 -26.622 1.00 24.29 ? 17  GLU A CD    1 
ATOM   280   O  OE1   . GLU A 1 17  ? -25.903 -22.127 -26.439 1.00 22.24 ? 17  GLU A OE1   1 
ATOM   281   O  OE2   . GLU A 1 17  ? -26.712 -20.371 -27.549 1.00 22.94 ? 17  GLU A OE2   1 
ATOM   282   H  H     . GLU A 1 17  ? -22.266 -19.668 -25.287 1.00 20.61 ? 17  GLU A H     1 
ATOM   283   H  HA    . GLU A 1 17  ? -24.094 -19.071 -23.480 1.00 20.91 ? 17  GLU A HA    1 
ATOM   284   H  HB2   . GLU A 1 17  ? -23.846 -21.361 -25.110 1.00 19.07 ? 17  GLU A HB2   1 
ATOM   285   H  HB3   . GLU A 1 17  ? -25.053 -21.186 -24.096 1.00 19.07 ? 17  GLU A HB3   1 
ATOM   286   H  HG2   . GLU A 1 17  ? -25.825 -19.354 -25.302 1.00 20.01 ? 17  GLU A HG2   1 
ATOM   287   H  HG3   . GLU A 1 17  ? -24.593 -19.475 -26.297 1.00 20.01 ? 17  GLU A HG3   1 
ATOM   288   N  N     . VAL A 1 18  ? -22.069 -21.408 -22.651 1.00 18.84 ? 18  VAL A N     1 
ATOM   289   C  CA    . VAL A 1 18  ? -21.578 -22.171 -21.512 1.00 18.16 ? 18  VAL A CA    1 
ATOM   290   C  C     . VAL A 1 18  ? -21.133 -21.208 -20.415 1.00 22.16 ? 18  VAL A C     1 
ATOM   291   O  O     . VAL A 1 18  ? -21.437 -21.428 -19.246 1.00 24.60 ? 18  VAL A O     1 
ATOM   292   C  CB    . VAL A 1 18  ? -20.437 -23.130 -21.922 1.00 20.00 ? 18  VAL A CB    1 
ATOM   293   C  CG1   . VAL A 1 18  ? -19.752 -23.735 -20.703 1.00 19.57 ? 18  VAL A CG1   1 
ATOM   294   C  CG2   . VAL A 1 18  ? -21.005 -24.213 -22.831 1.00 17.64 ? 18  VAL A CG2   1 
ATOM   295   H  H     . VAL A 1 18  ? -21.601 -21.496 -23.367 1.00 22.54 ? 18  VAL A H     1 
ATOM   296   H  HA    . VAL A 1 18  ? -22.311 -22.713 -21.156 1.00 21.73 ? 18  VAL A HA    1 
ATOM   297   H  HB    . VAL A 1 18  ? -19.765 -22.629 -22.430 1.00 23.93 ? 18  VAL A HB    1 
ATOM   298   H  HG11  . VAL A 1 18  ? -20.171 -23.395 -19.909 1.00 23.43 ? 18  VAL A HG11  1 
ATOM   299   H  HG12  . VAL A 1 18  ? -19.841 -24.690 -20.738 1.00 23.43 ? 18  VAL A HG12  1 
ATOM   300   H  HG13  . VAL A 1 18  ? -18.824 -23.491 -20.714 1.00 23.43 ? 18  VAL A HG13  1 
ATOM   301   H  HG21  . VAL A 1 18  ? -20.296 -24.809 -23.086 1.00 21.11 ? 18  VAL A HG21  1 
ATOM   302   H  HG22  . VAL A 1 18  ? -21.684 -24.696 -22.355 1.00 21.11 ? 18  VAL A HG22  1 
ATOM   303   H  HG23  . VAL A 1 18  ? -21.382 -23.800 -23.611 1.00 21.11 ? 18  VAL A HG23  1 
ATOM   304   N  N     . LEU A 1 19  ? -20.451 -20.130 -20.802 1.00 19.74 ? 19  LEU A N     1 
ATOM   305   C  CA    . LEU A 1 19  ? -19.981 -19.151 -19.816 1.00 20.84 ? 19  LEU A CA    1 
ATOM   306   C  C     . LEU A 1 19  ? -21.126 -18.267 -19.305 1.00 24.58 ? 19  LEU A C     1 
ATOM   307   O  O     . LEU A 1 19  ? -21.006 -17.707 -18.225 1.00 22.80 ? 19  LEU A O     1 
ATOM   308   C  CB    . LEU A 1 19  ? -18.885 -18.253 -20.389 1.00 23.64 ? 19  LEU A CB    1 
ATOM   309   C  CG    . LEU A 1 19  ? -17.458 -18.698 -20.050 1.00 32.84 ? 19  LEU A CG    1 
ATOM   310   C  CD1   . LEU A 1 19  ? -17.300 -20.134 -20.424 1.00 28.75 ? 19  LEU A CD1   1 
ATOM   311   C  CD2   . LEU A 1 19  ? -16.446 -17.831 -20.761 1.00 31.48 ? 19  LEU A CD2   1 
ATOM   312   H  H     . LEU A 1 19  ? -20.249 -19.943 -21.617 1.00 23.63 ? 19  LEU A H     1 
ATOM   313   H  HA    . LEU A 1 19  ? -19.606 -19.630 -19.048 1.00 24.95 ? 19  LEU A HA    1 
ATOM   314   H  HB2   . LEU A 1 19  ? -18.968 -18.240 -21.356 1.00 28.31 ? 19  LEU A HB2   1 
ATOM   315   H  HB3   . LEU A 1 19  ? -19.005 -17.356 -20.039 1.00 28.31 ? 19  LEU A HB3   1 
ATOM   316   H  HG    . LEU A 1 19  ? -17.314 -18.614 -19.095 1.00 39.34 ? 19  LEU A HG    1 
ATOM   317   H  HD11  . LEU A 1 19  ? -17.934 -20.657 -19.929 1.00 34.44 ? 19  LEU A HD11  1 
ATOM   318   H  HD12  . LEU A 1 19  ? -17.459 -20.230 -21.366 1.00 34.44 ? 19  LEU A HD12  1 
ATOM   319   H  HD13  . LEU A 1 19  ? -16.406 -20.415 -20.213 1.00 34.44 ? 19  LEU A HD13  1 
ATOM   320   H  HD21  . LEU A 1 19  ? -16.565 -16.920 -20.483 1.00 37.72 ? 19  LEU A HD21  1 
ATOM   321   H  HD22  . LEU A 1 19  ? -15.563 -18.130 -20.533 1.00 37.72 ? 19  LEU A HD22  1 
ATOM   322   H  HD23  . LEU A 1 19  ? -16.582 -17.905 -21.709 1.00 37.72 ? 19  LEU A HD23  1 
ATOM   323   N  N     . ASN A 1 20  ? -22.200 -18.138 -20.093 1.00 20.28 ? 20  ASN A N     1 
ATOM   324   C  CA    . ASN A 1 20  ? -23.348 -17.267 -19.781 1.00 21.88 ? 20  ASN A CA    1 
ATOM   325   C  C     . ASN A 1 20  ? -24.644 -17.994 -20.182 1.00 24.34 ? 20  ASN A C     1 
ATOM   326   O  O     . ASN A 1 20  ? -25.236 -17.722 -21.223 1.00 21.94 ? 20  ASN A O     1 
ATOM   327   C  CB    . ASN A 1 20  ? -23.243 -15.927 -20.528 1.00 28.48 ? 20  ASN A CB    1 
ATOM   328   C  CG    . ASN A 1 20  ? -21.851 -15.298 -20.468 1.00 40.80 ? 20  ASN A CG    1 
ATOM   329   O  OD1   . ASN A 1 20  ? -21.500 -14.645 -19.486 1.00 42.19 ? 20  ASN A OD1   1 
ATOM   330   N  ND2   . ASN A 1 20  ? -21.068 -15.443 -21.563 1.00 35.37 ? 20  ASN A ND2   1 
ATOM   331   H  H     . ASN A 1 20  ? -22.290 -18.558 -20.838 1.00 24.28 ? 20  ASN A H     1 
ATOM   332   H  HA    . ASN A 1 20  ? -23.374 -17.088 -18.818 1.00 26.20 ? 20  ASN A HA    1 
ATOM   333   H  HB2   . ASN A 1 20  ? -23.464 -16.071 -21.462 1.00 34.12 ? 20  ASN A HB2   1 
ATOM   334   H  HB3   . ASN A 1 20  ? -23.870 -15.300 -20.135 1.00 34.12 ? 20  ASN A HB3   1 
ATOM   335   H  HD21  . ASN A 1 20  ? -21.362 -15.873 -22.247 1.00 42.38 ? 20  ASN A HD21  1 
ATOM   336   H  HD22  . ASN A 1 20  ? -20.278 -15.105 -21.573 1.00 42.38 ? 20  ASN A HD22  1 
ATOM   337   N  N     . PRO A 1 21  ? -25.087 -18.958 -19.364 1.00 20.26 ? 21  PRO A N     1 
ATOM   338   C  CA    . PRO A 1 21  ? -26.179 -19.808 -19.832 1.00 22.30 ? 21  PRO A CA    1 
ATOM   339   C  C     . PRO A 1 21  ? -27.489 -19.053 -20.001 1.00 26.79 ? 21  PRO A C     1 
ATOM   340   O  O     . PRO A 1 21  ? -28.364 -19.554 -20.661 1.00 23.11 ? 21  PRO A O     1 
ATOM   341   C  CB    . PRO A 1 21  ? -26.280 -20.884 -18.750 1.00 28.62 ? 21  PRO A CB    1 
ATOM   342   C  CG    . PRO A 1 21  ? -24.948 -20.902 -18.105 1.00 25.20 ? 21  PRO A CG    1 
ATOM   343   C  CD    . PRO A 1 21  ? -24.504 -19.458 -18.114 1.00 26.86 ? 21  PRO A CD    1 
ATOM   344   H  HA    . PRO A 1 21  ? -25.938 -20.229 -20.683 1.00 26.70 ? 21  PRO A HA    1 
ATOM   345   H  HB2   . PRO A 1 21  ? -26.969 -20.642 -18.111 1.00 34.28 ? 21  PRO A HB2   1 
ATOM   346   H  HB3   . PRO A 1 21  ? -26.476 -21.742 -19.158 1.00 34.28 ? 21  PRO A HB3   1 
ATOM   347   H  HG2   . PRO A 1 21  ? -25.027 -21.232 -17.196 1.00 30.18 ? 21  PRO A HG2   1 
ATOM   348   H  HG3   . PRO A 1 21  ? -24.340 -21.453 -18.622 1.00 30.18 ? 21  PRO A HG3   1 
ATOM   349   H  HD2   . PRO A 1 21  ? -24.871 -18.983 -17.353 1.00 32.17 ? 21  PRO A HD2   1 
ATOM   350   H  HD3   . PRO A 1 21  ? -23.536 -19.399 -18.142 1.00 32.17 ? 21  PRO A HD3   1 
ATOM   351   N  N     . GLN A 1 22  ? -27.604 -17.859 -19.439 1.00 24.66 ? 22  GLN A N     1 
ATOM   352   C  CA    . GLN A 1 22  ? -28.759 -17.007 -19.728 1.00 30.18 ? 22  GLN A CA    1 
ATOM   353   C  C     . GLN A 1 22  ? -28.946 -16.718 -21.240 1.00 33.69 ? 22  GLN A C     1 
ATOM   354   O  O     . GLN A 1 22  ? -30.046 -16.381 -21.694 1.00 29.96 ? 22  GLN A O     1 
ATOM   355   C  CB    . GLN A 1 22  ? -28.636 -15.681 -18.970 1.00 27.09 ? 22  GLN A CB    1 
ATOM   356   C  CG    . GLN A 1 22  ? -27.467 -14.803 -19.380 1.00 37.49 ? 22  GLN A CG    1 
ATOM   357   C  CD    . GLN A 1 22  ? -26.157 -15.140 -18.659 1.00 37.26 ? 22  GLN A CD    1 
ATOM   358   O  OE1   . GLN A 1 22  ? -25.953 -16.264 -18.208 1.00 34.39 ? 22  GLN A OE1   1 
ATOM   359   N  NE2   . GLN A 1 22  ? -25.267 -14.158 -18.563 1.00 41.48 ? 22  GLN A NE2   1 
ATOM   360   H  H     . GLN A 1 22  ? -27.036 -17.517 -18.892 1.00 29.53 ? 22  GLN A H     1 
ATOM   361   H  HA    . GLN A 1 22  ? -29.568 -17.458 -19.409 1.00 36.15 ? 22  GLN A HA    1 
ATOM   362   H  HB2   . GLN A 1 22  ? -29.448 -15.169 -19.111 1.00 32.45 ? 22  GLN A HB2   1 
ATOM   363   H  HB3   . GLN A 1 22  ? -28.536 -15.875 -18.025 1.00 32.45 ? 22  GLN A HB3   1 
ATOM   364   H  HG2   . GLN A 1 22  ? -27.316 -14.909 -20.333 1.00 44.92 ? 22  GLN A HG2   1 
ATOM   365   H  HG3   . GLN A 1 22  ? -27.685 -13.879 -19.183 1.00 44.92 ? 22  GLN A HG3   1 
ATOM   366   H  HE21  . GLN A 1 22  ? -25.441 -13.385 -18.896 1.00 49.71 ? 22  GLN A HE21  1 
ATOM   367   H  HE22  . GLN A 1 22  ? -24.516 -14.296 -18.167 1.00 49.71 ? 22  GLN A HE22  1 
ATOM   368   N  N     . TYR A 1 23  ? -27.878 -16.854 -22.018 1.00 21.56 ? 23  TYR A N     1 
ATOM   369   C  CA    . TYR A 1 23  ? -27.937 -16.577 -23.451 1.00 19.42 ? 23  TYR A CA    1 
ATOM   370   C  C     . TYR A 1 23  ? -28.575 -17.718 -24.188 1.00 23.03 ? 23  TYR A C     1 
ATOM   371   O  O     . TYR A 1 23  ? -29.043 -17.565 -25.311 1.00 24.16 ? 23  TYR A O     1 
ATOM   372   C  CB    . TYR A 1 23  ? -26.525 -16.371 -23.997 1.00 19.59 ? 23  TYR A CB    1 
ATOM   373   C  CG    . TYR A 1 23  ? -25.808 -15.125 -23.527 1.00 22.53 ? 23  TYR A CG    1 
ATOM   374   C  CD1   . TYR A 1 23  ? -24.425 -15.008 -23.678 1.00 30.86 ? 23  TYR A CD1   1 
ATOM   375   C  CD2   . TYR A 1 23  ? -26.494 -14.070 -22.946 1.00 30.34 ? 23  TYR A CD2   1 
ATOM   376   C  CE1   . TYR A 1 23  ? -23.755 -13.894 -23.263 1.00 35.34 ? 23  TYR A CE1   1 
ATOM   377   C  CE2   . TYR A 1 23  ? -25.823 -12.940 -22.540 1.00 28.94 ? 23  TYR A CE2   1 
ATOM   378   C  CZ    . TYR A 1 23  ? -24.456 -12.858 -22.697 1.00 36.10 ? 23  TYR A CZ    1 
ATOM   379   O  OH    . TYR A 1 23  ? -23.778 -11.736 -22.289 1.00 45.51 ? 23  TYR A OH    1 
ATOM   380   H  H     . TYR A 1 23  ? -27.104 -17.105 -21.741 1.00 25.82 ? 23  TYR A H     1 
ATOM   381   H  HA    . TYR A 1 23  ? -28.461 -15.764 -23.612 1.00 23.24 ? 23  TYR A HA    1 
ATOM   382   H  HB2   . TYR A 1 23  ? -25.983 -17.132 -23.737 1.00 23.45 ? 23  TYR A HB2   1 
ATOM   383   H  HB3   . TYR A 1 23  ? -26.576 -16.327 -24.965 1.00 23.45 ? 23  TYR A HB3   1 
ATOM   384   H  HD1   . TYR A 1 23  ? -23.948 -15.707 -24.063 1.00 36.98 ? 23  TYR A HD1   1 
ATOM   385   H  HD2   . TYR A 1 23  ? -27.417 -14.121 -22.841 1.00 36.35 ? 23  TYR A HD2   1 
ATOM   386   H  HE1   . TYR A 1 23  ? -22.834 -13.832 -23.373 1.00 42.34 ? 23  TYR A HE1   1 
ATOM   387   H  HE2   . TYR A 1 23  ? -26.290 -12.236 -22.150 1.00 34.66 ? 23  TYR A HE2   1 
ATOM   388   H  HH    . TYR A 1 23  ? -23.395 -11.392 -22.927 1.00 54.55 ? 23  TYR A HH    1 
ATOM   389   N  N     . LYS A 1 24  ? -28.563 -18.897 -23.577 1.00 21.89 ? 24  LYS A N     1 
ATOM   390   C  CA    . LYS A 1 24  ? -28.958 -20.090 -24.309 1.00 22.55 ? 24  LYS A CA    1 
ATOM   391   C  C     . LYS A 1 24  ? -30.439 -20.030 -24.694 1.00 29.79 ? 24  LYS A C     1 
ATOM   392   O  O     . LYS A 1 24  ? -31.251 -19.544 -23.920 1.00 22.98 ? 24  LYS A O     1 
ATOM   393   C  CB    . LYS A 1 24  ? -28.683 -21.328 -23.461 1.00 23.92 ? 24  LYS A CB    1 
ATOM   394   C  CG    . LYS A 1 24  ? -29.058 -22.623 -24.178 1.00 30.86 ? 24  LYS A CG    1 
ATOM   395   C  CD    . LYS A 1 24  ? -28.654 -23.838 -23.366 1.00 35.62 ? 24  LYS A CD    1 
ATOM   396   C  CE    . LYS A 1 24  ? -29.069 -25.106 -24.062 1.00 35.15 ? 24  LYS A CE    1 
ATOM   397   N  NZ    . LYS A 1 24  ? -28.193 -25.409 -25.217 1.00 36.17 ? 24  LYS A NZ    1 
ATOM   398   H  H     . LYS A 1 24  ? -28.336 -19.031 -22.758 1.00 26.20 ? 24  LYS A H     1 
ATOM   399   H  HA    . LYS A 1 24  ? -28.428 -20.156 -25.131 1.00 27.00 ? 24  LYS A HA    1 
ATOM   400   H  HB2   . LYS A 1 24  ? -27.737 -21.364 -23.250 1.00 28.64 ? 24  LYS A HB2   1 
ATOM   401   H  HB3   . LYS A 1 24  ? -29.205 -21.274 -22.645 1.00 28.64 ? 24  LYS A HB3   1 
ATOM   402   H  HG2   . LYS A 1 24  ? -30.018 -22.651 -24.310 1.00 36.97 ? 24  LYS A HG2   1 
ATOM   403   H  HG3   . LYS A 1 24  ? -28.599 -22.661 -25.032 1.00 36.97 ? 24  LYS A HG3   1 
ATOM   404   H  HD2   . LYS A 1 24  ? -27.690 -23.848 -23.259 1.00 42.68 ? 24  LYS A HD2   1 
ATOM   405   H  HD3   . LYS A 1 24  ? -29.090 -23.806 -22.500 1.00 42.68 ? 24  LYS A HD3   1 
ATOM   406   H  HE2   . LYS A 1 24  ? -29.014 -25.846 -23.437 1.00 42.11 ? 24  LYS A HE2   1 
ATOM   407   H  HE3   . LYS A 1 24  ? -29.978 -25.009 -24.387 1.00 42.11 ? 24  LYS A HE3   1 
ATOM   408   H  HZ1   . LYS A 1 24  ? -27.352 -25.507 -24.943 1.00 43.34 ? 24  LYS A HZ1   1 
ATOM   409   H  HZ2   . LYS A 1 24  ? -28.459 -26.162 -25.610 1.00 43.34 ? 24  LYS A HZ2   1 
ATOM   410   H  HZ3   . LYS A 1 24  ? -28.229 -24.745 -25.808 1.00 43.34 ? 24  LYS A HZ3   1 
ATOM   411   N  N     . GLY A 1 25  ? -30.771 -20.519 -25.888 1.00 22.55 ? 25  GLY A N     1 
ATOM   412   C  CA    . GLY A 1 25  ? -32.133 -20.546 -26.381 1.00 29.80 ? 25  GLY A CA    1 
ATOM   413   C  C     . GLY A 1 25  ? -32.697 -19.214 -26.847 1.00 34.15 ? 25  GLY A C     1 
ATOM   414   O  O     . GLY A 1 25  ? -33.881 -19.137 -27.149 1.00 25.38 ? 25  GLY A O     1 
ATOM   415   H  H     . GLY A 1 25  ? -30.202 -20.849 -26.442 1.00 27.00 ? 25  GLY A H     1 
ATOM   416   H  HA2   . GLY A 1 25  ? -32.181 -21.164 -27.128 1.00 35.70 ? 25  GLY A HA2   1 
ATOM   417   H  HA3   . GLY A 1 25  ? -32.711 -20.882 -25.679 1.00 35.70 ? 25  GLY A HA3   1 
ATOM   418   N  N     . LYS A 1 26  ? -31.875 -18.168 -26.872 1.00 26.30 ? 26  LYS A N     1 
ATOM   419   C  CA    . LYS A 1 26  ? -32.259 -16.894 -27.469 1.00 26.01 ? 26  LYS A CA    1 
ATOM   420   C  C     . LYS A 1 26  ? -31.178 -16.502 -28.491 1.00 22.64 ? 26  LYS A C     1 
ATOM   421   O  O     . LYS A 1 26  ? -30.064 -16.985 -28.398 1.00 20.15 ? 26  LYS A O     1 
ATOM   422   C  CB    . LYS A 1 26  ? -32.345 -15.788 -26.413 1.00 23.18 ? 26  LYS A CB    1 
ATOM   423   C  CG    . LYS A 1 26  ? -33.315 -16.074 -25.232 1.00 39.13 ? 26  LYS A CG    1 
ATOM   424   C  CD    . LYS A 1 26  ? -34.761 -16.186 -25.723 1.00 51.82 ? 26  LYS A CD    1 
ATOM   425   C  CE    . LYS A 1 26  ? -35.734 -16.556 -24.592 1.00 64.77 ? 26  LYS A CE    1 
ATOM   426   N  NZ    . LYS A 1 26  ? -37.136 -16.777 -25.077 1.00 67.57 ? 26  LYS A NZ    1 
ATOM   427   H  H     . LYS A 1 26  ? -31.080 -18.172 -26.546 1.00 31.50 ? 26  LYS A H     1 
ATOM   428   H  HA    . LYS A 1 26  ? -33.122 -16.976 -27.925 1.00 31.15 ? 26  LYS A HA    1 
ATOM   429   H  HB2   . LYS A 1 26  ? -31.461 -15.652 -26.037 1.00 27.75 ? 26  LYS A HB2   1 
ATOM   430   H  HB3   . LYS A 1 26  ? -32.644 -14.973 -26.845 1.00 27.75 ? 26  LYS A HB3   1 
ATOM   431   H  HG2   . LYS A 1 26  ? -33.071 -16.912 -24.810 1.00 46.89 ? 26  LYS A HG2   1 
ATOM   432   H  HG3   . LYS A 1 26  ? -33.266 -15.347 -24.592 1.00 46.89 ? 26  LYS A HG3   1 
ATOM   433   H  HD2   . LYS A 1 26  ? -35.038 -15.332 -26.092 1.00 62.12 ? 26  LYS A HD2   1 
ATOM   434   H  HD3   . LYS A 1 26  ? -34.813 -16.876 -26.403 1.00 62.12 ? 26  LYS A HD3   1 
ATOM   435   H  HE2   . LYS A 1 26  ? -35.430 -17.374 -24.170 1.00 77.66 ? 26  LYS A HE2   1 
ATOM   436   H  HE3   . LYS A 1 26  ? -35.752 -15.835 -23.944 1.00 77.66 ? 26  LYS A HE3   1 
ATOM   437   H  HZ1   . LYS A 1 26  ? -37.151 -17.441 -25.670 1.00 81.02 ? 26  LYS A HZ1   1 
ATOM   438   H  HZ2   . LYS A 1 26  ? -37.664 -16.988 -24.393 1.00 81.02 ? 26  LYS A HZ2   1 
ATOM   439   H  HZ3   . LYS A 1 26  ? -37.444 -16.037 -25.463 1.00 81.02 ? 26  LYS A HZ3   1 
ATOM   440   N  N     . PRO A 1 27  ? -31.515 -15.633 -29.456 1.00 21.47 ? 27  PRO A N     1 
ATOM   441   C  CA    . PRO A 1 27  ? -30.515 -15.232 -30.457 1.00 23.40 ? 27  PRO A CA    1 
ATOM   442   C  C     . PRO A 1 27  ? -29.296 -14.605 -29.785 1.00 17.85 ? 27  PRO A C     1 
ATOM   443   O  O     . PRO A 1 27  ? -29.386 -13.667 -28.997 1.00 16.67 ? 27  PRO A O     1 
ATOM   444   C  CB    . PRO A 1 27  ? -31.242 -14.206 -31.312 1.00 23.15 ? 27  PRO A CB    1 
ATOM   445   C  CG    . PRO A 1 27  ? -32.682 -14.552 -31.177 1.00 24.76 ? 27  PRO A CG    1 
ATOM   446   C  CD    . PRO A 1 27  ? -32.851 -15.071 -29.751 1.00 24.45 ? 27  PRO A CD    1 
ATOM   447   H  HA    . PRO A 1 27  ? -30.242 -15.996 -31.007 1.00 28.02 ? 27  PRO A HA    1 
ATOM   448   H  HB2   . PRO A 1 27  ? -31.070 -13.314 -30.972 1.00 27.71 ? 27  PRO A HB2   1 
ATOM   449   H  HB3   . PRO A 1 27  ? -30.954 -14.284 -32.235 1.00 27.71 ? 27  PRO A HB3   1 
ATOM   450   H  HG2   . PRO A 1 27  ? -33.222 -13.759 -31.318 1.00 29.66 ? 27  PRO A HG2   1 
ATOM   451   H  HG3   . PRO A 1 27  ? -32.912 -15.241 -31.820 1.00 29.66 ? 27  PRO A HG3   1 
ATOM   452   H  HD2   . PRO A 1 27  ? -33.055 -14.341 -29.145 1.00 29.27 ? 27  PRO A HD2   1 
ATOM   453   H  HD3   . PRO A 1 27  ? -33.528 -15.765 -29.718 1.00 29.27 ? 27  PRO A HD3   1 
ATOM   454   N  N     . LEU A 1 28  ? -28.145 -15.161 -30.145 1.00 20.55 ? 28  LEU A N     1 
ATOM   455   C  CA    . LEU A 1 28  ? -26.844 -14.691 -29.672 1.00 18.97 ? 28  LEU A CA    1 
ATOM   456   C  C     . LEU A 1 28  ? -25.900 -14.552 -30.867 1.00 13.87 ? 28  LEU A C     1 
ATOM   457   O  O     . LEU A 1 28  ? -25.801 -15.466 -31.661 1.00 16.65 ? 28  LEU A O     1 
ATOM   458   C  CB    . LEU A 1 28  ? -26.253 -15.724 -28.722 1.00 16.28 ? 28  LEU A CB    1 
ATOM   459   C  CG    . LEU A 1 28  ? -24.879 -15.348 -28.137 1.00 15.65 ? 28  LEU A CG    1 
ATOM   460   C  CD1   . LEU A 1 28  ? -24.905 -14.099 -27.318 1.00 20.80 ? 28  LEU A CD1   1 
ATOM   461   C  CD2   . LEU A 1 28  ? -24.366 -16.491 -27.336 1.00 19.27 ? 28  LEU A CD2   1 
ATOM   462   H  H     . LEU A 1 28  ? -28.089 -15.833 -30.679 1.00 24.60 ? 28  LEU A H     1 
ATOM   463   H  HA    . LEU A 1 28  ? -26.930 -13.829 -29.214 1.00 22.70 ? 28  LEU A HA    1 
ATOM   464   H  HB2   . LEU A 1 28  ? -26.865 -15.848 -27.979 1.00 19.47 ? 28  LEU A HB2   1 
ATOM   465   H  HB3   . LEU A 1 28  ? -26.149 -16.561 -29.201 1.00 19.47 ? 28  LEU A HB3   1 
ATOM   466   H  HG    . LEU A 1 28  ? -24.261 -15.204 -28.870 1.00 18.72 ? 28  LEU A HG    1 
ATOM   467   H  HD11  . LEU A 1 28  ? -25.512 -14.218 -26.585 1.00 24.90 ? 28  LEU A HD11  1 
ATOM   468   H  HD12  . LEU A 1 28  ? -24.021 -13.925 -26.987 1.00 24.90 ? 28  LEU A HD12  1 
ATOM   469   H  HD13  . LEU A 1 28  ? -25.197 -13.370 -27.870 1.00 24.90 ? 28  LEU A HD13  1 
ATOM   470   H  HD21  . LEU A 1 28  ? -24.280 -17.258 -27.907 1.00 23.06 ? 28  LEU A HD21  1 
ATOM   471   H  HD22  . LEU A 1 28  ? -23.509 -16.256 -26.971 1.00 23.06 ? 28  LEU A HD22  1 
ATOM   472   H  HD23  . LEU A 1 28  ? -24.984 -16.678 -26.627 1.00 23.06 ? 28  LEU A HD23  1 
ATOM   473   N  N     . VAL A 1 29  ? -25.254 -13.404 -30.987 1.00 14.76 ? 29  VAL A N     1 
ATOM   474   C  CA    . VAL A 1 29  ? -24.310 -13.145 -32.069 1.00 18.17 ? 29  VAL A CA    1 
ATOM   475   C  C     . VAL A 1 29  ? -22.924 -12.759 -31.531 1.00 17.22 ? 29  VAL A C     1 
ATOM   476   O  O     . VAL A 1 29  ? -22.788 -11.772 -30.803 1.00 18.61 ? 29  VAL A O     1 
ATOM   477   C  CB    . VAL A 1 29  ? -24.816 -12.000 -32.962 1.00 17.57 ? 29  VAL A CB    1 
ATOM   478   C  CG1   . VAL A 1 29  ? -23.931 -11.860 -34.193 1.00 15.47 ? 29  VAL A CG1   1 
ATOM   479   C  CG2   . VAL A 1 29  ? -26.276 -12.301 -33.403 1.00 16.99 ? 29  VAL A CG2   1 
ATOM   480   H  H     . VAL A 1 29  ? -25.345 -12.743 -30.444 1.00 17.65 ? 29  VAL A H     1 
ATOM   481   H  HA    . VAL A 1 29  ? -24.217 -13.950 -32.620 1.00 21.74 ? 29  VAL A HA    1 
ATOM   482   H  HB    . VAL A 1 29  ? -24.802 -11.156 -32.463 1.00 21.02 ? 29  VAL A HB    1 
ATOM   483   H  HG11  . VAL A 1 29  ? -24.263 -11.141 -34.736 1.00 18.50 ? 29  VAL A HG11  1 
ATOM   484   H  HG12  . VAL A 1 29  ? -23.033 -11.671 -33.912 1.00 18.50 ? 29  VAL A HG12  1 
ATOM   485   H  HG13  . VAL A 1 29  ? -23.953 -12.682 -34.688 1.00 18.50 ? 29  VAL A HG13  1 
ATOM   486   H  HG21  . VAL A 1 29  ? -26.550 -13.139 -33.023 1.00 20.33 ? 29  VAL A HG21  1 
ATOM   487   H  HG22  . VAL A 1 29  ? -26.848 -11.596 -33.090 1.00 20.33 ? 29  VAL A HG22  1 
ATOM   488   H  HG23  . VAL A 1 29  ? -26.309 -12.349 -34.361 1.00 20.33 ? 29  VAL A HG23  1 
ATOM   489   N  N     . VAL A 1 30  ? -21.904 -13.520 -31.934 1.00 16.94 ? 30  VAL A N     1 
ATOM   490   C  CA    . VAL A 1 30  ? -20.512 -13.242 -31.523 1.00 13.67 ? 30  VAL A CA    1 
ATOM   491   C  C     . VAL A 1 30  ? -19.859 -12.409 -32.638 1.00 14.74 ? 30  VAL A C     1 
ATOM   492   O  O     . VAL A 1 30  ? -19.829 -12.797 -33.813 1.00 16.45 ? 30  VAL A O     1 
ATOM   493   C  CB    . VAL A 1 30  ? -19.692 -14.534 -31.285 1.00 16.26 ? 30  VAL A CB    1 
ATOM   494   C  CG1   . VAL A 1 30  ? -18.210 -14.181 -30.957 1.00 16.94 ? 30  VAL A CG1   1 
ATOM   495   C  CG2   . VAL A 1 30  ? -20.311 -15.334 -30.194 1.00 19.59 ? 30  VAL A CG2   1 
ATOM   496   H  H     . VAL A 1 30  ? -21.985 -14.205 -32.447 1.00 20.26 ? 30  VAL A H     1 
ATOM   497   H  HA    . VAL A 1 30  ? -20.511 -12.715 -30.697 1.00 16.34 ? 30  VAL A HA    1 
ATOM   498   H  HB    . VAL A 1 30  ? -19.702 -15.075 -32.102 1.00 19.45 ? 30  VAL A HB    1 
ATOM   499   H  HG11  . VAL A 1 30  ? -18.106 -13.227 -30.970 1.00 20.27 ? 30  VAL A HG11  1 
ATOM   500   H  HG12  . VAL A 1 30  ? -17.992 -14.523 -30.087 1.00 20.27 ? 30  VAL A HG12  1 
ATOM   501   H  HG13  . VAL A 1 30  ? -17.640 -14.581 -31.618 1.00 20.27 ? 30  VAL A HG13  1 
ATOM   502   H  HG21  . VAL A 1 30  ? -21.090 -14.873 -29.873 1.00 23.44 ? 30  VAL A HG21  1 
ATOM   503   H  HG22  . VAL A 1 30  ? -20.560 -16.195 -30.541 1.00 23.44 ? 30  VAL A HG22  1 
ATOM   504   H  HG23  . VAL A 1 30  ? -19.675 -15.438 -29.483 1.00 23.44 ? 30  VAL A HG23  1 
ATOM   505   N  N     . CYS A 1 31  ? -19.383 -11.239 -32.240 1.00 16.96 ? 31  CYS A N     1 
ATOM   506   C  CA    . CYS A 1 31  ? -19.024 -10.195 -33.147 1.00 18.87 ? 31  CYS A CA    1 
ATOM   507   C  C     . CYS A 1 31  ? -17.551 -9.869  -33.042 1.00 19.08 ? 31  CYS A C     1 
ATOM   508   O  O     . CYS A 1 31  ? -16.958 -9.875  -31.956 1.00 17.22 ? 31  CYS A O     1 
ATOM   509   C  CB    . CYS A 1 31  ? -19.766 -8.915  -32.824 1.00 21.55 ? 31  CYS A CB    1 
ATOM   510   S  SG    . CYS A 1 31  ? -21.558 -9.099  -33.025 1.00 23.05 ? 31  CYS A SG    1 
ATOM   511   H  H     . CYS A 1 31  ? -19.260 -11.031 -31.415 1.00 20.29 ? 31  CYS A H     1 
ATOM   512   H  HA    . CYS A 1 31  ? -19.229 -10.462 -34.067 1.00 22.58 ? 31  CYS A HA    1 
ATOM   513   H  HB2   . CYS A 1 31  ? -19.589 -8.668  -31.903 1.00 25.80 ? 31  CYS A HB2   1 
ATOM   514   H  HB3   . CYS A 1 31  ? -19.466 -8.213  -33.422 1.00 25.80 ? 31  CYS A HB3   1 
ATOM   515   H  HG    . CYS A 1 31  ? -21.794 -9.399  -34.163 1.00 27.59 ? 31  CYS A HG    1 
ATOM   516   N  N     . VAL A 1 32  ? -17.021 -9.509  -34.189 1.00 16.35 ? 32  VAL A N     1 
ATOM   517   C  CA    . VAL A 1 32  ? -15.619 -9.056  -34.272 1.00 17.67 ? 32  VAL A CA    1 
ATOM   518   C  C     . VAL A 1 32  ? -15.645 -7.539  -34.501 1.00 14.56 ? 32  VAL A C     1 
ATOM   519   O  O     . VAL A 1 32  ? -15.834 -7.079  -35.642 1.00 17.11 ? 32  VAL A O     1 
ATOM   520   C  CB    . VAL A 1 32  ? -14.897 -9.734  -35.426 1.00 15.82 ? 32  VAL A CB    1 
ATOM   521   C  CG1   . VAL A 1 32  ? -13.397 -9.359  -35.385 1.00 18.65 ? 32  VAL A CG1   1 
ATOM   522   C  CG2   . VAL A 1 32  ? -15.060 -11.230 -35.329 1.00 17.71 ? 32  VAL A CG2   1 
ATOM   523   H  H     . VAL A 1 32  ? -17.438 -9.512  -34.942 1.00 19.55 ? 32  VAL A H     1 
ATOM   524   H  HA    . VAL A 1 32  ? -15.148 -9.250  -33.434 1.00 21.14 ? 32  VAL A HA    1 
ATOM   525   H  HB    . VAL A 1 32  ? -15.275 -9.431  -36.277 1.00 18.92 ? 32  VAL A HB    1 
ATOM   526   H  HG11  . VAL A 1 32  ? -13.242 -8.777  -34.637 1.00 22.32 ? 32  VAL A HG11  1 
ATOM   527   H  HG12  . VAL A 1 32  ? -12.877 -10.160 -35.289 1.00 22.32 ? 32  VAL A HG12  1 
ATOM   528   H  HG13  . VAL A 1 32  ? -13.165 -8.913  -36.202 1.00 22.32 ? 32  VAL A HG13  1 
ATOM   529   H  HG21  . VAL A 1 32  ? -14.599 -11.642 -36.063 1.00 21.19 ? 32  VAL A HG21  1 
ATOM   530   H  HG22  . VAL A 1 32  ? -14.687 -11.531 -34.497 1.00 21.19 ? 32  VAL A HG22  1 
ATOM   531   H  HG23  . VAL A 1 32  ? -15.995 -11.445 -35.366 1.00 21.19 ? 32  VAL A HG23  1 
ATOM   532   N  N     . TYR A 1 33  ? -15.507 -6.780  -33.412 1.00 15.39 ? 33  TYR A N     1 
ATOM   533   C  CA    . TYR A 1 33  ? -15.584 -5.336  -33.472 1.00 18.97 ? 33  TYR A CA    1 
ATOM   534   C  C     . TYR A 1 33  ? -14.236 -4.779  -33.856 1.00 23.39 ? 33  TYR A C     1 
ATOM   535   O  O     . TYR A 1 33  ? -13.265 -5.014  -33.160 1.00 22.93 ? 33  TYR A O     1 
ATOM   536   C  CB    . TYR A 1 33  ? -15.942 -4.743  -32.111 1.00 21.00 ? 33  TYR A CB    1 
ATOM   537   C  CG    . TYR A 1 33  ? -17.376 -5.011  -31.723 1.00 25.52 ? 33  TYR A CG    1 
ATOM   538   C  CD1   . TYR A 1 33  ? -17.700 -6.077  -30.896 1.00 24.88 ? 33  TYR A CD1   1 
ATOM   539   C  CD2   . TYR A 1 33  ? -18.401 -4.210  -32.191 1.00 24.46 ? 33  TYR A CD2   1 
ATOM   540   C  CE1   . TYR A 1 33  ? -19.007 -6.327  -30.519 1.00 23.87 ? 33  TYR A CE1   1 
ATOM   541   C  CE2   . TYR A 1 33  ? -19.734 -4.464  -31.824 1.00 31.35 ? 33  TYR A CE2   1 
ATOM   542   C  CZ    . TYR A 1 33  ? -20.014 -5.529  -30.990 1.00 28.79 ? 33  TYR A CZ    1 
ATOM   543   O  OH    . TYR A 1 33  ? -21.302 -5.819  -30.604 1.00 26.32 ? 33  TYR A OH    1 
ATOM   544   H  H     . TYR A 1 33  ? -15.366 -7.089  -32.622 1.00 18.41 ? 33  TYR A H     1 
ATOM   545   H  HA    . TYR A 1 33  ? -16.251 -5.058  -34.134 1.00 22.71 ? 33  TYR A HA    1 
ATOM   546   H  HB2   . TYR A 1 33  ? -15.369 -5.134  -31.434 1.00 25.13 ? 33  TYR A HB2   1 
ATOM   547   H  HB3   . TYR A 1 33  ? -15.814 -3.782  -32.141 1.00 25.13 ? 33  TYR A HB3   1 
ATOM   548   H  HD1   . TYR A 1 33  ? -17.020 -6.622  -30.569 1.00 29.79 ? 33  TYR A HD1   1 
ATOM   549   H  HD2   . TYR A 1 33  ? -18.206 -3.492  -32.750 1.00 29.29 ? 33  TYR A HD2   1 
ATOM   550   H  HE1   . TYR A 1 33  ? -19.203 -7.047  -29.963 1.00 28.58 ? 33  TYR A HE1   1 
ATOM   551   H  HE2   . TYR A 1 33  ? -20.420 -3.921  -32.139 1.00 37.56 ? 33  TYR A HE2   1 
ATOM   552   H  HH    . TYR A 1 33  ? -21.763 -5.981  -31.263 1.00 31.53 ? 33  TYR A HH    1 
ATOM   553   N  N     . SER A 1 34  ? -14.204 -4.019  -34.926 1.00 20.21 ? 34  SER A N     1 
ATOM   554   C  CA    . SER A 1 34  ? -12.926 -3.512  -35.445 1.00 25.21 ? 34  SER A CA    1 
ATOM   555   C  C     . SER A 1 34  ? -12.472 -2.260  -34.705 1.00 33.67 ? 34  SER A C     1 
ATOM   556   O  O     . SER A 1 34  ? -11.290 -1.919  -34.719 1.00 30.93 ? 34  SER A O     1 
ATOM   557   C  CB    . SER A 1 34  ? -13.015 -3.221  -36.939 1.00 23.84 ? 34  SER A CB    1 
ATOM   558   O  OG    . SER A 1 34  ? -13.933 -2.177  -37.260 1.00 29.86 ? 34  SER A OG    1 
ATOM   559   H  H     . SER A 1 34  ? -14.895 -3.776  -35.377 1.00 24.20 ? 34  SER A H     1 
ATOM   560   H  HA    . SER A 1 34  ? -12.240 -4.200  -35.316 1.00 30.20 ? 34  SER A HA    1 
ATOM   561   H  HB2   . SER A 1 34  ? -12.135 -2.963  -37.255 1.00 28.55 ? 34  SER A HB2   1 
ATOM   562   H  HB3   . SER A 1 34  ? -13.298 -4.029  -37.393 1.00 28.55 ? 34  SER A HB3   1 
ATOM   563   H  HG    . SER A 1 34  ? -14.280 -1.888  -36.575 1.00 35.77 ? 34  SER A HG    1 
ATOM   564   N  N     . GLY A 1 35  ? -13.411 -1.571  -34.073 1.00 24.62 ? 35  GLY A N     1 
ATOM   565   C  CA    . GLY A 1 35  ? -13.079 -0.456  -33.201 1.00 33.90 ? 35  GLY A CA    1 
ATOM   566   C  C     . GLY A 1 35  ? -13.138 0.884   -33.903 1.00 40.10 ? 35  GLY A C     1 
ATOM   567   O  O     . GLY A 1 35  ? -13.003 1.939   -33.288 1.00 43.53 ? 35  GLY A O     1 
ATOM   568   H  H     . GLY A 1 35  ? -14.254 -1.730  -34.134 1.00 29.49 ? 35  GLY A H     1 
ATOM   569   H  HA2   . GLY A 1 35  ? -13.698 -0.437  -32.454 1.00 40.62 ? 35  GLY A HA2   1 
ATOM   570   H  HA3   . GLY A 1 35  ? -12.182 -0.578  -32.851 1.00 40.62 ? 35  GLY A HA3   1 
ATOM   571   N  N     . ARG A 1 36  ? -13.338 0.855   -35.205 1.00 30.69 ? 36  ARG A N     1 
ATOM   572   C  CA    . ARG A 1 36  ? -13.469 2.086   -35.959 1.00 36.56 ? 36  ARG A CA    1 
ATOM   573   C  C     . ARG A 1 36  ? -14.698 2.898   -35.570 1.00 43.89 ? 36  ARG A C     1 
ATOM   574   O  O     . ARG A 1 36  ? -14.630 4.117   -35.516 1.00 40.86 ? 36  ARG A O     1 
ATOM   575   C  CB    . ARG A 1 36  ? -13.513 1.788   -37.443 1.00 33.87 ? 36  ARG A CB    1 
ATOM   576   C  CG    . ARG A 1 36  ? -13.924 2.967   -38.228 1.00 48.32 ? 36  ARG A CG    1 
ATOM   577   C  CD    . ARG A 1 36  ? -13.477 2.845   -39.617 1.00 39.37 ? 36  ARG A CD    1 
ATOM   578   N  NE    . ARG A 1 36  ? -12.032 2.794   -39.718 1.00 43.64 ? 36  ARG A NE    1 
ATOM   579   C  CZ    . ARG A 1 36  ? -11.390 2.994   -40.853 1.00 38.53 ? 36  ARG A CZ    1 
ATOM   580   N  NH1   . ARG A 1 36  ? -12.082 3.285   -41.940 1.00 33.23 ? 36  ARG A NH1   1 
ATOM   581   N  NH2   . ARG A 1 36  ? -10.063 2.918   -40.898 1.00 41.92 ? 36  ARG A NH2   1 
ATOM   582   H  H     . ARG A 1 36  ? -13.401 0.139   -35.676 1.00 36.76 ? 36  ARG A H     1 
ATOM   583   H  HA    . ARG A 1 36  ? -12.680 2.642   -35.790 1.00 43.82 ? 36  ARG A HA    1 
ATOM   584   H  HB2   . ARG A 1 36  ? -12.630 1.518   -37.740 1.00 40.58 ? 36  ARG A HB2   1 
ATOM   585   H  HB3   . ARG A 1 36  ? -14.153 1.077   -37.606 1.00 40.58 ? 36  ARG A HB3   1 
ATOM   586   H  HG2   . ARG A 1 36  ? -14.891 3.037   -38.221 1.00 57.93 ? 36  ARG A HG2   1 
ATOM   587   H  HG3   . ARG A 1 36  ? -13.524 3.764   -37.846 1.00 57.93 ? 36  ARG A HG3   1 
ATOM   588   H  HD2   . ARG A 1 36  ? -13.836 2.028   -39.997 1.00 47.19 ? 36  ARG A HD2   1 
ATOM   589   H  HD3   . ARG A 1 36  ? -13.789 3.613   -40.121 1.00 47.19 ? 36  ARG A HD3   1 
ATOM   590   H  HE    . ARG A 1 36  ? -11.595 2.445   -39.065 1.00 52.30 ? 36  ARG A HE    1 
ATOM   591   H  HH11  . ARG A 1 36  ? -12.941 3.327   -41.904 1.00 39.81 ? 36  ARG A HH11  1 
ATOM   592   H  HH12  . ARG A 1 36  ? -11.676 3.422   -42.685 1.00 39.81 ? 36  ARG A HH12  1 
ATOM   593   H  HH21  . ARG A 1 36  ? -9.619  2.735   -40.185 1.00 50.24 ? 36  ARG A HH21  1 
ATOM   594   H  HH22  . ARG A 1 36  ? -9.649  3.061   -41.638 1.00 50.24 ? 36  ARG A HH22  1 
ATOM   595   N  N     . THR A 1 37  ? -15.821 2.222   -35.329 1.00 39.05 ? 37  THR A N     1 
ATOM   596   C  CA    . THR A 1 37  ? -17.000 2.859   -34.765 1.00 39.08 ? 37  THR A CA    1 
ATOM   597   C  C     . THR A 1 37  ? -17.511 1.939   -33.668 1.00 44.16 ? 37  THR A C     1 
ATOM   598   O  O     . THR A 1 37  ? -16.933 0.888   -33.412 1.00 32.10 ? 37  THR A O     1 
ATOM   599   C  CB    . THR A 1 37  ? -18.119 3.108   -35.819 1.00 35.87 ? 37  THR A CB    1 
ATOM   600   O  OG1   . THR A 1 37  ? -18.683 1.860   -36.252 1.00 35.64 ? 37  THR A OG1   1 
ATOM   601   C  CG2   . THR A 1 37  ? -17.569 3.877   -37.019 1.00 42.59 ? 37  THR A CG2   1 
ATOM   602   H  H     . THR A 1 37  ? -15.922 1.383   -35.486 1.00 46.79 ? 37  THR A H     1 
ATOM   603   H  HA    . THR A 1 37  ? -16.751 3.718   -34.364 1.00 46.83 ? 37  THR A HA    1 
ATOM   604   H  HB    . THR A 1 37  ? -18.818 3.645   -35.415 1.00 42.99 ? 37  THR A HB    1 
ATOM   605   H  HG1   . THR A 1 37  ? -19.272 1.996   -36.806 1.00 42.71 ? 37  THR A HG1   1 
ATOM   606   H  HG21  . THR A 1 37  ? -16.863 3.376   -37.434 1.00 51.05 ? 37  THR A HG21  1 
ATOM   607   H  HG22  . THR A 1 37  ? -18.267 4.025   -37.662 1.00 51.05 ? 37  THR A HG22  1 
ATOM   608   H  HG23  . THR A 1 37  ? -17.223 4.726   -36.734 1.00 51.05 ? 37  THR A HG23  1 
ATOM   609   N  N     . LYS A 1 38  ? -18.592 2.339   -33.013 1.00 40.46 ? 38  LYS A N     1 
ATOM   610   C  CA    . LYS A 1 38  ? -19.197 1.533   -31.965 1.00 36.41 ? 38  LYS A CA    1 
ATOM   611   C  C     . LYS A 1 38  ? -19.634 0.160   -32.490 1.00 35.62 ? 38  LYS A C     1 
ATOM   612   O  O     . LYS A 1 38  ? -19.615 -0.825  -31.747 1.00 39.30 ? 38  LYS A O     1 
ATOM   613   C  CB    . LYS A 1 38  ? -20.415 2.265   -31.386 1.00 40.87 ? 38  LYS A CB    1 
ATOM   614   C  CG    . LYS A 1 38  ? -21.406 2.738   -32.471 1.00 57.12 ? 38  LYS A CG    1 
ATOM   615   C  CD    . LYS A 1 38  ? -22.762 3.174   -31.897 1.00 55.89 ? 38  LYS A CD    1 
ATOM   616   C  CE    . LYS A 1 38  ? -23.707 3.654   -32.990 1.00 57.67 ? 38  LYS A CE    1 
ATOM   617   N  NZ    . LYS A 1 38  ? -24.809 4.482   -32.428 1.00 66.66 ? 38  LYS A NZ    1 
ATOM   618   H  H     . LYS A 1 38  ? -18.998 3.083   -33.159 1.00 48.49 ? 38  LYS A H     1 
ATOM   619   H  HA    . LYS A 1 38  ? -18.547 1.396   -31.245 1.00 43.63 ? 38  LYS A HA    1 
ATOM   620   H  HB2   . LYS A 1 38  ? -20.889 1.665   -30.788 1.00 48.98 ? 38  LYS A HB2   1 
ATOM   621   H  HB3   . LYS A 1 38  ? -20.111 3.047   -30.898 1.00 48.98 ? 38  LYS A HB3   1 
ATOM   622   H  HG2   . LYS A 1 38  ? -21.023 3.495   -32.940 1.00 68.48 ? 38  LYS A HG2   1 
ATOM   623   H  HG3   . LYS A 1 38  ? -21.565 2.009   -33.091 1.00 68.48 ? 38  LYS A HG3   1 
ATOM   624   H  HD2   . LYS A 1 38  ? -23.176 2.421   -31.448 1.00 67.00 ? 38  LYS A HD2   1 
ATOM   625   H  HD3   . LYS A 1 38  ? -22.625 3.903   -31.273 1.00 67.00 ? 38  LYS A HD3   1 
ATOM   626   H  HE2   . LYS A 1 38  ? -23.213 4.195   -33.626 1.00 69.14 ? 38  LYS A HE2   1 
ATOM   627   H  HE3   . LYS A 1 38  ? -24.100 2.886   -33.435 1.00 69.14 ? 38  LYS A HE3   1 
ATOM   628   H  HZ1   . LYS A 1 38  ? -25.280 4.006   -31.843 1.00 79.93 ? 38  LYS A HZ1   1 
ATOM   629   H  HZ2   . LYS A 1 38  ? -24.473 5.196   -32.017 1.00 79.93 ? 38  LYS A HZ2   1 
ATOM   630   H  HZ3   . LYS A 1 38  ? -25.350 4.753   -33.082 1.00 79.93 ? 38  LYS A HZ3   1 
ATOM   631   N  N     . THR A 1 39  ? -19.999 0.099   -33.766 1.00 31.33 ? 39  THR A N     1 
ATOM   632   C  CA    . THR A 1 39  ? -20.639 -1.096  -34.324 1.00 34.66 ? 39  THR A CA    1 
ATOM   633   C  C     . THR A 1 39  ? -19.976 -1.650  -35.586 1.00 33.53 ? 39  THR A C     1 
ATOM   634   O  O     . THR A 1 39  ? -20.490 -2.582  -36.201 1.00 35.40 ? 39  THR A O     1 
ATOM   635   C  CB    . THR A 1 39  ? -22.121 -0.821  -34.658 1.00 35.14 ? 39  THR A CB    1 
ATOM   636   O  OG1   . THR A 1 39  ? -22.218 0.200   -35.661 1.00 36.76 ? 39  THR A OG1   1 
ATOM   637   C  CG2   . THR A 1 39  ? -22.897 -0.407  -33.409 1.00 36.11 ? 39  THR A CG2   1 
ATOM   638   H  H     . THR A 1 39  ? -19.889 0.736   -34.333 1.00 37.53 ? 39  THR A H     1 
ATOM   639   H  HA    . THR A 1 39  ? -20.616 -1.804  -33.646 1.00 41.53 ? 39  THR A HA    1 
ATOM   640   H  HB    . THR A 1 39  ? -22.521 -1.635  -35.000 1.00 42.10 ? 39  THR A HB    1 
ATOM   641   H  HG1   . THR A 1 39  ? -21.874 0.893   -35.391 1.00 44.06 ? 39  THR A HG1   1 
ATOM   642   H  HG21  . THR A 1 39  ? -23.815 -0.240  -33.634 1.00 43.27 ? 39  THR A HG21  1 
ATOM   643   H  HG22  . THR A 1 39  ? -22.859 -1.107  -32.753 1.00 43.27 ? 39  THR A HG22  1 
ATOM   644   H  HG23  . THR A 1 39  ? -22.516 0.391   -33.036 1.00 43.27 ? 39  THR A HG23  1 
ATOM   645   N  N     . SER A 1 40  ? -18.841 -1.086  -35.985 1.00 27.00 ? 40  SER A N     1 
ATOM   646   C  CA    . SER A 1 40  ? -18.145 -1.574  -37.156 1.00 29.24 ? 40  SER A CA    1 
ATOM   647   C  C     . SER A 1 40  ? -17.581 -2.958  -36.819 1.00 19.93 ? 40  SER A C     1 
ATOM   648   O  O     . SER A 1 40  ? -17.043 -3.165  -35.722 1.00 24.54 ? 40  SER A O     1 
ATOM   649   C  CB    . SER A 1 40  ? -16.998 -0.624  -37.525 1.00 28.44 ? 40  SER A CB    1 
ATOM   650   O  OG    . SER A 1 40  ? -16.169 -0.422  -36.399 1.00 27.01 ? 40  SER A OG    1 
ATOM   651   H  H     . SER A 1 40  ? -18.459 -0.422  -35.593 1.00 32.34 ? 40  SER A H     1 
ATOM   652   H  HA    . SER A 1 40  ? -18.762 -1.649  -37.913 1.00 35.03 ? 40  SER A HA    1 
ATOM   653   H  HB2   . SER A 1 40  ? -16.475 -1.018  -38.241 1.00 34.07 ? 40  SER A HB2   1 
ATOM   654   H  HB3   . SER A 1 40  ? -17.367 0.227   -37.808 1.00 34.07 ? 40  SER A HB3   1 
ATOM   655   H  HG    . SER A 1 40  ? -15.554 0.085   -36.591 1.00 32.35 ? 40  SER A HG    1 
ATOM   656   N  N     . GLY A 1 41  ? -17.718 -3.891  -37.756 1.00 26.76 ? 41  GLY A N     1 
ATOM   657   C  CA    . GLY A 1 41  ? -17.160 -5.225  -37.580 1.00 22.94 ? 41  GLY A CA    1 
ATOM   658   C  C     . GLY A 1 41  ? -17.948 -6.261  -38.345 1.00 20.44 ? 41  GLY A C     1 
ATOM   659   O  O     . GLY A 1 41  ? -18.852 -5.941  -39.142 1.00 18.20 ? 41  GLY A O     1 
ATOM   660   H  H     . GLY A 1 41  ? -18.130 -3.776  -38.502 1.00 32.05 ? 41  GLY A H     1 
ATOM   661   H  HA2   . GLY A 1 41  ? -16.243 -5.239  -37.894 1.00 27.46 ? 41  GLY A HA2   1 
ATOM   662   H  HA3   . GLY A 1 41  ? -17.169 -5.461  -36.639 1.00 27.46 ? 41  GLY A HA3   1 
ATOM   663   N  N     . ALA A 1 42  ? -17.595 -7.523  -38.128 1.00 18.96 ? 42  ALA A N     1 
ATOM   664   C  CA    . ALA A 1 42  ? -18.276 -8.637  -38.776 1.00 18.00 ? 42  ALA A CA    1 
ATOM   665   C  C     . ALA A 1 42  ? -18.666 -9.700  -37.783 1.00 21.66 ? 42  ALA A C     1 
ATOM   666   O  O     . ALA A 1 42  ? -18.075 -9.798  -36.728 1.00 15.44 ? 42  ALA A O     1 
ATOM   667   C  CB    . ALA A 1 42  ? -17.370 -9.257  -39.854 1.00 25.60 ? 42  ALA A CB    1 
ATOM   668   H  H     . ALA A 1 42  ? -16.956 -7.763  -37.604 1.00 22.69 ? 42  ALA A H     1 
ATOM   669   H  HA    . ALA A 1 42  ? -19.091 -8.309  -39.210 1.00 21.54 ? 42  ALA A HA    1 
ATOM   670   H  HB1   . ALA A 1 42  ? -17.834 -9.987  -40.269 1.00 30.66 ? 42  ALA A HB1   1 
ATOM   671   H  HB2   . ALA A 1 42  ? -17.161 -8.586  -40.508 1.00 30.66 ? 42  ALA A HB2   1 
ATOM   672   H  HB3   . ALA A 1 42  ? -16.564 -9.573  -39.440 1.00 30.66 ? 42  ALA A HB3   1 
ATOM   673   N  N     . VAL A 1 43  ? -19.633 -10.539 -38.157 1.00 16.55 ? 43  VAL A N     1 
ATOM   674   C  CA    . VAL A 1 43  ? -20.104 -11.607 -37.294 1.00 15.90 ? 43  VAL A CA    1 
ATOM   675   C  C     . VAL A 1 43  ? -19.156 -12.787 -37.448 1.00 16.06 ? 43  VAL A C     1 
ATOM   676   O  O     . VAL A 1 43  ? -18.911 -13.223 -38.574 1.00 13.95 ? 43  VAL A O     1 
ATOM   677   C  CB    . VAL A 1 43  ? -21.505 -12.058 -37.716 1.00 22.56 ? 43  VAL A CB    1 
ATOM   678   C  CG1   . VAL A 1 43  ? -21.906 -13.339 -36.993 1.00 16.57 ? 43  VAL A CG1   1 
ATOM   679   C  CG2   . VAL A 1 43  ? -22.501 -10.942 -37.462 1.00 23.17 ? 43  VAL A CG2   1 
ATOM   680   H  H     . VAL A 1 43  ? -20.033 -10.505 -38.918 1.00 19.79 ? 43  VAL A H     1 
ATOM   681   H  HA    . VAL A 1 43  ? -20.119 -11.316 -36.358 1.00 19.02 ? 43  VAL A HA    1 
ATOM   682   H  HB    . VAL A 1 43  ? -21.501 -12.244 -38.678 1.00 27.02 ? 43  VAL A HB    1 
ATOM   683   H  HG11  . VAL A 1 43  ? -22.786 -13.595 -37.278 1.00 19.82 ? 43  VAL A HG11  1 
ATOM   684   H  HG12  . VAL A 1 43  ? -21.277 -14.030 -37.211 1.00 19.82 ? 43  VAL A HG12  1 
ATOM   685   H  HG13  . VAL A 1 43  ? -21.901 -13.178 -36.047 1.00 19.82 ? 43  VAL A HG13  1 
ATOM   686   H  HG21  . VAL A 1 43  ? -22.038 -10.189 -37.089 1.00 27.74 ? 43  VAL A HG21  1 
ATOM   687   H  HG22  . VAL A 1 43  ? -22.912 -10.695 -38.293 1.00 27.74 ? 43  VAL A HG22  1 
ATOM   688   H  HG23  . VAL A 1 43  ? -23.168 -11.254 -36.846 1.00 27.74 ? 43  VAL A HG23  1 
ATOM   689   N  N     . ALA A 1 44  ? -18.658 -13.299 -36.327 1.00 14.73 ? 44  ALA A N     1 
ATOM   690   C  CA    . ALA A 1 44  ? -17.863 -14.540 -36.326 1.00 17.54 ? 44  ALA A CA    1 
ATOM   691   C  C     . ALA A 1 44  ? -18.792 -15.753 -36.361 1.00 16.69 ? 44  ALA A C     1 
ATOM   692   O  O     . ALA A 1 44  ? -18.572 -16.719 -37.110 1.00 18.02 ? 44  ALA A O     1 
ATOM   693   C  CB    . ALA A 1 44  ? -16.941 -14.622 -35.085 1.00 19.36 ? 44  ALA A CB    1 
ATOM   694   H  H     . ALA A 1 44  ? -18.762 -12.951 -35.548 1.00 17.62 ? 44  ALA A H     1 
ATOM   695   H  HA    . ALA A 1 44  ? -17.300 -14.562 -37.128 1.00 20.99 ? 44  ALA A HA    1 
ATOM   696   H  HB1   . ALA A 1 44  ? -17.482 -14.602 -34.293 1.00 23.17 ? 44  ALA A HB1   1 
ATOM   697   H  HB2   . ALA A 1 44  ? -16.442 -15.441 -35.121 1.00 23.17 ? 44  ALA A HB2   1 
ATOM   698   H  HB3   . ALA A 1 44  ? -16.342 -13.872 -35.092 1.00 23.17 ? 44  ALA A HB3   1 
ATOM   699   N  N     . THR A 1 45  ? -19.815 -15.730 -35.519 1.00 16.93 ? 45  THR A N     1 
ATOM   700   C  CA    . THR A 1 45  ? -20.823 -16.758 -35.613 1.00 16.07 ? 45  THR A CA    1 
ATOM   701   C  C     . THR A 1 45  ? -22.037 -16.389 -34.814 1.00 18.74 ? 45  THR A C     1 
ATOM   702   O  O     . THR A 1 45  ? -22.002 -15.470 -33.972 1.00 17.23 ? 45  THR A O     1 
ATOM   703   C  CB    . THR A 1 45  ? -20.273 -18.104 -35.206 1.00 31.27 ? 45  THR A CB    1 
ATOM   704   O  OG1   . THR A 1 45  ? -21.096 -19.146 -35.762 1.00 28.73 ? 45  THR A OG1   1 
ATOM   705   C  CG2   . THR A 1 45  ? -20.201 -18.216 -33.714 1.00 18.12 ? 45  THR A CG2   1 
ATOM   706   H  H     . THR A 1 45  ? -19.942 -15.144 -34.902 1.00 20.26 ? 45  THR A H     1 
ATOM   707   H  HA    . THR A 1 45  ? -21.102 -16.829 -36.549 1.00 19.22 ? 45  THR A HA    1 
ATOM   708   H  HB    . THR A 1 45  ? -19.373 -18.195 -35.556 1.00 37.47 ? 45  THR A HB    1 
ATOM   709   H  HG1   . THR A 1 45  ? -21.101 -19.092 -36.580 1.00 34.42 ? 45  THR A HG1   1 
ATOM   710   H  HG21  . THR A 1 45  ? -21.078 -18.115 -33.336 1.00 21.68 ? 45  THR A HG21  1 
ATOM   711   H  HG22  . THR A 1 45  ? -19.851 -19.074 -33.466 1.00 21.68 ? 45  THR A HG22  1 
ATOM   712   H  HG23  . THR A 1 45  ? -19.628 -17.531 -33.362 1.00 21.68 ? 45  THR A HG23  1 
ATOM   713   N  N     . ALA A 1 46  ? -23.124 -17.097 -35.091 1.00 15.56 ? 46  ALA A N     1 
ATOM   714   C  CA    . ALA A 1 46  ? -24.380 -16.856 -34.384 1.00 21.15 ? 46  ALA A CA    1 
ATOM   715   C  C     . ALA A 1 46  ? -24.917 -18.201 -33.960 1.00 18.75 ? 46  ALA A C     1 
ATOM   716   O  O     . ALA A 1 46  ? -24.703 -19.201 -34.645 1.00 18.43 ? 46  ALA A O     1 
ATOM   717   C  CB    . ALA A 1 46  ? -25.373 -16.175 -35.294 1.00 21.45 ? 46  ALA A CB    1 
ATOM   718   H  H     . ALA A 1 46  ? -23.164 -17.721 -35.681 1.00 18.62 ? 46  ALA A H     1 
ATOM   719   H  HA    . ALA A 1 46  ? -24.227 -16.300 -33.592 1.00 25.31 ? 46  ALA A HA    1 
ATOM   720   H  HB1   . ALA A 1 46  ? -25.007 -15.337 -35.584 1.00 25.67 ? 46  ALA A HB1   1 
ATOM   721   H  HB2   . ALA A 1 46  ? -25.540 -16.740 -36.052 1.00 25.67 ? 46  ALA A HB2   1 
ATOM   722   H  HB3   . ALA A 1 46  ? -26.189 -16.027 -34.810 1.00 25.67 ? 46  ALA A HB3   1 
ATOM   723   N  N     . ASN A 1 47  ? -25.649 -18.229 -32.860 1.00 18.21 ? 47  ASN A N     1 
ATOM   724   C  CA    . ASN A 1 47  ? -26.313 -19.449 -32.492 1.00 14.72 ? 47  ASN A CA    1 
ATOM   725   C  C     . ASN A 1 47  ? -27.499 -19.718 -33.435 1.00 17.92 ? 47  ASN A C     1 
ATOM   726   O  O     . ASN A 1 47  ? -27.860 -18.879 -34.268 1.00 16.57 ? 47  ASN A O     1 
ATOM   727   C  CB    . ASN A 1 47  ? -26.662 -19.460 -30.999 1.00 17.45 ? 47  ASN A CB    1 
ATOM   728   C  CG    . ASN A 1 47  ? -27.791 -18.482 -30.624 1.00 18.60 ? 47  ASN A CG    1 
ATOM   729   O  OD1   . ASN A 1 47  ? -28.347 -17.781 -31.465 1.00 16.33 ? 47  ASN A OD1   1 
ATOM   730   N  ND2   . ASN A 1 47  ? -28.104 -18.443 -29.341 1.00 17.88 ? 47  ASN A ND2   1 
ATOM   731   H  H     . ASN A 1 47  ? -25.772 -17.568 -32.324 1.00 21.79 ? 47  ASN A H     1 
ATOM   732   H  HA    . ASN A 1 47  ? -25.679 -20.183 -32.632 1.00 17.60 ? 47  ASN A HA    1 
ATOM   733   H  HB2   . ASN A 1 47  ? -26.948 -20.353 -30.750 1.00 20.88 ? 47  ASN A HB2   1 
ATOM   734   H  HB3   . ASN A 1 47  ? -25.874 -19.213 -30.491 1.00 20.88 ? 47  ASN A HB3   1 
ATOM   735   H  HD21  . ASN A 1 47  ? -28.727 -17.917 -29.067 1.00 21.39 ? 47  ASN A HD21  1 
ATOM   736   H  HD22  . ASN A 1 47  ? -27.685 -18.943 -28.781 1.00 21.39 ? 47  ASN A HD22  1 
ATOM   737   N  N     . TYR A 1 48  ? -28.082 -20.906 -33.350 1.00 19.95 ? 48  TYR A N     1 
ATOM   738   C  CA    . TYR A 1 48  ? -29.090 -21.292 -34.336 1.00 23.76 ? 48  TYR A CA    1 
ATOM   739   C  C     . TYR A 1 48  ? -30.326 -20.389 -34.269 1.00 23.48 ? 48  TYR A C     1 
ATOM   740   O  O     . TYR A 1 48  ? -30.932 -20.104 -35.296 1.00 22.56 ? 48  TYR A O     1 
ATOM   741   C  CB    . TYR A 1 48  ? -29.441 -22.772 -34.194 1.00 22.86 ? 48  TYR A CB    1 
ATOM   742   C  CG    . TYR A 1 48  ? -28.230 -23.677 -34.338 1.00 29.41 ? 48  TYR A CG    1 
ATOM   743   C  CD1   . TYR A 1 48  ? -27.257 -23.424 -35.294 1.00 33.17 ? 48  TYR A CD1   1 
ATOM   744   C  CD2   . TYR A 1 48  ? -28.043 -24.761 -33.495 1.00 36.23 ? 48  TYR A CD2   1 
ATOM   745   C  CE1   . TYR A 1 48  ? -26.153 -24.239 -35.433 1.00 24.58 ? 48  TYR A CE1   1 
ATOM   746   C  CE2   . TYR A 1 48  ? -26.937 -25.578 -33.621 1.00 38.69 ? 48  TYR A CE2   1 
ATOM   747   C  CZ    . TYR A 1 48  ? -25.995 -25.305 -34.600 1.00 28.17 ? 48  TYR A CZ    1 
ATOM   748   O  OH    . TYR A 1 48  ? -24.892 -26.115 -34.731 1.00 39.72 ? 48  TYR A OH    1 
ATOM   749   H  H     . TYR A 1 48  ? -27.919 -21.497 -32.747 1.00 23.88 ? 48  TYR A H     1 
ATOM   750   H  HA    . TYR A 1 48  ? -28.701 -21.175 -35.228 1.00 28.45 ? 48  TYR A HA    1 
ATOM   751   H  HB2   . TYR A 1 48  ? -29.827 -22.923 -33.317 1.00 27.37 ? 48  TYR A HB2   1 
ATOM   752   H  HB3   . TYR A 1 48  ? -30.080 -23.014 -34.883 1.00 27.37 ? 48  TYR A HB3   1 
ATOM   753   H  HD1   . TYR A 1 48  ? -27.363 -22.701 -35.869 1.00 39.75 ? 48  TYR A HD1   1 
ATOM   754   H  HD2   . TYR A 1 48  ? -28.678 -24.948 -32.841 1.00 43.42 ? 48  TYR A HD2   1 
ATOM   755   H  HE1   . TYR A 1 48  ? -25.516 -24.056 -36.085 1.00 29.44 ? 48  TYR A HE1   1 
ATOM   756   H  HE2   . TYR A 1 48  ? -26.828 -26.308 -33.055 1.00 46.37 ? 48  TYR A HE2   1 
ATOM   757   H  HH    . TYR A 1 48  ? -24.208 -25.678 -34.621 1.00 47.60 ? 48  TYR A HH    1 
ATOM   758   N  N     . GLU A 1 49  ? -30.667 -19.911 -33.075 1.00 19.43 ? 49  GLU A N     1 
ATOM   759   C  CA    . GLU A 1 49  ? -31.787 -18.977 -32.896 1.00 21.15 ? 49  GLU A CA    1 
ATOM   760   C  C     . GLU A 1 49  ? -31.578 -17.685 -33.675 1.00 28.54 ? 49  GLU A C     1 
ATOM   761   O  O     . GLU A 1 49  ? -32.518 -17.135 -34.250 1.00 20.35 ? 49  GLU A O     1 
ATOM   762   C  CB    . GLU A 1 49  ? -32.007 -18.648 -31.405 1.00 22.76 ? 49  GLU A CB    1 
ATOM   763   C  CG    . GLU A 1 49  ? -32.553 -19.816 -30.543 1.00 30.61 ? 49  GLU A CG    1 
ATOM   764   C  CD    . GLU A 1 49  ? -31.519 -20.890 -30.203 1.00 38.82 ? 49  GLU A CD    1 
ATOM   765   O  OE1   . GLU A 1 49  ? -30.287 -20.656 -30.376 1.00 24.17 ? 49  GLU A OE1   1 
ATOM   766   O  OE2   . GLU A 1 49  ? -31.949 -21.987 -29.773 1.00 32.26 ? 49  GLU A OE2   1 
ATOM   767   H  H     . GLU A 1 49  ? -30.263 -20.112 -32.343 1.00 23.26 ? 49  GLU A H     1 
ATOM   768   H  HA    . GLU A 1 49  ? -32.605 -19.399 -33.232 1.00 25.32 ? 49  GLU A HA    1 
ATOM   769   H  HB2   . GLU A 1 49  ? -31.159 -18.374 -31.022 1.00 27.26 ? 49  GLU A HB2   1 
ATOM   770   H  HB3   . GLU A 1 49  ? -32.643 -17.917 -31.342 1.00 27.26 ? 49  GLU A HB3   1 
ATOM   771   H  HG2   . GLU A 1 49  ? -32.887 -19.455 -29.707 1.00 36.67 ? 49  GLU A HG2   1 
ATOM   772   H  HG3   . GLU A 1 49  ? -33.276 -20.246 -31.026 1.00 36.67 ? 49  GLU A HG3   1 
ATOM   773   N  N     . ALA A 1 50  ? -30.344 -17.181 -33.680 1.00 16.33 ? 50  ALA A N     1 
ATOM   774   C  CA    . ALA A 1 50  ? -30.013 -16.005 -34.460 1.00 13.80 ? 50  ALA A CA    1 
ATOM   775   C  C     . ALA A 1 50  ? -29.973 -16.307 -35.939 1.00 17.43 ? 50  ALA A C     1 
ATOM   776   O  O     . ALA A 1 50  ? -30.383 -15.462 -36.738 1.00 19.87 ? 50  ALA A O     1 
ATOM   777   C  CB    . ALA A 1 50  ? -28.701 -15.394 -34.015 1.00 16.25 ? 50  ALA A CB    1 
ATOM   778   H  H     . ALA A 1 50  ? -29.683 -17.508 -33.237 1.00 19.53 ? 50  ALA A H     1 
ATOM   779   H  HA    . ALA A 1 50  ? -30.712 -15.333 -34.317 1.00 16.50 ? 50  ALA A HA    1 
ATOM   780   H  HB1   . ALA A 1 50  ? -28.002 -16.042 -34.125 1.00 19.44 ? 50  ALA A HB1   1 
ATOM   781   H  HB2   . ALA A 1 50  ? -28.518 -14.620 -34.554 1.00 19.44 ? 50  ALA A HB2   1 
ATOM   782   H  HB3   . ALA A 1 50  ? -28.772 -15.141 -33.092 1.00 19.44 ? 50  ALA A HB3   1 
ATOM   783   N  N     . ARG A 1 51  ? -29.503 -17.499 -36.319 1.00 17.65 ? 51  ARG A N     1 
ATOM   784   C  CA    . ARG A 1 51  ? -29.475 -17.870 -37.725 1.00 18.59 ? 51  ARG A CA    1 
ATOM   785   C  C     . ARG A 1 51  ? -30.897 -17.921 -38.315 1.00 25.17 ? 51  ARG A C     1 
ATOM   786   O  O     . ARG A 1 51  ? -31.116 -17.610 -39.492 1.00 21.68 ? 51  ARG A O     1 
ATOM   787   C  CB    . ARG A 1 51  ? -28.761 -19.207 -37.929 1.00 24.31 ? 51  ARG A CB    1 
ATOM   788   C  CG    . ARG A 1 51  ? -27.248 -19.127 -37.702 1.00 18.36 ? 51  ARG A CG    1 
ATOM   789   C  CD    . ARG A 1 51  ? -26.592 -20.462 -37.879 1.00 22.91 ? 51  ARG A CD    1 
ATOM   790   N  NE    . ARG A 1 51  ? -25.334 -20.510 -37.139 1.00 23.81 ? 51  ARG A NE    1 
ATOM   791   C  CZ    . ARG A 1 51  ? -24.443 -21.481 -37.257 1.00 26.70 ? 51  ARG A CZ    1 
ATOM   792   N  NH1   . ARG A 1 51  ? -24.683 -22.485 -38.081 1.00 20.77 ? 51  ARG A NH1   1 
ATOM   793   N  NH2   . ARG A 1 51  ? -23.302 -21.432 -36.560 1.00 23.38 ? 51  ARG A NH2   1 
ATOM   794   H  H     . ARG A 1 51  ? -29.199 -18.100 -35.785 1.00 21.11 ? 51  ARG A H     1 
ATOM   795   H  HA    . ARG A 1 51  ? -28.974 -17.188 -38.219 1.00 22.25 ? 51  ARG A HA    1 
ATOM   796   H  HB2   . ARG A 1 51  ? -29.122 -19.855 -37.304 1.00 29.11 ? 51  ARG A HB2   1 
ATOM   797   H  HB3   . ARG A 1 51  ? -28.910 -19.508 -38.839 1.00 29.11 ? 51  ARG A HB3   1 
ATOM   798   H  HG2   . ARG A 1 51  ? -26.861 -18.511 -38.343 1.00 21.97 ? 51  ARG A HG2   1 
ATOM   799   H  HG3   . ARG A 1 51  ? -27.077 -18.822 -36.797 1.00 21.97 ? 51  ARG A HG3   1 
ATOM   800   H  HD2   . ARG A 1 51  ? -27.176 -21.158 -37.540 1.00 27.43 ? 51  ARG A HD2   1 
ATOM   801   H  HD3   . ARG A 1 51  ? -26.402 -20.607 -38.819 1.00 27.43 ? 51  ARG A HD3   1 
ATOM   802   H  HE    . ARG A 1 51  ? -25.132 -19.836 -36.644 1.00 28.51 ? 51  ARG A HE    1 
ATOM   803   H  HH11  . ARG A 1 51  ? -25.415 -22.506 -38.533 1.00 24.86 ? 51  ARG A HH11  1 
ATOM   804   H  HH12  . ARG A 1 51  ? -24.109 -23.121 -38.163 1.00 24.86 ? 51  ARG A HH12  1 
ATOM   805   H  HH21  . ARG A 1 51  ? -23.154 -20.777 -36.023 1.00 27.99 ? 51  ARG A HH21  1 
ATOM   806   H  HH22  . ARG A 1 51  ? -22.728 -22.068 -36.632 1.00 27.99 ? 51  ARG A HH22  1 
ATOM   807   N  N     . LYS A 1 52  ? -31.862 -18.337 -37.505 1.00 25.88 ? 52  LYS A N     1 
ATOM   808   C  CA    . LYS A 1 52  ? -33.239 -18.405 -37.981 1.00 25.89 ? 52  LYS A CA    1 
ATOM   809   C  C     . LYS A 1 52  ? -33.754 -17.043 -38.419 1.00 24.50 ? 52  LYS A C     1 
ATOM   810   O  O     . LYS A 1 52  ? -34.721 -16.969 -39.172 1.00 29.97 ? 52  LYS A O     1 
ATOM   811   C  CB    . LYS A 1 52  ? -34.150 -18.981 -36.913 1.00 23.76 ? 52  LYS A CB    1 
ATOM   812   C  CG    . LYS A 1 52  ? -33.917 -20.471 -36.637 1.00 31.37 ? 52  LYS A CG    1 
ATOM   813   C  CD    . LYS A 1 52  ? -34.959 -20.951 -35.620 1.00 40.30 ? 52  LYS A CD    1 
ATOM   814   C  CE    . LYS A 1 52  ? -34.657 -22.331 -35.049 1.00 50.92 ? 52  LYS A CE    1 
ATOM   815   N  NZ    . LYS A 1 52  ? -35.314 -22.485 -33.703 1.00 63.71 ? 52  LYS A NZ    1 
ATOM   816   H  H     . LYS A 1 52  ? -31.750 -18.582 -36.688 1.00 30.99 ? 52  LYS A H     1 
ATOM   817   H  HA    . LYS A 1 52  ? -33.275 -19.001 -38.758 1.00 31.00 ? 52  LYS A HA    1 
ATOM   818   H  HB2   . LYS A 1 52  ? -34.002 -18.499 -36.084 1.00 28.45 ? 52  LYS A HB2   1 
ATOM   819   H  HB3   . LYS A 1 52  ? -35.071 -18.873 -37.196 1.00 28.45 ? 52  LYS A HB3   1 
ATOM   820   H  HG2   . LYS A 1 52  ? -34.023 -20.979 -37.457 1.00 37.59 ? 52  LYS A HG2   1 
ATOM   821   H  HG3   . LYS A 1 52  ? -33.031 -20.602 -36.263 1.00 37.59 ? 52  LYS A HG3   1 
ATOM   822   H  HD2   . LYS A 1 52  ? -34.989 -20.323 -34.881 1.00 48.30 ? 52  LYS A HD2   1 
ATOM   823   H  HD3   . LYS A 1 52  ? -35.826 -20.991 -36.053 1.00 48.30 ? 52  LYS A HD3   1 
ATOM   824   H  HE2   . LYS A 1 52  ? -35.007 -23.012 -35.644 1.00 61.05 ? 52  LYS A HE2   1 
ATOM   825   H  HE3   . LYS A 1 52  ? -33.699 -22.435 -34.939 1.00 61.05 ? 52  LYS A HE3   1 
ATOM   826   H  HZ1   . LYS A 1 52  ? -35.007 -21.866 -33.142 1.00 76.39 ? 52  LYS A HZ1   1 
ATOM   827   H  HZ2   . LYS A 1 52  ? -36.195 -22.391 -33.782 1.00 76.39 ? 52  LYS A HZ2   1 
ATOM   828   H  HZ3   . LYS A 1 52  ? -35.138 -23.291 -33.369 1.00 76.39 ? 52  LYS A HZ3   1 
ATOM   829   N  N     . LEU A 1 53  ? -33.126 -15.971 -37.927 1.00 22.39 ? 53  LEU A N     1 
ATOM   830   C  CA    . LEU A 1 53  ? -33.502 -14.602 -38.264 1.00 20.36 ? 53  LEU A CA    1 
ATOM   831   C  C     . LEU A 1 53  ? -32.685 -13.986 -39.411 1.00 23.90 ? 53  LEU A C     1 
ATOM   832   O  O     . LEU A 1 53  ? -32.890 -12.838 -39.784 1.00 23.92 ? 53  LEU A O     1 
ATOM   833   C  CB    . LEU A 1 53  ? -33.373 -13.724 -37.041 1.00 21.16 ? 53  LEU A CB    1 
ATOM   834   C  CG    . LEU A 1 53  ? -34.211 -14.191 -35.840 1.00 22.25 ? 53  LEU A CG    1 
ATOM   835   C  CD1   . LEU A 1 53  ? -34.012 -13.242 -34.705 1.00 23.56 ? 53  LEU A CD1   1 
ATOM   836   C  CD2   . LEU A 1 53  ? -35.683 -14.239 -36.243 1.00 25.03 ? 53  LEU A CD2   1 
ATOM   837   H  H     . LEU A 1 53  ? -32.463 -16.017 -37.382 1.00 26.81 ? 53  LEU A H     1 
ATOM   838   H  HA    . LEU A 1 53  ? -34.444 -14.595 -38.535 1.00 24.37 ? 53  LEU A HA    1 
ATOM   839   H  HB2   . LEU A 1 53  ? -32.443 -13.710 -36.765 1.00 25.33 ? 53  LEU A HB2   1 
ATOM   840   H  HB3   . LEU A 1 53  ? -33.660 -12.827 -37.271 1.00 25.33 ? 53  LEU A HB3   1 
ATOM   841   H  HG    . LEU A 1 53  ? -33.930 -15.077 -35.563 1.00 26.63 ? 53  LEU A HG    1 
ATOM   842   H  HD11  . LEU A 1 53  ? -34.536 -13.536 -33.957 1.00 28.21 ? 53  LEU A HD11  1 
ATOM   843   H  HD12  . LEU A 1 53  ? -33.081 -13.229 -34.469 1.00 28.21 ? 53  LEU A HD12  1 
ATOM   844   H  HD13  . LEU A 1 53  ? -34.293 -12.365 -34.978 1.00 28.21 ? 53  LEU A HD13  1 
ATOM   845   H  HD21  . LEU A 1 53  ? -35.786 -14.855 -36.972 1.00 29.97 ? 53  LEU A HD21  1 
ATOM   846   H  HD22  . LEU A 1 53  ? -36.203 -14.530 -35.491 1.00 29.97 ? 53  LEU A HD22  1 
ATOM   847   H  HD23  . LEU A 1 53  ? -35.961 -13.361 -36.514 1.00 29.97 ? 53  LEU A HD23  1 
ATOM   848   N  N     . GLY A 1 54  ? -31.748 -14.750 -39.942 1.00 18.23 ? 54  GLY A N     1 
ATOM   849   C  CA    . GLY A 1 54  ? -30.995 -14.326 -41.113 1.00 24.21 ? 54  GLY A CA    1 
ATOM   850   C  C     . GLY A 1 54  ? -29.534 -13.972 -40.794 1.00 25.99 ? 54  GLY A C     1 
ATOM   851   O  O     . GLY A 1 54  ? -28.765 -13.597 -41.676 1.00 27.91 ? 54  GLY A O     1 
ATOM   852   H  H     . GLY A 1 54  ? -31.525 -15.525 -39.643 1.00 21.81 ? 54  GLY A H     1 
ATOM   853   H  HA2   . GLY A 1 54  ? -30.999 -15.038 -41.772 1.00 28.99 ? 54  GLY A HA2   1 
ATOM   854   H  HA3   . GLY A 1 54  ? -31.420 -13.546 -41.502 1.00 28.99 ? 54  GLY A HA3   1 
ATOM   855   N  N     . VAL A 1 55  ? -29.139 -14.101 -39.537 1.00 19.61 ? 55  VAL A N     1 
ATOM   856   C  CA    . VAL A 1 55  ? -27.760 -13.751 -39.164 1.00 17.43 ? 55  VAL A CA    1 
ATOM   857   C  C     . VAL A 1 55  ? -26.810 -14.838 -39.664 1.00 18.96 ? 55  VAL A C     1 
ATOM   858   O  O     . VAL A 1 55  ? -27.037 -16.045 -39.464 1.00 20.05 ? 55  VAL A O     1 
ATOM   859   C  CB    . VAL A 1 55  ? -27.640 -13.512 -37.623 1.00 23.34 ? 55  VAL A CB    1 
ATOM   860   C  CG1   . VAL A 1 55  ? -26.209 -13.126 -37.190 1.00 23.69 ? 55  VAL A CG1   1 
ATOM   861   C  CG2   . VAL A 1 55  ? -28.596 -12.427 -37.180 1.00 20.45 ? 55  VAL A CG2   1 
ATOM   862   H  H     . VAL A 1 55  ? -29.629 -14.382 -38.889 1.00 23.47 ? 55  VAL A H     1 
ATOM   863   H  HA    . VAL A 1 55  ? -27.516 -12.915 -39.614 1.00 20.86 ? 55  VAL A HA    1 
ATOM   864   H  HB    . VAL A 1 55  ? -27.884 -14.337 -37.155 1.00 27.95 ? 55  VAL A HB    1 
ATOM   865   H  HG11  . VAL A 1 55  ? -26.197 -12.992 -36.240 1.00 28.37 ? 55  VAL A HG11  1 
ATOM   866   H  HG12  . VAL A 1 55  ? -25.609 -13.837 -37.429 1.00 28.37 ? 55  VAL A HG12  1 
ATOM   867   H  HG13  . VAL A 1 55  ? -25.955 -12.317 -37.639 1.00 28.37 ? 55  VAL A HG13  1 
ATOM   868   H  HG21  . VAL A 1 55  ? -28.504 -12.298 -36.233 1.00 24.48 ? 55  VAL A HG21  1 
ATOM   869   H  HG22  . VAL A 1 55  ? -28.382 -11.614 -37.644 1.00 24.48 ? 55  VAL A HG22  1 
ATOM   870   H  HG23  . VAL A 1 55  ? -29.493 -12.697 -37.389 1.00 24.48 ? 55  VAL A HG23  1 
ATOM   871   N  N     . LYS A 1 56  ? -25.761 -14.424 -40.378 1.00 21.41 ? 56  LYS A N     1 
ATOM   872   C  CA    . LYS A 1 56  ? -24.794 -15.372 -40.914 1.00 21.00 ? 56  LYS A CA    1 
ATOM   873   C  C     . LYS A 1 56  ? -23.350 -14.951 -40.610 1.00 20.54 ? 56  LYS A C     1 
ATOM   874   O  O     . LYS A 1 56  ? -23.049 -13.770 -40.556 1.00 17.66 ? 56  LYS A O     1 
ATOM   875   C  CB    . LYS A 1 56  ? -24.955 -15.455 -42.437 1.00 28.41 ? 56  LYS A CB    1 
ATOM   876   C  CG    . LYS A 1 56  ? -26.228 -16.157 -42.901 1.00 45.54 ? 56  LYS A CG    1 
ATOM   877   C  CD    . LYS A 1 56  ? -26.248 -16.332 -44.411 1.00 49.37 ? 56  LYS A CD    1 
ATOM   878   C  CE    . LYS A 1 56  ? -26.143 -14.987 -45.110 1.00 62.85 ? 56  LYS A CE    1 
ATOM   879   N  NZ    . LYS A 1 56  ? -26.508 -15.025 -46.574 1.00 64.31 ? 56  LYS A NZ    1 
ATOM   880   H  H     . LYS A 1 56  ? -25.591 -13.602 -40.563 1.00 25.63 ? 56  LYS A H     1 
ATOM   881   H  HA    . LYS A 1 56  ? -24.952 -16.260 -40.530 1.00 25.14 ? 56  LYS A HA    1 
ATOM   882   H  HB2   . LYS A 1 56  ? -24.967 -14.555 -42.797 1.00 34.03 ? 56  LYS A HB2   1 
ATOM   883   H  HB3   . LYS A 1 56  ? -24.200 -15.943 -42.802 1.00 34.03 ? 56  LYS A HB3   1 
ATOM   884   H  HG2   . LYS A 1 56  ? -26.277 -17.035 -42.493 1.00 54.59 ? 56  LYS A HG2   1 
ATOM   885   H  HG3   . LYS A 1 56  ? -26.998 -15.625 -42.646 1.00 54.59 ? 56  LYS A HG3   1 
ATOM   886   H  HD2   . LYS A 1 56  ? -25.494 -16.878 -44.682 1.00 59.18 ? 56  LYS A HD2   1 
ATOM   887   H  HD3   . LYS A 1 56  ? -27.082 -16.750 -44.676 1.00 59.18 ? 56  LYS A HD3   1 
ATOM   888   H  HE2   . LYS A 1 56  ? -26.741 -14.360 -44.672 1.00 75.36 ? 56  LYS A HE2   1 
ATOM   889   H  HE3   . LYS A 1 56  ? -25.229 -14.670 -45.041 1.00 75.36 ? 56  LYS A HE3   1 
ATOM   890   H  HZ1   . LYS A 1 56  ? -25.968 -15.584 -47.007 1.00 77.11 ? 56  LYS A HZ1   1 
ATOM   891   H  HZ2   . LYS A 1 56  ? -27.348 -15.301 -46.671 1.00 77.11 ? 56  LYS A HZ2   1 
ATOM   892   H  HZ3   . LYS A 1 56  ? -26.428 -14.213 -46.929 1.00 77.11 ? 56  LYS A HZ3   1 
ATOM   893   N  N     . ALA A 1 57  ? -22.466 -15.923 -40.407 1.00 18.71 ? 57  ALA A N     1 
ATOM   894   C  CA    . ALA A 1 57  ? -21.036 -15.629 -40.199 1.00 20.08 ? 57  ALA A CA    1 
ATOM   895   C  C     . ALA A 1 57  ? -20.532 -14.788 -41.358 1.00 22.04 ? 57  ALA A C     1 
ATOM   896   O  O     . ALA A 1 57  ? -20.883 -15.054 -42.504 1.00 19.17 ? 57  ALA A O     1 
ATOM   897   C  CB    . ALA A 1 57  ? -20.232 -16.928 -40.109 1.00 20.84 ? 57  ALA A CB    1 
ATOM   898   H  H     . ALA A 1 57  ? -22.661 -16.760 -40.382 1.00 22.39 ? 57  ALA A H     1 
ATOM   899   H  HA    . ALA A 1 57  ? -20.917 -15.125 -39.367 1.00 24.03 ? 57  ALA A HA    1 
ATOM   900   H  HB1   . ALA A 1 57  ? -20.559 -17.447 -39.371 1.00 24.95 ? 57  ALA A HB1   1 
ATOM   901   H  HB2   . ALA A 1 57  ? -20.339 -17.419 -40.927 1.00 24.95 ? 57  ALA A HB2   1 
ATOM   902   H  HB3   . ALA A 1 57  ? -19.306 -16.714 -39.975 1.00 24.95 ? 57  ALA A HB3   1 
ATOM   903   N  N     . GLY A 1 58  ? -19.692 -13.803 -41.064 1.00 20.91 ? 58  GLY A N     1 
ATOM   904   C  CA    . GLY A 1 58  ? -19.069 -12.982 -42.086 1.00 20.19 ? 58  GLY A CA    1 
ATOM   905   C  C     . GLY A 1 58  ? -19.865 -11.715 -42.369 1.00 28.65 ? 58  GLY A C     1 
ATOM   906   O  O     . GLY A 1 58  ? -19.374 -10.771 -42.973 1.00 24.31 ? 58  GLY A O     1 
ATOM   907   H  H     . GLY A 1 58  ? -19.464 -13.589 -40.263 1.00 25.03 ? 58  GLY A H     1 
ATOM   908   H  HA2   . GLY A 1 58  ? -18.178 -12.728 -41.798 1.00 24.17 ? 58  GLY A HA2   1 
ATOM   909   H  HA3   . GLY A 1 58  ? -18.994 -13.490 -42.909 1.00 24.17 ? 58  GLY A HA3   1 
ATOM   910   N  N     . MET A 1 59  ? -21.115 -11.676 -41.934 1.00 20.46 ? 59  MET A N     1 
ATOM   911   C  CA    . MET A 1 59  ? -21.956 -10.530 -42.270 1.00 16.18 ? 59  MET A CA    1 
ATOM   912   C  C     . MET A 1 59  ? -21.567 -9.353  -41.399 1.00 21.88 ? 59  MET A C     1 
ATOM   913   O  O     . MET A 1 59  ? -21.181 -9.520  -40.234 1.00 22.10 ? 59  MET A O     1 
ATOM   914   C  CB    . MET A 1 59  ? -23.431 -10.941 -42.081 1.00 27.01 ? 59  MET A CB    1 
ATOM   915   C  CG    . MET A 1 59  ? -24.391 -9.898  -41.587 1.00 30.56 ? 59  MET A CG    1 
ATOM   916   S  SD    . MET A 1 59  ? -25.954 -10.728 -41.097 1.00 27.29 ? 59  MET A SD    1 
ATOM   917   C  CE    . MET A 1 59  ? -25.313 -11.554 -39.681 1.00 43.68 ? 59  MET A CE    1 
ATOM   918   H  H     . MET A 1 59  ? -21.496 -12.281 -41.456 1.00 24.48 ? 59  MET A H     1 
ATOM   919   H  HA    . MET A 1 59  ? -21.821 -10.294 -43.211 1.00 19.35 ? 59  MET A HA    1 
ATOM   920   H  HB2   . MET A 1 59  ? -23.766 -11.251 -42.937 1.00 32.35 ? 59  MET A HB2   1 
ATOM   921   H  HB3   . MET A 1 59  ? -23.458 -11.674 -41.446 1.00 32.35 ? 59  MET A HB3   1 
ATOM   922   H  HG2   . MET A 1 59  ? -24.019 -9.449  -40.812 1.00 36.61 ? 59  MET A HG2   1 
ATOM   923   H  HG3   . MET A 1 59  ? -24.582 -9.264  -42.295 1.00 36.61 ? 59  MET A HG3   1 
ATOM   924   H  HE1   . MET A 1 59  ? -26.016 -12.064 -39.272 1.00 52.36 ? 59  MET A HE1   1 
ATOM   925   H  HE2   . MET A 1 59  ? -24.602 -12.138 -39.956 1.00 52.36 ? 59  MET A HE2   1 
ATOM   926   H  HE3   . MET A 1 59  ? -24.979 -10.900 -39.063 1.00 52.36 ? 59  MET A HE3   1 
ATOM   927   N  N     . PRO A 1 60  ? -21.668 -8.141  -41.956 1.00 19.71 ? 60  PRO A N     1 
ATOM   928   C  CA    . PRO A 1 60  ? -21.434 -6.910  -41.204 1.00 24.57 ? 60  PRO A CA    1 
ATOM   929   C  C     . PRO A 1 60  ? -22.285 -6.842  -39.950 1.00 22.11 ? 60  PRO A C     1 
ATOM   930   O  O     . PRO A 1 60  ? -23.480 -7.172  -40.019 1.00 23.91 ? 60  PRO A O     1 
ATOM   931   C  CB    . PRO A 1 60  ? -21.862 -5.814  -42.188 1.00 22.69 ? 60  PRO A CB    1 
ATOM   932   C  CG    . PRO A 1 60  ? -21.762 -6.439  -43.538 1.00 25.99 ? 60  PRO A CG    1 
ATOM   933   C  CD    . PRO A 1 60  ? -22.059 -7.886  -43.358 1.00 28.74 ? 60  PRO A CD    1 
ATOM   934   H  HA    . PRO A 1 60  ? -20.486 -6.809  -40.976 1.00 29.42 ? 60  PRO A HA    1 
ATOM   935   H  HB2   . PRO A 1 60  ? -22.775 -5.546  -42.002 1.00 27.17 ? 60  PRO A HB2   1 
ATOM   936   H  HB3   . PRO A 1 60  ? -21.260 -5.057  -42.116 1.00 27.17 ? 60  PRO A HB3   1 
ATOM   937   H  HG2   . PRO A 1 60  ? -22.413 -6.031  -44.131 1.00 31.12 ? 60  PRO A HG2   1 
ATOM   938   H  HG3   . PRO A 1 60  ? -20.865 -6.317  -43.884 1.00 31.12 ? 60  PRO A HG3   1 
ATOM   939   H  HD2   . PRO A 1 60  ? -23.006 -8.056  -43.482 1.00 34.43 ? 60  PRO A HD2   1 
ATOM   940   H  HD3   . PRO A 1 60  ? -21.519 -8.420  -43.962 1.00 34.43 ? 60  PRO A HD3   1 
ATOM   941   N  N     . ILE A 1 61  ? -21.708 -6.400  -38.836 1.00 20.71 ? 61  ILE A N     1 
ATOM   942   C  CA    . ILE A 1 61  ? -22.443 -6.324  -37.568 1.00 18.97 ? 61  ILE A CA    1 
ATOM   943   C  C     . ILE A 1 61  ? -23.686 -5.451  -37.724 1.00 32.91 ? 61  ILE A C     1 
ATOM   944   O  O     . ILE A 1 61  ? -24.756 -5.776  -37.213 1.00 21.78 ? 61  ILE A O     1 
ATOM   945   C  CB    . ILE A 1 61  ? -21.591 -5.770  -36.452 1.00 22.54 ? 61  ILE A CB    1 
ATOM   946   C  CG1   . ILE A 1 61  ? -20.454 -6.763  -36.123 1.00 21.18 ? 61  ILE A CG1   1 
ATOM   947   C  CG2   . ILE A 1 61  ? -22.413 -5.539  -35.182 1.00 26.04 ? 61  ILE A CG2   1 
ATOM   948   C  CD1   . ILE A 1 61  ? -19.451 -6.203  -35.167 1.00 25.46 ? 61  ILE A CD1   1 
ATOM   949   H  H     . ILE A 1 61  ? -20.890 -6.137  -38.784 1.00 24.79 ? 61  ILE A H     1 
ATOM   950   H  HA    . ILE A 1 61  ? -22.733 -7.224  -37.312 1.00 22.70 ? 61  ILE A HA    1 
ATOM   951   H  HB    . ILE A 1 61  ? -21.203 -4.927  -36.737 1.00 26.98 ? 61  ILE A HB    1 
ATOM   952   H  HG12  . ILE A 1 61  ? -20.837 -7.559  -35.723 1.00 25.35 ? 61  ILE A HG12  1 
ATOM   953   H  HG13  . ILE A 1 61  ? -19.990 -6.995  -36.943 1.00 25.35 ? 61  ILE A HG13  1 
ATOM   954   H  HG21  . ILE A 1 61  ? -23.115 -4.913  -35.374 1.00 31.19 ? 61  ILE A HG21  1 
ATOM   955   H  HG22  . ILE A 1 61  ? -22.789 -6.375  -34.897 1.00 31.19 ? 61  ILE A HG22  1 
ATOM   956   H  HG23  . ILE A 1 61  ? -21.838 -5.188  -34.498 1.00 31.19 ? 61  ILE A HG23  1 
ATOM   957   H  HD11  . ILE A 1 61  ? -19.056 -5.418  -35.554 1.00 30.49 ? 61  ILE A HD11  1 
ATOM   958   H  HD12  . ILE A 1 61  ? -19.894 -5.977  -34.346 1.00 30.49 ? 61  ILE A HD12  1 
ATOM   959   H  HD13  . ILE A 1 61  ? -18.773 -6.864  -35.003 1.00 30.49 ? 61  ILE A HD13  1 
ATOM   960   N  N     . ILE A 1 62  ? -23.528 -4.335  -38.415 1.00 26.08 ? 62  ILE A N     1 
ATOM   961   C  CA    . ILE A 1 62  ? -24.637 -3.406  -38.610 1.00 36.13 ? 62  ILE A CA    1 
ATOM   962   C  C     . ILE A 1 62  ? -25.821 -4.063  -39.344 1.00 29.48 ? 62  ILE A C     1 
ATOM   963   O  O     . ILE A 1 62  ? -26.980 -3.834  -38.985 1.00 33.29 ? 62  ILE A O     1 
ATOM   964   C  CB    . ILE A 1 62  ? -24.170 -2.114  -39.311 1.00 29.45 ? 62  ILE A CB    1 
ATOM   965   C  CG1   . ILE A 1 62  ? -25.265 -1.055  -39.220 1.00 44.52 ? 62  ILE A CG1   1 
ATOM   966   C  CG2   . ILE A 1 62  ? -23.856 -2.379  -40.737 1.00 28.71 ? 62  ILE A CG2   1 
ATOM   967   C  CD1   . ILE A 1 62  ? -25.782 -0.861  -37.830 1.00 34.49 ? 62  ILE A CD1   1 
ATOM   968   H  H     . ILE A 1 62  ? -22.791 -4.089  -38.784 1.00 31.23 ? 62  ILE A H     1 
ATOM   969   H  HA    . ILE A 1 62  ? -24.965 -3.143  -37.725 1.00 43.30 ? 62  ILE A HA    1 
ATOM   970   H  HB    . ILE A 1 62  ? -23.373 -1.783  -38.868 1.00 35.28 ? 62  ILE A HB    1 
ATOM   971   H  HG12  . ILE A 1 62  ? -24.909 -0.207  -39.527 1.00 53.37 ? 62  ILE A HG12  1 
ATOM   972   H  HG13  . ILE A 1 62  ? -26.010 -1.324  -39.780 1.00 53.37 ? 62  ILE A HG13  1 
ATOM   973   H  HG21  . ILE A 1 62  ? -23.156 -3.034  -40.785 1.00 34.39 ? 62  ILE A HG21  1 
ATOM   974   H  HG22  . ILE A 1 62  ? -24.645 -2.708  -41.174 1.00 34.39 ? 62  ILE A HG22  1 
ATOM   975   H  HG23  . ILE A 1 62  ? -23.569 -1.561  -41.150 1.00 34.39 ? 62  ILE A HG23  1 
ATOM   976   H  HD11  . ILE A 1 62  ? -26.464 -0.185  -37.842 1.00 41.32 ? 62  ILE A HD11  1 
ATOM   977   H  HD12  . ILE A 1 62  ? -26.147 -1.690  -37.514 1.00 41.32 ? 62  ILE A HD12  1 
ATOM   978   H  HD13  . ILE A 1 62  ? -25.057 -0.585  -37.263 1.00 41.32 ? 62  ILE A HD13  1 
ATOM   979   N  N     . LYS A 1 63  ? -25.537 -4.909  -40.323 1.00 24.58 ? 63  LYS A N     1 
ATOM   980   C  CA    . LYS A 1 63  ? -26.573 -5.630  -41.027 1.00 25.19 ? 63  LYS A CA    1 
ATOM   981   C  C     . LYS A 1 63  ? -27.276 -6.673  -40.182 1.00 31.87 ? 63  LYS A C     1 
ATOM   982   O  O     . LYS A 1 63  ? -28.483 -6.879  -40.314 1.00 29.54 ? 63  LYS A O     1 
ATOM   983   C  CB    . LYS A 1 63  ? -26.027 -6.314  -42.267 1.00 26.82 ? 63  LYS A CB    1 
ATOM   984   C  CG    . LYS A 1 63  ? -27.149 -6.897  -43.131 1.00 41.14 ? 63  LYS A CG    1 
ATOM   985   C  CD    . LYS A 1 63  ? -26.626 -7.804  -44.237 1.00 39.15 ? 63  LYS A CD    1 
ATOM   986   C  CE    . LYS A 1 63  ? -27.726 -8.211  -45.238 1.00 39.44 ? 63  LYS A CE    1 
ATOM   987   N  NZ    . LYS A 1 63  ? -28.867 -9.012  -44.648 1.00 52.48 ? 63  LYS A NZ    1 
ATOM   988   H  H     . LYS A 1 63  ? -24.741 -5.082  -40.599 1.00 29.44 ? 63  LYS A H     1 
ATOM   989   H  HA    . LYS A 1 63  ? -27.250 -4.986  -41.321 1.00 30.17 ? 63  LYS A HA    1 
ATOM   990   H  HB2   . LYS A 1 63  ? -25.539 -5.666  -42.800 1.00 32.12 ? 63  LYS A HB2   1 
ATOM   991   H  HB3   . LYS A 1 63  ? -25.440 -7.039  -42.001 1.00 32.12 ? 63  LYS A HB3   1 
ATOM   992   H  HG2   . LYS A 1 63  ? -27.741 -7.421  -42.568 1.00 49.31 ? 63  LYS A HG2   1 
ATOM   993   H  HG3   . LYS A 1 63  ? -27.640 -6.171  -43.544 1.00 49.31 ? 63  LYS A HG3   1 
ATOM   994   H  HD2   . LYS A 1 63  ? -25.932 -7.336  -44.728 1.00 46.92 ? 63  LYS A HD2   1 
ATOM   995   H  HD3   . LYS A 1 63  ? -26.266 -8.612  -43.841 1.00 46.92 ? 63  LYS A HD3   1 
ATOM   996   H  HE2   . LYS A 1 63  ? -28.104 -7.406  -45.625 1.00 47.27 ? 63  LYS A HE2   1 
ATOM   997   H  HE3   . LYS A 1 63  ? -27.322 -8.749  -45.937 1.00 47.27 ? 63  LYS A HE3   1 
ATOM   998   H  HZ1   . LYS A 1 63  ? -29.459 -9.209  -45.283 1.00 62.92 ? 63  LYS A HZ1   1 
ATOM   999   H  HZ2   . LYS A 1 63  ? -28.557 -9.769  -44.296 1.00 62.92 ? 63  LYS A HZ2   1 
ATOM   1000  H  HZ3   . LYS A 1 63  ? -29.272 -8.541  -44.011 1.00 62.92 ? 63  LYS A HZ3   1 
ATOM   1001  N  N     . ALA A 1 64  ? -26.521 -7.376  -39.351 1.00 24.63 ? 64  ALA A N     1 
ATOM   1002  C  CA    . ALA A 1 64  ? -27.114 -8.321  -38.420 1.00 25.22 ? 64  ALA A CA    1 
ATOM   1003  C  C     . ALA A 1 64  ? -28.059 -7.540  -37.547 1.00 23.67 ? 64  ALA A C     1 
ATOM   1004  O  O     . ALA A 1 64  ? -29.197 -7.954  -37.333 1.00 24.32 ? 64  ALA A O     1 
ATOM   1005  C  CB    . ALA A 1 64  ? -26.047 -8.977  -37.564 1.00 23.82 ? 64  ALA A CB    1 
ATOM   1006  H  H     . ALA A 1 64  ? -25.663 -7.324  -39.307 1.00 29.49 ? 64  ALA A H     1 
ATOM   1007  H  HA    . ALA A 1 64  ? -27.613 -9.011  -38.905 1.00 30.20 ? 64  ALA A HA    1 
ATOM   1008  H  HB1   . ALA A 1 64  ? -26.468 -9.594  -36.960 1.00 28.52 ? 64  ALA A HB1   1 
ATOM   1009  H  HB2   . ALA A 1 64  ? -25.433 -9.444  -38.135 1.00 28.52 ? 64  ALA A HB2   1 
ATOM   1010  H  HB3   . ALA A 1 64  ? -25.584 -8.298  -37.068 1.00 28.52 ? 64  ALA A HB3   1 
ATOM   1011  N  N     . MET A 1 65  ? -27.577 -6.416  -37.027 1.00 24.33 ? 65  MET A N     1 
ATOM   1012  C  CA    . MET A 1 65  ? -28.371 -5.601  -36.103 1.00 30.92 ? 65  MET A CA    1 
ATOM   1013  C  C     . MET A 1 65  ? -29.658 -5.089  -36.776 1.00 32.30 ? 65  MET A C     1 
ATOM   1014  O  O     . MET A 1 65  ? -30.688 -4.954  -36.107 1.00 31.74 ? 65  MET A O     1 
ATOM   1015  C  CB    . MET A 1 65  ? -27.544 -4.452  -35.530 1.00 31.82 ? 65  MET A CB    1 
ATOM   1016  C  CG    . MET A 1 65  ? -26.618 -4.865  -34.376 1.00 31.79 ? 65  MET A CG    1 
ATOM   1017  S  SD    . MET A 1 65  ? -25.440 -3.571  -33.937 1.00 30.46 ? 65  MET A SD    1 
ATOM   1018  C  CE    . MET A 1 65  ? -25.272 -2.785  -35.477 1.00 38.97 ? 65  MET A CE    1 
ATOM   1019  H  H     . MET A 1 65  ? -26.793 -6.101  -37.191 1.00 29.14 ? 65  MET A H     1 
ATOM   1020  H  HA    . MET A 1 65  ? -28.632 -6.169  -35.349 1.00 37.04 ? 65  MET A HA    1 
ATOM   1021  H  HB2   . MET A 1 65  ? -26.991 -4.084  -36.236 1.00 38.13 ? 65  MET A HB2   1 
ATOM   1022  H  HB3   . MET A 1 65  ? -28.147 -3.770  -35.196 1.00 38.13 ? 65  MET A HB3   1 
ATOM   1023  H  HG2   . MET A 1 65  ? -27.156 -5.059  -33.593 1.00 38.08 ? 65  MET A HG2   1 
ATOM   1024  H  HG3   . MET A 1 65  ? -26.116 -5.652  -34.639 1.00 38.08 ? 65  MET A HG3   1 
ATOM   1025  H  HE1   . MET A 1 65  ? -24.656 -2.055  -35.390 1.00 46.70 ? 65  MET A HE1   1 
ATOM   1026  H  HE2   . MET A 1 65  ? -24.941 -3.419  -36.117 1.00 46.70 ? 65  MET A HE2   1 
ATOM   1027  H  HE3   . MET A 1 65  ? -26.131 -2.457  -35.755 1.00 46.70 ? 65  MET A HE3   1 
ATOM   1028  N  N     . GLN A 1 66  ? -29.613 -4.858  -38.087 1.00 33.88 ? 66  GLN A N     1 
ATOM   1029  C  CA    . GLN A 1 66  ? -30.810 -4.449  -38.850 1.00 36.25 ? 66  GLN A CA    1 
ATOM   1030  C  C     . GLN A 1 66  ? -31.871 -5.548  -38.835 1.00 37.26 ? 66  GLN A C     1 
ATOM   1031  O  O     . GLN A 1 66  ? -33.056 -5.264  -38.646 1.00 38.74 ? 66  GLN A O     1 
ATOM   1032  C  CB    . GLN A 1 66  ? -30.473 -4.102  -40.316 1.00 39.35 ? 66  GLN A CB    1 
ATOM   1033  C  CG    . GLN A 1 66  ? -29.791 -2.740  -40.552 1.00 48.37 ? 66  GLN A CG    1 
ATOM   1034  C  CD    . GLN A 1 66  ? -29.297 -2.549  -42.012 1.00 60.62 ? 66  GLN A CD    1 
ATOM   1035  O  OE1   . GLN A 1 66  ? -29.650 -3.322  -42.908 1.00 62.89 ? 66  GLN A OE1   1 
ATOM   1036  N  NE2   . GLN A 1 66  ? -28.479 -1.518  -42.240 1.00 56.66 ? 66  GLN A NE2   1 
ATOM   1037  H  H     . GLN A 1 66  ? -28.902 -4.930  -38.566 1.00 40.60 ? 66  GLN A H     1 
ATOM   1038  H  HA    . GLN A 1 66  ? -31.195 -3.650  -38.432 1.00 43.44 ? 66  GLN A HA    1 
ATOM   1039  H  HB2   . GLN A 1 66  ? -29.879 -4.786  -40.663 1.00 47.16 ? 66  GLN A HB2   1 
ATOM   1040  H  HB3   . GLN A 1 66  ? -31.298 -4.104  -40.827 1.00 47.16 ? 66  GLN A HB3   1 
ATOM   1041  H  HG2   . GLN A 1 66  ? -30.425 -2.033  -40.356 1.00 57.99 ? 66  GLN A HG2   1 
ATOM   1042  H  HG3   . GLN A 1 66  ? -29.023 -2.667  -39.964 1.00 57.99 ? 66  GLN A HG3   1 
ATOM   1043  H  HE21  . GLN A 1 66  ? -28.251 -0.999  -41.594 1.00 67.93 ? 66  GLN A HE21  1 
ATOM   1044  H  HE22  . GLN A 1 66  ? -28.181 -1.374  -43.034 1.00 67.93 ? 66  GLN A HE22  1 
ATOM   1045  N  N     . ILE A 1 67  ? -31.466 -6.801  -39.037 1.00 32.27 ? 67  ILE A N     1 
ATOM   1046  C  CA    . ILE A 1 67  ? -32.446 -7.885  -39.144 1.00 30.51 ? 67  ILE A CA    1 
ATOM   1047  C  C     . ILE A 1 67  ? -32.766 -8.602  -37.833 1.00 35.41 ? 67  ILE A C     1 
ATOM   1048  O  O     . ILE A 1 67  ? -33.785 -9.289  -37.734 1.00 31.66 ? 67  ILE A O     1 
ATOM   1049  C  CB    . ILE A 1 67  ? -32.058 -8.942  -40.190 1.00 23.91 ? 67  ILE A CB    1 
ATOM   1050  C  CG1   . ILE A 1 67  ? -30.674 -9.563  -39.886 1.00 29.17 ? 67  ILE A CG1   1 
ATOM   1051  C  CG2   . ILE A 1 67  ? -32.091 -8.327  -41.566 1.00 40.11 ? 67  ILE A CG2   1 
ATOM   1052  C  CD1   . ILE A 1 67  ? -30.373 -10.758 -40.784 1.00 31.39 ? 67  ILE A CD1   1 
ATOM   1053  H  H     . ILE A 1 67  ? -30.646 -7.048  -39.116 1.00 38.66 ? 67  ILE A H     1 
ATOM   1054  H  HA    . ILE A 1 67  ? -33.287 -7.487  -39.452 1.00 36.55 ? 67  ILE A HA    1 
ATOM   1055  H  HB    . ILE A 1 67  ? -32.719 -9.651  -40.161 1.00 28.63 ? 67  ILE A HB    1 
ATOM   1056  H  HG12  . ILE A 1 67  ? -29.986 -8.895  -40.032 1.00 34.94 ? 67  ILE A HG12  1 
ATOM   1057  H  HG13  . ILE A 1 67  ? -30.655 -9.865  -38.965 1.00 34.94 ? 67  ILE A HG13  1 
ATOM   1058  H  HG21  . ILE A 1 67  ? -31.848 -8.994  -42.212 1.00 48.08 ? 67  ILE A HG21  1 
ATOM   1059  H  HG22  . ILE A 1 67  ? -32.979 -8.007  -41.743 1.00 48.08 ? 67  ILE A HG22  1 
ATOM   1060  H  HG23  . ILE A 1 67  ? -31.468 -7.597  -41.597 1.00 48.08 ? 67  ILE A HG23  1 
ATOM   1061  H  HD11  . ILE A 1 67  ? -29.508 -11.108 -40.559 1.00 37.61 ? 67  ILE A HD11  1 
ATOM   1062  H  HD12  . ILE A 1 67  ? -31.045 -11.430 -40.644 1.00 37.61 ? 67  ILE A HD12  1 
ATOM   1063  H  HD13  . ILE A 1 67  ? -30.383 -10.471 -41.700 1.00 37.61 ? 67  ILE A HD13  1 
ATOM   1064  N  N     . ALA A 1 68  ? -31.917 -8.456  -36.827 1.00 18.95 ? 68  ALA A N     1 
ATOM   1065  C  CA    . ALA A 1 68  ? -32.141 -9.147  -35.563 1.00 25.70 ? 68  ALA A CA    1 
ATOM   1066  C  C     . ALA A 1 68  ? -31.745 -8.227  -34.433 1.00 26.17 ? 68  ALA A C     1 
ATOM   1067  O  O     . ALA A 1 68  ? -30.834 -8.528  -33.639 1.00 23.91 ? 68  ALA A O     1 
ATOM   1068  C  CB    . ALA A 1 68  ? -31.387 -10.476 -35.514 1.00 19.88 ? 68  ALA A CB    1 
ATOM   1069  H  H     . ALA A 1 68  ? -31.210 -7.968  -36.847 1.00 22.68 ? 68  ALA A H     1 
ATOM   1070  H  HA    . ALA A 1 68  ? -33.097 -9.341  -35.472 1.00 30.77 ? 68  ALA A HA    1 
ATOM   1071  H  HB1   . ALA A 1 68  ? -31.695 -11.036 -36.231 1.00 23.80 ? 68  ALA A HB1   1 
ATOM   1072  H  HB2   . ALA A 1 68  ? -30.447 -10.306 -35.611 1.00 23.80 ? 68  ALA A HB2   1 
ATOM   1073  H  HB3   . ALA A 1 68  ? -31.558 -10.901 -34.670 1.00 23.80 ? 68  ALA A HB3   1 
ATOM   1074  N  N     . PRO A 1 69  ? -32.430 -7.075  -34.355 1.00 27.08 ? 69  PRO A N     1 
ATOM   1075  C  CA    . PRO A 1 69  ? -31.977 -6.032  -33.435 1.00 26.92 ? 69  PRO A CA    1 
ATOM   1076  C  C     . PRO A 1 69  ? -32.145 -6.403  -31.984 1.00 27.38 ? 69  PRO A C     1 
ATOM   1077  O  O     . PRO A 1 69  ? -31.529 -5.771  -31.135 1.00 32.34 ? 69  PRO A O     1 
ATOM   1078  C  CB    . PRO A 1 69  ? -32.824 -4.805  -33.833 1.00 36.07 ? 69  PRO A CB    1 
ATOM   1079  C  CG    . PRO A 1 69  ? -33.961 -5.342  -34.596 1.00 33.21 ? 69  PRO A CG    1 
ATOM   1080  C  CD    . PRO A 1 69  ? -33.530 -6.617  -35.224 1.00 29.17 ? 69  PRO A CD    1 
ATOM   1081  H  HA    . PRO A 1 69  ? -31.032 -5.831  -33.602 1.00 32.24 ? 69  PRO A HA    1 
ATOM   1082  H  HB2   . PRO A 1 69  ? -33.132 -4.350  -33.034 1.00 43.22 ? 69  PRO A HB2   1 
ATOM   1083  H  HB3   . PRO A 1 69  ? -32.294 -4.209  -34.384 1.00 43.22 ? 69  PRO A HB3   1 
ATOM   1084  H  HG2   . PRO A 1 69  ? -34.703 -5.501  -33.992 1.00 39.79 ? 69  PRO A HG2   1 
ATOM   1085  H  HG3   . PRO A 1 69  ? -34.217 -4.703  -35.279 1.00 39.79 ? 69  PRO A HG3   1 
ATOM   1086  H  HD2   . PRO A 1 69  ? -34.256 -7.260  -35.216 1.00 34.94 ? 69  PRO A HD2   1 
ATOM   1087  H  HD3   . PRO A 1 69  ? -33.206 -6.458  -36.124 1.00 34.94 ? 69  PRO A HD3   1 
ATOM   1088  N  N     . SER A 1 70  ? -32.907 -7.443  -31.690 1.00 25.28 ? 70  SER A N     1 
ATOM   1089  C  CA    . SER A 1 70  ? -33.091 -7.838  -30.294 1.00 25.51 ? 70  SER A CA    1 
ATOM   1090  C  C     . SER A 1 70  ? -32.193 -9.009  -29.886 1.00 28.95 ? 70  SER A C     1 
ATOM   1091  O  O     . SER A 1 70  ? -32.239 -9.470  -28.758 1.00 22.13 ? 70  SER A O     1 
ATOM   1092  C  CB    . SER A 1 70  ? -34.558 -8.174  -30.039 1.00 33.67 ? 70  SER A CB    1 
ATOM   1093  O  OG    . SER A 1 70  ? -35.326 -6.995  -30.266 1.00 41.86 ? 70  SER A OG    1 
ATOM   1094  H  H     . SER A 1 70  ? -33.322 -7.932  -32.263 1.00 30.28 ? 70  SER A H     1 
ATOM   1095  H  HA    . SER A 1 70  ? -32.859 -7.076  -29.723 1.00 30.55 ? 70  SER A HA    1 
ATOM   1096  H  HB2   . SER A 1 70  ? -34.843 -8.870  -30.651 1.00 40.34 ? 70  SER A HB2   1 
ATOM   1097  H  HB3   . SER A 1 70  ? -34.670 -8.463  -29.119 1.00 40.34 ? 70  SER A HB3   1 
ATOM   1098  H  HG    . SER A 1 70  ? -34.834 -6.378  -30.486 1.00 50.17 ? 70  SER A HG    1 
ATOM   1099  N  N     . ALA A 1 71  ? -31.354 -9.476  -30.795 1.00 22.42 ? 71  ALA A N     1 
ATOM   1100  C  CA    . ALA A 1 71  ? -30.367 -10.494 -30.442 1.00 23.53 ? 71  ALA A CA    1 
ATOM   1101  C  C     . ALA A 1 71  ? -29.369 -9.926  -29.426 1.00 21.39 ? 71  ALA A C     1 
ATOM   1102  O  O     . ALA A 1 71  ? -29.235 -8.722  -29.296 1.00 22.86 ? 71  ALA A O     1 
ATOM   1103  C  CB    . ALA A 1 71  ? -29.636 -10.942 -31.706 1.00 21.46 ? 71  ALA A CB    1 
ATOM   1104  H  H     . ALA A 1 71  ? -31.331 -9.226  -31.617 1.00 26.85 ? 71  ALA A H     1 
ATOM   1105  H  HA    . ALA A 1 71  ? -30.816 -11.269 -30.045 1.00 28.18 ? 71  ALA A HA    1 
ATOM   1106  H  HB1   . ALA A 1 71  ? -28.988 -11.611 -31.471 1.00 25.69 ? 71  ALA A HB1   1 
ATOM   1107  H  HB2   . ALA A 1 71  ? -30.274 -11.307 -32.323 1.00 25.69 ? 71  ALA A HB2   1 
ATOM   1108  H  HB3   . ALA A 1 71  ? -29.197 -10.184 -32.098 1.00 25.69 ? 71  ALA A HB3   1 
ATOM   1109  N  N     . ILE A 1 72  ? -28.685 -10.800 -28.698 1.00 22.73 ? 72  ILE A N     1 
ATOM   1110  C  CA    . ILE A 1 72  ? -27.623 -10.362 -27.814 1.00 20.17 ? 72  ILE A CA    1 
ATOM   1111  C  C     . ILE A 1 72  ? -26.349 -10.357 -28.658 1.00 22.04 ? 72  ILE A C     1 
ATOM   1112  O  O     . ILE A 1 72  ? -26.070 -11.330 -29.344 1.00 18.77 ? 72  ILE A O     1 
ATOM   1113  C  CB    . ILE A 1 72  ? -27.449 -11.295 -26.641 1.00 22.41 ? 72  ILE A CB    1 
ATOM   1114  C  CG1   . ILE A 1 72  ? -28.791 -11.453 -25.914 1.00 33.77 ? 72  ILE A CG1   1 
ATOM   1115  C  CG2   . ILE A 1 72  ? -26.353 -10.756 -25.712 1.00 23.73 ? 72  ILE A CG2   1 
ATOM   1116  C  CD1   . ILE A 1 72  ? -29.487 -10.121 -25.647 1.00 46.41 ? 72  ILE A CD1   1 
ATOM   1117  H  H     . ILE A 1 72  ? -28.818 -11.650 -28.700 1.00 27.22 ? 72  ILE A H     1 
ATOM   1118  H  HA    . ILE A 1 72  ? -27.801 -9.456  -27.486 1.00 24.15 ? 72  ILE A HA    1 
ATOM   1119  H  HB    . ILE A 1 72  ? -27.173 -12.163 -26.975 1.00 26.82 ? 72  ILE A HB    1 
ATOM   1120  H  HG12  . ILE A 1 72  ? -29.382 -11.996 -26.459 1.00 40.46 ? 72  ILE A HG12  1 
ATOM   1121  H  HG13  . ILE A 1 72  ? -28.637 -11.887 -25.060 1.00 40.46 ? 72  ILE A HG13  1 
ATOM   1122  H  HG21  . ILE A 1 72  ? -26.250 -11.357 -24.970 1.00 28.41 ? 72  ILE A HG21  1 
ATOM   1123  H  HG22  . ILE A 1 72  ? -25.530 -10.697 -26.203 1.00 28.41 ? 72  ILE A HG22  1 
ATOM   1124  H  HG23  . ILE A 1 72  ? -26.611 -9.887  -25.397 1.00 28.41 ? 72  ILE A HG23  1 
ATOM   1125  H  HD11  . ILE A 1 72  ? -30.316 -10.288 -25.193 1.00 55.63 ? 72  ILE A HD11  1 
ATOM   1126  H  HD12  . ILE A 1 72  ? -28.917 -9.576  -25.100 1.00 55.63 ? 72  ILE A HD12  1 
ATOM   1127  H  HD13  . ILE A 1 72  ? -29.655 -9.683  -26.485 1.00 55.63 ? 72  ILE A HD13  1 
ATOM   1128  N  N     . TYR A 1 73  ? -25.645 -9.237  -28.642 1.00 20.65 ? 73  TYR A N     1 
ATOM   1129  C  CA    . TYR A 1 73  ? -24.410 -9.048  -29.426 1.00 22.31 ? 73  TYR A CA    1 
ATOM   1130  C  C     . TYR A 1 73  ? -23.254 -8.995  -28.461 1.00 23.98 ? 73  TYR A C     1 
ATOM   1131  O  O     . TYR A 1 73  ? -23.238 -8.129  -27.585 1.00 23.10 ? 73  TYR A O     1 
ATOM   1132  C  CB    . TYR A 1 73  ? -24.487 -7.764  -30.247 1.00 16.04 ? 73  TYR A CB    1 
ATOM   1133  C  CG    . TYR A 1 73  ? -25.464 -7.908  -31.367 1.00 19.96 ? 73  TYR A CG    1 
ATOM   1134  C  CD1   . TYR A 1 73  ? -26.824 -7.612  -31.186 1.00 23.24 ? 73  TYR A CD1   1 
ATOM   1135  C  CD2   . TYR A 1 73  ? -25.072 -8.440  -32.567 1.00 20.39 ? 73  TYR A CD2   1 
ATOM   1136  C  CE1   . TYR A 1 73  ? -27.724 -7.806  -32.187 1.00 18.53 ? 73  TYR A CE1   1 
ATOM   1137  C  CE2   . TYR A 1 73  ? -25.987 -8.638  -33.598 1.00 19.65 ? 73  TYR A CE2   1 
ATOM   1138  C  CZ    . TYR A 1 73  ? -27.312 -8.331  -33.388 1.00 22.41 ? 73  TYR A CZ    1 
ATOM   1139  O  OH    . TYR A 1 73  ? -28.179 -8.576  -34.404 1.00 20.17 ? 73  TYR A OH    1 
ATOM   1140  H  H     . TYR A 1 73  ? -25.860 -8.547  -28.175 1.00 24.72 ? 73  TYR A H     1 
ATOM   1141  H  HA    . TYR A 1 73  ? -24.282 -9.806  -30.033 1.00 26.72 ? 73  TYR A HA    1 
ATOM   1142  H  HB2   . TYR A 1 73  ? -24.779 -7.035  -29.678 1.00 19.19 ? 73  TYR A HB2   1 
ATOM   1143  H  HB3   . TYR A 1 73  ? -23.615 -7.571  -30.625 1.00 19.19 ? 73  TYR A HB3   1 
ATOM   1144  H  HD1   . TYR A 1 73  ? -27.114 -7.271  -30.370 1.00 27.83 ? 73  TYR A HD1   1 
ATOM   1145  H  HD2   . TYR A 1 73  ? -24.178 -8.661  -32.700 1.00 24.40 ? 73  TYR A HD2   1 
ATOM   1146  H  HE1   . TYR A 1 73  ? -28.621 -7.603  -32.051 1.00 22.17 ? 73  TYR A HE1   1 
ATOM   1147  H  HE2   . TYR A 1 73  ? -25.711 -9.000  -34.409 1.00 23.52 ? 73  TYR A HE2   1 
ATOM   1148  H  HH    . TYR A 1 73  ? -28.549 -7.881  -34.632 1.00 24.15 ? 73  TYR A HH    1 
ATOM   1149  N  N     . VAL A 1 74  ? -22.326 -9.954  -28.565 1.00 19.92 ? 74  VAL A N     1 
ATOM   1150  C  CA    . VAL A 1 74  ? -21.148 -9.980  -27.682 1.00 18.12 ? 74  VAL A CA    1 
ATOM   1151  C  C     . VAL A 1 74  ? -19.824 -10.018 -28.478 1.00 21.11 ? 74  VAL A C     1 
ATOM   1152  O  O     . VAL A 1 74  ? -19.788 -10.515 -29.620 1.00 17.58 ? 74  VAL A O     1 
ATOM   1153  C  CB    . VAL A 1 74  ? -21.171 -11.157 -26.692 1.00 18.05 ? 74  VAL A CB    1 
ATOM   1154  C  CG1   . VAL A 1 74  ? -22.480 -11.156 -25.858 1.00 22.18 ? 74  VAL A CG1   1 
ATOM   1155  C  CG2   . VAL A 1 74  ? -21.018 -12.461 -27.402 1.00 16.85 ? 74  VAL A CG2   1 
ATOM   1156  H  H     . VAL A 1 74  ? -22.353 -10.598 -29.134 1.00 23.84 ? 74  VAL A H     1 
ATOM   1157  H  HA    . VAL A 1 74  ? -21.146 -9.156  -27.153 1.00 21.68 ? 74  VAL A HA    1 
ATOM   1158  H  HB    . VAL A 1 74  ? -20.419 -11.062 -26.071 1.00 21.60 ? 74  VAL A HB    1 
ATOM   1159  H  HG11  . VAL A 1 74  ? -23.022 -10.412 -26.128 1.00 26.56 ? 74  VAL A HG11  1 
ATOM   1160  H  HG12  . VAL A 1 74  ? -22.950 -11.978 -26.014 1.00 26.56 ? 74  VAL A HG12  1 
ATOM   1161  H  HG13  . VAL A 1 74  ? -22.257 -11.078 -24.927 1.00 26.56 ? 74  VAL A HG13  1 
ATOM   1162  H  HG21  . VAL A 1 74  ? -21.036 -13.172 -26.757 1.00 20.16 ? 74  VAL A HG21  1 
ATOM   1163  H  HG22  . VAL A 1 74  ? -21.741 -12.565 -28.025 1.00 20.16 ? 74  VAL A HG22  1 
ATOM   1164  H  HG23  . VAL A 1 74  ? -20.179 -12.465 -27.870 1.00 20.16 ? 74  VAL A HG23  1 
ATOM   1165  N  N     . PRO A 1 75  ? -18.756 -9.448  -27.891 1.00 20.49 ? 75  PRO A N     1 
ATOM   1166  C  CA    . PRO A 1 75  ? -17.458 -9.392  -28.569 1.00 19.78 ? 75  PRO A CA    1 
ATOM   1167  C  C     . PRO A 1 75  ? -16.768 -10.742 -28.539 1.00 16.45 ? 75  PRO A C     1 
ATOM   1168  O  O     . PRO A 1 75  ? -16.906 -11.517 -27.603 1.00 18.30 ? 75  PRO A O     1 
ATOM   1169  C  CB    . PRO A 1 75  ? -16.670 -8.365  -27.737 1.00 23.15 ? 75  PRO A CB    1 
ATOM   1170  C  CG    . PRO A 1 75  ? -17.183 -8.528  -26.401 1.00 24.97 ? 75  PRO A CG    1 
ATOM   1171  C  CD    . PRO A 1 75  ? -18.695 -8.759  -26.593 1.00 24.82 ? 75  PRO A CD    1 
ATOM   1172  H  HA    . PRO A 1 75  ? -17.554 -9.079  -29.493 1.00 23.67 ? 75  PRO A HA    1 
ATOM   1173  H  HB2   . PRO A 1 75  ? -15.722 -8.569  -27.771 1.00 27.72 ? 75  PRO A HB2   1 
ATOM   1174  H  HB3   . PRO A 1 75  ? -16.844 -7.469  -28.067 1.00 27.72 ? 75  PRO A HB3   1 
ATOM   1175  H  HG2   . PRO A 1 75  ? -16.767 -9.297  -25.981 1.00 29.90 ? 75  PRO A HG2   1 
ATOM   1176  H  HG3   . PRO A 1 75  ? -17.020 -7.722  -25.886 1.00 29.90 ? 75  PRO A HG3   1 
ATOM   1177  H  HD2   . PRO A 1 75  ? -19.044 -9.328  -25.889 1.00 29.72 ? 75  PRO A HD2   1 
ATOM   1178  H  HD3   . PRO A 1 75  ? -19.166 -7.912  -26.635 1.00 29.72 ? 75  PRO A HD3   1 
ATOM   1179  N  N     . MET A 1 76  ? -16.004 -11.013 -29.582 1.00 19.60 ? 76  MET A N     1 
ATOM   1180  C  CA    . MET A 1 76  ? -15.312 -12.280 -29.709 1.00 23.10 ? 76  MET A CA    1 
ATOM   1181  C  C     . MET A 1 76  ? -14.254 -12.340 -28.594 1.00 21.71 ? 76  MET A C     1 
ATOM   1182  O  O     . MET A 1 76  ? -13.552 -11.362 -28.340 1.00 25.12 ? 76  MET A O     1 
ATOM   1183  C  CB    . MET A 1 76  ? -14.696 -12.353 -31.132 1.00 26.05 ? 76  MET A CB    1 
ATOM   1184  C  CG    . MET A 1 76  ? -14.434 -13.777 -31.664 1.00 24.18 ? 76  MET A CG    1 
ATOM   1185  S  SD    . MET A 1 76  ? -13.266 -13.857 -33.006 1.00 33.06 ? 76  MET A SD    1 
ATOM   1186  C  CE    . MET A 1 76  ? -12.211 -12.410 -32.721 1.00 26.10 ? 76  MET A CE    1 
ATOM   1187  H  H     . MET A 1 76  ? -15.868 -10.473 -30.237 1.00 23.46 ? 76  MET A H     1 
ATOM   1188  H  HA    . MET A 1 76  ? -15.948 -13.018 -29.603 1.00 27.66 ? 76  MET A HA    1 
ATOM   1189  H  HB2   . MET A 1 76  ? -15.301 -11.916 -31.752 1.00 31.19 ? 76  MET A HB2   1 
ATOM   1190  H  HB3   . MET A 1 76  ? -13.846 -11.884 -31.123 1.00 31.19 ? 76  MET A HB3   1 
ATOM   1191  H  HG2   . MET A 1 76  ? -14.088 -14.321 -30.940 1.00 28.96 ? 76  MET A HG2   1 
ATOM   1192  H  HG3   . MET A 1 76  ? -15.272 -14.149 -31.981 1.00 28.96 ? 76  MET A HG3   1 
ATOM   1193  H  HE1   . MET A 1 76  ? -11.542 -12.372 -33.408 1.00 31.26 ? 76  MET A HE1   1 
ATOM   1194  H  HE2   . MET A 1 76  ? -12.754 -11.618 -32.748 1.00 31.26 ? 76  MET A HE2   1 
ATOM   1195  H  HE3   . MET A 1 76  ? -11.794 -12.492 -31.860 1.00 31.26 ? 76  MET A HE3   1 
ATOM   1196  N  N     . ARG A 1 77  ? -14.171 -13.469 -27.892 1.00 19.39 ? 77  ARG A N     1 
ATOM   1197  C  CA    . ARG A 1 77  ? -13.121 -13.701 -26.886 1.00 20.21 ? 77  ARG A CA    1 
ATOM   1198  C  C     . ARG A 1 77  ? -12.294 -14.928 -27.318 1.00 19.56 ? 77  ARG A C     1 
ATOM   1199  O  O     . ARG A 1 77  ? -12.369 -16.013 -26.726 1.00 18.04 ? 77  ARG A O     1 
ATOM   1200  C  CB    . ARG A 1 77  ? -13.710 -13.899 -25.494 1.00 19.70 ? 77  ARG A CB    1 
ATOM   1201  C  CG    . ARG A 1 77  ? -14.448 -12.659 -24.949 1.00 21.61 ? 77  ARG A CG    1 
ATOM   1202  C  CD    . ARG A 1 77  ? -14.844 -12.774 -23.485 1.00 22.83 ? 77  ARG A CD    1 
ATOM   1203  N  NE    . ARG A 1 77  ? -15.981 -13.676 -23.263 1.00 24.28 ? 77  ARG A NE    1 
ATOM   1204  C  CZ    . ARG A 1 77  ? -16.404 -14.064 -22.064 1.00 26.44 ? 77  ARG A CZ    1 
ATOM   1205  N  NH1   . ARG A 1 77  ? -15.793 -13.629 -20.961 1.00 28.74 ? 77  ARG A NH1   1 
ATOM   1206  N  NH2   . ARG A 1 77  ? -17.434 -14.889 -21.961 1.00 25.72 ? 77  ARG A NH2   1 
ATOM   1207  H  H     . ARG A 1 77  ? -14.716 -14.128 -27.978 1.00 23.21 ? 77  ARG A H     1 
ATOM   1208  H  HA    . ARG A 1 77  ? -12.524 -12.924 -26.858 1.00 24.19 ? 77  ARG A HA    1 
ATOM   1209  H  HB2   . ARG A 1 77  ? -14.344 -14.632 -25.524 1.00 23.57 ? 77  ARG A HB2   1 
ATOM   1210  H  HB3   . ARG A 1 77  ? -12.991 -14.111 -24.878 1.00 23.57 ? 77  ARG A HB3   1 
ATOM   1211  H  HG2   . ARG A 1 77  ? -13.870 -11.886 -25.039 1.00 25.87 ? 77  ARG A HG2   1 
ATOM   1212  H  HG3   . ARG A 1 77  ? -15.258 -12.526 -25.465 1.00 25.87 ? 77  ARG A HG3   1 
ATOM   1213  H  HD2   . ARG A 1 77  ? -14.089 -13.116 -22.981 1.00 27.34 ? 77  ARG A HD2   1 
ATOM   1214  H  HD3   . ARG A 1 77  ? -15.091 -11.895 -23.156 1.00 27.34 ? 77  ARG A HD3   1 
ATOM   1215  H  HE    . ARG A 1 77  ? -16.401 -13.971 -23.953 1.00 29.07 ? 77  ARG A HE    1 
ATOM   1216  H  HH11  . ARG A 1 77  ? -15.122 -13.095 -21.023 1.00 34.43 ? 77  ARG A HH11  1 
ATOM   1217  H  HH12  . ARG A 1 77  ? -16.071 -13.882 -20.187 1.00 34.43 ? 77  ARG A HH12  1 
ATOM   1218  H  HH21  . ARG A 1 77  ? -17.832 -15.170 -22.670 1.00 30.80 ? 77  ARG A HH21  1 
ATOM   1219  H  HH22  . ARG A 1 77  ? -17.710 -15.137 -21.185 1.00 30.80 ? 77  ARG A HH22  1 
ATOM   1220  N  N     . LYS A 1 78  ? -11.547 -14.773 -28.400 1.00 20.44 ? 78  LYS A N     1 
ATOM   1221  C  CA    . LYS A 1 78  ? -10.909 -15.933 -29.035 1.00 21.08 ? 78  LYS A CA    1 
ATOM   1222  C  C     . LYS A 1 78  ? -10.016 -16.773 -28.104 1.00 19.52 ? 78  LYS A C     1 
ATOM   1223  O  O     . LYS A 1 78  ? -10.021 -17.995 -28.174 1.00 15.76 ? 78  LYS A O     1 
ATOM   1224  C  CB    . LYS A 1 78  ? -10.152 -15.491 -30.283 1.00 23.58 ? 78  LYS A CB    1 
ATOM   1225  C  CG    . LYS A 1 78  ? -9.820  -16.607 -31.243 1.00 26.77 ? 78  LYS A CG    1 
ATOM   1226  C  CD    . LYS A 1 78  ? -9.093  -16.026 -32.442 1.00 41.70 ? 78  LYS A CD    1 
ATOM   1227  C  CE    . LYS A 1 78  ? -8.713  -17.072 -33.453 1.00 44.96 ? 78  LYS A CE    1 
ATOM   1228  N  NZ    . LYS A 1 78  ? -7.682  -16.515 -34.403 1.00 59.55 ? 78  LYS A NZ    1 
ATOM   1229  H  H     . LYS A 1 78  ? -11.390 -14.021 -28.787 1.00 24.47 ? 78  LYS A H     1 
ATOM   1230  H  HA    . LYS A 1 78  ? -11.625 -16.529 -29.341 1.00 25.23 ? 78  LYS A HA    1 
ATOM   1231  H  HB2   . LYS A 1 78  ? -10.694 -14.843 -30.761 1.00 28.23 ? 78  LYS A HB2   1 
ATOM   1232  H  HB3   . LYS A 1 78  ? -9.317  -15.080 -30.010 1.00 28.23 ? 78  LYS A HB3   1 
ATOM   1233  H  HG2   . LYS A 1 78  ? -9.239  -17.252 -30.809 1.00 32.06 ? 78  LYS A HG2   1 
ATOM   1234  H  HG3   . LYS A 1 78  ? -10.637 -17.031 -31.550 1.00 32.06 ? 78  LYS A HG3   1 
ATOM   1235  H  HD2   . LYS A 1 78  ? -9.670  -15.381 -32.879 1.00 49.97 ? 78  LYS A HD2   1 
ATOM   1236  H  HD3   . LYS A 1 78  ? -8.280  -15.592 -32.139 1.00 49.97 ? 78  LYS A HD3   1 
ATOM   1237  H  HE2   . LYS A 1 78  ? -8.332  -17.840 -32.999 1.00 53.89 ? 78  LYS A HE2   1 
ATOM   1238  H  HE3   . LYS A 1 78  ? -9.496  -17.330 -33.964 1.00 53.89 ? 78  LYS A HE3   1 
ATOM   1239  H  HZ1   . LYS A 1 78  ? -8.012  -15.807 -34.829 1.00 71.40 ? 78  LYS A HZ1   1 
ATOM   1240  H  HZ2   . LYS A 1 78  ? -6.955  -16.270 -33.953 1.00 71.40 ? 78  LYS A HZ2   1 
ATOM   1241  H  HZ3   . LYS A 1 78  ? -7.456  -17.134 -35.003 1.00 71.40 ? 78  LYS A HZ3   1 
ATOM   1242  N  N     . PRO A 1 79  ? -9.298  -16.136 -27.172 1.00 21.98 ? 79  PRO A N     1 
ATOM   1243  C  CA    . PRO A 1 79  ? -8.468  -16.996 -26.313 1.00 19.75 ? 79  PRO A CA    1 
ATOM   1244  C  C     . PRO A 1 79  ? -9.259  -17.991 -25.511 1.00 19.64 ? 79  PRO A C     1 
ATOM   1245  O  O     . PRO A 1 79  ? -8.761  -19.091 -25.228 1.00 15.59 ? 79  PRO A O     1 
ATOM   1246  C  CB    . PRO A 1 79  ? -7.771  -15.991 -25.375 1.00 26.27 ? 79  PRO A CB    1 
ATOM   1247  C  CG    . PRO A 1 79  ? -7.648  -14.746 -26.218 1.00 26.30 ? 79  PRO A CG    1 
ATOM   1248  C  CD    . PRO A 1 79  ? -9.010  -14.706 -26.956 1.00 25.51 ? 79  PRO A CD    1 
ATOM   1249  H  HA    . PRO A 1 79  ? -7.794  -17.466 -26.847 1.00 23.64 ? 79  PRO A HA    1 
ATOM   1250  H  HB2   . PRO A 1 79  ? -8.322  -15.829 -24.594 1.00 31.46 ? 79  PRO A HB2   1 
ATOM   1251  H  HB3   . PRO A 1 79  ? -6.896  -16.326 -25.121 1.00 31.46 ? 79  PRO A HB3   1 
ATOM   1252  H  HG2   . PRO A 1 79  ? -7.534  -13.967 -25.650 1.00 31.49 ? 79  PRO A HG2   1 
ATOM   1253  H  HG3   . PRO A 1 79  ? -6.912  -14.837 -26.843 1.00 31.49 ? 79  PRO A HG3   1 
ATOM   1254  H  HD2   . PRO A 1 79  ? -9.690  -14.302 -26.395 1.00 30.55 ? 79  PRO A HD2   1 
ATOM   1255  H  HD3   . PRO A 1 79  ? -8.924  -14.244 -27.805 1.00 30.55 ? 79  PRO A HD3   1 
ATOM   1256  N  N     . ILE A 1 80  ? -10.456 -17.620 -25.088 1.00 18.97 ? 80  ILE A N     1 
ATOM   1257  C  CA    . ILE A 1 80  ? -11.252 -18.554 -24.337 1.00 18.29 ? 80  ILE A CA    1 
ATOM   1258  C  C     . ILE A 1 80  ? -11.700 -19.708 -25.234 1.00 19.32 ? 80  ILE A C     1 
ATOM   1259  O  O     . ILE A 1 80  ? -11.724 -20.862 -24.799 1.00 17.75 ? 80  ILE A O     1 
ATOM   1260  C  CB    . ILE A 1 80  ? -12.502 -17.916 -23.689 1.00 17.44 ? 80  ILE A CB    1 
ATOM   1261  C  CG1   . ILE A 1 80  ? -12.117 -16.750 -22.771 1.00 22.83 ? 80  ILE A CG1   1 
ATOM   1262  C  CG2   . ILE A 1 80  ? -13.249 -18.963 -22.891 1.00 20.39 ? 80  ILE A CG2   1 
ATOM   1263  C  CD1   . ILE A 1 80  ? -13.273 -16.138 -22.033 1.00 26.79 ? 80  ILE A CD1   1 
ATOM   1264  H  H     . ILE A 1 80  ? -10.818 -16.851 -25.221 1.00 22.71 ? 80  ILE A H     1 
ATOM   1265  H  HA    . ILE A 1 80  ? -10.702 -18.930 -23.618 1.00 21.88 ? 80  ILE A HA    1 
ATOM   1266  H  HB    . ILE A 1 80  ? -13.083 -17.583 -24.391 1.00 20.87 ? 80  ILE A HB    1 
ATOM   1267  H  HG12  . ILE A 1 80  ? -11.482 -17.070 -22.111 1.00 27.33 ? 80  ILE A HG12  1 
ATOM   1268  H  HG13  . ILE A 1 80  ? -11.707 -16.053 -23.307 1.00 27.33 ? 80  ILE A HG13  1 
ATOM   1269  H  HG21  . ILE A 1 80  ? -13.517 -19.672 -23.480 1.00 24.41 ? 80  ILE A HG21  1 
ATOM   1270  H  HG22  . ILE A 1 80  ? -12.670 -19.306 -22.207 1.00 24.41 ? 80  ILE A HG22  1 
ATOM   1271  H  HG23  . ILE A 1 80  ? -14.023 -18.558 -22.492 1.00 24.41 ? 80  ILE A HG23  1 
ATOM   1272  H  HD11  . ILE A 1 80  ? -13.684 -16.810 -21.484 1.00 32.08 ? 80  ILE A HD11  1 
ATOM   1273  H  HD12  . ILE A 1 80  ? -12.948 -15.420 -21.484 1.00 32.08 ? 80  ILE A HD12  1 
ATOM   1274  H  HD13  . ILE A 1 80  ? -13.907 -15.802 -22.670 1.00 32.08 ? 80  ILE A HD13  1 
ATOM   1275  N  N     . TYR A 1 81  ? -12.090 -19.389 -26.460 1.00 16.63 ? 81  TYR A N     1 
ATOM   1276  C  CA    . TYR A 1 81  ? -12.521 -20.430 -27.411 1.00 14.78 ? 81  TYR A CA    1 
ATOM   1277  C  C     . TYR A 1 81  ? -11.342 -21.383 -27.719 1.00 15.93 ? 81  TYR A C     1 
ATOM   1278  O  O     . TYR A 1 81  ? -11.538 -22.580 -27.841 1.00 15.32 ? 81  TYR A O     1 
ATOM   1279  C  CB    . TYR A 1 81  ? -13.085 -19.812 -28.716 1.00 15.49 ? 81  TYR A CB    1 
ATOM   1280  C  CG    . TYR A 1 81  ? -14.018 -18.628 -28.494 1.00 16.74 ? 81  TYR A CG    1 
ATOM   1281  C  CD1   . TYR A 1 81  ? -14.128 -17.627 -29.453 1.00 15.43 ? 81  TYR A CD1   1 
ATOM   1282  C  CD2   . TYR A 1 81  ? -14.806 -18.537 -27.354 1.00 16.26 ? 81  TYR A CD2   1 
ATOM   1283  C  CE1   . TYR A 1 81  ? -14.944 -16.548 -29.271 1.00 16.89 ? 81  TYR A CE1   1 
ATOM   1284  C  CE2   . TYR A 1 81  ? -15.654 -17.431 -27.152 1.00 15.37 ? 81  TYR A CE2   1 
ATOM   1285  C  CZ    . TYR A 1 81  ? -15.697 -16.437 -28.112 1.00 16.05 ? 81  TYR A CZ    1 
ATOM   1286  O  OH    . TYR A 1 81  ? -16.500 -15.335 -27.951 1.00 16.99 ? 81  TYR A OH    1 
ATOM   1287  H  H     . TYR A 1 81  ? -12.117 -18.588 -26.772 1.00 19.90 ? 81  TYR A H     1 
ATOM   1288  H  HA    . TYR A 1 81  ? -13.234 -20.959 -26.998 1.00 17.67 ? 81  TYR A HA    1 
ATOM   1289  H  HB2   . TYR A 1 81  ? -12.343 -19.505 -29.260 1.00 18.53 ? 81  TYR A HB2   1 
ATOM   1290  H  HB3   . TYR A 1 81  ? -13.582 -20.494 -29.193 1.00 18.53 ? 81  TYR A HB3   1 
ATOM   1291  H  HD1   . TYR A 1 81  ? -13.606 -17.675 -30.221 1.00 18.46 ? 81  TYR A HD1   1 
ATOM   1292  H  HD2   . TYR A 1 81  ? -14.748 -19.196 -26.701 1.00 19.45 ? 81  TYR A HD2   1 
ATOM   1293  H  HE1   . TYR A 1 81  ? -14.980 -15.878 -29.915 1.00 20.21 ? 81  TYR A HE1   1 
ATOM   1294  H  HE2   . TYR A 1 81  ? -16.161 -17.359 -26.375 1.00 18.39 ? 81  TYR A HE2   1 
ATOM   1295  H  HH    . TYR A 1 81  ? -16.276 -14.920 -27.281 1.00 20.33 ? 81  TYR A HH    1 
ATOM   1296  N  N     . GLU A 1 82  ? -10.126 -20.839 -27.799 1.00 15.63 ? 82  GLU A N     1 
ATOM   1297  C  CA    . GLU A 1 82  ? -8.924  -21.644 -28.028 1.00 17.61 ? 82  GLU A CA    1 
ATOM   1298  C  C     . GLU A 1 82  ? -8.657  -22.603 -26.875 1.00 21.30 ? 82  GLU A C     1 
ATOM   1299  O  O     . GLU A 1 82  ? -8.199  -23.735 -27.076 1.00 18.80 ? 82  GLU A O     1 
ATOM   1300  C  CB    . GLU A 1 82  ? -7.727  -20.712 -28.285 1.00 18.53 ? 82  GLU A CB    1 
ATOM   1301  C  CG    . GLU A 1 82  ? -7.877  -19.938 -29.560 1.00 24.16 ? 82  GLU A CG    1 
ATOM   1302  C  CD    . GLU A 1 82  ? -6.679  -19.055 -29.882 1.00 43.97 ? 82  GLU A CD    1 
ATOM   1303  O  OE1   . GLU A 1 82  ? -5.819  -18.863 -28.989 1.00 46.89 ? 82  GLU A OE1   1 
ATOM   1304  O  OE2   . GLU A 1 82  ? -6.612  -18.554 -31.034 1.00 42.11 ? 82  GLU A OE2   1 
ATOM   1305  H  H     . GLU A 1 82  ? -9.970  -19.997 -27.724 1.00 18.69 ? 82  GLU A H     1 
ATOM   1306  H  HA    . GLU A 1 82  ? -9.058  -22.183 -28.835 1.00 21.07 ? 82  GLU A HA    1 
ATOM   1307  H  HB2   . GLU A 1 82  ? -7.655  -20.078 -27.555 1.00 22.17 ? 82  GLU A HB2   1 
ATOM   1308  H  HB3   . GLU A 1 82  ? -6.918  -21.243 -28.348 1.00 22.17 ? 82  GLU A HB3   1 
ATOM   1309  H  HG2   . GLU A 1 82  ? -7.990  -20.563 -30.293 1.00 28.93 ? 82  GLU A HG2   1 
ATOM   1310  H  HG3   . GLU A 1 82  ? -8.657  -19.367 -29.490 1.00 28.93 ? 82  GLU A HG3   1 
ATOM   1311  N  N     . ALA A 1 83  ? -8.986  -22.154 -25.666 1.00 18.38 ? 83  ALA A N     1 
ATOM   1312  C  CA    . ALA A 1 83  ? -8.798  -22.953 -24.470 1.00 21.10 ? 83  ALA A CA    1 
ATOM   1313  C  C     . ALA A 1 83  ? -9.769  -24.114 -24.484 1.00 23.22 ? 83  ALA A C     1 
ATOM   1314  O  O     . ALA A 1 83  ? -9.389  -25.274 -24.276 1.00 15.48 ? 83  ALA A O     1 
ATOM   1315  C  CB    . ALA A 1 83  ? -9.034  -22.080 -23.231 1.00 21.56 ? 83  ALA A CB    1 
ATOM   1316  H  H     . ALA A 1 83  ? -9.324  -21.378 -25.516 1.00 21.99 ? 83  ALA A H     1 
ATOM   1317  H  HA    . ALA A 1 83  ? -7.884  -23.303 -24.442 1.00 25.26 ? 83  ALA A HA    1 
ATOM   1318  H  HB1   . ALA A 1 83  ? -9.931  -21.739 -23.256 1.00 25.81 ? 83  ALA A HB1   1 
ATOM   1319  H  HB2   . ALA A 1 83  ? -8.908  -22.615 -22.444 1.00 25.81 ? 83  ALA A HB2   1 
ATOM   1320  H  HB3   . ALA A 1 83  ? -8.407  -21.354 -23.237 1.00 25.81 ? 83  ALA A HB3   1 
ATOM   1321  N  N     . PHE A 1 84  ? -11.039 -23.810 -24.744 1.00 17.52 ? 84  PHE A N     1 
ATOM   1322  C  CA    . PHE A 1 84  ? -12.026 -24.857 -24.883 1.00 17.75 ? 84  PHE A CA    1 
ATOM   1323  C  C     . PHE A 1 84  ? -11.566 -25.820 -25.958 1.00 18.11 ? 84  PHE A C     1 
ATOM   1324  O  O     . PHE A 1 84  ? -11.595 -27.025 -25.776 1.00 18.64 ? 84  PHE A O     1 
ATOM   1325  C  CB    . PHE A 1 84  ? -13.381 -24.268 -25.282 1.00 20.28 ? 84  PHE A CB    1 
ATOM   1326  C  CG    . PHE A 1 84  ? -14.250 -23.949 -24.125 1.00 18.41 ? 84  PHE A CG    1 
ATOM   1327  C  CD1   . PHE A 1 84  ? -14.018 -22.845 -23.341 1.00 17.76 ? 84  PHE A CD1   1 
ATOM   1328  C  CD2   . PHE A 1 84  ? -15.323 -24.761 -23.829 1.00 19.02 ? 84  PHE A CD2   1 
ATOM   1329  C  CE1   . PHE A 1 84  ? -14.871 -22.564 -22.253 1.00 19.26 ? 84  PHE A CE1   1 
ATOM   1330  C  CE2   . PHE A 1 84  ? -16.154 -24.483 -22.744 1.00 24.23 ? 84  PHE A CE2   1 
ATOM   1331  C  CZ    . PHE A 1 84  ? -15.913 -23.394 -21.967 1.00 16.55 ? 84  PHE A CZ    1 
ATOM   1332  H  H     . PHE A 1 84  ? -11.345 -23.012 -24.842 1.00 20.97 ? 84  PHE A H     1 
ATOM   1333  H  HA    . PHE A 1 84  ? -12.124 -25.343 -24.037 1.00 21.24 ? 84  PHE A HA    1 
ATOM   1334  H  HB2   . PHE A 1 84  ? -13.232 -23.448 -25.778 1.00 24.27 ? 84  PHE A HB2   1 
ATOM   1335  H  HB3   . PHE A 1 84  ? -13.850 -24.910 -25.839 1.00 24.27 ? 84  PHE A HB3   1 
ATOM   1336  H  HD1   . PHE A 1 84  ? -13.303 -22.282 -23.529 1.00 21.25 ? 84  PHE A HD1   1 
ATOM   1337  H  HD2   . PHE A 1 84  ? -15.487 -25.513 -24.351 1.00 22.76 ? 84  PHE A HD2   1 
ATOM   1338  H  HE1   . PHE A 1 84  ? -14.709 -21.821 -21.718 1.00 23.05 ? 84  PHE A HE1   1 
ATOM   1339  H  HE2   . PHE A 1 84  ? -16.872 -25.043 -22.552 1.00 29.02 ? 84  PHE A HE2   1 
ATOM   1340  H  HZ    . PHE A 1 84  ? -16.473 -23.203 -21.249 1.00 19.80 ? 84  PHE A HZ    1 
ATOM   1341  N  N     . SER A 1 85  ? -11.157 -25.276 -27.097 1.00 16.82 ? 85  SER A N     1 
ATOM   1342  C  CA    . SER A 1 85  ? -10.757 -26.126 -28.206 1.00 15.56 ? 85  SER A CA    1 
ATOM   1343  C  C     . SER A 1 85  ? -9.611  -27.026 -27.769 1.00 17.69 ? 85  SER A C     1 
ATOM   1344  O  O     . SER A 1 85  ? -9.643  -28.240 -27.928 1.00 16.61 ? 85  SER A O     1 
ATOM   1345  C  CB    . SER A 1 85  ? -10.343 -25.271 -29.393 1.00 21.82 ? 85  SER A CB    1 
ATOM   1346  O  OG    . SER A 1 85  ? -9.915  -26.087 -30.460 1.00 18.57 ? 85  SER A OG    1 
ATOM   1347  H  H     . SER A 1 85  ? -11.103 -24.432 -27.251 1.00 20.12 ? 85  SER A H     1 
ATOM   1348  H  HA    . SER A 1 85  ? -11.512 -26.690 -28.476 1.00 18.61 ? 85  SER A HA    1 
ATOM   1349  H  HB2   . SER A 1 85  ? -11.102 -24.742 -29.683 1.00 26.12 ? 85  SER A HB2   1 
ATOM   1350  H  HB3   . SER A 1 85  ? -9.614  -24.690 -29.126 1.00 26.12 ? 85  SER A HB3   1 
ATOM   1351  H  HG    . SER A 1 85  ? -9.967  -26.877 -30.248 1.00 22.22 ? 85  SER A HG    1 
ATOM   1352  N  N     . ASN A 1 86  ? -8.594  -26.426 -27.164 1.00 19.82 ? 86  ASN A N     1 
ATOM   1353  C  CA    . ASN A 1 86  ? -7.432  -27.218 -26.735 1.00 21.54 ? 86  ASN A CA    1 
ATOM   1354  C  C     . ASN A 1 86  ? -7.825  -28.365 -25.810 1.00 18.05 ? 86  ASN A C     1 
ATOM   1355  O  O     . ASN A 1 86  ? -7.296  -29.479 -25.933 1.00 19.84 ? 86  ASN A O     1 
ATOM   1356  C  CB    . ASN A 1 86  ? -6.372  -26.315 -26.080 1.00 22.20 ? 86  ASN A CB    1 
ATOM   1357  C  CG    . ASN A 1 86  ? -5.651  -25.427 -27.081 1.00 30.81 ? 86  ASN A CG    1 
ATOM   1358  O  OD1   . ASN A 1 86  ? -5.594  -25.734 -28.261 1.00 35.15 ? 86  ASN A OD1   1 
ATOM   1359  N  ND2   . ASN A 1 86  ? -5.063  -24.327 -26.598 1.00 42.04 ? 86  ASN A ND2   1 
ATOM   1360  H  H     . ASN A 1 86  ? -8.544  -25.585 -26.991 1.00 23.72 ? 86  ASN A H     1 
ATOM   1361  H  HA    . ASN A 1 86  ? -7.022  -27.616 -27.531 1.00 25.78 ? 86  ASN A HA    1 
ATOM   1362  H  HB2   . ASN A 1 86  ? -6.805  -25.741 -25.428 1.00 26.58 ? 86  ASN A HB2   1 
ATOM   1363  H  HB3   . ASN A 1 86  ? -5.709  -26.872 -25.642 1.00 26.58 ? 86  ASN A HB3   1 
ATOM   1364  H  HD21  . ASN A 1 86  ? -4.644  -23.795 -27.128 1.00 50.39 ? 86  ASN A HD21  1 
ATOM   1365  H  HD22  . ASN A 1 86  ? -5.105  -24.151 -25.757 1.00 50.39 ? 86  ASN A HD22  1 
ATOM   1366  N  N     . ARG A 1 87  ? -8.744  -28.129 -24.872 1.00 17.48 ? 87  ARG A N     1 
ATOM   1367  C  CA    . ARG A 1 87  ? -9.132  -29.199 -23.962 1.00 21.27 ? 87  ARG A CA    1 
ATOM   1368  C  C     . ARG A 1 87  ? -9.899  -30.290 -24.675 1.00 23.44 ? 87  ARG A C     1 
ATOM   1369  O  O     . ARG A 1 87  ? -9.678  -31.478 -24.433 1.00 21.76 ? 87  ARG A O     1 
ATOM   1370  C  CB    . ARG A 1 87  ? -9.963  -28.686 -22.781 1.00 18.56 ? 87  ARG A CB    1 
ATOM   1371  C  CG    . ARG A 1 87  ? -9.258  -27.679 -21.921 1.00 18.75 ? 87  ARG A CG    1 
ATOM   1372  C  CD    . ARG A 1 87  ? -9.971  -27.474 -20.582 1.00 24.62 ? 87  ARG A CD    1 
ATOM   1373  N  NE    . ARG A 1 87  ? -11.294 -26.864 -20.689 1.00 22.57 ? 87  ARG A NE    1 
ATOM   1374  C  CZ    . ARG A 1 87  ? -11.553 -25.548 -20.674 1.00 22.08 ? 87  ARG A CZ    1 
ATOM   1375  N  NH1   . ARG A 1 87  ? -10.588 -24.655 -20.598 1.00 21.21 ? 87  ARG A NH1   1 
ATOM   1376  N  NH2   . ARG A 1 87  ? -12.815 -25.114 -20.740 1.00 21.19 ? 87  ARG A NH2   1 
ATOM   1377  H  H     . ARG A 1 87  ? -9.145  -27.379 -24.745 1.00 20.91 ? 87  ARG A H     1 
ATOM   1378  H  HA    . ARG A 1 87  ? -8.318  -29.603 -23.595 1.00 25.47 ? 87  ARG A HA    1 
ATOM   1379  H  HB2   . ARG A 1 87  ? -10.768 -28.267 -23.126 1.00 22.21 ? 87  ARG A HB2   1 
ATOM   1380  H  HB3   . ARG A 1 87  ? -10.202 -29.439 -22.218 1.00 22.21 ? 87  ARG A HB3   1 
ATOM   1381  H  HG2   . ARG A 1 87  ? -8.357  -27.989 -21.740 1.00 22.44 ? 87  ARG A HG2   1 
ATOM   1382  H  HG3   . ARG A 1 87  ? -9.232  -26.827 -22.384 1.00 22.44 ? 87  ARG A HG3   1 
ATOM   1383  H  HD2   . ARG A 1 87  ? -10.079 -28.337 -20.153 1.00 29.49 ? 87  ARG A HD2   1 
ATOM   1384  H  HD3   . ARG A 1 87  ? -9.426  -26.898 -20.025 1.00 29.49 ? 87  ARG A HD3   1 
ATOM   1385  H  HE    . ARG A 1 87  ? -11.966 -27.395 -20.768 1.00 27.03 ? 87  ARG A HE    1 
ATOM   1386  H  HH11  . ARG A 1 87  ? -9.769  -24.911 -20.545 1.00 25.39 ? 87  ARG A HH11  1 
ATOM   1387  H  HH12  . ARG A 1 87  ? -10.778 -23.816 -20.596 1.00 25.39 ? 87  ARG A HH12  1 
ATOM   1388  H  HH21  . ARG A 1 87  ? -13.461 -25.678 -20.799 1.00 25.36 ? 87  ARG A HH21  1 
ATOM   1389  H  HH22  . ARG A 1 87  ? -12.980 -24.270 -20.748 1.00 25.36 ? 87  ARG A HH22  1 
ATOM   1390  N  N     . ILE A 1 88  ? -10.780 -29.895 -25.585 1.00 18.90 ? 88  ILE A N     1 
ATOM   1391  C  CA    . ILE A 1 88  ? -11.547 -30.893 -26.319 1.00 22.63 ? 88  ILE A CA    1 
ATOM   1392  C  C     . ILE A 1 88  ? -10.639 -31.759 -27.194 1.00 22.00 ? 88  ILE A C     1 
ATOM   1393  O  O     . ILE A 1 88  ? -10.767 -32.981 -27.174 1.00 26.28 ? 88  ILE A O     1 
ATOM   1394  C  CB    . ILE A 1 88  ? -12.683 -30.259 -27.125 1.00 19.58 ? 88  ILE A CB    1 
ATOM   1395  C  CG1   . ILE A 1 88  ? -13.682 -29.630 -26.144 1.00 22.05 ? 88  ILE A CG1   1 
ATOM   1396  C  CG2   . ILE A 1 88  ? -13.427 -31.323 -27.932 1.00 15.00 ? 88  ILE A CG2   1 
ATOM   1397  C  CD1   . ILE A 1 88  ? -14.768 -28.770 -26.811 1.00 19.84 ? 88  ILE A CD1   1 
ATOM   1398  H  H     . ILE A 1 88  ? -10.950 -29.077 -25.793 1.00 22.62 ? 88  ILE A H     1 
ATOM   1399  H  HA    . ILE A 1 88  ? -11.964 -31.492 -25.665 1.00 27.10 ? 88  ILE A HA    1 
ATOM   1400  H  HB    . ILE A 1 88  ? -12.329 -29.579 -27.719 1.00 23.43 ? 88  ILE A HB    1 
ATOM   1401  H  HG12  . ILE A 1 88  ? -14.127 -30.340 -25.655 1.00 26.40 ? 88  ILE A HG12  1 
ATOM   1402  H  HG13  . ILE A 1 88  ? -13.195 -29.063 -25.526 1.00 26.40 ? 88  ILE A HG13  1 
ATOM   1403  H  HG21  . ILE A 1 88  ? -14.133 -30.901 -28.427 1.00 17.94 ? 88  ILE A HG21  1 
ATOM   1404  H  HG22  . ILE A 1 88  ? -12.811 -31.745 -28.535 1.00 17.94 ? 88  ILE A HG22  1 
ATOM   1405  H  HG23  . ILE A 1 88  ? -13.793 -31.973 -27.329 1.00 17.94 ? 88  ILE A HG23  1 
ATOM   1406  H  HD11  . ILE A 1 88  ? -14.348 -28.052 -27.289 1.00 23.74 ? 88  ILE A HD11  1 
ATOM   1407  H  HD12  . ILE A 1 88  ? -15.271 -29.318 -27.418 1.00 23.74 ? 88  ILE A HD12  1 
ATOM   1408  H  HD13  . ILE A 1 88  ? -15.347 -28.416 -26.132 1.00 23.74 ? 88  ILE A HD13  1 
ATOM   1409  N  N     . MET A 1 89  ? -9.732  -31.135 -27.948 1.00 21.03 ? 89  MET A N     1 
ATOM   1410  C  CA    . MET A 1 89  ? -8.819  -31.882 -28.813 1.00 21.68 ? 89  MET A CA    1 
ATOM   1411  C  C     . MET A 1 89  ? -8.005  -32.855 -27.971 1.00 26.73 ? 89  MET A C     1 
ATOM   1412  O  O     . MET A 1 89  ? -7.695  -33.960 -28.404 1.00 28.68 ? 89  MET A O     1 
ATOM   1413  C  CB    . MET A 1 89  ? -7.868  -30.954 -29.552 1.00 24.94 ? 89  MET A CB    1 
ATOM   1414  C  CG    . MET A 1 89  ? -8.546  -29.988 -30.532 1.00 20.48 ? 89  MET A CG    1 
ATOM   1415  S  SD    . MET A 1 89  ? -9.713  -30.851 -31.596 1.00 19.26 ? 89  MET A SD    1 
ATOM   1416  C  CE    . MET A 1 89  ? -10.409 -29.514 -32.545 1.00 19.12 ? 89  MET A CE    1 
ATOM   1417  H  H     . MET A 1 89  ? -9.626  -30.282 -27.977 1.00 25.17 ? 89  MET A H     1 
ATOM   1418  H  HA    . MET A 1 89  ? -9.338  -32.382 -29.477 1.00 25.95 ? 89  MET A HA    1 
ATOM   1419  H  HB2   . MET A 1 89  ? -7.387  -30.421 -28.900 1.00 29.87 ? 89  MET A HB2   1 
ATOM   1420  H  HB3   . MET A 1 89  ? -7.241  -31.494 -30.058 1.00 29.87 ? 89  MET A HB3   1 
ATOM   1421  H  HG2   . MET A 1 89  ? -9.031  -29.312 -30.033 1.00 24.51 ? 89  MET A HG2   1 
ATOM   1422  H  HG3   . MET A 1 89  ? -7.871  -29.574 -31.092 1.00 24.51 ? 89  MET A HG3   1 
ATOM   1423  H  HE1   . MET A 1 89  ? -10.830 -28.893 -31.946 1.00 22.89 ? 89  MET A HE1   1 
ATOM   1424  H  HE2   . MET A 1 89  ? -9.706  -29.077 -33.030 1.00 22.89 ? 89  MET A HE2   1 
ATOM   1425  H  HE3   . MET A 1 89  ? -11.057 -29.870 -33.156 1.00 22.89 ? 89  MET A HE3   1 
ATOM   1426  N  N     . ASN A 1 90  ? -7.656  -32.438 -26.763 1.00 25.98 ? 90  ASN A N     1 
ATOM   1427  C  CA    . ASN A 1 90  ? -6.944  -33.328 -25.852 1.00 26.93 ? 90  ASN A CA    1 
ATOM   1428  C  C     . ASN A 1 90  ? -7.805  -34.524 -25.451 1.00 24.23 ? 90  ASN A C     1 
ATOM   1429  O  O     . ASN A 1 90  ? -7.300  -35.634 -25.342 1.00 28.61 ? 90  ASN A O     1 
ATOM   1430  C  CB    . ASN A 1 90  ? -6.425  -32.571 -24.627 1.00 28.58 ? 90  ASN A CB    1 
ATOM   1431  C  CG    . ASN A 1 90  ? -5.216  -31.706 -24.946 1.00 33.64 ? 90  ASN A CG    1 
ATOM   1432  O  OD1   . ASN A 1 90  ? -4.527  -31.918 -25.943 1.00 37.31 ? 90  ASN A OD1   1 
ATOM   1433  N  ND2   . ASN A 1 90  ? -4.945  -30.727 -24.083 1.00 42.04 ? 90  ASN A ND2   1 
ATOM   1434  H  H     . ASN A 1 90  ? -7.815  -31.654 -26.447 1.00 31.12 ? 90  ASN A H     1 
ATOM   1435  H  HA    . ASN A 1 90  ? -6.161  -33.683 -26.324 1.00 32.26 ? 90  ASN A HA    1 
ATOM   1436  H  HB2   . ASN A 1 90  ? -7.128  -31.994 -24.291 1.00 34.23 ? 90  ASN A HB2   1 
ATOM   1437  H  HB3   . ASN A 1 90  ? -6.166  -33.211 -23.946 1.00 34.23 ? 90  ASN A HB3   1 
ATOM   1438  H  HD21  . ASN A 1 90  ? -4.272  -30.210 -24.217 1.00 50.39 ? 90  ASN A HD21  1 
ATOM   1439  H  HD22  . ASN A 1 90  ? -5.444  -30.614 -23.391 1.00 50.39 ? 90  ASN A HD22  1 
ATOM   1440  N  N     . LEU A 1 91  ? -9.105  -34.334 -25.274 1.00 24.59 ? 91  LEU A N     1 
ATOM   1441  C  CA    . LEU A 1 91  ? -9.962  -35.478 -24.981 1.00 26.50 ? 91  LEU A CA    1 
ATOM   1442  C  C     . LEU A 1 91  ? -10.053 -36.416 -26.191 1.00 34.42 ? 91  LEU A C     1 
ATOM   1443  O  O     . LEU A 1 91  ? -10.049 -37.643 -26.044 1.00 31.56 ? 91  LEU A O     1 
ATOM   1444  C  CB    . LEU A 1 91  ? -11.355 -35.041 -24.577 1.00 29.42 ? 91  LEU A CB    1 
ATOM   1445  C  CG    . LEU A 1 91  ? -11.445 -34.217 -23.300 1.00 38.02 ? 91  LEU A CG    1 
ATOM   1446  C  CD1   . LEU A 1 91  ? -12.853 -33.705 -23.168 1.00 36.10 ? 91  LEU A CD1   1 
ATOM   1447  C  CD2   . LEU A 1 91  ? -11.041 -35.056 -22.076 1.00 38.16 ? 91  LEU A CD2   1 
ATOM   1448  H  H     . LEU A 1 91  ? -9.509  -33.576 -25.316 1.00 29.44 ? 91  LEU A H     1 
ATOM   1449  H  HA    . LEU A 1 91  ? -9.575  -35.982 -24.235 1.00 31.74 ? 91  LEU A HA    1 
ATOM   1450  H  HB2   . LEU A 1 91  ? -11.727 -34.505 -25.295 1.00 35.24 ? 91  LEU A HB2   1 
ATOM   1451  H  HB3   . LEU A 1 91  ? -11.899 -35.833 -24.450 1.00 35.24 ? 91  LEU A HB3   1 
ATOM   1452  H  HG    . LEU A 1 91  ? -10.846 -33.456 -23.363 1.00 45.57 ? 91  LEU A HG    1 
ATOM   1453  H  HD11  . LEU A 1 91  ? -12.921 -33.183 -22.365 1.00 43.26 ? 91  LEU A HD11  1 
ATOM   1454  H  HD12  . LEU A 1 91  ? -13.060 -33.160 -23.931 1.00 43.26 ? 91  LEU A HD12  1 
ATOM   1455  H  HD13  . LEU A 1 91  ? -13.454 -34.452 -23.126 1.00 43.26 ? 91  LEU A HD13  1 
ATOM   1456  H  HD21  . LEU A 1 91  ? -10.137 -35.359 -22.190 1.00 45.73 ? 91  LEU A HD21  1 
ATOM   1457  H  HD22  . LEU A 1 91  ? -11.107 -34.511 -21.288 1.00 45.73 ? 91  LEU A HD22  1 
ATOM   1458  H  HD23  . LEU A 1 91  ? -11.633 -35.808 -22.005 1.00 45.73 ? 91  LEU A HD23  1 
ATOM   1459  N  N     . LEU A 1 92  ? -10.164 -35.833 -27.381 1.00 28.96 ? 92  LEU A N     1 
ATOM   1460  C  CA    . LEU A 1 92  ? -10.286 -36.621 -28.606 1.00 26.06 ? 92  LEU A CA    1 
ATOM   1461  C  C     . LEU A 1 92  ? -9.037  -37.479 -28.804 1.00 30.64 ? 92  LEU A C     1 
ATOM   1462  O  O     . LEU A 1 92  ? -9.114  -38.662 -29.108 1.00 32.90 ? 92  LEU A O     1 
ATOM   1463  C  CB    . LEU A 1 92  ? -10.471 -35.694 -29.813 1.00 30.23 ? 92  LEU A CB    1 
ATOM   1464  C  CG    . LEU A 1 92  ? -11.781 -34.909 -29.863 1.00 27.48 ? 92  LEU A CG    1 
ATOM   1465  C  CD1   . LEU A 1 92  ? -11.796 -33.996 -31.082 1.00 27.20 ? 92  LEU A CD1   1 
ATOM   1466  C  CD2   . LEU A 1 92  ? -12.988 -35.875 -29.868 1.00 27.62 ? 92  LEU A CD2   1 
ATOM   1467  H  H     . LEU A 1 92  ? -10.171 -34.982 -27.508 1.00 34.69 ? 92  LEU A H     1 
ATOM   1468  H  HA    . LEU A 1 92  ? -11.066 -37.212 -28.542 1.00 31.22 ? 92  LEU A HA    1 
ATOM   1469  H  HB2   . LEU A 1 92  ? -9.748  -35.048 -29.814 1.00 36.21 ? 92  LEU A HB2   1 
ATOM   1470  H  HB3   . LEU A 1 92  ? -10.425 -36.231 -30.620 1.00 36.21 ? 92  LEU A HB3   1 
ATOM   1471  H  HG    . LEU A 1 92  ? -11.846 -34.353 -29.072 1.00 32.91 ? 92  LEU A HG    1 
ATOM   1472  H  HD11  . LEU A 1 92  ? -11.714 -34.532 -31.875 1.00 32.57 ? 92  LEU A HD11  1 
ATOM   1473  H  HD12  . LEU A 1 92  ? -12.624 -33.511 -31.099 1.00 32.57 ? 92  LEU A HD12  1 
ATOM   1474  H  HD13  . LEU A 1 92  ? -11.059 -33.384 -31.022 1.00 32.57 ? 92  LEU A HD13  1 
ATOM   1475  H  HD21  . LEU A 1 92  ? -12.967 -36.405 -29.068 1.00 33.08 ? 92  LEU A HD21  1 
ATOM   1476  H  HD22  . LEU A 1 92  ? -13.799 -35.361 -29.900 1.00 33.08 ? 92  LEU A HD22  1 
ATOM   1477  H  HD23  . LEU A 1 92  ? -12.930 -36.444 -30.639 1.00 33.08 ? 92  LEU A HD23  1 
ATOM   1478  N  N     . ASN A 1 93  ? -7.880  -36.868 -28.605 1.00 34.51 ? 93  ASN A N     1 
ATOM   1479  C  CA    . ASN A 1 93  ? -6.604  -37.512 -28.871 1.00 37.50 ? 93  ASN A CA    1 
ATOM   1480  C  C     . ASN A 1 93  ? -6.455  -38.872 -28.193 1.00 41.88 ? 93  ASN A C     1 
ATOM   1481  O  O     . ASN A 1 93  ? -5.831  -39.784 -28.739 1.00 36.39 ? 93  ASN A O     1 
ATOM   1482  C  CB    . ASN A 1 93  ? -5.471  -36.592 -28.431 1.00 39.24 ? 93  ASN A CB    1 
ATOM   1483  C  CG    . ASN A 1 93  ? -4.122  -37.171 -28.727 1.00 43.10 ? 93  ASN A CG    1 
ATOM   1484  O  OD1   . ASN A 1 93  ? -3.726  -37.292 -29.886 1.00 46.02 ? 93  ASN A OD1   1 
ATOM   1485  N  ND2   . ASN A 1 93  ? -3.403  -37.543 -27.683 1.00 46.49 ? 93  ASN A ND2   1 
ATOM   1486  H  H     . ASN A 1 93  ? -7.806  -36.063 -28.311 1.00 41.36 ? 93  ASN A H     1 
ATOM   1487  H  HA    . ASN A 1 93  ? -6.518  -37.651 -29.837 1.00 44.94 ? 93  ASN A HA    1 
ATOM   1488  H  HB2   . ASN A 1 93  ? -5.547  -35.748 -28.903 1.00 47.03 ? 93  ASN A HB2   1 
ATOM   1489  H  HB3   . ASN A 1 93  ? -5.534  -36.447 -27.474 1.00 47.03 ? 93  ASN A HB3   1 
ATOM   1490  H  HD21  . ASN A 1 93  ? -3.717  -37.447 -26.888 1.00 55.73 ? 93  ASN A HD21  1 
ATOM   1491  H  HD22  . ASN A 1 93  ? -2.620  -37.881 -27.798 1.00 55.73 ? 93  ASN A HD22  1 
ATOM   1492  N  N     . LYS A 1 94  ? -7.031  -39.018 -27.006 1.00 43.33 ? 94  LYS A N     1 
ATOM   1493  C  CA    . LYS A 1 94  ? -6.881  -40.269 -26.265 1.00 42.91 ? 94  LYS A CA    1 
ATOM   1494  C  C     . LYS A 1 94  ? -7.734  -41.404 -26.845 1.00 47.14 ? 94  LYS A C     1 
ATOM   1495  O  O     . LYS A 1 94  ? -7.554  -42.566 -26.491 1.00 45.05 ? 94  LYS A O     1 
ATOM   1496  C  CB    . LYS A 1 94  ? -7.190  -40.053 -24.773 1.00 51.69 ? 94  LYS A CB    1 
ATOM   1497  C  CG    . LYS A 1 94  ? -8.644  -40.252 -24.362 1.00 47.48 ? 94  LYS A CG    1 
ATOM   1498  C  CD    . LYS A 1 94  ? -8.798  -39.971 -22.859 1.00 59.46 ? 94  LYS A CD    1 
ATOM   1499  C  CE    . LYS A 1 94  ? -10.187 -39.470 -22.493 1.00 58.35 ? 94  LYS A CE    1 
ATOM   1500  N  NZ    . LYS A 1 94  ? -10.186 -38.876 -21.116 1.00 58.65 ? 94  LYS A NZ    1 
ATOM   1501  H  H     . LYS A 1 94  ? -7.507  -38.421 -26.610 1.00 51.93 ? 94  LYS A H     1 
ATOM   1502  H  HA    . LYS A 1 94  ? -5.944  -40.551 -26.328 1.00 51.43 ? 94  LYS A HA    1 
ATOM   1503  H  HB2   . LYS A 1 94  ? -6.655  -40.676 -24.257 1.00 61.97 ? 94  LYS A HB2   1 
ATOM   1504  H  HB3   . LYS A 1 94  ? -6.943  -39.145 -24.539 1.00 61.97 ? 94  LYS A HB3   1 
ATOM   1505  H  HG2   . LYS A 1 94  ? -9.209  -39.634 -24.852 1.00 56.91 ? 94  LYS A HG2   1 
ATOM   1506  H  HG3   . LYS A 1 94  ? -8.909  -41.168 -24.534 1.00 56.91 ? 94  LYS A HG3   1 
ATOM   1507  H  HD2   . LYS A 1 94  ? -8.635  -40.790 -22.366 1.00 71.29 ? 94  LYS A HD2   1 
ATOM   1508  H  HD3   . LYS A 1 94  ? -8.156  -39.292 -22.597 1.00 71.29 ? 94  LYS A HD3   1 
ATOM   1509  H  HE2   . LYS A 1 94  ? -10.461 -38.785 -23.123 1.00 69.95 ? 94  LYS A HE2   1 
ATOM   1510  H  HE3   . LYS A 1 94  ? -10.812 -40.212 -22.507 1.00 69.95 ? 94  LYS A HE3   1 
ATOM   1511  H  HZ1   . LYS A 1 94  ? -11.002 -38.586 -20.909 1.00 70.32 ? 94  LYS A HZ1   1 
ATOM   1512  H  HZ2   . LYS A 1 94  ? -9.938  -39.489 -20.521 1.00 70.32 ? 94  LYS A HZ2   1 
ATOM   1513  H  HZ3   . LYS A 1 94  ? -9.618  -38.191 -21.081 1.00 70.32 ? 94  LYS A HZ3   1 
ATOM   1514  N  N     . HIS A 1 95  ? -8.655  -41.075 -27.747 1.00 35.74 ? 95  HIS A N     1 
ATOM   1515  C  CA    . HIS A 1 95  ? -9.524  -42.090 -28.343 1.00 40.43 ? 95  HIS A CA    1 
ATOM   1516  C  C     . HIS A 1 95  ? -9.056  -42.518 -29.721 1.00 43.30 ? 95  HIS A C     1 
ATOM   1517  O  O     . HIS A 1 95  ? -9.687  -43.368 -30.356 1.00 46.72 ? 95  HIS A O     1 
ATOM   1518  C  CB    . HIS A 1 95  ? -10.936 -41.545 -28.487 1.00 39.30 ? 95  HIS A CB    1 
ATOM   1519  C  CG    . HIS A 1 95  ? -11.612 -41.277 -27.190 1.00 37.28 ? 95  HIS A CG    1 
ATOM   1520  N  ND1   . HIS A 1 95  ? -12.016 -42.285 -26.343 1.00 34.38 ? 95  HIS A ND1   1 
ATOM   1521  C  CD2   . HIS A 1 95  ? -11.975 -40.115 -26.596 1.00 37.36 ? 95  HIS A CD2   1 
ATOM   1522  C  CE1   . HIS A 1 95  ? -12.603 -41.756 -25.284 1.00 45.32 ? 95  HIS A CE1   1 
ATOM   1523  N  NE2   . HIS A 1 95  ? -12.591 -40.440 -25.415 1.00 33.72 ? 95  HIS A NE2   1 
ATOM   1524  H  H     . HIS A 1 95  ? -8.797  -40.276 -28.030 1.00 42.83 ? 95  HIS A H     1 
ATOM   1525  H  HA    . HIS A 1 95  ? -9.552  -42.879 -27.763 1.00 48.45 ? 95  HIS A HA    1 
ATOM   1526  H  HB2   . HIS A 1 95  ? -10.900 -40.710 -28.980 1.00 47.10 ? 95  HIS A HB2   1 
ATOM   1527  H  HB3   . HIS A 1 95  ? -11.472 -42.191 -28.972 1.00 47.10 ? 95  HIS A HB3   1 
ATOM   1528  H  HD1   . HIS A 1 95  ? -11.910 -43.127 -26.485 1.00 41.19 ? 95  HIS A HD1   1 
ATOM   1529  H  HD2   . HIS A 1 95  ? -11.841 -39.258 -26.931 1.00 44.78 ? 95  HIS A HD2   1 
ATOM   1530  H  HE1   . HIS A 1 95  ? -12.957 -42.229 -24.565 1.00 54.32 ? 95  HIS A HE1   1 
ATOM   1531  H  HE2   . HIS A 1 95  ? -12.909 -39.879 -24.846 1.00 40.41 ? 95  HIS A HE2   1 
ATOM   1532  N  N     . ALA A 1 96  ? -7.968  -41.914 -30.185 1.00 32.90 ? 96  ALA A N     1 
ATOM   1533  C  CA    . ALA A 1 96  ? -7.523  -42.079 -31.558 1.00 40.28 ? 96  ALA A CA    1 
ATOM   1534  C  C     . ALA A 1 96  ? -6.151  -42.724 -31.654 1.00 42.35 ? 96  ALA A C     1 
ATOM   1535  O  O     . ALA A 1 96  ? -5.230  -42.384 -30.903 1.00 37.17 ? 96  ALA A O     1 
ATOM   1536  C  CB    . ALA A 1 96  ? -7.482  -40.739 -32.253 1.00 29.86 ? 96  ALA A CB    1 
ATOM   1537  H  H     . ALA A 1 96  ? -7.465  -41.398 -29.716 1.00 39.42 ? 96  ALA A H     1 
ATOM   1538  H  HA    . ALA A 1 96  ? -8.161  -42.650 -32.035 1.00 48.27 ? 96  ALA A HA    1 
ATOM   1539  H  HB1   . ALA A 1 96  ? -7.187  -40.865 -33.157 1.00 35.77 ? 96  ALA A HB1   1 
ATOM   1540  H  HB2   . ALA A 1 96  ? -8.363  -40.357 -32.246 1.00 35.77 ? 96  ALA A HB2   1 
ATOM   1541  H  HB3   . ALA A 1 96  ? -6.872  -40.163 -31.786 1.00 35.77 ? 96  ALA A HB3   1 
ATOM   1542  N  N     . ASP A 1 97  ? -6.029  -43.640 -32.605 1.00 39.39 ? 97  ASP A N     1 
ATOM   1543  C  CA    . ASP A 1 97  ? -4.728  -44.066 -33.101 1.00 45.63 ? 97  ASP A CA    1 
ATOM   1544  C  C     . ASP A 1 97  ? -3.924  -42.847 -33.567 1.00 42.28 ? 97  ASP A C     1 
ATOM   1545  O  O     . ASP A 1 97  ? -2.737  -42.710 -33.252 1.00 41.33 ? 97  ASP A O     1 
ATOM   1546  C  CB    . ASP A 1 97  ? -4.895  -45.039 -34.279 1.00 45.46 ? 97  ASP A CB    1 
ATOM   1547  C  CG    . ASP A 1 97  ? -5.859  -46.202 -33.978 1.00 44.19 ? 97  ASP A CG    1 
ATOM   1548  O  OD1   . ASP A 1 97  ? -6.089  -46.539 -32.802 1.00 48.65 ? 97  ASP A OD1   1 
ATOM   1549  O  OD2   . ASP A 1 97  ? -6.380  -46.805 -34.942 1.00 54.43 ? 97  ASP A OD2   1 
ATOM   1550  H  H     . ASP A 1 97  ? -6.692  -44.034 -32.985 1.00 47.21 ? 97  ASP A H     1 
ATOM   1551  H  HA    . ASP A 1 97  ? -4.232  -44.518 -32.387 1.00 54.70 ? 97  ASP A HA    1 
ATOM   1552  H  HB2   . ASP A 1 97  ? -5.245  -44.552 -35.042 1.00 54.49 ? 97  ASP A HB2   1 
ATOM   1553  H  HB3   . ASP A 1 97  ? -4.030  -45.418 -34.499 1.00 54.49 ? 97  ASP A HB3   1 
ATOM   1554  N  N     . LYS A 1 98  ? -4.566  -41.975 -34.338 1.00 40.20 ? 98  LYS A N     1 
ATOM   1555  C  CA    . LYS A 1 98  ? -3.933  -40.772 -34.879 1.00 33.75 ? 98  LYS A CA    1 
ATOM   1556  C  C     . LYS A 1 98  ? -4.989  -39.670 -34.905 1.00 35.73 ? 98  LYS A C     1 
ATOM   1557  O  O     . LYS A 1 98  ? -6.155  -39.959 -35.131 1.00 31.43 ? 98  LYS A O     1 
ATOM   1558  C  CB    . LYS A 1 98  ? -3.500  -40.978 -36.336 1.00 29.05 ? 98  LYS A CB    1 
ATOM   1559  C  CG    . LYS A 1 98  ? -2.472  -42.060 -36.630 1.00 29.09 ? 98  LYS A CG    1 
ATOM   1560  C  CD    . LYS A 1 98  ? -2.503  -42.470 -38.143 1.00 28.82 ? 98  LYS A CD    1 
ATOM   1561  C  CE    . LYS A 1 98  ? -2.182  -41.292 -39.075 1.00 28.59 ? 98  LYS A CE    1 
ATOM   1562  N  NZ    . LYS A 1 98  ? -1.939  -41.682 -40.505 1.00 30.61 ? 98  LYS A NZ    1 
ATOM   1563  H  HA    . LYS A 1 98  ? -3.168  -40.495 -34.333 1.00 40.44 ? 98  LYS A HA    1 
ATOM   1564  H  HB2   . LYS A 1 98  ? -4.291  -41.192 -36.855 1.00 34.80 ? 98  LYS A HB2   1 
ATOM   1565  H  HB3   . LYS A 1 98  ? -3.128  -40.141 -36.658 1.00 34.80 ? 98  LYS A HB3   1 
ATOM   1566  H  HG2   . LYS A 1 98  ? -1.585  -41.727 -36.422 1.00 34.84 ? 98  LYS A HG2   1 
ATOM   1567  H  HG3   . LYS A 1 98  ? -2.670  -42.846 -36.097 1.00 34.84 ? 98  LYS A HG3   1 
ATOM   1568  H  HD2   . LYS A 1 98  ? -1.843  -43.164 -38.298 1.00 34.52 ? 98  LYS A HD2   1 
ATOM   1569  H  HD3   . LYS A 1 98  ? -3.389  -42.797 -38.365 1.00 34.52 ? 98  LYS A HD3   1 
ATOM   1570  H  HE2   . LYS A 1 98  ? -2.929  -40.673 -39.062 1.00 34.25 ? 98  LYS A HE2   1 
ATOM   1571  H  HE3   . LYS A 1 98  ? -1.383  -40.848 -38.751 1.00 34.25 ? 98  LYS A HE3   1 
ATOM   1572  H  HZ1   . LYS A 1 98  ? -1.759  -40.958 -40.990 1.00 36.67 ? 98  LYS A HZ1   1 
ATOM   1573  H  HZ2   . LYS A 1 98  ? -1.248  -42.242 -40.554 1.00 36.67 ? 98  LYS A HZ2   1 
ATOM   1574  H  HZ3   . LYS A 1 98  ? -2.660  -42.082 -40.838 1.00 36.67 ? 98  LYS A HZ3   1 
ATOM   1575  N  N     . ILE A 1 99  ? -4.590  -38.415 -34.715 1.00 29.83 ? 99  ILE A N     1 
ATOM   1576  C  CA    . ILE A 1 99  ? -5.544  -37.311 -34.821 1.00 32.21 ? 99  ILE A CA    1 
ATOM   1577  C  C     . ILE A 1 99  ? -5.032  -36.205 -35.703 1.00 30.93 ? 99  ILE A C     1 
ATOM   1578  O  O     . ILE A 1 99  ? -3.860  -35.827 -35.643 1.00 28.57 ? 99  ILE A O     1 
ATOM   1579  C  CB    . ILE A 1 99  ? -5.895  -36.691 -33.450 1.00 32.40 ? 99  ILE A CB    1 
ATOM   1580  C  CG1   . ILE A 1 99  ? -6.942  -35.595 -33.631 1.00 29.58 ? 99  ILE A CG1   1 
ATOM   1581  C  CG2   . ILE A 1 99  ? -4.653  -36.074 -32.790 1.00 34.94 ? 99  ILE A CG2   1 
ATOM   1582  C  CD1   . ILE A 1 99  ? -7.672  -35.267 -32.325 1.00 34.55 ? 99  ILE A CD1   1 
ATOM   1583  H  H     . ILE A 1 99  ? -3.785  -38.177 -34.526 1.00 35.74 ? 99  ILE A H     1 
ATOM   1584  H  HA    . ILE A 1 99  ? -6.374  -37.650 -35.217 1.00 38.60 ? 99  ILE A HA    1 
ATOM   1585  H  HB    . ILE A 1 99  ? -6.253  -37.381 -32.871 1.00 38.82 ? 99  ILE A HB    1 
ATOM   1586  H  HG12  . ILE A 1 99  ? -6.506  -34.788 -33.944 1.00 35.43 ? 99  ILE A HG12  1 
ATOM   1587  H  HG13  . ILE A 1 99  ? -7.601  -35.890 -34.279 1.00 35.43 ? 99  ILE A HG13  1 
ATOM   1588  H  HG21  . ILE A 1 99  ? -3.994  -36.760 -32.662 1.00 41.87 ? 99  ILE A HG21  1 
ATOM   1589  H  HG22  . ILE A 1 99  ? -4.304  -35.387 -33.363 1.00 41.87 ? 99  ILE A HG22  1 
ATOM   1590  H  HG23  . ILE A 1 99  ? -4.904  -35.698 -31.943 1.00 41.87 ? 99  ILE A HG23  1 
ATOM   1591  H  HD11  . ILE A 1 99  ? -8.114  -36.058 -32.007 1.00 41.40 ? 99  ILE A HD11  1 
ATOM   1592  H  HD12  . ILE A 1 99  ? -7.031  -34.967 -31.676 1.00 41.40 ? 99  ILE A HD12  1 
ATOM   1593  H  HD13  . ILE A 1 99  ? -8.316  -34.576 -32.492 1.00 41.40 ? 99  ILE A HD13  1 
ATOM   1594  N  N     . GLU A 1 100 ? -5.930  -35.675 -36.515 1.00 26.80 ? 100 GLU A N     1 
ATOM   1595  C  CA    . GLU A 1 100 ? -5.665  -34.489 -37.305 1.00 28.23 ? 100 GLU A CA    1 
ATOM   1596  C  C     . GLU A 1 100 ? -6.556  -33.321 -36.878 1.00 32.04 ? 100 GLU A C     1 
ATOM   1597  O  O     . GLU A 1 100 ? -7.748  -33.308 -37.167 1.00 25.70 ? 100 GLU A O     1 
ATOM   1598  C  CB    . GLU A 1 100 ? -5.908  -34.767 -38.782 1.00 24.54 ? 100 GLU A CB    1 
ATOM   1599  C  CG    . GLU A 1 100 ? -5.678  -33.581 -39.695 1.00 23.52 ? 100 GLU A CG    1 
ATOM   1600  C  CD    . GLU A 1 100 ? -5.709  -33.959 -41.173 1.00 36.67 ? 100 GLU A CD    1 
ATOM   1601  O  OE1   . GLU A 1 100 ? -5.969  -33.081 -42.029 1.00 35.31 ? 100 GLU A OE1   1 
ATOM   1602  O  OE2   . GLU A 1 100 ? -5.470  -35.147 -41.481 1.00 30.62 ? 100 GLU A OE2   1 
ATOM   1603  H  H     . GLU A 1 100 ? -6.721  -35.994 -36.629 1.00 32.09 ? 100 GLU A H     1 
ATOM   1604  H  HA    . GLU A 1 100 ? -4.729  -34.223 -37.190 1.00 33.81 ? 100 GLU A HA    1 
ATOM   1605  H  HB2   . GLU A 1 100 ? -5.311  -35.477 -39.066 1.00 29.38 ? 100 GLU A HB2   1 
ATOM   1606  H  HB3   . GLU A 1 100 ? -6.829  -35.051 -38.896 1.00 29.38 ? 100 GLU A HB3   1 
ATOM   1607  H  HG2   . GLU A 1 100 ? -6.373  -32.922 -39.539 1.00 28.16 ? 100 GLU A HG2   1 
ATOM   1608  H  HG3   . GLU A 1 100 ? -4.808  -33.198 -39.501 1.00 28.16 ? 100 GLU A HG3   1 
ATOM   1609  N  N     . VAL A 1 101 ? -5.956  -32.320 -36.237 1.00 26.44 ? 101 VAL A N     1 
ATOM   1610  C  CA    . VAL A 1 101 ? -6.685  -31.134 -35.829 1.00 25.28 ? 101 VAL A CA    1 
ATOM   1611  C  C     . VAL A 1 101 ? -6.701  -30.204 -37.012 1.00 27.04 ? 101 VAL A C     1 
ATOM   1612  O  O     . VAL A 1 101 ? -5.663  -29.668 -37.430 1.00 28.38 ? 101 VAL A O     1 
ATOM   1613  C  CB    . VAL A 1 101 ? -6.016  -30.466 -34.611 1.00 26.49 ? 101 VAL A CB    1 
ATOM   1614  C  CG1   . VAL A 1 101 ? -6.736  -29.167 -34.236 1.00 33.18 ? 101 VAL A CG1   1 
ATOM   1615  C  CG2   . VAL A 1 101 ? -5.992  -31.438 -33.478 1.00 26.33 ? 101 VAL A CG2   1 
ATOM   1616  H  H     . VAL A 1 101 ? -5.122  -32.308 -36.029 1.00 31.67 ? 101 VAL A H     1 
ATOM   1617  H  HA    . VAL A 1 101 ? -7.607  -31.371 -35.596 1.00 30.27 ? 101 VAL A HA    1 
ATOM   1618  H  HB    . VAL A 1 101 ? -5.090  -30.243 -34.839 1.00 31.73 ? 101 VAL A HB    1 
ATOM   1619  H  HG11  . VAL A 1 101 ? -6.298  -28.776 -33.477 1.00 39.76 ? 101 VAL A HG11  1 
ATOM   1620  H  HG12  . VAL A 1 101 ? -6.701  -28.564 -34.982 1.00 39.76 ? 101 VAL A HG12  1 
ATOM   1621  H  HG13  . VAL A 1 101 ? -7.650  -29.368 -34.020 1.00 39.76 ? 101 VAL A HG13  1 
ATOM   1622  H  HG21  . VAL A 1 101 ? -6.398  -32.260 -33.763 1.00 31.53 ? 101 VAL A HG21  1 
ATOM   1623  H  HG22  . VAL A 1 101 ? -5.081  -31.595 -33.221 1.00 31.53 ? 101 VAL A HG22  1 
ATOM   1624  H  HG23  . VAL A 1 101 ? -6.482  -31.069 -32.740 1.00 31.53 ? 101 VAL A HG23  1 
ATOM   1625  N  N     . ALA A 1 102 ? -7.886  -30.019 -37.575 1.00 22.25 ? 102 ALA A N     1 
ATOM   1626  C  CA    . ALA A 1 102 ? -8.016  -29.333 -38.851 1.00 28.96 ? 102 ALA A CA    1 
ATOM   1627  C  C     . ALA A 1 102 ? -8.231  -27.847 -38.682 1.00 36.56 ? 102 ALA A C     1 
ATOM   1628  O  O     . ALA A 1 102 ? -7.886  -27.065 -39.565 1.00 26.67 ? 102 ALA A O     1 
ATOM   1629  C  CB    . ALA A 1 102 ? -9.144  -29.942 -39.671 1.00 31.06 ? 102 ALA A CB    1 
ATOM   1630  H  H     . ALA A 1 102 ? -8.633  -30.281 -37.238 1.00 26.63 ? 102 ALA A H     1 
ATOM   1631  H  HA    . ALA A 1 102 ? -7.185  -29.455 -39.355 1.00 34.69 ? 102 ALA A HA    1 
ATOM   1632  H  HB1   . ALA A 1 102 ? -8.949  -30.869 -39.828 1.00 37.21 ? 102 ALA A HB1   1 
ATOM   1633  H  HB2   . ALA A 1 102 ? -9.966  -29.859 -39.182 1.00 37.21 ? 102 ALA A HB2   1 
ATOM   1634  H  HB3   . ALA A 1 102 ? -9.210  -29.474 -40.506 1.00 37.21 ? 102 ALA A HB3   1 
ATOM   1635  N  N     . SER A 1 103 ? -8.812  -27.454 -37.553 1.00 24.27 ? 103 SER A N     1 
ATOM   1636  C  CA    . SER A 1 103 ? -9.124  -26.048 -37.307 1.00 25.85 ? 103 SER A CA    1 
ATOM   1637  C  C     . SER A 1 103 ? -9.427  -25.923 -35.828 1.00 20.84 ? 103 SER A C     1 
ATOM   1638  O  O     . SER A 1 103 ? -9.358  -26.898 -35.112 1.00 21.34 ? 103 SER A O     1 
ATOM   1639  C  CB    . SER A 1 103 ? -10.318 -25.549 -38.145 1.00 20.72 ? 103 SER A CB    1 
ATOM   1640  O  OG    . SER A 1 103 ? -11.594 -25.877 -37.601 1.00 25.87 ? 103 SER A OG    1 
ATOM   1641  H  H     . SER A 1 103 ? -9.035  -27.982 -36.912 1.00 29.07 ? 103 SER A H     1 
ATOM   1642  H  HA    . SER A 1 103 ? -8.342  -25.495 -37.515 1.00 30.96 ? 103 SER A HA    1 
ATOM   1643  H  HB2   . SER A 1 103 ? -10.256 -24.584 -38.217 1.00 24.80 ? 103 SER A HB2   1 
ATOM   1644  H  HB3   . SER A 1 103 ? -10.254 -25.942 -39.030 1.00 24.80 ? 103 SER A HB3   1 
ATOM   1645  H  HG    . SER A 1 103 ? -11.502 -26.295 -36.901 1.00 30.99 ? 103 SER A HG    1 
ATOM   1646  N  N     . ILE A 1 104 ? -9.759  -24.725 -35.381 1.00 24.80 ? 104 ILE A N     1 
ATOM   1647  C  CA    . ILE A 1 104 ? -10.080 -24.517 -33.973 1.00 24.34 ? 104 ILE A CA    1 
ATOM   1648  C  C     . ILE A 1 104 ? -11.280 -25.356 -33.516 1.00 21.55 ? 104 ILE A C     1 
ATOM   1649  O  O     . ILE A 1 104 ? -11.487 -25.594 -32.323 1.00 18.45 ? 104 ILE A O     1 
ATOM   1650  C  CB    . ILE A 1 104 ? -10.359 -23.034 -33.679 1.00 21.99 ? 104 ILE A CB    1 
ATOM   1651  C  CG1   . ILE A 1 104 ? -10.412 -22.822 -32.162 1.00 23.35 ? 104 ILE A CG1   1 
ATOM   1652  C  CG2   . ILE A 1 104 ? -11.625 -22.544 -34.396 1.00 22.84 ? 104 ILE A CG2   1 
ATOM   1653  C  CD1   . ILE A 1 104 ? -10.496 -21.392 -31.774 1.00 21.88 ? 104 ILE A CD1   1 
ATOM   1654  H  H     . ILE A 1 104 ? -9.807  -24.017 -35.866 1.00 29.70 ? 104 ILE A H     1 
ATOM   1655  H  HA    . ILE A 1 104 ? -9.307  -24.787 -33.434 1.00 29.15 ? 104 ILE A HA    1 
ATOM   1656  H  HB    . ILE A 1 104 ? -9.611  -22.521 -34.022 1.00 26.33 ? 104 ILE A HB    1 
ATOM   1657  H  HG12  . ILE A 1 104 ? -11.195 -23.274 -31.809 1.00 27.96 ? 104 ILE A HG12  1 
ATOM   1658  H  HG13  . ILE A 1 104 ? -9.609  -23.193 -31.764 1.00 27.96 ? 104 ILE A HG13  1 
ATOM   1659  H  HG21  . ILE A 1 104 ? -11.763 -21.617 -34.187 1.00 27.34 ? 104 ILE A HG21  1 
ATOM   1660  H  HG22  . ILE A 1 104 ? -11.509 -22.652 -35.343 1.00 27.34 ? 104 ILE A HG22  1 
ATOM   1661  H  HG23  . ILE A 1 104 ? -12.375 -23.062 -34.096 1.00 27.34 ? 104 ILE A HG23  1 
ATOM   1662  H  HD11  . ILE A 1 104 ? -10.526 -21.330 -30.817 1.00 26.19 ? 104 ILE A HD11  1 
ATOM   1663  H  HD12  . ILE A 1 104 ? -9.723  -20.932 -32.109 1.00 26.19 ? 104 ILE A HD12  1 
ATOM   1664  H  HD13  . ILE A 1 104 ? -11.293 -21.013 -32.153 1.00 26.19 ? 104 ILE A HD13  1 
ATOM   1665  N  N     . ASP A 1 105 ? -12.119 -25.788 -34.441 1.00 17.78 ? 105 ASP A N     1 
ATOM   1666  C  CA    . ASP A 1 105 ? -13.253 -26.571 -33.956 1.00 21.04 ? 105 ASP A CA    1 
ATOM   1667  C  C     . ASP A 1 105 ? -13.543 -27.860 -34.685 1.00 19.18 ? 105 ASP A C     1 
ATOM   1668  O  O     . ASP A 1 105 ? -14.652 -28.378 -34.567 1.00 17.29 ? 105 ASP A O     1 
ATOM   1669  C  CB    . ASP A 1 105 ? -14.519 -25.738 -33.870 1.00 24.13 ? 105 ASP A CB    1 
ATOM   1670  C  CG    . ASP A 1 105 ? -15.271 -25.701 -35.170 1.00 24.53 ? 105 ASP A CG    1 
ATOM   1671  O  OD1   . ASP A 1 105 ? -14.642 -25.773 -36.227 1.00 28.24 ? 105 ASP A OD1   1 
ATOM   1672  O  OD2   . ASP A 1 105 ? -16.489 -25.563 -35.116 1.00 17.58 ? 105 ASP A OD2   1 
ATOM   1673  H  H     . ASP A 1 105 ? -12.070 -25.658 -35.290 1.00 21.28 ? 105 ASP A H     1 
ATOM   1674  H  HA    . ASP A 1 105 ? -13.040 -26.830 -33.035 1.00 25.18 ? 105 ASP A HA    1 
ATOM   1675  H  HB2   . ASP A 1 105 ? -15.103 -26.119 -33.196 1.00 28.90 ? 105 ASP A HB2   1 
ATOM   1676  H  HB3   . ASP A 1 105 ? -14.284 -24.828 -33.632 1.00 28.90 ? 105 ASP A HB3   1 
ATOM   1677  N  N     . GLU A 1 106 ? -12.552 -28.413 -35.379 1.00 16.79 ? 106 GLU A N     1 
ATOM   1678  C  CA    . GLU A 1 106 ? -12.786 -29.717 -35.968 1.00 19.27 ? 106 GLU A CA    1 
ATOM   1679  C  C     . GLU A 1 106 ? -11.530 -30.575 -36.073 1.00 20.64 ? 106 GLU A C     1 
ATOM   1680  O  O     . GLU A 1 106 ? -10.393 -30.063 -36.207 1.00 20.39 ? 106 GLU A O     1 
ATOM   1681  C  CB    . GLU A 1 106 ? -13.521 -29.566 -37.302 1.00 25.95 ? 106 GLU A CB    1 
ATOM   1682  C  CG    . GLU A 1 106 ? -12.722 -29.013 -38.392 1.00 21.46 ? 106 GLU A CG    1 
ATOM   1683  C  CD    . GLU A 1 106 ? -13.542 -28.678 -39.633 1.00 32.91 ? 106 GLU A CD    1 
ATOM   1684  O  OE1   . GLU A 1 106 ? -14.517 -27.935 -39.554 1.00 37.02 ? 106 GLU A OE1   1 
ATOM   1685  O  OE2   . GLU A 1 106 ? -13.212 -29.167 -40.704 1.00 27.75 ? 106 GLU A OE2   1 
ATOM   1686  H  H     . GLU A 1 106 ? -11.775 -28.072 -35.516 1.00 20.09 ? 106 GLU A H     1 
ATOM   1687  H  HA    . GLU A 1 106 ? -13.396 -30.200 -35.372 1.00 23.07 ? 106 GLU A HA    1 
ATOM   1688  H  HB2   . GLU A 1 106 ? -13.833 -30.440 -37.583 1.00 31.08 ? 106 GLU A HB2   1 
ATOM   1689  H  HB3   . GLU A 1 106 ? -14.281 -28.977 -37.169 1.00 31.08 ? 106 GLU A HB3   1 
ATOM   1690  H  HG2   . GLU A 1 106 ? -12.296 -28.197 -38.087 1.00 25.70 ? 106 GLU A HG2   1 
ATOM   1691  H  HG3   . GLU A 1 106 ? -12.047 -29.662 -38.647 1.00 25.70 ? 106 GLU A HG3   1 
ATOM   1692  N  N     . ALA A 1 107 ? -11.741 -31.888 -35.968 1.00 18.09 ? 107 ALA A N     1 
ATOM   1693  C  CA    . ALA A 1 107 ? -10.644 -32.824 -36.054 1.00 19.33 ? 107 ALA A CA    1 
ATOM   1694  C  C     . ALA A 1 107 ? -11.081 -34.144 -36.698 1.00 22.15 ? 107 ALA A C     1 
ATOM   1695  O  O     . ALA A 1 107 ? -12.254 -34.503 -36.670 1.00 15.46 ? 107 ALA A O     1 
ATOM   1696  C  CB    . ALA A 1 107 ? -10.046 -33.072 -34.718 1.00 23.74 ? 107 ALA A CB    1 
ATOM   1697  H  H     . ALA A 1 107 ? -12.511 -32.253 -35.847 1.00 21.65 ? 107 ALA A H     1 
ATOM   1698  H  HA    . ALA A 1 107 ? -9.947  -32.435 -36.622 1.00 23.13 ? 107 ALA A HA    1 
ATOM   1699  H  HB1   . ALA A 1 107 ? -9.323  -33.696 -34.811 1.00 28.43 ? 107 ALA A HB1   1 
ATOM   1700  H  HB2   . ALA A 1 107 ? -9.720  -32.242 -34.363 1.00 28.43 ? 107 ALA A HB2   1 
ATOM   1701  H  HB3   . ALA A 1 107 ? -10.719 -33.434 -34.137 1.00 28.43 ? 107 ALA A HB3   1 
ATOM   1702  N  N     . TYR A 1 108 ? -10.100 -34.824 -37.290 1.00 21.63 ? 108 TYR A N     1 
ATOM   1703  C  CA    . TYR A 1 108 ? -10.247 -36.178 -37.822 1.00 25.04 ? 108 TYR A CA    1 
ATOM   1704  C  C     . TYR A 1 108 ? -9.520  -37.146 -36.925 1.00 22.51 ? 108 TYR A C     1 
ATOM   1705  O  O     . TYR A 1 108 ? -8.354  -36.932 -36.583 1.00 29.41 ? 108 TYR A O     1 
ATOM   1706  C  CB    . TYR A 1 108 ? -9.648  -36.253 -39.235 1.00 24.10 ? 108 TYR A CB    1 
ATOM   1707  C  CG    . TYR A 1 108 ? -10.343 -35.364 -40.229 1.00 23.01 ? 108 TYR A CG    1 
ATOM   1708  C  CD1   . TYR A 1 108 ? -9.929  -34.052 -40.430 1.00 25.14 ? 108 TYR A CD1   1 
ATOM   1709  C  CD2   . TYR A 1 108 ? -11.440 -35.820 -40.951 1.00 27.83 ? 108 TYR A CD2   1 
ATOM   1710  C  CE1   . TYR A 1 108 ? -10.571 -33.225 -41.306 1.00 26.16 ? 108 TYR A CE1   1 
ATOM   1711  C  CE2   . TYR A 1 108 ? -12.076 -35.005 -41.836 1.00 24.99 ? 108 TYR A CE2   1 
ATOM   1712  C  CZ    . TYR A 1 108 ? -11.629 -33.706 -42.027 1.00 28.75 ? 108 TYR A CZ    1 
ATOM   1713  O  OH    . TYR A 1 108 ? -12.284 -32.880 -42.906 1.00 31.26 ? 108 TYR A OH    1 
ATOM   1714  H  H     . TYR A 1 108 ? -9.308  -34.508 -37.399 1.00 25.90 ? 108 TYR A H     1 
ATOM   1715  H  HA    . TYR A 1 108 ? -11.195 -36.424 -37.861 1.00 29.99 ? 108 TYR A HA    1 
ATOM   1716  H  HB2   . TYR A 1 108 ? -8.717  -35.985 -39.195 1.00 28.86 ? 108 TYR A HB2   1 
ATOM   1717  H  HB3   . TYR A 1 108 ? -9.715  -37.167 -39.555 1.00 28.86 ? 108 TYR A HB3   1 
ATOM   1718  H  HD1   . TYR A 1 108 ? -9.204  -33.726 -39.947 1.00 30.11 ? 108 TYR A HD1   1 
ATOM   1719  H  HD2   . TYR A 1 108 ? -11.737 -36.693 -40.833 1.00 33.33 ? 108 TYR A HD2   1 
ATOM   1720  H  HE1   . TYR A 1 108 ? -10.273 -32.354 -41.434 1.00 31.33 ? 108 TYR A HE1   1 
ATOM   1721  H  HE2   . TYR A 1 108 ? -12.804 -35.322 -42.320 1.00 29.92 ? 108 TYR A HE2   1 
ATOM   1722  H  HH    . TYR A 1 108 ? -13.073 -32.812 -42.693 1.00 37.45 ? 108 TYR A HH    1 
ATOM   1723  N  N     . LEU A 1 109 ? -10.199 -38.206 -36.516 1.00 22.85 ? 109 LEU A N     1 
ATOM   1724  C  CA    . LEU A 1 109 ? -9.565  -39.268 -35.766 1.00 28.65 ? 109 LEU A CA    1 
ATOM   1725  C  C     . LEU A 1 109 ? -9.473  -40.548 -36.575 1.00 30.87 ? 109 LEU A C     1 
ATOM   1726  O  O     . LEU A 1 109 ? -10.473 -40.989 -37.127 1.00 26.04 ? 109 LEU A O     1 
ATOM   1727  C  CB    . LEU A 1 109 ? -10.348 -39.586 -34.501 1.00 24.47 ? 109 LEU A CB    1 
ATOM   1728  C  CG    . LEU A 1 109 ? -10.328 -38.562 -33.356 1.00 27.77 ? 109 LEU A CG    1 
ATOM   1729  C  CD1   . LEU A 1 109 ? -10.973 -37.254 -33.739 1.00 30.42 ? 109 LEU A CD1   1 
ATOM   1730  C  CD2   . LEU A 1 109 ? -11.027 -39.162 -32.173 1.00 29.26 ? 109 LEU A CD2   1 
ATOM   1731  H  H     . LEU A 1 109 ? -11.037 -38.331 -36.663 1.00 27.36 ? 109 LEU A H     1 
ATOM   1732  H  HA    . LEU A 1 109 ? -8.659  -38.994 -35.511 1.00 34.32 ? 109 LEU A HA    1 
ATOM   1733  H  HB2   . LEU A 1 109 ? -11.277 -39.711 -34.750 1.00 29.30 ? 109 LEU A HB2   1 
ATOM   1734  H  HB3   . LEU A 1 109 ? -10.004 -40.418 -34.140 1.00 29.30 ? 109 LEU A HB3   1 
ATOM   1735  H  HG    . LEU A 1 109 ? -9.409  -38.383 -33.105 1.00 33.27 ? 109 LEU A HG    1 
ATOM   1736  H  HD11  . LEU A 1 109 ? -10.933 -36.655 -32.990 1.00 36.44 ? 109 LEU A HD11  1 
ATOM   1737  H  HD12  . LEU A 1 109 ? -10.499 -36.878 -34.484 1.00 36.44 ? 109 LEU A HD12  1 
ATOM   1738  H  HD13  . LEU A 1 109 ? -11.888 -37.415 -33.980 1.00 36.44 ? 109 LEU A HD13  1 
ATOM   1739  H  HD21  . LEU A 1 109 ? -11.020 -38.528 -31.452 1.00 35.05 ? 109 LEU A HD21  1 
ATOM   1740  H  HD22  . LEU A 1 109 ? -11.932 -39.369 -32.418 1.00 35.05 ? 109 LEU A HD22  1 
ATOM   1741  H  HD23  . LEU A 1 109 ? -10.567 -39.962 -31.911 1.00 35.05 ? 109 LEU A HD23  1 
ATOM   1742  N  N     . ASP A 1 110 ? -8.286  -41.158 -36.620 1.00 32.61 ? 110 ASP A N     1 
ATOM   1743  C  CA    . ASP A 1 110 ? -8.176  -42.521 -37.146 1.00 28.79 ? 110 ASP A CA    1 
ATOM   1744  C  C     . ASP A 1 110 ? -8.276  -43.490 -35.971 1.00 32.35 ? 110 ASP A C     1 
ATOM   1745  O  O     . ASP A 1 110 ? -7.389  -43.539 -35.116 1.00 34.13 ? 110 ASP A O     1 
ATOM   1746  C  CB    . ASP A 1 110 ? -6.870  -42.704 -37.920 1.00 38.30 ? 110 ASP A CB    1 
ATOM   1747  C  CG    . ASP A 1 110 ? -6.726  -44.096 -38.525 1.00 43.36 ? 110 ASP A CG    1 
ATOM   1748  O  OD1   . ASP A 1 110 ? -7.508  -45.006 -38.158 1.00 36.64 ? 110 ASP A OD1   1 
ATOM   1749  O  OD2   . ASP A 1 110 ? -5.813  -44.268 -39.357 1.00 43.28 ? 110 ASP A OD2   1 
ATOM   1750  H  H     . ASP A 1 110 ? -7.543  -40.812 -36.358 1.00 39.07 ? 110 ASP A H     1 
ATOM   1751  H  HA    . ASP A 1 110 ? -8.924  -42.696 -37.756 1.00 34.49 ? 110 ASP A HA    1 
ATOM   1752  H  HB2   . ASP A 1 110 ? -6.839  -42.058 -38.643 1.00 45.90 ? 110 ASP A HB2   1 
ATOM   1753  H  HB3   . ASP A 1 110 ? -6.124  -42.561 -37.317 1.00 45.90 ? 110 ASP A HB3   1 
ATOM   1754  N  N     . VAL A 1 111 ? -9.376  -44.241 -35.921 1.00 32.53 ? 111 VAL A N     1 
ATOM   1755  C  CA    . VAL A 1 111 ? -9.657  -45.136 -34.796 1.00 37.21 ? 111 VAL A CA    1 
ATOM   1756  C  C     . VAL A 1 111 ? -9.697  -46.610 -35.233 1.00 33.51 ? 111 VAL A C     1 
ATOM   1757  O  O     . VAL A 1 111 ? -10.193 -47.485 -34.517 1.00 39.72 ? 111 VAL A O     1 
ATOM   1758  C  CB    . VAL A 1 111 ? -10.985 -44.748 -34.109 1.00 30.42 ? 111 VAL A CB    1 
ATOM   1759  C  CG1   . VAL A 1 111 ? -10.960 -43.275 -33.729 1.00 32.01 ? 111 VAL A CG1   1 
ATOM   1760  C  CG2   . VAL A 1 111 ? -12.178 -45.015 -35.023 1.00 29.47 ? 111 VAL A CG2   1 
ATOM   1761  H  H     . VAL A 1 111 ? -9.981  -44.251 -36.531 1.00 38.97 ? 111 VAL A H     1 
ATOM   1762  H  HA    . VAL A 1 111 ? -8.941  -45.041 -34.134 1.00 44.59 ? 111 VAL A HA    1 
ATOM   1763  H  HB    . VAL A 1 111 ? -11.096 -45.277 -33.292 1.00 36.44 ? 111 VAL A HB    1 
ATOM   1764  H  HG11  . VAL A 1 111 ? -11.790 -43.049 -33.304 1.00 38.35 ? 111 VAL A HG11  1 
ATOM   1765  H  HG12  . VAL A 1 111 ? -10.229 -43.121 -33.126 1.00 38.35 ? 111 VAL A HG12  1 
ATOM   1766  H  HG13  . VAL A 1 111 ? -10.844 -42.750 -34.525 1.00 38.35 ? 111 VAL A HG13  1 
ATOM   1767  H  HG21  . VAL A 1 111 ? -12.984 -44.764 -34.566 1.00 35.31 ? 111 VAL A HG21  1 
ATOM   1768  H  HG22  . VAL A 1 111 ? -12.080 -44.495 -35.824 1.00 35.31 ? 111 VAL A HG22  1 
ATOM   1769  H  HG23  . VAL A 1 111 ? -12.202 -45.950 -35.240 1.00 35.31 ? 111 VAL A HG23  1 
ATOM   1770  N  N     . THR A 1 112 ? -9.160  -46.857 -36.416 1.00 42.65 ? 112 THR A N     1 
ATOM   1771  C  CA    . THR A 1 112 ? -9.106  -48.183 -37.016 1.00 38.99 ? 112 THR A CA    1 
ATOM   1772  C  C     . THR A 1 112 ? -8.616  -49.235 -36.028 1.00 41.74 ? 112 THR A C     1 
ATOM   1773  O  O     . THR A 1 112 ? -9.312  -50.195 -35.727 1.00 36.52 ? 112 THR A O     1 
ATOM   1774  C  CB    . THR A 1 112 ? -8.148  -48.155 -38.219 1.00 46.59 ? 112 THR A CB    1 
ATOM   1775  O  OG1   . THR A 1 112 ? -8.598  -47.185 -39.179 1.00 41.83 ? 112 THR A OG1   1 
ATOM   1776  C  CG2   . THR A 1 112 ? -8.065  -49.522 -38.875 1.00 56.89 ? 112 THR A CG2   1 
ATOM   1777  H  H     . THR A 1 112 ? -8.806  -46.249 -36.911 1.00 51.12 ? 112 THR A H     1 
ATOM   1778  H  HA    . THR A 1 112 ? -9.998  -48.440 -37.330 1.00 46.72 ? 112 THR A HA    1 
ATOM   1779  H  HB    . THR A 1 112 ? -7.261  -47.912 -37.913 1.00 55.84 ? 112 THR A HB    1 
ATOM   1780  H  HG1   . THR A 1 112 ? -8.089  -47.168 -39.821 1.00 50.13 ? 112 THR A HG1   1 
ATOM   1781  H  HG21  . THR A 1 112 ? -8.933  -49.792 -39.182 1.00 68.20 ? 112 THR A HG21  1 
ATOM   1782  H  HG22  . THR A 1 112 ? -7.464  -49.491 -39.623 1.00 68.20 ? 112 THR A HG22  1 
ATOM   1783  H  HG23  . THR A 1 112 ? -7.742  -50.170 -38.243 1.00 68.20 ? 112 THR A HG23  1 
ATOM   1784  N  N     . ASN A 1 113 ? -7.407  -49.054 -35.525 1.00 45.91 ? 113 ASN A N     1 
ATOM   1785  C  CA    . ASN A 1 113 ? -6.845  -50.011 -34.587 1.00 48.35 ? 113 ASN A CA    1 
ATOM   1786  C  C     . ASN A 1 113 ? -7.511  -49.949 -33.222 1.00 51.09 ? 113 ASN A C     1 
ATOM   1787  O  O     . ASN A 1 113 ? -7.751  -50.982 -32.607 1.00 55.62 ? 113 ASN A O     1 
ATOM   1788  C  CB    . ASN A 1 113 ? -5.331  -49.828 -34.506 1.00 52.81 ? 113 ASN A CB    1 
ATOM   1789  C  CG    . ASN A 1 113 ? -4.663  -50.086 -35.848 1.00 62.50 ? 113 ASN A CG    1 
ATOM   1790  O  OD1   . ASN A 1 113 ? -5.147  -50.905 -36.637 1.00 65.11 ? 113 ASN A OD1   1 
ATOM   1791  N  ND2   . ASN A 1 113 ? -3.574  -49.378 -36.127 1.00 63.56 ? 113 ASN A ND2   1 
ATOM   1792  H  H     . ASN A 1 113 ? -6.894  -48.389 -35.707 1.00 55.03 ? 113 ASN A H     1 
ATOM   1793  H  HA    . ASN A 1 113 ? -7.005  -50.911 -34.941 1.00 57.95 ? 113 ASN A HA    1 
ATOM   1794  H  HB2   . ASN A 1 113 ? -5.134  -48.917 -34.239 1.00 63.31 ? 113 ASN A HB2   1 
ATOM   1795  H  HB3   . ASN A 1 113 ? -4.967  -50.453 -33.860 1.00 63.31 ? 113 ASN A HB3   1 
ATOM   1796  H  HD21  . ASN A 1 113 ? -3.277  -48.804 -35.560 1.00 76.21 ? 113 ASN A HD21  1 
ATOM   1797  H  HD22  . ASN A 1 113 ? -3.166  -49.494 -36.875 1.00 76.21 ? 113 ASN A HD22  1 
ATOM   1798  N  N     . LYS A 1 114 ? -7.850  -48.744 -32.774 1.00 49.39 ? 114 LYS A N     1 
ATOM   1799  C  CA    . LYS A 1 114 ? -8.549  -48.567 -31.503 1.00 52.83 ? 114 LYS A CA    1 
ATOM   1800  C  C     . LYS A 1 114 ? -9.786  -49.456 -31.441 1.00 49.74 ? 114 LYS A C     1 
ATOM   1801  O  O     . LYS A 1 114 ? -10.150 -49.920 -30.364 1.00 57.74 ? 114 LYS A O     1 
ATOM   1802  C  CB    . LYS A 1 114 ? -8.957  -47.099 -31.289 1.00 45.13 ? 114 LYS A CB    1 
ATOM   1803  C  CG    . LYS A 1 114 ? -8.950  -46.620 -29.823 1.00 60.54 ? 114 LYS A CG    1 
ATOM   1804  C  CD    . LYS A 1 114 ? -7.523  -46.295 -29.348 1.00 62.09 ? 114 LYS A CD    1 
ATOM   1805  C  CE    . LYS A 1 114 ? -7.478  -45.391 -28.104 1.00 66.96 ? 114 LYS A CE    1 
ATOM   1806  N  NZ    . LYS A 1 114 ? -7.691  -46.100 -26.797 1.00 66.42 ? 114 LYS A NZ    1 
ATOM   1807  H  H     . LYS A 1 114 ? -7.686  -48.009 -33.189 1.00 59.20 ? 114 LYS A H     1 
ATOM   1808  H  HA    . LYS A 1 114 ? -7.951  -48.826 -30.771 1.00 63.34 ? 114 LYS A HA    1 
ATOM   1809  H  HB2   . LYS A 1 114 ? -8.343  -46.534 -31.783 1.00 54.09 ? 114 LYS A HB2   1 
ATOM   1810  H  HB3   . LYS A 1 114 ? -9.856  -46.978 -31.631 1.00 54.09 ? 114 LYS A HB3   1 
ATOM   1811  H  HG2   . LYS A 1 114 ? -9.488  -45.816 -29.746 1.00 72.59 ? 114 LYS A HG2   1 
ATOM   1812  H  HG3   . LYS A 1 114 ? -9.308  -47.320 -29.255 1.00 72.59 ? 114 LYS A HG3   1 
ATOM   1813  H  HD2   . LYS A 1 114 ? -7.070  -47.124 -29.129 1.00 74.45 ? 114 LYS A HD2   1 
ATOM   1814  H  HD3   . LYS A 1 114 ? -7.051  -45.840 -30.063 1.00 74.45 ? 114 LYS A HD3   1 
ATOM   1815  H  HE2   . LYS A 1 114 ? -6.609  -44.962 -28.066 1.00 80.29 ? 114 LYS A HE2   1 
ATOM   1816  H  HE3   . LYS A 1 114 ? -8.171  -44.716 -28.187 1.00 80.29 ? 114 LYS A HE3   1 
ATOM   1817  H  HZ1   . LYS A 1 114 ? -7.652  -45.518 -26.125 1.00 79.64 ? 114 LYS A HZ1   1 
ATOM   1818  H  HZ2   . LYS A 1 114 ? -8.489  -46.495 -26.791 1.00 79.64 ? 114 LYS A HZ2   1 
ATOM   1819  H  HZ3   . LYS A 1 114 ? -7.062  -46.719 -26.680 1.00 79.64 ? 114 LYS A HZ3   1 
ATOM   1820  N  N     . VAL A 1 115 ? -10.439 -49.689 -32.581 1.00 43.62 ? 115 VAL A N     1 
ATOM   1821  C  CA    . VAL A 1 115 ? -11.676 -50.478 -32.593 1.00 46.77 ? 115 VAL A CA    1 
ATOM   1822  C  C     . VAL A 1 115 ? -11.534 -51.816 -33.331 1.00 52.76 ? 115 VAL A C     1 
ATOM   1823  O  O     . VAL A 1 115 ? -12.534 -52.440 -33.678 1.00 48.19 ? 115 VAL A O     1 
ATOM   1824  C  CB    . VAL A 1 115 ? -12.874 -49.704 -33.211 1.00 50.41 ? 115 VAL A CB    1 
ATOM   1825  C  CG1   . VAL A 1 115 ? -13.185 -48.467 -32.389 1.00 46.46 ? 115 VAL A CG1   1 
ATOM   1826  C  CG2   . VAL A 1 115 ? -12.598 -49.348 -34.674 1.00 42.84 ? 115 VAL A CG2   1 
ATOM   1827  H  H     . VAL A 1 115 ? -10.191 -49.405 -33.354 1.00 52.29 ? 115 VAL A H     1 
ATOM   1828  H  HA    . VAL A 1 115 ? -11.913 -50.684 -31.665 1.00 56.06 ? 115 VAL A HA    1 
ATOM   1829  H  HB    . VAL A 1 115 ? -13.665 -50.282 -33.189 1.00 60.43 ? 115 VAL A HB    1 
ATOM   1830  H  HG11  . VAL A 1 115 ? -12.572 -48.418 -31.653 1.00 55.69 ? 115 VAL A HG11  1 
ATOM   1831  H  HG12  . VAL A 1 115 ? -13.090 -47.691 -32.946 1.00 55.69 ? 115 VAL A HG12  1 
ATOM   1832  H  HG13  . VAL A 1 115 ? -14.086 -48.527 -32.063 1.00 55.69 ? 115 VAL A HG13  1 
ATOM   1833  H  HG21  . VAL A 1 115 ? -11.730 -49.678 -34.918 1.00 51.35 ? 115 VAL A HG21  1 
ATOM   1834  H  HG22  . VAL A 1 115 ? -13.270 -49.754 -35.226 1.00 51.35 ? 115 VAL A HG22  1 
ATOM   1835  H  HG23  . VAL A 1 115 ? -12.625 -48.394 -34.773 1.00 51.35 ? 115 VAL A HG23  1 
ATOM   1836  N  N     . GLU A 1 116 ? -10.304 -52.262 -33.560 1.00 52.82 ? 116 GLU A N     1 
ATOM   1837  C  CA    . GLU A 1 116 ? -10.090 -53.565 -34.184 1.00 63.37 ? 116 GLU A CA    1 
ATOM   1838  C  C     . GLU A 1 116 ? -10.805 -53.661 -35.532 1.00 57.48 ? 116 GLU A C     1 
ATOM   1839  O  O     . GLU A 1 116 ? -11.445 -54.672 -35.836 1.00 56.45 ? 116 GLU A O     1 
ATOM   1840  C  CB    . GLU A 1 116 ? -10.596 -54.684 -33.267 1.00 69.17 ? 116 GLU A CB    1 
ATOM   1841  C  CG    . GLU A 1 116 ? -9.721  -54.962 -32.056 1.00 70.13 ? 116 GLU A CG    1 
ATOM   1842  C  CD    . GLU A 1 116 ? -10.104 -56.256 -31.362 1.00 71.90 ? 116 GLU A CD    1 
ATOM   1843  O  OE1   . GLU A 1 116 ? -11.301 -56.438 -31.047 1.00 74.70 ? 116 GLU A OE1   1 
ATOM   1844  O  OE2   . GLU A 1 116 ? -9.209  -57.097 -31.148 1.00 68.55 ? 116 GLU A OE2   1 
ATOM   1845  H  H     . GLU A 1 116 ? -9.583  -51.836 -33.367 1.00 63.32 ? 116 GLU A H     1 
ATOM   1846  H  HA    . GLU A 1 116 ? -9.131  -53.699 -34.333 1.00 75.99 ? 116 GLU A HA    1 
ATOM   1847  H  HB2   . GLU A 1 116 ? -11.477 -54.442 -32.942 1.00 82.95 ? 116 GLU A HB2   1 
ATOM   1848  H  HB3   . GLU A 1 116 ? -10.652 -55.504 -33.782 1.00 82.95 ? 116 GLU A HB3   1 
ATOM   1849  H  HG2   . GLU A 1 116 ? -8.797  -55.034 -32.340 1.00 84.09 ? 116 GLU A HG2   1 
ATOM   1850  H  HG3   . GLU A 1 116 ? -9.819  -54.238 -31.418 1.00 84.09 ? 116 GLU A HG3   1 
ATOM   1851  N  N     . GLY A 1 117 ? -10.702 -52.600 -36.329 1.00 51.39 ? 117 GLY A N     1 
ATOM   1852  C  CA    . GLY A 1 117 ? -11.305 -52.564 -37.650 1.00 45.08 ? 117 GLY A CA    1 
ATOM   1853  C  C     . GLY A 1 117 ? -12.781 -52.894 -37.655 1.00 47.01 ? 117 GLY A C     1 
ATOM   1854  O  O     . GLY A 1 117 ? -13.352 -53.196 -38.700 1.00 49.43 ? 117 GLY A O     1 
ATOM   1855  H  H     . GLY A 1 117 ? -10.281 -51.880 -36.120 1.00 61.60 ? 117 GLY A H     1 
ATOM   1856  H  HA2   . GLY A 1 117 ? -11.191 -51.677 -38.028 1.00 54.04 ? 117 GLY A HA2   1 
ATOM   1857  H  HA3   . GLY A 1 117 ? -10.850 -53.199 -38.225 1.00 54.04 ? 117 GLY A HA3   1 
ATOM   1858  N  N     . ASN A 1 118 ? -13.407 -52.828 -36.486 1.00 39.47 ? 118 ASN A N     1 
ATOM   1859  C  CA    . ASN A 1 118 ? -14.821 -53.117 -36.365 1.00 42.00 ? 118 ASN A CA    1 
ATOM   1860  C  C     . ASN A 1 118 ? -15.633 -51.831 -36.475 1.00 50.12 ? 118 ASN A C     1 
ATOM   1861  O  O     . ASN A 1 118 ? -15.668 -51.005 -35.546 1.00 36.97 ? 118 ASN A O     1 
ATOM   1862  C  CB    . ASN A 1 118 ? -15.111 -53.778 -35.022 1.00 43.76 ? 118 ASN A CB    1 
ATOM   1863  C  CG    . ASN A 1 118 ? -16.565 -54.184 -34.878 1.00 50.45 ? 118 ASN A CG    1 
ATOM   1864  O  OD1   . ASN A 1 118 ? -17.457 -53.341 -34.856 1.00 41.41 ? 118 ASN A OD1   1 
ATOM   1865  N  ND2   . ASN A 1 118 ? -16.812 -55.488 -34.778 1.00 53.97 ? 118 ASN A ND2   1 
ATOM   1866  H  H     . ASN A 1 118 ? -13.027 -52.617 -35.744 1.00 47.31 ? 118 ASN A H     1 
ATOM   1867  H  HA    . ASN A 1 118 ? -15.097 -53.726 -37.082 1.00 50.34 ? 118 ASN A HA    1 
ATOM   1868  H  HB2   . ASN A 1 118 ? -14.566 -54.576 -34.937 1.00 52.46 ? 118 ASN A HB2   1 
ATOM   1869  H  HB3   . ASN A 1 118 ? -14.901 -53.154 -34.310 1.00 52.46 ? 118 ASN A HB3   1 
ATOM   1870  H  HD21  . ASN A 1 118 ? -16.163 -56.051 -34.796 1.00 64.70 ? 118 ASN A HD21  1 
ATOM   1871  H  HD22  . ASN A 1 118 ? -17.621 -55.767 -34.695 1.00 64.70 ? 118 ASN A HD22  1 
ATOM   1872  N  N     . PHE A 1 119 ? -16.312 -51.679 -37.602 1.00 46.55 ? 119 PHE A N     1 
ATOM   1873  C  CA    . PHE A 1 119 ? -16.953 -50.424 -37.925 1.00 41.85 ? 119 PHE A CA    1 
ATOM   1874  C  C     . PHE A 1 119 ? -18.044 -50.040 -36.924 1.00 47.20 ? 119 PHE A C     1 
ATOM   1875  O  O     . PHE A 1 119 ? -18.161 -48.865 -36.548 1.00 40.01 ? 119 PHE A O     1 
ATOM   1876  C  CB    . PHE A 1 119 ? -17.513 -50.450 -39.349 1.00 40.43 ? 119 PHE A CB    1 
ATOM   1877  C  CG    . PHE A 1 119 ? -17.862 -49.097 -39.860 1.00 28.63 ? 119 PHE A CG    1 
ATOM   1878  C  CD1   . PHE A 1 119 ? -16.938 -48.349 -40.572 1.00 43.62 ? 119 PHE A CD1   1 
ATOM   1879  C  CD2   . PHE A 1 119 ? -19.096 -48.543 -39.578 1.00 39.60 ? 119 PHE A CD2   1 
ATOM   1880  C  CE1   . PHE A 1 119 ? -17.261 -47.072 -41.034 1.00 35.57 ? 119 PHE A CE1   1 
ATOM   1881  C  CE2   . PHE A 1 119 ? -19.425 -47.277 -40.026 1.00 35.79 ? 119 PHE A CE2   1 
ATOM   1882  C  CZ    . PHE A 1 119 ? -18.510 -46.536 -40.757 1.00 31.31 ? 119 PHE A CZ    1 
ATOM   1883  H  H     . PHE A 1 119 ? -16.414 -52.291 -38.197 1.00 55.79 ? 119 PHE A H     1 
ATOM   1884  H  HA    . PHE A 1 119 ? -16.274 -49.718 -37.895 1.00 50.16 ? 119 PHE A HA    1 
ATOM   1885  H  HB2   . PHE A 1 119 ? -16.847 -50.831 -39.943 1.00 48.46 ? 119 PHE A HB2   1 
ATOM   1886  H  HB3   . PHE A 1 119 ? -18.318 -50.992 -39.362 1.00 48.46 ? 119 PHE A HB3   1 
ATOM   1887  H  HD1   . PHE A 1 119 ? -16.102 -48.709 -40.761 1.00 52.28 ? 119 PHE A HD1   1 
ATOM   1888  H  HD2   . PHE A 1 119 ? -19.718 -49.034 -39.091 1.00 47.46 ? 119 PHE A HD2   1 
ATOM   1889  H  HE1   . PHE A 1 119 ? -16.639 -46.581 -41.522 1.00 42.62 ? 119 PHE A HE1   1 
ATOM   1890  H  HE2   . PHE A 1 119 ? -20.265 -46.923 -39.839 1.00 42.88 ? 119 PHE A HE2   1 
ATOM   1891  H  HZ    . PHE A 1 119 ? -18.732 -45.685 -41.060 1.00 37.51 ? 119 PHE A HZ    1 
ATOM   1892  N  N     . GLU A 1 120 ? -18.835 -51.020 -36.485 1.00 43.84 ? 120 GLU A N     1 
ATOM   1893  C  CA    . GLU A 1 120 ? -19.890 -50.764 -35.498 1.00 44.96 ? 120 GLU A CA    1 
ATOM   1894  C  C     . GLU A 1 120 ? -19.327 -50.300 -34.139 1.00 41.22 ? 120 GLU A C     1 
ATOM   1895  O  O     . GLU A 1 120 ? -19.895 -49.415 -33.497 1.00 43.08 ? 120 GLU A O     1 
ATOM   1896  C  CB    . GLU A 1 120 ? -20.750 -52.011 -35.300 1.00 53.28 ? 120 GLU A CB    1 
ATOM   1897  C  CG    . GLU A 1 120 ? -21.405 -52.518 -36.581 1.00 58.84 ? 120 GLU A CG    1 
ATOM   1898  C  CD    . GLU A 1 120 ? -22.436 -51.555 -37.136 1.00 63.44 ? 120 GLU A CD    1 
ATOM   1899  O  OE1   . GLU A 1 120 ? -22.443 -51.338 -38.371 1.00 56.16 ? 120 GLU A OE1   1 
ATOM   1900  O  OE2   . GLU A 1 120 ? -23.246 -51.027 -36.341 1.00 54.62 ? 120 GLU A OE2   1 
ATOM   1901  H  H     . GLU A 1 120 ? -18.783 -51.839 -36.740 1.00 52.54 ? 120 GLU A H     1 
ATOM   1902  H  HA    . GLU A 1 120 ? -20.471 -50.052 -35.838 1.00 53.89 ? 120 GLU A HA    1 
ATOM   1903  H  HB2   . GLU A 1 120 ? -20.192 -52.723 -34.951 1.00 63.87 ? 120 GLU A HB2   1 
ATOM   1904  H  HB3   . GLU A 1 120 ? -21.456 -51.807 -34.668 1.00 63.87 ? 120 GLU A HB3   1 
ATOM   1905  H  HG2   . GLU A 1 120 ? -20.720 -52.646 -37.256 1.00 70.55 ? 120 GLU A HG2   1 
ATOM   1906  H  HG3   . GLU A 1 120 ? -21.850 -53.360 -36.396 1.00 70.55 ? 120 GLU A HG3   1 
ATOM   1907  N  N     . ASN A 1 121 ? -18.236 -50.920 -33.697 1.00 37.01 ? 121 ASN A N     1 
ATOM   1908  C  CA    . ASN A 1 121 ? -17.512 -50.445 -32.523 1.00 44.13 ? 121 ASN A CA    1 
ATOM   1909  C  C     . ASN A 1 121 ? -17.037 -49.004 -32.739 1.00 43.90 ? 121 ASN A C     1 
ATOM   1910  O  O     . ASN A 1 121 ? -16.931 -48.232 -31.792 1.00 36.22 ? 121 ASN A O     1 
ATOM   1911  C  CB    . ASN A 1 121 ? -16.309 -51.348 -32.210 1.00 44.69 ? 121 ASN A CB    1 
ATOM   1912  C  CG    . ASN A 1 121 ? -16.715 -52.693 -31.614 1.00 45.61 ? 121 ASN A CG    1 
ATOM   1913  O  OD1   . ASN A 1 121 ? -17.881 -52.917 -31.256 1.00 39.08 ? 121 ASN A OD1   1 
ATOM   1914  N  ND2   . ASN A 1 121 ? -15.742 -53.589 -31.491 1.00 52.66 ? 121 ASN A ND2   1 
ATOM   1915  H  H     . ASN A 1 121 ? -17.895 -51.621 -34.061 1.00 44.35 ? 121 ASN A H     1 
ATOM   1916  H  HA    . ASN A 1 121 ? -18.112 -50.456 -31.748 1.00 52.90 ? 121 ASN A HA    1 
ATOM   1917  H  HB2   . ASN A 1 121 ? -15.822 -51.519 -33.031 1.00 53.56 ? 121 ASN A HB2   1 
ATOM   1918  H  HB3   . ASN A 1 121 ? -15.735 -50.898 -31.571 1.00 53.56 ? 121 ASN A HB3   1 
ATOM   1919  H  HD21  . ASN A 1 121 ? -14.943 -53.393 -31.741 1.00 63.13 ? 121 ASN A HD21  1 
ATOM   1920  H  HD22  . ASN A 1 121 ? -15.911 -54.365 -31.161 1.00 63.13 ? 121 ASN A HD22  1 
ATOM   1921  N  N     . GLY A 1 122 ? -16.740 -48.650 -33.986 1.00 40.46 ? 122 GLY A N     1 
ATOM   1922  C  CA    . GLY A 1 122 ? -16.417 -47.273 -34.325 1.00 37.22 ? 122 GLY A CA    1 
ATOM   1923  C  C     . GLY A 1 122 ? -17.572 -46.321 -34.035 1.00 32.58 ? 122 GLY A C     1 
ATOM   1924  O  O     . GLY A 1 122 ? -17.385 -45.218 -33.504 1.00 36.43 ? 122 GLY A O     1 
ATOM   1925  H  H     . GLY A 1 122 ? -16.720 -49.191 -34.654 1.00 48.50 ? 122 GLY A H     1 
ATOM   1926  H  HA2   . GLY A 1 122 ? -15.646 -46.986 -33.812 1.00 44.61 ? 122 GLY A HA2   1 
ATOM   1927  H  HA3   . GLY A 1 122 ? -16.199 -47.214 -35.268 1.00 44.61 ? 122 GLY A HA3   1 
ATOM   1928  N  N     . ILE A 1 123 ? -18.774 -46.733 -34.391 1.00 29.41 ? 123 ILE A N     1 
ATOM   1929  C  CA    . ILE A 1 123 ? -19.951 -45.921 -34.111 1.00 31.88 ? 123 ILE A CA    1 
ATOM   1930  C  C     . ILE A 1 123 ? -20.126 -45.753 -32.607 1.00 38.11 ? 123 ILE A C     1 
ATOM   1931  O  O     . ILE A 1 123 ? -20.331 -44.644 -32.122 1.00 34.45 ? 123 ILE A O     1 
ATOM   1932  C  CB    . ILE A 1 123 ? -21.201 -46.541 -34.708 1.00 33.93 ? 123 ILE A CB    1 
ATOM   1933  C  CG1   . ILE A 1 123 ? -21.123 -46.487 -36.238 1.00 37.31 ? 123 ILE A CG1   1 
ATOM   1934  C  CG2   . ILE A 1 123 ? -22.433 -45.809 -34.230 1.00 43.90 ? 123 ILE A CG2   1 
ATOM   1935  C  CD1   . ILE A 1 123 ? -22.030 -47.449 -36.935 1.00 41.65 ? 123 ILE A CD1   1 
ATOM   1936  H  H     . ILE A 1 123 ? -18.939 -47.475 -34.795 1.00 35.23 ? 123 ILE A H     1 
ATOM   1937  H  HA    . ILE A 1 123 ? -19.831 -45.033 -34.507 1.00 38.19 ? 123 ILE A HA    1 
ATOM   1938  H  HB    . ILE A 1 123 ? -21.257 -47.468 -34.428 1.00 40.66 ? 123 ILE A HB    1 
ATOM   1939  H  HG12  . ILE A 1 123 ? -21.361 -45.593 -36.530 1.00 44.72 ? 123 ILE A HG12  1 
ATOM   1940  H  HG13  . ILE A 1 123 ? -20.214 -46.688 -36.510 1.00 44.72 ? 123 ILE A HG13  1 
ATOM   1941  H  HG21  . ILE A 1 123 ? -22.375 -44.890 -34.501 1.00 52.62 ? 123 ILE A HG21  1 
ATOM   1942  H  HG22  . ILE A 1 123 ? -23.209 -46.218 -34.619 1.00 52.62 ? 123 ILE A HG22  1 
ATOM   1943  H  HG23  . ILE A 1 123 ? -22.477 -45.866 -33.272 1.00 52.62 ? 123 ILE A HG23  1 
ATOM   1944  H  HD11  . ILE A 1 123 ? -21.801 -48.342 -36.669 1.00 49.92 ? 123 ILE A HD11  1 
ATOM   1945  H  HD12  . ILE A 1 123 ? -22.938 -47.256 -36.689 1.00 49.92 ? 123 ILE A HD12  1 
ATOM   1946  H  HD13  . ILE A 1 123 ? -21.920 -47.351 -37.884 1.00 49.92 ? 123 ILE A HD13  1 
ATOM   1947  N  N     . GLU A 1 124 ? -20.031 -46.852 -31.865 1.00 35.68 ? 124 GLU A N     1 
ATOM   1948  C  CA    . GLU A 1 124 ? -20.153 -46.790 -30.405 1.00 39.19 ? 124 GLU A CA    1 
ATOM   1949  C  C     . GLU A 1 124 ? -19.117 -45.837 -29.821 1.00 32.81 ? 124 GLU A C     1 
ATOM   1950  O  O     . GLU A 1 124 ? -19.410 -45.102 -28.882 1.00 36.49 ? 124 GLU A O     1 
ATOM   1951  C  CB    . GLU A 1 124 ? -19.982 -48.180 -29.783 1.00 40.54 ? 124 GLU A CB    1 
ATOM   1952  C  CG    . GLU A 1 124 ? -21.009 -49.195 -30.280 1.00 55.04 ? 124 GLU A CG    1 
ATOM   1953  C  CD    . GLU A 1 124 ? -20.891 -50.555 -29.596 1.00 63.46 ? 124 GLU A CD    1 
ATOM   1954  O  OE1   . GLU A 1 124 ? -20.062 -50.690 -28.667 1.00 59.67 ? 124 GLU A OE1   1 
ATOM   1955  O  OE2   . GLU A 1 124 ? -21.630 -51.483 -29.993 1.00 63.12 ? 124 GLU A OE2   1 
ATOM   1956  H  H     . GLU A 1 124 ? -19.898 -47.642 -32.177 1.00 42.75 ? 124 GLU A H     1 
ATOM   1957  H  HA    . GLU A 1 124 ? -21.043 -46.457 -30.170 1.00 46.97 ? 124 GLU A HA    1 
ATOM   1958  H  HB2   . GLU A 1 124 ? -19.099 -48.517 -30.004 1.00 48.59 ? 124 GLU A HB2   1 
ATOM   1959  H  HB3   . GLU A 1 124 ? -20.076 -48.107 -28.820 1.00 48.59 ? 124 GLU A HB3   1 
ATOM   1960  H  HG2   . GLU A 1 124 ? -21.900 -48.851 -30.109 1.00 65.99 ? 124 GLU A HG2   1 
ATOM   1961  H  HG3   . GLU A 1 124 ? -20.884 -49.328 -31.233 1.00 65.99 ? 124 GLU A HG3   1 
ATOM   1962  N  N     . LEU A 1 125 ? -17.900 -45.868 -30.361 1.00 33.16 ? 125 LEU A N     1 
ATOM   1963  C  CA    . LEU A 1 125 ? -16.831 -44.982 -29.891 1.00 29.08 ? 125 LEU A CA    1 
ATOM   1964  C  C     . LEU A 1 125 ? -17.231 -43.524 -30.119 1.00 37.42 ? 125 LEU A C     1 
ATOM   1965  O  O     . LEU A 1 125 ? -17.011 -42.653 -29.264 1.00 31.88 ? 125 LEU A O     1 
ATOM   1966  C  CB    . LEU A 1 125 ? -15.526 -45.275 -30.607 1.00 38.42 ? 125 LEU A CB    1 
ATOM   1967  C  CG    . LEU A 1 125 ? -14.356 -44.403 -30.174 1.00 28.36 ? 125 LEU A CG    1 
ATOM   1968  C  CD1   . LEU A 1 125 ? -14.164 -44.419 -28.634 1.00 27.60 ? 125 LEU A CD1   1 
ATOM   1969  C  CD2   . LEU A 1 125 ? -13.081 -44.847 -30.873 1.00 34.65 ? 125 LEU A CD2   1 
ATOM   1970  H  H     . LEU A 1 125 ? -17.665 -46.393 -31.000 1.00 39.73 ? 125 LEU A H     1 
ATOM   1971  H  HA    . LEU A 1 125 ? -16.693 -45.119 -28.930 1.00 34.83 ? 125 LEU A HA    1 
ATOM   1972  H  HB2   . LEU A 1 125 ? -15.281 -46.199 -30.440 1.00 46.04 ? 125 LEU A HB2   1 
ATOM   1973  H  HB3   . LEU A 1 125 ? -15.657 -45.139 -31.559 1.00 46.04 ? 125 LEU A HB3   1 
ATOM   1974  H  HG    . LEU A 1 125 ? -14.535 -43.488 -30.440 1.00 33.97 ? 125 LEU A HG    1 
ATOM   1975  H  HD11  . LEU A 1 125 ? -13.418 -43.858 -28.407 1.00 33.06 ? 125 LEU A HD11  1 
ATOM   1976  H  HD12  . LEU A 1 125 ? -14.962 -44.088 -28.217 1.00 33.06 ? 125 LEU A HD12  1 
ATOM   1977  H  HD13  . LEU A 1 125 ? -13.994 -45.320 -28.350 1.00 33.06 ? 125 LEU A HD13  1 
ATOM   1978  H  HD21  . LEU A 1 125 ? -13.202 -44.769 -31.822 1.00 41.52 ? 125 LEU A HD21  1 
ATOM   1979  H  HD22  . LEU A 1 125 ? -12.357 -44.286 -30.587 1.00 41.52 ? 125 LEU A HD22  1 
ATOM   1980  H  HD23  . LEU A 1 125 ? -12.900 -45.761 -30.640 1.00 41.52 ? 125 LEU A HD23  1 
ATOM   1981  N  N     . ALA A 1 126 ? -17.827 -43.274 -31.276 1.00 30.28 ? 126 ALA A N     1 
ATOM   1982  C  CA    . ALA A 1 126 ? -18.305 -41.947 -31.617 1.00 33.46 ? 126 ALA A CA    1 
ATOM   1983  C  C     . ALA A 1 126 ? -19.356 -41.467 -30.616 1.00 28.80 ? 126 ALA A C     1 
ATOM   1984  O  O     . ALA A 1 126 ? -19.335 -40.310 -30.198 1.00 25.07 ? 126 ALA A O     1 
ATOM   1985  C  CB    . ALA A 1 126 ? -18.877 -41.943 -33.023 1.00 32.19 ? 126 ALA A CB    1 
ATOM   1986  H  H     . ALA A 1 126 ? -17.967 -43.864 -31.887 1.00 36.28 ? 126 ALA A H     1 
ATOM   1987  H  HA    . ALA A 1 126 ? -17.553 -41.319 -31.592 1.00 40.09 ? 126 ALA A HA    1 
ATOM   1988  H  HB1   . ALA A 1 126 ? -18.189 -42.202 -33.640 1.00 38.56 ? 126 ALA A HB1   1 
ATOM   1989  H  HB2   . ALA A 1 126 ? -19.606 -42.565 -33.064 1.00 38.56 ? 126 ALA A HB2   1 
ATOM   1990  H  HB3   . ALA A 1 126 ? -19.188 -41.059 -33.231 1.00 38.56 ? 126 ALA A HB3   1 
ATOM   1991  N  N     . ARG A 1 127 ? -20.283 -42.344 -30.233 1.00 30.63 ? 127 ARG A N     1 
ATOM   1992  C  CA    . ARG A 1 127 ? -21.288 -41.980 -29.245 1.00 33.27 ? 127 ARG A CA    1 
ATOM   1993  C  C     . ARG A 1 127 ? -20.624 -41.672 -27.907 1.00 29.39 ? 127 ARG A C     1 
ATOM   1994  O  O     . ARG A 1 127 ? -20.997 -40.739 -27.237 1.00 31.00 ? 127 ARG A O     1 
ATOM   1995  C  CB    . ARG A 1 127 ? -22.338 -43.086 -29.064 1.00 35.54 ? 127 ARG A CB    1 
ATOM   1996  C  CG    . ARG A 1 127 ? -23.123 -43.379 -30.322 1.00 43.78 ? 127 ARG A CG    1 
ATOM   1997  C  CD    . ARG A 1 127 ? -24.306 -44.328 -30.092 1.00 59.28 ? 127 ARG A CD    1 
ATOM   1998  N  NE    . ARG A 1 127 ? -24.972 -44.675 -31.357 1.00 64.45 ? 127 ARG A NE    1 
ATOM   1999  C  CZ    . ARG A 1 127 ? -25.905 -43.929 -31.959 1.00 75.73 ? 127 ARG A CZ    1 
ATOM   2000  N  NH1   . ARG A 1 127 ? -26.316 -42.777 -31.422 1.00 71.13 ? 127 ARG A NH1   1 
ATOM   2001  N  NH2   . ARG A 1 127 ? -26.437 -44.333 -33.110 1.00 73.98 ? 127 ARG A NH2   1 
ATOM   2002  H  H     . ARG A 1 127 ? -20.349 -43.148 -30.529 1.00 36.70 ? 127 ARG A H     1 
ATOM   2003  H  HA    . ARG A 1 127 ? -21.751 -41.171 -29.546 1.00 39.87 ? 127 ARG A HA    1 
ATOM   2004  H  HB2   . ARG A 1 127 ? -21.890 -43.903 -28.795 1.00 42.59 ? 127 ARG A HB2   1 
ATOM   2005  H  HB3   . ARG A 1 127 ? -22.967 -42.812 -28.378 1.00 42.59 ? 127 ARG A HB3   1 
ATOM   2006  H  HG2   . ARG A 1 127 ? -23.473 -42.546 -30.675 1.00 52.48 ? 127 ARG A HG2   1 
ATOM   2007  H  HG3   . ARG A 1 127 ? -22.532 -43.791 -30.972 1.00 52.48 ? 127 ARG A HG3   1 
ATOM   2008  H  HD2   . ARG A 1 127 ? -23.986 -45.146 -29.682 1.00 71.08 ? 127 ARG A HD2   1 
ATOM   2009  H  HD3   . ARG A 1 127 ? -24.956 -43.896 -29.515 1.00 71.08 ? 127 ARG A HD3   1 
ATOM   2010  H  HE    . ARG A 1 127 ? -24.744 -45.412 -31.737 1.00 77.27 ? 127 ARG A HE    1 
ATOM   2011  H  HH11  . ARG A 1 127 ? -25.978 -42.504 -30.680 1.00 85.29 ? 127 ARG A HH11  1 
ATOM   2012  H  HH12  . ARG A 1 127 ? -26.918 -42.308 -31.819 1.00 85.29 ? 127 ARG A HH12  1 
ATOM   2013  H  HH21  . ARG A 1 127 ? -26.183 -45.074 -33.464 1.00 88.71 ? 127 ARG A HH21  1 
ATOM   2014  H  HH22  . ARG A 1 127 ? -27.040 -43.857 -33.496 1.00 88.71 ? 127 ARG A HH22  1 
ATOM   2015  N  N     . LYS A 1 128 ? -19.641 -42.458 -27.521 1.00 28.66 ? 128 LYS A N     1 
ATOM   2016  C  CA    . LYS A 1 128 ? -18.964 -42.218 -26.256 1.00 35.48 ? 128 LYS A CA    1 
ATOM   2017  C  C     . LYS A 1 128 ? -18.223 -40.885 -26.313 1.00 36.09 ? 128 LYS A C     1 
ATOM   2018  O  O     . LYS A 1 128 ? -18.114 -40.175 -25.308 1.00 31.04 ? 128 LYS A O     1 
ATOM   2019  C  CB    . LYS A 1 128 ? -17.968 -43.339 -25.925 1.00 35.04 ? 128 LYS A CB    1 
ATOM   2020  C  CG    . LYS A 1 128 ? -18.599 -44.720 -25.718 1.00 53.78 ? 128 LYS A CG    1 
ATOM   2021  C  CD    . LYS A 1 128 ? -19.826 -44.694 -24.795 1.00 60.50 ? 128 LYS A CD    1 
ATOM   2022  C  CE    . LYS A 1 128 ? -19.465 -44.417 -23.344 1.00 52.44 ? 128 LYS A CE    1 
ATOM   2023  N  NZ    . LYS A 1 128 ? -20.691 -44.488 -22.500 1.00 60.73 ? 128 LYS A NZ    1 
ATOM   2024  H  H     . LYS A 1 128 ? -19.345 -43.133 -27.965 1.00 34.33 ? 128 LYS A H     1 
ATOM   2025  H  HA    . LYS A 1 128 ? -19.627 -42.172 -25.536 1.00 42.51 ? 128 LYS A HA    1 
ATOM   2026  H  HB2   . LYS A 1 128 ? -17.332 -43.413 -26.654 1.00 41.99 ? 128 LYS A HB2   1 
ATOM   2027  H  HB3   . LYS A 1 128 ? -17.500 -43.105 -25.108 1.00 41.99 ? 128 LYS A HB3   1 
ATOM   2028  H  HG2   . LYS A 1 128 ? -18.881 -45.069 -26.578 1.00 64.48 ? 128 LYS A HG2   1 
ATOM   2029  H  HG3   . LYS A 1 128 ? -17.940 -45.311 -25.322 1.00 64.48 ? 128 LYS A HG3   1 
ATOM   2030  H  HD2   . LYS A 1 128 ? -20.430 -43.996 -25.093 1.00 72.54 ? 128 LYS A HD2   1 
ATOM   2031  H  HD3   . LYS A 1 128 ? -20.269 -45.556 -24.835 1.00 72.54 ? 128 LYS A HD3   1 
ATOM   2032  H  HE2   . LYS A 1 128 ? -18.835 -45.085 -23.031 1.00 62.87 ? 128 LYS A HE2   1 
ATOM   2033  H  HE3   . LYS A 1 128 ? -19.086 -43.528 -23.266 1.00 62.87 ? 128 LYS A HE3   1 
ATOM   2034  H  HZ1   . LYS A 1 128 ? -20.485 -44.326 -21.649 1.00 72.82 ? 128 LYS A HZ1   1 
ATOM   2035  H  HZ2   . LYS A 1 128 ? -21.284 -43.883 -22.774 1.00 72.82 ? 128 LYS A HZ2   1 
ATOM   2036  H  HZ3   . LYS A 1 128 ? -21.056 -45.298 -22.560 1.00 72.82 ? 128 LYS A HZ3   1 
ATOM   2037  N  N     . ILE A 1 129 ? -17.706 -40.548 -27.488 1.00 28.73 ? 129 ILE A N     1 
ATOM   2038  C  CA    . ILE A 1 129 ? -16.940 -39.325 -27.620 1.00 31.98 ? 129 ILE A CA    1 
ATOM   2039  C  C     . ILE A 1 129 ? -17.841 -38.126 -27.378 1.00 25.39 ? 129 ILE A C     1 
ATOM   2040  O  O     . ILE A 1 129 ? -17.479 -37.239 -26.590 1.00 28.35 ? 129 ILE A O     1 
ATOM   2041  C  CB    . ILE A 1 129 ? -16.212 -39.235 -28.976 1.00 30.95 ? 129 ILE A CB    1 
ATOM   2042  C  CG1   . ILE A 1 129 ? -14.961 -40.101 -28.937 1.00 29.33 ? 129 ILE A CG1   1 
ATOM   2043  C  CG2   . ILE A 1 129 ? -15.771 -37.799 -29.261 1.00 30.79 ? 129 ILE A CG2   1 
ATOM   2044  C  CD1   . ILE A 1 129 ? -14.385 -40.467 -30.305 1.00 28.12 ? 129 ILE A CD1   1 
ATOM   2045  H  H     . ILE A 1 129 ? -17.785 -41.005 -28.213 1.00 34.41 ? 129 ILE A H     1 
ATOM   2046  H  HA    . ILE A 1 129 ? -16.252 -39.317 -26.921 1.00 38.32 ? 129 ILE A HA    1 
ATOM   2047  H  HB    . ILE A 1 129 ? -16.800 -39.542 -29.684 1.00 37.08 ? 129 ILE A HB    1 
ATOM   2048  H  HG12  . ILE A 1 129 ? -14.272 -39.626 -28.447 1.00 35.14 ? 129 ILE A HG12  1 
ATOM   2049  H  HG13  . ILE A 1 129 ? -15.174 -40.929 -28.479 1.00 35.14 ? 129 ILE A HG13  1 
ATOM   2050  H  HG21  . ILE A 1 129 ? -15.323 -37.772 -30.109 1.00 36.89 ? 129 ILE A HG21  1 
ATOM   2051  H  HG22  . ILE A 1 129 ? -16.547 -37.233 -29.282 1.00 36.89 ? 129 ILE A HG22  1 
ATOM   2052  H  HG23  . ILE A 1 129 ? -15.175 -37.512 -28.565 1.00 36.89 ? 129 ILE A HG23  1 
ATOM   2053  H  HD11  . ILE A 1 129 ? -13.604 -41.011 -30.180 1.00 33.68 ? 129 ILE A HD11  1 
ATOM   2054  H  HD12  . ILE A 1 129 ? -15.047 -40.954 -30.802 1.00 33.68 ? 129 ILE A HD12  1 
ATOM   2055  H  HD13  . ILE A 1 129 ? -14.152 -39.661 -30.771 1.00 33.68 ? 129 ILE A HD13  1 
ATOM   2056  N  N     . LYS A 1 130 ? -19.015 -38.122 -28.020 1.00 25.96 ? 130 LYS A N     1 
ATOM   2057  C  CA    . LYS A 1 130 ? -19.996 -37.048 -27.883 1.00 24.44 ? 130 LYS A CA    1 
ATOM   2058  C  C     . LYS A 1 130 ? -20.466 -36.910 -26.457 1.00 29.14 ? 130 LYS A C     1 
ATOM   2059  O  O     . LYS A 1 130 ? -20.680 -35.806 -25.962 1.00 23.77 ? 130 LYS A O     1 
ATOM   2060  C  CB    . LYS A 1 130 ? -21.242 -37.312 -28.749 1.00 29.17 ? 130 LYS A CB    1 
ATOM   2061  C  CG    . LYS A 1 130 ? -21.072 -37.073 -30.251 1.00 31.45 ? 130 LYS A CG    1 
ATOM   2062  C  CD    . LYS A 1 130 ? -22.373 -37.267 -31.018 1.00 31.83 ? 130 LYS A CD    1 
ATOM   2063  C  CE    . LYS A 1 130 ? -23.520 -36.481 -30.431 1.00 34.12 ? 130 LYS A CE    1 
ATOM   2064  N  NZ    . LYS A 1 130 ? -23.957 -35.383 -31.288 1.00 24.29 ? 130 LYS A NZ    1 
ATOM   2065  H  H     . LYS A 1 130 ? -19.269 -38.749 -28.551 1.00 31.09 ? 130 LYS A H     1 
ATOM   2066  H  HA    . LYS A 1 130 ? -19.595 -36.199 -28.163 1.00 29.26 ? 130 LYS A HA    1 
ATOM   2067  H  HB2   . LYS A 1 130 ? -21.505 -38.238 -28.631 1.00 34.95 ? 130 LYS A HB2   1 
ATOM   2068  H  HB3   . LYS A 1 130 ? -21.956 -36.731 -28.442 1.00 34.95 ? 130 LYS A HB3   1 
ATOM   2069  H  HG2   . LYS A 1 130 ? -20.771 -36.162 -30.395 1.00 37.67 ? 130 LYS A HG2   1 
ATOM   2070  H  HG3   . LYS A 1 130 ? -20.420 -37.699 -30.600 1.00 37.67 ? 130 LYS A HG3   1 
ATOM   2071  H  HD2   . LYS A 1 130 ? -22.246 -36.974 -31.934 1.00 38.14 ? 130 LYS A HD2   1 
ATOM   2072  H  HD3   . LYS A 1 130 ? -22.613 -38.207 -31.001 1.00 38.14 ? 130 LYS A HD3   1 
ATOM   2073  H  HE2   . LYS A 1 130 ? -24.274 -37.075 -30.297 1.00 40.89 ? 130 LYS A HE2   1 
ATOM   2074  H  HE3   . LYS A 1 130 ? -23.241 -36.104 -29.581 1.00 40.89 ? 130 LYS A HE3   1 
ATOM   2075  H  HZ1   . LYS A 1 130 ? -24.632 -34.948 -30.904 1.00 29.08 ? 130 LYS A HZ1   1 
ATOM   2076  H  HZ2   . LYS A 1 130 ? -23.285 -34.815 -31.421 1.00 29.08 ? 130 LYS A HZ2   1 
ATOM   2077  H  HZ3   . LYS A 1 130 ? -24.227 -35.701 -32.074 1.00 29.08 ? 130 LYS A HZ3   1 
ATOM   2078  N  N     . GLN A 1 131 ? -20.659 -38.047 -25.805 1.00 29.16 ? 131 GLN A N     1 
ATOM   2079  C  CA    . GLN A 1 131 ? -21.105 -38.070 -24.414 1.00 30.70 ? 131 GLN A CA    1 
ATOM   2080  C  C     . GLN A 1 131 ? -20.061 -37.435 -23.497 1.00 24.99 ? 131 GLN A C     1 
ATOM   2081  O  O     . GLN A 1 131 ? -20.390 -36.620 -22.627 1.00 32.64 ? 131 GLN A O     1 
ATOM   2082  C  CB    . GLN A 1 131 ? -21.398 -39.523 -23.999 1.00 34.94 ? 131 GLN A CB    1 
ATOM   2083  C  CG    . GLN A 1 131 ? -21.939 -39.695 -22.575 1.00 52.96 ? 131 GLN A CG    1 
ATOM   2084  C  CD    . GLN A 1 131 ? -22.039 -41.166 -22.145 1.00 66.94 ? 131 GLN A CD    1 
ATOM   2085  O  OE1   . GLN A 1 131 ? -22.275 -42.061 -22.970 1.00 62.06 ? 131 GLN A OE1   1 
ATOM   2086  N  NE2   . GLN A 1 131 ? -21.861 -41.416 -20.846 1.00 63.03 ? 131 GLN A NE2   1 
ATOM   2087  H  H     . GLN A 1 131 ? -20.539 -38.828 -26.146 1.00 34.94 ? 131 GLN A H     1 
ATOM   2088  H  HA    . GLN A 1 131 ? -21.935 -37.556 -24.334 1.00 36.78 ? 131 GLN A HA    1 
ATOM   2089  H  HB2   . GLN A 1 131 ? -22.057 -39.891 -24.609 1.00 41.87 ? 131 GLN A HB2   1 
ATOM   2090  H  HB3   . GLN A 1 131 ? -20.576 -40.034 -24.063 1.00 41.87 ? 131 GLN A HB3   1 
ATOM   2091  H  HG2   . GLN A 1 131 ? -21.347 -39.242 -21.956 1.00 63.49 ? 131 GLN A HG2   1 
ATOM   2092  H  HG3   . GLN A 1 131 ? -22.828 -39.309 -22.527 1.00 63.49 ? 131 GLN A HG3   1 
ATOM   2093  H  HE21  . GLN A 1 131 ? -21.700 -40.769 -20.302 1.00 75.58 ? 131 GLN A HE21  1 
ATOM   2094  H  HE22  . GLN A 1 131 ? -21.906 -42.223 -20.553 1.00 75.58 ? 131 GLN A HE22  1 
ATOM   2095  N  N     . GLU A 1 132 ? -18.797 -37.788 -23.703 1.00 24.64 ? 132 GLU A N     1 
ATOM   2096  C  CA    . GLU A 1 132 ? -17.727 -37.290 -22.868 1.00 32.76 ? 132 GLU A CA    1 
ATOM   2097  C  C     . GLU A 1 132 ? -17.539 -35.784 -23.022 1.00 32.77 ? 132 GLU A C     1 
ATOM   2098  O  O     . GLU A 1 132 ? -17.361 -35.056 -22.038 1.00 24.37 ? 132 GLU A O     1 
ATOM   2099  C  CB    . GLU A 1 132 ? -16.426 -37.997 -23.209 1.00 32.45 ? 132 GLU A CB    1 
ATOM   2100  C  CG    . GLU A 1 132 ? -15.256 -37.507 -22.386 1.00 41.25 ? 132 GLU A CG    1 
ATOM   2101  C  CD    . GLU A 1 132 ? -13.990 -38.262 -22.695 1.00 41.26 ? 132 GLU A CD    1 
ATOM   2102  O  OE1   . GLU A 1 132 ? -13.058 -38.213 -21.872 1.00 49.96 ? 132 GLU A OE1   1 
ATOM   2103  O  OE2   . GLU A 1 132 ? -13.926 -38.906 -23.764 1.00 44.70 ? 132 GLU A OE2   1 
ATOM   2104  H  H     . GLU A 1 132 ? -18.537 -38.320 -24.326 1.00 29.51 ? 132 GLU A H     1 
ATOM   2105  H  HA    . GLU A 1 132 ? -17.938 -37.476 -21.929 1.00 39.25 ? 132 GLU A HA    1 
ATOM   2106  H  HB2   . GLU A 1 132 ? -16.531 -38.947 -23.045 1.00 38.88 ? 132 GLU A HB2   1 
ATOM   2107  H  HB3   . GLU A 1 132 ? -16.220 -37.843 -24.145 1.00 38.88 ? 132 GLU A HB3   1 
ATOM   2108  H  HG2   . GLU A 1 132 ? -15.102 -36.569 -22.578 1.00 49.43 ? 132 GLU A HG2   1 
ATOM   2109  H  HG3   . GLU A 1 132 ? -15.457 -37.627 -21.445 1.00 49.43 ? 132 GLU A HG3   1 
ATOM   2110  N  N     . ILE A 1 133 ? -17.548 -35.309 -24.262 1.00 22.20 ? 133 ILE A N     1 
ATOM   2111  C  CA    . ILE A 1 133 ? -17.377 -33.880 -24.483 1.00 20.07 ? 133 ILE A CA    1 
ATOM   2112  C  C     . ILE A 1 133 ? -18.528 -33.100 -23.852 1.00 19.85 ? 133 ILE A C     1 
ATOM   2113  O  O     . ILE A 1 133 ? -18.326 -32.024 -23.307 1.00 23.12 ? 133 ILE A O     1 
ATOM   2114  C  CB    . ILE A 1 133 ? -17.287 -33.562 -25.960 1.00 20.77 ? 133 ILE A CB    1 
ATOM   2115  C  CG1   . ILE A 1 133 ? -16.001 -34.189 -26.524 1.00 24.31 ? 133 ILE A CG1   1 
ATOM   2116  C  CG2   . ILE A 1 133 ? -17.302 -32.062 -26.159 1.00 22.83 ? 133 ILE A CG2   1 
ATOM   2117  C  CD1   . ILE A 1 133 ? -15.964 -34.227 -27.992 1.00 22.47 ? 133 ILE A CD1   1 
ATOM   2118  H  H     . ILE A 1 133 ? -17.648 -35.779 -24.975 1.00 26.58 ? 133 ILE A H     1 
ATOM   2119  H  HA    . ILE A 1 133 ? -16.543 -33.588 -24.058 1.00 24.02 ? 133 ILE A HA    1 
ATOM   2120  H  HB    . ILE A 1 133 ? -18.053 -33.949 -26.413 1.00 24.86 ? 133 ILE A HB    1 
ATOM   2121  H  HG12  . ILE A 1 133 ? -15.240 -33.670 -26.220 1.00 29.11 ? 133 ILE A HG12  1 
ATOM   2122  H  HG13  . ILE A 1 133 ? -15.928 -35.101 -26.200 1.00 29.11 ? 133 ILE A HG13  1 
ATOM   2123  H  HG21  . ILE A 1 133 ? -18.119 -31.708 -25.801 1.00 27.33 ? 133 ILE A HG21  1 
ATOM   2124  H  HG22  . ILE A 1 133 ? -16.550 -31.679 -25.700 1.00 27.33 ? 133 ILE A HG22  1 
ATOM   2125  H  HG23  . ILE A 1 133 ? -17.245 -31.872 -27.098 1.00 27.33 ? 133 ILE A HG23  1 
ATOM   2126  H  HD11  . ILE A 1 133 ? -16.706 -34.747 -28.309 1.00 26.90 ? 133 ILE A HD11  1 
ATOM   2127  H  HD12  . ILE A 1 133 ? -16.025 -33.330 -28.329 1.00 26.90 ? 133 ILE A HD12  1 
ATOM   2128  H  HD13  . ILE A 1 133 ? -15.139 -34.628 -28.274 1.00 26.90 ? 133 ILE A HD13  1 
ATOM   2129  N  N     . LEU A 1 134 ? -19.729 -33.640 -23.942 1.00 16.97 ? 134 LEU A N     1 
ATOM   2130  C  CA    . LEU A 1 134 ? -20.888 -33.010 -23.331 1.00 19.96 ? 134 LEU A CA    1 
ATOM   2131  C  C     . LEU A 1 134 ? -20.767 -32.996 -21.803 1.00 24.68 ? 134 LEU A C     1 
ATOM   2132  O  O     . LEU A 1 134 ? -20.976 -31.966 -21.175 1.00 26.23 ? 134 LEU A O     1 
ATOM   2133  C  CB    . LEU A 1 134 ? -22.161 -33.725 -23.742 1.00 23.23 ? 134 LEU A CB    1 
ATOM   2134  C  CG    . LEU A 1 134 ? -23.443 -33.073 -23.229 1.00 32.06 ? 134 LEU A CG    1 
ATOM   2135  C  CD1   . LEU A 1 134 ? -23.567 -31.631 -23.744 1.00 27.20 ? 134 LEU A CD1   1 
ATOM   2136  C  CD2   . LEU A 1 134 ? -24.665 -33.923 -23.595 1.00 34.60 ? 134 LEU A CD2   1 
ATOM   2137  H  H     . LEU A 1 134 ? -19.903 -34.375 -24.354 1.00 20.30 ? 134 LEU A H     1 
ATOM   2138  H  HA    . LEU A 1 134 ? -20.948 -32.082 -23.639 1.00 23.89 ? 134 LEU A HA    1 
ATOM   2139  H  HB2   . LEU A 1 134 ? -22.208 -33.744 -24.711 1.00 27.82 ? 134 LEU A HB2   1 
ATOM   2140  H  HB3   . LEU A 1 134 ? -22.133 -34.632 -23.398 1.00 27.82 ? 134 LEU A HB3   1 
ATOM   2141  H  HG    . LEU A 1 134 ? -23.398 -33.032 -22.261 1.00 38.41 ? 134 LEU A HG    1 
ATOM   2142  H  HD11  . LEU A 1 134 ? -24.380 -31.248 -23.406 1.00 32.58 ? 134 LEU A HD11  1 
ATOM   2143  H  HD12  . LEU A 1 134 ? -22.813 -31.124 -23.436 1.00 32.58 ? 134 LEU A HD12  1 
ATOM   2144  H  HD13  . LEU A 1 134 ? -23.585 -31.643 -24.704 1.00 32.58 ? 134 LEU A HD13  1 
ATOM   2145  H  HD21  . LEU A 1 134 ? -24.572 -34.791 -23.196 1.00 41.46 ? 134 LEU A HD21  1 
ATOM   2146  H  HD22  . LEU A 1 134 ? -25.456 -33.492 -23.261 1.00 41.46 ? 134 LEU A HD22  1 
ATOM   2147  H  HD23  . LEU A 1 134 ? -24.714 -34.004 -24.550 1.00 41.46 ? 134 LEU A HD23  1 
ATOM   2148  N  N     . GLU A 1 135 ? -20.441 -34.141 -21.220 1.00 29.07 ? 135 GLU A N     1 
ATOM   2149  C  CA    . GLU A 1 135 ? -20.258 -34.238 -19.769 1.00 38.59 ? 135 GLU A CA    1 
ATOM   2150  C  C     . GLU A 1 135 ? -19.184 -33.291 -19.266 1.00 33.07 ? 135 GLU A C     1 
ATOM   2151  O  O     . GLU A 1 135 ? -19.415 -32.508 -18.348 1.00 31.76 ? 135 GLU A O     1 
ATOM   2152  C  CB    . GLU A 1 135 ? -19.877 -35.670 -19.371 1.00 39.96 ? 135 GLU A CB    1 
ATOM   2153  C  CG    . GLU A 1 135 ? -21.081 -36.555 -19.097 1.00 59.53 ? 135 GLU A CG    1 
ATOM   2154  C  CD    . GLU A 1 135 ? -20.771 -38.049 -19.217 1.00 72.32 ? 135 GLU A CD    1 
ATOM   2155  O  OE1   . GLU A 1 135 ? -19.575 -38.423 -19.250 1.00 73.01 ? 135 GLU A OE1   1 
ATOM   2156  O  OE2   . GLU A 1 135 ? -21.728 -38.852 -19.285 1.00 66.47 ? 135 GLU A OE2   1 
ATOM   2157  H  H     . GLU A 1 135 ? -20.319 -34.882 -21.639 1.00 34.82 ? 135 GLU A H     1 
ATOM   2158  H  HA    . GLU A 1 135 ? -21.100 -34.010 -19.322 1.00 46.25 ? 135 GLU A HA    1 
ATOM   2159  H  HB2   . GLU A 1 135 ? -19.369 -36.072 -20.093 1.00 47.89 ? 135 GLU A HB2   1 
ATOM   2160  H  HB3   . GLU A 1 135 ? -19.339 -35.640 -18.565 1.00 47.89 ? 135 GLU A HB3   1 
ATOM   2161  H  HG2   . GLU A 1 135 ? -21.396 -36.387 -18.195 1.00 71.37 ? 135 GLU A HG2   1 
ATOM   2162  H  HG3   . GLU A 1 135 ? -21.780 -36.342 -19.736 1.00 71.37 ? 135 GLU A HG3   1 
ATOM   2163  N  N     . LYS A 1 136 ? -18.001 -33.361 -19.869 1.00 23.52 ? 136 LYS A N     1 
ATOM   2164  C  CA    . LYS A 1 136 ? -16.851 -32.626 -19.378 1.00 29.71 ? 136 LYS A CA    1 
ATOM   2165  C  C     . LYS A 1 136 ? -16.830 -31.134 -19.693 1.00 33.10 ? 136 LYS A C     1 
ATOM   2166  O  O     . LYS A 1 136 ? -16.370 -30.337 -18.874 1.00 32.14 ? 136 LYS A O     1 
ATOM   2167  C  CB    . LYS A 1 136 ? -15.568 -33.269 -19.900 1.00 30.35 ? 136 LYS A CB    1 
ATOM   2168  C  CG    . LYS A 1 136 ? -15.375 -34.668 -19.352 1.00 36.48 ? 136 LYS A CG    1 
ATOM   2169  C  CD    . LYS A 1 136 ? -13.935 -35.112 -19.409 1.00 45.52 ? 136 LYS A CD    1 
ATOM   2170  C  CE    . LYS A 1 136 ? -13.759 -36.444 -18.697 1.00 48.30 ? 136 LYS A CE    1 
ATOM   2171  N  NZ    . LYS A 1 136 ? -12.990 -37.385 -19.534 1.00 50.19 ? 136 LYS A NZ    1 
ATOM   2172  H  H     . LYS A 1 136 ? -17.842 -33.833 -20.570 1.00 28.17 ? 136 LYS A H     1 
ATOM   2173  H  HA    . LYS A 1 136 ? -16.836 -32.710 -18.401 1.00 35.59 ? 136 LYS A HA    1 
ATOM   2174  H  HB2   . LYS A 1 136 ? -15.612 -33.326 -20.868 1.00 36.36 ? 136 LYS A HB2   1 
ATOM   2175  H  HB3   . LYS A 1 136 ? -14.809 -32.730 -19.631 1.00 36.36 ? 136 LYS A HB3   1 
ATOM   2176  H  HG2   . LYS A 1 136 ? -15.659 -34.688 -18.425 1.00 43.71 ? 136 LYS A HG2   1 
ATOM   2177  H  HG3   . LYS A 1 136 ? -15.903 -35.290 -19.876 1.00 43.71 ? 136 LYS A HG3   1 
ATOM   2178  H  HD2   . LYS A 1 136 ? -13.667 -35.221 -20.335 1.00 54.56 ? 136 LYS A HD2   1 
ATOM   2179  H  HD3   . LYS A 1 136 ? -13.376 -34.453 -18.969 1.00 54.56 ? 136 LYS A HD3   1 
ATOM   2180  H  HE2   . LYS A 1 136 ? -13.276 -36.305 -17.868 1.00 57.90 ? 136 LYS A HE2   1 
ATOM   2181  H  HE3   . LYS A 1 136 ? -14.630 -36.832 -18.520 1.00 57.90 ? 136 LYS A HE3   1 
ATOM   2182  H  HZ1   . LYS A 1 136 ? -13.417 -37.527 -20.302 1.00 60.17 ? 136 LYS A HZ1   1 
ATOM   2183  H  HZ2   . LYS A 1 136 ? -12.185 -37.048 -19.709 1.00 60.17 ? 136 LYS A HZ2   1 
ATOM   2184  H  HZ3   . LYS A 1 136 ? -12.893 -38.160 -19.109 1.00 60.17 ? 136 LYS A HZ3   1 
ATOM   2185  N  N     . GLU A 1 137 ? -17.295 -30.744 -20.873 1.00 23.31 ? 137 GLU A N     1 
ATOM   2186  C  CA    . GLU A 1 137 ? -17.245 -29.316 -21.250 1.00 26.15 ? 137 GLU A CA    1 
ATOM   2187  C  C     . GLU A 1 137 ? -18.606 -28.667 -21.502 1.00 26.94 ? 137 GLU A C     1 
ATOM   2188  O  O     . GLU A 1 137 ? -18.671 -27.456 -21.719 1.00 21.74 ? 137 GLU A O     1 
ATOM   2189  C  CB    . GLU A 1 137 ? -16.365 -29.103 -22.482 1.00 24.96 ? 137 GLU A CB    1 
ATOM   2190  C  CG    . GLU A 1 137 ? -14.916 -29.520 -22.277 1.00 20.91 ? 137 GLU A CG    1 
ATOM   2191  C  CD    . GLU A 1 137 ? -14.199 -28.624 -21.300 1.00 28.23 ? 137 GLU A CD    1 
ATOM   2192  O  OE1   . GLU A 1 137 ? -14.720 -27.529 -20.992 1.00 26.51 ? 137 GLU A OE1   1 
ATOM   2193  O  OE2   . GLU A 1 137 ? -13.121 -29.026 -20.826 1.00 23.88 ? 137 GLU A OE2   1 
ATOM   2194  H  H     . GLU A 1 137 ? -17.638 -31.264 -21.466 1.00 27.91 ? 137 GLU A H     1 
ATOM   2195  H  HA    . GLU A 1 137 ? -16.828 -28.825 -20.512 1.00 31.32 ? 137 GLU A HA    1 
ATOM   2196  H  HB2   . GLU A 1 137 ? -16.723 -29.625 -23.217 1.00 29.89 ? 137 GLU A HB2   1 
ATOM   2197  H  HB3   . GLU A 1 137 ? -16.373 -28.161 -22.713 1.00 29.89 ? 137 GLU A HB3   1 
ATOM   2198  H  HG2   . GLU A 1 137 ? -14.892 -30.425 -21.930 1.00 25.03 ? 137 GLU A HG2   1 
ATOM   2199  H  HG3   . GLU A 1 137 ? -14.449 -29.475 -23.126 1.00 25.03 ? 137 GLU A HG3   1 
ATOM   2200  N  N     . LYS A 1 138 ? -19.676 -29.457 -21.457 1.00 20.40 ? 138 LYS A N     1 
ATOM   2201  C  CA    . LYS A 1 138 ? -21.010 -28.974 -21.759 1.00 20.49 ? 138 LYS A CA    1 
ATOM   2202  C  C     . LYS A 1 138 ? -21.117 -28.422 -23.186 1.00 23.94 ? 138 LYS A C     1 
ATOM   2203  O  O     . LYS A 1 138 ? -21.897 -27.495 -23.444 1.00 24.88 ? 138 LYS A O     1 
ATOM   2204  C  CB    . LYS A 1 138 ? -21.429 -27.873 -20.791 1.00 32.41 ? 138 LYS A CB    1 
ATOM   2205  C  CG    . LYS A 1 138 ? -21.198 -28.236 -19.329 1.00 44.95 ? 138 LYS A CG    1 
ATOM   2206  C  CD    . LYS A 1 138 ? -21.805 -29.591 -19.004 1.00 45.35 ? 138 LYS A CD    1 
ATOM   2207  C  CE    . LYS A 1 138 ? -21.690 -29.922 -17.508 1.00 56.14 ? 138 LYS A CE    1 
ATOM   2208  N  NZ    . LYS A 1 138 ? -21.562 -31.395 -17.247 1.00 49.14 ? 138 LYS A NZ    1 
ATOM   2209  H  H     . LYS A 1 138 ? -19.649 -30.291 -21.250 1.00 24.42 ? 138 LYS A H     1 
ATOM   2210  H  HA    . LYS A 1 138 ? -21.646 -29.715 -21.671 1.00 24.52 ? 138 LYS A HA    1 
ATOM   2211  H  HB2   . LYS A 1 138 ? -20.915 -27.073 -20.985 1.00 38.83 ? 138 LYS A HB2   1 
ATOM   2212  H  HB3   . LYS A 1 138 ? -22.375 -27.694 -20.909 1.00 38.83 ? 138 LYS A HB3   1 
ATOM   2213  H  HG2   . LYS A 1 138 ? -20.245 -28.278 -19.155 1.00 53.88 ? 138 LYS A HG2   1 
ATOM   2214  H  HG3   . LYS A 1 138 ? -21.617 -27.569 -18.762 1.00 53.88 ? 138 LYS A HG3   1 
ATOM   2215  H  HD2   . LYS A 1 138 ? -22.745 -29.586 -19.242 1.00 54.35 ? 138 LYS A HD2   1 
ATOM   2216  H  HD3   . LYS A 1 138 ? -21.337 -30.279 -19.503 1.00 54.35 ? 138 LYS A HD3   1 
ATOM   2217  H  HE2   . LYS A 1 138 ? -20.904 -29.484 -17.147 1.00 67.30 ? 138 LYS A HE2   1 
ATOM   2218  H  HE3   . LYS A 1 138 ? -22.485 -29.604 -17.052 1.00 67.30 ? 138 LYS A HE3   1 
ATOM   2219  H  HZ1   . LYS A 1 138 ? -20.834 -31.713 -17.649 1.00 58.91 ? 138 LYS A HZ1   1 
ATOM   2220  H  HZ2   . LYS A 1 138 ? -21.499 -31.545 -16.372 1.00 58.91 ? 138 LYS A HZ2   1 
ATOM   2221  H  HZ3   . LYS A 1 138 ? -22.276 -31.823 -17.563 1.00 58.91 ? 138 LYS A HZ3   1 
ATOM   2222  N  N     . ILE A 1 139 ? -20.320 -28.985 -24.084 1.00 19.64 ? 139 ILE A N     1 
ATOM   2223  C  CA    . ILE A 1 139 ? -20.351 -28.643 -25.521 1.00 20.88 ? 139 ILE A CA    1 
ATOM   2224  C  C     . ILE A 1 139 ? -20.947 -29.790 -26.354 1.00 20.25 ? 139 ILE A C     1 
ATOM   2225  O  O     . ILE A 1 139 ? -20.526 -30.941 -26.235 1.00 20.98 ? 139 ILE A O     1 
ATOM   2226  C  CB    . ILE A 1 139 ? -18.933 -28.351 -26.010 1.00 15.28 ? 139 ILE A CB    1 
ATOM   2227  C  CG1   . ILE A 1 139 ? -18.401 -27.080 -25.360 1.00 20.77 ? 139 ILE A CG1   1 
ATOM   2228  C  CG2   . ILE A 1 139 ? -18.846 -28.259 -27.544 1.00 15.16 ? 139 ILE A CG2   1 
ATOM   2229  C  CD1   . ILE A 1 139 ? -19.124 -25.813 -25.781 1.00 21.43 ? 139 ILE A CD1   1 
ATOM   2230  H  H     . ILE A 1 139 ? -19.734 -29.584 -23.890 1.00 23.51 ? 139 ILE A H     1 
ATOM   2231  H  HA    . ILE A 1 139 ? -20.899 -27.842 -25.656 1.00 24.99 ? 139 ILE A HA    1 
ATOM   2232  H  HB    . ILE A 1 139 ? -18.367 -29.086 -25.727 1.00 18.28 ? 139 ILE A HB    1 
ATOM   2233  H  HG12  . ILE A 1 139 ? -18.489 -27.163 -24.397 1.00 24.87 ? 139 ILE A HG12  1 
ATOM   2234  H  HG13  . ILE A 1 139 ? -17.466 -26.978 -25.596 1.00 24.87 ? 139 ILE A HG13  1 
ATOM   2235  H  HG21  . ILE A 1 139 ? -19.420 -27.552 -27.848 1.00 18.13 ? 139 ILE A HG21  1 
ATOM   2236  H  HG22  . ILE A 1 139 ? -17.938 -28.075 -27.795 1.00 18.13 ? 139 ILE A HG22  1 
ATOM   2237  H  HG23  . ILE A 1 139 ? -19.128 -29.095 -27.923 1.00 18.13 ? 139 ILE A HG23  1 
ATOM   2238  H  HD11  . ILE A 1 139 ? -19.037 -25.705 -26.731 1.00 25.65 ? 139 ILE A HD11  1 
ATOM   2239  H  HD12  . ILE A 1 139 ? -20.051 -25.889 -25.544 1.00 25.65 ? 139 ILE A HD12  1 
ATOM   2240  H  HD13  . ILE A 1 139 ? -18.730 -25.064 -25.329 1.00 25.65 ? 139 ILE A HD13  1 
ATOM   2241  N  N     . THR A 1 140 ? -21.942 -29.463 -27.176 1.00 17.27 ? 140 THR A N     1 
ATOM   2242  C  CA    . THR A 1 140 ? -22.506 -30.408 -28.140 1.00 18.47 ? 140 THR A CA    1 
ATOM   2243  C  C     . THR A 1 140 ? -21.691 -30.328 -29.416 1.00 21.86 ? 140 THR A C     1 
ATOM   2244  O  O     . THR A 1 140 ? -21.277 -29.257 -29.802 1.00 17.12 ? 140 THR A O     1 
ATOM   2245  C  CB    . THR A 1 140 ? -23.972 -30.077 -28.469 1.00 24.99 ? 140 THR A CB    1 
ATOM   2246  O  OG1   . THR A 1 140 ? -24.046 -28.767 -29.049 1.00 28.68 ? 140 THR A OG1   1 
ATOM   2247  C  CG2   . THR A 1 140 ? -24.810 -30.080 -27.184 1.00 26.19 ? 140 THR A CG2   1 
ATOM   2248  H  H     . THR A 1 140 ? -22.313 -28.687 -27.195 1.00 20.66 ? 140 THR A H     1 
ATOM   2249  H  HA    . THR A 1 140 ? -22.456 -31.320 -27.785 1.00 22.11 ? 140 THR A HA    1 
ATOM   2250  H  HB    . THR A 1 140 ? -24.332 -30.735 -29.084 1.00 29.93 ? 140 THR A HB    1 
ATOM   2251  H  HG1   . THR A 1 140 ? -24.825 -28.583 -29.227 1.00 34.36 ? 140 THR A HG1   1 
ATOM   2252  H  HG21  . THR A 1 140 ? -24.770 -30.945 -26.769 1.00 31.37 ? 140 THR A HG21  1 
ATOM   2253  H  HG22  . THR A 1 140 ? -24.471 -29.424 -26.570 1.00 31.37 ? 140 THR A HG22  1 
ATOM   2254  H  HG23  . THR A 1 140 ? -25.725 -29.874 -27.388 1.00 31.37 ? 140 THR A HG23  1 
ATOM   2255  N  N     . VAL A 1 141 ? -21.497 -31.469 -30.072 1.00 19.62 ? 141 VAL A N     1 
ATOM   2256  C  CA    . VAL A 1 141 ? -20.730 -31.548 -31.300 1.00 17.20 ? 141 VAL A CA    1 
ATOM   2257  C  C     . VAL A 1 141 ? -21.490 -32.427 -32.279 1.00 22.59 ? 141 VAL A C     1 
ATOM   2258  O  O     . VAL A 1 141 ? -22.404 -33.183 -31.905 1.00 18.55 ? 141 VAL A O     1 
ATOM   2259  C  CB    . VAL A 1 141 ? -19.309 -32.159 -31.033 1.00 20.57 ? 141 VAL A CB    1 
ATOM   2260  C  CG1   . VAL A 1 141 ? -18.580 -31.384 -29.949 1.00 19.77 ? 141 VAL A CG1   1 
ATOM   2261  C  CG2   . VAL A 1 141 ? -19.401 -33.637 -30.614 1.00 19.55 ? 141 VAL A CG2   1 
ATOM   2262  H  H     . VAL A 1 141 ? -21.809 -32.228 -29.814 1.00 23.49 ? 141 VAL A H     1 
ATOM   2263  H  HA    . VAL A 1 141 ? -20.626 -30.654 -31.688 1.00 20.58 ? 141 VAL A HA    1 
ATOM   2264  H  HB    . VAL A 1 141 ? -18.778 -32.108 -31.855 1.00 24.62 ? 141 VAL A HB    1 
ATOM   2265  H  HG11  . VAL A 1 141 ? -19.144 -30.669 -29.643 1.00 23.67 ? 141 VAL A HG11  1 
ATOM   2266  H  HG12  . VAL A 1 141 ? -18.381 -31.978 -29.221 1.00 23.67 ? 141 VAL A HG12  1 
ATOM   2267  H  HG13  . VAL A 1 141 ? -17.767 -31.027 -30.313 1.00 23.67 ? 141 VAL A HG13  1 
ATOM   2268  H  HG21  . VAL A 1 141 ? -20.325 -33.899 -30.597 1.00 23.40 ? 141 VAL A HG21  1 
ATOM   2269  H  HG22  . VAL A 1 141 ? -18.920 -34.172 -31.249 1.00 23.40 ? 141 VAL A HG22  1 
ATOM   2270  H  HG23  . VAL A 1 141 ? -19.016 -33.738 -29.740 1.00 23.40 ? 141 VAL A HG23  1 
ATOM   2271  N  N     . THR A 1 142 ? -21.095 -32.330 -33.535 1.00 19.78 ? 142 THR A N     1 
ATOM   2272  C  CA    . THR A 1 142 ? -21.610 -33.204 -34.563 1.00 19.32 ? 142 THR A CA    1 
ATOM   2273  C  C     . THR A 1 142 ? -20.491 -34.081 -35.033 1.00 21.00 ? 142 THR A C     1 
ATOM   2274  O  O     . THR A 1 142 ? -19.367 -33.626 -35.261 1.00 21.22 ? 142 THR A O     1 
ATOM   2275  C  CB    . THR A 1 142 ? -22.244 -32.371 -35.701 1.00 19.15 ? 142 THR A CB    1 
ATOM   2276  O  OG1   . THR A 1 142 ? -23.422 -31.741 -35.208 1.00 20.31 ? 142 THR A OG1   1 
ATOM   2277  C  CG2   . THR A 1 142 ? -22.631 -33.256 -36.890 1.00 23.42 ? 142 THR A CG2   1 
ATOM   2278  H  H     . THR A 1 142 ? -20.521 -31.756 -33.820 1.00 23.67 ? 142 THR A H     1 
ATOM   2279  H  HA    . THR A 1 142 ? -22.306 -33.776 -34.179 1.00 23.13 ? 142 THR A HA    1 
ATOM   2280  H  HB    . THR A 1 142 ? -21.614 -31.698 -36.004 1.00 22.92 ? 142 THR A HB    1 
ATOM   2281  H  HG1   . THR A 1 142 ? -23.234 -31.248 -34.579 1.00 24.31 ? 142 THR A HG1   1 
ATOM   2282  H  HG21  . THR A 1 142 ? -23.268 -33.919 -36.612 1.00 28.04 ? 142 THR A HG21  1 
ATOM   2283  H  HG22  . THR A 1 142 ? -23.022 -32.720 -37.584 1.00 28.04 ? 142 THR A HG22  1 
ATOM   2284  H  HG23  . THR A 1 142 ? -21.853 -33.698 -37.238 1.00 28.04 ? 142 THR A HG23  1 
ATOM   2285  N  N     . VAL A 1 143 ? -20.783 -35.360 -35.168 1.00 22.98 ? 143 VAL A N     1 
ATOM   2286  C  CA    . VAL A 1 143 ? -19.758 -36.319 -35.514 1.00 17.65 ? 143 VAL A CA    1 
ATOM   2287  C  C     . VAL A 1 143 ? -20.163 -37.027 -36.801 1.00 21.18 ? 143 VAL A C     1 
ATOM   2288  O  O     . VAL A 1 143 ? -21.348 -37.125 -37.098 1.00 22.74 ? 143 VAL A O     1 
ATOM   2289  C  CB    . VAL A 1 143 ? -19.551 -37.319 -34.352 1.00 25.67 ? 143 VAL A CB    1 
ATOM   2290  C  CG1   . VAL A 1 143 ? -18.806 -38.533 -34.783 1.00 29.57 ? 143 VAL A CG1   1 
ATOM   2291  C  CG2   . VAL A 1 143 ? -18.804 -36.623 -33.220 1.00 25.27 ? 143 VAL A CG2   1 
ATOM   2292  H  H     . VAL A 1 143 ? -21.567 -35.698 -35.064 1.00 27.52 ? 143 VAL A H     1 
ATOM   2293  H  HA    . VAL A 1 143 ? -18.913 -35.849 -35.672 1.00 21.12 ? 143 VAL A HA    1 
ATOM   2294  H  HB    . VAL A 1 143 ? -20.425 -37.602 -34.012 1.00 30.74 ? 143 VAL A HB    1 
ATOM   2295  H  HG11  . VAL A 1 143 ? -18.597 -38.456 -35.716 1.00 35.42 ? 143 VAL A HG11  1 
ATOM   2296  H  HG12  . VAL A 1 143 ? -17.998 -38.602 -34.270 1.00 35.42 ? 143 VAL A HG12  1 
ATOM   2297  H  HG13  . VAL A 1 143 ? -19.356 -39.306 -34.633 1.00 35.42 ? 143 VAL A HG13  1 
ATOM   2298  H  HG21  . VAL A 1 143 ? -18.677 -37.246 -32.500 1.00 30.27 ? 143 VAL A HG21  1 
ATOM   2299  H  HG22  . VAL A 1 143 ? -17.954 -36.320 -33.546 1.00 30.27 ? 143 VAL A HG22  1 
ATOM   2300  H  HG23  . VAL A 1 143 ? -19.324 -35.874 -32.917 1.00 30.27 ? 143 VAL A HG23  1 
ATOM   2301  N  N     . GLY A 1 144 ? -19.172 -37.484 -37.558 1.00 21.93 ? 144 GLY A N     1 
ATOM   2302  C  CA    . GLY A 1 144 ? -19.400 -38.291 -38.748 1.00 26.36 ? 144 GLY A CA    1 
ATOM   2303  C  C     . GLY A 1 144 ? -18.459 -39.467 -38.716 1.00 27.07 ? 144 GLY A C     1 
ATOM   2304  O  O     . GLY A 1 144 ? -17.303 -39.290 -38.375 1.00 18.72 ? 144 GLY A O     1 
ATOM   2305  H  H     . GLY A 1 144 ? -18.340 -37.336 -37.398 1.00 26.25 ? 144 GLY A H     1 
ATOM   2306  H  HA2   . GLY A 1 144 ? -20.314 -38.614 -38.764 1.00 31.57 ? 144 GLY A HA2   1 
ATOM   2307  H  HA3   . GLY A 1 144 ? -19.231 -37.767 -39.546 1.00 31.57 ? 144 GLY A HA3   1 
ATOM   2308  N  N     . VAL A 1 145 ? -18.944 -40.671 -39.032 1.00 22.15 ? 145 VAL A N     1 
ATOM   2309  C  CA    . VAL A 1 145 ? -18.105 -41.853 -38.987 1.00 20.29 ? 145 VAL A CA    1 
ATOM   2310  C  C     . VAL A 1 145 ? -18.121 -42.484 -40.376 1.00 22.12 ? 145 VAL A C     1 
ATOM   2311  O  O     . VAL A 1 145 ? -19.194 -42.731 -40.891 1.00 24.06 ? 145 VAL A O     1 
ATOM   2312  C  CB    . VAL A 1 145 ? -18.668 -42.896 -37.989 1.00 28.02 ? 145 VAL A CB    1 
ATOM   2313  C  CG1   . VAL A 1 145 ? -17.707 -44.056 -37.866 1.00 28.92 ? 145 VAL A CG1   1 
ATOM   2314  C  CG2   . VAL A 1 145 ? -18.974 -42.275 -36.617 1.00 32.15 ? 145 VAL A CG2   1 
ATOM   2315  H  H     . VAL A 1 145 ? -19.755 -40.822 -39.275 1.00 26.52 ? 145 VAL A H     1 
ATOM   2316  H  HA    . VAL A 1 145 ? -17.186 -41.618 -38.739 1.00 24.28 ? 145 VAL A HA    1 
ATOM   2317  H  HB    . VAL A 1 145 ? -19.510 -43.247 -38.348 1.00 33.56 ? 145 VAL A HB    1 
ATOM   2318  H  HG11  . VAL A 1 145 ? -18.067 -44.695 -37.246 1.00 34.64 ? 145 VAL A HG11  1 
ATOM   2319  H  HG12  . VAL A 1 145 ? -17.597 -44.463 -38.729 1.00 34.64 ? 145 VAL A HG12  1 
ATOM   2320  H  HG13  . VAL A 1 145 ? -16.863 -43.729 -37.547 1.00 34.64 ? 145 VAL A HG13  1 
ATOM   2321  H  HG21  . VAL A 1 145 ? -18.754 -41.341 -36.641 1.00 38.52 ? 145 VAL A HG21  1 
ATOM   2322  H  HG22  . VAL A 1 145 ? -19.909 -42.386 -36.426 1.00 38.52 ? 145 VAL A HG22  1 
ATOM   2323  H  HG23  . VAL A 1 145 ? -18.448 -42.720 -35.949 1.00 38.52 ? 145 VAL A HG23  1 
ATOM   2324  N  N     . ALA A 1 146 ? -16.958 -42.710 -40.982 1.00 24.67 ? 146 ALA A N     1 
ATOM   2325  C  CA    . ALA A 1 146 ? -16.899 -43.196 -42.367 1.00 23.66 ? 146 ALA A CA    1 
ATOM   2326  C  C     . ALA A 1 146 ? -15.541 -43.816 -42.677 1.00 28.02 ? 146 ALA A C     1 
ATOM   2327  O  O     . ALA A 1 146 ? -14.605 -43.715 -41.883 1.00 28.00 ? 146 ALA A O     1 
ATOM   2328  C  CB    . ALA A 1 146 ? -17.208 -42.044 -43.357 1.00 22.17 ? 146 ALA A CB    1 
ATOM   2329  H  H     . ALA A 1 146 ? -16.188 -42.592 -40.618 1.00 29.54 ? 146 ALA A H     1 
ATOM   2330  H  HA    . ALA A 1 146 ? -17.581 -43.889 -42.489 1.00 28.33 ? 146 ALA A HA    1 
ATOM   2331  H  HB1   . ALA A 1 146 ? -17.164 -42.383 -44.254 1.00 26.54 ? 146 ALA A HB1   1 
ATOM   2332  H  HB2   . ALA A 1 146 ? -18.088 -41.705 -43.176 1.00 26.54 ? 146 ALA A HB2   1 
ATOM   2333  H  HB3   . ALA A 1 146 ? -16.558 -41.347 -43.237 1.00 26.54 ? 146 ALA A HB3   1 
ATOM   2334  N  N     . PRO A 1 147 ? -15.421 -44.462 -43.848 1.00 29.85 ? 147 PRO A N     1 
ATOM   2335  C  CA    . PRO A 1 147 ? -14.164 -45.115 -44.222 1.00 25.71 ? 147 PRO A CA    1 
ATOM   2336  C  C     . PRO A 1 147 ? -13.036 -44.141 -44.569 1.00 30.00 ? 147 PRO A C     1 
ATOM   2337  O  O     . PRO A 1 147 ? -11.884 -44.566 -44.593 1.00 33.30 ? 147 PRO A O     1 
ATOM   2338  C  CB    . PRO A 1 147 ? -14.547 -45.955 -45.459 1.00 25.85 ? 147 PRO A CB    1 
ATOM   2339  C  CG    . PRO A 1 147 ? -16.049 -46.054 -45.432 1.00 26.75 ? 147 PRO A CG    1 
ATOM   2340  C  CD    . PRO A 1 147 ? -16.522 -44.780 -44.785 1.00 26.40 ? 147 PRO A CD    1 
ATOM   2341  H  HA    . PRO A 1 147 ? -13.866 -45.713 -43.506 1.00 30.79 ? 147 PRO A HA    1 
ATOM   2342  H  HB2   . PRO A 1 147 ? -14.248 -45.503 -46.264 1.00 30.96 ? 147 PRO A HB2   1 
ATOM   2343  H  HB3   . PRO A 1 147 ? -14.145 -46.835 -45.392 1.00 30.96 ? 147 PRO A HB3   1 
ATOM   2344  H  HG2   . PRO A 1 147 ? -16.387 -46.123 -46.339 1.00 32.04 ? 147 PRO A HG2   1 
ATOM   2345  H  HG3   . PRO A 1 147 ? -16.316 -46.824 -44.907 1.00 32.04 ? 147 PRO A HG3   1 
ATOM   2346  H  HD2   . PRO A 1 147 ? -16.619 -44.077 -45.447 1.00 31.61 ? 147 PRO A HD2   1 
ATOM   2347  H  HD3   . PRO A 1 147 ? -17.349 -44.931 -44.300 1.00 31.61 ? 147 PRO A HD3   1 
ATOM   2348  N  N     . ASN A 1 148 ? -13.366 -42.878 -44.838 1.00 27.55 ? 148 ASN A N     1 
ATOM   2349  C  CA    . ASN A 1 148 ? -12.346 -41.868 -45.101 1.00 36.08 ? 148 ASN A CA    1 
ATOM   2350  C  C     . ASN A 1 148 ? -12.758 -40.471 -44.622 1.00 31.32 ? 148 ASN A C     1 
ATOM   2351  O  O     . ASN A 1 148 ? -13.937 -40.201 -44.366 1.00 25.40 ? 148 ASN A O     1 
ATOM   2352  C  CB    . ASN A 1 148 ? -11.961 -41.844 -46.599 1.00 35.09 ? 148 ASN A CB    1 
ATOM   2353  C  CG    . ASN A 1 148 ? -13.063 -41.325 -47.483 1.00 38.66 ? 148 ASN A CG    1 
ATOM   2354  O  OD1   . ASN A 1 148 ? -13.604 -40.243 -47.258 1.00 37.92 ? 148 ASN A OD1   1 
ATOM   2355  N  ND2   . ASN A 1 148 ? -13.417 -42.105 -48.505 1.00 40.37 ? 148 ASN A ND2   1 
ATOM   2356  H  H     . ASN A 1 148 ? -14.173 -42.582 -44.874 1.00 32.99 ? 148 ASN A H     1 
ATOM   2357  H  HA    . ASN A 1 148 ? -11.540 -42.115 -44.601 1.00 43.24 ? 148 ASN A HA    1 
ATOM   2358  H  HB2   . ASN A 1 148 ? -11.188 -41.270 -46.716 1.00 42.04 ? 148 ASN A HB2   1 
ATOM   2359  H  HB3   . ASN A 1 148 ? -11.749 -42.747 -46.884 1.00 42.04 ? 148 ASN A HB3   1 
ATOM   2360  H  HD21  . ASN A 1 148 ? -14.042 -41.854 -49.040 1.00 48.38 ? 148 ASN A HD21  1 
ATOM   2361  H  HD22  . ASN A 1 148 ? -13.021 -42.858 -48.629 1.00 48.38 ? 148 ASN A HD22  1 
ATOM   2362  N  N     . LYS A 1 149 ? -11.769 -39.582 -44.553 1.00 31.91 ? 149 LYS A N     1 
ATOM   2363  C  CA    . LYS A 1 149 ? -11.950 -38.229 -44.025 1.00 27.03 ? 149 LYS A CA    1 
ATOM   2364  C  C     . LYS A 1 149 ? -13.052 -37.466 -44.707 1.00 28.31 ? 149 LYS A C     1 
ATOM   2365  O  O     . LYS A 1 149 ? -13.869 -36.819 -44.077 1.00 22.92 ? 149 LYS A O     1 
ATOM   2366  C  CB    . LYS A 1 149 ? -10.638 -37.445 -44.161 1.00 27.94 ? 149 LYS A CB    1 
ATOM   2367  C  CG    . LYS A 1 149 ? -9.646  -37.803 -43.111 1.00 27.37 ? 149 LYS A CG    1 
ATOM   2368  C  CD    . LYS A 1 149 ? -8.220  -37.461 -43.512 1.00 41.12 ? 149 LYS A CD    1 
ATOM   2369  C  CE    . LYS A 1 149 ? -8.119  -36.050 -43.954 1.00 34.08 ? 149 LYS A CE    1 
ATOM   2370  N  NZ    . LYS A 1 149 ? -6.725  -35.556 -44.149 1.00 30.37 ? 149 LYS A NZ    1 
ATOM   2371  H  H     . LYS A 1 149 ? -10.965 -39.742 -44.812 1.00 38.23 ? 149 LYS A H     1 
ATOM   2372  H  HA    . LYS A 1 149 ? -12.169 -38.287 -43.071 1.00 32.38 ? 149 LYS A HA    1 
ATOM   2373  H  HB2   . LYS A 1 149 ? -10.243 -37.637 -45.026 1.00 33.46 ? 149 LYS A HB2   1 
ATOM   2374  H  HB3   . LYS A 1 149 ? -10.827 -36.496 -44.085 1.00 33.46 ? 149 LYS A HB3   1 
ATOM   2375  H  HG2   . LYS A 1 149 ? -9.855  -37.316 -42.299 1.00 32.78 ? 149 LYS A HG2   1 
ATOM   2376  H  HG3   . LYS A 1 149 ? -9.691  -38.758 -42.946 1.00 32.78 ? 149 LYS A HG3   1 
ATOM   2377  H  HD2   . LYS A 1 149 ? -7.633  -37.586 -42.750 1.00 49.28 ? 149 LYS A HD2   1 
ATOM   2378  H  HD3   . LYS A 1 149 ? -7.947  -38.032 -44.247 1.00 49.28 ? 149 LYS A HD3   1 
ATOM   2379  H  HE2   . LYS A 1 149 ? -8.584  -35.956 -44.800 1.00 40.84 ? 149 LYS A HE2   1 
ATOM   2380  H  HE3   . LYS A 1 149 ? -8.539  -35.485 -43.286 1.00 40.84 ? 149 LYS A HE3   1 
ATOM   2381  H  HZ1   . LYS A 1 149 ? -6.272  -35.615 -43.385 1.00 36.38 ? 149 LYS A HZ1   1 
ATOM   2382  H  HZ2   . LYS A 1 149 ? -6.313  -36.045 -44.768 1.00 36.38 ? 149 LYS A HZ2   1 
ATOM   2383  H  HZ3   . LYS A 1 149 ? -6.738  -34.706 -44.413 1.00 36.38 ? 149 LYS A HZ3   1 
ATOM   2384  N  N     . ILE A 1 150 ? -13.061 -37.518 -46.031 1.00 32.73 ? 150 ILE A N     1 
ATOM   2385  C  CA    . ILE A 1 150 ? -13.971 -36.684 -46.774 1.00 22.23 ? 150 ILE A CA    1 
ATOM   2386  C  C     . ILE A 1 150 ? -15.452 -37.096 -46.570 1.00 25.97 ? 150 ILE A C     1 
ATOM   2387  O  O     . ILE A 1 150 ? -16.346 -36.246 -46.404 1.00 23.59 ? 150 ILE A O     1 
ATOM   2388  C  CB    . ILE A 1 150 ? -13.543 -36.659 -48.268 1.00 40.47 ? 150 ILE A CB    1 
ATOM   2389  C  CG1   . ILE A 1 150 ? -14.357 -35.636 -49.027 1.00 31.09 ? 150 ILE A CG1   1 
ATOM   2390  C  CG2   . ILE A 1 150 ? -13.620 -38.069 -48.884 1.00 38.85 ? 150 ILE A CG2   1 
ATOM   2391  C  CD1   . ILE A 1 150 ? -14.028 -34.212 -48.591 1.00 48.05 ? 150 ILE A CD1   1 
ATOM   2392  H  H     . ILE A 1 150 ? -12.556 -38.023 -46.511 1.00 39.22 ? 150 ILE A H     1 
ATOM   2393  H  HA    . ILE A 1 150 ? -13.883 -35.768 -46.438 1.00 26.62 ? 150 ILE A HA    1 
ATOM   2394  H  HB    . ILE A 1 150 ? -12.615 -36.377 -48.302 1.00 48.50 ? 150 ILE A HB    1 
ATOM   2395  H  HG12  . ILE A 1 150 ? -14.165 -35.714 -49.975 1.00 37.25 ? 150 ILE A HG12  1 
ATOM   2396  H  HG13  . ILE A 1 150 ? -15.300 -35.793 -48.862 1.00 37.25 ? 150 ILE A HG13  1 
ATOM   2397  H  HG21  . ILE A 1 150 ? -14.523 -38.387 -48.823 1.00 46.56 ? 150 ILE A HG21  1 
ATOM   2398  H  HG22  . ILE A 1 150 ? -13.350 -38.023 -49.804 1.00 46.56 ? 150 ILE A HG22  1 
ATOM   2399  H  HG23  . ILE A 1 150 ? -13.033 -38.654 -48.399 1.00 46.56 ? 150 ILE A HG23  1 
ATOM   2400  H  HD11  . ILE A 1 150 ? -14.566 -33.598 -49.097 1.00 57.60 ? 150 ILE A HD11  1 
ATOM   2401  H  HD12  . ILE A 1 150 ? -14.219 -34.120 -47.655 1.00 57.60 ? 150 ILE A HD12  1 
ATOM   2402  H  HD13  . ILE A 1 150 ? -13.097 -34.043 -48.754 1.00 57.60 ? 150 ILE A HD13  1 
ATOM   2403  N  N     . LEU A 1 151 ? -15.718 -38.400 -46.551 1.00 27.65 ? 151 LEU A N     1 
ATOM   2404  C  CA    . LEU A 1 151 ? -17.082 -38.851 -46.328 1.00 27.11 ? 151 LEU A CA    1 
ATOM   2405  C  C     . LEU A 1 151 ? -17.477 -38.592 -44.864 1.00 21.09 ? 151 LEU A C     1 
ATOM   2406  O  O     . LEU A 1 151 ? -18.663 -38.343 -44.566 1.00 23.18 ? 151 LEU A O     1 
ATOM   2407  C  CB    . LEU A 1 151 ? -17.222 -40.335 -46.685 1.00 33.67 ? 151 LEU A CB    1 
ATOM   2408  C  CG    . LEU A 1 151 ? -17.159 -40.615 -48.204 1.00 35.54 ? 151 LEU A CG    1 
ATOM   2409  C  CD1   . LEU A 1 151 ? -17.109 -42.093 -48.472 1.00 42.31 ? 151 LEU A CD1   1 
ATOM   2410  C  CD2   . LEU A 1 151 ? -18.348 -39.974 -48.933 1.00 33.53 ? 151 LEU A CD2   1 
ATOM   2411  H  H     . LEU A 1 151 ? -15.141 -39.027 -46.662 1.00 33.12 ? 151 LEU A H     1 
ATOM   2412  H  HA    . LEU A 1 151 ? -17.688 -38.340 -46.904 1.00 32.47 ? 151 LEU A HA    1 
ATOM   2413  H  HB2   . LEU A 1 151 ? -16.502 -40.828 -46.262 1.00 40.34 ? 151 LEU A HB2   1 
ATOM   2414  H  HB3   . LEU A 1 151 ? -18.077 -40.656 -46.359 1.00 40.34 ? 151 LEU A HB3   1 
ATOM   2415  H  HG    . LEU A 1 151 ? -16.347 -40.222 -48.561 1.00 42.59 ? 151 LEU A HG    1 
ATOM   2416  H  HD11  . LEU A 1 151 ? -17.899 -42.502 -48.110 1.00 50.71 ? 151 LEU A HD11  1 
ATOM   2417  H  HD12  . LEU A 1 151 ? -17.070 -42.237 -49.420 1.00 50.71 ? 151 LEU A HD12  1 
ATOM   2418  H  HD13  . LEU A 1 151 ? -16.328 -42.460 -48.052 1.00 50.71 ? 151 LEU A HD13  1 
ATOM   2419  H  HD21  . LEU A 1 151 ? -18.280 -40.166 -49.871 1.00 40.17 ? 151 LEU A HD21  1 
ATOM   2420  H  HD22  . LEU A 1 151 ? -19.163 -40.341 -48.582 1.00 40.17 ? 151 LEU A HD22  1 
ATOM   2421  H  HD23  . LEU A 1 151 ? -18.328 -39.025 -48.789 1.00 40.17 ? 151 LEU A HD23  1 
ATOM   2422  N  N     . ALA A 1 152 ? -16.500 -38.673 -43.961 1.00 26.35 ? 152 ALA A N     1 
ATOM   2423  C  CA    . ALA A 1 152 ? -16.778 -38.409 -42.550 1.00 23.66 ? 152 ALA A CA    1 
ATOM   2424  C  C     . ALA A 1 152 ? -17.279 -36.978 -42.409 1.00 24.38 ? 152 ALA A C     1 
ATOM   2425  O  O     . ALA A 1 152 ? -18.270 -36.733 -41.712 1.00 21.16 ? 152 ALA A O     1 
ATOM   2426  C  CB    . ALA A 1 152 ? -15.533 -38.666 -41.661 1.00 22.45 ? 152 ALA A CB    1 
ATOM   2427  H  H     . ALA A 1 152 ? -15.682 -38.876 -44.136 1.00 31.55 ? 152 ALA A H     1 
ATOM   2428  H  HA    . ALA A 1 152 ? -17.491 -39.010 -42.249 1.00 28.33 ? 152 ALA A HA    1 
ATOM   2429  H  HB1   . ALA A 1 152 ? -14.821 -38.088 -41.946 1.00 26.88 ? 152 ALA A HB1   1 
ATOM   2430  H  HB2   . ALA A 1 152 ? -15.759 -38.481 -40.746 1.00 26.88 ? 152 ALA A HB2   1 
ATOM   2431  H  HB3   . ALA A 1 152 ? -15.266 -39.584 -41.754 1.00 26.88 ? 152 ALA A HB3   1 
ATOM   2432  N  N     . LYS A 1 153 ? -16.598 -36.040 -43.071 1.00 23.60 ? 153 LYS A N     1 
ATOM   2433  C  CA    . LYS A 1 153 ? -17.004 -34.630 -43.032 1.00 22.84 ? 153 LYS A CA    1 
ATOM   2434  C  C     . LYS A 1 153 ? -18.354 -34.410 -43.674 1.00 25.73 ? 153 LYS A C     1 
ATOM   2435  O  O     . LYS A 1 153 ? -19.220 -33.773 -43.096 1.00 24.10 ? 153 LYS A O     1 
ATOM   2436  C  CB    . LYS A 1 153 ? -15.954 -33.727 -43.704 1.00 24.93 ? 153 LYS A CB    1 
ATOM   2437  C  CG    . LYS A 1 153 ? -16.303 -32.246 -43.684 1.00 24.40 ? 153 LYS A CG    1 
ATOM   2438  C  CD    . LYS A 1 153 ? -15.151 -31.467 -44.274 1.00 32.88 ? 153 LYS A CD    1 
ATOM   2439  C  CE    . LYS A 1 153 ? -15.286 -29.999 -44.027 1.00 44.69 ? 153 LYS A CE    1 
ATOM   2440  N  NZ    . LYS A 1 153 ? -14.906 -29.709 -42.632 1.00 40.44 ? 153 LYS A NZ    1 
ATOM   2441  H  H     . LYS A 1 153 ? -15.898 -36.192 -43.548 1.00 28.26 ? 153 LYS A H     1 
ATOM   2442  H  HA    . LYS A 1 153 ? -17.075 -34.353 -42.095 1.00 27.35 ? 153 LYS A HA    1 
ATOM   2443  H  HB2   . LYS A 1 153 ? -15.108 -33.837 -43.242 1.00 29.85 ? 153 LYS A HB2   1 
ATOM   2444  H  HB3   . LYS A 1 153 ? -15.859 -33.995 -44.631 1.00 29.85 ? 153 LYS A HB3   1 
ATOM   2445  H  HG2   . LYS A 1 153 ? -17.095 -32.088 -44.221 1.00 29.21 ? 153 LYS A HG2   1 
ATOM   2446  H  HG3   . LYS A 1 153 ? -16.443 -31.954 -42.770 1.00 29.21 ? 153 LYS A HG3   1 
ATOM   2447  H  HD2   . LYS A 1 153 ? -14.323 -31.767 -43.868 1.00 39.40 ? 153 LYS A HD2   1 
ATOM   2448  H  HD3   . LYS A 1 153 ? -15.126 -31.612 -45.232 1.00 39.40 ? 153 LYS A HD3   1 
ATOM   2449  H  HE2   . LYS A 1 153 ? -14.693 -29.511 -44.620 1.00 53.57 ? 153 LYS A HE2   1 
ATOM   2450  H  HE3   . LYS A 1 153 ? -16.207 -29.727 -44.163 1.00 53.57 ? 153 LYS A HE3   1 
ATOM   2451  H  HZ1   . LYS A 1 153 ? -15.438 -30.153 -42.073 1.00 48.46 ? 153 LYS A HZ1   1 
ATOM   2452  H  HZ2   . LYS A 1 153 ? -14.064 -29.957 -42.488 1.00 48.46 ? 153 LYS A HZ2   1 
ATOM   2453  H  HZ3   . LYS A 1 153 ? -14.982 -28.837 -42.471 1.00 48.46 ? 153 LYS A HZ3   1 
ATOM   2454  N  N     . ILE A 1 154 ? -18.545 -34.940 -44.878 1.00 27.93 ? 154 ILE A N     1 
ATOM   2455  C  CA    . ILE A 1 154 ? -19.829 -34.762 -45.567 1.00 27.26 ? 154 ILE A CA    1 
ATOM   2456  C  C     . ILE A 1 154 ? -21.003 -35.266 -44.729 1.00 20.98 ? 154 ILE A C     1 
ATOM   2457  O  O     . ILE A 1 154 ? -21.994 -34.559 -44.551 1.00 27.09 ? 154 ILE A O     1 
ATOM   2458  C  CB    . ILE A 1 154 ? -19.853 -35.476 -46.923 1.00 34.55 ? 154 ILE A CB    1 
ATOM   2459  C  CG1   . ILE A 1 154 ? -18.926 -34.757 -47.909 1.00 35.00 ? 154 ILE A CG1   1 
ATOM   2460  C  CG2   . ILE A 1 154 ? -21.284 -35.513 -47.445 1.00 32.38 ? 154 ILE A CG2   1 
ATOM   2461  C  CD1   . ILE A 1 154 ? -18.488 -35.601 -49.108 1.00 30.55 ? 154 ILE A CD1   1 
ATOM   2462  H  H     . ILE A 1 154 ? -17.963 -35.399 -45.314 1.00 33.46 ? 154 ILE A H     1 
ATOM   2463  H  HA    . ILE A 1 154 ? -19.968 -33.806 -45.730 1.00 32.65 ? 154 ILE A HA    1 
ATOM   2464  H  HB    . ILE A 1 154 ? -19.539 -36.386 -46.805 1.00 41.40 ? 154 ILE A HB    1 
ATOM   2465  H  HG12  . ILE A 1 154 ? -19.386 -33.975 -48.252 1.00 41.94 ? 154 ILE A HG12  1 
ATOM   2466  H  HG13  . ILE A 1 154 ? -18.125 -34.483 -47.435 1.00 41.94 ? 154 ILE A HG13  1 
ATOM   2467  H  HG21  . ILE A 1 154 ? -21.295 -35.960 -48.294 1.00 38.79 ? 154 ILE A HG21  1 
ATOM   2468  H  HG22  . ILE A 1 154 ? -21.832 -35.988 -46.817 1.00 38.79 ? 154 ILE A HG22  1 
ATOM   2469  H  HG23  . ILE A 1 154 ? -21.603 -34.613 -47.544 1.00 38.79 ? 154 ILE A HG23  1 
ATOM   2470  H  HD11  . ILE A 1 154 ? -18.017 -36.375 -48.790 1.00 36.60 ? 154 ILE A HD11  1 
ATOM   2471  H  HD12  . ILE A 1 154 ? -19.267 -35.872 -49.600 1.00 36.60 ? 154 ILE A HD12  1 
ATOM   2472  H  HD13  . ILE A 1 154 ? -17.914 -35.074 -49.668 1.00 36.60 ? 154 ILE A HD13  1 
ATOM   2473  N  N     . ILE A 1 155 ? -20.885 -36.465 -44.163 1.00 29.23 ? 155 ILE A N     1 
ATOM   2474  C  CA    . ILE A 1 155 ? -21.998 -36.996 -43.380 1.00 25.49 ? 155 ILE A CA    1 
ATOM   2475  C  C     . ILE A 1 155 ? -22.206 -36.212 -42.069 1.00 26.56 ? 155 ILE A C     1 
ATOM   2476  O  O     . ILE A 1 155 ? -23.335 -35.982 -41.658 1.00 27.59 ? 155 ILE A O     1 
ATOM   2477  C  CB    . ILE A 1 155 ? -21.892 -38.536 -43.156 1.00 29.15 ? 155 ILE A CB    1 
ATOM   2478  C  CG1   . ILE A 1 155 ? -23.282 -39.095 -42.830 1.00 33.46 ? 155 ILE A CG1   1 
ATOM   2479  C  CG2   . ILE A 1 155 ? -20.881 -38.898 -42.075 1.00 24.17 ? 155 ILE A CG2   1 
ATOM   2480  C  CD1   . ILE A 1 155 ? -24.268 -39.033 -44.019 1.00 35.46 ? 155 ILE A CD1   1 
ATOM   2481  H  H     . ILE A 1 155 ? -20.196 -36.976 -44.213 1.00 35.01 ? 155 ILE A H     1 
ATOM   2482  H  HA    . ILE A 1 155 ? -22.811 -36.857 -43.909 1.00 30.53 ? 155 ILE A HA    1 
ATOM   2483  H  HB    . ILE A 1 155 ? -21.596 -38.939 -43.987 1.00 34.92 ? 155 ILE A HB    1 
ATOM   2484  H  HG12  . ILE A 1 155 ? -23.192 -40.025 -42.567 1.00 40.09 ? 155 ILE A HG12  1 
ATOM   2485  H  HG13  . ILE A 1 155 ? -23.663 -38.582 -42.100 1.00 40.09 ? 155 ILE A HG13  1 
ATOM   2486  H  HG21  . ILE A 1 155 ? -20.016 -38.572 -42.335 1.00 28.94 ? 155 ILE A HG21  1 
ATOM   2487  H  HG22  . ILE A 1 155 ? -21.149 -38.491 -41.247 1.00 28.94 ? 155 ILE A HG22  1 
ATOM   2488  H  HG23  . ILE A 1 155 ? -20.856 -39.853 -41.978 1.00 28.94 ? 155 ILE A HG23  1 
ATOM   2489  H  HD11  . ILE A 1 155 ? -24.377 -38.117 -44.286 1.00 42.49 ? 155 ILE A HD11  1 
ATOM   2490  H  HD12  . ILE A 1 155 ? -23.911 -39.546 -44.748 1.00 42.49 ? 155 ILE A HD12  1 
ATOM   2491  H  HD13  . ILE A 1 155 ? -25.112 -39.397 -43.744 1.00 42.49 ? 155 ILE A HD13  1 
ATOM   2492  N  N     . ALA A 1 156 ? -21.134 -35.745 -41.436 1.00 26.64 ? 156 ALA A N     1 
ATOM   2493  C  CA    . ALA A 1 156 ? -21.296 -34.853 -40.285 1.00 25.22 ? 156 ALA A CA    1 
ATOM   2494  C  C     . ALA A 1 156 ? -22.057 -33.603 -40.725 1.00 22.13 ? 156 ALA A C     1 
ATOM   2495  O  O     . ALA A 1 156 ? -23.010 -33.184 -40.084 1.00 24.43 ? 156 ALA A O     1 
ATOM   2496  C  CB    . ALA A 1 156 ? -19.913 -34.446 -39.707 1.00 21.73 ? 156 ALA A CB    1 
ATOM   2497  H  H     . ALA A 1 156 ? -20.319 -35.922 -41.644 1.00 31.91 ? 156 ALA A H     1 
ATOM   2498  H  HA    . ALA A 1 156 ? -21.810 -35.306 -39.584 1.00 30.20 ? 156 ALA A HA    1 
ATOM   2499  H  HB1   . ALA A 1 156 ? -19.411 -33.992 -40.388 1.00 26.01 ? 156 ALA A HB1   1 
ATOM   2500  H  HB2   . ALA A 1 156 ? -20.047 -33.864 -38.956 1.00 26.01 ? 156 ALA A HB2   1 
ATOM   2501  H  HB3   . ALA A 1 156 ? -19.446 -35.238 -39.429 1.00 26.01 ? 156 ALA A HB3   1 
ATOM   2502  N  N     . ASP A 1 157 ? -21.592 -32.969 -41.796 1.00 21.95 ? 157 ASP A N     1 
ATOM   2503  C  CA    . ASP A 1 157 ? -22.253 -31.746 -42.251 1.00 24.07 ? 157 ASP A CA    1 
ATOM   2504  C  C     . ASP A 1 157 ? -23.760 -32.006 -42.446 1.00 33.34 ? 157 ASP A C     1 
ATOM   2505  O  O     . ASP A 1 157 ? -24.601 -31.168 -42.121 1.00 31.96 ? 157 ASP A O     1 
ATOM   2506  C  CB    . ASP A 1 157 ? -21.609 -31.217 -43.532 1.00 30.64 ? 157 ASP A CB    1 
ATOM   2507  C  CG    . ASP A 1 157 ? -20.257 -30.546 -43.285 1.00 33.82 ? 157 ASP A CG    1 
ATOM   2508  O  OD1   . ASP A 1 157 ? -19.941 -30.257 -42.113 1.00 38.98 ? 157 ASP A OD1   1 
ATOM   2509  O  OD2   . ASP A 1 157 ? -19.508 -30.315 -44.265 1.00 35.43 ? 157 ASP A OD2   1 
ATOM   2510  H  H     . ASP A 1 157 ? -20.916 -33.215 -42.266 1.00 26.28 ? 157 ASP A H     1 
ATOM   2511  H  HA    . ASP A 1 157 ? -22.154 -31.058 -41.561 1.00 28.82 ? 157 ASP A HA    1 
ATOM   2512  H  HB2   . ASP A 1 157 ? -21.469 -31.957 -44.143 1.00 36.71 ? 157 ASP A HB2   1 
ATOM   2513  H  HB3   . ASP A 1 157 ? -22.200 -30.562 -43.935 1.00 36.71 ? 157 ASP A HB3   1 
ATOM   2514  N  N     . LYS A 1 158 ? -24.108 -33.192 -42.920 1.00 30.99 ? 158 LYS A N     1 
ATOM   2515  C  CA    . LYS A 1 158 ? -25.511 -33.489 -43.183 1.00 33.62 ? 158 LYS A CA    1 
ATOM   2516  C  C     . LYS A 1 158 ? -26.316 -33.758 -41.918 1.00 36.88 ? 158 LYS A C     1 
ATOM   2517  O  O     . LYS A 1 158 ? -27.544 -33.842 -41.982 1.00 30.36 ? 158 LYS A O     1 
ATOM   2518  C  CB    . LYS A 1 158 ? -25.634 -34.670 -44.158 1.00 37.55 ? 158 LYS A CB    1 
ATOM   2519  C  CG    . LYS A 1 158 ? -25.263 -34.296 -45.591 1.00 34.75 ? 158 LYS A CG    1 
ATOM   2520  C  CD    . LYS A 1 158 ? -25.349 -35.479 -46.562 1.00 50.72 ? 158 LYS A CD    1 
ATOM   2521  C  CE    . LYS A 1 158 ? -26.786 -35.745 -47.010 1.00 55.98 ? 158 LYS A CE    1 
ATOM   2522  N  NZ    . LYS A 1 158 ? -27.291 -34.663 -47.900 1.00 48.87 ? 158 LYS A NZ    1 
ATOM   2523  H  H     . LYS A 1 158 ? -23.564 -33.834 -43.096 1.00 37.13 ? 158 LYS A H     1 
ATOM   2524  H  HA    . LYS A 1 158 ? -25.911 -32.709 -43.620 1.00 40.29 ? 158 LYS A HA    1 
ATOM   2525  H  HB2   . LYS A 1 158 ? -25.041 -35.381 -43.870 1.00 45.00 ? 158 LYS A HB2   1 
ATOM   2526  H  HB3   . LYS A 1 158 ? -26.552 -34.984 -44.159 1.00 45.00 ? 158 LYS A HB3   1 
ATOM   2527  H  HG2   . LYS A 1 158 ? -25.869 -33.607 -45.905 1.00 41.64 ? 158 LYS A HG2   1 
ATOM   2528  H  HG3   . LYS A 1 158 ? -24.351 -33.965 -45.604 1.00 41.64 ? 158 LYS A HG3   1 
ATOM   2529  H  HD2   . LYS A 1 158 ? -24.818 -35.284 -47.350 1.00 60.80 ? 158 LYS A HD2   1 
ATOM   2530  H  HD3   . LYS A 1 158 ? -25.017 -36.277 -46.122 1.00 60.80 ? 158 LYS A HD3   1 
ATOM   2531  H  HE2   . LYS A 1 158 ? -26.818 -36.581 -47.501 1.00 67.12 ? 158 LYS A HE2   1 
ATOM   2532  H  HE3   . LYS A 1 158 ? -27.361 -35.791 -46.231 1.00 67.12 ? 158 LYS A HE3   1 
ATOM   2533  H  HZ1   . LYS A 1 158 ? -26.780 -34.604 -48.626 1.00 58.59 ? 158 LYS A HZ1   1 
ATOM   2534  H  HZ2   . LYS A 1 158 ? -28.127 -34.839 -48.148 1.00 58.59 ? 158 LYS A HZ2   1 
ATOM   2535  H  HZ3   . LYS A 1 158 ? -27.274 -33.884 -47.470 1.00 58.59 ? 158 LYS A HZ3   1 
ATOM   2536  N  N     . SER A 1 159 ? -25.630 -33.897 -40.776 1.00 25.37 ? 159 SER A N     1 
ATOM   2537  C  CA    . SER A 1 159 ? -26.265 -34.289 -39.535 1.00 24.18 ? 159 SER A CA    1 
ATOM   2538  C  C     . SER A 1 159 ? -26.307 -33.171 -38.487 1.00 26.55 ? 159 SER A C     1 
ATOM   2539  O  O     . SER A 1 159 ? -26.741 -33.424 -37.368 1.00 26.12 ? 159 SER A O     1 
ATOM   2540  C  CB    . SER A 1 159 ? -25.550 -35.504 -38.928 1.00 31.35 ? 159 SER A CB    1 
ATOM   2541  O  OG    . SER A 1 159 ? -25.355 -36.535 -39.886 1.00 29.61 ? 159 SER A OG    1 
ATOM   2542  H  H     . SER A 1 159 ? -24.783 -33.766 -40.704 1.00 30.38 ? 159 SER A H     1 
ATOM   2543  H  HA    . SER A 1 159 ? -27.190 -34.552 -39.726 1.00 28.95 ? 159 SER A HA    1 
ATOM   2544  H  HB2   . SER A 1 159 ? -24.685 -35.222 -38.592 1.00 37.56 ? 159 SER A HB2   1 
ATOM   2545  H  HB3   . SER A 1 159 ? -26.088 -35.852 -38.200 1.00 37.56 ? 159 SER A HB3   1 
ATOM   2546  H  HG    . SER A 1 159 ? -25.661 -36.305 -40.611 1.00 35.47 ? 159 SER A HG    1 
ATOM   2547  N  N     . LYS A 1 160 ? -25.859 -31.957 -38.828 1.00 24.19 ? 160 LYS A N     1 
ATOM   2548  C  CA    . LYS A 1 160 ? -25.832 -30.855 -37.852 1.00 25.38 ? 160 LYS A CA    1 
ATOM   2549  C  C     . LYS A 1 160 ? -27.254 -30.421 -37.530 1.00 28.43 ? 160 LYS A C     1 
ATOM   2550  O  O     . LYS A 1 160 ? -28.116 -30.460 -38.394 1.00 35.31 ? 160 LYS A O     1 
ATOM   2551  C  CB    . LYS A 1 160 ? -25.051 -29.646 -38.382 1.00 31.89 ? 160 LYS A CB    1 
ATOM   2552  C  CG    . LYS A 1 160 ? -23.559 -29.857 -38.573 1.00 30.52 ? 160 LYS A CG    1 
ATOM   2553  C  CD    . LYS A 1 160 ? -22.804 -28.506 -38.809 1.00 41.72 ? 160 LYS A CD    1 
ATOM   2554  C  CE    . LYS A 1 160 ? -21.291 -28.702 -39.078 1.00 41.56 ? 160 LYS A CE    1 
ATOM   2555  N  NZ    . LYS A 1 160 ? -20.523 -27.456 -39.540 1.00 29.85 ? 160 LYS A NZ    1 
ATOM   2556  H  H     . LYS A 1 160 ? -25.569 -31.746 -39.609 1.00 28.97 ? 160 LYS A H     1 
ATOM   2557  H  HA    . LYS A 1 160 ? -25.406 -31.161 -37.024 1.00 30.40 ? 160 LYS A HA    1 
ATOM   2558  H  HB2   . LYS A 1 160 ? -25.421 -29.396 -39.243 1.00 38.20 ? 160 LYS A HB2   1 
ATOM   2559  H  HB3   . LYS A 1 160 ? -25.162 -28.912 -37.757 1.00 38.20 ? 160 LYS A HB3   1 
ATOM   2560  H  HG2   . LYS A 1 160 ? -23.191 -30.274 -37.778 1.00 36.56 ? 160 LYS A HG2   1 
ATOM   2561  H  HG3   . LYS A 1 160 ? -23.414 -30.424 -39.347 1.00 36.56 ? 160 LYS A HG3   1 
ATOM   2562  H  HD2   . LYS A 1 160 ? -23.190 -28.059 -39.579 1.00 50.00 ? 160 LYS A HD2   1 
ATOM   2563  H  HD3   . LYS A 1 160 ? -22.899 -27.950 -38.021 1.00 50.00 ? 160 LYS A HD3   1 
ATOM   2564  H  HE2   . LYS A 1 160 ? -20.874 -29.012 -38.259 1.00 49.81 ? 160 LYS A HE2   1 
ATOM   2565  H  HE3   . LYS A 1 160 ? -21.189 -29.377 -39.767 1.00 49.81 ? 160 LYS A HE3   1 
ATOM   2566  H  HZ1   . LYS A 1 160 ? -20.868 -27.152 -40.303 1.00 35.76 ? 160 LYS A HZ1   1 
ATOM   2567  H  HZ2   . LYS A 1 160 ? -20.580 -26.818 -38.923 1.00 35.76 ? 160 LYS A HZ2   1 
ATOM   2568  H  HZ3   . LYS A 1 160 ? -19.666 -27.658 -39.670 1.00 35.76 ? 160 LYS A HZ3   1 
ATOM   2569  N  N     . PRO A 1 161 ? -27.507 -29.968 -36.297 1.00 30.23 ? 161 PRO A N     1 
ATOM   2570  C  CA    . PRO A 1 161 ? -26.569 -29.884 -35.179 1.00 27.79 ? 161 PRO A CA    1 
ATOM   2571  C  C     . PRO A 1 161 ? -26.671 -31.105 -34.280 1.00 26.82 ? 161 PRO A C     1 
ATOM   2572  O  O     . PRO A 1 161 ? -27.604 -31.910 -34.404 1.00 26.85 ? 161 PRO A O     1 
ATOM   2573  C  CB    . PRO A 1 161 ? -27.055 -28.641 -34.442 1.00 40.77 ? 161 PRO A CB    1 
ATOM   2574  C  CG    . PRO A 1 161 ? -28.523 -28.659 -34.634 1.00 37.53 ? 161 PRO A CG    1 
ATOM   2575  C  CD    . PRO A 1 161 ? -28.796 -29.345 -35.957 1.00 41.55 ? 161 PRO A CD    1 
ATOM   2576  H  HA    . PRO A 1 161 ? -25.649 -29.759 -35.491 1.00 33.29 ? 161 PRO A HA    1 
ATOM   2577  H  HB2   . PRO A 1 161 ? -26.828 -28.706 -33.501 1.00 48.87 ? 161 PRO A HB2   1 
ATOM   2578  H  HB3   . PRO A 1 161 ? -26.663 -27.847 -34.839 1.00 48.87 ? 161 PRO A HB3   1 
ATOM   2579  H  HG2   . PRO A 1 161 ? -28.936 -29.153 -33.908 1.00 44.97 ? 161 PRO A HG2   1 
ATOM   2580  H  HG3   . PRO A 1 161 ? -28.855 -27.748 -34.653 1.00 44.97 ? 161 PRO A HG3   1 
ATOM   2581  H  HD2   . PRO A 1 161 ? -29.481 -30.024 -35.851 1.00 49.79 ? 161 PRO A HD2   1 
ATOM   2582  H  HD3   . PRO A 1 161 ? -29.044 -28.693 -36.631 1.00 49.79 ? 161 PRO A HD3   1 
ATOM   2583  N  N     . ASN A 1 162 ? -25.693 -31.257 -33.398 1.00 21.79 ? 162 ASN A N     1 
ATOM   2584  C  CA    . ASN A 1 162 ? -25.683 -32.339 -32.423 1.00 28.81 ? 162 ASN A CA    1 
ATOM   2585  C  C     . ASN A 1 162 ? -25.927 -33.700 -33.055 1.00 28.37 ? 162 ASN A C     1 
ATOM   2586  O  O     . ASN A 1 162 ? -26.651 -34.535 -32.513 1.00 34.08 ? 162 ASN A O     1 
ATOM   2587  C  CB    . ASN A 1 162 ? -26.729 -32.086 -31.325 1.00 31.48 ? 162 ASN A CB    1 
ATOM   2588  C  CG    . ASN A 1 162 ? -26.456 -32.881 -30.070 1.00 34.82 ? 162 ASN A CG    1 
ATOM   2589  O  OD1   . ASN A 1 162 ? -25.432 -33.568 -29.954 1.00 34.91 ? 162 ASN A OD1   1 
ATOM   2590  N  ND2   . ASN A 1 162 ? -27.358 -32.780 -29.108 1.00 39.01 ? 162 ASN A ND2   1 
ATOM   2591  H  H     . ASN A 1 162 ? -25.011 -30.736 -33.342 1.00 26.08 ? 162 ASN A H     1 
ATOM   2592  H  HA    . ASN A 1 162 ? -24.802 -32.364 -31.994 1.00 34.51 ? 162 ASN A HA    1 
ATOM   2593  H  HB2   . ASN A 1 162 ? -26.722 -31.144 -31.092 1.00 37.71 ? 162 ASN A HB2   1 
ATOM   2594  H  HB3   . ASN A 1 162 ? -27.604 -32.340 -31.657 1.00 37.71 ? 162 ASN A HB3   1 
ATOM   2595  H  HD21  . ASN A 1 162 ? -27.252 -33.211 -28.372 1.00 46.76 ? 162 ASN A HD21  1 
ATOM   2596  H  HD22  . ASN A 1 162 ? -28.051 -32.282 -29.219 1.00 46.76 ? 162 ASN A HD22  1 
ATOM   2597  N  N     . GLY A 1 163 ? -25.307 -33.943 -34.192 1.00 24.53 ? 163 GLY A N     1 
ATOM   2598  C  CA    . GLY A 1 163 ? -25.598 -35.154 -34.940 1.00 27.17 ? 163 GLY A CA    1 
ATOM   2599  C  C     . GLY A 1 163 ? -24.556 -36.242 -34.812 1.00 27.85 ? 163 GLY A C     1 
ATOM   2600  O  O     . GLY A 1 163 ? -23.482 -36.048 -34.261 1.00 22.85 ? 163 GLY A O     1 
ATOM   2601  H  H     . GLY A 1 163 ? -24.719 -33.430 -34.552 1.00 29.37 ? 163 GLY A H     1 
ATOM   2602  H  HA2   . GLY A 1 163 ? -26.446 -35.515 -34.637 1.00 32.54 ? 163 GLY A HA2   1 
ATOM   2603  H  HA3   . GLY A 1 163 ? -25.684 -34.931 -35.880 1.00 32.54 ? 163 GLY A HA3   1 
ATOM   2604  N  N     . LEU A 1 164 ? -24.888 -37.410 -35.341 1.00 22.48 ? 164 LEU A N     1 
ATOM   2605  C  CA    . LEU A 1 164 ? -23.963 -38.504 -35.415 1.00 26.21 ? 164 LEU A CA    1 
ATOM   2606  C  C     . LEU A 1 164 ? -24.273 -39.167 -36.727 1.00 29.54 ? 164 LEU A C     1 
ATOM   2607  O  O     . LEU A 1 164 ? -25.210 -39.959 -36.830 1.00 29.55 ? 164 LEU A O     1 
ATOM   2608  C  CB    . LEU A 1 164 ? -24.141 -39.474 -34.243 1.00 34.84 ? 164 LEU A CB    1 
ATOM   2609  C  CG    . LEU A 1 164 ? -22.875 -40.291 -33.925 1.00 38.63 ? 164 LEU A CG    1 
ATOM   2610  C  CD1   . LEU A 1 164 ? -23.014 -40.993 -32.585 1.00 43.91 ? 164 LEU A CD1   1 
ATOM   2611  C  CD2   . LEU A 1 164 ? -22.583 -41.322 -35.005 1.00 37.30 ? 164 LEU A CD2   1 
ATOM   2612  H  H     . LEU A 1 164 ? -25.662 -37.588 -35.669 1.00 26.92 ? 164 LEU A H     1 
ATOM   2613  H  HA    . LEU A 1 164 ? -23.041 -38.173 -35.426 1.00 31.39 ? 164 LEU A HA    1 
ATOM   2614  H  HB2   . LEU A 1 164 ? -24.376 -38.968 -33.450 1.00 41.75 ? 164 LEU A HB2   1 
ATOM   2615  H  HB3   . LEU A 1 164 ? -24.851 -40.099 -34.458 1.00 41.75 ? 164 LEU A HB3   1 
ATOM   2616  H  HG    . LEU A 1 164 ? -22.116 -39.689 -33.871 1.00 46.30 ? 164 LEU A HG    1 
ATOM   2617  H  HD11  . LEU A 1 164 ? -23.144 -40.334 -31.899 1.00 52.62 ? 164 LEU A HD11  1 
ATOM   2618  H  HD12  . LEU A 1 164 ? -23.769 -41.585 -32.619 1.00 52.62 ? 164 LEU A HD12  1 
ATOM   2619  H  HD13  . LEU A 1 164 ? -22.213 -41.494 -32.411 1.00 52.62 ? 164 LEU A HD13  1 
ATOM   2620  H  HD21  . LEU A 1 164 ? -21.789 -41.806 -34.768 1.00 44.70 ? 164 LEU A HD21  1 
ATOM   2621  H  HD22  . LEU A 1 164 ? -23.327 -41.924 -35.072 1.00 44.70 ? 164 LEU A HD22  1 
ATOM   2622  H  HD23  . LEU A 1 164 ? -22.452 -40.868 -35.842 1.00 44.70 ? 164 LEU A HD23  1 
ATOM   2623  N  N     . GLY A 1 165 ? -23.505 -38.801 -37.748 1.00 25.18 ? 165 GLY A N     1 
ATOM   2624  C  CA    . GLY A 1 165 ? -23.733 -39.291 -39.097 1.00 26.13 ? 165 GLY A CA    1 
ATOM   2625  C  C     . GLY A 1 165 ? -22.879 -40.503 -39.368 1.00 26.80 ? 165 GLY A C     1 
ATOM   2626  O  O     . GLY A 1 165 ? -21.741 -40.603 -38.892 1.00 23.91 ? 165 GLY A O     1 
ATOM   2627  H  H     . GLY A 1 165 ? -22.838 -38.262 -37.682 1.00 30.15 ? 165 GLY A H     1 
ATOM   2628  H  HA2   . GLY A 1 165 ? -24.666 -39.533 -39.207 1.00 31.29 ? 165 GLY A HA2   1 
ATOM   2629  H  HA3   . GLY A 1 165 ? -23.510 -38.600 -39.741 1.00 31.29 ? 165 GLY A HA3   1 
ATOM   2630  N  N     . VAL A 1 166 ? -23.410 -41.427 -40.171 1.00 28.45 ? 166 VAL A N     1 
ATOM   2631  C  CA    . VAL A 1 166 ? -22.688 -42.655 -40.462 1.00 26.81 ? 166 VAL A CA    1 
ATOM   2632  C  C     . VAL A 1 166 ? -22.798 -43.073 -41.926 1.00 23.99 ? 166 VAL A C     1 
ATOM   2633  O  O     . VAL A 1 166 ? -23.879 -43.044 -42.500 1.00 22.32 ? 166 VAL A O     1 
ATOM   2634  C  CB    . VAL A 1 166 ? -23.223 -43.801 -39.595 1.00 29.42 ? 166 VAL A CB    1 
ATOM   2635  C  CG1   . VAL A 1 166 ? -22.546 -45.112 -39.978 1.00 28.82 ? 166 VAL A CG1   1 
ATOM   2636  C  CG2   . VAL A 1 166 ? -23.017 -43.460 -38.079 1.00 32.19 ? 166 VAL A CG2   1 
ATOM   2637  H  H     . VAL A 1 166 ? -24.178 -41.363 -40.554 1.00 34.07 ? 166 VAL A H     1 
ATOM   2638  H  HA    . VAL A 1 166 ? -21.740 -42.528 -40.251 1.00 32.11 ? 166 VAL A HA    1 
ATOM   2639  H  HB    . VAL A 1 166 ? -24.185 -43.899 -39.755 1.00 35.25 ? 166 VAL A HB    1 
ATOM   2640  H  HG11  . VAL A 1 166 ? -22.893 -45.816 -39.426 1.00 34.52 ? 166 VAL A HG11  1 
ATOM   2641  H  HG12  . VAL A 1 166 ? -22.729 -45.300 -40.902 1.00 34.52 ? 166 VAL A HG12  1 
ATOM   2642  H  HG13  . VAL A 1 166 ? -21.599 -45.026 -39.843 1.00 34.52 ? 166 VAL A HG13  1 
ATOM   2643  H  HG21  . VAL A 1 166 ? -23.355 -44.184 -37.547 1.00 38.56 ? 166 VAL A HG21  1 
ATOM   2644  H  HG22  . VAL A 1 166 ? -22.079 -43.340 -37.911 1.00 38.56 ? 166 VAL A HG22  1 
ATOM   2645  H  HG23  . VAL A 1 166 ? -23.492 -42.652 -37.873 1.00 38.56 ? 166 VAL A HG23  1 
ATOM   2646  N  N     . ILE A 1 167 ? -21.673 -43.453 -42.513 1.00 31.14 ? 167 ILE A N     1 
ATOM   2647  C  CA    . ILE A 1 167 ? -21.669 -44.055 -43.844 1.00 27.38 ? 167 ILE A CA    1 
ATOM   2648  C  C     . ILE A 1 167 ? -20.807 -45.308 -43.762 1.00 29.93 ? 167 ILE A C     1 
ATOM   2649  O  O     . ILE A 1 167 ? -19.594 -45.235 -43.572 1.00 25.40 ? 167 ILE A O     1 
ATOM   2650  C  CB    . ILE A 1 167 ? -21.131 -43.093 -44.906 1.00 31.74 ? 167 ILE A CB    1 
ATOM   2651  C  CG1   . ILE A 1 167 ? -22.012 -41.847 -44.972 1.00 31.29 ? 167 ILE A CG1   1 
ATOM   2652  C  CG2   . ILE A 1 167 ? -21.098 -43.764 -46.280 1.00 35.31 ? 167 ILE A CG2   1 
ATOM   2653  C  CD1   . ILE A 1 167 ? -21.387 -40.735 -45.853 1.00 38.30 ? 167 ILE A CD1   1 
ATOM   2654  H  H     . ILE A 1 167 ? -20.892 -43.375 -42.162 1.00 37.30 ? 167 ILE A H     1 
ATOM   2655  H  HA    . ILE A 1 167 ? -22.581 -44.316 -44.091 1.00 32.79 ? 167 ILE A HA    1 
ATOM   2656  H  HB    . ILE A 1 167 ? -20.230 -42.829 -44.663 1.00 38.02 ? 167 ILE A HB    1 
ATOM   2657  H  HG12  . ILE A 1 167 ? -22.872 -42.086 -45.351 1.00 37.49 ? 167 ILE A HG12  1 
ATOM   2658  H  HG13  . ILE A 1 167 ? -22.128 -41.493 -44.076 1.00 37.49 ? 167 ILE A HG13  1 
ATOM   2659  H  HG21  . ILE A 1 167 ? -20.528 -44.535 -46.238 1.00 42.31 ? 167 ILE A HG21  1 
ATOM   2660  H  HG22  . ILE A 1 167 ? -21.989 -44.028 -46.520 1.00 42.31 ? 167 ILE A HG22  1 
ATOM   2661  H  HG23  . ILE A 1 167 ? -20.757 -43.139 -46.924 1.00 42.31 ? 167 ILE A HG23  1 
ATOM   2662  H  HD11  . ILE A 1 167 ? -21.976 -39.977 -45.862 1.00 45.89 ? 167 ILE A HD11  1 
ATOM   2663  H  HD12  . ILE A 1 167 ? -20.537 -40.486 -45.485 1.00 45.89 ? 167 ILE A HD12  1 
ATOM   2664  H  HD13  . ILE A 1 167 ? -21.272 -41.072 -46.745 1.00 45.89 ? 167 ILE A HD13  1 
ATOM   2665  N  N     . ARG A 1 168 ? -21.452 -46.466 -43.866 1.00 29.95 ? 168 ARG A N     1 
ATOM   2666  C  CA    . ARG A 1 168 ? -20.755 -47.741 -43.781 1.00 35.45 ? 168 ARG A CA    1 
ATOM   2667  C  C     . ARG A 1 168 ? -20.013 -48.066 -45.054 1.00 34.77 ? 168 ARG A C     1 
ATOM   2668  O  O     . ARG A 1 168 ? -20.359 -47.563 -46.112 1.00 32.28 ? 168 ARG A O     1 
ATOM   2669  C  CB    . ARG A 1 168 ? -21.761 -48.845 -43.464 1.00 39.84 ? 168 ARG A CB    1 
ATOM   2670  C  CG    . ARG A 1 168 ? -22.369 -48.674 -42.092 1.00 33.65 ? 168 ARG A CG    1 
ATOM   2671  C  CD    . ARG A 1 168 ? -23.454 -49.709 -41.804 1.00 47.48 ? 168 ARG A CD    1 
ATOM   2672  N  NE    . ARG A 1 168 ? -23.718 -49.808 -40.370 1.00 50.13 ? 168 ARG A NE    1 
ATOM   2673  C  CZ    . ARG A 1 168 ? -24.590 -49.052 -39.706 1.00 54.73 ? 168 ARG A CZ    1 
ATOM   2674  N  NH1   . ARG A 1 168 ? -25.305 -48.129 -40.342 1.00 53.05 ? 168 ARG A NH1   1 
ATOM   2675  N  NH2   . ARG A 1 168 ? -24.748 -49.220 -38.397 1.00 48.09 ? 168 ARG A NH2   1 
ATOM   2676  H  H     . ARG A 1 168 ? -22.300 -46.538 -43.988 1.00 35.87 ? 168 ARG A H     1 
ATOM   2677  H  HA    . ARG A 1 168 ? -20.103 -47.702 -43.050 1.00 42.48 ? 168 ARG A HA    1 
ATOM   2678  H  HB2   . ARG A 1 168 ? -22.477 -48.821 -44.118 1.00 47.74 ? 168 ARG A HB2   1 
ATOM   2679  H  HB3   . ARG A 1 168 ? -21.311 -49.704 -43.491 1.00 47.74 ? 168 ARG A HB3   1 
ATOM   2680  H  HG2   . ARG A 1 168 ? -21.674 -48.771 -41.423 1.00 40.31 ? 168 ARG A HG2   1 
ATOM   2681  H  HG3   . ARG A 1 168 ? -22.770 -47.793 -42.031 1.00 40.31 ? 168 ARG A HG3   1 
ATOM   2682  H  HD2   . ARG A 1 168 ? -24.275 -49.446 -42.249 1.00 56.92 ? 168 ARG A HD2   1 
ATOM   2683  H  HD3   . ARG A 1 168 ? -23.161 -50.578 -42.121 1.00 56.92 ? 168 ARG A HD3   1 
ATOM   2684  H  HE    . ARG A 1 168 ? -23.279 -50.396 -39.922 1.00 60.09 ? 168 ARG A HE    1 
ATOM   2685  H  HH11  . ARG A 1 168 ? -25.204 -48.016 -41.189 1.00 63.60 ? 168 ARG A HH11  1 
ATOM   2686  H  HH12  . ARG A 1 168 ? -25.867 -47.645 -39.907 1.00 63.60 ? 168 ARG A HH12  1 
ATOM   2687  H  HH21  . ARG A 1 168 ? -24.289 -49.817 -37.982 1.00 57.65 ? 168 ARG A HH21  1 
ATOM   2688  H  HH22  . ARG A 1 168 ? -25.313 -48.736 -37.966 1.00 57.65 ? 168 ARG A HH22  1 
ATOM   2689  N  N     . PRO A 1 169 ? -18.988 -48.923 -44.961 1.00 30.26 ? 169 PRO A N     1 
ATOM   2690  C  CA    . PRO A 1 169 ? -18.248 -49.254 -46.177 1.00 32.69 ? 169 PRO A CA    1 
ATOM   2691  C  C     . PRO A 1 169 ? -19.173 -49.726 -47.286 1.00 44.96 ? 169 PRO A C     1 
ATOM   2692  O  O     . PRO A 1 169 ? -18.904 -49.436 -48.449 1.00 37.41 ? 169 PRO A O     1 
ATOM   2693  C  CB    . PRO A 1 169 ? -17.311 -50.376 -45.724 1.00 45.47 ? 169 PRO A CB    1 
ATOM   2694  C  CG    . PRO A 1 169 ? -17.101 -50.118 -44.273 1.00 35.68 ? 169 PRO A CG    1 
ATOM   2695  C  CD    . PRO A 1 169 ? -18.407 -49.562 -43.766 1.00 35.40 ? 169 PRO A CD    1 
ATOM   2696  H  HA    . PRO A 1 169 ? -17.722 -48.486 -46.485 1.00 39.16 ? 169 PRO A HA    1 
ATOM   2697  H  HB2   . PRO A 1 169 ? -17.737 -51.237 -45.864 1.00 54.50 ? 169 PRO A HB2   1 
ATOM   2698  H  HB3   . PRO A 1 169 ? -16.473 -50.322 -46.209 1.00 54.50 ? 169 PRO A HB3   1 
ATOM   2699  H  HG2   . PRO A 1 169 ? -16.886 -50.949 -43.822 1.00 42.75 ? 169 PRO A HG2   1 
ATOM   2700  H  HG3   . PRO A 1 169 ? -16.388 -49.471 -44.158 1.00 42.75 ? 169 PRO A HG3   1 
ATOM   2701  H  HD2   . PRO A 1 169 ? -18.980 -50.279 -43.452 1.00 42.41 ? 169 PRO A HD2   1 
ATOM   2702  H  HD3   . PRO A 1 169 ? -18.248 -48.903 -43.072 1.00 42.41 ? 169 PRO A HD3   1 
ATOM   2703  N  N     . THR A 1 170 ? -20.258 -50.411 -46.930 1.00 41.91 ? 170 THR A N     1 
ATOM   2704  C  CA    . THR A 1 170 ? -21.148 -50.982 -47.934 1.00 51.25 ? 170 THR A CA    1 
ATOM   2705  C  C     . THR A 1 170 ? -22.057 -49.939 -48.565 1.00 47.14 ? 170 THR A C     1 
ATOM   2706  O  O     . THR A 1 170 ? -22.563 -50.167 -49.663 1.00 41.38 ? 170 THR A O     1 
ATOM   2707  C  CB    . THR A 1 170 ? -22.007 -52.133 -47.360 1.00 47.52 ? 170 THR A CB    1 
ATOM   2708  O  OG1   . THR A 1 170 ? -22.730 -51.681 -46.214 1.00 49.16 ? 170 THR A OG1   1 
ATOM   2709  C  CG2   . THR A 1 170 ? -21.123 -53.321 -46.975 1.00 51.15 ? 170 THR A CG2   1 
ATOM   2710  H  H     . THR A 1 170 ? -20.499 -50.557 -46.118 1.00 50.24 ? 170 THR A H     1 
ATOM   2711  H  HA    . THR A 1 170 ? -20.597 -51.360 -48.651 1.00 61.44 ? 170 THR A HA    1 
ATOM   2712  H  HB    . THR A 1 170 ? -22.635 -52.430 -48.037 1.00 56.96 ? 170 THR A HB    1 
ATOM   2713  H  HG1   . THR A 1 170 ? -23.223 -51.059 -46.420 1.00 58.93 ? 170 THR A HG1   1 
ATOM   2714  H  HG21  . THR A 1 170 ? -20.653 -53.643 -47.747 1.00 61.32 ? 170 THR A HG21  1 
ATOM   2715  H  HG22  . THR A 1 170 ? -20.485 -53.052 -46.310 1.00 61.32 ? 170 THR A HG22  1 
ATOM   2716  H  HG23  . THR A 1 170 ? -21.664 -54.030 -46.620 1.00 61.32 ? 170 THR A HG23  1 
ATOM   2717  N  N     . GLU A 1 171 ? -22.238 -48.799 -47.890 1.00 35.82 ? 171 GLU A N     1 
ATOM   2718  C  CA    . GLU A 1 171 ? -23.139 -47.738 -48.360 1.00 39.28 ? 171 GLU A CA    1 
ATOM   2719  C  C     . GLU A 1 171 ? -22.429 -46.668 -49.207 1.00 35.32 ? 171 GLU A C     1 
ATOM   2720  O  O     . GLU A 1 171 ? -23.074 -45.814 -49.808 1.00 36.63 ? 171 GLU A O     1 
ATOM   2721  C  CB    . GLU A 1 171 ? -23.824 -47.065 -47.163 1.00 40.68 ? 171 GLU A CB    1 
ATOM   2722  C  CG    . GLU A 1 171 ? -24.527 -48.040 -46.213 1.00 42.68 ? 171 GLU A CG    1 
ATOM   2723  C  CD    . GLU A 1 171 ? -24.885 -47.424 -44.849 1.00 55.67 ? 171 GLU A CD    1 
ATOM   2724  O  OE1   . GLU A 1 171 ? -25.961 -47.762 -44.292 1.00 53.64 ? 171 GLU A OE1   1 
ATOM   2725  O  OE2   . GLU A 1 171 ? -24.081 -46.620 -44.322 1.00 41.93 ? 171 GLU A OE2   1 
ATOM   2726  H  H     . GLU A 1 171 ? -21.845 -48.613 -47.147 1.00 42.93 ? 171 GLU A H     1 
ATOM   2727  H  HA    . GLU A 1 171 ? -23.838 -48.143 -48.915 1.00 47.07 ? 171 GLU A HA    1 
ATOM   2728  H  HB2   . GLU A 1 171 ? -23.155 -46.585 -46.651 1.00 48.76 ? 171 GLU A HB2   1 
ATOM   2729  H  HB3   . GLU A 1 171 ? -24.491 -46.443 -47.495 1.00 48.76 ? 171 GLU A HB3   1 
ATOM   2730  H  HG2   . GLU A 1 171 ? -25.351 -48.342 -46.627 1.00 51.15 ? 171 GLU A HG2   1 
ATOM   2731  H  HG3   . GLU A 1 171 ? -23.943 -48.798 -46.052 1.00 51.15 ? 171 GLU A HG3   1 
ATOM   2732  N  N     . VAL A 1 172 ? -21.105 -46.715 -49.251 1.00 33.11 ? 172 VAL A N     1 
ATOM   2733  C  CA    . VAL A 1 172 ? -20.317 -45.666 -49.903 1.00 33.90 ? 172 VAL A CA    1 
ATOM   2734  C  C     . VAL A 1 172 ? -20.659 -45.460 -51.385 1.00 37.61 ? 172 VAL A C     1 
ATOM   2735  O  O     . VAL A 1 172 ? -20.809 -44.333 -51.823 1.00 30.16 ? 172 VAL A O     1 
ATOM   2736  C  CB    . VAL A 1 172 ? -18.807 -45.942 -49.770 1.00 33.84 ? 172 VAL A CB    1 
ATOM   2737  C  CG1   . VAL A 1 172 ? -17.971 -45.001 -50.654 1.00 36.74 ? 172 VAL A CG1   1 
ATOM   2738  C  CG2   . VAL A 1 172 ? -18.382 -45.849 -48.304 1.00 32.99 ? 172 VAL A CG2   1 
ATOM   2739  H  H     . VAL A 1 172 ? -20.631 -47.346 -48.909 1.00 39.67 ? 172 VAL A H     1 
ATOM   2740  H  HA    . VAL A 1 172 ? -20.499 -44.820 -49.444 1.00 40.62 ? 172 VAL A HA    1 
ATOM   2741  H  HB    . VAL A 1 172 ? -18.631 -46.859 -50.070 1.00 40.55 ? 172 VAL A HB    1 
ATOM   2742  H  HG11  . VAL A 1 172 ? -18.562 -44.411 -51.127 1.00 44.03 ? 172 VAL A HG11  1 
ATOM   2743  H  HG12  . VAL A 1 172 ? -17.379 -44.493 -50.095 1.00 44.03 ? 172 VAL A HG12  1 
ATOM   2744  H  HG13  . VAL A 1 172 ? -17.464 -45.526 -51.277 1.00 44.03 ? 172 VAL A HG13  1 
ATOM   2745  H  HG21  . VAL A 1 172 ? -17.440 -46.023 -48.240 1.00 39.53 ? 172 VAL A HG21  1 
ATOM   2746  H  HG22  . VAL A 1 172 ? -18.575 -44.967 -47.978 1.00 39.53 ? 172 VAL A HG22  1 
ATOM   2747  H  HG23  . VAL A 1 172 ? -18.871 -46.500 -47.795 1.00 39.53 ? 172 VAL A HG23  1 
ATOM   2748  N  N     . GLN A 1 173 ? -20.749 -46.525 -52.174 1.00 41.12 ? 173 GLN A N     1 
ATOM   2749  C  CA    . GLN A 1 173 ? -20.961 -46.304 -53.604 1.00 50.85 ? 173 GLN A CA    1 
ATOM   2750  C  C     . GLN A 1 173 ? -22.332 -45.693 -53.873 1.00 34.69 ? 173 GLN A C     1 
ATOM   2751  O  O     . GLN A 1 173 ? -22.449 -44.722 -54.634 1.00 40.98 ? 173 GLN A O     1 
ATOM   2752  C  CB    . GLN A 1 173 ? -20.757 -47.573 -54.433 1.00 54.09 ? 173 GLN A CB    1 
ATOM   2753  C  CG    . GLN A 1 173 ? -20.551 -47.256 -55.918 1.00 69.89 ? 173 GLN A CG    1 
ATOM   2754  C  CD    . GLN A 1 173 ? -19.523 -46.137 -56.153 1.00 75.88 ? 173 GLN A CD    1 
ATOM   2755  O  OE1   . GLN A 1 173 ? -18.340 -46.292 -55.829 1.00 75.31 ? 173 GLN A OE1   1 
ATOM   2756  N  NE2   . GLN A 1 173 ? -19.978 -45.002 -56.711 1.00 57.88 ? 173 GLN A NE2   1 
ATOM   2757  H  H     . GLN A 1 173 ? -20.695 -47.346 -51.926 1.00 49.28 ? 173 GLN A H     1 
ATOM   2758  H  HA    . GLN A 1 173 ? -20.294 -45.654 -53.909 1.00 60.96 ? 173 GLN A HA    1 
ATOM   2759  H  HB2   . GLN A 1 173 ? -19.971 -48.041 -54.111 1.00 64.84 ? 173 GLN A HB2   1 
ATOM   2760  H  HB3   . GLN A 1 173 ? -21.541 -48.138 -54.349 1.00 64.84 ? 173 GLN A HB3   1 
ATOM   2761  H  HG2   . GLN A 1 173 ? -20.235 -48.054 -56.370 1.00 83.80 ? 173 GLN A HG2   1 
ATOM   2762  H  HG3   . GLN A 1 173 ? -21.396 -46.972 -56.300 1.00 83.80 ? 173 GLN A HG3   1 
ATOM   2763  H  HE21  . GLN A 1 173 ? -20.809 -44.927 -56.918 1.00 69.40 ? 173 GLN A HE21  1 
ATOM   2764  H  HE22  . GLN A 1 173 ? -19.437 -44.350 -56.860 1.00 69.40 ? 173 GLN A HE22  1 
ATOM   2765  N  N     . ASP A 1 174 ? -23.370 -46.226 -53.247 1.00 39.34 ? 174 ASP A N     1 
ATOM   2766  C  CA    . ASP A 1 174 ? -24.681 -45.597 -53.370 1.00 41.61 ? 174 ASP A CA    1 
ATOM   2767  C  C     . ASP A 1 174 ? -24.608 -44.129 -52.932 1.00 47.58 ? 174 ASP A C     1 
ATOM   2768  O  O     . ASP A 1 174 ? -25.120 -43.229 -53.607 1.00 41.43 ? 174 ASP A O     1 
ATOM   2769  C  CB    . ASP A 1 174 ? -25.731 -46.342 -52.545 1.00 51.22 ? 174 ASP A CB    1 
ATOM   2770  C  CG    . ASP A 1 174 ? -27.105 -45.661 -52.585 1.00 69.59 ? 174 ASP A CG    1 
ATOM   2771  O  OD1   . ASP A 1 174 ? -28.031 -46.207 -53.227 1.00 71.65 ? 174 ASP A OD1   1 
ATOM   2772  O  OD2   . ASP A 1 174 ? -27.262 -44.580 -51.973 1.00 69.97 ? 174 ASP A OD2   1 
ATOM   2773  H  H     . ASP A 1 174 ? -23.348 -46.932 -52.757 1.00 47.15 ? 174 ASP A H     1 
ATOM   2774  H  HA    . ASP A 1 174 ? -24.960 -45.621 -54.309 1.00 49.87 ? 174 ASP A HA    1 
ATOM   2775  H  HB2   . ASP A 1 174 ? -25.831 -47.240 -52.897 1.00 61.40 ? 174 ASP A HB2   1 
ATOM   2776  H  HB3   . ASP A 1 174 ? -25.441 -46.377 -51.621 1.00 61.40 ? 174 ASP A HB3   1 
ATOM   2777  N  N     . PHE A 1 175 ? -23.965 -43.882 -51.797 1.00 39.50 ? 175 PHE A N     1 
ATOM   2778  C  CA    . PHE A 1 175 ? -23.886 -42.527 -51.284 1.00 36.44 ? 175 PHE A CA    1 
ATOM   2779  C  C     . PHE A 1 175 ? -23.229 -41.578 -52.288 1.00 31.66 ? 175 PHE A C     1 
ATOM   2780  O  O     . PHE A 1 175 ? -23.698 -40.469 -52.489 1.00 32.86 ? 175 PHE A O     1 
ATOM   2781  C  CB    . PHE A 1 175 ? -23.127 -42.490 -49.956 1.00 36.89 ? 175 PHE A CB    1 
ATOM   2782  C  CG    . PHE A 1 175 ? -23.152 -41.141 -49.302 1.00 27.53 ? 175 PHE A CG    1 
ATOM   2783  C  CD1   . PHE A 1 175 ? -24.238 -40.762 -48.512 1.00 34.99 ? 175 PHE A CD1   1 
ATOM   2784  C  CD2   . PHE A 1 175 ? -22.128 -40.236 -49.509 1.00 34.90 ? 175 PHE A CD2   1 
ATOM   2785  C  CE1   . PHE A 1 175 ? -24.269 -39.504 -47.903 1.00 39.73 ? 175 PHE A CE1   1 
ATOM   2786  C  CE2   . PHE A 1 175 ? -22.156 -38.975 -48.915 1.00 34.45 ? 175 PHE A CE2   1 
ATOM   2787  C  CZ    . PHE A 1 175 ? -23.224 -38.612 -48.109 1.00 34.49 ? 175 PHE A CZ    1 
ATOM   2788  H  H     . PHE A 1 175 ? -23.571 -44.474 -51.313 1.00 47.33 ? 175 PHE A H     1 
ATOM   2789  H  HA    . PHE A 1 175 ? -24.795 -42.202 -51.117 1.00 43.67 ? 175 PHE A HA    1 
ATOM   2790  H  HB2   . PHE A 1 175 ? -23.531 -43.127 -49.345 1.00 44.20 ? 175 PHE A HB2   1 
ATOM   2791  H  HB3   . PHE A 1 175 ? -22.200 -42.728 -50.116 1.00 44.20 ? 175 PHE A HB3   1 
ATOM   2792  H  HD1   . PHE A 1 175 ? -24.934 -41.362 -48.367 1.00 41.93 ? 175 PHE A HD1   1 
ATOM   2793  H  HD2   . PHE A 1 175 ? -21.404 -40.476 -50.042 1.00 41.81 ? 175 PHE A HD2   1 
ATOM   2794  H  HE1   . PHE A 1 175 ? -24.991 -39.262 -47.369 1.00 47.62 ? 175 PHE A HE1   1 
ATOM   2795  H  HE2   . PHE A 1 175 ? -21.454 -38.381 -49.052 1.00 41.28 ? 175 PHE A HE2   1 
ATOM   2796  H  HZ    . PHE A 1 175 ? -23.244 -37.771 -47.713 1.00 41.32 ? 175 PHE A HZ    1 
ATOM   2797  N  N     . LEU A 1 176 ? -22.135 -42.010 -52.903 1.00 33.60 ? 176 LEU A N     1 
ATOM   2798  C  CA    . LEU A 1 176 ? -21.403 -41.151 -53.831 1.00 33.84 ? 176 LEU A CA    1 
ATOM   2799  C  C     . LEU A 1 176 ? -22.189 -40.966 -55.114 1.00 36.81 ? 176 LEU A C     1 
ATOM   2800  O  O     . LEU A 1 176 ? -22.040 -39.970 -55.812 1.00 33.96 ? 176 LEU A O     1 
ATOM   2801  C  CB    . LEU A 1 176 ? -20.048 -41.754 -54.178 1.00 36.22 ? 176 LEU A CB    1 
ATOM   2802  C  CG    . LEU A 1 176 ? -18.983 -41.703 -53.088 1.00 38.78 ? 176 LEU A CG    1 
ATOM   2803  C  CD1   . LEU A 1 176 ? -17.763 -42.453 -53.539 1.00 33.62 ? 176 LEU A CD1   1 
ATOM   2804  C  CD2   . LEU A 1 176 ? -18.640 -40.268 -52.737 1.00 29.50 ? 176 LEU A CD2   1 
ATOM   2805  H  H     . LEU A 1 176 ? -21.795 -42.794 -52.803 1.00 40.26 ? 176 LEU A H     1 
ATOM   2806  H  HA    . LEU A 1 176 ? -21.259 -40.272 -53.422 1.00 40.55 ? 176 LEU A HA    1 
ATOM   2807  H  HB2   . LEU A 1 176 ? -20.181 -42.687 -54.407 1.00 43.40 ? 176 LEU A HB2   1 
ATOM   2808  H  HB3   . LEU A 1 176 ? -19.695 -41.281 -54.948 1.00 43.40 ? 176 LEU A HB3   1 
ATOM   2809  H  HG    . LEU A 1 176 ? -19.325 -42.135 -52.289 1.00 46.48 ? 176 LEU A HG    1 
ATOM   2810  H  HD11  . LEU A 1 176 ? -18.004 -43.365 -53.712 1.00 40.29 ? 176 LEU A HD11  1 
ATOM   2811  H  HD12  . LEU A 1 176 ? -17.425 -42.045 -54.339 1.00 40.29 ? 176 LEU A HD12  1 
ATOM   2812  H  HD13  . LEU A 1 176 ? -17.099 -42.414 -52.846 1.00 40.29 ? 176 LEU A HD13  1 
ATOM   2813  H  HD21  . LEU A 1 176 ? -17.970 -40.267 -52.050 1.00 35.34 ? 176 LEU A HD21  1 
ATOM   2814  H  HD22  . LEU A 1 176 ? -18.308 -39.826 -53.522 1.00 35.34 ? 176 LEU A HD22  1 
ATOM   2815  H  HD23  . LEU A 1 176 ? -19.432 -39.826 -52.423 1.00 35.34 ? 176 LEU A HD23  1 
ATOM   2816  N  N     . ASN A 1 177 ? -23.008 -41.948 -55.447 1.00 37.35 ? 177 ASN A N     1 
ATOM   2817  C  CA    . ASN A 1 177 ? -23.823 -41.836 -56.646 1.00 49.19 ? 177 ASN A CA    1 
ATOM   2818  C  C     . ASN A 1 177 ? -24.946 -40.821 -56.491 1.00 50.24 ? 177 ASN A C     1 
ATOM   2819  O  O     . ASN A 1 177 ? -25.491 -40.331 -57.476 1.00 51.62 ? 177 ASN A O     1 
ATOM   2820  C  CB    . ASN A 1 177 ? -24.394 -43.196 -57.031 1.00 49.00 ? 177 ASN A CB    1 
ATOM   2821  C  CG    . ASN A 1 177 ? -23.350 -44.096 -57.640 1.00 61.26 ? 177 ASN A CG    1 
ATOM   2822  O  OD1   . ASN A 1 177 ? -22.331 -43.623 -58.169 1.00 68.45 ? 177 ASN A OD1   1 
ATOM   2823  N  ND2   . ASN A 1 177 ? -23.582 -45.404 -57.561 1.00 64.86 ? 177 ASN A ND2   1 
ATOM   2824  H  H     . ASN A 1 177 ? -23.111 -42.679 -55.005 1.00 44.76 ? 177 ASN A H     1 
ATOM   2825  H  HA    . ASN A 1 177 ? -23.253 -41.535 -57.383 1.00 58.97 ? 177 ASN A HA    1 
ATOM   2826  H  HB2   . ASN A 1 177 ? -24.742 -43.632 -56.237 1.00 58.74 ? 177 ASN A HB2   1 
ATOM   2827  H  HB3   . ASN A 1 177 ? -25.102 -43.072 -57.682 1.00 58.74 ? 177 ASN A HB3   1 
ATOM   2828  H  HD21  . ASN A 1 177 ? -23.017 -45.961 -57.893 1.00 77.77 ? 177 ASN A HD21  1 
ATOM   2829  H  HD22  . ASN A 1 177 ? -24.296 -45.692 -57.178 1.00 77.77 ? 177 ASN A HD22  1 
ATOM   2830  N  N     . GLU A 1 178 ? -25.293 -40.490 -55.256 1.00 41.53 ? 178 GLU A N     1 
ATOM   2831  C  CA    . GLU A 1 178 ? -26.423 -39.600 -55.048 1.00 42.86 ? 178 GLU A CA    1 
ATOM   2832  C  C     . GLU A 1 178 ? -25.997 -38.218 -54.553 1.00 45.03 ? 178 GLU A C     1 
ATOM   2833  O  O     . GLU A 1 178 ? -26.806 -37.304 -54.474 1.00 37.00 ? 178 GLU A O     1 
ATOM   2834  C  CB    . GLU A 1 178 ? -27.419 -40.245 -54.088 1.00 44.86 ? 178 GLU A CB    1 
ATOM   2835  C  CG    . GLU A 1 178 ? -27.989 -41.574 -54.605 1.00 57.39 ? 178 GLU A CG    1 
ATOM   2836  C  CD    . GLU A 1 178 ? -28.825 -41.419 -55.875 1.00 69.12 ? 178 GLU A CD    1 
ATOM   2837  O  OE1   . GLU A 1 178 ? -29.463 -40.352 -56.052 1.00 70.84 ? 178 GLU A OE1   1 
ATOM   2838  O  OE2   . GLU A 1 178 ? -28.841 -42.366 -56.700 1.00 65.50 ? 178 GLU A OE2   1 
ATOM   2839  H  H     . GLU A 1 178 ? -24.903 -40.760 -54.538 1.00 49.78 ? 178 GLU A H     1 
ATOM   2840  H  HA    . GLU A 1 178 ? -26.880 -39.475 -55.906 1.00 51.37 ? 178 GLU A HA    1 
ATOM   2841  H  HB2   . GLU A 1 178 ? -26.973 -40.420 -53.244 1.00 53.77 ? 178 GLU A HB2   1 
ATOM   2842  H  HB3   . GLU A 1 178 ? -28.161 -39.636 -53.949 1.00 53.77 ? 178 GLU A HB3   1 
ATOM   2843  H  HG2   . GLU A 1 178 ? -27.255 -42.176 -54.802 1.00 68.81 ? 178 GLU A HG2   1 
ATOM   2844  H  HG3   . GLU A 1 178 ? -28.558 -41.960 -53.919 1.00 68.81 ? 178 GLU A HG3   1 
ATOM   2845  N  N     . LEU A 1 179 ? -24.722 -38.053 -54.239 1.00 37.31 ? 179 LEU A N     1 
ATOM   2846  C  CA    . LEU A 1 179 ? -24.269 -36.804 -53.634 1.00 36.34 ? 179 LEU A CA    1 
ATOM   2847  C  C     . LEU A 1 179 ? -24.370 -35.621 -54.609 1.00 33.29 ? 179 LEU A C     1 
ATOM   2848  O  O     . LEU A 1 179 ? -23.937 -35.718 -55.749 1.00 33.15 ? 179 LEU A O     1 
ATOM   2849  C  CB    . LEU A 1 179 ? -22.831 -36.991 -53.129 1.00 28.63 ? 179 LEU A CB    1 
ATOM   2850  C  CG    . LEU A 1 179 ? -22.179 -35.865 -52.324 1.00 38.24 ? 179 LEU A CG    1 
ATOM   2851  C  CD1   . LEU A 1 179 ? -22.965 -35.530 -51.071 1.00 37.52 ? 179 LEU A CD1   1 
ATOM   2852  C  CD2   . LEU A 1 179 ? -20.760 -36.270 -51.964 1.00 36.08 ? 179 LEU A CD2   1 
ATOM   2853  H  H     . LEU A 1 179 ? -24.103 -38.637 -54.363 1.00 44.71 ? 179 LEU A H     1 
ATOM   2854  H  HA    . LEU A 1 179 ? -24.836 -36.604 -52.860 1.00 43.55 ? 179 LEU A HA    1 
ATOM   2855  H  HB2   . LEU A 1 179 ? -22.817 -37.781 -52.565 1.00 34.30 ? 179 LEU A HB2   1 
ATOM   2856  H  HB3   . LEU A 1 179 ? -22.265 -37.147 -53.901 1.00 34.30 ? 179 LEU A HB3   1 
ATOM   2857  H  HG    . LEU A 1 179 ? -22.134 -35.067 -52.874 1.00 45.83 ? 179 LEU A HG    1 
ATOM   2858  H  HD11  . LEU A 1 179 ? -23.848 -35.251 -51.322 1.00 44.97 ? 179 LEU A HD11  1 
ATOM   2859  H  HD12  . LEU A 1 179 ? -23.013 -36.311 -50.515 1.00 44.97 ? 179 LEU A HD12  1 
ATOM   2860  H  HD13  . LEU A 1 179 ? -22.518 -34.821 -50.603 1.00 44.97 ? 179 LEU A HD13  1 
ATOM   2861  H  HD21  . LEU A 1 179 ? -20.789 -37.073 -51.439 1.00 43.24 ? 179 LEU A HD21  1 
ATOM   2862  H  HD22  . LEU A 1 179 ? -20.265 -36.425 -52.772 1.00 43.24 ? 179 LEU A HD22  1 
ATOM   2863  H  HD23  . LEU A 1 179 ? -20.352 -35.563 -51.460 1.00 43.24 ? 179 LEU A HD23  1 
ATOM   2864  N  N     . ASP A 1 180 ? -24.945 -34.514 -54.142 1.00 36.85 ? 180 ASP A N     1 
ATOM   2865  C  CA    . ASP A 1 180 ? -24.991 -33.249 -54.886 1.00 35.55 ? 180 ASP A CA    1 
ATOM   2866  C  C     . ASP A 1 180 ? -23.668 -32.505 -54.893 1.00 47.45 ? 180 ASP A C     1 
ATOM   2867  O  O     . ASP A 1 180 ? -22.934 -32.483 -53.903 1.00 38.80 ? 180 ASP A O     1 
ATOM   2868  C  CB    . ASP A 1 180 ? -26.050 -32.320 -54.290 1.00 51.25 ? 180 ASP A CB    1 
ATOM   2869  C  CG    . ASP A 1 180 ? -27.361 -32.373 -55.037 1.00 58.12 ? 180 ASP A CG    1 
ATOM   2870  O  OD1   . ASP A 1 180 ? -27.462 -33.140 -56.016 1.00 50.63 ? 180 ASP A OD1   1 
ATOM   2871  O  OD2   . ASP A 1 180 ? -28.292 -31.641 -54.643 1.00 60.81 ? 180 ASP A OD2   1 
ATOM   2872  H  H     . ASP A 1 180 ? -25.327 -34.467 -53.373 1.00 44.16 ? 180 ASP A H     1 
ATOM   2873  H  HA    . ASP A 1 180 ? -25.239 -33.434 -55.816 1.00 42.60 ? 180 ASP A HA    1 
ATOM   2874  H  HB2   . ASP A 1 180 ? -26.218 -32.581 -53.371 1.00 61.44 ? 180 ASP A HB2   1 
ATOM   2875  H  HB3   . ASP A 1 180 ? -25.723 -31.407 -54.321 1.00 61.44 ? 180 ASP A HB3   1 
ATOM   2876  N  N     . ILE A 1 181 ? -23.388 -31.862 -56.014 1.00 39.85 ? 181 ILE A N     1 
ATOM   2877  C  CA    . ILE A 1 181 ? -22.118 -31.193 -56.210 1.00 39.72 ? 181 ILE A CA    1 
ATOM   2878  C  C     . ILE A 1 181 ? -21.869 -30.109 -55.153 1.00 38.73 ? 181 ILE A C     1 
ATOM   2879  O  O     . ILE A 1 181 ? -20.739 -29.900 -54.692 1.00 37.75 ? 181 ILE A O     1 
ATOM   2880  C  CB    . ILE A 1 181 ? -22.072 -30.583 -57.633 1.00 40.67 ? 181 ILE A CB    1 
ATOM   2881  C  CG1   . ILE A 1 181 ? -20.644 -30.535 -58.146 1.00 47.67 ? 181 ILE A CG1   1 
ATOM   2882  C  CG2   . ILE A 1 181 ? -22.767 -29.221 -57.661 1.00 51.43 ? 181 ILE A CG2   1 
ATOM   2883  C  CD1   . ILE A 1 181 ? -20.103 -31.917 -58.505 1.00 42.13 ? 181 ILE A CD1   1 
ATOM   2884  H  H     . ILE A 1 181 ? -23.924 -31.799 -56.684 1.00 47.76 ? 181 ILE A H     1 
ATOM   2885  H  HA    . ILE A 1 181 ? -21.397 -31.853 -56.141 1.00 47.61 ? 181 ILE A HA    1 
ATOM   2886  H  HB    . ILE A 1 181 ? -22.571 -31.174 -58.219 1.00 48.74 ? 181 ILE A HB    1 
ATOM   2887  H  HG12  . ILE A 1 181 ? -20.612 -29.984 -58.943 1.00 57.14 ? 181 ILE A HG12  1 
ATOM   2888  H  HG13  . ILE A 1 181 ? -20.073 -30.158 -57.458 1.00 57.14 ? 181 ILE A HG13  1 
ATOM   2889  H  HG21  . ILE A 1 181 ? -22.320 -28.630 -57.052 1.00 61.65 ? 181 ILE A HG21  1 
ATOM   2890  H  HG22  . ILE A 1 181 ? -22.724 -28.867 -58.552 1.00 61.65 ? 181 ILE A HG22  1 
ATOM   2891  H  HG23  . ILE A 1 181 ? -23.683 -29.333 -57.397 1.00 61.65 ? 181 ILE A HG23  1 
ATOM   2892  H  HD11  . ILE A 1 181 ? -20.654 -32.300 -59.191 1.00 50.50 ? 181 ILE A HD11  1 
ATOM   2893  H  HD12  . ILE A 1 181 ? -19.201 -31.827 -58.821 1.00 50.50 ? 181 ILE A HD12  1 
ATOM   2894  H  HD13  . ILE A 1 181 ? -20.121 -32.473 -57.722 1.00 50.50 ? 181 ILE A HD13  1 
ATOM   2895  N  N     . ASP A 1 182 ? -22.926 -29.420 -54.753 1.00 46.87 ? 182 ASP A N     1 
ATOM   2896  C  CA    . ASP A 1 182 ? -22.747 -28.304 -53.829 1.00 51.47 ? 182 ASP A CA    1 
ATOM   2897  C  C     . ASP A 1 182 ? -22.555 -28.799 -52.399 1.00 49.56 ? 182 ASP A C     1 
ATOM   2898  O  O     . ASP A 1 182 ? -22.285 -28.003 -51.505 1.00 50.94 ? 182 ASP A O     1 
ATOM   2899  C  CB    . ASP A 1 182 ? -23.904 -27.297 -53.924 1.00 52.05 ? 182 ASP A CB    1 
ATOM   2900  C  CG    . ASP A 1 182 ? -25.266 -27.962 -53.982 1.00 61.53 ? 182 ASP A CG    1 
ATOM   2901  O  OD1   . ASP A 1 182 ? -25.589 -28.756 -53.065 1.00 57.52 ? 182 ASP A OD1   1 
ATOM   2902  O  OD2   . ASP A 1 182 ? -26.014 -27.691 -54.955 1.00 62.46 ? 182 ASP A OD2   1 
ATOM   2903  H  H     . ASP A 1 182 ? -23.738 -29.569 -54.993 1.00 56.19 ? 182 ASP A H     1 
ATOM   2904  H  HA    . ASP A 1 182 ? -21.929 -27.828 -54.082 1.00 61.71 ? 182 ASP A HA    1 
ATOM   2905  H  HB2   . ASP A 1 182 ? -23.886 -26.721 -53.145 1.00 62.40 ? 182 ASP A HB2   1 
ATOM   2906  H  HB3   . ASP A 1 182 ? -23.796 -26.768 -54.730 1.00 62.40 ? 182 ASP A HB3   1 
ATOM   2907  N  N     . GLU A 1 183 ? -22.675 -30.111 -52.191 1.00 42.83 ? 183 GLU A N     1 
ATOM   2908  C  CA    . GLU A 1 183 ? -22.490 -30.697 -50.864 1.00 38.45 ? 183 GLU A CA    1 
ATOM   2909  C  C     . GLU A 1 183 ? -21.061 -31.177 -50.646 1.00 39.63 ? 183 GLU A C     1 
ATOM   2910  O  O     . GLU A 1 183 ? -20.771 -31.854 -49.662 1.00 40.68 ? 183 GLU A O     1 
ATOM   2911  C  CB    . GLU A 1 183 ? -23.416 -31.890 -50.668 1.00 34.95 ? 183 GLU A CB    1 
ATOM   2912  C  CG    . GLU A 1 183 ? -24.896 -31.570 -50.720 1.00 49.97 ? 183 GLU A CG    1 
ATOM   2913  C  CD    . GLU A 1 183 ? -25.744 -32.826 -50.615 1.00 57.03 ? 183 GLU A CD    1 
ATOM   2914  O  OE1   . GLU A 1 183 ? -26.430 -32.995 -49.583 1.00 58.64 ? 183 GLU A OE1   1 
ATOM   2915  O  OE2   . GLU A 1 183 ? -25.711 -33.655 -51.557 1.00 55.49 ? 183 GLU A OE2   1 
ATOM   2916  H  H     . GLU A 1 183 ? -22.864 -30.684 -52.804 1.00 51.34 ? 183 GLU A H     1 
ATOM   2917  H  HA    . GLU A 1 183 ? -22.699 -30.027 -50.180 1.00 46.08 ? 183 GLU A HA    1 
ATOM   2918  H  HB2   . GLU A 1 183 ? -23.233 -32.539 -51.365 1.00 41.88 ? 183 GLU A HB2   1 
ATOM   2919  H  HB3   . GLU A 1 183 ? -23.232 -32.284 -49.801 1.00 41.88 ? 183 GLU A HB3   1 
ATOM   2920  H  HG2   . GLU A 1 183 ? -25.123 -30.988 -49.978 1.00 59.91 ? 183 GLU A HG2   1 
ATOM   2921  H  HG3   . GLU A 1 183 ? -25.100 -31.136 -51.562 1.00 59.91 ? 183 GLU A HG3   1 
ATOM   2922  N  N     . ILE A 1 184 ? -20.169 -30.844 -51.561 1.00 28.03 ? 184 ILE A N     1 
ATOM   2923  C  CA    . ILE A 1 184 ? -18.818 -31.366 -51.506 1.00 34.02 ? 184 ILE A CA    1 
ATOM   2924  C  C     . ILE A 1 184 ? -17.920 -30.346 -50.856 1.00 34.31 ? 184 ILE A C     1 
ATOM   2925  O  O     . ILE A 1 184 ? -17.849 -29.217 -51.307 1.00 32.32 ? 184 ILE A O     1 
ATOM   2926  C  CB    . ILE A 1 184 ? -18.304 -31.665 -52.912 1.00 29.77 ? 184 ILE A CB    1 
ATOM   2927  C  CG1   . ILE A 1 184 ? -19.156 -32.775 -53.537 1.00 39.48 ? 184 ILE A CG1   1 
ATOM   2928  C  CG2   . ILE A 1 184 ? -16.847 -32.059 -52.903 1.00 32.88 ? 184 ILE A CG2   1 
ATOM   2929  C  CD1   . ILE A 1 184 ? -18.753 -33.080 -54.927 1.00 40.42 ? 184 ILE A CD1   1 
ATOM   2930  H  H     . ILE A 1 184 ? -20.320 -30.318 -52.224 1.00 33.57 ? 184 ILE A H     1 
ATOM   2931  H  HA    . ILE A 1 184 ? -18.799 -32.191 -50.978 1.00 40.76 ? 184 ILE A HA    1 
ATOM   2932  H  HB    . ILE A 1 184 ? -18.402 -30.864 -53.451 1.00 35.66 ? 184 ILE A HB    1 
ATOM   2933  H  HG12  . ILE A 1 184 ? -19.057 -33.585 -53.011 1.00 47.31 ? 184 ILE A HG12  1 
ATOM   2934  H  HG13  . ILE A 1 184 ? -20.084 -32.495 -53.547 1.00 47.31 ? 184 ILE A HG13  1 
ATOM   2935  H  HG21  . ILE A 1 184 ? -16.740 -32.846 -52.364 1.00 39.40 ? 184 ILE A HG21  1 
ATOM   2936  H  HG22  . ILE A 1 184 ? -16.567 -32.237 -53.804 1.00 39.40 ? 184 ILE A HG22  1 
ATOM   2937  H  HG23  . ILE A 1 184 ? -16.331 -31.337 -52.536 1.00 39.40 ? 184 ILE A HG23  1 
ATOM   2938  H  HD11  . ILE A 1 184 ? -19.316 -33.779 -55.269 1.00 48.44 ? 184 ILE A HD11  1 
ATOM   2939  H  HD12  . ILE A 1 184 ? -18.853 -32.288 -55.461 1.00 48.44 ? 184 ILE A HD12  1 
ATOM   2940  H  HD13  . ILE A 1 184 ? -17.837 -33.365 -54.931 1.00 48.44 ? 184 ILE A HD13  1 
ATOM   2941  N  N     . PRO A 1 185 ? -17.224 -30.747 -49.791 1.00 33.15 ? 185 PRO A N     1 
ATOM   2942  C  CA    . PRO A 1 185 ? -16.252 -29.843 -49.170 1.00 32.89 ? 185 PRO A CA    1 
ATOM   2943  C  C     . PRO A 1 185 ? -15.236 -29.337 -50.187 1.00 32.67 ? 185 PRO A C     1 
ATOM   2944  O  O     . PRO A 1 185 ? -14.658 -30.099 -50.976 1.00 36.06 ? 185 PRO A O     1 
ATOM   2945  C  CB    . PRO A 1 185 ? -15.558 -30.728 -48.130 1.00 27.16 ? 185 PRO A CB    1 
ATOM   2946  C  CG    . PRO A 1 185 ? -16.557 -31.792 -47.815 1.00 33.72 ? 185 PRO A CG    1 
ATOM   2947  C  CD    . PRO A 1 185 ? -17.325 -32.033 -49.084 1.00 32.05 ? 185 PRO A CD    1 
ATOM   2948  H  HA    . PRO A 1 185 ? -16.698 -29.089 -48.730 1.00 39.41 ? 185 PRO A HA    1 
ATOM   2949  H  HB2   . PRO A 1 185 ? -14.753 -31.113 -48.510 1.00 32.53 ? 185 PRO A HB2   1 
ATOM   2950  H  HB3   . PRO A 1 185 ? -15.351 -30.206 -47.339 1.00 32.53 ? 185 PRO A HB3   1 
ATOM   2951  H  HG2   . PRO A 1 185 ? -16.095 -32.599 -47.539 1.00 40.41 ? 185 PRO A HG2   1 
ATOM   2952  H  HG3   . PRO A 1 185 ? -17.150 -31.483 -47.113 1.00 40.41 ? 185 PRO A HG3   1 
ATOM   2953  H  HD2   . PRO A 1 185 ? -16.908 -32.739 -49.603 1.00 38.40 ? 185 PRO A HD2   1 
ATOM   2954  H  HD3   . PRO A 1 185 ? -18.252 -32.238 -48.884 1.00 38.40 ? 185 PRO A HD3   1 
ATOM   2955  N  N     . GLY A 1 186 ? -15.027 -28.036 -50.177 1.00 33.60 ? 186 GLY A N     1 
ATOM   2956  C  CA    . GLY A 1 186 ? -14.010 -27.454 -51.021 1.00 37.37 ? 186 GLY A CA    1 
ATOM   2957  C  C     . GLY A 1 186 ? -14.581 -26.955 -52.330 1.00 38.28 ? 186 GLY A C     1 
ATOM   2958  O  O     . GLY A 1 186 ? -13.847 -26.413 -53.143 1.00 42.07 ? 186 GLY A O     1 
ATOM   2959  H  H     . GLY A 1 186 ? -15.458 -27.472 -49.693 1.00 40.26 ? 186 GLY A H     1 
ATOM   2960  H  HA2   . GLY A 1 186 ? -13.594 -26.707 -50.561 1.00 44.78 ? 186 GLY A HA2   1 
ATOM   2961  H  HA3   . GLY A 1 186 ? -13.328 -28.116 -51.213 1.00 44.78 ? 186 GLY A HA3   1 
ATOM   2962  N  N     . ILE A 1 187 ? -15.881 -27.135 -52.549 1.00 34.73 ? 187 ILE A N     1 
ATOM   2963  C  CA    . ILE A 1 187 ? -16.498 -26.575 -53.744 1.00 35.93 ? 187 ILE A CA    1 
ATOM   2964  C  C     . ILE A 1 187 ? -17.424 -25.447 -53.323 1.00 38.31 ? 187 ILE A C     1 
ATOM   2965  O  O     . ILE A 1 187 ? -18.583 -25.671 -52.906 1.00 41.82 ? 187 ILE A O     1 
ATOM   2966  C  CB    . ILE A 1 187 ? -17.281 -27.621 -54.551 1.00 40.31 ? 187 ILE A CB    1 
ATOM   2967  C  CG1   . ILE A 1 187 ? -16.445 -28.887 -54.752 1.00 35.39 ? 187 ILE A CG1   1 
ATOM   2968  C  CG2   . ILE A 1 187 ? -17.669 -27.036 -55.899 1.00 40.94 ? 187 ILE A CG2   1 
ATOM   2969  C  CD1   . ILE A 1 187 ? -15.184 -28.667 -55.570 1.00 34.56 ? 187 ILE A CD1   1 
ATOM   2970  H  H     . ILE A 1 187 ? -16.416 -27.567 -52.033 1.00 41.61 ? 187 ILE A H     1 
ATOM   2971  H  HA    . ILE A 1 187 ? -15.801 -26.201 -54.322 1.00 43.06 ? 187 ILE A HA    1 
ATOM   2972  H  HB    . ILE A 1 187 ? -18.088 -27.852 -54.065 1.00 48.31 ? 187 ILE A HB    1 
ATOM   2973  H  HG12  . ILE A 1 187 ? -16.179 -29.227 -53.883 1.00 42.41 ? 187 ILE A HG12  1 
ATOM   2974  H  HG13  . ILE A 1 187 ? -16.985 -29.549 -55.212 1.00 42.41 ? 187 ILE A HG13  1 
ATOM   2975  H  HG21  . ILE A 1 187 ? -16.872 -26.791 -56.374 1.00 49.07 ? 187 ILE A HG21  1 
ATOM   2976  H  HG22  . ILE A 1 187 ? -18.158 -27.695 -56.396 1.00 49.07 ? 187 ILE A HG22  1 
ATOM   2977  H  HG23  . ILE A 1 187 ? -18.217 -26.260 -55.756 1.00 49.07 ? 187 ILE A HG23  1 
ATOM   2978  H  HD11  . ILE A 1 187 ? -15.429 -28.342 -56.440 1.00 41.41 ? 187 ILE A HD11  1 
ATOM   2979  H  HD12  . ILE A 1 187 ? -14.630 -28.023 -55.123 1.00 41.41 ? 187 ILE A HD12  1 
ATOM   2980  H  HD13  . ILE A 1 187 ? -14.716 -29.501 -55.653 1.00 41.41 ? 187 ILE A HD13  1 
ATOM   2981  N  N     . GLY A 1 188 ? -16.909 -24.230 -53.423 1.00 41.53 ? 188 GLY A N     1 
ATOM   2982  C  CA    . GLY A 1 188 ? -17.648 -23.056 -52.989 1.00 45.45 ? 188 GLY A CA    1 
ATOM   2983  C  C     . GLY A 1 188 ? -18.835 -22.734 -53.879 1.00 47.66 ? 188 GLY A C     1 
ATOM   2984  O  O     . GLY A 1 188 ? -18.983 -23.286 -54.973 1.00 45.89 ? 188 GLY A O     1 
ATOM   2985  H  H     . GLY A 1 188 ? -16.129 -24.057 -53.741 1.00 49.77 ? 188 GLY A H     1 
ATOM   2986  H  HA2   . GLY A 1 188 ? -17.973 -23.197 -52.086 1.00 54.48 ? 188 GLY A HA2   1 
ATOM   2987  H  HA3   . GLY A 1 188 ? -17.054 -22.288 -52.984 1.00 54.48 ? 188 GLY A HA3   1 
ATOM   2988  N  N     . SER A 1 189 ? -19.673 -21.822 -53.397 1.00 47.22 ? 189 SER A N     1 
ATOM   2989  C  CA    . SER A 1 189 ? -20.915 -21.429 -54.071 1.00 55.42 ? 189 SER A CA    1 
ATOM   2990  C  C     . SER A 1 189 ? -20.759 -21.061 -55.554 1.00 53.82 ? 189 SER A C     1 
ATOM   2991  O  O     . SER A 1 189 ? -21.574 -21.473 -56.390 1.00 47.99 ? 189 SER A O     1 
ATOM   2992  C  CB    . SER A 1 189 ? -21.551 -20.255 -53.314 1.00 56.51 ? 189 SER A CB    1 
ATOM   2993  O  OG    . SER A 1 189 ? -20.595 -19.236 -53.043 1.00 62.07 ? 189 SER A OG    1 
ATOM   2994  H  H     . SER A 1 189 ? -19.542 -21.401 -52.658 1.00 56.61 ? 189 SER A H     1 
ATOM   2995  H  HA    . SER A 1 189 ? -21.542 -22.181 -54.023 1.00 66.44 ? 189 SER A HA    1 
ATOM   2996  H  HB2   . SER A 1 189 ? -22.264 -19.881 -53.856 1.00 67.75 ? 189 SER A HB2   1 
ATOM   2997  H  HB3   . SER A 1 189 ? -21.911 -20.580 -52.474 1.00 67.75 ? 189 SER A HB3   1 
ATOM   2998  H  HG    . SER A 1 189 ? -19.862 -19.454 -53.340 1.00 74.43 ? 189 SER A HG    1 
ATOM   2999  N  N     . VAL A 1 190 ? -19.730 -20.284 -55.874 1.00 45.44 ? 190 VAL A N     1 
ATOM   3000  C  CA    . VAL A 1 190 ? -19.540 -19.803 -57.233 1.00 57.56 ? 190 VAL A CA    1 
ATOM   3001  C  C     . VAL A 1 190 ? -19.299 -20.975 -58.166 1.00 58.01 ? 190 VAL A C     1 
ATOM   3002  O  O     . VAL A 1 190 ? -19.993 -21.142 -59.176 1.00 50.55 ? 190 VAL A O     1 
ATOM   3003  C  CB    . VAL A 1 190 ? -18.347 -18.807 -57.342 1.00 54.80 ? 190 VAL A CB    1 
ATOM   3004  C  CG1   . VAL A 1 190 ? -17.044 -19.422 -56.832 1.00 62.77 ? 190 VAL A CG1   1 
ATOM   3005  C  CG2   . VAL A 1 190 ? -18.174 -18.338 -58.774 1.00 58.16 ? 190 VAL A CG2   1 
ATOM   3006  H  H     . VAL A 1 190 ? -19.127 -20.021 -55.319 1.00 54.47 ? 190 VAL A H     1 
ATOM   3007  H  HA    . VAL A 1 190 ? -20.352 -19.339 -57.526 1.00 69.01 ? 190 VAL A HA    1 
ATOM   3008  H  HB    . VAL A 1 190 ? -18.542 -18.021 -56.792 1.00 65.70 ? 190 VAL A HB    1 
ATOM   3009  H  HG11  . VAL A 1 190 ? -17.217 -20.319 -56.538 1.00 75.27 ? 190 VAL A HG11  1 
ATOM   3010  H  HG12  . VAL A 1 190 ? -16.402 -19.430 -57.546 1.00 75.27 ? 190 VAL A HG12  1 
ATOM   3011  H  HG13  . VAL A 1 190 ? -16.716 -18.894 -56.101 1.00 75.27 ? 190 VAL A HG13  1 
ATOM   3012  H  HG21  . VAL A 1 190 ? -17.434 -17.728 -58.815 1.00 69.74 ? 190 VAL A HG21  1 
ATOM   3013  H  HG22  . VAL A 1 190 ? -18.002 -19.099 -59.333 1.00 69.74 ? 190 VAL A HG22  1 
ATOM   3014  H  HG23  . VAL A 1 190 ? -18.978 -17.898 -59.058 1.00 69.74 ? 190 VAL A HG23  1 
ATOM   3015  N  N     . LEU A 1 191 ? -18.332 -21.804 -57.801 1.00 50.42 ? 191 LEU A N     1 
ATOM   3016  C  CA    . LEU A 1 191 ? -17.863 -22.851 -58.672 1.00 47.92 ? 191 LEU A CA    1 
ATOM   3017  C  C     . LEU A 1 191 ? -18.968 -23.875 -58.809 1.00 49.06 ? 191 LEU A C     1 
ATOM   3018  O  O     . LEU A 1 191 ? -19.215 -24.414 -59.887 1.00 44.78 ? 191 LEU A O     1 
ATOM   3019  C  CB    . LEU A 1 191 ? -16.626 -23.499 -58.079 1.00 44.16 ? 191 LEU A CB    1 
ATOM   3020  C  CG    . LEU A 1 191 ? -16.155 -24.733 -58.843 1.00 54.94 ? 191 LEU A CG    1 
ATOM   3021  C  CD1   . LEU A 1 191 ? -15.775 -24.350 -60.284 1.00 48.97 ? 191 LEU A CD1   1 
ATOM   3022  C  CD2   . LEU A 1 191 ? -15.000 -25.391 -58.132 1.00 49.15 ? 191 LEU A CD2   1 
ATOM   3023  H  H     . LEU A 1 191 ? -17.930 -21.775 -57.041 1.00 60.44 ? 191 LEU A H     1 
ATOM   3024  H  HA    . LEU A 1 191 ? -17.647 -22.487 -59.556 1.00 57.45 ? 191 LEU A HA    1 
ATOM   3025  H  HB2   . LEU A 1 191 ? -15.903 -22.853 -58.083 1.00 52.93 ? 191 LEU A HB2   1 
ATOM   3026  H  HB3   . LEU A 1 191 ? -16.821 -23.770 -57.169 1.00 52.93 ? 191 LEU A HB3   1 
ATOM   3027  H  HG    . LEU A 1 191 ? -16.883 -25.373 -58.887 1.00 65.87 ? 191 LEU A HG    1 
ATOM   3028  H  HD11  . LEU A 1 191 ? -15.481 -25.137 -60.749 1.00 58.70 ? 191 LEU A HD11  1 
ATOM   3029  H  HD12  . LEU A 1 191 ? -16.544 -23.979 -60.722 1.00 58.70 ? 191 LEU A HD12  1 
ATOM   3030  H  HD13  . LEU A 1 191 ? -15.067 -23.702 -60.258 1.00 58.70 ? 191 LEU A HD13  1 
ATOM   3031  H  HD21  . LEU A 1 191 ? -14.724 -26.163 -58.632 1.00 58.92 ? 191 LEU A HD21  1 
ATOM   3032  H  HD22  . LEU A 1 191 ? -14.275 -24.765 -58.068 1.00 58.92 ? 191 LEU A HD22  1 
ATOM   3033  H  HD23  . LEU A 1 191 ? -15.284 -25.655 -57.253 1.00 58.92 ? 191 LEU A HD23  1 
ATOM   3034  N  N     . ALA A 1 192 ? -19.654 -24.130 -57.708 1.00 43.67 ? 192 ALA A N     1 
ATOM   3035  C  CA    . ALA A 1 192 ? -20.764 -25.054 -57.751 1.00 44.28 ? 192 ALA A CA    1 
ATOM   3036  C  C     . ALA A 1 192 ? -21.678 -24.623 -58.884 1.00 48.12 ? 192 ALA A C     1 
ATOM   3037  O  O     . ALA A 1 192 ? -22.006 -25.435 -59.728 1.00 47.40 ? 192 ALA A O     1 
ATOM   3038  C  CB    . ALA A 1 192 ? -21.511 -25.079 -56.442 1.00 39.35 ? 192 ALA A CB    1 
ATOM   3039  H  H     . ALA A 1 192 ? -19.498 -23.785 -56.936 1.00 52.34 ? 192 ALA A H     1 
ATOM   3040  H  HA    . ALA A 1 192 ? -20.434 -25.957 -57.940 1.00 53.07 ? 192 ALA A HA    1 
ATOM   3041  H  HB1   . ALA A 1 192 ? -22.238 -25.702 -56.509 1.00 47.16 ? 192 ALA A HB1   1 
ATOM   3042  H  HB2   . ALA A 1 192 ? -20.910 -25.352 -55.745 1.00 47.16 ? 192 ALA A HB2   1 
ATOM   3043  H  HB3   . ALA A 1 192 ? -21.849 -24.199 -56.258 1.00 47.16 ? 192 ALA A HB3   1 
ATOM   3044  N  N     . ARG A 1 193 ? -22.078 -23.352 -58.916 1.00 49.85 ? 193 ARG A N     1 
ATOM   3045  C  CA    . ARG A 1 193 ? -23.045 -22.904 -59.926 1.00 51.42 ? 193 ARG A CA    1 
ATOM   3046  C  C     . ARG A 1 193 ? -22.455 -23.031 -61.332 1.00 44.58 ? 193 ARG A C     1 
ATOM   3047  O  O     . ARG A 1 193 ? -23.120 -23.502 -62.250 1.00 54.97 ? 193 ARG A O     1 
ATOM   3048  C  CB    . ARG A 1 193 ? -23.541 -21.473 -59.656 1.00 60.62 ? 193 ARG A CB    1 
ATOM   3049  C  CG    . ARG A 1 193 ? -22.707 -20.352 -60.306 1.00 64.21 ? 193 ARG A CG    1 
ATOM   3050  C  CD    . ARG A 1 193 ? -23.580 -19.165 -60.739 1.00 66.05 ? 193 ARG A CD    1 
ATOM   3051  N  NE    . ARG A 1 193 ? -24.396 -18.638 -59.642 1.00 71.64 ? 193 ARG A NE    1 
ATOM   3052  C  CZ    . ARG A 1 193 ? -23.925 -17.900 -58.635 1.00 71.24 ? 193 ARG A CZ    1 
ATOM   3053  N  NH1   . ARG A 1 193 ? -22.629 -17.597 -58.569 1.00 66.08 ? 193 ARG A NH1   1 
ATOM   3054  N  NH2   . ARG A 1 193 ? -24.751 -17.473 -57.687 1.00 65.26 ? 193 ARG A NH2   1 
ATOM   3055  H  H     . ARG A 1 193 ? -21.812 -22.738 -58.376 1.00 59.76 ? 193 ARG A H     1 
ATOM   3056  H  HA    . ARG A 1 193 ? -23.826 -23.494 -59.884 1.00 61.64 ? 193 ARG A HA    1 
ATOM   3057  H  HB2   . ARG A 1 193 ? -24.447 -21.394 -59.992 1.00 72.68 ? 193 ARG A HB2   1 
ATOM   3058  H  HB3   . ARG A 1 193 ? -23.535 -21.321 -58.698 1.00 72.68 ? 193 ARG A HB3   1 
ATOM   3059  H  HG2   . ARG A 1 193 ? -22.053 -20.029 -59.666 1.00 77.00 ? 193 ARG A HG2   1 
ATOM   3060  H  HG3   . ARG A 1 193 ? -22.260 -20.702 -61.093 1.00 77.00 ? 193 ARG A HG3   1 
ATOM   3061  H  HD2   . ARG A 1 193 ? -23.008 -18.450 -61.058 1.00 79.20 ? 193 ARG A HD2   1 
ATOM   3062  H  HD3   . ARG A 1 193 ? -24.178 -19.453 -61.447 1.00 79.20 ? 193 ARG A HD3   1 
ATOM   3063  H  HE    . ARG A 1 193 ? -25.237 -18.818 -59.647 1.00 85.91 ? 193 ARG A HE    1 
ATOM   3064  H  HH11  . ARG A 1 193 ? -22.091 -17.872 -59.181 1.00 79.24 ? 193 ARG A HH11  1 
ATOM   3065  H  HH12  . ARG A 1 193 ? -22.331 -17.122 -57.917 1.00 79.24 ? 193 ARG A HH12  1 
ATOM   3066  H  HH21  . ARG A 1 193 ? -25.588 -17.668 -57.725 1.00 78.25 ? 193 ARG A HH21  1 
ATOM   3067  H  HH22  . ARG A 1 193 ? -24.450 -16.999 -57.036 1.00 78.25 ? 193 ARG A HH22  1 
ATOM   3068  N  N     . ARG A 1 194 ? -21.199 -22.634 -61.492 1.00 42.06 ? 194 ARG A N     1 
ATOM   3069  C  CA    . ARG A 1 194 ? -20.497 -22.799 -62.756 1.00 46.35 ? 194 ARG A CA    1 
ATOM   3070  C  C     . ARG A 1 194 ? -20.542 -24.255 -63.266 1.00 51.79 ? 194 ARG A C     1 
ATOM   3071  O  O     . ARG A 1 194 ? -20.966 -24.499 -64.395 1.00 48.27 ? 194 ARG A O     1 
ATOM   3072  C  CB    . ARG A 1 194 ? -19.062 -22.306 -62.617 1.00 46.92 ? 194 ARG A CB    1 
ATOM   3073  C  CG    . ARG A 1 194 ? -18.249 -22.389 -63.879 1.00 59.32 ? 194 ARG A CG    1 
ATOM   3074  C  CD    . ARG A 1 194 ? -17.162 -21.314 -63.899 1.00 57.70 ? 194 ARG A CD    1 
ATOM   3075  N  NE    . ARG A 1 194 ? -16.045 -21.658 -64.779 1.00 65.70 ? 194 ARG A NE    1 
ATOM   3076  C  CZ    . ARG A 1 194 ? -16.143 -21.894 -66.091 1.00 66.77 ? 194 ARG A CZ    1 
ATOM   3077  N  NH1   . ARG A 1 194 ? -17.320 -21.843 -66.716 1.00 65.27 ? 194 ARG A NH1   1 
ATOM   3078  N  NH2   . ARG A 1 194 ? -15.050 -22.197 -66.786 1.00 63.16 ? 194 ARG A NH2   1 
ATOM   3079  H  H     . ARG A 1 194 ? -20.727 -22.262 -60.876 1.00 50.41 ? 194 ARG A H     1 
ATOM   3080  H  HA    . ARG A 1 194 ? -20.937 -22.239 -63.430 1.00 55.56 ? 194 ARG A HA    1 
ATOM   3081  H  HB2   . ARG A 1 194 ? -19.080 -21.377 -62.338 1.00 56.24 ? 194 ARG A HB2   1 
ATOM   3082  H  HB3   . ARG A 1 194 ? -18.615 -22.841 -61.943 1.00 56.24 ? 194 ARG A HB3   1 
ATOM   3083  H  HG2   . ARG A 1 194 ? -17.821 -23.257 -63.930 1.00 71.12 ? 194 ARG A HG2   1 
ATOM   3084  H  HG3   . ARG A 1 194 ? -18.829 -22.252 -64.645 1.00 71.12 ? 194 ARG A HG3   1 
ATOM   3085  H  HD2   . ARG A 1 194 ? -17.547 -20.481 -64.214 1.00 69.17 ? 194 ARG A HD2   1 
ATOM   3086  H  HD3   . ARG A 1 194 ? -16.813 -21.200 -63.001 1.00 69.17 ? 194 ARG A HD3   1 
ATOM   3087  H  HE    . ARG A 1 194 ? -15.264 -21.713 -64.425 1.00 78.78 ? 194 ARG A HE    1 
ATOM   3088  H  HH11  . ARG A 1 194 ? -18.033 -21.648 -66.276 1.00 78.27 ? 194 ARG A HH11  1 
ATOM   3089  H  HH12  . ARG A 1 194 ? -17.365 -21.999 -67.561 1.00 78.27 ? 194 ARG A HH12  1 
ATOM   3090  H  HH21  . ARG A 1 194 ? -14.286 -22.235 -66.391 1.00 75.73 ? 194 ARG A HH21  1 
ATOM   3091  H  HH22  . ARG A 1 194 ? -15.106 -22.354 -67.629 1.00 75.73 ? 194 ARG A HH22  1 
ATOM   3092  N  N     . LEU A 1 195 ? -20.116 -25.216 -62.445 1.00 43.87 ? 195 LEU A N     1 
ATOM   3093  C  CA    . LEU A 1 195 ? -20.291 -26.641 -62.775 1.00 41.71 ? 195 LEU A CA    1 
ATOM   3094  C  C     . LEU A 1 195 ? -21.764 -26.955 -63.044 1.00 43.92 ? 195 LEU A C     1 
ATOM   3095  O  O     . LEU A 1 195 ? -22.094 -27.639 -63.999 1.00 37.10 ? 195 LEU A O     1 
ATOM   3096  C  CB    . LEU A 1 195 ? -19.819 -27.538 -61.630 1.00 36.40 ? 195 LEU A CB    1 
ATOM   3097  C  CG    . LEU A 1 195 ? -18.322 -27.590 -61.397 1.00 43.34 ? 195 LEU A CG    1 
ATOM   3098  C  CD1   . LEU A 1 195 ? -18.078 -28.170 -60.024 1.00 44.06 ? 195 LEU A CD1   1 
ATOM   3099  C  CD2   . LEU A 1 195 ? -17.608 -28.398 -62.476 1.00 38.55 ? 195 LEU A CD2   1 
ATOM   3100  H  H     . LEU A 1 195 ? -19.724 -25.074 -61.693 1.00 52.58 ? 195 LEU A H     1 
ATOM   3101  H  HA    . LEU A 1 195 ? -19.773 -26.859 -63.578 1.00 49.99 ? 195 LEU A HA    1 
ATOM   3102  H  HB2   . LEU A 1 195 ? -20.229 -27.225 -60.809 1.00 43.62 ? 195 LEU A HB2   1 
ATOM   3103  H  HB3   . LEU A 1 195 ? -20.114 -28.444 -61.812 1.00 43.62 ? 195 LEU A HB3   1 
ATOM   3104  H  HG    . LEU A 1 195 ? -17.967 -26.687 -61.410 1.00 51.94 ? 195 LEU A HG    1 
ATOM   3105  H  HD11  . LEU A 1 195 ? -17.132 -28.207 -59.865 1.00 52.81 ? 195 LEU A HD11  1 
ATOM   3106  H  HD12  . LEU A 1 195 ? -18.498 -27.608 -59.369 1.00 52.81 ? 195 LEU A HD12  1 
ATOM   3107  H  HD13  . LEU A 1 195 ? -18.451 -29.053 -59.988 1.00 52.81 ? 195 LEU A HD13  1 
ATOM   3108  H  HD21  . LEU A 1 195 ? -17.770 -27.990 -63.330 1.00 46.20 ? 195 LEU A HD21  1 
ATOM   3109  H  HD22  . LEU A 1 195 ? -16.666 -28.404 -62.290 1.00 46.20 ? 195 LEU A HD22  1 
ATOM   3110  H  HD23  . LEU A 1 195 ? -17.949 -29.295 -62.472 1.00 46.20 ? 195 LEU A HD23  1 
ATOM   3111  N  N     . ASN A 1 196 ? -22.634 -26.459 -62.171 1.00 41.65 ? 196 ASN A N     1 
ATOM   3112  C  CA    . ASN A 1 196 ? -24.079 -26.616 -62.307 1.00 47.68 ? 196 ASN A CA    1 
ATOM   3113  C  C     . ASN A 1 196 ? -24.572 -26.114 -63.665 1.00 52.70 ? 196 ASN A C     1 
ATOM   3114  O  O     . ASN A 1 196 ? -25.430 -26.722 -64.301 1.00 46.20 ? 196 ASN A O     1 
ATOM   3115  C  CB    . ASN A 1 196 ? -24.776 -25.815 -61.213 1.00 51.71 ? 196 ASN A CB    1 
ATOM   3116  C  CG    . ASN A 1 196 ? -25.840 -26.607 -60.497 1.00 62.62 ? 196 ASN A CG    1 
ATOM   3117  O  OD1   . ASN A 1 196 ? -27.018 -26.573 -60.872 1.00 64.15 ? 196 ASN A OD1   1 
ATOM   3118  N  ND2   . ASN A 1 196 ? -25.438 -27.314 -59.443 1.00 57.57 ? 196 ASN A ND2   1 
ATOM   3119  H  H     . ASN A 1 196 ? -22.405 -26.014 -61.471 1.00 49.91 ? 196 ASN A H     1 
ATOM   3120  H  HA    . ASN A 1 196 ? -24.321 -27.561 -62.212 1.00 57.16 ? 196 ASN A HA    1 
ATOM   3121  H  HB2   . ASN A 1 196 ? -24.117 -25.536 -60.558 1.00 62.00 ? 196 ASN A HB2   1 
ATOM   3122  H  HB3   . ASN A 1 196 ? -25.198 -25.038 -61.611 1.00 62.00 ? 196 ASN A HB3   1 
ATOM   3123  H  HD21  . ASN A 1 196 ? -24.611 -27.301 -59.206 1.00 69.02 ? 196 ASN A HD21  1 
ATOM   3124  H  HD22  . ASN A 1 196 ? -26.005 -27.783 -58.998 1.00 69.02 ? 196 ASN A HD22  1 
ATOM   3125  N  N     . GLU A 1 197 ? -24.005 -24.991 -64.089 1.00 50.37 ? 197 GLU A N     1 
ATOM   3126  C  CA    . GLU A 1 197 ? -24.363 -24.355 -65.347 1.00 56.66 ? 197 GLU A CA    1 
ATOM   3127  C  C     . GLU A 1 197 ? -23.990 -25.255 -66.508 1.00 53.32 ? 197 GLU A C     1 
ATOM   3128  O  O     . GLU A 1 197 ? -24.584 -25.186 -67.583 1.00 50.76 ? 197 GLU A O     1 
ATOM   3129  C  CB    . GLU A 1 197 ? -23.606 -23.036 -65.494 1.00 53.98 ? 197 GLU A CB    1 
ATOM   3130  C  CG    . GLU A 1 197 ? -24.483 -21.807 -65.599 1.00 65.83 ? 197 GLU A CG    1 
ATOM   3131  C  CD    . GLU A 1 197 ? -23.668 -20.562 -65.902 1.00 69.48 ? 197 GLU A CD    1 
ATOM   3132  O  OE1   . GLU A 1 197 ? -22.417 -20.634 -65.808 1.00 68.61 ? 197 GLU A OE1   1 
ATOM   3133  O  OE2   . GLU A 1 197 ? -24.279 -19.527 -66.251 1.00 68.65 ? 197 GLU A OE2   1 
ATOM   3134  H  H     . GLU A 1 197 ? -23.395 -24.570 -63.654 1.00 60.38 ? 197 GLU A H     1 
ATOM   3135  H  HA    . GLU A 1 197 ? -25.327 -24.177 -65.374 1.00 67.94 ? 197 GLU A HA    1 
ATOM   3136  H  HB2   . GLU A 1 197 ? -23.032 -22.922 -64.720 1.00 64.71 ? 197 GLU A HB2   1 
ATOM   3137  H  HB3   . GLU A 1 197 ? -23.064 -23.079 -66.297 1.00 64.71 ? 197 GLU A HB3   1 
ATOM   3138  H  HG2   . GLU A 1 197 ? -25.124 -21.932 -66.315 1.00 78.94 ? 197 GLU A HG2   1 
ATOM   3139  H  HG3   . GLU A 1 197 ? -24.944 -21.670 -64.756 1.00 78.94 ? 197 GLU A HG3   1 
ATOM   3140  N  N     . LEU A 1 198 ? -22.994 -26.097 -66.285 1.00 41.93 ? 198 LEU A N     1 
ATOM   3141  C  CA    . LEU A 1 198 ? -22.505 -26.981 -67.320 1.00 36.27 ? 198 LEU A CA    1 
ATOM   3142  C  C     . LEU A 1 198 ? -23.106 -28.388 -67.220 1.00 31.25 ? 198 LEU A C     1 
ATOM   3143  O  O     . LEU A 1 198 ? -22.617 -29.337 -67.849 1.00 33.40 ? 198 LEU A O     1 
ATOM   3144  C  CB    . LEU A 1 198 ? -20.979 -26.997 -67.280 1.00 46.06 ? 198 LEU A CB    1 
ATOM   3145  C  CG    . LEU A 1 198 ? -20.382 -25.604 -67.502 1.00 47.05 ? 198 LEU A CG    1 
ATOM   3146  C  CD1   . LEU A 1 198 ? -18.904 -25.595 -67.183 1.00 53.14 ? 198 LEU A CD1   1 
ATOM   3147  C  CD2   . LEU A 1 198 ? -20.612 -25.173 -68.937 1.00 53.66 ? 198 LEU A CD2   1 
ATOM   3148  H  H     . LEU A 1 198 ? -22.582 -26.174 -65.534 1.00 50.26 ? 198 LEU A H     1 
ATOM   3149  H  HA    . LEU A 1 198 ? -22.769 -26.613 -68.189 1.00 43.46 ? 198 LEU A HA    1 
ATOM   3150  H  HB2   . LEU A 1 198 ? -20.687 -27.317 -66.412 1.00 55.21 ? 198 LEU A HB2   1 
ATOM   3151  H  HB3   . LEU A 1 198 ? -20.649 -27.583 -67.980 1.00 55.21 ? 198 LEU A HB3   1 
ATOM   3152  H  HG    . LEU A 1 198 ? -20.824 -24.968 -66.918 1.00 56.40 ? 198 LEU A HG    1 
ATOM   3153  H  HD11  . LEU A 1 198 ? -18.782 -25.846 -66.264 1.00 63.71 ? 198 LEU A HD11  1 
ATOM   3154  H  HD12  . LEU A 1 198 ? -18.457 -26.223 -67.756 1.00 63.71 ? 198 LEU A HD12  1 
ATOM   3155  H  HD13  . LEU A 1 198 ? -18.558 -24.712 -67.331 1.00 63.71 ? 198 LEU A HD13  1 
ATOM   3156  H  HD21  . LEU A 1 198 ? -20.188 -25.802 -69.524 1.00 64.33 ? 198 LEU A HD21  1 
ATOM   3157  H  HD22  . LEU A 1 198 ? -21.556 -25.149 -69.108 1.00 64.33 ? 198 LEU A HD22  1 
ATOM   3158  H  HD23  . LEU A 1 198 ? -20.234 -24.299 -69.065 1.00 64.33 ? 198 LEU A HD23  1 
ATOM   3159  N  N     . GLY A 1 199 ? -24.176 -28.509 -66.446 1.00 29.78 ? 199 GLY A N     1 
ATOM   3160  C  CA    . GLY A 1 199 ? -24.909 -29.765 -66.321 1.00 41.00 ? 199 GLY A CA    1 
ATOM   3161  C  C     . GLY A 1 199 ? -24.333 -30.739 -65.303 1.00 40.43 ? 199 GLY A C     1 
ATOM   3162  O  O     . GLY A 1 199 ? -24.724 -31.902 -65.242 1.00 32.25 ? 199 GLY A O     1 
ATOM   3163  H  H     . GLY A 1 199 ? -24.504 -27.869 -65.975 1.00 35.68 ? 199 GLY A H     1 
ATOM   3164  H  HA2   . GLY A 1 199 ? -25.825 -29.572 -66.065 1.00 49.14 ? 199 GLY A HA2   1 
ATOM   3165  H  HA3   . GLY A 1 199 ? -24.925 -30.209 -67.183 1.00 49.14 ? 199 GLY A HA3   1 
ATOM   3166  N  N     . ILE A 1 200 ? -23.399 -30.254 -64.496 1.00 34.06 ? 200 ILE A N     1 
ATOM   3167  C  CA    . ILE A 1 200 ? -22.814 -31.060 -63.437 1.00 37.36 ? 200 ILE A CA    1 
ATOM   3168  C  C     . ILE A 1 200 ? -23.535 -30.709 -62.129 1.00 36.83 ? 200 ILE A C     1 
ATOM   3169  O  O     . ILE A 1 200 ? -23.243 -29.708 -61.479 1.00 38.13 ? 200 ILE A O     1 
ATOM   3170  C  CB    . ILE A 1 200 ? -21.307 -30.859 -63.411 1.00 38.32 ? 200 ILE A CB    1 
ATOM   3171  C  CG1   . ILE A 1 200 ? -20.751 -31.185 -64.798 1.00 42.00 ? 200 ILE A CG1   1 
ATOM   3172  C  CG2   . ILE A 1 200 ? -20.647 -31.771 -62.379 1.00 38.65 ? 200 ILE A CG2   1 
ATOM   3173  C  CD1   . ILE A 1 200 ? -19.299 -30.857 -64.994 1.00 41.18 ? 200 ILE A CD1   1 
ATOM   3174  H  H     . ILE A 1 200 ? -23.085 -29.454 -64.542 1.00 40.82 ? 200 ILE A H     1 
ATOM   3175  H  HA    . ILE A 1 200 ? -22.986 -32.006 -63.629 1.00 44.77 ? 200 ILE A HA    1 
ATOM   3176  H  HB    . ILE A 1 200 ? -21.110 -29.934 -63.196 1.00 45.92 ? 200 ILE A HB    1 
ATOM   3177  H  HG12  . ILE A 1 200 ? -20.860 -32.135 -64.959 1.00 50.33 ? 200 ILE A HG12  1 
ATOM   3178  H  HG13  . ILE A 1 200 ? -21.255 -30.684 -65.459 1.00 50.33 ? 200 ILE A HG13  1 
ATOM   3179  H  HG21  . ILE A 1 200 ? -20.835 -32.685 -62.605 1.00 46.32 ? 200 ILE A HG21  1 
ATOM   3180  H  HG22  . ILE A 1 200 ? -19.699 -31.619 -62.389 1.00 46.32 ? 200 ILE A HG22  1 
ATOM   3181  H  HG23  . ILE A 1 200 ? -21.003 -31.568 -61.511 1.00 46.32 ? 200 ILE A HG23  1 
ATOM   3182  H  HD11  . ILE A 1 200 ? -19.170 -29.916 -64.856 1.00 49.35 ? 200 ILE A HD11  1 
ATOM   3183  H  HD12  . ILE A 1 200 ? -18.778 -31.356 -64.360 1.00 49.35 ? 200 ILE A HD12  1 
ATOM   3184  H  HD13  . ILE A 1 200 ? -19.043 -31.095 -65.888 1.00 49.35 ? 200 ILE A HD13  1 
ATOM   3185  N  N     . GLN A 1 201 ? -24.540 -31.517 -61.805 1.00 32.42 ? 201 GLN A N     1 
ATOM   3186  C  CA    . GLN A 1 201 ? -25.413 -31.273 -60.663 1.00 43.96 ? 201 GLN A CA    1 
ATOM   3187  C  C     . GLN A 1 201 ? -25.082 -32.242 -59.523 1.00 46.03 ? 201 GLN A C     1 
ATOM   3188  O  O     . GLN A 1 201 ? -25.354 -31.968 -58.360 1.00 39.86 ? 201 GLN A O     1 
ATOM   3189  C  CB    . GLN A 1 201 ? -26.887 -31.466 -61.047 1.00 45.15 ? 201 GLN A CB    1 
ATOM   3190  C  CG    . GLN A 1 201 ? -27.339 -30.840 -62.390 1.00 53.36 ? 201 GLN A CG    1 
ATOM   3191  C  CD    . GLN A 1 201 ? -27.599 -29.335 -62.322 1.00 64.07 ? 201 GLN A CD    1 
ATOM   3192  O  OE1   . GLN A 1 201 ? -26.924 -28.551 -62.997 1.00 68.83 ? 201 GLN A OE1   1 
ATOM   3193  N  NE2   . GLN A 1 201 ? -28.598 -28.927 -61.531 1.00 62.71 ? 201 GLN A NE2   1 
ATOM   3194  H  H     . GLN A 1 201 ? -24.739 -32.230 -62.243 1.00 38.84 ? 201 GLN A H     1 
ATOM   3195  H  HA    . GLN A 1 201 ? -25.289 -30.355 -60.342 1.00 52.69 ? 201 GLN A HA    1 
ATOM   3196  H  HB2   . GLN A 1 201 ? -27.064 -32.418 -61.100 1.00 54.12 ? 201 GLN A HB2   1 
ATOM   3197  H  HB3   . GLN A 1 201 ? -27.436 -31.076 -60.348 1.00 54.12 ? 201 GLN A HB3   1 
ATOM   3198  H  HG2   . GLN A 1 201 ? -26.647 -30.990 -63.052 1.00 63.98 ? 201 GLN A HG2   1 
ATOM   3199  H  HG3   . GLN A 1 201 ? -28.162 -31.269 -62.672 1.00 63.98 ? 201 GLN A HG3   1 
ATOM   3200  H  HE21  . GLN A 1 201 ? -29.059 -29.503 -61.090 1.00 75.19 ? 201 GLN A HE21  1 
ATOM   3201  H  HE22  . GLN A 1 201 ? -28.778 -28.089 -61.464 1.00 75.19 ? 201 GLN A HE22  1 
ATOM   3202  N  N     . LYS A 1 202 ? -24.519 -33.386 -59.880 1.00 30.88 ? 202 LYS A N     1 
ATOM   3203  C  CA    . LYS A 1 202 ? -24.253 -34.442 -58.922 1.00 36.98 ? 202 LYS A CA    1 
ATOM   3204  C  C     . LYS A 1 202 ? -22.826 -34.901 -59.087 1.00 34.46 ? 202 LYS A C     1 
ATOM   3205  O  O     . LYS A 1 202 ? -22.245 -34.804 -60.176 1.00 27.16 ? 202 LYS A O     1 
ATOM   3206  C  CB    . LYS A 1 202 ? -25.220 -35.611 -59.125 1.00 41.99 ? 202 LYS A CB    1 
ATOM   3207  C  CG    . LYS A 1 202 ? -26.490 -35.508 -58.279 1.00 42.10 ? 202 LYS A CG    1 
ATOM   3208  C  CD    . LYS A 1 202 ? -27.454 -36.643 -58.563 1.00 54.48 ? 202 LYS A CD    1 
ATOM   3209  C  CE    . LYS A 1 202 ? -28.205 -37.085 -57.316 1.00 55.72 ? 202 LYS A CE    1 
ATOM   3210  N  NZ    . LYS A 1 202 ? -28.889 -35.965 -56.589 1.00 58.15 ? 202 LYS A NZ    1 
ATOM   3211  H  H     . LYS A 1 202 ? -24.278 -33.576 -60.684 1.00 36.99 ? 202 LYS A H     1 
ATOM   3212  H  HA    . LYS A 1 202 ? -24.367 -34.096 -58.012 1.00 44.31 ? 202 LYS A HA    1 
ATOM   3213  H  HB2   . LYS A 1 202 ? -25.485 -35.641 -60.057 1.00 50.33 ? 202 LYS A HB2   1 
ATOM   3214  H  HB3   . LYS A 1 202 ? -24.769 -36.436 -58.884 1.00 50.33 ? 202 LYS A HB3   1 
ATOM   3215  H  HG2   . LYS A 1 202 ? -26.252 -35.542 -57.340 1.00 50.46 ? 202 LYS A HG2   1 
ATOM   3216  H  HG3   . LYS A 1 202 ? -26.940 -34.672 -58.480 1.00 50.46 ? 202 LYS A HG3   1 
ATOM   3217  H  HD2   . LYS A 1 202 ? -28.105 -36.350 -59.220 1.00 65.32 ? 202 LYS A HD2   1 
ATOM   3218  H  HD3   . LYS A 1 202 ? -26.957 -37.404 -58.902 1.00 65.32 ? 202 LYS A HD3   1 
ATOM   3219  H  HE2   . LYS A 1 202 ? -28.883 -37.730 -57.571 1.00 66.81 ? 202 LYS A HE2   1 
ATOM   3220  H  HE3   . LYS A 1 202 ? -27.576 -37.495 -56.701 1.00 66.81 ? 202 LYS A HE3   1 
ATOM   3221  H  HZ1   . LYS A 1 202 ? -28.291 -35.359 -56.330 1.00 69.72 ? 202 LYS A HZ1   1 
ATOM   3222  H  HZ2   . LYS A 1 202 ? -29.483 -35.574 -57.125 1.00 69.72 ? 202 LYS A HZ2   1 
ATOM   3223  H  HZ3   . LYS A 1 202 ? -29.311 -36.281 -55.872 1.00 69.72 ? 202 LYS A HZ3   1 
ATOM   3224  N  N     . LEU A 1 203 ? -22.245 -35.405 -58.004 1.00 31.01 ? 203 LEU A N     1 
ATOM   3225  C  CA    . LEU A 1 203 ? -20.852 -35.823 -58.048 1.00 25.93 ? 203 LEU A CA    1 
ATOM   3226  C  C     . LEU A 1 203 ? -20.615 -36.801 -59.216 1.00 20.12 ? 203 LEU A C     1 
ATOM   3227  O  O     . LEU A 1 203 ? -19.645 -36.667 -59.965 1.00 29.99 ? 203 LEU A O     1 
ATOM   3228  C  CB    . LEU A 1 203 ? -20.461 -36.479 -56.718 1.00 21.70 ? 203 LEU A CB    1 
ATOM   3229  C  CG    . LEU A 1 203 ? -19.039 -37.064 -56.669 1.00 26.27 ? 203 LEU A CG    1 
ATOM   3230  C  CD1   . LEU A 1 203 ? -17.970 -36.021 -56.942 1.00 30.01 ? 203 LEU A CD1   1 
ATOM   3231  C  CD2   . LEU A 1 203 ? -18.819 -37.714 -55.325 1.00 31.51 ? 203 LEU A CD2   1 
ATOM   3232  H  H     . LEU A 1 203 ? -22.630 -35.514 -57.243 1.00 37.15 ? 203 LEU A H     1 
ATOM   3233  H  HA    . LEU A 1 203 ? -20.282 -35.038 -58.184 1.00 31.06 ? 203 LEU A HA    1 
ATOM   3234  H  HB2   . LEU A 1 203 ? -20.526 -35.813 -56.016 1.00 25.97 ? 203 LEU A HB2   1 
ATOM   3235  H  HB3   . LEU A 1 203 ? -21.081 -37.202 -56.538 1.00 25.97 ? 203 LEU A HB3   1 
ATOM   3236  H  HG    . LEU A 1 203 ? -18.961 -37.753 -57.348 1.00 31.46 ? 203 LEU A HG    1 
ATOM   3237  H  HD11  . LEU A 1 203 ? -18.111 -35.650 -57.816 1.00 35.95 ? 203 LEU A HD11  1 
ATOM   3238  H  HD12  . LEU A 1 203 ? -18.032 -35.330 -56.278 1.00 35.95 ? 203 LEU A HD12  1 
ATOM   3239  H  HD13  . LEU A 1 203 ? -17.107 -36.440 -56.899 1.00 35.95 ? 203 LEU A HD13  1 
ATOM   3240  H  HD21  . LEU A 1 203 ? -19.465 -38.415 -55.207 1.00 37.75 ? 203 LEU A HD21  1 
ATOM   3241  H  HD22  . LEU A 1 203 ? -17.931 -38.079 -55.297 1.00 37.75 ? 203 LEU A HD22  1 
ATOM   3242  H  HD23  . LEU A 1 203 ? -18.923 -37.053 -54.637 1.00 37.75 ? 203 LEU A HD23  1 
ATOM   3243  N  N     . ARG A 1 204 ? -21.510 -37.765 -59.370 1.00 29.13 ? 204 ARG A N     1 
ATOM   3244  C  CA    . ARG A 1 204 ? -21.354 -38.776 -60.428 1.00 33.47 ? 204 ARG A CA    1 
ATOM   3245  C  C     . ARG A 1 204 ? -21.231 -38.128 -61.823 1.00 30.68 ? 204 ARG A C     1 
ATOM   3246  O  O     . ARG A 1 204 ? -20.634 -38.699 -62.737 1.00 30.18 ? 204 ARG A O     1 
ATOM   3247  C  CB    . ARG A 1 204 ? -22.525 -39.784 -60.389 1.00 36.07 ? 204 ARG A CB    1 
ATOM   3248  C  CG    . ARG A 1 204 ? -23.906 -39.172 -60.724 1.00 42.93 ? 204 ARG A CG    1 
ATOM   3249  C  CD    . ARG A 1 204 ? -25.051 -40.207 -60.765 1.00 50.20 ? 204 ARG A CD    1 
ATOM   3250  N  NE    . ARG A 1 204 ? -26.298 -39.621 -61.281 1.00 56.16 ? 204 ARG A NE    1 
ATOM   3251  C  CZ    . ARG A 1 204 ? -27.428 -39.455 -60.585 1.00 57.81 ? 204 ARG A CZ    1 
ATOM   3252  N  NH1   . ARG A 1 204 ? -27.529 -39.838 -59.314 1.00 56.59 ? 204 ARG A NH1   1 
ATOM   3253  N  NH2   . ARG A 1 204 ? -28.480 -38.899 -61.171 1.00 60.33 ? 204 ARG A NH2   1 
ATOM   3254  H  H     . ARG A 1 204 ? -22.214 -37.863 -58.885 1.00 34.89 ? 204 ARG A H     1 
ATOM   3255  H  HA    . ARG A 1 204 ? -20.527 -39.276 -60.261 1.00 40.11 ? 204 ARG A HA    1 
ATOM   3256  H  HB2   . ARG A 1 204 ? -22.350 -40.488 -61.033 1.00 43.22 ? 204 ARG A HB2   1 
ATOM   3257  H  HB3   . ARG A 1 204 ? -22.579 -40.163 -59.497 1.00 43.22 ? 204 ARG A HB3   1 
ATOM   3258  H  HG2   . ARG A 1 204 ? -24.128 -38.511 -60.049 1.00 51.45 ? 204 ARG A HG2   1 
ATOM   3259  H  HG3   . ARG A 1 204 ? -23.858 -38.749 -61.595 1.00 51.45 ? 204 ARG A HG3   1 
ATOM   3260  H  HD2   . ARG A 1 204 ? -24.797 -40.941 -61.346 1.00 60.18 ? 204 ARG A HD2   1 
ATOM   3261  H  HD3   . ARG A 1 204 ? -25.218 -40.534 -59.867 1.00 60.18 ? 204 ARG A HD3   1 
ATOM   3262  H  HE    . ARG A 1 204 ? -26.301 -39.363 -62.102 1.00 67.33 ? 204 ARG A HE    1 
ATOM   3263  H  HH11  . ARG A 1 204 ? -26.855 -40.197 -58.918 1.00 67.84 ? 204 ARG A HH11  1 
ATOM   3264  H  HH12  . ARG A 1 204 ? -28.266 -39.723 -58.887 1.00 67.84 ? 204 ARG A HH12  1 
ATOM   3265  H  HH21  . ARG A 1 204 ? -28.432 -38.649 -61.992 1.00 72.33 ? 204 ARG A HH21  1 
ATOM   3266  H  HH22  . ARG A 1 204 ? -29.212 -38.795 -60.731 1.00 72.33 ? 204 ARG A HH22  1 
ATOM   3267  N  N     . ASP A 1 205 ? -21.779 -36.928 -61.982 1.00 29.93 ? 205 ASP A N     1 
ATOM   3268  C  CA    . ASP A 1 205 ? -21.736 -36.242 -63.279 1.00 27.81 ? 205 ASP A CA    1 
ATOM   3269  C  C     . ASP A 1 205 ? -20.320 -35.859 -63.686 1.00 41.69 ? 205 ASP A C     1 
ATOM   3270  O  O     . ASP A 1 205 ? -20.076 -35.556 -64.849 1.00 32.71 ? 205 ASP A O     1 
ATOM   3271  C  CB    . ASP A 1 205 ? -22.629 -34.984 -63.257 1.00 36.64 ? 205 ASP A CB    1 
ATOM   3272  C  CG    . ASP A 1 205 ? -24.118 -35.309 -63.123 1.00 38.56 ? 205 ASP A CG    1 
ATOM   3273  O  OD1   . ASP A 1 205 ? -24.533 -36.436 -63.495 1.00 39.24 ? 205 ASP A OD1   1 
ATOM   3274  O  OD2   . ASP A 1 205 ? -24.884 -34.433 -62.657 1.00 34.07 ? 205 ASP A OD2   1 
ATOM   3275  H  H     . ASP A 1 205 ? -22.180 -36.488 -61.362 1.00 35.85 ? 205 ASP A H     1 
ATOM   3276  H  HA    . ASP A 1 205 ? -22.090 -36.846 -63.965 1.00 33.32 ? 205 ASP A HA    1 
ATOM   3277  H  HB2   . ASP A 1 205 ? -22.375 -34.430 -62.502 1.00 43.91 ? 205 ASP A HB2   1 
ATOM   3278  H  HB3   . ASP A 1 205 ? -22.503 -34.494 -64.085 1.00 43.91 ? 205 ASP A HB3   1 
ATOM   3279  N  N     . ILE A 1 206 ? -19.390 -35.865 -62.723 1.00 32.92 ? 206 ILE A N     1 
ATOM   3280  C  CA    . ILE A 1 206 ? -17.990 -35.547 -62.974 1.00 33.88 ? 206 ILE A CA    1 
ATOM   3281  C  C     . ILE A 1 206 ? -17.390 -36.584 -63.878 1.00 33.91 ? 206 ILE A C     1 
ATOM   3282  O  O     . ILE A 1 206 ? -16.494 -36.292 -64.660 1.00 35.63 ? 206 ILE A O     1 
ATOM   3283  C  CB    . ILE A 1 206 ? -17.173 -35.522 -61.617 1.00 27.65 ? 206 ILE A CB    1 
ATOM   3284  C  CG1   . ILE A 1 206 ? -17.587 -34.309 -60.785 1.00 35.94 ? 206 ILE A CG1   1 
ATOM   3285  C  CG2   . ILE A 1 206 ? -15.693 -35.478 -61.854 1.00 30.65 ? 206 ILE A CG2   1 
ATOM   3286  C  CD1   . ILE A 1 206 ? -17.353 -32.985 -61.476 1.00 38.04 ? 206 ILE A CD1   1 
ATOM   3287  H  H     . ILE A 1 206 ? -19.556 -36.056 -61.901 1.00 39.44 ? 206 ILE A H     1 
ATOM   3288  H  HA    . ILE A 1 206 ? -17.919 -34.670 -63.405 1.00 40.59 ? 206 ILE A HA    1 
ATOM   3289  H  HB    . ILE A 1 206 ? -17.381 -36.326 -61.116 1.00 33.12 ? 206 ILE A HB    1 
ATOM   3290  H  HG12  . ILE A 1 206 ? -18.534 -34.376 -60.585 1.00 43.07 ? 206 ILE A HG12  1 
ATOM   3291  H  HG13  . ILE A 1 206 ? -17.076 -34.307 -59.960 1.00 43.07 ? 206 ILE A HG13  1 
ATOM   3292  H  HG21  . ILE A 1 206 ? -15.480 -34.686 -62.352 1.00 36.72 ? 206 ILE A HG21  1 
ATOM   3293  H  HG22  . ILE A 1 206 ? -15.241 -35.464 -61.007 1.00 36.72 ? 206 ILE A HG22  1 
ATOM   3294  H  HG23  . ILE A 1 206 ? -15.433 -36.257 -62.351 1.00 36.72 ? 206 ILE A HG23  1 
ATOM   3295  H  HD11  . ILE A 1 206 ? -17.862 -32.964 -62.291 1.00 45.59 ? 206 ILE A HD11  1 
ATOM   3296  H  HD12  . ILE A 1 206 ? -17.636 -32.275 -60.895 1.00 45.59 ? 206 ILE A HD12  1 
ATOM   3297  H  HD13  . ILE A 1 206 ? -16.418 -32.895 -61.671 1.00 45.59 ? 206 ILE A HD13  1 
ATOM   3298  N  N     . LEU A 1 207 ? -17.862 -37.815 -63.742 1.00 33.12 ? 207 LEU A N     1 
ATOM   3299  C  CA    . LEU A 1 207 ? -17.286 -38.930 -64.486 1.00 41.09 ? 207 LEU A CA    1 
ATOM   3300  C  C     . LEU A 1 207 ? -17.480 -38.759 -65.996 1.00 46.29 ? 207 LEU A C     1 
ATOM   3301  O  O     . LEU A 1 207 ? -16.728 -39.317 -66.787 1.00 53.75 ? 207 LEU A O     1 
ATOM   3302  C  CB    . LEU A 1 207 ? -17.910 -40.234 -64.019 1.00 36.65 ? 207 LEU A CB    1 
ATOM   3303  C  CG    . LEU A 1 207 ? -17.667 -40.542 -62.534 1.00 47.11 ? 207 LEU A CG    1 
ATOM   3304  C  CD1   . LEU A 1 207 ? -18.493 -41.744 -62.066 1.00 36.86 ? 207 LEU A CD1   1 
ATOM   3305  C  CD2   . LEU A 1 207 ? -16.188 -40.766 -62.273 1.00 44.28 ? 207 LEU A CD2   1 
ATOM   3306  H  H     . LEU A 1 207 ? -18.514 -38.034 -63.225 1.00 39.68 ? 207 LEU A H     1 
ATOM   3307  H  HA    . LEU A 1 207 ? -16.324 -38.971 -64.306 1.00 49.24 ? 207 LEU A HA    1 
ATOM   3308  H  HB2   . LEU A 1 207 ? -18.869 -40.189 -64.159 1.00 43.92 ? 207 LEU A HB2   1 
ATOM   3309  H  HB3   . LEU A 1 207 ? -17.536 -40.963 -64.538 1.00 43.92 ? 207 LEU A HB3   1 
ATOM   3310  H  HG    . LEU A 1 207 ? -17.944 -39.774 -62.010 1.00 56.47 ? 207 LEU A HG    1 
ATOM   3311  H  HD11  . LEU A 1 207 ? -18.313 -41.903 -61.136 1.00 44.17 ? 207 LEU A HD11  1 
ATOM   3312  H  HD12  . LEU A 1 207 ? -19.425 -41.549 -62.190 1.00 44.17 ? 207 LEU A HD12  1 
ATOM   3313  H  HD13  . LEU A 1 207 ? -18.247 -42.513 -62.584 1.00 44.17 ? 207 LEU A HD13  1 
ATOM   3314  H  HD21  . LEU A 1 207 ? -16.062 -40.956 -61.340 1.00 53.08 ? 207 LEU A HD21  1 
ATOM   3315  H  HD22  . LEU A 1 207 ? -15.886 -41.507 -62.803 1.00 53.08 ? 207 LEU A HD22  1 
ATOM   3316  H  HD23  . LEU A 1 207 ? -15.705 -39.972 -62.513 1.00 53.08 ? 207 LEU A HD23  1 
ATOM   3317  N  N     . SER A 1 208 ? -18.479 -37.968 -66.378 1.00 43.62 ? 208 SER A N     1 
ATOM   3318  C  CA    . SER A 1 208 ? -18.777 -37.701 -67.784 1.00 55.57 ? 208 SER A CA    1 
ATOM   3319  C  C     . SER A 1 208 ? -17.666 -36.888 -68.431 1.00 58.52 ? 208 SER A C     1 
ATOM   3320  O  O     . SER A 1 208 ? -17.344 -37.093 -69.600 1.00 60.14 ? 208 SER A O     1 
ATOM   3321  C  CB    . SER A 1 208 ? -20.093 -36.935 -67.910 1.00 54.47 ? 208 SER A CB    1 
ATOM   3322  O  OG    . SER A 1 208 ? -19.921 -35.571 -67.535 1.00 57.51 ? 208 SER A OG    1 
ATOM   3323  H  H     . SER A 1 208 ? -19.009 -37.566 -65.832 1.00 52.29 ? 208 SER A H     1 
ATOM   3324  H  HA    . SER A 1 208 ? -18.864 -38.550 -68.266 1.00 66.62 ? 208 SER A HA    1 
ATOM   3325  H  HB2   . SER A 1 208 ? -20.394 -36.974 -68.831 1.00 65.30 ? 208 SER A HB2   1 
ATOM   3326  H  HB3   . SER A 1 208 ? -20.753 -37.342 -67.327 1.00 65.30 ? 208 SER A HB3   1 
ATOM   3327  H  HG    . SER A 1 208 ? -20.632 -35.169 -67.606 1.00 68.96 ? 208 SER A HG    1 
ATOM   3328  N  N     . LYS A 1 209 ? -17.090 -35.955 -67.678 1.00 51.60 ? 209 LYS A N     1 
ATOM   3329  C  CA    . LYS A 1 209 ? -15.987 -35.148 -68.186 1.00 52.80 ? 209 LYS A CA    1 
ATOM   3330  C  C     . LYS A 1 209 ? -14.638 -35.820 -67.918 1.00 52.10 ? 209 LYS A C     1 
ATOM   3331  O  O     . LYS A 1 209 ? -14.524 -36.692 -67.056 1.00 56.52 ? 209 LYS A O     1 
ATOM   3332  C  CB    . LYS A 1 209 ? -16.011 -33.747 -67.558 1.00 54.56 ? 209 LYS A CB    1 
ATOM   3333  C  CG    . LYS A 1 209 ? -17.253 -32.917 -67.891 1.00 57.59 ? 209 LYS A CG    1 
ATOM   3334  C  CD    . LYS A 1 209 ? -17.280 -32.506 -69.362 1.00 64.09 ? 209 LYS A CD    1 
ATOM   3335  C  CE    . LYS A 1 209 ? -18.544 -31.725 -69.717 1.00 63.81 ? 209 LYS A CE    1 
ATOM   3336  N  NZ    . LYS A 1 209 ? -18.590 -30.363 -69.101 1.00 65.24 ? 209 LYS A NZ    1 
ATOM   3337  H  H     . LYS A 1 209 ? -17.321 -35.770 -66.870 1.00 61.86 ? 209 LYS A H     1 
ATOM   3338  H  HA    . LYS A 1 209 ? -16.086 -35.046 -69.156 1.00 63.30 ? 209 LYS A HA    1 
ATOM   3339  H  HB2   . LYS A 1 209 ? -15.970 -33.840 -66.593 1.00 65.41 ? 209 LYS A HB2   1 
ATOM   3340  H  HB3   . LYS A 1 209 ? -15.236 -33.254 -67.871 1.00 65.41 ? 209 LYS A HB3   1 
ATOM   3341  H  HG2   . LYS A 1 209 ? -18.047 -33.444 -67.709 1.00 69.05 ? 209 LYS A HG2   1 
ATOM   3342  H  HG3   . LYS A 1 209 ? -17.253 -32.112 -67.351 1.00 69.05 ? 209 LYS A HG3   1 
ATOM   3343  H  HD2   . LYS A 1 209 ? -16.513 -31.941 -69.548 1.00 76.84 ? 209 LYS A HD2   1 
ATOM   3344  H  HD3   . LYS A 1 209 ? -17.250 -33.302 -69.915 1.00 76.84 ? 209 LYS A HD3   1 
ATOM   3345  H  HE2   . LYS A 1 209 ? -18.587 -31.619 -70.680 1.00 76.51 ? 209 LYS A HE2   1 
ATOM   3346  H  HE3   . LYS A 1 209 ? -19.317 -32.220 -69.404 1.00 76.51 ? 209 LYS A HE3   1 
ATOM   3347  H  HZ1   . LYS A 1 209 ? -17.896 -29.881 -69.378 1.00 78.23 ? 209 LYS A HZ1   1 
ATOM   3348  H  HZ2   . LYS A 1 209 ? -19.342 -29.949 -69.336 1.00 78.23 ? 209 LYS A HZ2   1 
ATOM   3349  H  HZ3   . LYS A 1 209 ? -18.561 -30.429 -68.214 1.00 78.23 ? 209 LYS A HZ3   1 
ATOM   3350  N  N     . ASN A 1 210 ? -13.616 -35.416 -68.667 1.00 52.97 ? 210 ASN A N     1 
ATOM   3351  C  CA    . ASN A 1 210 ? -12.257 -35.884 -68.431 1.00 55.76 ? 210 ASN A CA    1 
ATOM   3352  C  C     . ASN A 1 210 ? -11.428 -34.754 -67.813 1.00 61.11 ? 210 ASN A C     1 
ATOM   3353  O  O     . ASN A 1 210 ? -11.908 -33.622 -67.677 1.00 53.71 ? 210 ASN A O     1 
ATOM   3354  C  CB    . ASN A 1 210 ? -11.624 -36.399 -69.728 1.00 63.68 ? 210 ASN A CB    1 
ATOM   3355  C  CG    . ASN A 1 210 ? -10.907 -35.309 -70.521 1.00 70.79 ? 210 ASN A CG    1 
ATOM   3356  O  OD1   . ASN A 1 210 ? -11.131 -34.114 -70.319 1.00 67.04 ? 210 ASN A OD1   1 
ATOM   3357  N  ND2   . ASN A 1 210 ? -10.049 -35.728 -71.446 1.00 69.81 ? 210 ASN A ND2   1 
ATOM   3358  H  H     . ASN A 1 210 ? -13.686 -34.865 -69.324 1.00 63.50 ? 210 ASN A H     1 
ATOM   3359  H  HA    . ASN A 1 210 ? -12.281 -36.626 -67.792 1.00 66.86 ? 210 ASN A HA    1 
ATOM   3360  H  HB2   . ASN A 1 210 ? -10.975 -37.086 -69.511 1.00 76.35 ? 210 ASN A HB2   1 
ATOM   3361  H  HB3   . ASN A 1 210 ? -12.321 -36.769 -70.293 1.00 76.35 ? 210 ASN A HB3   1 
ATOM   3362  H  HD21  . ASN A 1 210 ? -9.926  -36.571 -71.568 1.00 83.71 ? 210 ASN A HD21  1 
ATOM   3363  H  HD22  . ASN A 1 210 ? -9.617  -35.157 -71.922 1.00 83.71 ? 210 ASN A HD22  1 
ATOM   3364  N  N     . TYR A 1 211 ? -10.191 -35.045 -67.434 1.00 48.80 ? 211 TYR A N     1 
ATOM   3365  C  CA    . TYR A 1 211 ? -9.413  -34.066 -66.686 1.00 57.33 ? 211 TYR A CA    1 
ATOM   3366  C  C     . TYR A 1 211 ? -9.198  -32.739 -67.440 1.00 60.05 ? 211 TYR A C     1 
ATOM   3367  O  O     . TYR A 1 211 ? -9.500  -31.666 -66.911 1.00 45.35 ? 211 TYR A O     1 
ATOM   3368  C  CB    . TYR A 1 211 ? -8.080  -34.649 -66.247 1.00 51.59 ? 211 TYR A CB    1 
ATOM   3369  C  CG    . TYR A 1 211 ? -7.178  -33.591 -65.687 1.00 63.28 ? 211 TYR A CG    1 
ATOM   3370  C  CD1   . TYR A 1 211 ? -7.453  -33.004 -64.459 1.00 60.45 ? 211 TYR A CD1   1 
ATOM   3371  C  CD2   . TYR A 1 211 ? -6.069  -33.145 -66.399 1.00 60.54 ? 211 TYR A CD2   1 
ATOM   3372  C  CE1   . TYR A 1 211 ? -6.641  -32.013 -63.944 1.00 54.74 ? 211 TYR A CE1   1 
ATOM   3373  C  CE2   . TYR A 1 211 ? -5.251  -32.150 -65.893 1.00 56.13 ? 211 TYR A CE2   1 
ATOM   3374  C  CZ    . TYR A 1 211 ? -5.545  -31.590 -64.662 1.00 58.71 ? 211 TYR A CZ    1 
ATOM   3375  O  OH    . TYR A 1 211 ? -4.747  -30.605 -64.139 1.00 57.22 ? 211 TYR A OH    1 
ATOM   3376  H  H     . TYR A 1 211 ? -9.785  -35.787 -67.592 1.00 58.49 ? 211 TYR A H     1 
ATOM   3377  H  HA    . TYR A 1 211 ? -9.911  -33.850 -65.870 1.00 68.74 ? 211 TYR A HA    1 
ATOM   3378  H  HB2   . TYR A 1 211 ? -8.232  -35.314 -65.557 1.00 61.85 ? 211 TYR A HB2   1 
ATOM   3379  H  HB3   . TYR A 1 211 ? -7.639  -35.052 -67.011 1.00 61.85 ? 211 TYR A HB3   1 
ATOM   3380  H  HD1   . TYR A 1 211 ? -8.194  -33.287 -63.974 1.00 72.48 ? 211 TYR A HD1   1 
ATOM   3381  H  HD2   . TYR A 1 211 ? -5.875  -33.520 -67.227 1.00 72.58 ? 211 TYR A HD2   1 
ATOM   3382  H  HE1   . TYR A 1 211 ? -6.834  -31.633 -63.118 1.00 65.62 ? 211 TYR A HE1   1 
ATOM   3383  H  HE2   . TYR A 1 211 ? -4.509  -31.863 -66.374 1.00 67.30 ? 211 TYR A HE2   1 
ATOM   3384  H  HH    . TYR A 1 211 ? -4.733  -29.959 -64.644 1.00 68.60 ? 211 TYR A HH    1 
ATOM   3385  N  N     . ASN A 1 212 ? -8.689  -32.804 -68.667 1.00 57.71 ? 212 ASN A N     1 
ATOM   3386  C  CA    . ASN A 1 212 ? -8.445  -31.582 -69.438 1.00 52.86 ? 212 ASN A CA    1 
ATOM   3387  C  C     . ASN A 1 212 ? -9.700  -30.734 -69.559 1.00 49.20 ? 212 ASN A C     1 
ATOM   3388  O  O     . ASN A 1 212 ? -9.647  -29.507 -69.480 1.00 51.71 ? 212 ASN A O     1 
ATOM   3389  C  CB    . ASN A 1 212 ? -7.881  -31.912 -70.821 1.00 43.23 ? 212 ASN A CB    1 
ATOM   3390  C  CG    . ASN A 1 212 ? -6.436  -32.371 -70.757 1.00 46.43 ? 212 ASN A CG    1 
ATOM   3391  O  OD1   . ASN A 1 212 ? -5.722  -32.088 -69.784 1.00 57.72 ? 212 ASN A OD1   1 
ATOM   3392  N  ND2   . ASN A 1 212 ? -5.991  -33.083 -71.794 1.00 52.26 ? 212 ASN A ND2   1 
ATOM   3393  H  H     . ASN A 1 212 ? -8.478  -33.531 -69.074 1.00 69.19 ? 212 ASN A H     1 
ATOM   3394  H  HA    . ASN A 1 212 ? -7.773  -31.047 -68.966 1.00 63.38 ? 212 ASN A HA    1 
ATOM   3395  H  HB2   . ASN A 1 212 ? -8.407  -32.624 -71.217 1.00 51.81 ? 212 ASN A HB2   1 
ATOM   3396  H  HB3   . ASN A 1 212 ? -7.921  -31.118 -71.378 1.00 51.81 ? 212 ASN A HB3   1 
ATOM   3397  H  HD21  . ASN A 1 212 ? -6.516  -33.258 -72.452 1.00 62.65 ? 212 ASN A HD21  1 
ATOM   3398  H  HD22  . ASN A 1 212 ? -5.179  -33.366 -71.804 1.00 62.65 ? 212 ASN A HD22  1 
ATOM   3399  N  N     . GLU A 1 213 ? -10.837 -31.395 -69.730 1.00 45.21 ? 213 GLU A N     1 
ATOM   3400  C  CA    . GLU A 1 213 ? -12.109 -30.702 -69.833 1.00 47.64 ? 213 GLU A CA    1 
ATOM   3401  C  C     . GLU A 1 213 ? -12.441 -30.001 -68.518 1.00 53.12 ? 213 GLU A C     1 
ATOM   3402  O  O     . GLU A 1 213 ? -12.797 -28.824 -68.500 1.00 47.58 ? 213 GLU A O     1 
ATOM   3403  C  CB    . GLU A 1 213 ? -13.220 -31.697 -70.186 1.00 41.94 ? 213 GLU A CB    1 
ATOM   3404  C  CG    . GLU A 1 213 ? -13.029 -32.382 -71.565 1.00 43.00 ? 213 GLU A CG    1 
ATOM   3405  C  CD    . GLU A 1 213 ? -13.816 -33.697 -71.691 1.00 48.21 ? 213 GLU A CD    1 
ATOM   3406  O  OE1   . GLU A 1 213 ? -14.567 -34.059 -70.739 1.00 50.78 ? 213 GLU A OE1   1 
ATOM   3407  O  OE2   . GLU A 1 213 ? -13.670 -34.369 -72.742 1.00 58.04 ? 213 GLU A OE2   1 
ATOM   3408  H  H     . GLU A 1 213 ? -10.897 -32.251 -69.789 1.00 54.19 ? 213 GLU A H     1 
ATOM   3409  H  HA    . GLU A 1 213 ? -12.058 -30.027 -70.542 1.00 57.11 ? 213 GLU A HA    1 
ATOM   3410  H  HB2   . GLU A 1 213 ? -13.244 -32.393 -69.510 1.00 50.26 ? 213 GLU A HB2   1 
ATOM   3411  H  HB3   . GLU A 1 213 ? -14.068 -31.226 -70.204 1.00 50.26 ? 213 GLU A HB3   1 
ATOM   3412  H  HG2   . GLU A 1 213 ? -13.335 -31.781 -72.262 1.00 51.54 ? 213 GLU A HG2   1 
ATOM   3413  H  HG3   . GLU A 1 213 ? -12.088 -32.583 -71.691 1.00 51.54 ? 213 GLU A HG3   1 
ATOM   3414  N  N     . LEU A 1 214 ? -12.331 -30.740 -67.420 1.00 50.99 ? 214 LEU A N     1 
ATOM   3415  C  CA    . LEU A 1 214 ? -12.740 -30.233 -66.118 1.00 48.87 ? 214 LEU A CA    1 
ATOM   3416  C  C     . LEU A 1 214 ? -11.780 -29.153 -65.607 1.00 39.72 ? 214 LEU A C     1 
ATOM   3417  O  O     . LEU A 1 214 ? -12.211 -28.199 -64.971 1.00 42.95 ? 214 LEU A O     1 
ATOM   3418  C  CB    . LEU A 1 214 ? -12.816 -31.389 -65.109 1.00 46.44 ? 214 LEU A CB    1 
ATOM   3419  C  CG    . LEU A 1 214 ? -13.553 -31.056 -63.804 1.00 36.28 ? 214 LEU A CG    1 
ATOM   3420  C  CD1   . LEU A 1 214 ? -15.026 -30.819 -64.062 1.00 37.82 ? 214 LEU A CD1   1 
ATOM   3421  C  CD2   . LEU A 1 214 ? -13.357 -32.172 -62.773 1.00 40.32 ? 214 LEU A CD2   1 
ATOM   3422  H  H     . LEU A 1 214 ? -12.020 -31.542 -67.403 1.00 61.13 ? 214 LEU A H     1 
ATOM   3423  H  HA    . LEU A 1 214 ? -13.633 -29.836 -66.194 1.00 58.58 ? 214 LEU A HA    1 
ATOM   3424  H  HB2   . LEU A 1 214 ? -13.278 -32.133 -65.525 1.00 55.67 ? 214 LEU A HB2   1 
ATOM   3425  H  HB3   . LEU A 1 214 ? -11.913 -31.656 -64.875 1.00 55.67 ? 214 LEU A HB3   1 
ATOM   3426  H  HG    . LEU A 1 214 ? -13.181 -30.240 -63.434 1.00 43.48 ? 214 LEU A HG    1 
ATOM   3427  H  HD11  . LEU A 1 214 ? -15.459 -30.614 -63.230 1.00 45.33 ? 214 LEU A HD11  1 
ATOM   3428  H  HD12  . LEU A 1 214 ? -15.122 -30.084 -64.672 1.00 45.33 ? 214 LEU A HD12  1 
ATOM   3429  H  HD13  . LEU A 1 214 ? -15.408 -31.613 -64.443 1.00 45.33 ? 214 LEU A HD13  1 
ATOM   3430  H  HD21  . LEU A 1 214 ? -13.705 -32.992 -63.130 1.00 48.33 ? 214 LEU A HD21  1 
ATOM   3431  H  HD22  . LEU A 1 214 ? -12.419 -32.266 -62.589 1.00 48.33 ? 214 LEU A HD22  1 
ATOM   3432  H  HD23  . LEU A 1 214 ? -13.827 -31.939 -61.969 1.00 48.33 ? 214 LEU A HD23  1 
ATOM   3433  N  N     . GLU A 1 215 ? -10.487 -29.318 -65.873 1.00 43.78 ? 215 GLU A N     1 
ATOM   3434  C  CA    . GLU A 1 215 ? -9.485  -28.354 -65.430 1.00 41.09 ? 215 GLU A CA    1 
ATOM   3435  C  C     . GLU A 1 215 ? -9.863  -26.952 -65.878 1.00 52.38 ? 215 GLU A C     1 
ATOM   3436  O  O     . GLU A 1 215 ? -9.748  -25.993 -65.118 1.00 49.61 ? 215 GLU A O     1 
ATOM   3437  C  CB    . GLU A 1 215 ? -8.100  -28.719 -65.953 1.00 48.02 ? 215 GLU A CB    1 
ATOM   3438  C  CG    . GLU A 1 215 ? -6.954  -27.850 -65.391 1.00 57.89 ? 215 GLU A CG    1 
ATOM   3439  C  CD    . GLU A 1 215 ? -6.841  -26.456 -66.036 1.00 59.61 ? 215 GLU A CD    1 
ATOM   3440  O  OE1   . GLU A 1 215 ? -7.296  -26.281 -67.186 1.00 51.29 ? 215 GLU A OE1   1 
ATOM   3441  O  OE2   . GLU A 1 215 ? -6.290  -25.529 -65.390 1.00 56.92 ? 215 GLU A OE2   1 
ATOM   3442  H  H     . GLU A 1 215 ? -10.163 -29.984 -66.311 1.00 52.48 ? 215 GLU A H     1 
ATOM   3443  H  HA    . GLU A 1 215 ? -9.449  -28.359 -64.450 1.00 49.25 ? 215 GLU A HA    1 
ATOM   3444  H  HB2   . GLU A 1 215 ? -7.913  -29.642 -65.718 1.00 57.56 ? 215 GLU A HB2   1 
ATOM   3445  H  HB3   . GLU A 1 215 ? -8.097  -28.622 -66.918 1.00 57.56 ? 215 GLU A HB3   1 
ATOM   3446  H  HG2   . GLU A 1 215 ? -7.098  -27.725 -64.440 1.00 69.40 ? 215 GLU A HG2   1 
ATOM   3447  H  HG3   . GLU A 1 215 ? -6.114  -28.312 -65.537 1.00 69.40 ? 215 GLU A HG3   1 
ATOM   3448  N  N     . LYS A 1 216 ? -10.331 -26.827 -67.115 1.00 53.55 ? 216 LYS A N     1 
ATOM   3449  C  CA    . LYS A 1 216 ? -10.739 -25.525 -67.639 1.00 51.86 ? 216 LYS A CA    1 
ATOM   3450  C  C     . LYS A 1 216 ? -11.869 -24.909 -66.811 1.00 49.06 ? 216 LYS A C     1 
ATOM   3451  O  O     . LYS A 1 216 ? -12.022 -23.689 -66.752 1.00 49.48 ? 216 LYS A O     1 
ATOM   3452  C  CB    . LYS A 1 216 ? -11.161 -25.672 -69.107 1.00 39.74 ? 216 LYS A CB    1 
ATOM   3453  C  CG    . LYS A 1 216 ? -10.018 -26.160 -69.988 1.00 42.69 ? 216 LYS A CG    1 
ATOM   3454  C  CD    . LYS A 1 216 ? -10.493 -26.612 -71.370 1.00 41.90 ? 216 LYS A CD    1 
ATOM   3455  C  CE    . LYS A 1 216 ? -9.301  -26.785 -72.308 1.00 46.13 ? 216 LYS A CE    1 
ATOM   3456  N  NZ    . LYS A 1 216 ? -8.496  -25.515 -72.421 1.00 53.09 ? 216 LYS A NZ    1 
ATOM   3457  H  H     . LYS A 1 216 ? -10.423 -27.477 -67.670 1.00 64.20 ? 216 LYS A H     1 
ATOM   3458  H  HA    . LYS A 1 216 ? -9.973  -24.915 -67.604 1.00 62.18 ? 216 LYS A HA    1 
ATOM   3459  H  HB2   . LYS A 1 216 ? -11.884 -26.316 -69.167 1.00 47.62 ? 216 LYS A HB2   1 
ATOM   3460  H  HB3   . LYS A 1 216 ? -11.453 -24.810 -69.442 1.00 47.62 ? 216 LYS A HB3   1 
ATOM   3461  H  HG2   . LYS A 1 216 ? -9.382  -25.437 -70.110 1.00 51.16 ? 216 LYS A HG2   1 
ATOM   3462  H  HG3   . LYS A 1 216 ? -9.586  -26.914 -69.556 1.00 51.16 ? 216 LYS A HG3   1 
ATOM   3463  H  HD2   . LYS A 1 216 ? -10.950 -27.465 -71.293 1.00 50.22 ? 216 LYS A HD2   1 
ATOM   3464  H  HD3   . LYS A 1 216 ? -11.085 -25.942 -71.745 1.00 50.22 ? 216 LYS A HD3   1 
ATOM   3465  H  HE2   . LYS A 1 216 ? -8.721  -27.482 -71.963 1.00 55.29 ? 216 LYS A HE2   1 
ATOM   3466  H  HE3   . LYS A 1 216 ? -9.621  -27.022 -73.192 1.00 55.29 ? 216 LYS A HE3   1 
ATOM   3467  H  HZ1   . LYS A 1 216 ? -8.188  -25.278 -71.621 1.00 63.65 ? 216 LYS A HZ1   1 
ATOM   3468  H  HZ2   . LYS A 1 216 ? -7.808  -25.639 -72.972 1.00 63.65 ? 216 LYS A HZ2   1 
ATOM   3469  H  HZ3   . LYS A 1 216 ? -9.007  -24.859 -72.740 1.00 63.65 ? 216 LYS A HZ3   1 
ATOM   3470  N  N     . ILE A 1 217 ? -12.660 -25.760 -66.170 1.00 46.99 ? 217 ILE A N     1 
ATOM   3471  C  CA    . ILE A 1 217 ? -13.789 -25.305 -65.382 1.00 44.66 ? 217 ILE A CA    1 
ATOM   3472  C  C     . ILE A 1 217 ? -13.436 -25.114 -63.899 1.00 47.95 ? 217 ILE A C     1 
ATOM   3473  O  O     . ILE A 1 217 ? -13.985 -24.223 -63.253 1.00 46.73 ? 217 ILE A O     1 
ATOM   3474  C  CB    . ILE A 1 217 ? -14.954 -26.298 -65.473 1.00 49.52 ? 217 ILE A CB    1 
ATOM   3475  C  CG1   . ILE A 1 217 ? -15.371 -26.487 -66.930 1.00 55.02 ? 217 ILE A CG1   1 
ATOM   3476  C  CG2   . ILE A 1 217 ? -16.144 -25.824 -64.627 1.00 49.99 ? 217 ILE A CG2   1 
ATOM   3477  C  CD1   . ILE A 1 217 ? -16.377 -27.611 -67.120 1.00 58.96 ? 217 ILE A CD1   1 
ATOM   3478  H  H     . ILE A 1 217 ? -12.560 -26.614 -66.178 1.00 56.32 ? 217 ILE A H     1 
ATOM   3479  H  HA    . ILE A 1 217 ? -14.096 -24.443 -65.733 1.00 53.53 ? 217 ILE A HA    1 
ATOM   3480  H  HB    . ILE A 1 217 ? -14.655 -27.153 -65.127 1.00 59.36 ? 217 ILE A HB    1 
ATOM   3481  H  HG12  . ILE A 1 217 ? -15.776 -25.666 -67.251 1.00 65.96 ? 217 ILE A HG12  1 
ATOM   3482  H  HG13  . ILE A 1 217 ? -14.585 -26.698 -67.458 1.00 65.96 ? 217 ILE A HG13  1 
ATOM   3483  H  HG21  . ILE A 1 217 ? -15.866 -25.750 -63.711 1.00 59.93 ? 217 ILE A HG21  1 
ATOM   3484  H  HG22  . ILE A 1 217 ? -16.436 -24.968 -64.950 1.00 59.93 ? 217 ILE A HG22  1 
ATOM   3485  H  HG23  . ILE A 1 217 ? -16.856 -26.463 -64.703 1.00 59.93 ? 217 ILE A HG23  1 
ATOM   3486  H  HD11  . ILE A 1 217 ? -17.166 -27.412 -66.610 1.00 70.69 ? 217 ILE A HD11  1 
ATOM   3487  H  HD12  . ILE A 1 217 ? -16.598 -27.678 -68.052 1.00 70.69 ? 217 ILE A HD12  1 
ATOM   3488  H  HD13  . ILE A 1 217 ? -15.988 -28.433 -66.814 1.00 70.69 ? 217 ILE A HD13  1 
ATOM   3489  N  N     . THR A 1 218 ? -12.533 -25.937 -63.358 1.00 48.83 ? 218 THR A N     1 
ATOM   3490  C  CA    . THR A 1 218 ? -12.286 -25.938 -61.904 1.00 43.47 ? 218 THR A CA    1 
ATOM   3491  C  C     . THR A 1 218 ? -10.870 -25.573 -61.455 1.00 44.63 ? 218 THR A C     1 
ATOM   3492  O  O     . THR A 1 218 ? -10.664 -25.222 -60.296 1.00 40.11 ? 218 THR A O     1 
ATOM   3493  C  CB    . THR A 1 218 ? -12.570 -27.328 -61.287 1.00 36.55 ? 218 THR A CB    1 
ATOM   3494  O  OG1   . THR A 1 218 ? -11.717 -28.300 -61.898 1.00 34.24 ? 218 THR A OG1   1 
ATOM   3495  C  CG2   . THR A 1 218 ? -14.019 -27.739 -61.460 1.00 42.12 ? 218 THR A CG2   1 
ATOM   3496  H  H     . THR A 1 218 ? -12.054 -26.498 -63.801 1.00 58.54 ? 218 THR A H     1 
ATOM   3497  H  HA    . THR A 1 218 ? -12.901 -25.299 -61.487 1.00 52.10 ? 218 THR A HA    1 
ATOM   3498  H  HB    . THR A 1 218 ? -12.380 -27.296 -60.336 1.00 43.80 ? 218 THR A HB    1 
ATOM   3499  H  HG1   . THR A 1 218 ? -10.931 -28.102 -61.771 1.00 41.03 ? 218 THR A HG1   1 
ATOM   3500  H  HG21  . THR A 1 218 ? -14.594 -27.102 -61.031 1.00 50.48 ? 218 THR A HG21  1 
ATOM   3501  H  HG22  . THR A 1 218 ? -14.239 -27.779 -62.394 1.00 50.48 ? 218 THR A HG22  1 
ATOM   3502  H  HG23  . THR A 1 218 ? -14.164 -28.603 -61.068 1.00 50.48 ? 218 THR A HG23  1 
ATOM   3503  N  N     . GLY A 1 219 ? -9.894  -25.682 -62.341 1.00 36.97 ? 219 GLY A N     1 
ATOM   3504  C  CA    . GLY A 1 219 ? -8.504  -25.607 -61.927 1.00 41.31 ? 219 GLY A CA    1 
ATOM   3505  C  C     . GLY A 1 219 ? -7.964  -26.998 -61.630 1.00 35.73 ? 219 GLY A C     1 
ATOM   3506  O  O     . GLY A 1 219 ? -8.729  -27.901 -61.294 1.00 45.51 ? 219 GLY A O     1 
ATOM   3507  H  H     . GLY A 1 219 ? -10.008 -25.800 -63.185 1.00 44.30 ? 219 GLY A H     1 
ATOM   3508  H  HA2   . GLY A 1 219 ? -7.971  -25.207 -62.631 1.00 49.51 ? 219 GLY A HA2   1 
ATOM   3509  H  HA3   . GLY A 1 219 ? -8.427  -25.063 -61.127 1.00 49.51 ? 219 GLY A HA3   1 
ATOM   3510  N  N     . LYS A 1 220 ? -6.654  -27.171 -61.752 1.00 31.75 ? 220 LYS A N     1 
ATOM   3511  C  CA    . LYS A 1 220 ? -5.998  -28.474 -61.577 1.00 34.22 ? 220 LYS A CA    1 
ATOM   3512  C  C     . LYS A 1 220 ? -6.352  -29.181 -60.268 1.00 43.23 ? 220 LYS A C     1 
ATOM   3513  O  O     . LYS A 1 220 ? -6.868  -30.299 -60.268 1.00 36.81 ? 220 LYS A O     1 
ATOM   3514  C  CB    . LYS A 1 220 ? -4.490  -28.296 -61.619 1.00 34.22 ? 220 LYS A CB    1 
ATOM   3515  C  CG    . LYS A 1 220 ? -3.695  -29.571 -61.372 1.00 45.93 ? 220 LYS A CG    1 
ATOM   3516  C  CD    . LYS A 1 220 ? -2.206  -29.304 -61.599 1.00 49.42 ? 220 LYS A CD    1 
ATOM   3517  C  CE    . LYS A 1 220 ? -1.356  -30.561 -61.466 1.00 59.42 ? 220 LYS A CE    1 
ATOM   3518  N  NZ    . LYS A 1 220 ? 0.091   -30.263 -61.692 1.00 56.90 ? 220 LYS A NZ    1 
ATOM   3519  H  H     . LYS A 1 220 ? -6.105  -26.536 -61.940 1.00 38.04 ? 220 LYS A H     1 
ATOM   3520  H  HA    . LYS A 1 220 ? -6.255  -29.062 -62.318 1.00 41.00 ? 220 LYS A HA    1 
ATOM   3521  H  HB2   . LYS A 1 220 ? -4.242  -27.960 -62.494 1.00 41.00 ? 220 LYS A HB2   1 
ATOM   3522  H  HB3   . LYS A 1 220 ? -4.235  -27.655 -60.938 1.00 41.00 ? 220 LYS A HB3   1 
ATOM   3523  H  HG2   . LYS A 1 220 ? -3.821  -29.862 -60.455 1.00 55.05 ? 220 LYS A HG2   1 
ATOM   3524  H  HG3   . LYS A 1 220 ? -3.984  -30.260 -61.991 1.00 55.05 ? 220 LYS A HG3   1 
ATOM   3525  H  HD2   . LYS A 1 220 ? -2.080  -28.950 -62.493 1.00 59.24 ? 220 LYS A HD2   1 
ATOM   3526  H  HD3   . LYS A 1 220 ? -1.896  -28.662 -60.941 1.00 59.24 ? 220 LYS A HD3   1 
ATOM   3527  H  HE2   . LYS A 1 220 ? -1.457  -30.924 -60.572 1.00 71.25 ? 220 LYS A HE2   1 
ATOM   3528  H  HE3   . LYS A 1 220 ? -1.640  -31.212 -62.127 1.00 71.25 ? 220 LYS A HE3   1 
ATOM   3529  H  HZ1   . LYS A 1 220 ? 0.209   -29.930 -62.509 1.00 68.22 ? 220 LYS A HZ1   1 
ATOM   3530  H  HZ2   . LYS A 1 220 ? 0.376   -29.668 -61.094 1.00 68.22 ? 220 LYS A HZ2   1 
ATOM   3531  H  HZ3   . LYS A 1 220 ? 0.571   -31.007 -61.610 1.00 68.22 ? 220 LYS A HZ3   1 
ATOM   3532  N  N     . ALA A 1 221 ? -6.034  -28.528 -59.154 1.00 39.49 ? 221 ALA A N     1 
ATOM   3533  C  CA    . ALA A 1 221 ? -6.290  -29.092 -57.834 1.00 37.84 ? 221 ALA A CA    1 
ATOM   3534  C  C     . ALA A 1 221 ? -7.732  -29.591 -57.669 1.00 28.83 ? 221 ALA A C     1 
ATOM   3535  O  O     . ALA A 1 221 ? -7.945  -30.737 -57.260 1.00 27.62 ? 221 ALA A O     1 
ATOM   3536  C  CB    . ALA A 1 221 ? -5.969  -28.058 -56.759 1.00 43.19 ? 221 ALA A CB    1 
ATOM   3537  H  H     . ALA A 1 221 ? -5.667  -27.751 -59.136 1.00 47.33 ? 221 ALA A H     1 
ATOM   3538  H  HA    . ALA A 1 221 ? -5.693  -29.857 -57.700 1.00 45.35 ? 221 ALA A HA    1 
ATOM   3539  H  HB1   . ALA A 1 221 ? -6.142  -28.442 -55.896 1.00 51.77 ? 221 ALA A HB1   1 
ATOM   3540  H  HB2   . ALA A 1 221 ? -5.044  -27.811 -56.829 1.00 51.77 ? 221 ALA A HB2   1 
ATOM   3541  H  HB3   . ALA A 1 221 ? -6.526  -27.287 -56.892 1.00 51.77 ? 221 ALA A HB3   1 
ATOM   3542  N  N     . LYS A 1 222 ? -8.705  -28.731 -57.963 1.00 27.16 ? 222 LYS A N     1 
ATOM   3543  C  CA    . LYS A 1 222 ? -10.104 -29.094 -57.790 1.00 30.31 ? 222 LYS A CA    1 
ATOM   3544  C  C     . LYS A 1 222 ? -10.518 -30.225 -58.766 1.00 33.26 ? 222 LYS A C     1 
ATOM   3545  O  O     . LYS A 1 222 ? -11.315 -31.098 -58.417 1.00 25.86 ? 222 LYS A O     1 
ATOM   3546  C  CB    . LYS A 1 222 ? -11.002 -27.874 -57.938 1.00 39.85 ? 222 LYS A CB    1 
ATOM   3547  C  CG    . LYS A 1 222 ? -10.830 -26.822 -56.847 1.00 45.59 ? 222 LYS A CG    1 
ATOM   3548  C  CD    . LYS A 1 222 ? -11.402 -27.277 -55.518 1.00 48.41 ? 222 LYS A CD    1 
ATOM   3549  C  CE    . LYS A 1 222 ? -11.289 -26.183 -54.429 1.00 52.57 ? 222 LYS A CE    1 
ATOM   3550  N  NZ    . LYS A 1 222 ? -9.885  -25.957 -53.938 1.00 56.14 ? 222 LYS A NZ    1 
ATOM   3551  H  H     . LYS A 1 222 ? -8.580  -27.934 -58.262 1.00 32.53 ? 222 LYS A H     1 
ATOM   3552  H  HA    . LYS A 1 222 ? -10.224 -29.436 -56.879 1.00 36.31 ? 222 LYS A HA    1 
ATOM   3553  H  HB2   . LYS A 1 222 ? -10.809 -27.450 -58.789 1.00 47.76 ? 222 LYS A HB2   1 
ATOM   3554  H  HB3   . LYS A 1 222 ? -11.926 -28.167 -57.921 1.00 47.76 ? 222 LYS A HB3   1 
ATOM   3555  H  HG2   . LYS A 1 222 ? -9.884  -26.643 -56.724 1.00 54.64 ? 222 LYS A HG2   1 
ATOM   3556  H  HG3   . LYS A 1 222 ? -11.291 -26.010 -57.112 1.00 54.64 ? 222 LYS A HG3   1 
ATOM   3557  H  HD2   . LYS A 1 222 ? -12.340 -27.494 -55.633 1.00 58.03 ? 222 LYS A HD2   1 
ATOM   3558  H  HD3   . LYS A 1 222 ? -10.914 -28.058 -55.213 1.00 58.03 ? 222 LYS A HD3   1 
ATOM   3559  H  HE2   . LYS A 1 222 ? -11.614 -25.345 -54.794 1.00 63.02 ? 222 LYS A HE2   1 
ATOM   3560  H  HE3   . LYS A 1 222 ? -11.831 -26.443 -53.668 1.00 63.02 ? 222 LYS A HE3   1 
ATOM   3561  H  HZ1   . LYS A 1 222 ? -9.878  -25.321 -53.316 1.00 67.30 ? 222 LYS A HZ1   1 
ATOM   3562  H  HZ2   . LYS A 1 222 ? -9.561  -26.708 -53.587 1.00 67.30 ? 222 LYS A HZ2   1 
ATOM   3563  H  HZ3   . LYS A 1 222 ? -9.363  -25.706 -54.614 1.00 67.30 ? 222 LYS A HZ3   1 
ATOM   3564  N  N     . ALA A 1 223 ? -9.950  -30.223 -59.968 1.00 36.86 ? 223 ALA A N     1 
ATOM   3565  C  CA    . ALA A 1 223 ? -10.265 -31.269 -60.954 1.00 34.02 ? 223 ALA A CA    1 
ATOM   3566  C  C     . ALA A 1 223 ? -9.770  -32.652 -60.497 1.00 27.63 ? 223 ALA A C     1 
ATOM   3567  O  O     . ALA A 1 223 ? -10.486 -33.651 -60.591 1.00 32.04 ? 223 ALA A O     1 
ATOM   3568  C  CB    . ALA A 1 223 ? -9.674  -30.911 -62.320 1.00 29.24 ? 223 ALA A CB    1 
ATOM   3569  H  H     . ALA A 1 223 ? -9.384  -29.636 -60.241 1.00 44.17 ? 223 ALA A H     1 
ATOM   3570  H  HA    . ALA A 1 223 ? -11.238 -31.321 -61.056 1.00 40.76 ? 223 ALA A HA    1 
ATOM   3571  H  HB1   . ALA A 1 223 ? -10.049 -30.077 -62.612 1.00 35.03 ? 223 ALA A HB1   1 
ATOM   3572  H  HB2   . ALA A 1 223 ? -8.721  -30.831 -62.236 1.00 35.03 ? 223 ALA A HB2   1 
ATOM   3573  H  HB3   . ALA A 1 223 ? -9.891  -31.605 -62.946 1.00 35.03 ? 223 ALA A HB3   1 
ATOM   3574  N  N     . LEU A 1 224 ? -8.546  -32.718 -59.998 1.00 23.63 ? 224 LEU A N     1 
ATOM   3575  C  CA    . LEU A 1 224 ? -7.987  -33.983 -59.573 1.00 27.61 ? 224 LEU A CA    1 
ATOM   3576  C  C     . LEU A 1 224 ? -8.746  -34.515 -58.371 1.00 26.13 ? 224 LEU A C     1 
ATOM   3577  O  O     . LEU A 1 224 ? -8.961  -35.709 -58.234 1.00 22.75 ? 224 LEU A O     1 
ATOM   3578  C  CB    . LEU A 1 224 ? -6.526  -33.797 -59.169 1.00 39.27 ? 224 LEU A CB    1 
ATOM   3579  C  CG    . LEU A 1 224 ? -5.594  -33.232 -60.231 1.00 43.18 ? 224 LEU A CG    1 
ATOM   3580  C  CD1   . LEU A 1 224 ? -4.288  -32.788 -59.584 1.00 44.80 ? 224 LEU A CD1   1 
ATOM   3581  C  CD2   . LEU A 1 224 ? -5.353  -34.276 -61.307 1.00 42.12 ? 224 LEU A CD2   1 
ATOM   3582  H  H     . LEU A 1 224 ? -8.020  -32.045 -59.897 1.00 28.30 ? 224 LEU A H     1 
ATOM   3583  H  HA    . LEU A 1 224 ? -8.038  -34.637 -60.301 1.00 33.07 ? 224 LEU A HA    1 
ATOM   3584  H  HB2   . LEU A 1 224 ? -6.496  -33.193 -58.410 1.00 47.06 ? 224 LEU A HB2   1 
ATOM   3585  H  HB3   . LEU A 1 224 ? -6.171  -34.660 -58.905 1.00 47.06 ? 224 LEU A HB3   1 
ATOM   3586  H  HG    . LEU A 1 224 ? -6.009  -32.458 -60.643 1.00 51.76 ? 224 LEU A HG    1 
ATOM   3587  H  HD11  . LEU A 1 224 ? -4.478  -32.113 -58.929 1.00 53.70 ? 224 LEU A HD11  1 
ATOM   3588  H  HD12  . LEU A 1 224 ? -3.875  -33.546 -59.163 1.00 53.70 ? 224 LEU A HD12  1 
ATOM   3589  H  HD13  . LEU A 1 224 ? -3.709  -32.434 -60.262 1.00 53.70 ? 224 LEU A HD13  1 
ATOM   3590  H  HD21  . LEU A 1 224 ? -4.953  -35.051 -60.907 1.00 50.48 ? 224 LEU A HD21  1 
ATOM   3591  H  HD22  . LEU A 1 224 ? -6.193  -34.511 -61.708 1.00 50.48 ? 224 LEU A HD22  1 
ATOM   3592  H  HD23  . LEU A 1 224 ? -4.765  -33.909 -61.971 1.00 50.48 ? 224 LEU A HD23  1 
ATOM   3593  N  N     . TYR A 1 225 ? -9.108  -33.601 -57.482 1.00 27.63 ? 225 TYR A N     1 
ATOM   3594  C  CA    . TYR A 1 225 ? -9.874  -33.931 -56.269 1.00 27.52 ? 225 TYR A CA    1 
ATOM   3595  C  C     . TYR A 1 225 ? -11.253 -34.524 -56.602 1.00 24.49 ? 225 TYR A C     1 
ATOM   3596  O  O     . TYR A 1 225 ? -11.633 -35.586 -56.105 1.00 23.07 ? 225 TYR A O     1 
ATOM   3597  C  CB    . TYR A 1 225 ? -9.999  -32.647 -55.454 1.00 28.76 ? 225 TYR A CB    1 
ATOM   3598  C  CG    . TYR A 1 225 ? -11.064 -32.643 -54.389 1.00 26.20 ? 225 TYR A CG    1 
ATOM   3599  C  CD1   . TYR A 1 225 ? -11.054 -33.592 -53.376 1.00 25.67 ? 225 TYR A CD1   1 
ATOM   3600  C  CD2   . TYR A 1 225 ? -12.045 -31.669 -54.371 1.00 27.09 ? 225 TYR A CD2   1 
ATOM   3601  C  CE1   . TYR A 1 225 ? -12.002 -33.583 -52.387 1.00 30.83 ? 225 TYR A CE1   1 
ATOM   3602  C  CE2   . TYR A 1 225 ? -13.012 -31.651 -53.370 1.00 30.83 ? 225 TYR A CE2   1 
ATOM   3603  C  CZ    . TYR A 1 225 ? -12.972 -32.614 -52.379 1.00 30.03 ? 225 TYR A CZ    1 
ATOM   3604  O  OH    . TYR A 1 225 ? -13.916 -32.629 -51.369 1.00 35.00 ? 225 TYR A OH    1 
ATOM   3605  H  H     . TYR A 1 225 ? -8.921  -32.765 -57.553 1.00 33.09 ? 225 TYR A H     1 
ATOM   3606  H  HA    . TYR A 1 225 ? -9.376  -34.587 -55.739 1.00 32.96 ? 225 TYR A HA    1 
ATOM   3607  H  HB2   . TYR A 1 225 ? -9.151  -32.480 -55.015 1.00 34.45 ? 225 TYR A HB2   1 
ATOM   3608  H  HB3   . TYR A 1 225 ? -10.196 -31.918 -56.063 1.00 34.45 ? 225 TYR A HB3   1 
ATOM   3609  H  HD1   . TYR A 1 225 ? -10.395 -34.247 -53.371 1.00 30.74 ? 225 TYR A HD1   1 
ATOM   3610  H  HD2   . TYR A 1 225 ? -12.061 -31.020 -55.037 1.00 32.45 ? 225 TYR A HD2   1 
ATOM   3611  H  HE1   . TYR A 1 225 ? -11.983 -34.228 -51.718 1.00 36.93 ? 225 TYR A HE1   1 
ATOM   3612  H  HE2   . TYR A 1 225 ? -13.672 -30.996 -53.365 1.00 36.94 ? 225 TYR A HE2   1 
ATOM   3613  H  HH    . TYR A 1 225 ? -14.667 -32.710 -51.687 1.00 41.93 ? 225 TYR A HH    1 
ATOM   3614  N  N     . LEU A 1 226 ? -11.993 -33.831 -57.462 1.00 23.44 ? 226 LEU A N     1 
ATOM   3615  C  CA    . LEU A 1 226 ? -13.336 -34.252 -57.831 1.00 21.46 ? 226 LEU A CA    1 
ATOM   3616  C  C     . LEU A 1 226 ? -13.339 -35.588 -58.571 1.00 25.98 ? 226 LEU A C     1 
ATOM   3617  O  O     . LEU A 1 226 ? -14.212 -36.433 -58.336 1.00 22.89 ? 226 LEU A O     1 
ATOM   3618  C  CB    . LEU A 1 226 ? -13.978 -33.178 -58.696 1.00 26.58 ? 226 LEU A CB    1 
ATOM   3619  C  CG    . LEU A 1 226 ? -14.425 -31.930 -57.951 1.00 29.67 ? 226 LEU A CG    1 
ATOM   3620  C  CD1   . LEU A 1 226 ? -14.806 -30.837 -58.938 1.00 34.87 ? 226 LEU A CD1   1 
ATOM   3621  C  CD2   . LEU A 1 226 ? -15.587 -32.264 -57.043 1.00 31.93 ? 226 LEU A CD2   1 
ATOM   3622  H  H     . LEU A 1 226 ? -11.735 -33.108 -57.848 1.00 28.07 ? 226 LEU A H     1 
ATOM   3623  H  HA    . LEU A 1 226 ? -13.875 -34.352 -57.019 1.00 25.69 ? 226 LEU A HA    1 
ATOM   3624  H  HB2   . LEU A 1 226 ? -13.337 -32.902 -59.370 1.00 31.83 ? 226 LEU A HB2   1 
ATOM   3625  H  HB3   . LEU A 1 226 ? -14.760 -33.557 -59.127 1.00 31.83 ? 226 LEU A HB3   1 
ATOM   3626  H  HG    . LEU A 1 226 ? -13.694 -31.604 -57.403 1.00 35.54 ? 226 LEU A HG    1 
ATOM   3627  H  HD11  . LEU A 1 226 ? -14.042 -30.627 -59.481 1.00 41.78 ? 226 LEU A HD11  1 
ATOM   3628  H  HD12  . LEU A 1 226 ? -15.524 -31.152 -59.491 1.00 41.78 ? 226 LEU A HD12  1 
ATOM   3629  H  HD13  . LEU A 1 226 ? -15.085 -30.058 -58.450 1.00 41.78 ? 226 LEU A HD13  1 
ATOM   3630  H  HD21  . LEU A 1 226 ? -16.313 -32.598 -57.575 1.00 38.26 ? 226 LEU A HD21  1 
ATOM   3631  H  HD22  . LEU A 1 226 ? -15.308 -32.932 -56.413 1.00 38.26 ? 226 LEU A HD22  1 
ATOM   3632  H  HD23  . LEU A 1 226 ? -15.859 -31.469 -56.579 1.00 38.26 ? 226 LEU A HD23  1 
ATOM   3633  N  N     . LEU A 1 227 ? -12.383 -35.776 -59.473 1.00 25.17 ? 227 LEU A N     1 
ATOM   3634  C  CA    . LEU A 1 227 ? -12.341 -37.008 -60.270 1.00 26.67 ? 227 LEU A CA    1 
ATOM   3635  C  C     . LEU A 1 227 ? -12.013 -38.173 -59.340 1.00 31.12 ? 227 LEU A C     1 
ATOM   3636  O  O     . LEU A 1 227 ? -12.543 -39.268 -59.462 1.00 30.52 ? 227 LEU A O     1 
ATOM   3637  C  CB    . LEU A 1 227 ? -11.311 -36.900 -61.393 1.00 36.35 ? 227 LEU A CB    1 
ATOM   3638  C  CG    . LEU A 1 227 ? -11.745 -35.986 -62.553 1.00 37.61 ? 227 LEU A CG    1 
ATOM   3639  C  CD1   . LEU A 1 227 ? -10.577 -35.635 -63.480 1.00 40.25 ? 227 LEU A CD1   1 
ATOM   3640  C  CD2   . LEU A 1 227 ? -12.860 -36.656 -63.345 1.00 36.98 ? 227 LEU A CD2   1 
ATOM   3641  H  H     . LEU A 1 227 ? -11.752 -35.218 -59.644 1.00 30.15 ? 227 LEU A H     1 
ATOM   3642  H  HA    . LEU A 1 227 ? -13.221 -37.168 -60.670 1.00 31.94 ? 227 LEU A HA    1 
ATOM   3643  H  HB2   . LEU A 1 227 ? -10.486 -36.543 -61.028 1.00 43.55 ? 227 LEU A HB2   1 
ATOM   3644  H  HB3   . LEU A 1 227 ? -11.152 -37.785 -61.757 1.00 43.55 ? 227 LEU A HB3   1 
ATOM   3645  H  HG    . LEU A 1 227 ? -12.095 -35.159 -62.187 1.00 45.07 ? 227 LEU A HG    1 
ATOM   3646  H  HD11  . LEU A 1 227 ? -9.901  -35.180 -62.972 1.00 48.24 ? 227 LEU A HD11  1 
ATOM   3647  H  HD12  . LEU A 1 227 ? -10.218 -36.445 -63.850 1.00 48.24 ? 227 LEU A HD12  1 
ATOM   3648  H  HD13  . LEU A 1 227 ? -10.897 -35.066 -64.184 1.00 48.24 ? 227 LEU A HD13  1 
ATOM   3649  H  HD21  . LEU A 1 227 ? -13.123 -36.077 -64.065 1.00 44.31 ? 227 LEU A HD21  1 
ATOM   3650  H  HD22  . LEU A 1 227 ? -12.537 -37.489 -63.696 1.00 44.31 ? 227 LEU A HD22  1 
ATOM   3651  H  HD23  . LEU A 1 227 ? -13.607 -36.813 -62.762 1.00 44.31 ? 227 LEU A HD23  1 
ATOM   3652  N  N     . LYS A 1 228 ? -11.153 -37.922 -58.373 1.00 25.88 ? 228 LYS A N     1 
ATOM   3653  C  CA    . LYS A 1 228 ? -10.821 -38.956 -57.401 1.00 30.08 ? 228 LYS A CA    1 
ATOM   3654  C  C     . LYS A 1 228 ? -12.032 -39.284 -56.509 1.00 24.69 ? 228 LYS A C     1 
ATOM   3655  O  O     . LYS A 1 228 ? -12.345 -40.440 -56.248 1.00 23.96 ? 228 LYS A O     1 
ATOM   3656  C  CB    . LYS A 1 228 ? -9.648  -38.478 -56.550 1.00 34.96 ? 228 LYS A CB    1 
ATOM   3657  C  CG    . LYS A 1 228 ? -9.169  -39.472 -55.502 1.00 38.12 ? 228 LYS A CG    1 
ATOM   3658  C  CD    . LYS A 1 228 ? -8.073  -38.842 -54.645 1.00 47.35 ? 228 LYS A CD    1 
ATOM   3659  C  CE    . LYS A 1 228 ? -6.826  -38.529 -55.478 1.00 45.04 ? 228 LYS A CE    1 
ATOM   3660  N  NZ    . LYS A 1 228 ? -6.057  -39.783 -55.759 1.00 49.76 ? 228 LYS A NZ    1 
ATOM   3661  H  H     . LYS A 1 228 ? -10.750 -37.172 -58.253 1.00 31.00 ? 228 LYS A H     1 
ATOM   3662  H  HA    . LYS A 1 228 ? -10.551 -39.773 -57.871 1.00 36.04 ? 228 LYS A HA    1 
ATOM   3663  H  HB2   . LYS A 1 228 ? -8.899  -38.286 -57.136 1.00 41.89 ? 228 LYS A HB2   1 
ATOM   3664  H  HB3   . LYS A 1 228 ? -9.913  -37.669 -56.085 1.00 41.89 ? 228 LYS A HB3   1 
ATOM   3665  H  HG2   . LYS A 1 228 ? -9.909  -39.718 -54.925 1.00 45.68 ? 228 LYS A HG2   1 
ATOM   3666  H  HG3   . LYS A 1 228 ? -8.804  -40.256 -55.942 1.00 45.68 ? 228 LYS A HG3   1 
ATOM   3667  H  HD2   . LYS A 1 228 ? -8.401  -38.012 -54.265 1.00 56.76 ? 228 LYS A HD2   1 
ATOM   3668  H  HD3   . LYS A 1 228 ? -7.822  -39.459 -53.940 1.00 56.76 ? 228 LYS A HD3   1 
ATOM   3669  H  HE2   . LYS A 1 228 ? -7.092  -38.136 -56.324 1.00 53.99 ? 228 LYS A HE2   1 
ATOM   3670  H  HE3   . LYS A 1 228 ? -6.252  -37.921 -54.986 1.00 53.99 ? 228 LYS A HE3   1 
ATOM   3671  H  HZ1   . LYS A 1 228 ? -6.566  -40.357 -56.210 1.00 59.65 ? 228 LYS A HZ1   1 
ATOM   3672  H  HZ2   . LYS A 1 228 ? -5.334  -39.594 -56.243 1.00 59.65 ? 228 LYS A HZ2   1 
ATOM   3673  H  HZ3   . LYS A 1 228 ? -5.803  -40.161 -54.995 1.00 59.65 ? 228 LYS A HZ3   1 
ATOM   3674  N  N     . LEU A 1 229 ? -12.695 -38.255 -56.017 1.00 22.77 ? 229 LEU A N     1 
ATOM   3675  C  CA    . LEU A 1 229 ? -13.789 -38.454 -55.073 1.00 25.25 ? 229 LEU A CA    1 
ATOM   3676  C  C     . LEU A 1 229 ? -14.906 -39.231 -55.745 1.00 31.68 ? 229 LEU A C     1 
ATOM   3677  O  O     . LEU A 1 229 ? -15.537 -40.119 -55.148 1.00 23.90 ? 229 LEU A O     1 
ATOM   3678  C  CB    . LEU A 1 229 ? -14.310 -37.109 -54.596 1.00 24.65 ? 229 LEU A CB    1 
ATOM   3679  C  CG    . LEU A 1 229 ? -15.433 -37.158 -53.576 1.00 34.42 ? 229 LEU A CG    1 
ATOM   3680  C  CD1   . LEU A 1 229 ? -14.949 -37.878 -52.308 1.00 31.03 ? 229 LEU A CD1   1 
ATOM   3681  C  CD2   . LEU A 1 229 ? -15.947 -35.749 -53.284 1.00 34.00 ? 229 LEU A CD2   1 
ATOM   3682  H  H     . LEU A 1 229 ? -12.537 -37.432 -56.210 1.00 27.26 ? 229 LEU A H     1 
ATOM   3683  H  HA    . LEU A 1 229 ? -13.471 -38.963 -54.298 1.00 30.24 ? 229 LEU A HA    1 
ATOM   3684  H  HB2   . LEU A 1 229 ? -13.574 -36.622 -54.192 1.00 29.51 ? 229 LEU A HB2   1 
ATOM   3685  H  HB3   . LEU A 1 229 ? -14.638 -36.618 -55.365 1.00 29.51 ? 229 LEU A HB3   1 
ATOM   3686  H  HG    . LEU A 1 229 ? -16.168 -37.672 -53.946 1.00 41.24 ? 229 LEU A HG    1 
ATOM   3687  H  HD11  . LEU A 1 229 ? -15.666 -37.904 -51.671 1.00 37.17 ? 229 LEU A HD11  1 
ATOM   3688  H  HD12  . LEU A 1 229 ? -14.683 -38.771 -52.539 1.00 37.17 ? 229 LEU A HD12  1 
ATOM   3689  H  HD13  . LEU A 1 229 ? -14.202 -37.398 -51.943 1.00 37.17 ? 229 LEU A HD13  1 
ATOM   3690  H  HD21  . LEU A 1 229 ? -16.275 -35.361 -54.099 1.00 40.74 ? 229 LEU A HD21  1 
ATOM   3691  H  HD22  . LEU A 1 229 ? -16.656 -35.803 -52.638 1.00 40.74 ? 229 LEU A HD22  1 
ATOM   3692  H  HD23  . LEU A 1 229 ? -15.226 -35.219 -52.936 1.00 40.74 ? 229 LEU A HD23  1 
ATOM   3693  N  N     . ALA A 1 230 ? -15.158 -38.869 -56.994 1.00 22.45 ? 230 ALA A N     1 
ATOM   3694  C  CA    . ALA A 1 230 ? -16.263 -39.462 -57.735 1.00 34.04 ? 230 ALA A CA    1 
ATOM   3695  C  C     . ALA A 1 230 ? -16.049 -40.971 -57.906 1.00 29.61 ? 230 ALA A C     1 
ATOM   3696  O  O     . ALA A 1 230 ? -17.004 -41.737 -58.044 1.00 32.80 ? 230 ALA A O     1 
ATOM   3697  C  CB    . ALA A 1 230 ? -16.402 -38.776 -59.081 1.00 30.23 ? 230 ALA A CB    1 
ATOM   3698  H  H     . ALA A 1 230 ? -14.707 -38.285 -57.435 1.00 26.88 ? 230 ALA A H     1 
ATOM   3699  H  HA    . ALA A 1 230 ? -17.095 -39.326 -57.235 1.00 40.79 ? 230 ALA A HA    1 
ATOM   3700  H  HB1   . ALA A 1 230 ? -17.132 -39.174 -59.560 1.00 36.21 ? 230 ALA A HB1   1 
ATOM   3701  H  HB2   . ALA A 1 230 ? -16.572 -37.842 -58.940 1.00 36.21 ? 230 ALA A HB2   1 
ATOM   3702  H  HB3   . ALA A 1 230 ? -15.586 -38.889 -59.574 1.00 36.21 ? 230 ALA A HB3   1 
ATOM   3703  N  N     . GLN A 1 231 ? -14.791 -41.385 -57.912 1.00 26.65 ? 231 GLN A N     1 
ATOM   3704  C  CA    . GLN A 1 231 ? -14.434 -42.785 -58.119 1.00 35.31 ? 231 GLN A CA    1 
ATOM   3705  C  C     . GLN A 1 231 ? -14.209 -43.505 -56.792 1.00 35.29 ? 231 GLN A C     1 
ATOM   3706  O  O     . GLN A 1 231 ? -13.758 -44.647 -56.781 1.00 36.85 ? 231 GLN A O     1 
ATOM   3707  C  CB    . GLN A 1 231 ? -13.160 -42.888 -58.969 1.00 35.08 ? 231 GLN A CB    1 
ATOM   3708  C  CG    . GLN A 1 231 ? -13.249 -42.173 -60.331 1.00 35.50 ? 231 GLN A CG    1 
ATOM   3709  C  CD    . GLN A 1 231 ? -11.957 -42.227 -61.122 1.00 44.31 ? 231 GLN A CD    1 
ATOM   3710  O  OE1   . GLN A 1 231 ? -11.160 -41.284 -61.113 1.00 45.33 ? 231 GLN A OE1   1 
ATOM   3711  N  NE2   . GLN A 1 231 ? -11.745 -43.332 -61.825 1.00 39.34 ? 231 GLN A NE2   1 
ATOM   3712  H  H     . GLN A 1 231 ? -14.113 -40.869 -57.797 1.00 31.92 ? 231 GLN A H     1 
ATOM   3713  H  HA    . GLN A 1 231 ? -15.161 -43.238 -58.596 1.00 42.31 ? 231 GLN A HA    1 
ATOM   3714  H  HB2   . GLN A 1 231 ? -12.424 -42.493 -58.476 1.00 42.03 ? 231 GLN A HB2   1 
ATOM   3715  H  HB3   . GLN A 1 231 ? -12.975 -43.825 -59.139 1.00 42.03 ? 231 GLN A HB3   1 
ATOM   3716  H  HG2   . GLN A 1 231 ? -13.942 -42.595 -60.863 1.00 42.54 ? 231 GLN A HG2   1 
ATOM   3717  H  HG3   . GLN A 1 231 ? -13.469 -41.240 -60.182 1.00 42.54 ? 231 GLN A HG3   1 
ATOM   3718  H  HE21  . GLN A 1 231 ? -12.325 -43.967 -61.815 1.00 47.14 ? 231 GLN A HE21  1 
ATOM   3719  H  HE22  . GLN A 1 231 ? -11.027 -43.414 -62.292 1.00 47.14 ? 231 GLN A HE22  1 
ATOM   3720  N  N     . ASP A 1 232 ? -14.524 -42.843 -55.682 1.00 29.18 ? 232 ASP A N     1 
ATOM   3721  C  CA    . ASP A 1 232 ? -14.205 -43.360 -54.355 1.00 43.23 ? 232 ASP A CA    1 
ATOM   3722  C  C     . ASP A 1 232 ? -12.746 -43.772 -54.310 1.00 42.12 ? 232 ASP A C     1 
ATOM   3723  O  O     . ASP A 1 232 ? -12.413 -44.870 -53.864 1.00 38.53 ? 232 ASP A O     1 
ATOM   3724  C  CB    . ASP A 1 232 ? -15.090 -44.557 -53.984 1.00 45.14 ? 232 ASP A CB    1 
ATOM   3725  C  CG    . ASP A 1 232 ? -14.884 -45.022 -52.535 1.00 53.12 ? 232 ASP A CG    1 
ATOM   3726  O  OD1   . ASP A 1 232 ? -14.460 -44.209 -51.668 1.00 43.97 ? 232 ASP A OD1   1 
ATOM   3727  O  OD2   . ASP A 1 232 ? -15.157 -46.214 -52.269 1.00 56.55 ? 232 ASP A OD2   1 
ATOM   3728  H  H     . ASP A 1 232 ? -14.928 -42.084 -55.671 1.00 34.95 ? 232 ASP A H     1 
ATOM   3729  H  HA    . ASP A 1 232 ? -14.346 -42.654 -53.690 1.00 51.81 ? 232 ASP A HA    1 
ATOM   3730  H  HB2   . ASP A 1 232 ? -16.021 -44.305 -54.089 1.00 54.11 ? 232 ASP A HB2   1 
ATOM   3731  H  HB3   . ASP A 1 232 ? -14.879 -45.300 -54.570 1.00 54.11 ? 232 ASP A HB3   1 
ATOM   3732  N  N     . GLU A 1 233 ? -11.891 -42.882 -54.796 1.00 36.53 ? 233 GLU A N     1 
ATOM   3733  C  CA    . GLU A 1 233 ? -10.454 -43.104 -54.757 1.00 40.98 ? 233 GLU A CA    1 
ATOM   3734  C  C     . GLU A 1 233 ? -9.785  -42.045 -53.914 1.00 44.29 ? 233 GLU A C     1 
ATOM   3735  O  O     . GLU A 1 233 ? -8.569  -41.843 -53.979 1.00 46.51 ? 233 GLU A O     1 
ATOM   3736  C  CB    . GLU A 1 233 ? -9.881  -43.156 -56.171 1.00 29.18 ? 233 GLU A CB    1 
ATOM   3737  C  CG    . GLU A 1 233 ? -10.326 -44.445 -56.878 1.00 31.77 ? 233 GLU A CG    1 
ATOM   3738  C  CD    . GLU A 1 233 ? -9.866  -44.575 -58.308 1.00 31.70 ? 233 GLU A CD    1 
ATOM   3739  O  OE1   . GLU A 1 233 ? -9.141  -43.693 -58.834 1.00 29.90 ? 233 GLU A OE1   1 
ATOM   3740  O  OE2   . GLU A 1 233 ? -10.238 -45.594 -58.909 1.00 33.83 ? 233 GLU A OE2   1 
ATOM   3741  H  H     . GLU A 1 233 ? -12.121 -42.136 -55.156 1.00 43.77 ? 233 GLU A H     1 
ATOM   3742  H  HA    . GLU A 1 233 ? -10.282 -43.972 -54.335 1.00 49.12 ? 233 GLU A HA    1 
ATOM   3743  H  HB2   . GLU A 1 233 ? -10.207 -42.397 -56.681 1.00 34.95 ? 233 GLU A HB2   1 
ATOM   3744  H  HB3   . GLU A 1 233 ? -8.912  -43.146 -56.129 1.00 34.95 ? 233 GLU A HB3   1 
ATOM   3745  H  HG2   . GLU A 1 233 ? -9.973  -45.203 -56.387 1.00 38.07 ? 233 GLU A HG2   1 
ATOM   3746  H  HG3   . GLU A 1 233 ? -11.295 -44.479 -56.878 1.00 38.07 ? 233 GLU A HG3   1 
ATOM   3747  N  N     . TYR A 1 234 ? -10.595 -41.347 -53.129 1.00 40.10 ? 234 TYR A N     1 
ATOM   3748  C  CA    . TYR A 1 234 ? -10.061 -40.459 -52.130 1.00 41.06 ? 234 TYR A CA    1 
ATOM   3749  C  C     . TYR A 1 234 ? -9.784  -41.324 -50.913 1.00 47.79 ? 234 TYR A C     1 
ATOM   3750  O  O     . TYR A 1 234 ? -10.644 -42.105 -50.488 1.00 39.95 ? 234 TYR A O     1 
ATOM   3751  C  CB    . TYR A 1 234 ? -11.056 -39.369 -51.778 1.00 50.65 ? 234 TYR A CB    1 
ATOM   3752  C  CG    . TYR A 1 234 ? -10.549 -38.460 -50.697 1.00 44.82 ? 234 TYR A CG    1 
ATOM   3753  C  CD1   . TYR A 1 234 ? -10.083 -37.178 -51.002 1.00 44.85 ? 234 TYR A CD1   1 
ATOM   3754  C  CD2   . TYR A 1 234 ? -10.528 -38.879 -49.360 1.00 48.56 ? 234 TYR A CD2   1 
ATOM   3755  C  CE1   . TYR A 1 234 ? -9.601  -36.331 -49.999 1.00 50.50 ? 234 TYR A CE1   1 
ATOM   3756  C  CE2   . TYR A 1 234 ? -10.058 -38.043 -48.341 1.00 39.09 ? 234 TYR A CE2   1 
ATOM   3757  C  CZ    . TYR A 1 234 ? -9.583  -36.769 -48.672 1.00 51.85 ? 234 TYR A CZ    1 
ATOM   3758  O  OH    . TYR A 1 234 ? -9.121  -35.910 -47.687 1.00 41.68 ? 234 TYR A OH    1 
ATOM   3759  H  H     . TYR A 1 234 ? -11.454 -41.374 -53.160 1.00 48.06 ? 234 TYR A H     1 
ATOM   3760  H  HA    . TYR A 1 234 ? -9.225  -40.054 -52.442 1.00 49.21 ? 234 TYR A HA    1 
ATOM   3761  H  HB2   . TYR A 1 234 ? -11.230 -38.832 -52.567 1.00 60.71 ? 234 TYR A HB2   1 
ATOM   3762  H  HB3   . TYR A 1 234 ? -11.878 -39.779 -51.466 1.00 60.71 ? 234 TYR A HB3   1 
ATOM   3763  H  HD1   . TYR A 1 234 ? -10.086 -36.887 -51.885 1.00 53.76 ? 234 TYR A HD1   1 
ATOM   3764  H  HD2   . TYR A 1 234 ? -10.837 -39.730 -49.145 1.00 58.21 ? 234 TYR A HD2   1 
ATOM   3765  H  HE1   . TYR A 1 234 ? -9.294  -35.480 -50.213 1.00 60.54 ? 234 TYR A HE1   1 
ATOM   3766  H  HE2   . TYR A 1 234 ? -10.049 -38.336 -47.458 1.00 46.84 ? 234 TYR A HE2   1 
ATOM   3767  H  HH    . TYR A 1 234 ? -8.474  -36.241 -47.307 1.00 49.95 ? 234 TYR A HH    1 
ATOM   3768  N  N     . ASN A 1 235 ? -8.581  -41.212 -50.365 1.00 41.22 ? 235 ASN A N     1 
ATOM   3769  C  CA    . ASN A 1 235 ? -8.251  -41.977 -49.179 1.00 41.34 ? 235 ASN A CA    1 
ATOM   3770  C  C     . ASN A 1 235 ? -7.105  -41.334 -48.423 1.00 47.95 ? 235 ASN A C     1 
ATOM   3771  O  O     . ASN A 1 235 ? -6.345  -42.037 -47.774 1.00 42.94 ? 235 ASN A O     1 
ATOM   3772  C  CB    . ASN A 1 235 ? -7.880  -43.415 -49.566 1.00 48.65 ? 235 ASN A CB    1 
ATOM   3773  C  CG    . ASN A 1 235 ? -8.121  -44.422 -48.428 1.00 60.06 ? 235 ASN A CG    1 
ATOM   3774  O  OD1   . ASN A 1 235 ? -9.190  -44.433 -47.803 1.00 58.82 ? 235 ASN A OD1   1 
ATOM   3775  N  ND2   . ASN A 1 235 ? -7.127  -45.274 -48.163 1.00 50.84 ? 235 ASN A ND2   1 
ATOM   3776  H  H     . ASN A 1 235 ? -7.949  -40.707 -50.657 1.00 49.40 ? 235 ASN A H     1 
ATOM   3777  H  HA    . ASN A 1 235 ? -9.031  -42.009 -48.587 1.00 49.55 ? 235 ASN A HA    1 
ATOM   3778  H  HB2   . ASN A 1 235 ? -8.419  -43.687 -50.325 1.00 58.32 ? 235 ASN A HB2   1 
ATOM   3779  H  HB3   . ASN A 1 235 ? -6.939  -43.446 -49.799 1.00 58.32 ? 235 ASN A HB3   1 
ATOM   3780  H  HD21  . ASN A 1 235 ? -6.399  -45.241 -48.620 1.00 60.95 ? 235 ASN A HD21  1 
ATOM   3781  H  HD22  . ASN A 1 235 ? -7.214  -45.856 -47.536 1.00 60.95 ? 235 ASN A HD22  1 
ATOM   3782  N  N     . GLU A 1 236 ? -7.001  -40.005 -48.486 1.00 39.72 ? 236 GLU A N     1 
ATOM   3783  C  CA    A GLU A 1 236 ? -5.893  -39.293 -47.853 0.48 41.78 ? 236 GLU A CA    1 
ATOM   3784  C  CA    B GLU A 1 236 ? -5.896  -39.295 -47.847 0.52 41.78 ? 236 GLU A CA    1 
ATOM   3785  C  C     . GLU A 1 236 ? -5.757  -39.630 -46.362 1.00 35.92 ? 236 GLU A C     1 
ATOM   3786  O  O     . GLU A 1 236 ? -6.741  -39.831 -45.656 1.00 33.99 ? 236 GLU A O     1 
ATOM   3787  C  CB    A GLU A 1 236 ? -6.025  -37.777 -48.041 0.48 41.89 ? 236 GLU A CB    1 
ATOM   3788  C  CB    B GLU A 1 236 ? -6.049  -37.783 -48.014 0.52 41.87 ? 236 GLU A CB    1 
ATOM   3789  C  CG    A GLU A 1 236 ? -5.945  -37.285 -49.491 0.48 51.56 ? 236 GLU A CG    1 
ATOM   3790  C  CG    B GLU A 1 236 ? -5.805  -37.284 -49.425 0.52 51.57 ? 236 GLU A CG    1 
ATOM   3791  C  CD    A GLU A 1 236 ? -4.926  -38.034 -50.337 0.48 59.58 ? 236 GLU A CD    1 
ATOM   3792  C  CD    B GLU A 1 236 ? -5.746  -35.773 -49.502 0.52 59.84 ? 236 GLU A CD    1 
ATOM   3793  O  OE1   A GLU A 1 236 ? -3.876  -38.443 -49.795 0.48 65.36 ? 236 GLU A OE1   1 
ATOM   3794  O  OE1   B GLU A 1 236 ? -5.955  -35.113 -48.458 0.52 65.51 ? 236 GLU A OE1   1 
ATOM   3795  O  OE2   A GLU A 1 236 ? -5.180  -38.211 -51.550 0.48 61.71 ? 236 GLU A OE2   1 
ATOM   3796  O  OE2   B GLU A 1 236 ? -5.488  -35.249 -50.606 0.52 62.43 ? 236 GLU A OE2   1 
ATOM   3797  H  H     . GLU A 1 236 ? -7.560  -39.492 -48.891 1.00 47.60 ? 236 GLU A H     1 
ATOM   3798  H  HA    . GLU A 1 236 ? -5.061  -39.564 -48.290 0.52 50.07 ? 236 GLU A HA    1 
ATOM   3799  H  HB2   A GLU A 1 236 ? -6.883  -37.497 -47.686 0.48 50.21 ? 236 GLU A HB2   1 
ATOM   3800  H  HB2   B GLU A 1 236 ? -6.953  -37.532 -47.765 0.52 50.19 ? 236 GLU A HB2   1 
ATOM   3801  H  HB3   A GLU A 1 236 ? -5.312  -37.343 -47.546 0.48 50.21 ? 236 GLU A HB3   1 
ATOM   3802  H  HB3   B GLU A 1 236 ? -5.414  -37.339 -47.431 0.52 50.19 ? 236 GLU A HB3   1 
ATOM   3803  H  HG2   A GLU A 1 236 ? -6.814  -37.396 -49.907 0.48 61.81 ? 236 GLU A HG2   1 
ATOM   3804  H  HG2   B GLU A 1 236 ? -4.959  -37.635 -49.743 0.52 61.82 ? 236 GLU A HG2   1 
ATOM   3805  H  HG3   A GLU A 1 236 ? -5.697  -36.347 -49.490 0.48 61.81 ? 236 GLU A HG3   1 
ATOM   3806  H  HG3   B GLU A 1 236 ? -6.528  -37.586 -49.997 0.52 61.82 ? 236 GLU A HG3   1 
ATOM   3807  N  N     . PRO A 1 237 ? -4.517  -39.691 -45.884 1.00 38.06 ? 237 PRO A N     1 
ATOM   3808  C  CA    . PRO A 1 237 ? -4.203  -40.063 -44.505 1.00 36.97 ? 237 PRO A CA    1 
ATOM   3809  C  C     . PRO A 1 237 ? -4.535  -38.960 -43.500 1.00 28.79 ? 237 PRO A C     1 
ATOM   3810  O  O     . PRO A 1 237 ? -4.591  -37.781 -43.834 1.00 27.11 ? 237 PRO A O     1 
ATOM   3811  C  CB    . PRO A 1 237 ? -2.694  -40.281 -44.544 1.00 30.92 ? 237 PRO A CB    1 
ATOM   3812  C  CG    . PRO A 1 237 ? -2.218  -39.361 -45.617 1.00 44.11 ? 237 PRO A CG    1 
ATOM   3813  C  CD    . PRO A 1 237 ? -3.317  -39.314 -46.649 1.00 40.18 ? 237 PRO A CD    1 
ATOM   3814  H  HA    . PRO A 1 237 ? -4.655  -40.895 -44.253 1.00 44.31 ? 237 PRO A HA    1 
ATOM   3815  H  HB2   . PRO A 1 237 ? -2.305  -40.044 -43.687 1.00 37.05 ? 237 PRO A HB2   1 
ATOM   3816  H  HB3   . PRO A 1 237 ? -2.501  -41.204 -44.769 1.00 37.05 ? 237 PRO A HB3   1 
ATOM   3817  H  HG2   . PRO A 1 237 ? -2.066  -38.479 -45.243 1.00 52.87 ? 237 PRO A HG2   1 
ATOM   3818  H  HG3   . PRO A 1 237 ? -1.402  -39.711 -46.005 1.00 52.87 ? 237 PRO A HG3   1 
ATOM   3819  H  HD2   . PRO A 1 237 ? -3.410  -38.416 -47.004 1.00 48.15 ? 237 PRO A HD2   1 
ATOM   3820  H  HD3   . PRO A 1 237 ? -3.148  -39.960 -47.353 1.00 48.15 ? 237 PRO A HD3   1 
ATOM   3821  N  N     . ILE A 1 238 ? -4.768  -39.376 -42.271 1.00 28.50 ? 238 ILE A N     1 
ATOM   3822  C  CA    . ILE A 1 238 ? -4.855  -38.446 -41.151 1.00 36.69 ? 238 ILE A CA    1 
ATOM   3823  C  C     . ILE A 1 238 ? -3.441  -37.989 -40.818 1.00 40.12 ? 238 ILE A C     1 
ATOM   3824  O  O     . ILE A 1 238 ? -2.564  -38.806 -40.558 1.00 36.84 ? 238 ILE A O     1 
ATOM   3825  C  CB    . ILE A 1 238 ? -5.521  -39.120 -39.935 1.00 36.26 ? 238 ILE A CB    1 
ATOM   3826  C  CG1   . ILE A 1 238 ? -7.045  -39.026 -40.041 1.00 38.30 ? 238 ILE A CG1   1 
ATOM   3827  C  CG2   . ILE A 1 238 ? -5.089  -38.450 -38.622 1.00 39.55 ? 238 ILE A CG2   1 
ATOM   3828  C  CD1   . ILE A 1 238 ? -7.666  -39.902 -41.040 1.00 37.78 ? 238 ILE A CD1   1 
ATOM   3829  H  H     . ILE A 1 238 ? -4.882  -40.199 -42.052 1.00 34.14 ? 238 ILE A H     1 
ATOM   3830  H  HA    . ILE A 1 238 ? -5.386  -37.665 -41.409 1.00 43.97 ? 238 ILE A HA    1 
ATOM   3831  H  HB    . ILE A 1 238 ? -5.263  -40.054 -39.912 1.00 43.46 ? 238 ILE A HB    1 
ATOM   3832  H  HG12  . ILE A 1 238 ? -7.427  -39.253 -39.179 1.00 45.89 ? 238 ILE A HG12  1 
ATOM   3833  H  HG13  . ILE A 1 238 ? -7.281  -38.113 -40.269 1.00 45.89 ? 238 ILE A HG13  1 
ATOM   3834  H  HG21  . ILE A 1 238 ? -5.522  -38.893 -37.888 1.00 47.40 ? 238 ILE A HG21  1 
ATOM   3835  H  HG22  . ILE A 1 238 ? -4.136  -38.522 -38.533 1.00 47.40 ? 238 ILE A HG22  1 
ATOM   3836  H  HG23  . ILE A 1 238 ? -5.347  -37.525 -38.644 1.00 47.40 ? 238 ILE A HG23  1 
ATOM   3837  H  HD11  . ILE A 1 238 ? -8.616  -39.767 -41.026 1.00 45.28 ? 238 ILE A HD11  1 
ATOM   3838  H  HD12  . ILE A 1 238 ? -7.316  -39.683 -41.907 1.00 45.28 ? 238 ILE A HD12  1 
ATOM   3839  H  HD13  . ILE A 1 238 ? -7.461  -40.815 -40.825 1.00 45.28 ? 238 ILE A HD13  1 
ATOM   3840  N  N     . ARG A 1 239 ? -3.200  -36.686 -40.848 1.00 29.91 ? 239 ARG A N     1 
ATOM   3841  C  CA    . ARG A 1 239 ? -1.844  -36.187 -40.673 1.00 37.03 ? 239 ARG A CA    1 
ATOM   3842  C  C     . ARG A 1 239 ? -1.805  -35.104 -39.597 1.00 41.03 ? 239 ARG A C     1 
ATOM   3843  O  O     . ARG A 1 239 ? -2.707  -34.278 -39.498 1.00 34.01 ? 239 ARG A O     1 
ATOM   3844  C  CB    . ARG A 1 239 ? -1.322  -35.583 -41.973 1.00 38.76 ? 239 ARG A CB    1 
ATOM   3845  C  CG    . ARG A 1 239 ? -1.948  -34.224 -42.269 1.00 37.52 ? 239 ARG A CG    1 
ATOM   3846  C  CD    . ARG A 1 239 ? -1.423  -33.567 -43.557 1.00 43.31 ? 239 ARG A CD    1 
ATOM   3847  N  NE    . ARG A 1 239 ? -2.158  -32.325 -43.843 1.00 51.87 ? 239 ARG A NE    1 
ATOM   3848  C  CZ    . ARG A 1 239 ? -3.450  -32.268 -44.193 1.00 46.33 ? 239 ARG A CZ    1 
ATOM   3849  N  NH1   . ARG A 1 239 ? -4.173  -33.380 -44.303 1.00 40.51 ? 239 ARG A NH1   1 
ATOM   3850  N  NH2   . ARG A 1 239 ? -4.032  -31.091 -44.435 1.00 51.75 ? 239 ARG A NH2   1 
ATOM   3851  H  H     . ARG A 1 239 ? -3.795  -36.077 -40.967 1.00 35.83 ? 239 ARG A H     1 
ATOM   3852  H  HA    . ARG A 1 239 ? -1.252  -36.920 -40.405 1.00 44.38 ? 239 ARG A HA    1 
ATOM   3853  H  HB2   . ARG A 1 239 ? -0.362  -35.465 -41.905 1.00 46.45 ? 239 ARG A HB2   1 
ATOM   3854  H  HB3   . ARG A 1 239 ? -1.534  -36.180 -42.708 1.00 46.45 ? 239 ARG A HB3   1 
ATOM   3855  H  HG2   . ARG A 1 239 ? -2.907  -34.335 -42.362 1.00 44.96 ? 239 ARG A HG2   1 
ATOM   3856  H  HG3   . ARG A 1 239 ? -1.756  -33.624 -41.531 1.00 44.96 ? 239 ARG A HG3   1 
ATOM   3857  H  HD2   . ARG A 1 239 ? -0.483  -33.350 -43.449 1.00 51.92 ? 239 ARG A HD2   1 
ATOM   3858  H  HD3   . ARG A 1 239 ? -1.546  -34.175 -44.303 1.00 51.92 ? 239 ARG A HD3   1 
ATOM   3859  H  HE    . ARG A 1 239 ? -1.728  -31.583 -43.782 1.00 62.19 ? 239 ARG A HE    1 
ATOM   3860  H  HH11  . ARG A 1 239 ? -3.811  -34.145 -44.150 1.00 48.55 ? 239 ARG A HH11  1 
ATOM   3861  H  HH12  . ARG A 1 239 ? -5.002  -33.334 -44.528 1.00 48.55 ? 239 ARG A HH12  1 
ATOM   3862  H  HH21  . ARG A 1 239 ? -3.577  -30.364 -44.367 1.00 62.04 ? 239 ARG A HH21  1 
ATOM   3863  H  HH22  . ARG A 1 239 ? -4.862  -31.059 -44.658 1.00 62.04 ? 239 ARG A HH22  1 
ATOM   3864  N  N     . THR A 1 240 ? -0.729  -35.089 -38.825 1.00 33.74 ? 240 THR A N     1 
ATOM   3865  C  CA    . THR A 1 240 ? -0.552  -34.078 -37.796 1.00 38.71 ? 240 THR A CA    1 
ATOM   3866  C  C     . THR A 1 240 ? -0.370  -32.761 -38.514 1.00 31.37 ? 240 THR A C     1 
ATOM   3867  O  O     . THR A 1 240 ? 0.449   -32.657 -39.405 1.00 36.39 ? 240 THR A O     1 
ATOM   3868  C  CB    . THR A 1 240 ? 0.677   -34.394 -36.926 1.00 38.85 ? 240 THR A CB    1 
ATOM   3869  O  OG1   . THR A 1 240 ? 0.417   -35.591 -36.187 1.00 41.11 ? 240 THR A OG1   1 
ATOM   3870  C  CG2   . THR A 1 240 ? 0.991   -33.241 -35.953 1.00 41.59 ? 240 THR A CG2   1 
ATOM   3871  H  H     . THR A 1 240 ? -0.084  -35.656 -38.877 1.00 40.42 ? 240 THR A H     1 
ATOM   3872  H  HA    . THR A 1 240 ? -1.348  -34.030 -37.227 1.00 46.40 ? 240 THR A HA    1 
ATOM   3873  H  HB    . THR A 1 240 ? 1.449   -34.530 -37.497 1.00 46.56 ? 240 THR A HB    1 
ATOM   3874  H  HG1   . THR A 1 240 ? -0.241  -35.488 -35.708 1.00 49.27 ? 240 THR A HG1   1 
ATOM   3875  H  HG21  . THR A 1 240 ? 1.760   -33.461 -35.421 1.00 49.85 ? 240 THR A HG21  1 
ATOM   3876  H  HG22  . THR A 1 240 ? 1.170   -32.437 -36.445 1.00 49.85 ? 240 THR A HG22  1 
ATOM   3877  H  HG23  . THR A 1 240 ? 0.242   -33.090 -35.371 1.00 49.85 ? 240 THR A HG23  1 
ATOM   3878  N  N     . ARG A 1 241 ? -1.173  -31.767 -38.170 1.00 32.82 ? 241 ARG A N     1 
ATOM   3879  C  CA    . ARG A 1 241 ? -1.050  -30.491 -38.844 1.00 32.35 ? 241 ARG A CA    1 
ATOM   3880  C  C     . ARG A 1 241 ? -0.019  -29.613 -38.115 1.00 27.74 ? 241 ARG A C     1 
ATOM   3881  O  O     . ARG A 1 241 ? 0.130   -29.668 -36.893 1.00 34.21 ? 241 ARG A O     1 
ATOM   3882  C  CB    . ARG A 1 241 ? -2.412  -29.816 -39.025 1.00 50.39 ? 241 ARG A CB    1 
ATOM   3883  C  CG    . ARG A 1 241 ? -3.239  -30.458 -40.154 1.00 45.12 ? 241 ARG A CG    1 
ATOM   3884  C  CD    . ARG A 1 241 ? -4.404  -29.577 -40.649 1.00 42.24 ? 241 ARG A CD    1 
ATOM   3885  N  NE    . ARG A 1 241 ? -5.334  -30.359 -41.481 1.00 49.61 ? 241 ARG A NE    1 
ATOM   3886  C  CZ    . ARG A 1 241 ? -6.483  -29.912 -41.991 1.00 43.25 ? 241 ARG A CZ    1 
ATOM   3887  N  NH1   . ARG A 1 241 ? -6.879  -28.656 -41.790 1.00 49.71 ? 241 ARG A NH1   1 
ATOM   3888  N  NH2   . ARG A 1 241 ? -7.241  -30.729 -42.718 1.00 44.60 ? 241 ARG A NH2   1 
ATOM   3889  H  H     . ARG A 1 241 ? -1.782  -31.804 -37.564 1.00 39.32 ? 241 ARG A H     1 
ATOM   3890  H  HA    . ARG A 1 241 ? -0.696  -30.658 -39.743 1.00 38.76 ? 241 ARG A HA    1 
ATOM   3891  H  HB2   . ARG A 1 241 ? -2.916  -29.894 -38.200 1.00 60.40 ? 241 ARG A HB2   1 
ATOM   3892  H  HB3   . ARG A 1 241 ? -2.276  -28.881 -39.245 1.00 60.40 ? 241 ARG A HB3   1 
ATOM   3893  H  HG2   . ARG A 1 241 ? -2.655  -30.630 -40.910 1.00 54.08 ? 241 ARG A HG2   1 
ATOM   3894  H  HG3   . ARG A 1 241 ? -3.614  -31.292 -39.832 1.00 54.08 ? 241 ARG A HG3   1 
ATOM   3895  H  HD2   . ARG A 1 241 ? -4.892  -29.230 -39.886 1.00 50.63 ? 241 ARG A HD2   1 
ATOM   3896  H  HD3   . ARG A 1 241 ? -4.052  -28.848 -41.185 1.00 50.63 ? 241 ARG A HD3   1 
ATOM   3897  H  HE    . ARG A 1 241 ? -5.118  -31.174 -41.652 1.00 59.47 ? 241 ARG A HE    1 
ATOM   3898  H  HH11  . ARG A 1 241 ? -6.396  -28.123 -41.319 1.00 59.58 ? 241 ARG A HH11  1 
ATOM   3899  H  HH12  . ARG A 1 241 ? -7.620  -28.380 -42.128 1.00 59.58 ? 241 ARG A HH12  1 
ATOM   3900  H  HH21  . ARG A 1 241 ? -6.990  -31.540 -42.856 1.00 53.46 ? 241 ARG A HH21  1 
ATOM   3901  H  HH22  . ARG A 1 241 ? -7.979  -30.444 -43.056 1.00 53.46 ? 241 ARG A HH22  1 
ATOM   3902  N  N     . VAL A 1 242 ? 0.748   -28.895 -38.920 1.00 37.75 ? 242 VAL A N     1 
ATOM   3903  C  CA    . VAL A 1 242 ? 1.841   -28.045 -38.469 1.00 34.27 ? 242 VAL A CA    1 
ATOM   3904  C  C     . VAL A 1 242 ? 1.545   -26.624 -38.954 1.00 22.82 ? 242 VAL A C     1 
ATOM   3905  O  O     . VAL A 1 242 ? 1.280   -26.423 -40.127 1.00 23.41 ? 242 VAL A O     1 
ATOM   3906  C  CB    . VAL A 1 242 ? 3.154   -28.528 -39.082 1.00 39.59 ? 242 VAL A CB    1 
ATOM   3907  C  CG1   . VAL A 1 242 ? 4.210   -27.427 -39.056 1.00 42.24 ? 242 VAL A CG1   1 
ATOM   3908  C  CG2   . VAL A 1 242 ? 3.633   -29.784 -38.363 1.00 42.67 ? 242 VAL A CG2   1 
ATOM   3909  H  H     . VAL A 1 242 ? 0.648   -28.883 -39.774 1.00 45.23 ? 242 VAL A H     1 
ATOM   3910  H  HA    . VAL A 1 242 ? 1.908   -28.055 -37.491 1.00 41.06 ? 242 VAL A HA    1 
ATOM   3911  H  HB    . VAL A 1 242 ? 2.994   -28.765 -40.019 1.00 47.45 ? 242 VAL A HB    1 
ATOM   3912  H  HG11  . VAL A 1 242 ? 5.020   -27.763 -39.448 1.00 50.63 ? 242 VAL A HG11  1 
ATOM   3913  H  HG12  . VAL A 1 242 ? 3.890   -26.676 -39.560 1.00 50.63 ? 242 VAL A HG12  1 
ATOM   3914  H  HG13  . VAL A 1 242 ? 4.369   -27.168 -38.146 1.00 50.63 ? 242 VAL A HG13  1 
ATOM   3915  H  HG21  . VAL A 1 242 ? 3.004   -30.007 -37.672 1.00 51.15 ? 242 VAL A HG21  1 
ATOM   3916  H  HG22  . VAL A 1 242 ? 3.693   -30.503 -38.996 1.00 51.15 ? 242 VAL A HG22  1 
ATOM   3917  H  HG23  . VAL A 1 242 ? 4.496   -29.613 -37.978 1.00 51.15 ? 242 VAL A HG23  1 
ATOM   3918  N  N     . ARG A 1 243 ? 1.535   -25.672 -38.029 1.00 27.02 ? 243 ARG A N     1 
ATOM   3919  C  CA    . ARG A 1 243 ? 1.315   -24.267 -38.341 1.00 28.75 ? 243 ARG A CA    1 
ATOM   3920  C  C     . ARG A 1 243 ? 2.372   -23.795 -39.330 1.00 27.95 ? 243 ARG A C     1 
ATOM   3921  O  O     . ARG A 1 243 ? 3.566   -23.923 -39.081 1.00 26.58 ? 243 ARG A O     1 
ATOM   3922  C  CB    . ARG A 1 243 ? 1.415   -23.449 -37.051 1.00 32.88 ? 243 ARG A CB    1 
ATOM   3923  C  CG    . ARG A 1 243 ? 1.106   -21.955 -37.198 1.00 34.56 ? 243 ARG A CG    1 
ATOM   3924  C  CD    . ARG A 1 243 ? -0.383  -21.675 -37.452 1.00 33.13 ? 243 ARG A CD    1 
ATOM   3925  N  NE    . ARG A 1 243 ? -0.789  -20.278 -37.180 1.00 30.49 ? 243 ARG A NE    1 
ATOM   3926  C  CZ    . ARG A 1 243 ? -1.237  -19.832 -36.002 1.00 42.22 ? 243 ARG A CZ    1 
ATOM   3927  N  NH1   . ARG A 1 243 ? -1.311  -20.647 -34.947 1.00 45.53 ? 243 ARG A NH1   1 
ATOM   3928  N  NH2   . ARG A 1 243 ? -1.610  -18.560 -35.864 1.00 36.75 ? 243 ARG A NH2   1 
ATOM   3929  H  H     . ARG A 1 243 ? 1.656   -25.821 -37.191 1.00 32.37 ? 243 ARG A H     1 
ATOM   3930  H  HA    . ARG A 1 243 ? 0.426   -24.143 -38.734 1.00 34.44 ? 243 ARG A HA    1 
ATOM   3931  H  HB2   . ARG A 1 243 ? 0.789   -23.814 -36.406 1.00 39.39 ? 243 ARG A HB2   1 
ATOM   3932  H  HB3   . ARG A 1 243 ? 2.318   -23.527 -36.707 1.00 39.39 ? 243 ARG A HB3   1 
ATOM   3933  H  HG2   . ARG A 1 243 ? 1.362   -21.498 -36.382 1.00 41.41 ? 243 ARG A HG2   1 
ATOM   3934  H  HG3   . ARG A 1 243 ? 1.609   -21.601 -37.948 1.00 41.41 ? 243 ARG A HG3   1 
ATOM   3935  H  HD2   . ARG A 1 243 ? -0.582  -21.865 -38.382 1.00 39.69 ? 243 ARG A HD2   1 
ATOM   3936  H  HD3   . ARG A 1 243 ? -0.911  -22.253 -36.879 1.00 39.69 ? 243 ARG A HD3   1 
ATOM   3937  H  HE    . ARG A 1 243 ? -0.732  -19.713 -37.826 1.00 36.52 ? 243 ARG A HE    1 
ATOM   3938  H  HH11  . ARG A 1 243 ? -1.081  -21.472 -35.025 1.00 54.58 ? 243 ARG A HH11  1 
ATOM   3939  H  HH12  . ARG A 1 243 ? -1.595  -20.349 -34.192 1.00 54.58 ? 243 ARG A HH12  1 
ATOM   3940  H  HH21  . ARG A 1 243 ? -1.558  -18.023 -36.534 1.00 44.04 ? 243 ARG A HH21  1 
ATOM   3941  H  HH22  . ARG A 1 243 ? -1.882  -18.272 -35.101 1.00 44.04 ? 243 ARG A HH22  1 
ATOM   3942  N  N     . LYS A 1 244 ? 1.926   -23.231 -40.439 1.00 22.66 ? 244 LYS A N     1 
ATOM   3943  C  CA    . LYS A 1 244 ? 2.825   -22.826 -41.504 1.00 27.62 ? 244 LYS A CA    1 
ATOM   3944  C  C     . LYS A 1 244 ? 2.970   -21.302 -41.633 1.00 23.95 ? 244 LYS A C     1 
ATOM   3945  O  O     . LYS A 1 244 ? 3.862   -20.822 -42.303 1.00 24.58 ? 244 LYS A O     1 
ATOM   3946  C  CB    . LYS A 1 244 ? 2.348   -23.460 -42.806 1.00 26.49 ? 244 LYS A CB    1 
ATOM   3947  C  CG    . LYS A 1 244 ? 2.940   -22.840 -44.056 1.00 43.44 ? 244 LYS A CG    1 
ATOM   3948  C  CD    . LYS A 1 244 ? 2.543   -23.568 -45.355 1.00 58.93 ? 244 LYS A CD    1 
ATOM   3949  C  CE    . LYS A 1 244 ? 3.605   -23.323 -46.451 1.00 67.58 ? 244 LYS A CE    1 
ATOM   3950  N  NZ    . LYS A 1 244 ? 3.167   -23.733 -47.820 1.00 73.90 ? 244 LYS A NZ    1 
ATOM   3951  H  H     . LYS A 1 244 ? 1.097   -23.069 -40.602 1.00 27.13 ? 244 LYS A H     1 
ATOM   3952  H  HA    . LYS A 1 244 ? 3.715   -23.189 -41.311 1.00 33.08 ? 244 LYS A HA    1 
ATOM   3953  H  HB2   . LYS A 1 244 ? 2.588   -24.399 -42.800 1.00 31.72 ? 244 LYS A HB2   1 
ATOM   3954  H  HB3   . LYS A 1 244 ? 1.384   -23.369 -42.860 1.00 31.72 ? 244 LYS A HB3   1 
ATOM   3955  H  HG2   . LYS A 1 244 ? 2.635   -21.922 -44.125 1.00 52.07 ? 244 LYS A HG2   1 
ATOM   3956  H  HG3   . LYS A 1 244 ? 3.908   -22.861 -43.988 1.00 52.07 ? 244 LYS A HG3   1 
ATOM   3957  H  HD2   . LYS A 1 244 ? 2.488   -24.522 -45.188 1.00 70.65 ? 244 LYS A HD2   1 
ATOM   3958  H  HD3   . LYS A 1 244 ? 1.691   -23.228 -45.670 1.00 70.65 ? 244 LYS A HD3   1 
ATOM   3959  H  HE2   . LYS A 1 244 ? 3.813   -22.375 -46.478 1.00 81.04 ? 244 LYS A HE2   1 
ATOM   3960  H  HE3   . LYS A 1 244 ? 4.403   -23.828 -46.231 1.00 81.04 ? 244 LYS A HE3   1 
ATOM   3961  H  HZ1   . LYS A 1 244 ? 2.979   -24.603 -47.831 1.00 88.62 ? 244 LYS A HZ1   1 
ATOM   3962  H  HZ2   . LYS A 1 244 ? 2.440   -23.277 -48.056 1.00 88.62 ? 244 LYS A HZ2   1 
ATOM   3963  H  HZ3   . LYS A 1 244 ? 3.815   -23.570 -48.408 1.00 88.62 ? 244 LYS A HZ3   1 
ATOM   3964  N  N     . SER A 1 245 ? 2.113   -20.539 -40.968 1.00 17.56 ? 245 SER A N     1 
ATOM   3965  C  CA    . SER A 1 245 ? 2.224   -19.090 -41.005 1.00 15.77 ? 245 SER A CA    1 
ATOM   3966  C  C     . SER A 1 245 ? 1.557   -18.515 -39.796 1.00 17.72 ? 245 SER A C     1 
ATOM   3967  O  O     . SER A 1 245 ? 0.704   -19.160 -39.183 1.00 22.70 ? 245 SER A O     1 
ATOM   3968  C  CB    . SER A 1 245 ? 1.600   -18.518 -42.278 1.00 19.50 ? 245 SER A CB    1 
ATOM   3969  O  OG    . SER A 1 245 ? 0.181   -18.584 -42.242 1.00 19.83 ? 245 SER A OG    1 
ATOM   3970  H  H     . SER A 1 245 ? 1.461   -20.835 -40.491 1.00 21.02 ? 245 SER A H     1 
ATOM   3971  H  HA    . SER A 1 245 ? 3.171   -18.836 -40.985 1.00 18.86 ? 245 SER A HA    1 
ATOM   3972  H  HB2   . SER A 1 245 ? 1.869   -17.591 -42.369 1.00 23.34 ? 245 SER A HB2   1 
ATOM   3973  H  HB3   . SER A 1 245 ? 1.918   -19.029 -43.039 1.00 23.34 ? 245 SER A HB3   1 
ATOM   3974  H  HG    . SER A 1 245 ? -0.132  -18.273 -42.933 1.00 23.73 ? 245 SER A HG    1 
ATOM   3975  N  N     . ILE A 1 246 ? 2.001   -17.330 -39.405 1.00 12.99 ? 246 ILE A N     1 
ATOM   3976  C  CA    . ILE A 1 246 ? 1.483   -16.666 -38.228 1.00 13.93 ? 246 ILE A CA    1 
ATOM   3977  C  C     . ILE A 1 246 ? 1.455   -15.185 -38.545 1.00 15.53 ? 246 ILE A C     1 
ATOM   3978  O  O     . ILE A 1 246 ? 2.446   -14.607 -39.028 1.00 14.93 ? 246 ILE A O     1 
ATOM   3979  C  CB    . ILE A 1 246 ? 2.387   -16.886 -37.022 1.00 19.46 ? 246 ILE A CB    1 
ATOM   3980  C  CG1   . ILE A 1 246 ? 2.315   -18.342 -36.584 1.00 26.50 ? 246 ILE A CG1   1 
ATOM   3981  C  CG2   . ILE A 1 246 ? 2.023   -15.911 -35.891 1.00 23.69 ? 246 ILE A CG2   1 
ATOM   3982  C  CD1   . ILE A 1 246 ? 3.344   -18.693 -35.559 1.00 27.24 ? 246 ILE A CD1   1 
ATOM   3983  H  H     . ILE A 1 246 ? 2.614   -16.886 -39.813 1.00 15.53 ? 246 ILE A H     1 
ATOM   3984  H  HA    . ILE A 1 246 ? 0.577   -16.978 -38.024 1.00 16.65 ? 246 ILE A HA    1 
ATOM   3985  H  HB    . ILE A 1 246 ? 3.300   -16.701 -37.294 1.00 23.29 ? 246 ILE A HB    1 
ATOM   3986  H  HG12  . ILE A 1 246 ? 1.440   -18.513 -36.201 1.00 31.73 ? 246 ILE A HG12  1 
ATOM   3987  H  HG13  . ILE A 1 246 ? 2.456   -18.911 -37.357 1.00 31.73 ? 246 ILE A HG13  1 
ATOM   3988  H  HG21  . ILE A 1 246 ? 2.132   -15.012 -36.207 1.00 28.37 ? 246 ILE A HG21  1 
ATOM   3989  H  HG22  . ILE A 1 246 ? 1.110   -16.060 -35.633 1.00 28.37 ? 246 ILE A HG22  1 
ATOM   3990  H  HG23  . ILE A 1 246 ? 2.605   -16.069 -35.143 1.00 28.37 ? 246 ILE A HG23  1 
ATOM   3991  H  HD11  . ILE A 1 246 ? 3.212   -18.143 -34.783 1.00 32.62 ? 246 ILE A HD11  1 
ATOM   3992  H  HD12  . ILE A 1 246 ? 3.247   -19.619 -35.324 1.00 32.62 ? 246 ILE A HD12  1 
ATOM   3993  H  HD13  . ILE A 1 246 ? 4.217   -18.537 -35.926 1.00 32.62 ? 246 ILE A HD13  1 
ATOM   3994  N  N     . GLY A 1 247 ? 0.329   -14.557 -38.292 1.00 12.72 ? 247 GLY A N     1 
ATOM   3995  C  CA    . GLY A 1 247 ? 0.208   -13.170 -38.674 1.00 14.98 ? 247 GLY A CA    1 
ATOM   3996  C  C     . GLY A 1 247 ? -0.788  -12.399 -37.827 1.00 19.82 ? 247 GLY A C     1 
ATOM   3997  O  O     . GLY A 1 247 ? -1.412  -12.918 -36.893 1.00 14.54 ? 247 GLY A O     1 
ATOM   3998  H  H     . GLY A 1 247 ? -0.362  -14.898 -37.912 1.00 15.20 ? 247 GLY A H     1 
ATOM   3999  H  HA2   . GLY A 1 247 ? 1.074   -12.739 -38.593 1.00 17.92 ? 247 GLY A HA2   1 
ATOM   4000  H  HA3   . GLY A 1 247 ? -0.074  -13.117 -39.600 1.00 17.92 ? 247 GLY A HA3   1 
ATOM   4001  N  N     . ARG A 1 248 ? -0.907  -11.126 -38.148 1.00 13.45 ? 248 ARG A N     1 
ATOM   4002  C  CA    . ARG A 1 248 ? -1.777  -10.247 -37.389 1.00 19.79 ? 248 ARG A CA    1 
ATOM   4003  C  C     . ARG A 1 248 ? -2.167  -9.088  -38.287 1.00 18.72 ? 248 ARG A C     1 
ATOM   4004  O  O     . ARG A 1 248 ? -1.351  -8.599  -39.037 1.00 17.12 ? 248 ARG A O     1 
ATOM   4005  C  CB    . ARG A 1 248 ? -1.068  -9.785  -36.118 1.00 18.41 ? 248 ARG A CB    1 
ATOM   4006  C  CG    . ARG A 1 248 ? -1.908  -8.927  -35.220 1.00 32.20 ? 248 ARG A CG    1 
ATOM   4007  C  CD    . ARG A 1 248 ? -2.668  -9.719  -34.124 1.00 30.27 ? 248 ARG A CD    1 
ATOM   4008  N  NE    . ARG A 1 248 ? -3.253  -8.751  -33.196 1.00 41.18 ? 248 ARG A NE    1 
ATOM   4009  C  CZ    . ARG A 1 248 ? -4.362  -8.038  -33.421 1.00 41.66 ? 248 ARG A CZ    1 
ATOM   4010  N  NH1   . ARG A 1 248 ? -5.079  -8.197  -34.538 1.00 39.26 ? 248 ARG A NH1   1 
ATOM   4011  N  NH2   . ARG A 1 248 ? -4.770  -7.160  -32.513 1.00 42.70 ? 248 ARG A NH2   1 
ATOM   4012  H  H     . ARG A 1 248 ? -0.496  -10.745 -38.800 1.00 16.08 ? 248 ARG A H     1 
ATOM   4013  H  HA    . ARG A 1 248 ? -2.590  -10.730 -37.134 1.00 23.69 ? 248 ARG A HA    1 
ATOM   4014  H  HB2   . ARG A 1 248 ? -0.798  -10.567 -35.611 1.00 22.04 ? 248 ARG A HB2   1 
ATOM   4015  H  HB3   . ARG A 1 248 ? -0.284  -9.271  -36.369 1.00 22.04 ? 248 ARG A HB3   1 
ATOM   4016  H  HG2   . ARG A 1 248 ? -1.333  -8.283  -34.777 1.00 38.58 ? 248 ARG A HG2   1 
ATOM   4017  H  HG3   . ARG A 1 248 ? -2.566  -8.462  -35.760 1.00 38.58 ? 248 ARG A HG3   1 
ATOM   4018  H  HD2   . ARG A 1 248 ? -3.380  -10.241 -34.525 1.00 36.26 ? 248 ARG A HD2   1 
ATOM   4019  H  HD3   . ARG A 1 248 ? -2.050  -10.288 -33.638 1.00 36.26 ? 248 ARG A HD3   1 
ATOM   4020  H  HE    . ARG A 1 248 ? -2.852  -8.631  -32.444 1.00 49.35 ? 248 ARG A HE    1 
ATOM   4021  H  HH11  . ARG A 1 248 ? -4.821  -8.755  -35.139 1.00 47.05 ? 248 ARG A HH11  1 
ATOM   4022  H  HH12  . ARG A 1 248 ? -5.794  -7.734  -34.660 1.00 47.05 ? 248 ARG A HH12  1 
ATOM   4023  H  HH21  . ARG A 1 248 ? -4.324  -7.056  -31.785 1.00 51.18 ? 248 ARG A HH21  1 
ATOM   4024  H  HH22  . ARG A 1 248 ? -5.493  -6.713  -32.642 1.00 51.18 ? 248 ARG A HH22  1 
ATOM   4025  N  N     A ILE A 1 249 ? -3.439  -8.700  -38.270 0.85 11.84 ? 249 ILE A N     1 
ATOM   4026  C  CA    A ILE A 1 249 ? -3.888  -7.622  -39.133 0.85 13.97 ? 249 ILE A CA    1 
ATOM   4027  C  C     . ILE A 1 249 ? -4.962  -6.822  -38.367 1.00 20.78 ? 249 ILE A C     1 
ATOM   4028  O  O     . ILE A 1 249 ? -5.795  -7.406  -37.685 1.00 17.40 ? 249 ILE A O     1 
ATOM   4029  C  CB    A ILE A 1 249 ? -4.361  -8.126  -40.490 0.85 15.41 ? 249 ILE A CB    1 
ATOM   4030  C  CG1   A ILE A 1 249 ? -4.908  -6.969  -41.315 0.85 16.38 ? 249 ILE A CG1   1 
ATOM   4031  C  CG2   A ILE A 1 249 ? -5.420  -9.197  -40.345 0.85 27.50 ? 249 ILE A CG2   1 
ATOM   4032  C  CD1   A ILE A 1 249 ? -4.968  -7.260  -42.791 0.85 21.85 ? 249 ILE A CD1   1 
ATOM   4033  H  H     A ILE A 1 249 ? -4.052  -9.041  -37.773 0.85 14.15 ? 249 ILE A H     1 
ATOM   4034  H  HA    A ILE A 1 249 ? -3.132  -7.018  -39.293 0.85 16.70 ? 249 ILE A HA    1 
ATOM   4035  H  HB    A ILE A 1 249 ? -3.601  -8.506  -40.958 0.85 18.43 ? 249 ILE A HB    1 
ATOM   4036  H  HG12  A ILE A 1 249 ? -5.808  -6.768  -41.014 0.85 19.60 ? 249 ILE A HG12  1 
ATOM   4037  H  HG13  A ILE A 1 249 ? -4.337  -6.196  -41.187 0.85 19.60 ? 249 ILE A HG13  1 
ATOM   4038  H  HG21  A ILE A 1 249 ? -5.053  -9.935  -39.854 0.85 32.94 ? 249 ILE A HG21  1 
ATOM   4039  H  HG22  A ILE A 1 249 ? -6.172  -8.830  -39.874 0.85 32.94 ? 249 ILE A HG22  1 
ATOM   4040  H  HG23  A ILE A 1 249 ? -5.691  -9.487  -41.219 0.85 32.94 ? 249 ILE A HG23  1 
ATOM   4041  H  HD11  A ILE A 1 249 ? -5.320  -6.491  -43.246 0.85 26.16 ? 249 ILE A HD11  1 
ATOM   4042  H  HD12  A ILE A 1 249 ? -4.082  -7.450  -43.108 0.85 26.16 ? 249 ILE A HD12  1 
ATOM   4043  H  HD13  A ILE A 1 249 ? -5.539  -8.018  -42.937 0.85 26.16 ? 249 ILE A HD13  1 
ATOM   4044  N  N     . VAL A 1 250 ? -4.869  -5.494  -38.419 1.00 16.82 ? 250 VAL A N     1 
ATOM   4045  C  CA    . VAL A 1 250 ? -5.693  -4.641  -37.557 1.00 18.37 ? 250 VAL A CA    1 
ATOM   4046  C  C     . VAL A 1 250 ? -6.340  -3.558  -38.419 1.00 24.17 ? 250 VAL A C     1 
ATOM   4047  O  O     . VAL A 1 250 ? -5.800  -3.142  -39.465 1.00 21.32 ? 250 VAL A O     1 
ATOM   4048  C  CB    . VAL A 1 250 ? -4.863  -3.939  -36.481 1.00 27.61 ? 250 VAL A CB    1 
ATOM   4049  C  CG1   . VAL A 1 250 ? -4.206  -4.946  -35.547 1.00 28.66 ? 250 VAL A CG1   1 
ATOM   4050  C  CG2   . VAL A 1 250 ? -3.822  -3.045  -37.127 1.00 25.25 ? 250 VAL A CG2   1 
ATOM   4051  H  H     . VAL A 1 250 ? -4.340  -5.062  -38.942 1.00 20.12 ? 250 VAL A H     1 
ATOM   4052  H  HA    . VAL A 1 250 ? -6.396  -5.172  -37.127 1.00 21.98 ? 250 VAL A HA    1 
ATOM   4053  H  HB    . VAL A 1 250 ? -5.455  -3.372  -35.943 1.00 33.07 ? 250 VAL A HB    1 
ATOM   4054  H  HG11  . VAL A 1 250 ? -4.447  -5.832  -35.825 1.00 34.34 ? 250 VAL A HG11  1 
ATOM   4055  H  HG12  . VAL A 1 250 ? -3.253  -4.836  -35.592 1.00 34.34 ? 250 VAL A HG12  1 
ATOM   4056  H  HG13  . VAL A 1 250 ? -4.513  -4.788  -34.652 1.00 34.34 ? 250 VAL A HG13  1 
ATOM   4057  H  HG21  . VAL A 1 250 ? -3.311  -2.613  -36.438 1.00 30.24 ? 250 VAL A HG21  1 
ATOM   4058  H  HG22  . VAL A 1 250 ? -3.245  -3.583  -37.674 1.00 30.24 ? 250 VAL A HG22  1 
ATOM   4059  H  HG23  . VAL A 1 250 ? -4.266  -2.387  -37.667 1.00 30.24 ? 250 VAL A HG23  1 
ATOM   4060  N  N     . THR A 1 251 ? -7.502  -3.106  -37.966 1.00 18.97 ? 251 THR A N     1 
ATOM   4061  C  CA    . THR A 1 251 ? -8.239  -2.052  -38.625 1.00 20.26 ? 251 THR A CA    1 
ATOM   4062  C  C     . THR A 1 251 ? -7.759  -0.733  -38.041 1.00 24.02 ? 251 THR A C     1 
ATOM   4063  O  O     . THR A 1 251 ? -7.666  -0.592  -36.837 1.00 25.49 ? 251 THR A O     1 
ATOM   4064  C  CB    . THR A 1 251 ? -9.749  -2.253  -38.415 1.00 21.46 ? 251 THR A CB    1 
ATOM   4065  O  OG1   . THR A 1 251 ? -10.183 -3.408  -39.162 1.00 18.77 ? 251 THR A OG1   1 
ATOM   4066  C  CG2   . THR A 1 251 ? -10.533 -1.042  -38.897 1.00 31.15 ? 251 THR A CG2   1 
ATOM   4067  H  H     . THR A 1 251 ? -7.889  -3.405  -37.259 1.00 22.70 ? 251 THR A H     1 
ATOM   4068  H  HA    . THR A 1 251 ? -8.048  -2.062  -39.586 1.00 24.25 ? 251 THR A HA    1 
ATOM   4069  H  HB    . THR A 1 251 ? -9.933  -2.386  -37.472 1.00 25.70 ? 251 THR A HB    1 
ATOM   4070  H  HG1   . THR A 1 251 ? -10.033 -3.299  -39.960 1.00 22.46 ? 251 THR A HG1   1 
ATOM   4071  H  HG21  . THR A 1 251 ? -10.260 -0.260  -38.411 1.00 37.32 ? 251 THR A HG21  1 
ATOM   4072  H  HG22  . THR A 1 251 ? -10.373 -0.899  -39.833 1.00 37.32 ? 251 THR A HG22  1 
ATOM   4073  H  HG23  . THR A 1 251 ? -11.472 -1.182  -38.759 1.00 37.32 ? 251 THR A HG23  1 
ATOM   4074  N  N     . MET A 1 252 ? -7.398  0.215   -38.903 1.00 23.56 ? 252 MET A N     1 
ATOM   4075  C  CA    . MET A 1 252 ? -6.910  1.502   -38.425 1.00 28.73 ? 252 MET A CA    1 
ATOM   4076  C  C     . MET A 1 252 ? -8.098  2.427   -38.087 1.00 32.56 ? 252 MET A C     1 
ATOM   4077  O  O     . MET A 1 252 ? -9.196  2.226   -38.585 1.00 34.67 ? 252 MET A O     1 
ATOM   4078  C  CB    . MET A 1 252 ? -6.018  2.141   -39.491 1.00 37.81 ? 252 MET A CB    1 
ATOM   4079  C  CG    . MET A 1 252 ? -4.787  1.301   -39.794 1.00 28.87 ? 252 MET A CG    1 
ATOM   4080  S  SD    . MET A 1 252 ? -3.639  2.142   -40.895 1.00 29.83 ? 252 MET A SD    1 
ATOM   4081  C  CE    . MET A 1 252 ? -4.585  2.170   -42.359 1.00 26.92 ? 252 MET A CE    1 
ATOM   4082  H  H     . MET A 1 252 ? -7.426  0.138   -39.759 1.00 28.21 ? 252 MET A H     1 
ATOM   4083  H  HA    . MET A 1 252 ? -6.371  1.362   -37.618 1.00 34.42 ? 252 MET A HA    1 
ATOM   4084  H  HB2   . MET A 1 252 ? -6.526  2.239   -40.312 1.00 45.32 ? 252 MET A HB2   1 
ATOM   4085  H  HB3   . MET A 1 252 ? -5.721  3.009   -39.177 1.00 45.32 ? 252 MET A HB3   1 
ATOM   4086  H  HG2   . MET A 1 252 ? -4.323  1.108   -38.965 1.00 34.58 ? 252 MET A HG2   1 
ATOM   4087  H  HG3   . MET A 1 252 ? -5.064  0.475   -40.221 1.00 34.58 ? 252 MET A HG3   1 
ATOM   4088  H  HE1   . MET A 1 252 ? -4.786  1.268   -42.618 1.00 32.24 ? 252 MET A HE1   1 
ATOM   4089  H  HE2   . MET A 1 252 ? -5.398  2.654   -42.197 1.00 32.24 ? 252 MET A HE2   1 
ATOM   4090  H  HE3   . MET A 1 252 ? -4.078  2.604   -43.050 1.00 32.24 ? 252 MET A HE3   1 
ATOM   4091  N  N     . LYS A 1 253 ? -7.874  3.408   -37.222 1.00 34.21 ? 253 LYS A N     1 
ATOM   4092  C  CA    . LYS A 1 253 ? -8.963  4.278   -36.787 1.00 41.12 ? 253 LYS A CA    1 
ATOM   4093  C  C     . LYS A 1 253 ? -9.520  5.036   -37.987 1.00 38.63 ? 253 LYS A C     1 
ATOM   4094  O  O     . LYS A 1 253 ? -10.716 5.279   -38.095 1.00 41.14 ? 253 LYS A O     1 
ATOM   4095  C  CB    . LYS A 1 253 ? -8.502  5.219   -35.674 1.00 43.59 ? 253 LYS A CB    1 
ATOM   4096  C  CG    . LYS A 1 253 ? -8.382  4.534   -34.320 1.00 55.49 ? 253 LYS A CG    1 
ATOM   4097  C  CD    . LYS A 1 253 ? -7.925  5.494   -33.210 1.00 64.48 ? 253 LYS A CD    1 
ATOM   4098  C  CE    . LYS A 1 253 ? -6.404  5.713   -33.192 1.00 60.06 ? 253 LYS A CE    1 
ATOM   4099  N  NZ    . LYS A 1 253 ? -5.645  4.556   -32.604 1.00 66.76 ? 253 LYS A NZ    1 
ATOM   4100  H  H     . LYS A 1 253 ? -7.109  3.592   -36.873 1.00 41.00 ? 253 LYS A H     1 
ATOM   4101  H  HA    . LYS A 1 253 ? -9.684  3.721   -36.426 1.00 49.28 ? 253 LYS A HA    1 
ATOM   4102  H  HB2   . LYS A 1 253 ? -7.631  5.577   -35.906 1.00 52.25 ? 253 LYS A HB2   1 
ATOM   4103  H  HB3   . LYS A 1 253 ? -9.144  5.941   -35.588 1.00 52.25 ? 253 LYS A HB3   1 
ATOM   4104  H  HG2   . LYS A 1 253 ? -9.247  4.174   -34.069 1.00 66.52 ? 253 LYS A HG2   1 
ATOM   4105  H  HG3   . LYS A 1 253 ? -7.731  3.818   -34.384 1.00 66.52 ? 253 LYS A HG3   1 
ATOM   4106  H  HD2   . LYS A 1 253 ? -8.350  6.356   -33.345 1.00 77.31 ? 253 LYS A HD2   1 
ATOM   4107  H  HD3   . LYS A 1 253 ? -8.185  5.128   -32.350 1.00 77.31 ? 253 LYS A HD3   1 
ATOM   4108  H  HE2   . LYS A 1 253 ? -6.094  5.842   -34.102 1.00 72.01 ? 253 LYS A HE2   1 
ATOM   4109  H  HE3   . LYS A 1 253 ? -6.207  6.501   -32.661 1.00 72.01 ? 253 LYS A HE3   1 
ATOM   4110  H  HZ1   . LYS A 1 253 ? -5.801  3.819   -33.077 1.00 80.05 ? 253 LYS A HZ1   1 
ATOM   4111  H  HZ2   . LYS A 1 253 ? -4.772  4.729   -32.614 1.00 80.05 ? 253 LYS A HZ2   1 
ATOM   4112  H  HZ3   . LYS A 1 253 ? -5.903  4.420   -31.763 1.00 80.05 ? 253 LYS A HZ3   1 
ATOM   4113  N  N     . ARG A 1 254 ? -8.654  5.379   -38.925 1.00 34.18 ? 254 ARG A N     1 
ATOM   4114  C  CA    . ARG A 1 254 ? -9.139  5.937   -40.173 1.00 42.11 ? 254 ARG A CA    1 
ATOM   4115  C  C     . ARG A 1 254 ? -8.283  5.446   -41.327 1.00 37.97 ? 254 ARG A C     1 
ATOM   4116  O  O     . ARG A 1 254 ? -7.180  4.967   -41.115 1.00 36.42 ? 254 ARG A O     1 
ATOM   4117  C  CB    . ARG A 1 254 ? -9.130  7.460   -40.097 1.00 48.90 ? 254 ARG A CB    1 
ATOM   4118  C  CG    . ARG A 1 254 ? -7.848  8.030   -39.551 1.00 46.62 ? 254 ARG A CG    1 
ATOM   4119  C  CD    . ARG A 1 254 ? -7.961  9.542   -39.416 1.00 56.19 ? 254 ARG A CD    1 
ATOM   4120  N  NE    . ARG A 1 254 ? -6.695  10.207  -39.700 1.00 66.14 ? 254 ARG A NE    1 
ATOM   4121  C  CZ    . ARG A 1 254 ? -6.571  11.499  -39.985 1.00 74.20 ? 254 ARG A CZ    1 
ATOM   4122  N  NH1   . ARG A 1 254 ? -7.643  12.287  -40.024 1.00 69.22 ? 254 ARG A NH1   1 
ATOM   4123  N  NH2   . ARG A 1 254 ? -5.372  12.004  -40.234 1.00 70.65 ? 254 ARG A NH2   1 
ATOM   4124  H  H     . ARG A 1 254 ? -7.800  5.302   -38.867 1.00 40.96 ? 254 ARG A H     1 
ATOM   4125  H  HA    . ARG A 1 254 ? -10.061 5.641   -40.324 1.00 50.47 ? 254 ARG A HA    1 
ATOM   4126  H  HB2   . ARG A 1 254 ? -9.258  7.819   -40.989 1.00 58.61 ? 254 ARG A HB2   1 
ATOM   4127  H  HB3   . ARG A 1 254 ? -9.853  7.749   -39.519 1.00 58.61 ? 254 ARG A HB3   1 
ATOM   4128  H  HG2   . ARG A 1 254 ? -7.674  7.655   -38.674 1.00 55.88 ? 254 ARG A HG2   1 
ATOM   4129  H  HG3   . ARG A 1 254 ? -7.119  7.828   -40.158 1.00 55.88 ? 254 ARG A HG3   1 
ATOM   4130  H  HD2   . ARG A 1 254 ? -8.623  9.870   -40.045 1.00 67.36 ? 254 ARG A HD2   1 
ATOM   4131  H  HD3   . ARG A 1 254 ? -8.222  9.762   -38.509 1.00 67.36 ? 254 ARG A HD3   1 
ATOM   4132  H  HE    . ARG A 1 254 ? -5.979  9.730   -39.683 1.00 79.31 ? 254 ARG A HE    1 
ATOM   4133  H  HH11  . ARG A 1 254 ? -8.423  11.960  -39.865 1.00 83.00 ? 254 ARG A HH11  1 
ATOM   4134  H  HH12  . ARG A 1 254 ? -7.556  13.122  -40.209 1.00 83.00 ? 254 ARG A HH12  1 
ATOM   4135  H  HH21  . ARG A 1 254 ? -4.678  11.497  -40.208 1.00 84.71 ? 254 ARG A HH21  1 
ATOM   4136  H  HH22  . ARG A 1 254 ? -5.287  12.840  -40.417 1.00 84.71 ? 254 ARG A HH22  1 
ATOM   4137  N  N     . ASN A 1 255 ? -8.807  5.560   -42.536 1.00 37.69 ? 255 ASN A N     1 
ATOM   4138  C  CA    . ASN A 1 255 ? -8.092  5.110   -43.698 1.00 39.57 ? 255 ASN A CA    1 
ATOM   4139  C  C     . ASN A 1 255 ? -6.940  6.050   -43.934 1.00 49.67 ? 255 ASN A C     1 
ATOM   4140  O  O     . ASN A 1 255 ? -6.879  7.148   -43.361 1.00 40.57 ? 255 ASN A O     1 
ATOM   4141  C  CB    . ASN A 1 255 ? -9.005  5.044   -44.909 1.00 35.85 ? 255 ASN A CB    1 
ATOM   4142  C  CG    . ASN A 1 255 ? -10.124 4.053   -44.725 1.00 47.31 ? 255 ASN A CG    1 
ATOM   4143  O  OD1   . ASN A 1 255 ? -10.117 3.270   -43.776 1.00 42.53 ? 255 ASN A OD1   1 
ATOM   4144  N  ND2   . ASN A 1 255 ? -11.098 4.074   -45.625 1.00 40.57 ? 255 ASN A ND2   1 
ATOM   4145  H  H     . ASN A 1 255 ? -9.580  5.897   -42.705 1.00 45.17 ? 255 ASN A H     1 
ATOM   4146  H  HA    . ASN A 1 255 ? -7.731  4.214   -43.533 1.00 47.42 ? 255 ASN A HA    1 
ATOM   4147  H  HB2   . ASN A 1 255 ? -9.397  5.918   -45.059 1.00 42.96 ? 255 ASN A HB2   1 
ATOM   4148  H  HB3   . ASN A 1 255 ? -8.487  4.774   -45.683 1.00 42.96 ? 255 ASN A HB3   1 
ATOM   4149  H  HD21  . ASN A 1 255 ? -11.757 3.526   -45.560 1.00 48.63 ? 255 ASN A HD21  1 
ATOM   4150  H  HD22  . ASN A 1 255 ? -11.070 4.637   -46.275 1.00 48.63 ? 255 ASN A HD22  1 
ATOM   4151  N  N     . SER A 1 256 ? -5.995  5.620   -44.754 1.00 44.42 ? 256 SER A N     1 
ATOM   4152  C  CA    . SER A 1 256 ? -4.792  6.398   -44.879 1.00 41.39 ? 256 SER A CA    1 
ATOM   4153  C  C     . SER A 1 256 ? -3.864  5.844   -45.908 1.00 45.86 ? 256 SER A C     1 
ATOM   4154  O  O     . SER A 1 256 ? -3.910  4.657   -46.245 1.00 36.45 ? 256 SER A O     1 
ATOM   4155  C  CB    . SER A 1 256 ? -4.052  6.439   -43.554 1.00 36.81 ? 256 SER A CB    1 
ATOM   4156  O  OG    . SER A 1 256 ? -3.088  7.465   -43.570 1.00 48.44 ? 256 SER A OG    1 
ATOM   4157  H  H     . SER A 1 256 ? -6.027  4.905   -45.231 1.00 53.24 ? 256 SER A H     1 
ATOM   4158  H  HA    . SER A 1 256 ? -5.024  7.316   -45.133 1.00 49.61 ? 256 SER A HA    1 
ATOM   4159  H  HB2   . SER A 1 256 ? -4.686  6.610   -42.840 1.00 44.11 ? 256 SER A HB2   1 
ATOM   4160  H  HB3   . SER A 1 256 ? -3.609  5.588   -43.410 1.00 44.11 ? 256 SER A HB3   1 
ATOM   4161  H  HG    . SER A 1 256 ? -2.689  7.486   -42.853 1.00 58.07 ? 256 SER A HG    1 
ATOM   4162  N  N     . ARG A 1 257 ? -3.028  6.750   -46.398 1.00 48.26 ? 257 ARG A N     1 
ATOM   4163  C  CA    . ARG A 1 257 ? -1.906  6.429   -47.254 1.00 42.90 ? 257 ARG A CA    1 
ATOM   4164  C  C     . ARG A 1 257 ? -0.711  7.170   -46.691 1.00 35.92 ? 257 ARG A C     1 
ATOM   4165  O  O     . ARG A 1 257 ? 0.289   7.355   -47.370 1.00 50.91 ? 257 ARG A O     1 
ATOM   4166  C  CB    . ARG A 1 257 ? -2.188  6.866   -48.688 1.00 37.18 ? 257 ARG A CB    1 
ATOM   4167  C  CG    . ARG A 1 257 ? -3.336  6.114   -49.343 1.00 38.47 ? 257 ARG A CG    1 
ATOM   4168  C  CD    . ARG A 1 257 ? -3.511  6.530   -50.790 1.00 45.57 ? 257 ARG A CD    1 
ATOM   4169  N  NE    . ARG A 1 257 ? -2.219  6.589   -51.484 1.00 54.21 ? 257 ARG A NE    1 
ATOM   4170  C  CZ    . ARG A 1 257 ? -1.698  5.611   -52.225 1.00 43.50 ? 257 ARG A CZ    1 
ATOM   4171  N  NH1   . ARG A 1 257 ? -2.339  4.465   -52.409 1.00 41.21 ? 257 ARG A NH1   1 
ATOM   4172  N  NH2   . ARG A 1 257 ? -0.517  5.791   -52.794 1.00 45.34 ? 257 ARG A NH2   1 
ATOM   4173  H  H     . ARG A 1 257 ? -3.098  7.592   -46.237 1.00 57.85 ? 257 ARG A H     1 
ATOM   4174  H  HA    . ARG A 1 257 ? -1.729  5.466   -47.237 1.00 51.42 ? 257 ARG A HA    1 
ATOM   4175  H  HB2   . ARG A 1 257 ? -2.412  7.809   -48.690 1.00 44.56 ? 257 ARG A HB2   1 
ATOM   4176  H  HB3   . ARG A 1 257 ? -1.392  6.716   -49.223 1.00 44.56 ? 257 ARG A HB3   1 
ATOM   4177  H  HG2   . ARG A 1 257 ? -3.151  5.162   -49.320 1.00 46.10 ? 257 ARG A HG2   1 
ATOM   4178  H  HG3   . ARG A 1 257 ? -4.159  6.308   -48.868 1.00 46.10 ? 257 ARG A HG3   1 
ATOM   4179  H  HD2   . ARG A 1 257 ? -4.072  5.882   -51.245 1.00 54.62 ? 257 ARG A HD2   1 
ATOM   4180  H  HD3   . ARG A 1 257 ? -3.916  7.410   -50.824 1.00 54.62 ? 257 ARG A HD3   1 
ATOM   4181  H  HE    . ARG A 1 257 ? -1.762  7.313   -51.406 1.00 64.99 ? 257 ARG A HE    1 
ATOM   4182  H  HH11  . ARG A 1 257 ? -3.107  4.338   -52.042 1.00 49.40 ? 257 ARG A HH11  1 
ATOM   4183  H  HH12  . ARG A 1 257 ? -1.986  3.847   -52.892 1.00 49.40 ? 257 ARG A HH12  1 
ATOM   4184  H  HH21  . ARG A 1 257 ? -0.095  6.532   -52.683 1.00 54.34 ? 257 ARG A HH21  1 
ATOM   4185  H  HH22  . ARG A 1 257 ? -0.173  5.169   -53.277 1.00 54.34 ? 257 ARG A HH22  1 
ATOM   4186  N  N     . ASN A 1 258 ? -0.808  7.583   -45.430 1.00 46.09 ? 258 ASN A N     1 
ATOM   4187  C  CA    . ASN A 1 258 ? 0.289   8.273   -44.782 1.00 39.67 ? 258 ASN A CA    1 
ATOM   4188  C  C     . ASN A 1 258 ? 1.178   7.310   -44.038 1.00 51.67 ? 258 ASN A C     1 
ATOM   4189  O  O     . ASN A 1 258 ? 0.806   6.764   -42.996 1.00 44.86 ? 258 ASN A O     1 
ATOM   4190  C  CB    . ASN A 1 258 ? -0.197  9.349   -43.806 1.00 50.26 ? 258 ASN A CB    1 
ATOM   4191  C  CG    . ASN A 1 258 ? 0.963   10.102  -43.139 1.00 45.97 ? 258 ASN A CG    1 
ATOM   4192  O  OD1   . ASN A 1 258 ? 1.740   9.535   -42.360 1.00 47.78 ? 258 ASN A OD1   1 
ATOM   4193  N  ND2   . ASN A 1 258 ? 1.077   11.391  -43.443 1.00 57.54 ? 258 ASN A ND2   1 
ATOM   4194  H  H     . ASN A 1 258 ? -1.500  7.473   -44.932 1.00 55.25 ? 258 ASN A H     1 
ATOM   4195  H  HA    . ASN A 1 258 ? 0.833   8.715   -45.468 1.00 47.55 ? 258 ASN A HA    1 
ATOM   4196  H  HB2   . ASN A 1 258 ? -0.737  9.994   -44.288 1.00 60.25 ? 258 ASN A HB2   1 
ATOM   4197  H  HB3   . ASN A 1 258 ? -0.724  8.929   -43.108 1.00 60.25 ? 258 ASN A HB3   1 
ATOM   4198  H  HD21  . ASN A 1 258 ? 0.518   11.756  -43.986 1.00 68.99 ? 258 ASN A HD21  1 
ATOM   4199  H  HD22  . ASN A 1 258 ? 1.709   11.860  -43.097 1.00 68.99 ? 258 ASN A HD22  1 
ATOM   4200  N  N     . LEU A 1 259 ? 2.382   7.134   -44.560 1.00 40.55 ? 259 LEU A N     1 
ATOM   4201  C  CA    . LEU A 1 259 ? 3.313   6.184   -43.990 1.00 42.86 ? 259 LEU A CA    1 
ATOM   4202  C  C     . LEU A 1 259 ? 3.443   6.321   -42.477 1.00 46.96 ? 259 LEU A C     1 
ATOM   4203  O  O     . LEU A 1 259 ? 3.369   5.328   -41.750 1.00 40.42 ? 259 LEU A O     1 
ATOM   4204  C  CB    . LEU A 1 259 ? 4.668   6.348   -44.670 1.00 51.79 ? 259 LEU A CB    1 
ATOM   4205  C  CG    . LEU A 1 259 ? 5.567   5.125   -44.628 1.00 36.34 ? 259 LEU A CG    1 
ATOM   4206  C  CD1   . LEU A 1 259 ? 4.930   3.997   -45.360 1.00 30.33 ? 259 LEU A CD1   1 
ATOM   4207  C  CD2   . LEU A 1 259 ? 6.933   5.452   -45.218 1.00 32.29 ? 259 LEU A CD2   1 
ATOM   4208  H  H     . LEU A 1 259 ? 2.683   7.556   -45.247 1.00 48.59 ? 259 LEU A H     1 
ATOM   4209  H  HA    . LEU A 1 259 ? 2.992   5.278   -44.180 1.00 51.37 ? 259 LEU A HA    1 
ATOM   4210  H  HB2   . LEU A 1 259 ? 4.520   6.569   -45.603 1.00 62.08 ? 259 LEU A HB2   1 
ATOM   4211  H  HB3   . LEU A 1 259 ? 5.144   7.074   -44.237 1.00 62.08 ? 259 LEU A HB3   1 
ATOM   4212  H  HG    . LEU A 1 259 ? 5.694   4.854   -43.706 1.00 43.55 ? 259 LEU A HG    1 
ATOM   4213  H  HD11  . LEU A 1 259 ? 4.090   3.790   -44.943 1.00 36.33 ? 259 LEU A HD11  1 
ATOM   4214  H  HD12  . LEU A 1 259 ? 4.787   4.258   -46.273 1.00 36.33 ? 259 LEU A HD12  1 
ATOM   4215  H  HD13  . LEU A 1 259 ? 5.510   3.234   -45.324 1.00 36.33 ? 259 LEU A HD13  1 
ATOM   4216  H  HD21  . LEU A 1 259 ? 6.820   5.732   -46.130 1.00 38.69 ? 259 LEU A HD21  1 
ATOM   4217  H  HD22  . LEU A 1 259 ? 7.333   6.158   -44.706 1.00 38.69 ? 259 LEU A HD22  1 
ATOM   4218  H  HD23  . LEU A 1 259 ? 7.484   4.667   -45.182 1.00 38.69 ? 259 LEU A HD23  1 
ATOM   4219  N  N     . GLU A 1 260 ? 3.637   7.537   -41.977 1.00 38.01 ? 260 GLU A N     1 
ATOM   4220  C  CA    . GLU A 1 260 ? 3.822   7.697   -40.542 1.00 42.57 ? 260 GLU A CA    1 
ATOM   4221  C  C     . GLU A 1 260 ? 2.533   7.361   -39.760 1.00 27.19 ? 260 GLU A C     1 
ATOM   4222  O  O     . GLU A 1 260 ? 2.591   7.047   -38.579 1.00 38.69 ? 260 GLU A O     1 
ATOM   4223  C  CB    . GLU A 1 260 ? 4.294   9.119   -40.197 1.00 54.34 ? 260 GLU A CB    1 
ATOM   4224  C  CG    . GLU A 1 260 ? 5.767   9.409   -40.534 1.00 50.09 ? 260 GLU A CG    1 
ATOM   4225  C  CD    . GLU A 1 260 ? 6.752   8.565   -39.731 1.00 54.88 ? 260 GLU A CD    1 
ATOM   4226  O  OE1   . GLU A 1 260 ? 6.707   8.578   -38.482 1.00 50.93 ? 260 GLU A OE1   1 
ATOM   4227  O  OE2   . GLU A 1 260 ? 7.583   7.881   -40.357 1.00 52.41 ? 260 GLU A OE2   1 
ATOM   4228  H  H     . GLU A 1 260 ? 3.665   8.265   -42.433 1.00 45.55 ? 260 GLU A H     1 
ATOM   4229  H  HA    . GLU A 1 260 ? 4.519   7.074   -40.246 1.00 51.03 ? 260 GLU A HA    1 
ATOM   4230  H  HB2   . GLU A 1 260 ? 3.750   9.753   -40.691 1.00 65.15 ? 260 GLU A HB2   1 
ATOM   4231  H  HB3   . GLU A 1 260 ? 4.177   9.261   -39.245 1.00 65.15 ? 260 GLU A HB3   1 
ATOM   4232  H  HG2   . GLU A 1 260 ? 5.916   9.226   -41.474 1.00 60.04 ? 260 GLU A HG2   1 
ATOM   4233  H  HG3   . GLU A 1 260 ? 5.953   10.343  -40.346 1.00 60.04 ? 260 GLU A HG3   1 
ATOM   4234  N  N     . GLU A 1 261 ? 1.390   7.459   -40.420 1.00 38.95 ? 261 GLU A N     1 
ATOM   4235  C  CA    . GLU A 1 261 ? 0.121   7.173   -39.757 1.00 43.50 ? 261 GLU A CA    1 
ATOM   4236  C  C     . GLU A 1 261 ? -0.047  5.645   -39.664 1.00 43.17 ? 261 GLU A C     1 
ATOM   4237  O  O     . GLU A 1 261 ? -0.520  5.113   -38.658 1.00 36.45 ? 261 GLU A O     1 
ATOM   4238  C  CB    . GLU A 1 261 ? -1.037  7.817   -40.528 1.00 44.90 ? 261 GLU A CB    1 
ATOM   4239  C  CG    . GLU A 1 261 ? -2.364  7.839   -39.776 1.00 51.60 ? 261 GLU A CG    1 
ATOM   4240  C  CD    . GLU A 1 261 ? -3.447  8.669   -40.461 1.00 60.37 ? 261 GLU A CD    1 
ATOM   4241  O  OE1   . GLU A 1 261 ? -3.272  9.088   -41.628 1.00 56.37 ? 261 GLU A OE1   1 
ATOM   4242  O  OE2   . GLU A 1 261 ? -4.489  8.900   -39.816 1.00 59.67 ? 261 GLU A OE2   1 
ATOM   4243  H  H     . GLU A 1 261 ? 1.318   7.688   -41.245 1.00 46.67 ? 261 GLU A H     1 
ATOM   4244  H  HA    . GLU A 1 261 ? 0.134   7.541   -38.849 1.00 52.14 ? 261 GLU A HA    1 
ATOM   4245  H  HB2   . GLU A 1 261 ? -0.800  8.735   -40.734 1.00 53.82 ? 261 GLU A HB2   1 
ATOM   4246  H  HB3   . GLU A 1 261 ? -1.174  7.323   -41.352 1.00 53.82 ? 261 GLU A HB3   1 
ATOM   4247  H  HG2   . GLU A 1 261 ? -2.693  6.930   -39.696 1.00 61.86 ? 261 GLU A HG2   1 
ATOM   4248  H  HG3   . GLU A 1 261 ? -2.217  8.215   -38.894 1.00 61.86 ? 261 GLU A HG3   1 
ATOM   4249  N  N     . ILE A 1 262 ? 0.373   4.949   -40.715 1.00 44.41 ? 262 ILE A N     1 
ATOM   4250  C  CA    . ILE A 1 262 ? 0.208   3.501   -40.795 1.00 44.06 ? 262 ILE A CA    1 
ATOM   4251  C  C     . ILE A 1 262 ? 1.210   2.726   -39.945 1.00 37.77 ? 262 ILE A C     1 
ATOM   4252  O  O     . ILE A 1 262 ? 0.849   1.711   -39.333 1.00 35.90 ? 262 ILE A O     1 
ATOM   4253  C  CB    . ILE A 1 262 ? 0.289   3.028   -42.250 1.00 41.59 ? 262 ILE A CB    1 
ATOM   4254  C  CG1   . ILE A 1 262 ? -0.785  3.743   -43.060 1.00 38.65 ? 262 ILE A CG1   1 
ATOM   4255  C  CG2   . ILE A 1 262 ? 0.134   1.502   -42.330 1.00 37.83 ? 262 ILE A CG2   1 
ATOM   4256  C  CD1   . ILE A 1 262 ? -0.733  3.491   -44.539 1.00 34.57 ? 262 ILE A CD1   1 
ATOM   4257  H  H     . ILE A 1 262 ? 0.760   5.295   -41.400 1.00 53.24 ? 262 ILE A H     1 
ATOM   4258  H  HA    . ILE A 1 262 ? -0.687  3.276   -40.465 1.00 52.81 ? 262 ILE A HA    1 
ATOM   4259  H  HB    . ILE A 1 262 ? 1.158   3.270   -42.606 1.00 49.85 ? 262 ILE A HB    1 
ATOM   4260  H  HG12  . ILE A 1 262 ? -1.655  3.453   -42.744 1.00 46.32 ? 262 ILE A HG12  1 
ATOM   4261  H  HG13  . ILE A 1 262 ? -0.690  4.699   -42.922 1.00 46.32 ? 262 ILE A HG13  1 
ATOM   4262  H  HG21  . ILE A 1 262 ? -0.720  1.255   -41.965 1.00 45.33 ? 262 ILE A HG21  1 
ATOM   4263  H  HG22  . ILE A 1 262 ? 0.188   1.230   -43.249 1.00 45.33 ? 262 ILE A HG22  1 
ATOM   4264  H  HG23  . ILE A 1 262 ? 0.838   1.089   -41.824 1.00 45.33 ? 262 ILE A HG23  1 
ATOM   4265  H  HD11  . ILE A 1 262 ? -1.442  3.979   -44.964 1.00 41.43 ? 262 ILE A HD11  1 
ATOM   4266  H  HD12  . ILE A 1 262 ? 0.116   3.786   -44.876 1.00 41.43 ? 262 ILE A HD12  1 
ATOM   4267  H  HD13  . ILE A 1 262 ? -0.840  2.550   -44.699 1.00 41.43 ? 262 ILE A HD13  1 
ATOM   4268  N  N     . LYS A 1 263 ? 2.461   3.188   -39.896 1.00 33.82 ? 263 LYS A N     1 
ATOM   4269  C  CA    . LYS A 1 263 ? 3.531   2.430   -39.240 1.00 37.17 ? 263 LYS A CA    1 
ATOM   4270  C  C     . LYS A 1 263 ? 3.234   1.877   -37.852 1.00 28.81 ? 263 LYS A C     1 
ATOM   4271  O  O     . LYS A 1 263 ? 3.612   0.744   -37.537 1.00 30.46 ? 263 LYS A O     1 
ATOM   4272  C  CB    . LYS A 1 263 ? 4.818   3.270   -39.148 1.00 42.63 ? 263 LYS A CB    1 
ATOM   4273  C  CG    . LYS A 1 263 ? 5.641   3.251   -40.402 1.00 35.16 ? 263 LYS A CG    1 
ATOM   4274  C  CD    . LYS A 1 263 ? 7.119   3.625   -40.126 1.00 46.50 ? 263 LYS A CD    1 
ATOM   4275  C  CE    . LYS A 1 263 ? 7.352   5.124   -40.124 1.00 42.10 ? 263 LYS A CE    1 
ATOM   4276  N  NZ    . LYS A 1 263 ? 8.819   5.480   -40.223 1.00 30.48 ? 263 LYS A NZ    1 
ATOM   4277  H  H     . LYS A 1 263 ? 2.717   3.936   -40.233 1.00 40.52 ? 263 LYS A H     1 
ATOM   4278  H  HA    . LYS A 1 263 ? 3.737   1.659   -39.810 1.00 44.55 ? 263 LYS A HA    1 
ATOM   4279  H  HB2   . LYS A 1 263 ? 4.577   4.192   -38.964 1.00 51.09 ? 263 LYS A HB2   1 
ATOM   4280  H  HB3   . LYS A 1 263 ? 5.366   2.923   -38.427 1.00 51.09 ? 263 LYS A HB3   1 
ATOM   4281  H  HG2   . LYS A 1 263 ? 5.620   2.360   -40.784 1.00 42.13 ? 263 LYS A HG2   1 
ATOM   4282  H  HG3   . LYS A 1 263 ? 5.278   3.894   -41.031 1.00 42.13 ? 263 LYS A HG3   1 
ATOM   4283  H  HD2   . LYS A 1 263 ? 7.375   3.280   -39.257 1.00 55.74 ? 263 LYS A HD2   1 
ATOM   4284  H  HD3   . LYS A 1 263 ? 7.677   3.235   -40.816 1.00 55.74 ? 263 LYS A HD3   1 
ATOM   4285  H  HE2   . LYS A 1 263 ? 6.896   5.517   -40.885 1.00 50.46 ? 263 LYS A HE2   1 
ATOM   4286  H  HE3   . LYS A 1 263 ? 7.006   5.498   -39.299 1.00 50.46 ? 263 LYS A HE3   1 
ATOM   4287  H  HZ1   . LYS A 1 263 ? 9.262   5.136   -39.531 1.00 36.51 ? 263 LYS A HZ1   1 
ATOM   4288  H  HZ2   . LYS A 1 263 ? 9.161   5.154   -40.977 1.00 36.51 ? 263 LYS A HZ2   1 
ATOM   4289  H  HZ3   . LYS A 1 263 ? 8.918   6.365   -40.219 1.00 36.51 ? 263 LYS A HZ3   1 
ATOM   4290  N  N     . PRO A 1 264 ? 2.635   2.688   -36.975 1.00 35.30 ? 264 PRO A N     1 
ATOM   4291  C  CA    . PRO A 1 264 ? 2.427   2.186   -35.612 1.00 40.08 ? 264 PRO A CA    1 
ATOM   4292  C  C     . PRO A 1 264 ? 1.543   0.921   -35.582 1.00 23.87 ? 264 PRO A C     1 
ATOM   4293  O  O     . PRO A 1 264 ? 1.799   0.001   -34.780 1.00 30.44 ? 264 PRO A O     1 
ATOM   4294  C  CB    . PRO A 1 264 ? 1.737   3.359   -34.908 1.00 42.47 ? 264 PRO A CB    1 
ATOM   4295  C  CG    . PRO A 1 264 ? 2.109   4.561   -35.715 1.00 38.81 ? 264 PRO A CG    1 
ATOM   4296  C  CD    . PRO A 1 264 ? 2.248   4.099   -37.121 1.00 41.84 ? 264 PRO A CD    1 
ATOM   4297  H  HA    . PRO A 1 264 ? 3.286   2.000   -35.178 1.00 48.03 ? 264 PRO A HA    1 
ATOM   4298  H  HB2   . PRO A 1 264 ? 0.777   3.225   -34.912 1.00 50.90 ? 264 PRO A HB2   1 
ATOM   4299  H  HB3   . PRO A 1 264 ? 2.070   3.438   -34.000 1.00 50.90 ? 264 PRO A HB3   1 
ATOM   4300  H  HG2   . PRO A 1 264 ? 1.407   5.227   -35.645 1.00 46.52 ? 264 PRO A HG2   1 
ATOM   4301  H  HG3   . PRO A 1 264 ? 2.950   4.920   -35.392 1.00 46.52 ? 264 PRO A HG3   1 
ATOM   4302  H  HD2   . PRO A 1 264 ? 1.400   4.171   -37.587 1.00 50.15 ? 264 PRO A HD2   1 
ATOM   4303  H  HD3   . PRO A 1 264 ? 2.947   4.597   -37.573 1.00 50.15 ? 264 PRO A HD3   1 
ATOM   4304  N  N     . TYR A 1 265 ? 0.545   0.897   -36.447 1.00 28.19 ? 265 TYR A N     1 
ATOM   4305  C  CA    . TYR A 1 265 ? -0.352  -0.254  -36.560 1.00 31.39 ? 265 TYR A CA    1 
ATOM   4306  C  C     . TYR A 1 265 ? 0.425   -1.452  -37.071 1.00 29.07 ? 265 TYR A C     1 
ATOM   4307  O  O     . TYR A 1 265 ? 0.296   -2.570  -36.570 1.00 24.04 ? 265 TYR A O     1 
ATOM   4308  C  CB    . TYR A 1 265 ? -1.466  0.044   -37.526 1.00 26.99 ? 265 TYR A CB    1 
ATOM   4309  C  CG    . TYR A 1 265 ? -2.458  1.122   -37.099 1.00 32.63 ? 265 TYR A CG    1 
ATOM   4310  C  CD1   . TYR A 1 265 ? -3.464  0.848   -36.185 1.00 32.92 ? 265 TYR A CD1   1 
ATOM   4311  C  CD2   . TYR A 1 265 ? -2.421  2.394   -37.673 1.00 36.80 ? 265 TYR A CD2   1 
ATOM   4312  C  CE1   . TYR A 1 265 ? -4.392  1.817   -35.819 1.00 29.90 ? 265 TYR A CE1   1 
ATOM   4313  C  CE2   . TYR A 1 265 ? -3.346  3.374   -37.322 1.00 41.22 ? 265 TYR A CE2   1 
ATOM   4314  C  CZ    . TYR A 1 265 ? -4.328  3.085   -36.392 1.00 36.04 ? 265 TYR A CZ    1 
ATOM   4315  O  OH    . TYR A 1 265 ? -5.249  4.067   -36.047 1.00 36.87 ? 265 TYR A OH    1 
ATOM   4316  H  H     . TYR A 1 265 ? 0.359   1.539   -36.988 1.00 33.77 ? 265 TYR A H     1 
ATOM   4317  H  HA    . TYR A 1 265 ? -0.736  -0.470  -35.685 1.00 37.60 ? 265 TYR A HA    1 
ATOM   4318  H  HB2   . TYR A 1 265 ? -1.072  0.331   -38.365 1.00 32.33 ? 265 TYR A HB2   1 
ATOM   4319  H  HB3   . TYR A 1 265 ? -1.970  -0.772  -37.669 1.00 32.33 ? 265 TYR A HB3   1 
ATOM   4320  H  HD1   . TYR A 1 265 ? -3.512  0.003   -35.800 1.00 39.44 ? 265 TYR A HD1   1 
ATOM   4321  H  HD2   . TYR A 1 265 ? -1.762  2.592   -38.300 1.00 44.10 ? 265 TYR A HD2   1 
ATOM   4322  H  HE1   . TYR A 1 265 ? -5.053  1.619   -35.196 1.00 35.82 ? 265 TYR A HE1   1 
ATOM   4323  H  HE2   . TYR A 1 265 ? -3.299  4.220   -37.706 1.00 49.40 ? 265 TYR A HE2   1 
ATOM   4324  H  HH    . TYR A 1 265 ? -5.206  4.222   -35.243 1.00 44.19 ? 265 TYR A HH    1 
ATOM   4325  N  N     . LEU A 1 266 ? 1.255   -1.209  -38.071 1.00 27.54 ? 266 LEU A N     1 
ATOM   4326  C  CA    . LEU A 1 266 ? 2.047   -2.280  -38.658 1.00 24.49 ? 266 LEU A CA    1 
ATOM   4327  C  C     . LEU A 1 266 ? 3.043   -2.836  -37.654 1.00 26.29 ? 266 LEU A C     1 
ATOM   4328  O  O     . LEU A 1 266 ? 3.194   -4.062  -37.553 1.00 27.47 ? 266 LEU A O     1 
ATOM   4329  C  CB    . LEU A 1 266 ? 2.717   -1.779  -39.945 1.00 33.21 ? 266 LEU A CB    1 
ATOM   4330  C  CG    . LEU A 1 266 ? 3.628   -2.703  -40.754 1.00 26.00 ? 266 LEU A CG    1 
ATOM   4331  C  CD1   . LEU A 1 266 ? 2.912   -3.952  -41.241 1.00 25.99 ? 266 LEU A CD1   1 
ATOM   4332  C  CD2   . LEU A 1 266 ? 4.151   -1.916  -41.932 1.00 27.67 ? 266 LEU A CD2   1 
ATOM   4333  H  H     . LEU A 1 266 ? 1.379   -0.437  -38.428 1.00 32.99 ? 266 LEU A H     1 
ATOM   4334  H  HA    . LEU A 1 266 ? 1.443   -3.011  -38.907 1.00 29.33 ? 266 LEU A HA    1 
ATOM   4335  H  HB2   . LEU A 1 266 ? 2.011   -1.495  -40.547 1.00 39.79 ? 266 LEU A HB2   1 
ATOM   4336  H  HB3   . LEU A 1 266 ? 3.253   -1.005  -39.709 1.00 39.79 ? 266 LEU A HB3   1 
ATOM   4337  H  HG    . LEU A 1 266 ? 4.382   -2.974  -40.207 1.00 31.14 ? 266 LEU A HG    1 
ATOM   4338  H  HD11  . LEU A 1 266 ? 3.529   -4.491  -41.740 1.00 31.13 ? 266 LEU A HD11  1 
ATOM   4339  H  HD12  . LEU A 1 266 ? 2.587   -4.442  -40.482 1.00 31.13 ? 266 LEU A HD12  1 
ATOM   4340  H  HD13  . LEU A 1 266 ? 2.177   -3.691  -41.801 1.00 31.13 ? 266 LEU A HD13  1 
ATOM   4341  H  HD21  . LEU A 1 266 ? 4.642   -1.157  -41.608 1.00 33.14 ? 266 LEU A HD21  1 
ATOM   4342  H  HD22  . LEU A 1 266 ? 4.727   -2.480  -42.454 1.00 33.14 ? 266 LEU A HD22  1 
ATOM   4343  H  HD23  . LEU A 1 266 ? 3.409   -1.622  -42.465 1.00 33.14 ? 266 LEU A HD23  1 
ATOM   4344  N  N     . PHE A 1 267 ? 3.689   -1.964  -36.870 1.00 26.20 ? 267 PHE A N     1 
ATOM   4345  C  CA    . PHE A 1 267 ? 4.685   -2.410  -35.909 1.00 25.57 ? 267 PHE A CA    1 
ATOM   4346  C  C     . PHE A 1 267 ? 4.049   -3.162  -34.746 1.00 22.94 ? 267 PHE A C     1 
ATOM   4347  O  O     . PHE A 1 267 ? 4.637   -4.120  -34.216 1.00 26.53 ? 267 PHE A O     1 
ATOM   4348  C  CB    . PHE A 1 267 ? 5.519   -1.225  -35.385 1.00 32.68 ? 267 PHE A CB    1 
ATOM   4349  C  CG    . PHE A 1 267 ? 6.407   -0.576  -36.441 1.00 34.50 ? 267 PHE A CG    1 
ATOM   4350  C  CD1   . PHE A 1 267 ? 6.598   -1.175  -37.691 1.00 34.54 ? 267 PHE A CD1   1 
ATOM   4351  C  CD2   . PHE A 1 267 ? 7.044   0.637   -36.184 1.00 40.06 ? 267 PHE A CD2   1 
ATOM   4352  C  CE1   . PHE A 1 267 ? 7.416   -0.577  -38.662 1.00 37.10 ? 267 PHE A CE1   1 
ATOM   4353  C  CE2   . PHE A 1 267 ? 7.862   1.247   -37.147 1.00 37.28 ? 267 PHE A CE2   1 
ATOM   4354  C  CZ    . PHE A 1 267 ? 8.049   0.638   -38.387 1.00 37.13 ? 267 PHE A CZ    1 
ATOM   4355  H  H     . PHE A 1 267 ? 3.565   -1.113  -36.881 1.00 31.37 ? 267 PHE A H     1 
ATOM   4356  H  HA    . PHE A 1 267 ? 5.299   -3.028  -36.359 1.00 30.62 ? 267 PHE A HA    1 
ATOM   4357  H  HB2   . PHE A 1 267 ? 4.916   -0.545  -35.046 1.00 39.15 ? 267 PHE A HB2   1 
ATOM   4358  H  HB3   . PHE A 1 267 ? 6.094   -1.540  -34.669 1.00 39.15 ? 267 PHE A HB3   1 
ATOM   4359  H  HD1   . PHE A 1 267 ? 6.180   -1.985  -37.879 1.00 41.38 ? 267 PHE A HD1   1 
ATOM   4360  H  HD2   . PHE A 1 267 ? 6.926   1.049   -35.358 1.00 48.02 ? 267 PHE A HD2   1 
ATOM   4361  H  HE1   . PHE A 1 267 ? 7.534   -0.988  -39.488 1.00 44.46 ? 267 PHE A HE1   1 
ATOM   4362  H  HE2   . PHE A 1 267 ? 8.281   2.055   -36.958 1.00 44.68 ? 267 PHE A HE2   1 
ATOM   4363  H  HZ    . PHE A 1 267 ? 8.590   1.039   -39.029 1.00 44.50 ? 267 PHE A HZ    1 
ATOM   4364  N  N     . ARG A 1 268 ? 2.872   -2.723  -34.310 1.00 24.24 ? 268 ARG A N     1 
ATOM   4365  C  CA    . ARG A 1 268 ? 2.172   -3.484  -33.276 1.00 20.41 ? 268 ARG A CA    1 
ATOM   4366  C  C     . ARG A 1 268 ? 1.844   -4.881  -33.833 1.00 15.60 ? 268 ARG A C     1 
ATOM   4367  O  O     . ARG A 1 268 ? 1.974   -5.878  -33.121 1.00 24.43 ? 268 ARG A O     1 
ATOM   4368  C  CB    . ARG A 1 268 ? 0.883   -2.784  -32.841 1.00 31.27 ? 268 ARG A CB    1 
ATOM   4369  C  CG    . ARG A 1 268 ? 0.089   -3.611  -31.840 1.00 49.03 ? 268 ARG A CG    1 
ATOM   4370  C  CD    . ARG A 1 268 ? -0.965  -2.789  -31.099 1.00 54.57 ? 268 ARG A CD    1 
ATOM   4371  N  NE    . ARG A 1 268 ? -2.088  -2.409  -31.959 1.00 54.61 ? 268 ARG A NE    1 
ATOM   4372  C  CZ    . ARG A 1 268 ? -2.216  -1.233  -32.577 1.00 55.55 ? 268 ARG A CZ    1 
ATOM   4373  N  NH1   . ARG A 1 268 ? -1.287  -0.266  -32.453 1.00 54.13 ? 268 ARG A NH1   1 
ATOM   4374  N  NH2   . ARG A 1 268 ? -3.299  -1.017  -33.320 1.00 51.64 ? 268 ARG A NH2   1 
ATOM   4375  H  H     . ARG A 1 268 ? 2.468   -2.015  -34.584 1.00 29.03 ? 268 ARG A H     1 
ATOM   4376  H  HA    . ARG A 1 268 ? 2.753   -3.588  -32.493 1.00 24.43 ? 268 ARG A HA    1 
ATOM   4377  H  HB2   . ARG A 1 268 ? 1.107   -1.938  -32.423 1.00 37.46 ? 268 ARG A HB2   1 
ATOM   4378  H  HB3   . ARG A 1 268 ? 0.324   -2.635  -33.619 1.00 37.46 ? 268 ARG A HB3   1 
ATOM   4379  H  HG2   . ARG A 1 268 ? -0.366  -4.327  -32.311 1.00 58.77 ? 268 ARG A HG2   1 
ATOM   4380  H  HG3   . ARG A 1 268 ? 0.697   -3.981  -31.181 1.00 58.77 ? 268 ARG A HG3   1 
ATOM   4381  H  HD2   . ARG A 1 268 ? -1.315  -3.313  -30.362 1.00 65.42 ? 268 ARG A HD2   1 
ATOM   4382  H  HD3   . ARG A 1 268 ? -0.554  -1.976  -30.765 1.00 65.42 ? 268 ARG A HD3   1 
ATOM   4383  H  HE    . ARG A 1 268 ? -2.713  -2.988  -32.075 1.00 65.47 ? 268 ARG A HE    1 
ATOM   4384  H  HH11  . ARG A 1 268 ? -0.588  -0.401  -31.970 1.00 64.89 ? 268 ARG A HH11  1 
ATOM   4385  H  HH12  . ARG A 1 268 ? -1.390  0.484   -32.860 1.00 64.89 ? 268 ARG A HH12  1 
ATOM   4386  H  HH21  . ARG A 1 268 ? -3.894  -1.632  -33.402 1.00 61.91 ? 268 ARG A HH21  1 
ATOM   4387  H  HH22  . ARG A 1 268 ? -3.398  -0.266  -33.729 1.00 61.91 ? 268 ARG A HH22  1 
ATOM   4388  N  N     . ALA A 1 269 ? 1.491   -4.955  -35.119 1.00 19.90 ? 269 ALA A N     1 
ATOM   4389  C  CA    . ALA A 1 269 ? 1.141   -6.255  -35.698 1.00 18.37 ? 269 ALA A CA    1 
ATOM   4390  C  C     . ALA A 1 269 ? 2.347   -7.179  -35.726 1.00 21.60 ? 269 ALA A C     1 
ATOM   4391  O  O     . ALA A 1 269 ? 2.267   -8.372  -35.437 1.00 18.59 ? 269 ALA A O     1 
ATOM   4392  C  CB    . ALA A 1 269 ? 0.538   -6.080  -37.055 1.00 21.38 ? 269 ALA A CB    1 
ATOM   4393  H  H     . ALA A 1 269 ? 1.447   -4.290  -35.662 1.00 23.82 ? 269 ALA A H     1 
ATOM   4394  H  HA    . ALA A 1 269 ? 0.464   -6.675  -35.128 1.00 21.99 ? 269 ALA A HA    1 
ATOM   4395  H  HB1   . ALA A 1 269 ? -0.255  -5.546  -36.977 1.00 25.60 ? 269 ALA A HB1   1 
ATOM   4396  H  HB2   . ALA A 1 269 ? 1.174   -5.642  -37.625 1.00 25.60 ? 269 ALA A HB2   1 
ATOM   4397  H  HB3   . ALA A 1 269 ? 0.318   -6.944  -37.412 1.00 25.60 ? 269 ALA A HB3   1 
ATOM   4398  N  N     . ILE A 1 270 ? 3.493   -6.605  -36.051 1.00 20.02 ? 270 ILE A N     1 
ATOM   4399  C  CA    . ILE A 1 270 ? 4.735   -7.344  -36.011 1.00 20.67 ? 270 ILE A CA    1 
ATOM   4400  C  C     . ILE A 1 270 ? 5.068   -7.815  -34.615 1.00 19.57 ? 270 ILE A C     1 
ATOM   4401  O  O     . ILE A 1 270 ? 5.417   -8.980  -34.383 1.00 21.22 ? 270 ILE A O     1 
ATOM   4402  C  CB    . ILE A 1 270 ? 5.874   -6.478  -36.613 1.00 23.10 ? 270 ILE A CB    1 
ATOM   4403  C  CG1   . ILE A 1 270 ? 5.648   -6.356  -38.112 1.00 20.78 ? 270 ILE A CG1   1 
ATOM   4404  C  CG2   . ILE A 1 270 ? 7.212   -7.121  -36.358 1.00 22.56 ? 270 ILE A CG2   1 
ATOM   4405  C  CD1   . ILE A 1 270 ? 6.536   -5.341  -38.789 1.00 29.45 ? 270 ILE A CD1   1 
ATOM   4406  H  H     . ILE A 1 270 ? 3.576   -5.786  -36.299 1.00 23.97 ? 270 ILE A H     1 
ATOM   4407  H  HA    . ILE A 1 270 ? 4.641   -8.140  -36.575 1.00 24.74 ? 270 ILE A HA    1 
ATOM   4408  H  HB    . ILE A 1 270 ? 5.857   -5.596  -36.210 1.00 27.66 ? 270 ILE A HB    1 
ATOM   4409  H  HG12  . ILE A 1 270 ? 5.819   -7.218  -38.524 1.00 24.88 ? 270 ILE A HG12  1 
ATOM   4410  H  HG13  . ILE A 1 270 ? 4.728   -6.095  -38.268 1.00 24.88 ? 270 ILE A HG13  1 
ATOM   4411  H  HG21  . ILE A 1 270 ? 7.343   -7.203  -35.411 1.00 27.01 ? 270 ILE A HG21  1 
ATOM   4412  H  HG22  . ILE A 1 270 ? 7.224   -7.989  -36.767 1.00 27.01 ? 270 ILE A HG22  1 
ATOM   4413  H  HG23  . ILE A 1 270 ? 7.900   -6.570  -36.738 1.00 27.01 ? 270 ILE A HG23  1 
ATOM   4414  H  HD11  . ILE A 1 270 ? 6.372   -4.477  -38.404 1.00 35.28 ? 270 ILE A HD11  1 
ATOM   4415  H  HD12  . ILE A 1 270 ? 7.454   -5.590  -38.657 1.00 35.28 ? 270 ILE A HD12  1 
ATOM   4416  H  HD13  . ILE A 1 270 ? 6.333   -5.325  -39.727 1.00 35.28 ? 270 ILE A HD13  1 
ATOM   4417  N  N     . GLU A 1 271 ? 4.926   -6.918  -33.650 1.00 20.16 ? 271 GLU A N     1 
ATOM   4418  C  CA    . GLU A 1 271 ? 5.271   -7.252  -32.295 1.00 20.51 ? 271 GLU A CA    1 
ATOM   4419  C  C     . GLU A 1 271 ? 4.404   -8.425  -31.802 1.00 22.67 ? 271 GLU A C     1 
ATOM   4420  O  O     . GLU A 1 271 ? 4.912   -9.391  -31.224 1.00 26.07 ? 271 GLU A O     1 
ATOM   4421  C  CB    . GLU A 1 271 ? 5.063   -6.014  -31.427 1.00 32.28 ? 271 GLU A CB    1 
ATOM   4422  C  CG    . GLU A 1 271 ? 5.728   -6.076  -30.071 1.00 47.34 ? 271 GLU A CG    1 
ATOM   4423  C  CD    . GLU A 1 271 ? 7.213   -5.744  -30.113 1.00 49.23 ? 271 GLU A CD    1 
ATOM   4424  O  OE1   . GLU A 1 271 ? 7.676   -5.088  -31.079 1.00 52.77 ? 271 GLU A OE1   1 
ATOM   4425  O  OE2   . GLU A 1 271 ? 7.927   -6.148  -29.170 1.00 54.83 ? 271 GLU A OE2   1 
ATOM   4426  H  H     . GLU A 1 271 ? 4.633   -6.117  -33.761 1.00 24.13 ? 271 GLU A H     1 
ATOM   4427  H  HA    . GLU A 1 271 ? 6.214   -7.515  -32.248 1.00 24.55 ? 271 GLU A HA    1 
ATOM   4428  H  HB2   . GLU A 1 271 ? 5.421   -5.243  -31.895 1.00 38.68 ? 271 GLU A HB2   1 
ATOM   4429  H  HB3   . GLU A 1 271 ? 4.111   -5.894  -31.282 1.00 38.68 ? 271 GLU A HB3   1 
ATOM   4430  H  HG2   . GLU A 1 271 ? 5.297   -5.438  -29.480 1.00 56.74 ? 271 GLU A HG2   1 
ATOM   4431  H  HG3   . GLU A 1 271 ? 5.633   -6.973  -29.715 1.00 56.74 ? 271 GLU A HG3   1 
ATOM   4432  N  N     . GLU A 1 272 ? 3.095   -8.328  -32.027 1.00 27.04 ? 272 GLU A N     1 
ATOM   4433  C  CA    . GLU A 1 272 ? 2.160   -9.369  -31.593 1.00 23.66 ? 272 GLU A CA    1 
ATOM   4434  C  C     . GLU A 1 272 ? 2.414   -10.650 -32.355 1.00 23.97 ? 272 GLU A C     1 
ATOM   4435  O  O     . GLU A 1 272 ? 2.320   -11.736 -31.803 1.00 20.66 ? 272 GLU A O     1 
ATOM   4436  C  CB    . GLU A 1 272 ? 0.720   -8.881  -31.760 1.00 25.91 ? 272 GLU A CB    1 
ATOM   4437  C  CG    . GLU A 1 272 ? 0.459   -7.580  -30.959 1.00 35.00 ? 272 GLU A CG    1 
ATOM   4438  C  CD    . GLU A 1 272 ? -1.010  -7.164  -30.868 1.00 44.11 ? 272 GLU A CD    1 
ATOM   4439  O  OE1   . GLU A 1 272 ? -1.295  -6.081  -30.318 1.00 51.67 ? 272 GLU A OE1   1 
ATOM   4440  O  OE2   . GLU A 1 272 ? -1.877  -7.907  -31.339 1.00 40.87 ? 272 GLU A OE2   1 
ATOM   4441  H  H     . GLU A 1 272 ? 2.720   -7.667  -32.429 1.00 32.39 ? 272 GLU A H     1 
ATOM   4442  H  HA    . GLU A 1 272 ? 2.308   -9.551  -30.642 1.00 28.33 ? 272 GLU A HA    1 
ATOM   4443  H  HB2   . GLU A 1 272 ? 0.551   -8.698  -32.698 1.00 31.03 ? 272 GLU A HB2   1 
ATOM   4444  H  HB3   . GLU A 1 272 ? 0.112   -9.563  -31.437 1.00 31.03 ? 272 GLU A HB3   1 
ATOM   4445  H  HG2   . GLU A 1 272 ? 0.785   -7.704  -30.053 1.00 41.94 ? 272 GLU A HG2   1 
ATOM   4446  H  HG3   . GLU A 1 272 ? 0.944   -6.854  -31.382 1.00 41.94 ? 272 GLU A HG3   1 
ATOM   4447  N  N     . SER A 1 273 ? 2.798   -10.521 -33.623 1.00 22.20 ? 273 SER A N     1 
ATOM   4448  C  CA    . SER A 1 273 ? 3.192   -11.692 -34.396 1.00 21.75 ? 273 SER A CA    1 
ATOM   4449  C  C     . SER A 1 273 ? 4.405   -12.394 -33.818 1.00 17.83 ? 273 SER A C     1 
ATOM   4450  O  O     . SER A 1 273 ? 4.435   -13.628 -33.709 1.00 20.16 ? 273 SER A O     1 
ATOM   4451  C  CB    . SER A 1 273 ? 3.456   -11.296 -35.853 1.00 17.53 ? 273 SER A CB    1 
ATOM   4452  O  OG    . SER A 1 273 ? 2.241   -10.959 -36.481 1.00 19.23 ? 273 SER A OG    1 
ATOM   4453  H  H     . SER A 1 273 ? 2.839   -9.777  -34.053 1.00 26.58 ? 273 SER A H     1 
ATOM   4454  H  HA    . SER A 1 273 ? 2.450   -12.333 -34.393 1.00 26.04 ? 273 SER A HA    1 
ATOM   4455  H  HB2   . SER A 1 273 ? 4.050   -10.529 -35.873 1.00 20.98 ? 273 SER A HB2   1 
ATOM   4456  H  HB3   . SER A 1 273 ? 3.860   -12.045 -36.320 1.00 20.98 ? 273 SER A HB3   1 
ATOM   4457  H  HG    . SER A 1 273 ? 1.620   -11.038 -35.951 1.00 23.01 ? 273 SER A HG    1 
ATOM   4458  N  N     . TYR A 1 274 ? 5.426   -11.626 -33.446 1.00 21.85 ? 274 TYR A N     1 
ATOM   4459  C  CA    . TYR A 1 274 ? 6.648   -12.251 -32.943 1.00 20.77 ? 274 TYR A CA    1 
ATOM   4460  C  C     . TYR A 1 274 ? 6.431   -12.911 -31.577 1.00 24.47 ? 274 TYR A C     1 
ATOM   4461  O  O     . TYR A 1 274 ? 7.041   -13.950 -31.252 1.00 24.33 ? 274 TYR A O     1 
ATOM   4462  C  CB    . TYR A 1 274 ? 7.813   -11.245 -32.943 1.00 25.80 ? 274 TYR A CB    1 
ATOM   4463  C  CG    . TYR A 1 274 ? 8.591   -11.330 -34.241 1.00 24.30 ? 274 TYR A CG    1 
ATOM   4464  C  CD1   . TYR A 1 274 ? 9.795   -12.023 -34.311 1.00 23.34 ? 274 TYR A CD1   1 
ATOM   4465  C  CD2   . TYR A 1 274 ? 8.086   -10.774 -35.404 1.00 23.99 ? 274 TYR A CD2   1 
ATOM   4466  C  CE1   . TYR A 1 274 ? 10.495  -12.132 -35.505 1.00 20.40 ? 274 TYR A CE1   1 
ATOM   4467  C  CE2   . TYR A 1 274 ? 8.772   -10.874 -36.603 1.00 21.53 ? 274 TYR A CE2   1 
ATOM   4468  C  CZ    . TYR A 1 274 ? 9.977   -11.552 -36.644 1.00 20.51 ? 274 TYR A CZ    1 
ATOM   4469  O  OH    . TYR A 1 274 ? 10.622  -11.640 -37.834 1.00 22.32 ? 274 TYR A OH    1 
ATOM   4470  H  H     . TYR A 1 274 ? 5.439   -10.766 -33.472 1.00 26.16 ? 274 TYR A H     1 
ATOM   4471  H  HA    . TYR A 1 274 ? 6.895   -12.967 -33.565 1.00 24.86 ? 274 TYR A HA    1 
ATOM   4472  H  HB2   . TYR A 1 274 ? 7.462   -10.345 -32.854 1.00 30.90 ? 274 TYR A HB2   1 
ATOM   4473  H  HB3   . TYR A 1 274 ? 8.415   -11.448 -32.210 1.00 30.90 ? 274 TYR A HB3   1 
ATOM   4474  H  HD1   . TYR A 1 274 ? 10.142  -12.412 -33.541 1.00 27.95 ? 274 TYR A HD1   1 
ATOM   4475  H  HD2   . TYR A 1 274 ? 7.277   -10.317 -35.378 1.00 28.73 ? 274 TYR A HD2   1 
ATOM   4476  H  HE1   . TYR A 1 274 ? 11.304  -12.589 -35.536 1.00 24.42 ? 274 TYR A HE1   1 
ATOM   4477  H  HE2   . TYR A 1 274 ? 8.426   -10.487 -37.375 1.00 25.77 ? 274 TYR A HE2   1 
ATOM   4478  H  HH    . TYR A 1 274 ? 10.705  -12.427 -38.050 1.00 26.72 ? 274 TYR A HH    1 
ATOM   4479  N  N     . TYR A 1 275 ? 5.536   -12.327 -30.788 1.00 27.39 ? 275 TYR A N     1 
ATOM   4480  C  CA    . TYR A 1 275 ? 5.153   -12.935 -29.522 1.00 30.70 ? 275 TYR A CA    1 
ATOM   4481  C  C     . TYR A 1 275 ? 4.567   -14.326 -29.782 1.00 28.66 ? 275 TYR A C     1 
ATOM   4482  O  O     . TYR A 1 275 ? 4.957   -15.310 -29.139 1.00 26.70 ? 275 TYR A O     1 
ATOM   4483  C  CB    . TYR A 1 275 ? 4.141   -12.065 -28.774 1.00 32.47 ? 275 TYR A CB    1 
ATOM   4484  C  CG    . TYR A 1 275 ? 3.676   -12.708 -27.484 1.00 38.33 ? 275 TYR A CG    1 
ATOM   4485  C  CD1   . TYR A 1 275 ? 4.440   -12.604 -26.316 1.00 49.83 ? 275 TYR A CD1   1 
ATOM   4486  C  CD2   . TYR A 1 275 ? 2.493   -13.439 -27.432 1.00 49.68 ? 275 TYR A CD2   1 
ATOM   4487  C  CE1   . TYR A 1 275 ? 4.028   -13.199 -25.127 1.00 50.20 ? 275 TYR A CE1   1 
ATOM   4488  C  CE2   . TYR A 1 275 ? 2.070   -14.036 -26.244 1.00 60.14 ? 275 TYR A CE2   1 
ATOM   4489  C  CZ    . TYR A 1 275 ? 2.843   -13.913 -25.100 1.00 56.91 ? 275 TYR A CZ    1 
ATOM   4490  O  OH    . TYR A 1 275 ? 2.422   -14.509 -23.931 1.00 76.42 ? 275 TYR A OH    1 
ATOM   4491  H  H     . TYR A 1 275 ? 5.139   -11.584 -30.962 1.00 32.81 ? 275 TYR A H     1 
ATOM   4492  H  HA    . TYR A 1 275 ? 5.948   -13.037 -28.958 1.00 36.77 ? 275 TYR A HA    1 
ATOM   4493  H  HB2   . TYR A 1 275 ? 4.554   -11.215 -28.555 1.00 38.90 ? 275 TYR A HB2   1 
ATOM   4494  H  HB3   . TYR A 1 275 ? 3.365   -11.924 -29.338 1.00 38.90 ? 275 TYR A HB3   1 
ATOM   4495  H  HD1   . TYR A 1 275 ? 5.237   -12.124 -26.333 1.00 59.73 ? 275 TYR A HD1   1 
ATOM   4496  H  HD2   . TYR A 1 275 ? 1.972   -13.522 -28.198 1.00 59.55 ? 275 TYR A HD2   1 
ATOM   4497  H  HE1   . TYR A 1 275 ? 4.544   -13.118 -24.358 1.00 60.18 ? 275 TYR A HE1   1 
ATOM   4498  H  HE2   . TYR A 1 275 ? 1.275   -14.519 -26.221 1.00 72.11 ? 275 TYR A HE2   1 
ATOM   4499  H  HH    . TYR A 1 275 ? 2.319   -13.941 -23.349 1.00 91.64 ? 275 TYR A HH    1 
ATOM   4500  N  N     . LYS A 1 276 ? 3.677   -14.413 -30.761 1.00 24.57 ? 276 LYS A N     1 
ATOM   4501  C  CA    . LYS A 1 276 ? 3.070   -15.687 -31.124 1.00 29.71 ? 276 LYS A CA    1 
ATOM   4502  C  C     . LYS A 1 276 ? 4.080   -16.652 -31.770 1.00 30.46 ? 276 LYS A C     1 
ATOM   4503  O  O     . LYS A 1 276 ? 4.034   -17.862 -31.543 1.00 26.26 ? 276 LYS A O     1 
ATOM   4504  C  CB    . LYS A 1 276 ? 1.875   -15.469 -32.052 1.00 35.10 ? 276 LYS A CB    1 
ATOM   4505  C  CG    . LYS A 1 276 ? 0.651   -14.898 -31.359 1.00 50.98 ? 276 LYS A CG    1 
ATOM   4506  C  CD    . LYS A 1 276 ? -0.360  -14.309 -32.354 1.00 48.50 ? 276 LYS A CD    1 
ATOM   4507  C  CE    . LYS A 1 276 ? -1.008  -15.373 -33.241 1.00 59.61 ? 276 LYS A CE    1 
ATOM   4508  N  NZ    . LYS A 1 276 ? -1.859  -14.777 -34.337 1.00 57.74 ? 276 LYS A NZ    1 
ATOM   4509  H  H     . LYS A 1 276 ? 3.406   -13.747 -31.234 1.00 29.42 ? 276 LYS A H     1 
ATOM   4510  H  HA    . LYS A 1 276 ? 2.736   -16.115 -30.308 1.00 35.59 ? 276 LYS A HA    1 
ATOM   4511  H  HB2   . LYS A 1 276 ? 2.134   -14.850 -32.753 1.00 42.06 ? 276 LYS A HB2   1 
ATOM   4512  H  HB3   . LYS A 1 276 ? 1.624   -16.321 -32.442 1.00 42.06 ? 276 LYS A HB3   1 
ATOM   4513  H  HG2   . LYS A 1 276 ? 0.208   -15.605 -30.863 1.00 61.11 ? 276 LYS A HG2   1 
ATOM   4514  H  HG3   . LYS A 1 276 ? 0.928   -14.191 -30.756 1.00 61.11 ? 276 LYS A HG3   1 
ATOM   4515  H  HD2   . LYS A 1 276 ? -1.064  -13.860 -31.860 1.00 58.14 ? 276 LYS A HD2   1 
ATOM   4516  H  HD3   . LYS A 1 276 ? 0.096   -13.675 -32.930 1.00 58.14 ? 276 LYS A HD3   1 
ATOM   4517  H  HE2   . LYS A 1 276 ? -0.312  -15.905 -33.657 1.00 71.47 ? 276 LYS A HE2   1 
ATOM   4518  H  HE3   . LYS A 1 276 ? -1.576  -15.938 -32.694 1.00 71.47 ? 276 LYS A HE3   1 
ATOM   4519  H  HZ1   . LYS A 1 276 ? -2.218  -15.426 -34.830 1.00 69.23 ? 276 LYS A HZ1   1 
ATOM   4520  H  HZ2   . LYS A 1 276 ? -2.513  -14.288 -33.983 1.00 69.23 ? 276 LYS A HZ2   1 
ATOM   4521  H  HZ3   . LYS A 1 276 ? -1.361  -14.258 -34.861 1.00 69.23 ? 276 LYS A HZ3   1 
ATOM   4522  N  N     . LEU A 1 277 ? 4.995   -16.131 -32.573 1.00 25.88 ? 277 LEU A N     1 
ATOM   4523  C  CA    . LEU A 1 277 ? 6.011   -16.994 -33.183 1.00 26.22 ? 277 LEU A CA    1 
ATOM   4524  C  C     . LEU A 1 277 ? 6.804   -17.698 -32.070 1.00 26.30 ? 277 LEU A C     1 
ATOM   4525  O  O     . LEU A 1 277 ? 7.155   -18.863 -32.181 1.00 26.52 ? 277 LEU A O     1 
ATOM   4526  C  CB    . LEU A 1 277 ? 6.968   -16.176 -34.054 1.00 25.94 ? 277 LEU A CB    1 
ATOM   4527  C  CG    . LEU A 1 277 ? 6.469   -15.808 -35.458 1.00 21.37 ? 277 LEU A CG    1 
ATOM   4528  C  CD1   . LEU A 1 277 ? 7.187   -14.613 -36.000 1.00 26.34 ? 277 LEU A CD1   1 
ATOM   4529  C  CD2   . LEU A 1 277 ? 6.696   -16.993 -36.347 1.00 22.63 ? 277 LEU A CD2   1 
ATOM   4530  H  H     . LEU A 1 277 ? 5.054   -15.298 -32.782 1.00 30.99 ? 277 LEU A H     1 
ATOM   4531  H  HA    . LEU A 1 277 ? 5.579   -17.674 -33.742 1.00 31.40 ? 277 LEU A HA    1 
ATOM   4532  H  HB2   . LEU A 1 277 ? 7.165   -15.346 -33.591 1.00 31.07 ? 277 LEU A HB2   1 
ATOM   4533  H  HB3   . LEU A 1 277 ? 7.787   -16.684 -34.164 1.00 31.07 ? 277 LEU A HB3   1 
ATOM   4534  H  HG    . LEU A 1 277 ? 5.519   -15.616 -35.430 1.00 25.58 ? 277 LEU A HG    1 
ATOM   4535  H  HD11  . LEU A 1 277 ? 7.037   -13.867 -35.415 1.00 31.55 ? 277 LEU A HD11  1 
ATOM   4536  H  HD12  . LEU A 1 277 ? 8.125   -14.809 -36.048 1.00 31.55 ? 277 LEU A HD12  1 
ATOM   4537  H  HD13  . LEU A 1 277 ? 6.847   -14.416 -36.876 1.00 31.55 ? 277 LEU A HD13  1 
ATOM   4538  H  HD21  . LEU A 1 277 ? 7.634   -17.195 -36.364 1.00 27.09 ? 277 LEU A HD21  1 
ATOM   4539  H  HD22  . LEU A 1 277 ? 6.205   -17.742 -36.000 1.00 27.09 ? 277 LEU A HD22  1 
ATOM   4540  H  HD23  . LEU A 1 277 ? 6.390   -16.783 -37.232 1.00 27.09 ? 277 LEU A HD23  1 
ATOM   4541  N  N     . ASP A 1 278 ? 7.092   -16.952 -31.010 1.00 32.07 ? 278 ASP A N     1 
ATOM   4542  C  CA    . ASP A 1 278 ? 7.881   -17.473 -29.897 1.00 39.17 ? 278 ASP A CA    1 
ATOM   4543  C  C     . ASP A 1 278 ? 9.281   -17.843 -30.382 1.00 34.44 ? 278 ASP A C     1 
ATOM   4544  O  O     . ASP A 1 278 ? 10.104  -16.965 -30.651 1.00 32.40 ? 278 ASP A O     1 
ATOM   4545  C  CB    . ASP A 1 278 ? 7.176   -18.674 -29.247 1.00 35.83 ? 278 ASP A CB    1 
ATOM   4546  C  CG    . ASP A 1 278 ? 7.768   -19.047 -27.882 1.00 44.41 ? 278 ASP A CG    1 
ATOM   4547  O  OD1   . ASP A 1 278 ? 8.754   -18.417 -27.436 1.00 40.82 ? 278 ASP A OD1   1 
ATOM   4548  O  OD2   . ASP A 1 278 ? 7.242   -19.991 -27.267 1.00 38.14 ? 278 ASP A OD2   1 
ATOM   4549  H  H     . ASP A 1 278 ? 6.840   -16.136 -30.909 1.00 38.43 ? 278 ASP A H     1 
ATOM   4550  H  HA    . ASP A 1 278 ? 7.973   -16.773 -29.217 1.00 46.95 ? 278 ASP A HA    1 
ATOM   4551  H  HB2   . ASP A 1 278 ? 6.239   -18.458 -29.119 1.00 42.93 ? 278 ASP A HB2   1 
ATOM   4552  H  HB3   . ASP A 1 278 ? 7.262   -19.444 -29.831 1.00 42.93 ? 278 ASP A HB3   1 
ATOM   4553  N  N     . LYS A 1 279 ? 9.576   -19.128 -30.498 1.00 32.45 ? 279 LYS A N     1 
ATOM   4554  C  CA    . LYS A 1 279 ? 10.937  -19.506 -30.867 1.00 33.53 ? 279 LYS A CA    1 
ATOM   4555  C  C     . LYS A 1 279 ? 11.069  -19.802 -32.347 1.00 33.68 ? 279 LYS A C     1 
ATOM   4556  O  O     . LYS A 1 279 ? 12.154  -20.113 -32.828 1.00 28.34 ? 279 LYS A O     1 
ATOM   4557  C  CB    . LYS A 1 279 ? 11.401  -20.700 -30.037 1.00 42.52 ? 279 LYS A CB    1 
ATOM   4558  C  CG    . LYS A 1 279 ? 11.474  -20.372 -28.537 1.00 45.20 ? 279 LYS A CG    1 
ATOM   4559  C  CD    . LYS A 1 279 ? 12.114  -21.490 -27.722 1.00 60.05 ? 279 LYS A CD    1 
ATOM   4560  C  CE    . LYS A 1 279 ? 12.196  -21.113 -26.247 1.00 67.78 ? 279 LYS A CE    1 
ATOM   4561  N  NZ    . LYS A 1 279 ? 10.854  -21.109 -25.586 1.00 68.57 ? 279 LYS A NZ    1 
ATOM   4562  H  H     . LYS A 1 279 ? 9.031   -19.782 -30.374 1.00 38.88 ? 279 LYS A H     1 
ATOM   4563  H  HA    . LYS A 1 279 ? 11.533  -18.755 -30.663 1.00 40.17 ? 279 LYS A HA    1 
ATOM   4564  H  HB2   . LYS A 1 279 ? 10.775  -21.432 -30.155 1.00 50.96 ? 279 LYS A HB2   1 
ATOM   4565  H  HB3   . LYS A 1 279 ? 12.286  -20.967 -30.331 1.00 50.96 ? 279 LYS A HB3   1 
ATOM   4566  H  HG2   . LYS A 1 279 ? 12.005  -19.570 -28.414 1.00 54.18 ? 279 LYS A HG2   1 
ATOM   4567  H  HG3   . LYS A 1 279 ? 10.576  -20.231 -28.199 1.00 54.18 ? 279 LYS A HG3   1 
ATOM   4568  H  HD2   . LYS A 1 279 ? 11.577  -22.294 -27.802 1.00 72.00 ? 279 LYS A HD2   1 
ATOM   4569  H  HD3   . LYS A 1 279 ? 13.013  -21.651 -28.047 1.00 72.00 ? 279 LYS A HD3   1 
ATOM   4570  H  HE2   . LYS A 1 279 ? 12.757  -21.756 -25.786 1.00 81.28 ? 279 LYS A HE2   1 
ATOM   4571  H  HE3   . LYS A 1 279 ? 12.573  -20.223 -26.168 1.00 81.28 ? 279 LYS A HE3   1 
ATOM   4572  H  HZ1   . LYS A 1 279 ? 10.486  -21.918 -25.639 1.00 82.22 ? 279 LYS A HZ1   1 
ATOM   4573  H  HZ2   . LYS A 1 279 ? 10.938  -20.885 -24.729 1.00 82.22 ? 279 LYS A HZ2   1 
ATOM   4574  H  HZ3   . LYS A 1 279 ? 10.319  -20.521 -25.987 1.00 82.22 ? 279 LYS A HZ3   1 
ATOM   4575  N  N     . ARG A 1 280 ? 9.961   -19.727 -33.074 1.00 27.07 ? 280 ARG A N     1 
ATOM   4576  C  CA    . ARG A 1 280 ? 10.016  -19.949 -34.513 1.00 27.82 ? 280 ARG A CA    1 
ATOM   4577  C  C     . ARG A 1 280 ? 10.606  -18.730 -35.198 1.00 19.59 ? 280 ARG A C     1 
ATOM   4578  O  O     . ARG A 1 280 ? 10.265  -17.583 -34.870 1.00 23.82 ? 280 ARG A O     1 
ATOM   4579  C  CB    . ARG A 1 280 ? 8.619   -20.211 -35.048 1.00 28.97 ? 280 ARG A CB    1 
ATOM   4580  C  CG    . ARG A 1 280 ? 8.074   -21.574 -34.712 1.00 30.77 ? 280 ARG A CG    1 
ATOM   4581  C  CD    . ARG A 1 280 ? 6.599   -21.626 -35.052 1.00 32.14 ? 280 ARG A CD    1 
ATOM   4582  N  NE    . ARG A 1 280 ? 5.840   -20.930 -34.021 1.00 39.37 ? 280 ARG A NE    1 
ATOM   4583  C  CZ    . ARG A 1 280 ? 4.667   -21.329 -33.561 1.00 36.82 ? 280 ARG A CZ    1 
ATOM   4584  N  NH1   . ARG A 1 280 ? 4.083   -22.411 -34.065 1.00 40.92 ? 280 ARG A NH1   1 
ATOM   4585  N  NH2   . ARG A 1 280 ? 4.065   -20.624 -32.615 1.00 38.17 ? 280 ARG A NH2   1 
ATOM   4586  H  H     . ARG A 1 280 ? 9.177   -19.551 -32.766 1.00 32.42 ? 280 ARG A H     1 
ATOM   4587  H  HA    . ARG A 1 280 ? 10.580  -20.726 -34.708 1.00 33.32 ? 280 ARG A HA    1 
ATOM   4588  H  HB2   . ARG A 1 280 ? 8.014   -19.551 -34.673 1.00 34.71 ? 280 ARG A HB2   1 
ATOM   4589  H  HB3   . ARG A 1 280 ? 8.635   -20.129 -36.014 1.00 34.71 ? 280 ARG A HB3   1 
ATOM   4590  H  HG2   . ARG A 1 280 ? 8.537   -22.248 -35.234 1.00 36.87 ? 280 ARG A HG2   1 
ATOM   4591  H  HG3   . ARG A 1 280 ? 8.180   -21.743 -33.763 1.00 36.87 ? 280 ARG A HG3   1 
ATOM   4592  H  HD2   . ARG A 1 280 ? 6.443   -21.186 -35.902 1.00 38.51 ? 280 ARG A HD2   1 
ATOM   4593  H  HD3   . ARG A 1 280 ? 6.303   -22.550 -35.085 1.00 38.51 ? 280 ARG A HD3   1 
ATOM   4594  H  HE    . ARG A 1 280 ? 6.178   -20.211 -33.690 1.00 47.19 ? 280 ARG A HE    1 
ATOM   4595  H  HH11  . ARG A 1 280 ? 4.478   -22.865 -34.680 1.00 49.05 ? 280 ARG A HH11  1 
ATOM   4596  H  HH12  . ARG A 1 280 ? 3.317   -22.665 -33.768 1.00 49.05 ? 280 ARG A HH12  1 
ATOM   4597  H  HH21  . ARG A 1 280 ? 4.444   -19.921 -32.296 1.00 45.74 ? 280 ARG A HH21  1 
ATOM   4598  H  HH22  . ARG A 1 280 ? 3.297   -20.871 -32.317 1.00 45.74 ? 280 ARG A HH22  1 
ATOM   4599  N  N     . ILE A 1 281 ? 11.482  -18.965 -36.161 1.00 21.04 ? 281 ILE A N     1 
ATOM   4600  C  CA    . ILE A 1 281 ? 12.117  -17.873 -36.860 1.00 20.96 ? 281 ILE A CA    1 
ATOM   4601  C  C     . ILE A 1 281 ? 11.717  -17.936 -38.321 1.00 18.30 ? 281 ILE A C     1 
ATOM   4602  O  O     . ILE A 1 281 ? 12.020  -18.910 -38.996 1.00 20.57 ? 281 ILE A O     1 
ATOM   4603  C  CB    . ILE A 1 281 ? 13.666  -17.973 -36.800 1.00 19.45 ? 281 ILE A CB    1 
ATOM   4604  C  CG1   . ILE A 1 281 ? 14.176  -18.033 -35.358 1.00 30.89 ? 281 ILE A CG1   1 
ATOM   4605  C  CG2   . ILE A 1 281 ? 14.286  -16.804 -37.504 1.00 19.65 ? 281 ILE A CG2   1 
ATOM   4606  C  CD1   . ILE A 1 281 ? 14.128  -16.709 -34.654 1.00 38.69 ? 281 ILE A CD1   1 
ATOM   4607  H  H     . ILE A 1 281 ? 11.723  -19.747 -36.426 1.00 25.19 ? 281 ILE A H     1 
ATOM   4608  H  HA    . ILE A 1 281 ? 11.832  -17.015 -36.482 1.00 25.09 ? 281 ILE A HA    1 
ATOM   4609  H  HB    . ILE A 1 281 ? 13.938  -18.785 -37.256 1.00 23.28 ? 281 ILE A HB    1 
ATOM   4610  H  HG12  . ILE A 1 281 ? 13.628  -18.657 -34.857 1.00 37.01 ? 281 ILE A HG12  1 
ATOM   4611  H  HG13  . ILE A 1 281 ? 15.098  -18.334 -35.364 1.00 37.01 ? 281 ILE A HG13  1 
ATOM   4612  H  HG21  . ILE A 1 281 ? 15.242  -16.882 -37.457 1.00 23.52 ? 281 ILE A HG21  1 
ATOM   4613  H  HG22  . ILE A 1 281 ? 14.002  -16.805 -38.421 1.00 23.52 ? 281 ILE A HG22  1 
ATOM   4614  H  HG23  . ILE A 1 281 ? 14.002  -15.994 -37.074 1.00 23.52 ? 281 ILE A HG23  1 
ATOM   4615  H  HD11  . ILE A 1 281 ? 13.219  -16.402 -34.630 1.00 46.37 ? 281 ILE A HD11  1 
ATOM   4616  H  HD12  . ILE A 1 281 ? 14.460  -16.820 -33.760 1.00 46.37 ? 281 ILE A HD12  1 
ATOM   4617  H  HD13  . ILE A 1 281 ? 14.674  -16.081 -35.131 1.00 46.37 ? 281 ILE A HD13  1 
ATOM   4618  N  N     . PRO A 1 282 ? 11.016  -16.905 -38.806 1.00 17.39 ? 282 PRO A N     1 
ATOM   4619  C  CA    . PRO A 1 282 ? 10.480  -16.908 -40.167 1.00 19.20 ? 282 PRO A CA    1 
ATOM   4620  C  C     . PRO A 1 282 ? 11.499  -16.447 -41.212 1.00 16.94 ? 282 PRO A C     1 
ATOM   4621  O  O     . PRO A 1 282 ? 12.297  -15.559 -40.925 1.00 20.41 ? 282 PRO A O     1 
ATOM   4622  C  CB    . PRO A 1 282 ? 9.343   -15.891 -40.088 1.00 16.30 ? 282 PRO A CB    1 
ATOM   4623  C  CG    . PRO A 1 282 ? 9.807   -14.916 -39.118 1.00 19.39 ? 282 PRO A CG    1 
ATOM   4624  C  CD    . PRO A 1 282 ? 10.648  -15.671 -38.087 1.00 20.11 ? 282 PRO A CD    1 
ATOM   4625  H  HA    . PRO A 1 282 ? 10.126  -17.790 -40.405 1.00 22.97 ? 282 PRO A HA    1 
ATOM   4626  H  HB2   . PRO A 1 282 ? 9.209   -15.478 -40.956 1.00 19.50 ? 282 PRO A HB2   1 
ATOM   4627  H  HB3   . PRO A 1 282 ? 8.532   -16.326 -39.781 1.00 19.50 ? 282 PRO A HB3   1 
ATOM   4628  H  HG2   . PRO A 1 282 ? 10.346  -14.247 -39.568 1.00 23.21 ? 282 PRO A HG2   1 
ATOM   4629  H  HG3   . PRO A 1 282 ? 9.042   -14.501 -38.689 1.00 23.21 ? 282 PRO A HG3   1 
ATOM   4630  H  HD2   . PRO A 1 282 ? 11.441  -15.163 -37.858 1.00 24.07 ? 282 PRO A HD2   1 
ATOM   4631  H  HD3   . PRO A 1 282 ? 10.118  -15.881 -37.303 1.00 24.07 ? 282 PRO A HD3   1 
ATOM   4632  N  N     . LYS A 1 283 ? 11.482  -17.057 -42.396 1.00 16.10 ? 283 LYS A N     1 
ATOM   4633  C  CA    . LYS A 1 283 ? 12.283  -16.525 -43.510 1.00 19.88 ? 283 LYS A CA    1 
ATOM   4634  C  C     . LYS A 1 283 ? 11.468  -15.666 -44.480 1.00 20.74 ? 283 LYS A C     1 
ATOM   4635  O  O     . LYS A 1 283 ? 12.034  -15.004 -45.335 1.00 18.89 ? 283 LYS A O     1 
ATOM   4636  C  CB    . LYS A 1 283 ? 12.993  -17.656 -44.277 1.00 17.65 ? 283 LYS A CB    1 
ATOM   4637  C  CG    . LYS A 1 283 ? 13.937  -18.458 -43.376 1.00 21.42 ? 283 LYS A CG    1 
ATOM   4638  C  CD    . LYS A 1 283 ? 14.864  -19.392 -44.143 1.00 28.93 ? 283 LYS A CD    1 
ATOM   4639  C  CE    . LYS A 1 283 ? 14.116  -20.487 -44.863 1.00 29.28 ? 283 LYS A CE    1 
ATOM   4640  N  NZ    . LYS A 1 283 ? 13.076  -21.158 -44.035 1.00 34.67 ? 283 LYS A NZ    1 
ATOM   4641  H  H     . LYS A 1 283 ? 11.028  -17.764 -42.583 1.00 19.26 ? 283 LYS A H     1 
ATOM   4642  H  HA    . LYS A 1 283 ? 12.981  -15.950 -43.134 1.00 23.79 ? 283 LYS A HA    1 
ATOM   4643  H  HB2   . LYS A 1 283 ? 12.327  -18.265 -44.634 1.00 21.12 ? 283 LYS A HB2   1 
ATOM   4644  H  HB3   . LYS A 1 283 ? 13.516  -17.273 -44.997 1.00 21.12 ? 283 LYS A HB3   1 
ATOM   4645  H  HG2   . LYS A 1 283 ? 14.488  -17.840 -42.872 1.00 25.65 ? 283 LYS A HG2   1 
ATOM   4646  H  HG3   . LYS A 1 283 ? 13.407  -18.998 -42.769 1.00 25.65 ? 283 LYS A HG3   1 
ATOM   4647  H  HD2   . LYS A 1 283 ? 15.355  -18.879 -44.804 1.00 34.66 ? 283 LYS A HD2   1 
ATOM   4648  H  HD3   . LYS A 1 283 ? 15.481  -19.808 -43.520 1.00 34.66 ? 283 LYS A HD3   1 
ATOM   4649  H  HE2   . LYS A 1 283 ? 13.676  -20.106 -45.639 1.00 35.07 ? 283 LYS A HE2   1 
ATOM   4650  H  HE3   . LYS A 1 283 ? 14.751  -21.164 -45.146 1.00 35.07 ? 283 LYS A HE3   1 
ATOM   4651  H  HZ1   . LYS A 1 283 ? 13.451  -21.530 -43.318 1.00 41.54 ? 283 LYS A HZ1   1 
ATOM   4652  H  HZ2   . LYS A 1 283 ? 12.469  -20.564 -43.768 1.00 41.54 ? 283 LYS A HZ2   1 
ATOM   4653  H  HZ3   . LYS A 1 283 ? 12.670  -21.792 -44.510 1.00 41.54 ? 283 LYS A HZ3   1 
ATOM   4654  N  N     . ALA A 1 284 ? 10.139  -15.643 -44.345 1.00 16.09 ? 284 ALA A N     1 
ATOM   4655  C  CA    . ALA A 1 284 ? 9.335   -14.870 -45.282 1.00 13.48 ? 284 ALA A CA    1 
ATOM   4656  C  C     . ALA A 1 284 ? 8.407   -13.947 -44.527 1.00 18.72 ? 284 ALA A C     1 
ATOM   4657  O  O     . ALA A 1 284 ? 7.871   -14.322 -43.471 1.00 15.54 ? 284 ALA A O     1 
ATOM   4658  C  CB    . ALA A 1 284 ? 8.498   -15.797 -46.183 1.00 18.06 ? 284 ALA A CB    1 
ATOM   4659  H  H     . ALA A 1 284 ? 9.693   -16.055 -43.736 1.00 19.25 ? 284 ALA A H     1 
ATOM   4660  H  HA    . ALA A 1 284 ? 9.922   -14.328 -45.849 1.00 16.11 ? 284 ALA A HA    1 
ATOM   4661  H  HB1   . ALA A 1 284 ? 9.089   -16.369 -46.677 1.00 21.61 ? 284 ALA A HB1   1 
ATOM   4662  H  HB2   . ALA A 1 284 ? 7.915   -16.325 -45.633 1.00 21.61 ? 284 ALA A HB2   1 
ATOM   4663  H  HB3   . ALA A 1 284 ? 7.980   -15.260 -46.788 1.00 21.61 ? 284 ALA A HB3   1 
ATOM   4664  N  N     . ILE A 1 285 ? 8.211   -12.767 -45.096 1.00 17.88 ? 285 ILE A N     1 
ATOM   4665  C  CA    . ILE A 1 285 ? 7.319   -11.768 -44.558 1.00 17.35 ? 285 ILE A CA    1 
ATOM   4666  C  C     . ILE A 1 285 ? 6.473   -11.204 -45.679 1.00 17.02 ? 285 ILE A C     1 
ATOM   4667  O  O     . ILE A 1 285 ? 6.977   -10.893 -46.782 1.00 15.42 ? 285 ILE A O     1 
ATOM   4668  C  CB    . ILE A 1 285 ? 8.086   -10.627 -43.850 1.00 17.47 ? 285 ILE A CB    1 
ATOM   4669  C  CG1   . ILE A 1 285 ? 7.130   -9.511  -43.423 1.00 19.48 ? 285 ILE A CG1   1 
ATOM   4670  C  CG2   . ILE A 1 285 ? 9.163   -10.053 -44.755 1.00 17.66 ? 285 ILE A CG2   1 
ATOM   4671  C  CD1   . ILE A 1 285 ? 7.848   -8.353  -42.625 1.00 21.14 ? 285 ILE A CD1   1 
ATOM   4672  H  H     . ILE A 1 285 ? 8.600   -12.518 -45.821 1.00 21.40 ? 285 ILE A H     1 
ATOM   4673  H  HA    . ILE A 1 285 ? 6.722   -12.187 -43.904 1.00 20.75 ? 285 ILE A HA    1 
ATOM   4674  H  HB    . ILE A 1 285 ? 8.511   -10.989 -43.057 1.00 20.90 ? 285 ILE A HB    1 
ATOM   4675  H  HG12  . ILE A 1 285 ? 6.726   -9.123  -44.215 1.00 23.31 ? 285 ILE A HG12  1 
ATOM   4676  H  HG13  . ILE A 1 285 ? 6.442   -9.887  -42.851 1.00 23.31 ? 285 ILE A HG13  1 
ATOM   4677  H  HG21  . ILE A 1 285 ? 9.782   -10.750 -44.985 1.00 21.13 ? 285 ILE A HG21  1 
ATOM   4678  H  HG22  . ILE A 1 285 ? 8.751   -9.705  -45.549 1.00 21.13 ? 285 ILE A HG22  1 
ATOM   4679  H  HG23  . ILE A 1 285 ? 9.620   -9.349  -44.288 1.00 21.13 ? 285 ILE A HG23  1 
ATOM   4680  H  HD11  . ILE A 1 285 ? 7.198   -7.688  -42.388 1.00 25.30 ? 285 ILE A HD11  1 
ATOM   4681  H  HD12  . ILE A 1 285 ? 8.246   -8.720  -41.833 1.00 25.30 ? 285 ILE A HD12  1 
ATOM   4682  H  HD13  . ILE A 1 285 ? 8.527   -7.964  -43.182 1.00 25.30 ? 285 ILE A HD13  1 
ATOM   4683  N  N     . HIS A 1 286 ? 5.171   -11.120 -45.433 1.00 13.28 ? 286 HIS A N     1 
ATOM   4684  C  CA    . HIS A 1 286 ? 4.266   -10.460 -46.362 1.00 15.94 ? 286 HIS A CA    1 
ATOM   4685  C  C     . HIS A 1 286 ? 3.459   -9.411  -45.639 1.00 16.91 ? 286 HIS A C     1 
ATOM   4686  O  O     . HIS A 1 286 ? 2.938   -9.663  -44.560 1.00 15.74 ? 286 HIS A O     1 
ATOM   4687  C  CB    . HIS A 1 286 ? 3.304   -11.449 -47.024 1.00 20.86 ? 286 HIS A CB    1 
ATOM   4688  C  CG    . HIS A 1 286 ? 3.972   -12.404 -47.967 1.00 27.78 ? 286 HIS A CG    1 
ATOM   4689  N  ND1   . HIS A 1 286 ? 3.741   -12.389 -49.323 1.00 23.36 ? 286 HIS A ND1   1 
ATOM   4690  C  CD2   . HIS A 1 286 ? 4.868   -13.396 -47.749 1.00 26.54 ? 286 HIS A CD2   1 
ATOM   4691  C  CE1   . HIS A 1 286 ? 4.449   -13.343 -49.904 1.00 24.70 ? 286 HIS A CE1   1 
ATOM   4692  N  NE2   . HIS A 1 286 ? 5.139   -13.970 -48.968 1.00 22.27 ? 286 HIS A NE2   1 
ATOM   4693  H  H     . HIS A 1 286 ? 4.786   -11.439 -44.733 1.00 15.87 ? 286 HIS A H     1 
ATOM   4694  H  HA    . HIS A 1 286 ? 4.787   -10.018 -47.064 1.00 19.07 ? 286 HIS A HA    1 
ATOM   4695  H  HB2   . HIS A 1 286 ? 2.868   -11.971 -46.333 1.00 24.97 ? 286 HIS A HB2   1 
ATOM   4696  H  HB3   . HIS A 1 286 ? 2.641   -10.951 -47.528 1.00 24.97 ? 286 HIS A HB3   1 
ATOM   4697  H  HD1   . HIS A 1 286 ? 3.205   -11.853 -49.729 1.00 27.97 ? 286 HIS A HD1   1 
ATOM   4698  H  HD2   . HIS A 1 286 ? 5.218   -13.654 -46.927 1.00 31.79 ? 286 HIS A HD2   1 
ATOM   4699  H  HE1   . HIS A 1 286 ? 4.464   -13.534 -50.813 1.00 29.58 ? 286 HIS A HE1   1 
ATOM   4700  H  HE2   . HIS A 1 286 ? 5.683   -14.623 -49.102 1.00 26.67 ? 286 HIS A HE2   1 
ATOM   4701  N  N     . VAL A 1 287 ? 3.349   -8.238  -46.243 1.00 15.64 ? 287 VAL A N     1 
ATOM   4702  C  CA    . VAL A 1 287 ? 2.548   -7.161  -45.659 1.00 17.91 ? 287 VAL A CA    1 
ATOM   4703  C  C     . VAL A 1 287 ? 1.241   -7.191  -46.422 1.00 16.86 ? 287 VAL A C     1 
ATOM   4704  O  O     . VAL A 1 287 ? 1.238   -7.285  -47.650 1.00 18.21 ? 287 VAL A O     1 
ATOM   4705  C  CB    . VAL A 1 287 ? 3.255   -5.785  -45.770 1.00 17.99 ? 287 VAL A CB    1 
ATOM   4706  C  CG1   . VAL A 1 287 ? 2.326   -4.645  -45.386 1.00 17.13 ? 287 VAL A CG1   1 
ATOM   4707  C  CG2   . VAL A 1 287 ? 4.535   -5.786  -44.932 1.00 19.94 ? 287 VAL A CG2   1 
ATOM   4708  H  H     . VAL A 1 287 ? 3.724   -8.035  -46.990 1.00 18.71 ? 287 VAL A H     1 
ATOM   4709  H  HA    . VAL A 1 287 ? 2.369   -7.352  -44.715 1.00 21.44 ? 287 VAL A HA    1 
ATOM   4710  H  HB    . VAL A 1 287 ? 3.517   -5.647  -46.704 1.00 21.53 ? 287 VAL A HB    1 
ATOM   4711  H  HG11  . VAL A 1 287 ? 2.801   -3.814  -45.468 1.00 20.50 ? 287 VAL A HG11  1 
ATOM   4712  H  HG12  . VAL A 1 287 ? 1.568   -4.648  -45.975 1.00 20.50 ? 287 VAL A HG12  1 
ATOM   4713  H  HG13  . VAL A 1 287 ? 2.038   -4.769  -44.479 1.00 20.50 ? 287 VAL A HG13  1 
ATOM   4714  H  HG21  . VAL A 1 287 ? 4.960   -4.929  -45.011 1.00 23.87 ? 287 VAL A HG21  1 
ATOM   4715  H  HG22  . VAL A 1 287 ? 4.307   -5.956  -44.015 1.00 23.87 ? 287 VAL A HG22  1 
ATOM   4716  H  HG23  . VAL A 1 287 ? 5.120   -6.474  -45.258 1.00 23.87 ? 287 VAL A HG23  1 
ATOM   4717  N  N     . VAL A 1 288 ? 0.135   -7.134  -45.679 1.00 16.54 ? 288 VAL A N     1 
ATOM   4718  C  CA    . VAL A 1 288 ? -1.170  -7.289  -46.246 1.00 16.58 ? 288 VAL A CA    1 
ATOM   4719  C  C     . VAL A 1 288 ? -1.971  -6.054  -45.930 1.00 25.39 ? 288 VAL A C     1 
ATOM   4720  O  O     . VAL A 1 288 ? -2.027  -5.620  -44.784 1.00 18.07 ? 288 VAL A O     1 
ATOM   4721  C  CB    . VAL A 1 288 ? -1.900  -8.497  -45.658 1.00 21.07 ? 288 VAL A CB    1 
ATOM   4722  C  CG1   . VAL A 1 288 ? -3.269  -8.644  -46.289 1.00 24.54 ? 288 VAL A CG1   1 
ATOM   4723  C  CG2   . VAL A 1 288 ? -1.083  -9.756  -45.862 1.00 20.35 ? 288 VAL A CG2   1 
ATOM   4724  H  H     . VAL A 1 288 ? 0.131   -7.004  -44.829 1.00 19.78 ? 288 VAL A H     1 
ATOM   4725  H  HA    . VAL A 1 288 ? -1.107  -7.392  -47.218 1.00 19.84 ? 288 VAL A HA    1 
ATOM   4726  H  HB    . VAL A 1 288 ? -2.020  -8.364  -44.694 1.00 25.22 ? 288 VAL A HB    1 
ATOM   4727  H  HG11  . VAL A 1 288 ? -3.709  -9.407  -45.907 1.00 29.38 ? 288 VAL A HG11  1 
ATOM   4728  H  HG12  . VAL A 1 288 ? -3.779  -7.850  -46.115 1.00 29.38 ? 288 VAL A HG12  1 
ATOM   4729  H  HG13  . VAL A 1 288 ? -3.164  -8.766  -47.236 1.00 29.38 ? 288 VAL A HG13  1 
ATOM   4730  H  HG21  . VAL A 1 288 ? -0.271  -9.530  -46.322 1.00 24.35 ? 288 VAL A HG21  1 
ATOM   4731  H  HG22  . VAL A 1 288 ? -0.879  -10.138 -45.005 1.00 24.35 ? 288 VAL A HG22  1 
ATOM   4732  H  HG23  . VAL A 1 288 ? -1.594  -10.378 -46.385 1.00 24.35 ? 288 VAL A HG23  1 
ATOM   4733  N  N     . ALA A 1 289 ? -2.596  -5.503  -46.962 1.00 19.59 ? 289 ALA A N     1 
ATOM   4734  C  CA    . ALA A 1 289 ? -3.426  -4.309  -46.819 1.00 25.94 ? 289 ALA A CA    1 
ATOM   4735  C  C     . ALA A 1 289 ? -4.853  -4.620  -47.279 1.00 23.99 ? 289 ALA A C     1 
ATOM   4736  O  O     . ALA A 1 289 ? -5.047  -5.258  -48.329 1.00 24.06 ? 289 ALA A O     1 
ATOM   4737  C  CB    . ALA A 1 289 ? -2.814  -3.156  -47.609 1.00 26.06 ? 289 ALA A CB    1 
ATOM   4738  H  H     . ALA A 1 289 ? -2.556  -5.804  -47.766 1.00 23.45 ? 289 ALA A H     1 
ATOM   4739  H  HA    . ALA A 1 289 ? -3.458  -4.050  -45.874 1.00 31.06 ? 289 ALA A HA    1 
ATOM   4740  H  HB1   . ALA A 1 289 ? -3.368  -2.379  -47.507 1.00 31.21 ? 289 ALA A HB1   1 
ATOM   4741  H  HB2   . ALA A 1 289 ? -1.933  -2.978  -47.269 1.00 31.21 ? 289 ALA A HB2   1 
ATOM   4742  H  HB3   . ALA A 1 289 ? -2.764  -3.404  -48.535 1.00 31.21 ? 289 ALA A HB3   1 
ATOM   4743  N  N     . VAL A 1 290 ? -5.836  -4.261  -46.446 1.00 23.12 ? 290 VAL A N     1 
ATOM   4744  C  CA    . VAL A 1 290 ? -7.228  -4.262  -46.863 1.00 23.62 ? 290 VAL A CA    1 
ATOM   4745  C  C     . VAL A 1 290 ? -7.537  -2.818  -47.212 1.00 28.96 ? 290 VAL A C     1 
ATOM   4746  O  O     . VAL A 1 290 ? -7.387  -1.919  -46.382 1.00 26.76 ? 290 VAL A O     1 
ATOM   4747  C  CB    . VAL A 1 290 ? -8.201  -4.726  -45.786 1.00 22.44 ? 290 VAL A CB    1 
ATOM   4748  C  CG1   . VAL A 1 290 ? -9.611  -4.757  -46.357 1.00 25.77 ? 290 VAL A CG1   1 
ATOM   4749  C  CG2   . VAL A 1 290 ? -7.830  -6.123  -45.258 1.00 23.56 ? 290 VAL A CG2   1 
ATOM   4750  H  H     . VAL A 1 290 ? -5.715  -4.012  -45.632 1.00 27.69 ? 290 VAL A H     1 
ATOM   4751  H  HA    . VAL A 1 290 ? -7.341  -4.818  -47.662 1.00 28.28 ? 290 VAL A HA    1 
ATOM   4752  H  HB    . VAL A 1 290 ? -8.183  -4.095  -45.036 1.00 26.87 ? 290 VAL A HB    1 
ATOM   4753  H  HG11  . VAL A 1 290 ? -9.583  -4.477  -47.274 1.00 30.87 ? 290 VAL A HG11  1 
ATOM   4754  H  HG12  . VAL A 1 290 ? -9.952  -5.652  -46.297 1.00 30.87 ? 290 VAL A HG12  1 
ATOM   4755  H  HG13  . VAL A 1 290 ? -10.166 -4.161  -45.849 1.00 30.87 ? 290 VAL A HG13  1 
ATOM   4756  H  HG21  . VAL A 1 290 ? -8.464  -6.379  -44.584 1.00 28.21 ? 290 VAL A HG21  1 
ATOM   4757  H  HG22  . VAL A 1 290 ? -7.855  -6.748  -45.986 1.00 28.21 ? 290 VAL A HG22  1 
ATOM   4758  H  HG23  . VAL A 1 290 ? -6.947  -6.090  -44.883 1.00 28.21 ? 290 VAL A HG23  1 
ATOM   4759  N  N     . THR A 1 291 ? -7.908  -2.596  -48.464 1.00 29.33 ? 291 THR A N     1 
ATOM   4760  C  CA    . THR A 1 291 ? -8.079  -1.242  -48.971 1.00 31.31 ? 291 THR A CA    1 
ATOM   4761  C  C     . THR A 1 291 ? -9.479  -0.711  -48.640 1.00 37.09 ? 291 THR A C     1 
ATOM   4762  O  O     . THR A 1 291 ? -10.331 -1.451  -48.148 1.00 31.67 ? 291 THR A O     1 
ATOM   4763  C  CB    . THR A 1 291 ? -7.845  -1.204  -50.500 1.00 28.59 ? 291 THR A CB    1 
ATOM   4764  O  OG1   . THR A 1 291 ? -8.592  -2.244  -51.134 1.00 36.80 ? 291 THR A OG1   1 
ATOM   4765  C  CG2   . THR A 1 291 ? -6.378  -1.419  -50.805 1.00 35.68 ? 291 THR A CG2   1 
ATOM   4766  H  H     . THR A 1 291 ? -8.066  -3.213  -49.043 1.00 35.14 ? 291 THR A H     1 
ATOM   4767  H  HA    . THR A 1 291 ? -7.421  -0.653  -48.546 1.00 37.51 ? 291 THR A HA    1 
ATOM   4768  H  HB    . THR A 1 291 ? -8.115  -0.342  -50.853 1.00 34.25 ? 291 THR A HB    1 
ATOM   4769  H  HG1   . THR A 1 291 ? -9.392  -2.146  -50.985 1.00 44.10 ? 291 THR A HG1   1 
ATOM   4770  H  HG21  . THR A 1 291 ? -5.853  -0.730  -50.392 1.00 42.75 ? 291 THR A HG21  1 
ATOM   4771  H  HG22  . THR A 1 291 ? -6.095  -2.272  -50.467 1.00 42.75 ? 291 THR A HG22  1 
ATOM   4772  H  HG23  . THR A 1 291 ? -6.234  -1.396  -51.753 1.00 42.75 ? 291 THR A HG23  1 
ATOM   4773  N  N     . GLU A 1 292 ? -9.689  0.571   -48.928 1.00 41.32 ? 292 GLU A N     1 
ATOM   4774  C  CA    . GLU A 1 292 ? -10.960 1.270   -48.702 1.00 35.44 ? 292 GLU A CA    1 
ATOM   4775  C  C     . GLU A 1 292 ? -12.189 0.469   -49.097 1.00 39.13 ? 292 GLU A C     1 
ATOM   4776  O  O     . GLU A 1 292 ? -13.186 0.478   -48.389 1.00 39.97 ? 292 GLU A O     1 
ATOM   4777  C  CB    . GLU A 1 292 ? -10.938 2.583   -49.490 1.00 40.64 ? 292 GLU A CB    1 
ATOM   4778  C  CG    . GLU A 1 292 ? -12.172 3.456   -49.328 1.00 57.60 ? 292 GLU A CG    1 
ATOM   4779  C  CD    . GLU A 1 292 ? -11.831 4.943   -49.348 1.00 66.47 ? 292 GLU A CD    1 
ATOM   4780  O  OE1   . GLU A 1 292 ? -11.053 5.363   -50.239 1.00 57.14 ? 292 GLU A OE1   1 
ATOM   4781  O  OE2   . GLU A 1 292 ? -12.325 5.681   -48.459 1.00 64.52 ? 292 GLU A OE2   1 
ATOM   4782  H  H     . GLU A 1 292 ? -9.086  1.080   -49.270 1.00 49.52 ? 292 GLU A H     1 
ATOM   4783  H  HA    . GLU A 1 292 ? -11.037 1.489   -47.750 1.00 42.47 ? 292 GLU A HA    1 
ATOM   4784  H  HB2   . GLU A 1 292 ? -10.172 3.103   -49.199 1.00 48.71 ? 292 GLU A HB2   1 
ATOM   4785  H  HB3   . GLU A 1 292 ? -10.849 2.375   -50.433 1.00 48.71 ? 292 GLU A HB3   1 
ATOM   4786  H  HG2   . GLU A 1 292 ? -12.786 3.277   -50.057 1.00 69.05 ? 292 GLU A HG2   1 
ATOM   4787  H  HG3   . GLU A 1 292 ? -12.595 3.255   -48.479 1.00 69.05 ? 292 GLU A HG3   1 
ATOM   4788  N  N     . ASP A 1 293 ? -12.107 -0.221  -50.228 1.00 31.21 ? 293 ASP A N     1 
ATOM   4789  C  CA    . ASP A 1 293 ? -13.224 -0.957  -50.799 1.00 35.76 ? 293 ASP A CA    1 
ATOM   4790  C  C     . ASP A 1 293 ? -13.194 -2.424  -50.424 1.00 34.48 ? 293 ASP A C     1 
ATOM   4791  O  O     . ASP A 1 293 ? -13.878 -3.242  -51.036 1.00 36.32 ? 293 ASP A O     1 
ATOM   4792  C  CB    . ASP A 1 293 ? -13.208 -0.823  -52.324 1.00 43.41 ? 293 ASP A CB    1 
ATOM   4793  C  CG    . ASP A 1 293 ? -11.900 -1.269  -52.935 1.00 52.32 ? 293 ASP A CG    1 
ATOM   4794  O  OD1   . ASP A 1 293 ? -10.906 -1.368  -52.175 1.00 42.33 ? 293 ASP A OD1   1 
ATOM   4795  O  OD2   . ASP A 1 293 ? -11.866 -1.511  -54.173 1.00 46.38 ? 293 ASP A OD2   1 
ATOM   4796  H  H     . ASP A 1 293 ? -11.389 -0.279  -50.698 1.00 37.39 ? 293 ASP A H     1 
ATOM   4797  H  HA    . ASP A 1 293 ? -14.063 -0.574  -50.467 1.00 42.86 ? 293 ASP A HA    1 
ATOM   4798  H  HB2   . ASP A 1 293 ? -13.916 -1.370  -52.697 1.00 52.03 ? 293 ASP A HB2   1 
ATOM   4799  H  HB3   . ASP A 1 293 ? -13.348 0.108   -52.561 1.00 52.03 ? 293 ASP A HB3   1 
ATOM   4800  N  N     . LEU A 1 294 ? -12.385 -2.748  -49.421 1.00 30.58 ? 294 LEU A N     1 
ATOM   4801  C  CA    . LEU A 1 294 ? -12.308 -4.104  -48.877 1.00 33.35 ? 294 LEU A CA    1 
ATOM   4802  C  C     . LEU A 1 294 ? -11.645 -5.108  -49.820 1.00 33.81 ? 294 LEU A C     1 
ATOM   4803  O  O     . LEU A 1 294 ? -11.768 -6.315  -49.644 1.00 33.22 ? 294 LEU A O     1 
ATOM   4804  C  CB    . LEU A 1 294 ? -13.689 -4.590  -48.444 1.00 38.37 ? 294 LEU A CB    1 
ATOM   4805  C  CG    . LEU A 1 294 ? -14.435 -3.642  -47.492 1.00 41.97 ? 294 LEU A CG    1 
ATOM   4806  C  CD1   . LEU A 1 294 ? -15.698 -4.329  -46.970 1.00 39.14 ? 294 LEU A CD1   1 
ATOM   4807  C  CD2   . LEU A 1 294 ? -13.559 -3.155  -46.329 1.00 37.77 ? 294 LEU A CD2   1 
ATOM   4808  H  H     . LEU A 1 294 ? -11.859 -2.191  -49.030 1.00 36.63 ? 294 LEU A H     1 
ATOM   4809  H  HA    . LEU A 1 294 ? -11.755 -4.069  -48.069 1.00 39.96 ? 294 LEU A HA    1 
ATOM   4810  H  HB2   . LEU A 1 294 ? -14.239 -4.704  -49.235 1.00 45.98 ? 294 LEU A HB2   1 
ATOM   4811  H  HB3   . LEU A 1 294 ? -13.590 -5.442  -47.992 1.00 45.98 ? 294 LEU A HB3   1 
ATOM   4812  H  HG    . LEU A 1 294 ? -14.715 -2.860  -47.993 1.00 50.30 ? 294 LEU A HG    1 
ATOM   4813  H  HD11  . LEU A 1 294 ? -15.447 -5.128  -46.500 1.00 46.91 ? 294 LEU A HD11  1 
ATOM   4814  H  HD12  . LEU A 1 294 ? -16.157 -3.731  -46.377 1.00 46.91 ? 294 LEU A HD12  1 
ATOM   4815  H  HD13  . LEU A 1 294 ? -16.262 -4.551  -47.714 1.00 46.91 ? 294 LEU A HD13  1 
ATOM   4816  H  HD21  . LEU A 1 294 ? -13.264 -3.915  -45.821 1.00 45.27 ? 294 LEU A HD21  1 
ATOM   4817  H  HD22  . LEU A 1 294 ? -12.802 -2.684  -46.684 1.00 45.27 ? 294 LEU A HD22  1 
ATOM   4818  H  HD23  . LEU A 1 294 ? -14.078 -2.570  -45.772 1.00 45.27 ? 294 LEU A HD23  1 
ATOM   4819  N  N     . ASP A 1 295 ? -10.923 -4.609  -50.814 1.00 36.25 ? 295 ASP A N     1 
ATOM   4820  C  CA    . ASP A 1 295 ? -10.030 -5.468  -51.583 1.00 41.96 ? 295 ASP A CA    1 
ATOM   4821  C  C     . ASP A 1 295 ? -8.804  -5.742  -50.705 1.00 33.99 ? 295 ASP A C     1 
ATOM   4822  O  O     . ASP A 1 295 ? -8.559  -5.036  -49.719 1.00 28.97 ? 295 ASP A O     1 
ATOM   4823  C  CB    . ASP A 1 295 ? -9.587  -4.799  -52.894 1.00 33.40 ? 295 ASP A CB    1 
ATOM   4824  C  CG    . ASP A 1 295 ? -10.526 -5.089  -54.064 1.00 55.90 ? 295 ASP A CG    1 
ATOM   4825  O  OD1   . ASP A 1 295 ? -11.639 -5.645  -53.856 1.00 51.94 ? 295 ASP A OD1   1 
ATOM   4826  O  OD2   . ASP A 1 295 ? -10.135 -4.750  -55.209 1.00 67.11 ? 295 ASP A OD2   1 
ATOM   4827  H  H     . ASP A 1 295 ? -10.931 -3.786  -51.063 1.00 43.44 ? 295 ASP A H     1 
ATOM   4828  H  HA    . ASP A 1 295 ? -10.474 -6.317  -51.789 1.00 50.29 ? 295 ASP A HA    1 
ATOM   4829  H  HB2   . ASP A 1 295 ? -9.560  -3.838  -52.764 1.00 40.02 ? 295 ASP A HB2   1 
ATOM   4830  H  HB3   . ASP A 1 295 ? -8.705  -5.125  -53.131 1.00 40.02 ? 295 ASP A HB3   1 
ATOM   4831  N  N     . ILE A 1 296 ? -8.047  -6.770  -51.070 1.00 24.15 ? 296 ILE A N     1 
ATOM   4832  C  CA    . ILE A 1 296 ? -6.868  -7.159  -50.287 1.00 28.56 ? 296 ILE A CA    1 
ATOM   4833  C  C     . ILE A 1 296 ? -5.634  -7.204  -51.189 1.00 32.37 ? 296 ILE A C     1 
ATOM   4834  O  O     . ILE A 1 296 ? -5.631  -7.875  -52.230 1.00 32.18 ? 296 ILE A O     1 
ATOM   4835  C  CB    . ILE A 1 296 ? -7.098  -8.519  -49.612 1.00 26.68 ? 296 ILE A CB    1 
ATOM   4836  C  CG1   . ILE A 1 296 ? -8.371  -8.458  -48.765 1.00 30.55 ? 296 ILE A CG1   1 
ATOM   4837  C  CG2   . ILE A 1 296 ? -5.891  -8.917  -48.776 1.00 28.07 ? 296 ILE A CG2   1 
ATOM   4838  C  CD1   . ILE A 1 296 ? -8.709  -9.739  -48.055 1.00 37.06 ? 296 ILE A CD1   1 
ATOM   4839  H  H     . ILE A 1 296 ? -8.190  -7.259  -51.762 1.00 28.92 ? 296 ILE A H     1 
ATOM   4840  H  HA    . ILE A 1 296 ? -6.711  -6.492  -49.587 1.00 34.21 ? 296 ILE A HA    1 
ATOM   4841  H  HB    . ILE A 1 296 ? -7.224  -9.186  -50.304 1.00 31.95 ? 296 ILE A HB    1 
ATOM   4842  H  HG12  . ILE A 1 296 ? -8.262  -7.768  -48.091 1.00 36.60 ? 296 ILE A HG12  1 
ATOM   4843  H  HG13  . ILE A 1 296 ? -9.117  -8.235  -49.342 1.00 36.60 ? 296 ILE A HG13  1 
ATOM   4844  H  HG21  . ILE A 1 296 ? -6.062  -9.768  -48.366 1.00 33.63 ? 296 ILE A HG21  1 
ATOM   4845  H  HG22  . ILE A 1 296 ? -5.122  -8.977  -49.347 1.00 33.63 ? 296 ILE A HG22  1 
ATOM   4846  H  HG23  . ILE A 1 296 ? -5.746  -8.251  -48.100 1.00 33.63 ? 296 ILE A HG23  1 
ATOM   4847  H  HD11  . ILE A 1 296 ? -9.516  -9.613  -47.550 1.00 44.41 ? 296 ILE A HD11  1 
ATOM   4848  H  HD12  . ILE A 1 296 ? -8.834  -10.433 -48.706 1.00 44.41 ? 296 ILE A HD12  1 
ATOM   4849  H  HD13  . ILE A 1 296 ? -7.986  -9.970  -47.466 1.00 44.41 ? 296 ILE A HD13  1 
ATOM   4850  N  N     . VAL A 1 297 ? -4.607  -6.458  -50.786 1.00 31.37 ? 297 VAL A N     1 
ATOM   4851  C  CA    . VAL A 1 297 ? -3.350  -6.363  -51.521 1.00 29.23 ? 297 VAL A CA    1 
ATOM   4852  C  C     . VAL A 1 297 ? -2.195  -6.776  -50.613 1.00 30.62 ? 297 VAL A C     1 
ATOM   4853  O  O     . VAL A 1 297 ? -2.093  -6.283  -49.497 1.00 25.16 ? 297 VAL A O     1 
ATOM   4854  C  CB    . VAL A 1 297 ? -3.080  -4.928  -51.957 1.00 25.47 ? 297 VAL A CB    1 
ATOM   4855  C  CG1   . VAL A 1 297 ? -1.855  -4.864  -52.888 1.00 31.77 ? 297 VAL A CG1   1 
ATOM   4856  C  CG2   . VAL A 1 297 ? -4.314  -4.356  -52.649 1.00 46.55 ? 297 VAL A CG2   1 
ATOM   4857  H  H     . VAL A 1 297 ? -4.617  -5.984  -50.068 1.00 37.58 ? 297 VAL A H     1 
ATOM   4858  H  HA    . VAL A 1 297 ? -3.370  -6.946  -52.309 1.00 35.01 ? 297 VAL A HA    1 
ATOM   4859  H  HB    . VAL A 1 297 ? -2.892  -4.382  -51.166 1.00 30.50 ? 297 VAL A HB    1 
ATOM   4860  H  HG11  . VAL A 1 297 ? -1.708  -3.951  -53.147 1.00 38.06 ? 297 VAL A HG11  1 
ATOM   4861  H  HG12  . VAL A 1 297 ? -1.088  -5.199  -52.418 1.00 38.06 ? 297 VAL A HG12  1 
ATOM   4862  H  HG13  . VAL A 1 297 ? -2.025  -5.402  -53.665 1.00 38.06 ? 297 VAL A HG13  1 
ATOM   4863  H  HG21  . VAL A 1 297 ? -4.129  -3.453  -52.918 1.00 55.80 ? 297 VAL A HG21  1 
ATOM   4864  H  HG22  . VAL A 1 297 ? -4.517  -4.892  -53.419 1.00 55.80 ? 297 VAL A HG22  1 
ATOM   4865  H  HG23  . VAL A 1 297 ? -5.051  -4.371  -52.034 1.00 55.80 ? 297 VAL A HG23  1 
ATOM   4866  N  N     . SER A 1 298 ? -1.321  -7.638  -51.138 1.00 19.59 ? 298 SER A N     1 
ATOM   4867  C  CA    . SER A 1 298 ? -0.213  -8.249  -50.400 1.00 20.84 ? 298 SER A CA    1 
ATOM   4868  C  C     . SER A 1 298 ? 1.102   -8.047  -51.155 1.00 22.31 ? 298 SER A C     1 
ATOM   4869  O  O     . SER A 1 298 ? 1.135   -8.225  -52.368 1.00 22.75 ? 298 SER A O     1 
ATOM   4870  C  CB    . SER A 1 298 ? -0.439  -9.756  -50.319 1.00 23.18 ? 298 SER A CB    1 
ATOM   4871  O  OG    . SER A 1 298 ? 0.599   -10.404 -49.585 1.00 27.59 ? 298 SER A OG    1 
ATOM   4872  H  H     . SER A 1 298 ? -1.354  -7.895  -51.958 1.00 23.45 ? 298 SER A H     1 
ATOM   4873  H  HA    . SER A 1 298 ? -0.142  -7.873  -49.498 1.00 24.94 ? 298 SER A HA    1 
ATOM   4874  H  HB2   . SER A 1 298 ? -1.286  -9.923  -49.878 1.00 27.76 ? 298 SER A HB2   1 
ATOM   4875  H  HB3   . SER A 1 298 ? -0.459  -10.118 -51.219 1.00 27.76 ? 298 SER A HB3   1 
ATOM   4876  H  HG    . SER A 1 298 ? 1.148   -9.851  -49.328 1.00 33.05 ? 298 SER A HG    1 
ATOM   4877  N  N     . ARG A 1 299 ? 2.170   -7.695  -50.445 1.00 15.85 ? 299 ARG A N     1 
ATOM   4878  C  CA    . ARG A 1 299 ? 3.516   -7.716  -51.010 1.00 18.31 ? 299 ARG A CA    1 
ATOM   4879  C  C     . ARG A 1 299 ? 4.424   -8.398  -50.002 1.00 19.74 ? 299 ARG A C     1 
ATOM   4880  O  O     . ARG A 1 299 ? 4.391   -8.069  -48.813 1.00 20.83 ? 299 ARG A O     1 
ATOM   4881  C  CB    . ARG A 1 299 ? 4.045   -6.309  -51.252 1.00 20.62 ? 299 ARG A CB    1 
ATOM   4882  C  CG    . ARG A 1 299 ? 3.314   -5.554  -52.356 1.00 21.37 ? 299 ARG A CG    1 
ATOM   4883  C  CD    . ARG A 1 299 ? 3.498   -6.214  -53.716 1.00 25.81 ? 299 ARG A CD    1 
ATOM   4884  N  NE    . ARG A 1 299 ? 2.815   -5.406  -54.734 1.00 27.95 ? 299 ARG A NE    1 
ATOM   4885  C  CZ    . ARG A 1 299 ? 1.568   -5.593  -55.149 1.00 31.40 ? 299 ARG A CZ    1 
ATOM   4886  N  NH1   . ARG A 1 299 ? 0.821   -6.584  -54.673 1.00 27.17 ? 299 ARG A NH1   1 
ATOM   4887  N  NH2   . ARG A 1 299 ? 1.066   -4.790  -56.079 1.00 41.96 ? 299 ARG A NH2   1 
ATOM   4888  H  H     . ARG A 1 299 ? 2.140   -7.437  -49.625 1.00 18.96 ? 299 ARG A H     1 
ATOM   4889  H  HA    . ARG A 1 299 ? 3.527   -8.219  -51.851 1.00 21.91 ? 299 ARG A HA    1 
ATOM   4890  H  HB2   . ARG A 1 299 ? 3.956   -5.797  -50.433 1.00 24.68 ? 299 ARG A HB2   1 
ATOM   4891  H  HB3   . ARG A 1 299 ? 4.981   -6.367  -51.503 1.00 24.68 ? 299 ARG A HB3   1 
ATOM   4892  H  HG2   . ARG A 1 299 ? 2.365   -5.536  -52.154 1.00 25.59 ? 299 ARG A HG2   1 
ATOM   4893  H  HG3   . ARG A 1 299 ? 3.662   -4.651  -52.408 1.00 25.59 ? 299 ARG A HG3   1 
ATOM   4894  H  HD2   . ARG A 1 299 ? 4.442   -6.259  -53.934 1.00 30.91 ? 299 ARG A HD2   1 
ATOM   4895  H  HD3   . ARG A 1 299 ? 3.105   -7.101  -53.706 1.00 30.91 ? 299 ARG A HD3   1 
ATOM   4896  H  HE    . ARG A 1 299 ? 3.259   -4.761  -55.091 1.00 33.48 ? 299 ARG A HE    1 
ATOM   4897  H  HH11  . ARG A 1 299 ? 1.139   -7.110  -54.071 1.00 32.54 ? 299 ARG A HH11  1 
ATOM   4898  H  HH12  . ARG A 1 299 ? 0.017   -6.692  -54.957 1.00 32.54 ? 299 ARG A HH12  1 
ATOM   4899  H  HH21  . ARG A 1 299 ? 1.544   -4.149  -56.397 1.00 50.29 ? 299 ARG A HH21  1 
ATOM   4900  H  HH22  . ARG A 1 299 ? 0.262   -4.906  -56.359 1.00 50.29 ? 299 ARG A HH22  1 
ATOM   4901  N  N     . GLY A 1 300 ? 5.277   -9.290  -50.482 1.00 16.60 ? 300 GLY A N     1 
ATOM   4902  C  CA    . GLY A 1 300 ? 6.100   -10.068 -49.591 1.00 16.22 ? 300 GLY A CA    1 
ATOM   4903  C  C     . GLY A 1 300 ? 7.471   -10.354 -50.165 1.00 21.63 ? 300 GLY A C     1 
ATOM   4904  O  O     . GLY A 1 300 ? 7.758   -10.048 -51.333 1.00 17.92 ? 300 GLY A O     1 
ATOM   4905  H  H     . GLY A 1 300 ? 5.393   -9.460  -51.317 1.00 19.85 ? 300 GLY A H     1 
ATOM   4906  H  HA2   . GLY A 1 300 ? 6.212   -9.589  -48.755 1.00 19.40 ? 300 GLY A HA2   1 
ATOM   4907  H  HA3   . GLY A 1 300 ? 5.663   -10.913 -49.404 1.00 19.40 ? 300 GLY A HA3   1 
ATOM   4908  N  N     . ARG A 1 301 ? 8.289   -10.961 -49.328 1.00 14.78 ? 301 ARG A N     1 
ATOM   4909  C  CA    . ARG A 1 301 ? 9.682   -11.285 -49.641 1.00 19.99 ? 301 ARG A CA    1 
ATOM   4910  C  C     . ARG A 1 301 ? 10.138  -12.451 -48.776 1.00 24.20 ? 301 ARG A C     1 
ATOM   4911  O  O     . ARG A 1 301 ? 9.857   -12.500 -47.562 1.00 18.50 ? 301 ARG A O     1 
ATOM   4912  C  CB    . ARG A 1 301 ? 10.560  -10.058 -49.395 1.00 20.47 ? 301 ARG A CB    1 
ATOM   4913  C  CG    . ARG A 1 301 ? 12.032  -10.287 -49.665 1.00 33.62 ? 301 ARG A CG    1 
ATOM   4914  C  CD    . ARG A 1 301 ? 12.837  -8.979  -49.653 1.00 36.10 ? 301 ARG A CD    1 
ATOM   4915  N  NE    . ARG A 1 301 ? 14.259  -9.284  -49.767 1.00 48.51 ? 301 ARG A NE    1 
ATOM   4916  C  CZ    . ARG A 1 301 ? 15.248  -8.430  -49.519 1.00 54.31 ? 301 ARG A CZ    1 
ATOM   4917  N  NH1   . ARG A 1 301 ? 14.991  -7.174  -49.146 1.00 52.08 ? 301 ARG A NH1   1 
ATOM   4918  N  NH2   . ARG A 1 301 ? 16.505  -8.844  -49.645 1.00 57.91 ? 301 ARG A NH2   1 
ATOM   4919  H  H     . ARG A 1 301 ? 8.056   -11.208 -48.537 1.00 17.67 ? 301 ARG A H     1 
ATOM   4920  H  HA    . ARG A 1 301 ? 9.758   -11.544 -50.583 1.00 23.92 ? 301 ARG A HA    1 
ATOM   4921  H  HB2   . ARG A 1 301 ? 10.261  -9.340  -49.976 1.00 24.50 ? 301 ARG A HB2   1 
ATOM   4922  H  HB3   . ARG A 1 301 ? 10.468  -9.789  -48.468 1.00 24.50 ? 301 ARG A HB3   1 
ATOM   4923  H  HG2   . ARG A 1 301 ? 12.394  -10.869 -48.979 1.00 40.29 ? 301 ARG A HG2   1 
ATOM   4924  H  HG3   . ARG A 1 301 ? 12.135  -10.696 -50.538 1.00 40.29 ? 301 ARG A HG3   1 
ATOM   4925  H  HD2   . ARG A 1 301 ? 12.576  -8.428  -50.408 1.00 43.26 ? 301 ARG A HD2   1 
ATOM   4926  H  HD3   . ARG A 1 301 ? 12.686  -8.509  -48.818 1.00 43.26 ? 301 ARG A HD3   1 
ATOM   4927  H  HE    . ARG A 1 301 ? 14.475  -10.079 -50.015 1.00 58.15 ? 301 ARG A HE    1 
ATOM   4928  H  HH11  . ARG A 1 301 ? 14.177  -6.909  -49.060 1.00 62.43 ? 301 ARG A HH11  1 
ATOM   4929  H  HH12  . ARG A 1 301 ? 15.639  -6.630  -48.990 1.00 62.43 ? 301 ARG A HH12  1 
ATOM   4930  H  HH21  . ARG A 1 301 ? 16.669  -9.653  -49.888 1.00 69.44 ? 301 ARG A HH21  1 
ATOM   4931  H  HH22  . ARG A 1 301 ? 17.154  -8.301  -49.494 1.00 69.44 ? 301 ARG A HH22  1 
ATOM   4932  N  N     . THR A 1 302 ? 10.827  -13.394 -49.416 1.00 18.11 ? 302 THR A N     1 
ATOM   4933  C  CA    . THR A 1 302 ? 11.550  -14.443 -48.735 1.00 21.95 ? 302 THR A CA    1 
ATOM   4934  C  C     . THR A 1 302 ? 13.036  -14.090 -48.689 1.00 23.37 ? 302 THR A C     1 
ATOM   4935  O  O     . THR A 1 302 ? 13.619  -13.666 -49.687 1.00 20.81 ? 302 THR A O     1 
ATOM   4936  C  CB    . THR A 1 302 ? 11.404  -15.777 -49.461 1.00 22.83 ? 302 THR A CB    1 
ATOM   4937  O  OG1   . THR A 1 302 ? 10.028  -16.159 -49.474 1.00 21.53 ? 302 THR A OG1   1 
ATOM   4938  C  CG2   . THR A 1 302 ? 12.235  -16.865 -48.762 1.00 22.89 ? 302 THR A CG2   1 
ATOM   4939  H  H     . THR A 1 302 ? 10.886  -13.441 -50.273 1.00 21.67 ? 302 THR A H     1 
ATOM   4940  H  HA    . THR A 1 302 ? 11.216  -14.539 -47.819 1.00 26.28 ? 302 THR A HA    1 
ATOM   4941  H  HB    . THR A 1 302 ? 11.723  -15.686 -50.372 1.00 27.34 ? 302 THR A HB    1 
ATOM   4942  H  HG1   . THR A 1 302 ? 9.582   -15.590 -49.862 1.00 25.78 ? 302 THR A HG1   1 
ATOM   4943  H  HG21  . THR A 1 302 ? 11.937  -16.974 -47.856 1.00 27.40 ? 302 THR A HG21  1 
ATOM   4944  H  HG22  . THR A 1 302 ? 12.137  -17.700 -49.225 1.00 27.40 ? 302 THR A HG22  1 
ATOM   4945  H  HG23  . THR A 1 302 ? 13.162  -16.617 -48.758 1.00 27.40 ? 302 THR A HG23  1 
ATOM   4946  N  N     . PHE A 1 303 ? 13.629  -14.286 -47.526 1.00 21.73 ? 303 PHE A N     1 
ATOM   4947  C  CA    . PHE A 1 303 ? 15.049  -14.002 -47.285 1.00 17.53 ? 303 PHE A CA    1 
ATOM   4948  C  C     . PHE A 1 303 ? 15.823  -15.291 -47.265 1.00 20.91 ? 303 PHE A C     1 
ATOM   4949  O  O     . PHE A 1 303 ? 15.267  -16.353 -47.020 1.00 21.16 ? 303 PHE A O     1 
ATOM   4950  C  CB    . PHE A 1 303 ? 15.224  -13.277 -45.926 1.00 20.31 ? 303 PHE A CB    1 
ATOM   4951  C  CG    . PHE A 1 303 ? 14.749  -11.873 -45.936 1.00 28.85 ? 303 PHE A CG    1 
ATOM   4952  C  CD1   . PHE A 1 303 ? 13.395  -11.582 -45.801 1.00 28.13 ? 303 PHE A CD1   1 
ATOM   4953  C  CD2   . PHE A 1 303 ? 15.645  -10.831 -46.115 1.00 34.36 ? 303 PHE A CD2   1 
ATOM   4954  C  CE1   . PHE A 1 303 ? 12.943  -10.280 -45.838 1.00 26.72 ? 303 PHE A CE1   1 
ATOM   4955  C  CE2   . PHE A 1 303 ? 15.208  -9.529  -46.150 1.00 37.39 ? 303 PHE A CE2   1 
ATOM   4956  C  CZ    . PHE A 1 303 ? 13.842  -9.249  -46.015 1.00 38.42 ? 303 PHE A CZ    1 
ATOM   4957  H  H     . PHE A 1 303 ? 13.224  -14.593 -46.832 1.00 26.01 ? 303 PHE A H     1 
ATOM   4958  H  HA    . PHE A 1 303 ? 15.401  -13.430 -47.999 1.00 20.98 ? 303 PHE A HA    1 
ATOM   4959  H  HB2   . PHE A 1 303 ? 14.722  -13.756 -45.249 1.00 24.31 ? 303 PHE A HB2   1 
ATOM   4960  H  HB3   . PHE A 1 303 ? 16.166  -13.270 -45.695 1.00 24.31 ? 303 PHE A HB3   1 
ATOM   4961  H  HD1   . PHE A 1 303 ? 12.786  -12.276 -45.690 1.00 33.69 ? 303 PHE A HD1   1 
ATOM   4962  H  HD2   . PHE A 1 303 ? 16.551  -11.015 -46.214 1.00 41.18 ? 303 PHE A HD2   1 
ATOM   4963  H  HE1   . PHE A 1 303 ? 12.036  -10.097 -45.742 1.00 32.01 ? 303 PHE A HE1   1 
ATOM   4964  H  HE2   . PHE A 1 303 ? 15.816  -8.835  -46.267 1.00 44.80 ? 303 PHE A HE2   1 
ATOM   4965  H  HZ    . PHE A 1 303 ? 13.544  -8.368  -46.030 1.00 46.04 ? 303 PHE A HZ    1 
ATOM   4966  N  N     . PRO A 1 304 ? 17.144  -15.208 -47.485 1.00 24.99 ? 304 PRO A N     1 
ATOM   4967  C  CA    . PRO A 1 304 ? 17.942  -16.429 -47.457 1.00 25.83 ? 304 PRO A CA    1 
ATOM   4968  C  C     . PRO A 1 304 ? 18.296  -16.838 -46.030 1.00 27.14 ? 304 PRO A C     1 
ATOM   4969  O  O     . PRO A 1 304 ? 19.030  -17.813 -45.810 1.00 27.69 ? 304 PRO A O     1 
ATOM   4970  C  CB    . PRO A 1 304 ? 19.207  -16.042 -48.249 1.00 28.70 ? 304 PRO A CB    1 
ATOM   4971  C  CG    . PRO A 1 304 ? 19.355  -14.567 -48.027 1.00 24.97 ? 304 PRO A CG    1 
ATOM   4972  C  CD    . PRO A 1 304 ? 17.922  -14.032 -47.909 1.00 29.98 ? 304 PRO A CD    1 
ATOM   4973  H  HA    . PRO A 1 304 ? 17.475  -17.162 -47.911 1.00 30.93 ? 304 PRO A HA    1 
ATOM   4974  H  HB2   . PRO A 1 304 ? 19.973  -16.522 -47.899 1.00 34.37 ? 304 PRO A HB2   1 
ATOM   4975  H  HB3   . PRO A 1 304 ? 19.077  -16.238 -49.191 1.00 34.37 ? 304 PRO A HB3   1 
ATOM   4976  H  HG2   . PRO A 1 304 ? 19.849  -14.409 -47.208 1.00 29.90 ? 304 PRO A HG2   1 
ATOM   4977  H  HG3   . PRO A 1 304 ? 19.809  -14.167 -48.785 1.00 29.90 ? 304 PRO A HG3   1 
ATOM   4978  H  HD2   . PRO A 1 304 ? 17.876  -13.336 -47.234 1.00 35.91 ? 304 PRO A HD2   1 
ATOM   4979  H  HD3   . PRO A 1 304 ? 17.608  -13.713 -48.769 1.00 35.91 ? 304 PRO A HD3   1 
ATOM   4980  N  N     . HIS A 1 305 ? 17.813  -16.062 -45.072 1.00 21.56 ? 305 HIS A N     1 
ATOM   4981  C  CA    . HIS A 1 305 ? 18.075  -16.313 -43.659 1.00 22.02 ? 305 HIS A CA    1 
ATOM   4982  C  C     . HIS A 1 305 ? 16.821  -15.963 -42.854 1.00 20.62 ? 305 HIS A C     1 
ATOM   4983  O  O     . HIS A 1 305 ? 15.910  -15.348 -43.397 1.00 20.79 ? 305 HIS A O     1 
ATOM   4984  C  CB    . HIS A 1 305 ? 19.249  -15.445 -43.163 1.00 23.16 ? 305 HIS A CB    1 
ATOM   4985  C  CG    . HIS A 1 305 ? 19.029  -13.969 -43.305 1.00 27.18 ? 305 HIS A CG    1 
ATOM   4986  N  ND1   . HIS A 1 305 ? 19.656  -13.206 -44.272 1.00 34.90 ? 305 HIS A ND1   1 
ATOM   4987  C  CD2   . HIS A 1 305 ? 18.287  -13.098 -42.573 1.00 23.21 ? 305 HIS A CD2   1 
ATOM   4988  C  CE1   . HIS A 1 305 ? 19.277  -11.943 -44.155 1.00 28.48 ? 305 HIS A CE1   1 
ATOM   4989  N  NE2   . HIS A 1 305 ? 18.449  -11.854 -43.127 1.00 32.84 ? 305 HIS A NE2   1 
ATOM   4990  H  H     . HIS A 1 305 ? 17.322  -15.371 -45.216 1.00 25.81 ? 305 HIS A H     1 
ATOM   4991  H  HA    . HIS A 1 305 ? 18.293  -17.258 -43.518 1.00 26.36 ? 305 HIS A HA    1 
ATOM   4992  H  HB2   . HIS A 1 305 ? 19.399  -15.632 -42.224 1.00 27.73 ? 305 HIS A HB2   1 
ATOM   4993  H  HB3   . HIS A 1 305 ? 20.042  -15.675 -43.673 1.00 27.73 ? 305 HIS A HB3   1 
ATOM   4994  H  HD1   . HIS A 1 305 ? 20.188  -13.511 -44.875 1.00 41.82 ? 305 HIS A HD1   1 
ATOM   4995  H  HD2   . HIS A 1 305 ? 17.749  -13.311 -41.845 1.00 27.78 ? 305 HIS A HD2   1 
ATOM   4996  H  HE1   . HIS A 1 305 ? 19.558  -11.237 -44.693 1.00 34.12 ? 305 HIS A HE1   1 
ATOM   4997  H  HE2   . HIS A 1 305 ? 18.077  -11.131 -42.847 1.00 39.35 ? 305 HIS A HE2   1 
ATOM   4998  N  N     . GLY A 1 306 ? 16.814  -16.326 -41.573 1.00 19.39 ? 306 GLY A N     1 
ATOM   4999  C  CA    . GLY A 1 306 ? 15.714  -15.982 -40.661 1.00 20.42 ? 306 GLY A CA    1 
ATOM   5000  C  C     . GLY A 1 306 ? 15.650  -14.484 -40.427 1.00 17.12 ? 306 GLY A C     1 
ATOM   5001  O  O     . GLY A 1 306 ? 16.672  -13.797 -40.405 1.00 19.41 ? 306 GLY A O     1 
ATOM   5002  H  H     . GLY A 1 306 ? 17.442  -16.778 -41.199 1.00 23.20 ? 306 GLY A H     1 
ATOM   5003  H  HA2   . GLY A 1 306 ? 14.870  -16.275 -41.040 1.00 24.45 ? 306 GLY A HA2   1 
ATOM   5004  H  HA3   . GLY A 1 306 ? 15.844  -16.426 -39.809 1.00 24.45 ? 306 GLY A HA3   1 
ATOM   5005  N  N     . ILE A 1 307 ? 14.448  -13.981 -40.165 1.00 15.68 ? 307 ILE A N     1 
ATOM   5006  C  CA    . ILE A 1 307 ? 14.191  -12.554 -40.006 1.00 19.93 ? 307 ILE A CA    1 
ATOM   5007  C  C     . ILE A 1 307 ? 14.077  -12.250 -38.523 1.00 23.96 ? 307 ILE A C     1 
ATOM   5008  O  O     . ILE A 1 307 ? 13.168  -12.766 -37.841 1.00 19.05 ? 307 ILE A O     1 
ATOM   5009  C  CB    . ILE A 1 307 ? 12.820  -12.170 -40.689 1.00 21.49 ? 307 ILE A CB    1 
ATOM   5010  C  CG1   . ILE A 1 307 ? 12.829  -12.596 -42.162 1.00 21.28 ? 307 ILE A CG1   1 
ATOM   5011  C  CG2   . ILE A 1 307 ? 12.515  -10.708 -40.533 1.00 22.80 ? 307 ILE A CG2   1 
ATOM   5012  C  CD1   . ILE A 1 307 ? 11.500  -12.427 -42.860 1.00 20.74 ? 307 ILE A CD1   1 
ATOM   5013  H  H     . ILE A 1 307 ? 13.742  -14.464 -40.071 1.00 18.76 ? 307 ILE A H     1 
ATOM   5014  H  HA    . ILE A 1 307 ? 14.917  -12.024 -40.398 1.00 23.86 ? 307 ILE A HA    1 
ATOM   5015  H  HB    . ILE A 1 307 ? 12.118  -12.668 -40.242 1.00 25.73 ? 307 ILE A HB    1 
ATOM   5016  H  HG12  . ILE A 1 307 ? 13.483  -12.059 -42.637 1.00 25.47 ? 307 ILE A HG12  1 
ATOM   5017  H  HG13  . ILE A 1 307 ? 13.074  -13.533 -42.214 1.00 25.47 ? 307 ILE A HG13  1 
ATOM   5018  H  HG21  . ILE A 1 307 ? 11.677  -10.517 -40.960 1.00 27.30 ? 307 ILE A HG21  1 
ATOM   5019  H  HG22  . ILE A 1 307 ? 12.461  -10.499 -39.597 1.00 27.30 ? 307 ILE A HG22  1 
ATOM   5020  H  HG23  . ILE A 1 307 ? 13.216  -10.197 -40.943 1.00 27.30 ? 307 ILE A HG23  1 
ATOM   5021  H  HD11  . ILE A 1 307 ? 11.588  -12.713 -43.772 1.00 24.82 ? 307 ILE A HD11  1 
ATOM   5022  H  HD12  . ILE A 1 307 ? 10.842  -12.962 -42.410 1.00 24.82 ? 307 ILE A HD12  1 
ATOM   5023  H  HD13  . ILE A 1 307 ? 11.247  -11.501 -42.830 1.00 24.82 ? 307 ILE A HD13  1 
ATOM   5024  N  N     . SER A 1 308 ? 14.962  -11.383 -38.035 1.00 19.41 ? 308 SER A N     1 
ATOM   5025  C  CA    . SER A 1 308 ? 14.856  -10.867 -36.677 1.00 22.82 ? 308 SER A CA    1 
ATOM   5026  C  C     . SER A 1 308 ? 13.673  -9.901  -36.586 1.00 21.04 ? 308 SER A C     1 
ATOM   5027  O  O     . SER A 1 308 ? 13.227  -9.366  -37.573 1.00 21.14 ? 308 SER A O     1 
ATOM   5028  C  CB    . SER A 1 308 ? 16.107  -10.109 -36.266 1.00 23.55 ? 308 SER A CB    1 
ATOM   5029  O  OG    . SER A 1 308 ? 16.296  -8.979  -37.088 1.00 23.66 ? 308 SER A OG    1 
ATOM   5030  H  H     . SER A 1 308 ? 15.635  -11.077 -38.475 1.00 23.23 ? 308 SER A H     1 
ATOM   5031  H  HA    . SER A 1 308 ? 14.712  -11.606 -36.049 1.00 27.32 ? 308 SER A HA    1 
ATOM   5032  H  HB2   . SER A 1 308 ? 16.014  -9.819  -35.345 1.00 28.20 ? 308 SER A HB2   1 
ATOM   5033  H  HB3   . SER A 1 308 ? 16.875  -10.695 -36.353 1.00 28.20 ? 308 SER A HB3   1 
ATOM   5034  H  HG    . SER A 1 308 ? 16.972  -8.576  -36.860 1.00 28.33 ? 308 SER A HG    1 
ATOM   5035  N  N     . LYS A 1 309 ? 13.191  -9.642  -35.388 1.00 21.12 ? 309 LYS A N     1 
ATOM   5036  C  CA    . LYS A 1 309 ? 12.033  -8.751  -35.279 1.00 25.71 ? 309 LYS A CA    1 
ATOM   5037  C  C     . LYS A 1 309 ? 12.386  -7.395  -35.815 1.00 20.21 ? 309 LYS A C     1 
ATOM   5038  O  O     . LYS A 1 309 ? 11.575  -6.715  -36.424 1.00 19.45 ? 309 LYS A O     1 
ATOM   5039  C  CB    . LYS A 1 309 ? 11.568  -8.652  -33.827 1.00 27.60 ? 309 LYS A CB    1 
ATOM   5040  C  CG    . LYS A 1 309 ? 10.423  -7.693  -33.631 1.00 34.13 ? 309 LYS A CG    1 
ATOM   5041  C  CD    . LYS A 1 309 ? 9.934   -7.732  -32.191 1.00 37.97 ? 309 LYS A CD    1 
ATOM   5042  C  CE    . LYS A 1 309 ? 10.824  -6.910  -31.282 1.00 47.27 ? 309 LYS A CE    1 
ATOM   5043  N  NZ    . LYS A 1 309 ? 10.354  -6.985  -29.879 1.00 44.27 ? 309 LYS A NZ    1 
ATOM   5044  H  H     . LYS A 1 309 ? 13.494  -9.950  -34.645 1.00 25.28 ? 309 LYS A H     1 
ATOM   5045  H  HA    . LYS A 1 309 ? 11.296  -9.112  -35.814 1.00 30.80 ? 309 LYS A HA    1 
ATOM   5046  H  HB2   . LYS A 1 309 ? 11.276  -9.528  -33.531 1.00 33.06 ? 309 LYS A HB2   1 
ATOM   5047  H  HB3   . LYS A 1 309 ? 12.309  -8.348  -33.280 1.00 33.06 ? 309 LYS A HB3   1 
ATOM   5048  H  HG2   . LYS A 1 309 ? 10.720  -6.791  -33.830 1.00 40.90 ? 309 LYS A HG2   1 
ATOM   5049  H  HG3   . LYS A 1 309 ? 9.688   -7.943  -34.212 1.00 40.90 ? 309 LYS A HG3   1 
ATOM   5050  H  HD2   . LYS A 1 309 ? 9.036   -7.368  -32.147 1.00 45.51 ? 309 LYS A HD2   1 
ATOM   5051  H  HD3   . LYS A 1 309 ? 9.940   -8.649  -31.875 1.00 45.51 ? 309 LYS A HD3   1 
ATOM   5052  H  HE2   . LYS A 1 309 ? 11.730  -7.254  -31.320 1.00 56.66 ? 309 LYS A HE2   1 
ATOM   5053  H  HE3   . LYS A 1 309 ? 10.803  -5.982  -31.563 1.00 56.66 ? 309 LYS A HE3   1 
ATOM   5054  H  HZ1   . LYS A 1 309 ? 10.884  -6.499  -29.355 1.00 53.07 ? 309 LYS A HZ1   1 
ATOM   5055  H  HZ2   . LYS A 1 309 ? 9.523   -6.673  -29.820 1.00 53.07 ? 309 LYS A HZ2   1 
ATOM   5056  H  HZ3   . LYS A 1 309 ? 10.366  -7.830  -29.600 1.00 53.07 ? 309 LYS A HZ3   1 
ATOM   5057  N  N     . GLU A 1 310 ? 13.625  -6.964  -35.581 1.00 25.08 ? 310 GLU A N     1 
ATOM   5058  C  CA    . GLU A 1 310 ? 14.048  -5.653  -36.056 1.00 20.43 ? 310 GLU A CA    1 
ATOM   5059  C  C     . GLU A 1 310 ? 14.122  -5.580  -37.579 1.00 22.55 ? 310 GLU A C     1 
ATOM   5060  O  O     . GLU A 1 310 ? 13.814  -4.558  -38.177 1.00 25.43 ? 310 GLU A O     1 
ATOM   5061  C  CB    . GLU A 1 310 ? 15.411  -5.267  -35.435 1.00 32.03 ? 310 GLU A CB    1 
ATOM   5062  C  CG    . GLU A 1 310 ? 15.377  -5.065  -33.926 1.00 29.48 ? 310 GLU A CG    1 
ATOM   5063  C  CD    . GLU A 1 310 ? 15.496  -6.354  -33.108 1.00 39.14 ? 310 GLU A CD    1 
ATOM   5064  O  OE1   . GLU A 1 310 ? 15.649  -7.460  -33.684 1.00 30.14 ? 310 GLU A OE1   1 
ATOM   5065  O  OE2   . GLU A 1 310 ? 15.448  -6.263  -31.861 1.00 48.13 ? 310 GLU A OE2   1 
ATOM   5066  H  H     . GLU A 1 310 ? 14.229  -7.406  -35.156 1.00 30.03 ? 310 GLU A H     1 
ATOM   5067  H  HA    . GLU A 1 310 ? 13.391  -4.989  -35.761 1.00 24.46 ? 310 GLU A HA    1 
ATOM   5068  H  HB2   . GLU A 1 310 ? 16.050  -5.972  -35.625 1.00 38.37 ? 310 GLU A HB2   1 
ATOM   5069  H  HB3   . GLU A 1 310 ? 15.711  -4.436  -35.837 1.00 38.37 ? 310 GLU A HB3   1 
ATOM   5070  H  HG2   . GLU A 1 310 ? 16.115  -4.488  -33.675 1.00 35.32 ? 310 GLU A HG2   1 
ATOM   5071  H  HG3   . GLU A 1 310 ? 14.537  -4.643  -33.689 1.00 35.32 ? 310 GLU A HG3   1 
ATOM   5072  N  N     . THR A 1 311 ? 14.554  -6.657  -38.234 1.00 22.84 ? 311 THR A N     1 
ATOM   5073  C  CA    . THR A 1 311 ? 14.593  -6.655  -39.682 1.00 19.60 ? 311 THR A CA    1 
ATOM   5074  C  C     . THR A 1 311 ? 13.158  -6.695  -40.259 1.00 20.50 ? 311 THR A C     1 
ATOM   5075  O  O     . THR A 1 311 ? 12.863  -6.151  -41.318 1.00 22.75 ? 311 THR A O     1 
ATOM   5076  C  CB    . THR A 1 311 ? 15.408  -7.856  -40.220 1.00 28.99 ? 311 THR A CB    1 
ATOM   5077  O  OG1   . THR A 1 311 ? 16.783  -7.691  -39.855 1.00 28.27 ? 311 THR A OG1   1 
ATOM   5078  C  CG2   . THR A 1 311 ? 15.294  -7.957  -41.700 1.00 30.63 ? 311 THR A CG2   1 
ATOM   5079  H  H     . THR A 1 311 ? 14.825  -7.385  -37.866 1.00 27.34 ? 311 THR A H     1 
ATOM   5080  H  HA    . THR A 1 311 ? 15.024  -5.830  -39.991 1.00 23.46 ? 311 THR A HA    1 
ATOM   5081  H  HB    . THR A 1 311 ? 15.067  -8.676  -39.830 1.00 34.73 ? 311 THR A HB    1 
ATOM   5082  H  HG1   . THR A 1 311 ? 16.854  -7.658  -39.038 1.00 33.86 ? 311 THR A HG1   1 
ATOM   5083  H  HG21  . THR A 1 311 ? 15.804  -8.706  -42.017 1.00 36.70 ? 311 THR A HG21  1 
ATOM   5084  H  HG22  . THR A 1 311 ? 14.375  -8.077  -41.950 1.00 36.70 ? 311 THR A HG22  1 
ATOM   5085  H  HG23  . THR A 1 311 ? 15.627  -7.156  -42.110 1.00 36.70 ? 311 THR A HG23  1 
ATOM   5086  N  N     . ALA A 1 312 ? 12.275  -7.374  -39.542 1.00 24.07 ? 312 ALA A N     1 
ATOM   5087  C  CA    . ALA A 1 312 ? 10.856  -7.410  -39.924 1.00 21.51 ? 312 ALA A CA    1 
ATOM   5088  C  C     . ALA A 1 312 ? 10.305  -5.976  -39.964 1.00 18.06 ? 312 ALA A C     1 
ATOM   5089  O  O     . ALA A 1 312 ? 9.640   -5.588  -40.913 1.00 21.56 ? 312 ALA A O     1 
ATOM   5090  C  CB    . ALA A 1 312 ? 10.092  -8.276  -38.921 1.00 18.07 ? 312 ALA A CB    1 
ATOM   5091  H  H     . ALA A 1 312 ? 12.462  -7.822  -38.832 1.00 28.82 ? 312 ALA A H     1 
ATOM   5092  H  HA    . ALA A 1 312 ? 10.764  -7.806  -40.815 1.00 25.75 ? 312 ALA A HA    1 
ATOM   5093  H  HB1   . ALA A 1 312 ? 9.166   -8.299  -39.171 1.00 21.62 ? 312 ALA A HB1   1 
ATOM   5094  H  HB2   . ALA A 1 312 ? 10.458  -9.164  -38.934 1.00 21.62 ? 312 ALA A HB2   1 
ATOM   5095  H  HB3   . ALA A 1 312 ? 10.186  -7.895  -38.045 1.00 21.62 ? 312 ALA A HB3   1 
ATOM   5096  N  N     . TYR A 1 313 ? 10.636  -5.145  -38.982 1.00 21.64 ? 313 TYR A N     1 
ATOM   5097  C  CA    . TYR A 1 313 ? 10.130  -3.772  -39.004 1.00 23.84 ? 313 TYR A CA    1 
ATOM   5098  C  C     . TYR A 1 313 ? 10.595  -3.045  -40.246 1.00 25.68 ? 313 TYR A C     1 
ATOM   5099  O  O     . TYR A 1 313 ? 9.824   -2.384  -40.935 1.00 21.17 ? 313 TYR A O     1 
ATOM   5100  C  CB    . TYR A 1 313 ? 10.622  -2.970  -37.796 1.00 32.42 ? 313 TYR A CB    1 
ATOM   5101  C  CG    . TYR A 1 313 ? 10.081  -3.399  -36.462 1.00 35.59 ? 313 TYR A CG    1 
ATOM   5102  C  CD1   . TYR A 1 313 ? 8.733   -3.552  -36.267 1.00 42.27 ? 313 TYR A CD1   1 
ATOM   5103  C  CD2   . TYR A 1 313 ? 10.935  -3.634  -35.382 1.00 44.33 ? 313 TYR A CD2   1 
ATOM   5104  C  CE1   . TYR A 1 313 ? 8.226   -3.932  -35.052 1.00 44.91 ? 313 TYR A CE1   1 
ATOM   5105  C  CE2   . TYR A 1 313 ? 10.437  -4.021  -34.151 1.00 46.61 ? 313 TYR A CE2   1 
ATOM   5106  C  CZ    . TYR A 1 313 ? 9.065   -4.166  -33.998 1.00 48.74 ? 313 TYR A CZ    1 
ATOM   5107  O  OH    . TYR A 1 313 ? 8.497   -4.543  -32.792 1.00 55.48 ? 313 TYR A OH    1 
ATOM   5108  H  H     . TYR A 1 313 ? 11.137  -5.340  -38.310 1.00 25.90 ? 313 TYR A H     1 
ATOM   5109  H  HA    . TYR A 1 313 ? 9.150   -3.782  -38.995 1.00 28.55 ? 313 TYR A HA    1 
ATOM   5110  H  HB2   . TYR A 1 313 ? 11.588  -3.043  -37.754 1.00 38.84 ? 313 TYR A HB2   1 
ATOM   5111  H  HB3   . TYR A 1 313 ? 10.373  -2.041  -37.924 1.00 38.84 ? 313 TYR A HB3   1 
ATOM   5112  H  HD1   . TYR A 1 313 ? 8.150   -3.396  -36.975 1.00 50.66 ? 313 TYR A HD1   1 
ATOM   5113  H  HD2   . TYR A 1 313 ? 11.853  -3.533  -35.493 1.00 53.14 ? 313 TYR A HD2   1 
ATOM   5114  H  HE1   . TYR A 1 313 ? 7.307   -4.031  -34.944 1.00 53.83 ? 313 TYR A HE1   1 
ATOM   5115  H  HE2   . TYR A 1 313 ? 11.011  -4.176  -33.436 1.00 55.88 ? 313 TYR A HE2   1 
ATOM   5116  H  HH    . TYR A 1 313 ? 8.078   -5.242  -32.886 1.00 66.51 ? 313 TYR A HH    1 
ATOM   5117  N  N     . SER A 1 314 ? 11.886  -3.117  -40.532 1.00 22.84 ? 314 SER A N     1 
ATOM   5118  C  CA    . SER A 1 314 ? 12.391  -2.291  -41.602 1.00 26.73 ? 314 SER A CA    1 
ATOM   5119  C  C     . SER A 1 314 ? 11.917  -2.806  -42.951 1.00 20.25 ? 314 SER A C     1 
ATOM   5120  O  O     . SER A 1 314 ? 11.503  -2.026  -43.797 1.00 24.63 ? 314 SER A O     1 
ATOM   5121  C  CB    . SER A 1 314 ? 13.925  -2.146  -41.528 1.00 29.12 ? 314 SER A CB    1 
ATOM   5122  O  OG    . SER A 1 314 ? 14.545  -3.392  -41.472 1.00 36.29 ? 314 SER A OG    1 
ATOM   5123  H  H     . SER A 1 314 ? 12.466  -3.616  -40.138 1.00 27.35 ? 314 SER A H     1 
ATOM   5124  H  HA    . SER A 1 314 ? 12.015  -1.393  -41.492 1.00 32.01 ? 314 SER A HA    1 
ATOM   5125  H  HB2   . SER A 1 314 ? 14.234  -1.675  -42.318 1.00 34.88 ? 314 SER A HB2   1 
ATOM   5126  H  HB3   . SER A 1 314 ? 14.156  -1.643  -40.732 1.00 34.88 ? 314 SER A HB3   1 
ATOM   5127  H  HG    . SER A 1 314 ? 13.981  -3.987  -41.488 1.00 43.48 ? 314 SER A HG    1 
ATOM   5128  N  N     . GLU A 1 315 ? 11.912  -4.122  -43.142 1.00 19.27 ? 315 GLU A N     1 
ATOM   5129  C  CA    A GLU A 1 315 ? 11.473  -4.682  -44.410 0.52 22.90 ? 315 GLU A CA    1 
ATOM   5130  C  CA    B GLU A 1 315 ? 11.470  -4.689  -44.401 0.48 22.90 ? 315 GLU A CA    1 
ATOM   5131  C  C     . GLU A 1 315 ? 9.976   -4.492  -44.602 1.00 19.27 ? 315 GLU A C     1 
ATOM   5132  O  O     . GLU A 1 315 ? 9.523   -4.319  -45.714 1.00 20.95 ? 315 GLU A O     1 
ATOM   5133  C  CB    A GLU A 1 315 ? 11.826  -6.158  -44.538 0.52 24.69 ? 315 GLU A CB    1 
ATOM   5134  C  CB    B GLU A 1 315 ? 11.800  -6.178  -44.451 0.48 24.70 ? 315 GLU A CB    1 
ATOM   5135  C  CG    A GLU A 1 315 ? 11.303  -6.798  -45.825 0.52 22.96 ? 315 GLU A CG    1 
ATOM   5136  C  CG    B GLU A 1 315 ? 13.277  -6.466  -44.356 0.48 25.03 ? 315 GLU A CG    1 
ATOM   5137  C  CD    A GLU A 1 315 ? 11.954  -6.245  -47.080 0.52 28.26 ? 315 GLU A CD    1 
ATOM   5138  C  CD    B GLU A 1 315 ? 14.038  -5.821  -45.476 0.48 26.95 ? 315 GLU A CD    1 
ATOM   5139  O  OE1   A GLU A 1 315 ? 13.158  -5.925  -47.034 0.52 27.04 ? 315 GLU A OE1   1 
ATOM   5140  O  OE1   B GLU A 1 315 ? 13.569  -5.914  -46.622 0.48 25.92 ? 315 GLU A OE1   1 
ATOM   5141  O  OE2   A GLU A 1 315 ? 11.258  -6.128  -48.105 0.52 24.34 ? 315 GLU A OE2   1 
ATOM   5142  O  OE2   B GLU A 1 315 ? 15.099  -5.217  -45.207 0.48 31.66 ? 315 GLU A OE2   1 
ATOM   5143  H  H     . GLU A 1 315 ? 12.158  -4.706  -42.559 1.00 23.07 ? 315 GLU A H     1 
ATOM   5144  H  HA    . GLU A 1 315 ? 11.934  -4.225  -45.137 0.48 27.42 ? 315 GLU A HA    1 
ATOM   5145  H  HB2   A GLU A 1 315 ? 12.792  -6.252  -44.531 0.52 29.56 ? 315 GLU A HB2   1 
ATOM   5146  H  HB2   B GLU A 1 315 ? 11.361  -6.621  -43.708 0.48 29.58 ? 315 GLU A HB2   1 
ATOM   5147  H  HB3   A GLU A 1 315 ? 11.442  -6.639  -43.789 0.52 29.56 ? 315 GLU A HB3   1 
ATOM   5148  H  HB3   B GLU A 1 315 ? 11.479  -6.543  -45.290 0.48 29.58 ? 315 GLU A HB3   1 
ATOM   5149  H  HG2   A GLU A 1 315 ? 11.476  -7.752  -45.795 0.52 27.50 ? 315 GLU A HG2   1 
ATOM   5150  H  HG2   B GLU A 1 315 ? 13.618  -6.118  -43.517 0.48 29.98 ? 315 GLU A HG2   1 
ATOM   5151  H  HG3   A GLU A 1 315 ? 10.348  -6.638  -45.890 0.52 27.50 ? 315 GLU A HG3   1 
ATOM   5152  H  HG3   B GLU A 1 315 ? 13.420  -7.425  -44.404 0.48 29.98 ? 315 GLU A HG3   1 
ATOM   5153  N  N     . SER A 1 316 ? 9.210   -4.548  -43.509 1.00 19.01 ? 316 SER A N     1 
ATOM   5154  C  CA    . SER A 1 316 ? 7.764   -4.365  -43.623 1.00 16.63 ? 316 SER A CA    1 
ATOM   5155  C  C     . SER A 1 316 ? 7.467   -2.970  -44.211 1.00 19.31 ? 316 SER A C     1 
ATOM   5156  O  O     . SER A 1 316 ? 6.532   -2.769  -44.999 1.00 18.76 ? 316 SER A O     1 
ATOM   5157  C  CB    . SER A 1 316 ? 7.064   -4.547  -42.251 1.00 21.12 ? 316 SER A CB    1 
ATOM   5158  O  OG    . SER A 1 316 ? 7.318   -3.443  -41.382 1.00 22.23 ? 316 SER A OG    1 
ATOM   5159  H  H     . SER A 1 316 ? 9.496   -4.687  -42.709 1.00 22.75 ? 316 SER A H     1 
ATOM   5160  H  HA    . SER A 1 316 ? 7.404   -5.038  -44.238 1.00 19.90 ? 316 SER A HA    1 
ATOM   5161  H  HB2   . SER A 1 316 ? 6.107   -4.619  -42.394 1.00 25.28 ? 316 SER A HB2   1 
ATOM   5162  H  HB3   . SER A 1 316 ? 7.396   -5.357  -41.834 1.00 25.28 ? 316 SER A HB3   1 
ATOM   5163  H  HG    . SER A 1 316 ? 6.940   -3.559  -40.663 1.00 26.61 ? 316 SER A HG    1 
ATOM   5164  N  N     . VAL A 1 317 ? 8.257   -1.980  -43.816 1.00 22.85 ? 317 VAL A N     1 
ATOM   5165  C  CA    . VAL A 1 317 ? 8.008   -0.647  -44.332 1.00 22.57 ? 317 VAL A CA    1 
ATOM   5166  C  C     . VAL A 1 317 ? 8.295   -0.606  -45.816 1.00 25.68 ? 317 VAL A C     1 
ATOM   5167  O  O     . VAL A 1 317 ? 7.577   0.040   -46.558 1.00 28.39 ? 317 VAL A O     1 
ATOM   5168  C  CB    . VAL A 1 317 ? 8.842   0.429   -43.625 1.00 30.91 ? 317 VAL A CB    1 
ATOM   5169  C  CG1   . VAL A 1 317 ? 8.565   1.788   -44.240 1.00 33.26 ? 317 VAL A CG1   1 
ATOM   5170  C  CG2   . VAL A 1 317 ? 8.517   0.463   -42.155 1.00 33.20 ? 317 VAL A CG2   1 
ATOM   5171  H  H     . VAL A 1 317 ? 8.919   -2.050  -43.271 1.00 27.36 ? 317 VAL A H     1 
ATOM   5172  H  HA    . VAL A 1 317 ? 7.061   -0.428  -44.202 1.00 27.02 ? 317 VAL A HA    1 
ATOM   5173  H  HB    . VAL A 1 317 ? 9.795   0.227   -43.730 1.00 37.03 ? 317 VAL A HB    1 
ATOM   5174  H  HG11  . VAL A 1 317 ? 9.093   2.449   -43.787 1.00 39.85 ? 317 VAL A HG11  1 
ATOM   5175  H  HG12  . VAL A 1 317 ? 8.798   1.762   -45.171 1.00 39.85 ? 317 VAL A HG12  1 
ATOM   5176  H  HG13  . VAL A 1 317 ? 7.632   1.990   -44.142 1.00 39.85 ? 317 VAL A HG13  1 
ATOM   5177  H  HG21  . VAL A 1 317 ? 9.049   1.142   -41.734 1.00 39.78 ? 317 VAL A HG21  1 
ATOM   5178  H  HG22  . VAL A 1 317 ? 7.584   0.664   -42.047 1.00 39.78 ? 317 VAL A HG22  1 
ATOM   5179  H  HG23  . VAL A 1 317 ? 8.715   -0.394  -41.772 1.00 39.78 ? 317 VAL A HG23  1 
ATOM   5180  N  N     . LYS A 1 318 ? 9.351   -1.283  -46.264 1.00 24.38 ? 318 LYS A N     1 
ATOM   5181  C  CA    . LYS A 1 318 ? 9.635   -1.293  -47.697 1.00 27.05 ? 318 LYS A CA    1 
ATOM   5182  C  C     . LYS A 1 318 ? 8.502   -1.949  -48.459 1.00 27.26 ? 318 LYS A C     1 
ATOM   5183  O  O     . LYS A 1 318 ? 8.140   -1.496  -49.529 1.00 27.77 ? 318 LYS A O     1 
ATOM   5184  C  CB    . LYS A 1 318 ? 10.947  -2.020  -48.016 1.00 26.44 ? 318 LYS A CB    1 
ATOM   5185  C  CG    . LYS A 1 318 ? 12.195  -1.341  -47.519 1.00 33.43 ? 318 LYS A CG    1 
ATOM   5186  C  CD    . LYS A 1 318 ? 13.414  -2.234  -47.791 1.00 37.15 ? 318 LYS A CD    1 
ATOM   5187  C  CE    . LYS A 1 318 ? 14.623  -1.846  -46.955 1.00 57.83 ? 318 LYS A CE    1 
ATOM   5188  N  NZ    . LYS A 1 318 ? 15.744  -2.810  -47.174 1.00 60.23 ? 318 LYS A NZ    1 
ATOM   5189  H  H     . LYS A 1 318 ? 9.901   -1.730  -45.777 1.00 29.19 ? 318 LYS A H     1 
ATOM   5190  H  HA    . LYS A 1 318 ? 9.716   -0.368  -48.012 1.00 32.40 ? 318 LYS A HA    1 
ATOM   5191  H  HB2   . LYS A 1 318 ? 10.915  -2.902  -47.614 1.00 31.67 ? 318 LYS A HB2   1 
ATOM   5192  H  HB3   . LYS A 1 318 ? 11.025  -2.105  -48.979 1.00 31.67 ? 318 LYS A HB3   1 
ATOM   5193  H  HG2   . LYS A 1 318 ? 12.317  -0.500  -47.986 1.00 40.06 ? 318 LYS A HG2   1 
ATOM   5194  H  HG3   . LYS A 1 318 ? 12.127  -1.194  -46.563 1.00 40.06 ? 318 LYS A HG3   1 
ATOM   5195  H  HD2   . LYS A 1 318 ? 13.186  -3.153  -47.581 1.00 44.52 ? 318 LYS A HD2   1 
ATOM   5196  H  HD3   . LYS A 1 318 ? 13.659  -2.158  -48.726 1.00 44.52 ? 318 LYS A HD3   1 
ATOM   5197  H  HE2   . LYS A 1 318 ? 14.924  -0.961  -47.213 1.00 69.33 ? 318 LYS A HE2   1 
ATOM   5198  H  HE3   . LYS A 1 318 ? 14.384  -1.862  -46.015 1.00 69.33 ? 318 LYS A HE3   1 
ATOM   5199  H  HZ1   . LYS A 1 318 ? 15.489  -3.631  -46.943 1.00 72.22 ? 318 LYS A HZ1   1 
ATOM   5200  H  HZ2   . LYS A 1 318 ? 15.980  -2.812  -48.033 1.00 72.22 ? 318 LYS A HZ2   1 
ATOM   5201  H  HZ3   . LYS A 1 318 ? 16.447  -2.576  -46.681 1.00 72.22 ? 318 LYS A HZ3   1 
ATOM   5202  N  N     . LEU A 1 319 ? 7.934   -3.026  -47.914 1.00 23.67 ? 319 LEU A N     1 
ATOM   5203  C  CA    . LEU A 1 319 ? 6.801   -3.672  -48.567 1.00 17.91 ? 319 LEU A CA    1 
ATOM   5204  C  C     . LEU A 1 319 ? 5.554   -2.778  -48.595 1.00 21.10 ? 319 LEU A C     1 
ATOM   5205  O  O     . LEU A 1 319 ? 4.835   -2.726  -49.599 1.00 23.43 ? 319 LEU A O     1 
ATOM   5206  C  CB    . LEU A 1 319 ? 6.511   -5.049  -47.944 1.00 17.06 ? 319 LEU A CB    1 
ATOM   5207  C  CG    . LEU A 1 319 ? 7.644   -6.068  -48.133 1.00 23.15 ? 319 LEU A CG    1 
ATOM   5208  C  CD1   . LEU A 1 319 ? 7.485   -7.262  -47.171 1.00 21.14 ? 319 LEU A CD1   1 
ATOM   5209  C  CD2   . LEU A 1 319 ? 7.724   -6.579  -49.571 1.00 21.07 ? 319 LEU A CD2   1 
ATOM   5210  H  H     . LEU A 1 319 ? 8.182   -3.396  -47.178 1.00 28.35 ? 319 LEU A H     1 
ATOM   5211  H  HA    . LEU A 1 319 ? 7.050   -3.833  -49.501 1.00 21.43 ? 319 LEU A HA    1 
ATOM   5212  H  HB2   . LEU A 1 319 ? 6.369   -4.937  -46.991 1.00 20.41 ? 319 LEU A HB2   1 
ATOM   5213  H  HB3   . LEU A 1 319 ? 5.712   -5.415  -48.354 1.00 20.41 ? 319 LEU A HB3   1 
ATOM   5214  H  HG    . LEU A 1 319 ? 8.487   -5.635  -47.928 1.00 27.72 ? 319 LEU A HG    1 
ATOM   5215  H  HD11  . LEU A 1 319 ? 8.208   -7.878  -47.316 1.00 25.31 ? 319 LEU A HD11  1 
ATOM   5216  H  HD12  . LEU A 1 319 ? 7.506   -6.939  -46.267 1.00 25.31 ? 319 LEU A HD12  1 
ATOM   5217  H  HD13  . LEU A 1 319 ? 6.646   -7.695  -47.346 1.00 25.31 ? 319 LEU A HD13  1 
ATOM   5218  H  HD21  . LEU A 1 319 ? 8.444   -7.210  -49.638 1.00 25.23 ? 319 LEU A HD21  1 
ATOM   5219  H  HD22  . LEU A 1 319 ? 6.893   -7.004  -49.797 1.00 25.23 ? 319 LEU A HD22  1 
ATOM   5220  H  HD23  . LEU A 1 319 ? 7.883   -5.836  -50.157 1.00 25.23 ? 319 LEU A HD23  1 
ATOM   5221  N  N     . LEU A 1 320 ? 5.301   -2.086  -47.493 1.00 24.52 ? 320 LEU A N     1 
ATOM   5222  C  CA    . LEU A 1 320 ? 4.184   -1.156  -47.414 1.00 25.03 ? 320 LEU A CA    1 
ATOM   5223  C  C     . LEU A 1 320 ? 4.355   -0.042  -48.466 1.00 23.52 ? 320 LEU A C     1 
ATOM   5224  O  O     . LEU A 1 320 ? 3.413   0.324   -49.154 1.00 25.97 ? 320 LEU A O     1 
ATOM   5225  C  CB    . LEU A 1 320 ? 4.084   -0.560  -46.007 1.00 24.18 ? 320 LEU A CB    1 
ATOM   5226  C  CG    . LEU A 1 320 ? 3.087   0.601   -45.899 1.00 22.45 ? 320 LEU A CG    1 
ATOM   5227  C  CD1   . LEU A 1 320 ? 1.701   0.185   -46.372 1.00 24.71 ? 320 LEU A CD1   1 
ATOM   5228  C  CD2   . LEU A 1 320 ? 3.056   1.107   -44.471 1.00 26.10 ? 320 LEU A CD2   1 
ATOM   5229  H  H     . LEU A 1 320 ? 5.765   -2.137  -46.771 1.00 29.36 ? 320 LEU A H     1 
ATOM   5230  H  HA    . LEU A 1 320 ? 3.350   -1.635  -47.605 1.00 29.98 ? 320 LEU A HA    1 
ATOM   5231  H  HB2   . LEU A 1 320 ? 3.800   -1.255  -45.393 1.00 28.96 ? 320 LEU A HB2   1 
ATOM   5232  H  HB3   . LEU A 1 320 ? 4.957   -0.227  -45.747 1.00 28.96 ? 320 LEU A HB3   1 
ATOM   5233  H  HG    . LEU A 1 320 ? 3.388   1.328   -46.465 1.00 26.88 ? 320 LEU A HG    1 
ATOM   5234  H  HD11  . LEU A 1 320 ? 1.755   -0.092  -47.289 1.00 29.59 ? 320 LEU A HD11  1 
ATOM   5235  H  HD12  . LEU A 1 320 ? 1.391   -0.542  -45.827 1.00 29.59 ? 320 LEU A HD12  1 
ATOM   5236  H  HD13  . LEU A 1 320 ? 1.105   0.933   -46.290 1.00 29.59 ? 320 LEU A HD13  1 
ATOM   5237  H  HD21  . LEU A 1 320 ? 2.785   0.391   -43.892 1.00 31.26 ? 320 LEU A HD21  1 
ATOM   5238  H  HD22  . LEU A 1 320 ? 3.934   1.410   -44.228 1.00 31.26 ? 320 LEU A HD22  1 
ATOM   5239  H  HD23  . LEU A 1 320 ? 2.430   1.833   -44.410 1.00 31.26 ? 320 LEU A HD23  1 
ATOM   5240  N  N     . GLN A 1 321 ? 5.561   0.491   -48.577 1.00 30.40 ? 321 GLN A N     1 
ATOM   5241  C  CA    . GLN A 1 321 ? 5.829   1.481   -49.615 1.00 34.94 ? 321 GLN A CA    1 
ATOM   5242  C  C     . GLN A 1 321 ? 5.506   0.912   -51.001 1.00 33.31 ? 321 GLN A C     1 
ATOM   5243  O  O     . GLN A 1 321 ? 4.897   1.578   -51.830 1.00 35.60 ? 321 GLN A O     1 
ATOM   5244  C  CB    . GLN A 1 321 ? 7.269   1.959   -49.523 1.00 33.05 ? 321 GLN A CB    1 
ATOM   5245  C  CG    . GLN A 1 321 ? 7.574   2.768   -48.273 1.00 35.64 ? 321 GLN A CG    1 
ATOM   5246  C  CD    . GLN A 1 321 ? 9.047   3.111   -48.139 1.00 41.56 ? 321 GLN A CD    1 
ATOM   5247  O  OE1   . GLN A 1 321 ? 9.814   2.429   -47.446 1.00 45.60 ? 321 GLN A OE1   1 
ATOM   5248  N  NE2   . GLN A 1 321 ? 9.454   4.175   -48.809 1.00 45.47 ? 321 GLN A NE2   1 
ATOM   5249  H  H     . GLN A 1 321 ? 6.233   0.303   -48.075 1.00 36.42 ? 321 GLN A H     1 
ATOM   5250  H  HA    . GLN A 1 321 ? 5.247   2.256   -49.468 1.00 41.86 ? 321 GLN A HA    1 
ATOM   5251  H  HB2   . GLN A 1 321 ? 7.855   1.186   -49.526 1.00 39.60 ? 321 GLN A HB2   1 
ATOM   5252  H  HB3   . GLN A 1 321 ? 7.461   2.519   -50.292 1.00 39.60 ? 321 GLN A HB3   1 
ATOM   5253  H  HG2   . GLN A 1 321 ? 7.074   3.599   -48.305 1.00 42.71 ? 321 GLN A HG2   1 
ATOM   5254  H  HG3   . GLN A 1 321 ? 7.314   2.254   -47.493 1.00 42.71 ? 321 GLN A HG3   1 
ATOM   5255  H  HE21  . GLN A 1 321 ? 10.278  4.417   -48.771 1.00 54.50 ? 321 GLN A HE21  1 
ATOM   5256  H  HE22  . GLN A 1 321 ? 8.895   4.624   -49.283 1.00 54.50 ? 321 GLN A HE22  1 
ATOM   5257  N  N     . LYS A 1 322 ? 5.875   -0.344  -51.241 1.00 30.22 ? 322 LYS A N     1 
ATOM   5258  C  CA    . LYS A 1 322 ? 5.574   -0.987  -52.513 1.00 34.84 ? 322 LYS A CA    1 
ATOM   5259  C  C     . LYS A 1 322 ? 4.062   -1.039  -52.765 1.00 33.53 ? 322 LYS A C     1 
ATOM   5260  O  O     . LYS A 1 322 ? 3.587   -0.719  -53.864 1.00 33.29 ? 322 LYS A O     1 
ATOM   5261  C  CB    . LYS A 1 322 ? 6.185   -2.391  -52.564 1.00 28.02 ? 322 LYS A CB    1 
ATOM   5262  C  CG    . LYS A 1 322 ? 6.095   -3.047  -53.930 1.00 45.66 ? 322 LYS A CG    1 
ATOM   5263  C  CD    . LYS A 1 322 ? 6.817   -4.400  -53.969 1.00 50.88 ? 322 LYS A CD    1 
ATOM   5264  C  CE    . LYS A 1 322 ? 8.321   -4.256  -53.742 1.00 57.27 ? 322 LYS A CE    1 
ATOM   5265  N  NZ    . LYS A 1 322 ? 9.045   -5.578  -53.675 1.00 62.33 ? 322 LYS A NZ    1 
ATOM   5266  H  H     . LYS A 1 322 ? 6.300   -0.843  -50.684 1.00 36.20 ? 322 LYS A H     1 
ATOM   5267  H  HA    . LYS A 1 322 ? 5.977   -0.460  -53.235 1.00 41.75 ? 322 LYS A HA    1 
ATOM   5268  H  HB2   . LYS A 1 322 ? 7.123   -2.333  -52.324 1.00 33.56 ? 322 LYS A HB2   1 
ATOM   5269  H  HB3   . LYS A 1 322 ? 5.719   -2.959  -51.931 1.00 33.56 ? 322 LYS A HB3   1 
ATOM   5270  H  HG2   . LYS A 1 322 ? 5.162   -3.197  -54.150 1.00 54.73 ? 322 LYS A HG2   1 
ATOM   5271  H  HG3   . LYS A 1 322 ? 6.505   -2.467  -54.589 1.00 54.73 ? 322 LYS A HG3   1 
ATOM   5272  H  HD2   . LYS A 1 322 ? 6.460   -4.972  -53.272 1.00 61.00 ? 322 LYS A HD2   1 
ATOM   5273  H  HD3   . LYS A 1 322 ? 6.681   -4.809  -54.838 1.00 61.00 ? 322 LYS A HD3   1 
ATOM   5274  H  HE2   . LYS A 1 322 ? 8.701   -3.744  -54.474 1.00 68.66 ? 322 LYS A HE2   1 
ATOM   5275  H  HE3   . LYS A 1 322 ? 8.469   -3.792  -52.903 1.00 68.66 ? 322 LYS A HE3   1 
ATOM   5276  H  HZ1   . LYS A 1 322 ? 8.935   -6.024  -54.437 1.00 74.74 ? 322 LYS A HZ1   1 
ATOM   5277  H  HZ2   . LYS A 1 322 ? 9.914   -5.442  -53.542 1.00 74.74 ? 322 LYS A HZ2   1 
ATOM   5278  H  HZ3   . LYS A 1 322 ? 8.723   -6.067  -53.005 1.00 74.74 ? 322 LYS A HZ3   1 
ATOM   5279  N  N     . ILE A 1 323 ? 3.288   -1.428  -51.757 1.00 26.50 ? 323 ILE A N     1 
ATOM   5280  C  CA    . ILE A 1 323 ? 1.837   -1.446  -51.913 1.00 22.09 ? 323 ILE A CA    1 
ATOM   5281  C  C     . ILE A 1 323 ? 1.322   -0.038  -52.261 1.00 24.41 ? 323 ILE A C     1 
ATOM   5282  O  O     . ILE A 1 323 ? 0.512   0.127   -53.169 1.00 34.43 ? 323 ILE A O     1 
ATOM   5283  C  CB    . ILE A 1 323 ? 1.147   -1.909  -50.617 1.00 29.03 ? 323 ILE A CB    1 
ATOM   5284  C  CG1   . ILE A 1 323 ? 1.408   -3.402  -50.377 1.00 22.55 ? 323 ILE A CG1   1 
ATOM   5285  C  CG2   . ILE A 1 323 ? -0.326  -1.657  -50.686 1.00 23.46 ? 323 ILE A CG2   1 
ATOM   5286  C  CD1   . ILE A 1 323 ? 0.914   -3.860  -48.999 1.00 25.63 ? 323 ILE A CD1   1 
ATOM   5287  H  H     . ILE A 1 323 ? 3.571   -1.682  -50.985 1.00 31.74 ? 323 ILE A H     1 
ATOM   5288  H  HA    . ILE A 1 323 ? 1.590   -2.059  -52.637 1.00 26.45 ? 323 ILE A HA    1 
ATOM   5289  H  HB    . ILE A 1 323 ? 1.513   -1.406  -49.873 1.00 34.77 ? 323 ILE A HB    1 
ATOM   5290  H  HG12  . ILE A 1 323 ? 0.942   -3.919  -51.053 1.00 27.00 ? 323 ILE A HG12  1 
ATOM   5291  H  HG13  . ILE A 1 323 ? 2.362   -3.570  -50.427 1.00 27.00 ? 323 ILE A HG13  1 
ATOM   5292  H  HG21  . ILE A 1 323 ? -0.476  -0.716  -50.804 1.00 28.10 ? 323 ILE A HG21  1 
ATOM   5293  H  HG22  . ILE A 1 323 ? -0.692  -2.143  -51.428 1.00 28.10 ? 323 ILE A HG22  1 
ATOM   5294  H  HG23  . ILE A 1 323 ? -0.732  -1.953  -49.868 1.00 28.10 ? 323 ILE A HG23  1 
ATOM   5295  H  HD11  . ILE A 1 323 ? -0.032  -3.704  -48.939 1.00 30.70 ? 323 ILE A HD11  1 
ATOM   5296  H  HD12  . ILE A 1 323 ? 1.098   -4.796  -48.896 1.00 30.70 ? 323 ILE A HD12  1 
ATOM   5297  H  HD13  . ILE A 1 323 ? 1.372   -3.358  -48.321 1.00 30.70 ? 323 ILE A HD13  1 
ATOM   5298  N  N     . LEU A 1 324 ? 1.798   0.964   -51.533 1.00 27.18 ? 324 LEU A N     1 
ATOM   5299  C  CA    . LEU A 1 324 ? 1.350   2.332   -51.750 1.00 35.02 ? 324 LEU A CA    1 
ATOM   5300  C  C     . LEU A 1 324 ? 1.747   2.790   -53.167 1.00 39.32 ? 324 LEU A C     1 
ATOM   5301  O  O     . LEU A 1 324 ? 1.041   3.553   -53.826 1.00 36.85 ? 324 LEU A O     1 
ATOM   5302  C  CB    . LEU A 1 324 ? 1.956   3.256   -50.698 1.00 33.65 ? 324 LEU A CB    1 
ATOM   5303  C  CG    . LEU A 1 324 ? 1.457   3.147   -49.241 1.00 34.35 ? 324 LEU A CG    1 
ATOM   5304  C  CD1   . LEU A 1 324 ? 2.293   4.032   -48.348 1.00 39.83 ? 324 LEU A CD1   1 
ATOM   5305  C  CD2   . LEU A 1 324 ? 0.003   3.508   -49.103 1.00 31.83 ? 324 LEU A CD2   1 
ATOM   5306  H  H     . LEU A 1 324 ? 2.381   0.878   -50.906 1.00 32.56 ? 324 LEU A H     1 
ATOM   5307  H  HA    . LEU A 1 324 ? 0.373   2.372   -51.673 1.00 41.96 ? 324 LEU A HA    1 
ATOM   5308  H  HB2   . LEU A 1 324 ? 2.912   3.095   -50.679 1.00 40.31 ? 324 LEU A HB2   1 
ATOM   5309  H  HB3   . LEU A 1 324 ? 1.796   4.170   -50.980 1.00 40.31 ? 324 LEU A HB3   1 
ATOM   5310  H  HG    . LEU A 1 324 ? 1.567   2.232   -48.940 1.00 41.16 ? 324 LEU A HG    1 
ATOM   5311  H  HD11  . LEU A 1 324 ? 1.974   3.956   -47.446 1.00 47.73 ? 324 LEU A HD11  1 
ATOM   5312  H  HD12  . LEU A 1 324 ? 3.209   3.748   -48.397 1.00 47.73 ? 324 LEU A HD12  1 
ATOM   5313  H  HD13  . LEU A 1 324 ? 2.215   4.941   -48.648 1.00 47.73 ? 324 LEU A HD13  1 
ATOM   5314  H  HD21  . LEU A 1 324 ? -0.519  2.911   -49.645 1.00 38.13 ? 324 LEU A HD21  1 
ATOM   5315  H  HD22  . LEU A 1 324 ? -0.254  3.423   -48.182 1.00 38.13 ? 324 LEU A HD22  1 
ATOM   5316  H  HD23  . LEU A 1 324 ? -0.124  4.413   -49.397 1.00 38.13 ? 324 LEU A HD23  1 
ATOM   5317  N  N     . GLU A 1 325 ? 2.892   2.317   -53.632 1.00 38.43 ? 325 GLU A N     1 
ATOM   5318  C  CA    . GLU A 1 325 ? 3.391   2.694   -54.951 1.00 39.76 ? 325 GLU A CA    1 
ATOM   5319  C  C     . GLU A 1 325 ? 2.527   2.083   -56.051 1.00 44.35 ? 325 GLU A C     1 
ATOM   5320  O  O     . GLU A 1 325 ? 2.204   2.741   -57.042 1.00 44.36 ? 325 GLU A O     1 
ATOM   5321  C  CB    . GLU A 1 325 ? 4.855   2.259   -55.077 1.00 37.66 ? 325 GLU A CB    1 
ATOM   5322  C  CG    . GLU A 1 325 ? 5.501   2.525   -56.423 1.00 51.78 ? 325 GLU A CG    1 
ATOM   5323  C  CD    . GLU A 1 325 ? 6.911   1.966   -56.487 1.00 50.89 ? 325 GLU A CD    1 
ATOM   5324  O  OE1   . GLU A 1 325 ? 7.700   2.254   -55.559 1.00 45.19 ? 325 GLU A OE1   1 
ATOM   5325  O  OE2   . GLU A 1 325 ? 7.219   1.225   -57.453 1.00 61.93 ? 325 GLU A OE2   1 
ATOM   5326  H  H     . GLU A 1 325 ? 3.404   1.774   -53.204 1.00 46.06 ? 325 GLU A H     1 
ATOM   5327  H  HA    . GLU A 1 325 ? 3.354   3.669   -55.041 1.00 47.65 ? 325 GLU A HA    1 
ATOM   5328  H  HB2   . GLU A 1 325 ? 5.374   2.731   -54.407 1.00 45.13 ? 325 GLU A HB2   1 
ATOM   5329  H  HB3   . GLU A 1 325 ? 4.906   1.305   -54.913 1.00 45.13 ? 325 GLU A HB3   1 
ATOM   5330  H  HG2   . GLU A 1 325 ? 4.975   2.102   -57.120 1.00 62.07 ? 325 GLU A HG2   1 
ATOM   5331  H  HG3   . GLU A 1 325 ? 5.547   3.482   -56.572 1.00 62.07 ? 325 GLU A HG3   1 
ATOM   5332  N  N     . GLU A 1 326 ? 2.110   0.837   -55.862 1.00 33.07 ? 326 GLU A N     1 
ATOM   5333  C  CA    . GLU A 1 326 ? 1.455   0.099   -56.931 1.00 39.32 ? 326 GLU A CA    1 
ATOM   5334  C  C     . GLU A 1 326 ? -0.060  0.053   -56.818 1.00 38.82 ? 326 GLU A C     1 
ATOM   5335  O  O     . GLU A 1 326 ? -0.726  -0.487  -57.698 1.00 38.87 ? 326 GLU A O     1 
ATOM   5336  C  CB    . GLU A 1 326 ? 2.039   -1.303  -56.998 1.00 33.28 ? 326 GLU A CB    1 
ATOM   5337  C  CG    . GLU A 1 326 ? 3.517   -1.259  -57.321 1.00 42.51 ? 326 GLU A CG    1 
ATOM   5338  C  CD    . GLU A 1 326 ? 4.172   -2.616  -57.318 1.00 45.94 ? 326 GLU A CD    1 
ATOM   5339  O  OE1   . GLU A 1 326 ? 3.499   -3.608  -56.954 1.00 41.42 ? 326 GLU A OE1   1 
ATOM   5340  O  OE2   . GLU A 1 326 ? 5.366   -2.679  -57.674 1.00 48.40 ? 326 GLU A OE2   1 
ATOM   5341  H  H     . GLU A 1 326 ? 2.194   0.398   -55.127 1.00 39.62 ? 326 GLU A H     1 
ATOM   5342  H  HA    . GLU A 1 326 ? 1.666   0.541   -57.780 1.00 47.12 ? 326 GLU A HA    1 
ATOM   5343  H  HB2   . GLU A 1 326 ? 1.926   -1.740  -56.140 1.00 39.87 ? 326 GLU A HB2   1 
ATOM   5344  H  HB3   . GLU A 1 326 ? 1.588   -1.806  -57.695 1.00 39.87 ? 326 GLU A HB3   1 
ATOM   5345  H  HG2   . GLU A 1 326 ? 3.634   -0.875  -58.204 1.00 50.95 ? 326 GLU A HG2   1 
ATOM   5346  H  HG3   . GLU A 1 326 ? 3.966   -0.710  -56.660 1.00 50.95 ? 326 GLU A HG3   1 
ATOM   5347  N  N     . ASP A 1 327 ? -0.596  0.624   -55.741 1.00 42.28 ? 327 ASP A N     1 
ATOM   5348  C  CA    . ASP A 1 327 ? -2.044  0.739   -55.555 1.00 37.33 ? 327 ASP A CA    1 
ATOM   5349  C  C     . ASP A 1 327 ? -2.398  2.133   -55.001 1.00 39.10 ? 327 ASP A C     1 
ATOM   5350  O  O     . ASP A 1 327 ? -1.895  2.544   -53.961 1.00 39.48 ? 327 ASP A O     1 
ATOM   5351  C  CB    . ASP A 1 327 ? -2.542  -0.358  -54.611 1.00 44.86 ? 327 ASP A CB    1 
ATOM   5352  C  CG    . ASP A 1 327 ? -4.037  -0.583  -54.711 1.00 45.11 ? 327 ASP A CG    1 
ATOM   5353  O  OD1   . ASP A 1 327 ? -4.795  0.348   -54.374 1.00 42.74 ? 327 ASP A OD1   1 
ATOM   5354  O  OD2   . ASP A 1 327 ? -4.456  -1.687  -55.139 1.00 49.49 ? 327 ASP A OD2   1 
ATOM   5355  H  H     . ASP A 1 327 ? -0.136  0.958   -55.095 1.00 50.67 ? 327 ASP A H     1 
ATOM   5356  H  HA    . ASP A 1 327 ? -2.492  0.628   -56.420 1.00 44.74 ? 327 ASP A HA    1 
ATOM   5357  H  HB2   . ASP A 1 327 ? -2.098  -1.192  -54.832 1.00 53.77 ? 327 ASP A HB2   1 
ATOM   5358  H  HB3   . ASP A 1 327 ? -2.337  -0.106  -53.697 1.00 53.77 ? 327 ASP A HB3   1 
ATOM   5359  N  N     . GLU A 1 328 ? -3.266  2.861   -55.699 1.00 42.72 ? 328 GLU A N     1 
ATOM   5360  C  CA    . GLU A 1 328 ? -3.569  4.246   -55.332 1.00 49.59 ? 328 GLU A CA    1 
ATOM   5361  C  C     . GLU A 1 328 ? -4.606  4.337   -54.212 1.00 48.54 ? 328 GLU A C     1 
ATOM   5362  O  O     . GLU A 1 328 ? -4.718  5.363   -53.551 1.00 45.33 ? 328 GLU A O     1 
ATOM   5363  C  CB    . GLU A 1 328 ? -4.030  5.039   -56.569 1.00 51.68 ? 328 GLU A CB    1 
ATOM   5364  C  CG    . GLU A 1 328 ? -2.928  5.159   -57.645 1.00 52.74 ? 328 GLU A CG    1 
ATOM   5365  C  CD    . GLU A 1 328 ? -3.344  5.960   -58.890 1.00 72.14 ? 328 GLU A CD    1 
ATOM   5366  O  OE1   . GLU A 1 328 ? -4.565  6.059   -59.183 1.00 66.21 ? 328 GLU A OE1   1 
ATOM   5367  O  OE2   . GLU A 1 328 ? -2.432  6.484   -59.581 1.00 71.29 ? 328 GLU A OE2   1 
ATOM   5368  H  H     . GLU A 1 328 ? -3.693  2.578   -56.390 1.00 51.20 ? 328 GLU A H     1 
ATOM   5369  H  HA    . GLU A 1 328 ? -2.747  4.667   -55.004 1.00 59.44 ? 328 GLU A HA    1 
ATOM   5370  H  HB2   . GLU A 1 328 ? -4.791  4.589   -56.968 1.00 61.96 ? 328 GLU A HB2   1 
ATOM   5371  H  HB3   . GLU A 1 328 ? -4.281  5.935   -56.295 1.00 61.96 ? 328 GLU A HB3   1 
ATOM   5372  H  HG2   . GLU A 1 328 ? -2.159  5.601   -57.254 1.00 63.23 ? 328 GLU A HG2   1 
ATOM   5373  H  HG3   . GLU A 1 328 ? -2.680  4.268   -57.937 1.00 63.23 ? 328 GLU A HG3   1 
ATOM   5374  N  N     . ARG A 1 329 ? -5.335  3.246   -53.987 1.00 47.86 ? 329 ARG A N     1 
ATOM   5375  C  CA    . ARG A 1 329 ? -6.391  3.212   -52.979 1.00 38.65 ? 329 ARG A CA    1 
ATOM   5376  C  C     . ARG A 1 329 ? -5.902  3.496   -51.554 1.00 47.91 ? 329 ARG A C     1 
ATOM   5377  O  O     . ARG A 1 329 ? -4.725  3.316   -51.217 1.00 40.96 ? 329 ARG A O     1 
ATOM   5378  C  CB    . ARG A 1 329 ? -7.136  1.878   -53.050 1.00 42.50 ? 329 ARG A CB    1 
ATOM   5379  C  CG    . ARG A 1 329 ? -7.911  1.717   -54.351 1.00 43.75 ? 329 ARG A CG    1 
ATOM   5380  C  CD    . ARG A 1 329 ? -8.540  0.347   -54.500 1.00 47.75 ? 329 ARG A CD    1 
ATOM   5381  N  NE    . ARG A 1 329 ? -7.545  -0.713  -54.636 1.00 38.64 ? 329 ARG A NE    1 
ATOM   5382  C  CZ    . ARG A 1 329 ? -7.840  -1.985  -54.880 1.00 40.96 ? 329 ARG A CZ    1 
ATOM   5383  N  NH1   . ARG A 1 329 ? -9.103  -2.361  -55.030 1.00 42.76 ? 329 ARG A NH1   1 
ATOM   5384  N  NH2   . ARG A 1 329 ? -6.873  -2.886  -54.987 1.00 39.92 ? 329 ARG A NH2   1 
ATOM   5385  H  H     . ARG A 1 329 ? -5.236  2.504   -54.410 1.00 57.37 ? 329 ARG A H     1 
ATOM   5386  H  HA    . ARG A 1 329 ? -7.040  3.912   -53.200 1.00 46.32 ? 329 ARG A HA    1 
ATOM   5387  H  HB2   . ARG A 1 329 ? -6.495  1.153   -52.990 1.00 50.94 ? 329 ARG A HB2   1 
ATOM   5388  H  HB3   . ARG A 1 329 ? -7.767  1.827   -52.315 1.00 50.94 ? 329 ARG A HB3   1 
ATOM   5389  H  HG2   . ARG A 1 329 ? -8.622  2.376   -54.378 1.00 52.44 ? 329 ARG A HG2   1 
ATOM   5390  H  HG3   . ARG A 1 329 ? -7.306  1.851   -55.097 1.00 52.44 ? 329 ARG A HG3   1 
ATOM   5391  H  HD2   . ARG A 1 329 ? -9.076  0.157   -53.715 1.00 57.24 ? 329 ARG A HD2   1 
ATOM   5392  H  HD3   . ARG A 1 329 ? -9.098  0.339   -55.294 1.00 57.24 ? 329 ARG A HD3   1 
ATOM   5393  H  HE    . ARG A 1 329 ? -6.714  -0.493  -54.602 1.00 46.31 ? 329 ARG A HE    1 
ATOM   5394  H  HH11  . ARG A 1 329 ? -9.735  -1.782  -54.962 1.00 51.25 ? 329 ARG A HH11  1 
ATOM   5395  H  HH12  . ARG A 1 329 ? -9.290  -3.185  -55.189 1.00 51.25 ? 329 ARG A HH12  1 
ATOM   5396  H  HH21  . ARG A 1 329 ? -6.051  -2.649  -54.894 1.00 47.84 ? 329 ARG A HH21  1 
ATOM   5397  H  HH22  . ARG A 1 329 ? -7.067  -3.708  -55.148 1.00 47.84 ? 329 ARG A HH22  1 
ATOM   5398  N  N     . LYS A 1 330 ? -6.815  3.983   -50.721 1.00 44.13 ? 330 LYS A N     1 
ATOM   5399  C  CA    . LYS A 1 330 ? -6.491  4.228   -49.325 1.00 40.98 ? 330 LYS A CA    1 
ATOM   5400  C  C     . LYS A 1 330 ? -6.559  2.878   -48.614 1.00 31.87 ? 330 LYS A C     1 
ATOM   5401  O  O     . LYS A 1 330 ? -7.290  1.975   -49.049 1.00 29.79 ? 330 LYS A O     1 
ATOM   5402  C  CB    . LYS A 1 330 ? -7.480  5.212   -48.689 1.00 51.70 ? 330 LYS A CB    1 
ATOM   5403  C  CG    . LYS A 1 330 ? -7.740  6.459   -49.527 1.00 56.48 ? 330 LYS A CG    1 
ATOM   5404  C  CD    . LYS A 1 330 ? -8.546  7.504   -48.770 1.00 64.87 ? 330 LYS A CD    1 
ATOM   5405  C  CE    . LYS A 1 330 ? -8.839  8.729   -49.642 1.00 67.22 ? 330 LYS A CE    1 
ATOM   5406  N  NZ    . LYS A 1 330 ? -9.858  8.465   -50.710 1.00 69.72 ? 330 LYS A NZ    1 
ATOM   5407  H  H     . LYS A 1 330 ? -7.624  4.179   -50.939 1.00 52.90 ? 330 LYS A H     1 
ATOM   5408  H  HA    . LYS A 1 330 ? -5.583  4.589   -49.247 1.00 49.11 ? 330 LYS A HA    1 
ATOM   5409  H  HB2   . LYS A 1 330 ? -8.329  4.761   -48.560 1.00 61.97 ? 330 LYS A HB2   1 
ATOM   5410  H  HB3   . LYS A 1 330 ? -7.127  5.499   -47.833 1.00 61.97 ? 330 LYS A HB3   1 
ATOM   5411  H  HG2   . LYS A 1 330 ? -6.891  6.856   -49.777 1.00 67.72 ? 330 LYS A HG2   1 
ATOM   5412  H  HG3   . LYS A 1 330 ? -8.238  6.211   -50.321 1.00 67.72 ? 330 LYS A HG3   1 
ATOM   5413  H  HD2   . LYS A 1 330 ? -9.392  7.117   -48.495 1.00 77.79 ? 330 LYS A HD2   1 
ATOM   5414  H  HD3   . LYS A 1 330 ? -8.042  7.796   -47.994 1.00 77.79 ? 330 LYS A HD3   1 
ATOM   5415  H  HE2   . LYS A 1 330 ? -9.176  9.443   -49.079 1.00 80.61 ? 330 LYS A HE2   1 
ATOM   5416  H  HE3   . LYS A 1 330 ? -8.018  9.010   -50.076 1.00 80.61 ? 330 LYS A HE3   1 
ATOM   5417  H  HZ1   . LYS A 1 330 ? -10.628 8.213   -50.340 1.00 83.60 ? 330 LYS A HZ1   1 
ATOM   5418  H  HZ2   . LYS A 1 330 ? -9.995  9.202   -51.189 1.00 83.60 ? 330 LYS A HZ2   1 
ATOM   5419  H  HZ3   . LYS A 1 330 ? -9.572  7.818   -51.250 1.00 83.60 ? 330 LYS A HZ3   1 
ATOM   5420  N  N     . ILE A 1 331 ? -5.808  2.762   -47.526 1.00 34.10 ? 331 ILE A N     1 
ATOM   5421  C  CA    . ILE A 1 331 ? -5.730  1.518   -46.776 1.00 35.88 ? 331 ILE A CA    1 
ATOM   5422  C  C     . ILE A 1 331 ? -6.630  1.605   -45.543 1.00 29.24 ? 331 ILE A C     1 
ATOM   5423  O  O     . ILE A 1 331 ? -6.632  2.616   -44.853 1.00 27.96 ? 331 ILE A O     1 
ATOM   5424  C  CB    . ILE A 1 331 ? -4.263  1.221   -46.401 1.00 29.03 ? 331 ILE A CB    1 
ATOM   5425  C  CG1   . ILE A 1 331 ? -3.470  1.015   -47.698 1.00 29.97 ? 331 ILE A CG1   1 
ATOM   5426  C  CG2   . ILE A 1 331 ? -4.162  -0.016  -45.459 1.00 27.95 ? 331 ILE A CG2   1 
ATOM   5427  C  CD1   . ILE A 1 331 ? -1.992  0.864   -47.526 1.00 31.72 ? 331 ILE A CD1   1 
ATOM   5428  H  H     . ILE A 1 331 ? -5.328  3.396   -47.200 1.00 40.85 ? 331 ILE A H     1 
ATOM   5429  H  HA    . ILE A 1 331 ? -6.055  0.784   -47.338 1.00 42.99 ? 331 ILE A HA    1 
ATOM   5430  H  HB    . ILE A 1 331 ? -3.901  1.992   -45.937 1.00 34.78 ? 331 ILE A HB    1 
ATOM   5431  H  HG12  . ILE A 1 331 ? -3.796  0.213   -48.134 1.00 35.91 ? 331 ILE A HG12  1 
ATOM   5432  H  HG13  . ILE A 1 331 ? -3.619  1.781   -48.275 1.00 35.91 ? 331 ILE A HG13  1 
ATOM   5433  H  HG21  . ILE A 1 331 ? -3.239  -0.172  -45.247 1.00 33.48 ? 331 ILE A HG21  1 
ATOM   5434  H  HG22  . ILE A 1 331 ? -4.657  0.161   -44.656 1.00 33.48 ? 331 ILE A HG22  1 
ATOM   5435  H  HG23  . ILE A 1 331 ? -4.529  -0.781  -45.908 1.00 33.48 ? 331 ILE A HG23  1 
ATOM   5436  H  HD11  . ILE A 1 331 ? -1.588  0.741   -48.388 1.00 38.01 ? 331 ILE A HD11  1 
ATOM   5437  H  HD12  . ILE A 1 331 ? -1.644  1.657   -47.110 1.00 38.01 ? 331 ILE A HD12  1 
ATOM   5438  H  HD13  . ILE A 1 331 ? -1.820  0.100   -46.971 1.00 38.01 ? 331 ILE A HD13  1 
ATOM   5439  N  N     . ARG A 1 332 ? -7.428  0.566   -45.324 1.00 28.65 ? 332 ARG A N     1 
ATOM   5440  C  CA    . ARG A 1 332 ? -8.299  0.477   -44.144 1.00 30.66 ? 332 ARG A CA    1 
ATOM   5441  C  C     . ARG A 1 332 ? -7.687  -0.395  -43.029 1.00 32.75 ? 332 ARG A C     1 
ATOM   5442  O  O     . ARG A 1 332 ? -7.634  0.014   -41.853 1.00 24.93 ? 332 ARG A O     1 
ATOM   5443  C  CB    . ARG A 1 332 ? -9.635  -0.108  -44.564 1.00 32.02 ? 332 ARG A CB    1 
ATOM   5444  C  CG    . ARG A 1 332 ? -10.680 -0.152  -43.451 1.00 30.87 ? 332 ARG A CG    1 
ATOM   5445  C  CD    . ARG A 1 332 ? -12.015 -0.706  -43.953 1.00 32.43 ? 332 ARG A CD    1 
ATOM   5446  N  NE    . ARG A 1 332 ? -12.977 -0.790  -42.849 1.00 37.34 ? 332 ARG A NE    1 
ATOM   5447  C  CZ    . ARG A 1 332 ? -13.934 0.105   -42.595 1.00 40.99 ? 332 ARG A CZ    1 
ATOM   5448  N  NH1   . ARG A 1 332 ? -14.131 1.166   -43.377 1.00 33.52 ? 332 ARG A NH1   1 
ATOM   5449  N  NH2   . ARG A 1 332 ? -14.711 -0.071  -41.545 1.00 29.82 ? 332 ARG A NH2   1 
ATOM   5450  H  H     . ARG A 1 332 ? -7.487  -0.112  -45.848 1.00 34.32 ? 332 ARG A H     1 
ATOM   5451  H  HA    . ARG A 1 332 ? -8.454  1.376   -43.785 1.00 36.73 ? 332 ARG A HA    1 
ATOM   5452  H  HB2   . ARG A 1 332 ? -9.996  0.428   -45.287 1.00 38.36 ? 332 ARG A HB2   1 
ATOM   5453  H  HB3   . ARG A 1 332 ? -9.493  -1.017  -44.871 1.00 38.36 ? 332 ARG A HB3   1 
ATOM   5454  H  HG2   . ARG A 1 332 ? -10.362 -0.725  -42.736 1.00 36.99 ? 332 ARG A HG2   1 
ATOM   5455  H  HG3   . ARG A 1 332 ? -10.831 0.747   -43.118 1.00 36.99 ? 332 ARG A HG3   1 
ATOM   5456  H  HD2   . ARG A 1 332 ? -12.376 -0.116  -44.633 1.00 38.85 ? 332 ARG A HD2   1 
ATOM   5457  H  HD3   . ARG A 1 332 ? -11.881 -1.597  -44.313 1.00 38.85 ? 332 ARG A HD3   1 
ATOM   5458  H  HE    . ARG A 1 332 ? -12.920 -1.469  -42.324 1.00 44.74 ? 332 ARG A HE    1 
ATOM   5459  H  HH11  . ARG A 1 332 ? -13.625 1.297   -44.059 1.00 40.16 ? 332 ARG A HH11  1 
ATOM   5460  H  HH12  . ARG A 1 332 ? -14.760 1.724   -43.194 1.00 40.16 ? 332 ARG A HH12  1 
ATOM   5461  H  HH21  . ARG A 1 332 ? -14.600 -0.757  -41.039 1.00 35.72 ? 332 ARG A HH21  1 
ATOM   5462  H  HH22  . ARG A 1 332 ? -15.343 0.488   -41.380 1.00 35.72 ? 332 ARG A HH22  1 
ATOM   5463  N  N     . ARG A 1 333 ? -7.246  -1.599  -43.408 1.00 24.25 ? 333 ARG A N     1 
ATOM   5464  C  CA    . ARG A 1 333 ? -6.574  -2.519  -42.486 1.00 21.52 ? 333 ARG A CA    1 
ATOM   5465  C  C     . ARG A 1 333 ? -5.130  -2.781  -42.958 1.00 19.39 ? 333 ARG A C     1 
ATOM   5466  O  O     . ARG A 1 333 ? -4.833  -2.755  -44.170 1.00 20.77 ? 333 ARG A O     1 
ATOM   5467  C  CB    . ARG A 1 333 ? -7.328  -3.849  -42.400 1.00 20.77 ? 333 ARG A CB    1 
ATOM   5468  C  CG    . ARG A 1 333 ? -8.841  -3.709  -42.301 1.00 23.07 ? 333 ARG A CG    1 
ATOM   5469  C  CD    . ARG A 1 333 ? -9.517  -5.010  -41.809 1.00 24.47 ? 333 ARG A CD    1 
ATOM   5470  N  NE    . ARG A 1 333 ? -10.940 -5.024  -42.171 1.00 23.41 ? 333 ARG A NE    1 
ATOM   5471  C  CZ    . ARG A 1 333 ? -11.580 -6.003  -42.810 1.00 23.48 ? 333 ARG A CZ    1 
ATOM   5472  N  NH1   . ARG A 1 333 ? -10.967 -7.125  -43.188 1.00 22.26 ? 333 ARG A NH1   1 
ATOM   5473  N  NH2   . ARG A 1 333 ? -12.873 -5.846  -43.084 1.00 26.35 ? 333 ARG A NH2   1 
ATOM   5474  H  H     . ARG A 1 333 ? -7.326  -1.909  -44.206 1.00 29.04 ? 333 ARG A H     1 
ATOM   5475  H  HA    . ARG A 1 333 ? -6.542  -2.121  -41.591 1.00 25.77 ? 333 ARG A HA    1 
ATOM   5476  H  HB2   . ARG A 1 333 ? -7.131  -4.369  -43.195 1.00 24.86 ? 333 ARG A HB2   1 
ATOM   5477  H  HB3   . ARG A 1 333 ? -7.024  -4.327  -41.613 1.00 24.86 ? 333 ARG A HB3   1 
ATOM   5478  H  HG2   . ARG A 1 333 ? -9.055  -3.002  -41.673 1.00 27.62 ? 333 ARG A HG2   1 
ATOM   5479  H  HG3   . ARG A 1 333 ? -9.199  -3.496  -43.177 1.00 27.62 ? 333 ARG A HG3   1 
ATOM   5480  H  HD2   . ARG A 1 333 ? -9.087  -5.774  -42.224 1.00 29.30 ? 333 ARG A HD2   1 
ATOM   5481  H  HD3   . ARG A 1 333 ? -9.445  -5.066  -40.843 1.00 29.30 ? 333 ARG A HD3   1 
ATOM   5482  H  HE    . ARG A 1 333 ? -11.404 -4.335  -41.949 1.00 28.03 ? 333 ARG A HE    1 
ATOM   5483  H  HH11  . ARG A 1 333 ? -10.130 -7.234  -43.022 1.00 26.66 ? 333 ARG A HH11  1 
ATOM   5484  H  HH12  . ARG A 1 333 ? -11.408 -7.739  -43.597 1.00 26.66 ? 333 ARG A HH12  1 
ATOM   5485  H  HH21  . ARG A 1 333 ? -13.281 -5.129  -42.842 1.00 31.56 ? 333 ARG A HH21  1 
ATOM   5486  H  HH22  . ARG A 1 333 ? -13.306 -6.470  -43.488 1.00 31.56 ? 333 ARG A HH22  1 
ATOM   5487  N  N     . ILE A 1 334 ? -4.245  -3.017  -42.001 1.00 21.20 ? 334 ILE A N     1 
ATOM   5488  C  CA    . ILE A 1 334 ? -2.846  -3.286  -42.319 1.00 23.51 ? 334 ILE A CA    1 
ATOM   5489  C  C     . ILE A 1 334 ? -2.334  -4.385  -41.410 1.00 20.68 ? 334 ILE A C     1 
ATOM   5490  O  O     . ILE A 1 334 ? -2.656  -4.416  -40.227 1.00 18.59 ? 334 ILE A O     1 
ATOM   5491  C  CB    . ILE A 1 334 ? -1.998  -2.034  -42.125 1.00 19.37 ? 334 ILE A CB    1 
ATOM   5492  C  CG1   . ILE A 1 334 ? -0.594  -2.220  -42.709 1.00 21.35 ? 334 ILE A CG1   1 
ATOM   5493  C  CG2   . ILE A 1 334 ? -1.873  -1.695  -40.661 1.00 24.93 ? 334 ILE A CG2   1 
ATOM   5494  C  CD1   . ILE A 1 334 ? -0.582  -2.385  -44.188 1.00 21.45 ? 334 ILE A CD1   1 
ATOM   5495  H  H     . ILE A 1 334 ? -4.426  -3.028  -41.160 1.00 25.38 ? 334 ILE A H     1 
ATOM   5496  H  HA    . ILE A 1 334 ? -2.766  -3.582  -43.250 1.00 28.15 ? 334 ILE A HA    1 
ATOM   5497  H  HB    . ILE A 1 334 ? -2.429  -1.294  -42.580 1.00 23.18 ? 334 ILE A HB    1 
ATOM   5498  H  HG12  . ILE A 1 334 ? -0.059  -1.440  -42.493 1.00 25.55 ? 334 ILE A HG12  1 
ATOM   5499  H  HG13  . ILE A 1 334 ? -0.194  -3.013  -42.318 1.00 25.55 ? 334 ILE A HG13  1 
ATOM   5500  H  HG21  . ILE A 1 334 ? -1.456  -2.429  -40.204 1.00 29.85 ? 334 ILE A HG21  1 
ATOM   5501  H  HG22  . ILE A 1 334 ? -1.336  -0.904  -40.569 1.00 29.85 ? 334 ILE A HG22  1 
ATOM   5502  H  HG23  . ILE A 1 334 ? -2.749  -1.539  -40.300 1.00 29.85 ? 334 ILE A HG23  1 
ATOM   5503  H  HD11  . ILE A 1 334 ? 0.325   -2.496  -44.482 1.00 25.68 ? 334 ILE A HD11  1 
ATOM   5504  H  HD12  . ILE A 1 334 ? -1.099  -3.161  -44.419 1.00 25.68 ? 334 ILE A HD12  1 
ATOM   5505  H  HD13  . ILE A 1 334 ? -0.965  -1.604  -44.592 1.00 25.68 ? 334 ILE A HD13  1 
ATOM   5506  N  N     . GLY A 1 335 ? -1.526  -5.285  -41.960 1.00 22.10 ? 335 GLY A N     1 
ATOM   5507  C  CA    . GLY A 1 335 ? -1.020  -6.378  -41.160 1.00 16.23 ? 335 GLY A CA    1 
ATOM   5508  C  C     . GLY A 1 335 ? 0.117   -7.090  -41.840 1.00 16.37 ? 335 GLY A C     1 
ATOM   5509  O  O     . GLY A 1 335 ? 0.643   -6.650  -42.841 1.00 17.42 ? 335 GLY A O     1 
ATOM   5510  H  H     . GLY A 1 335 ? -1.263  -5.282  -42.778 1.00 26.46 ? 335 GLY A H     1 
ATOM   5511  H  HA2   . GLY A 1 335 ? -0.707  -6.039  -40.307 1.00 19.41 ? 335 GLY A HA2   1 
ATOM   5512  H  HA3   . GLY A 1 335 ? -1.731  -7.017  -40.997 1.00 19.41 ? 335 GLY A HA3   1 
ATOM   5513  N  N     . VAL A 1 336 ? 0.475   -8.223  -41.285 1.00 18.12 ? 336 VAL A N     1 
ATOM   5514  C  CA    A VAL A 1 336 ? 1.679   -8.932  -41.708 0.34 16.50 ? 336 VAL A CA    1 
ATOM   5515  C  CA    B VAL A 1 336 ? 1.682   -8.910  -41.712 0.66 16.43 ? 336 VAL A CA    1 
ATOM   5516  C  C     . VAL A 1 336 ? 1.448   -10.408 -41.526 1.00 16.25 ? 336 VAL A C     1 
ATOM   5517  O  O     . VAL A 1 336 ? 0.667   -10.813 -40.638 1.00 17.19 ? 336 VAL A O     1 
ATOM   5518  C  CB    A VAL A 1 336 ? 2.914   -8.572  -40.854 0.34 17.60 ? 336 VAL A CB    1 
ATOM   5519  C  CB    B VAL A 1 336 ? 2.875   -8.381  -40.904 0.66 17.35 ? 336 VAL A CB    1 
ATOM   5520  C  CG1   A VAL A 1 336 ? 3.586   -7.317  -41.360 0.34 18.20 ? 336 VAL A CG1   1 
ATOM   5521  C  CG1   B VAL A 1 336 ? 2.782   -8.827  -39.450 0.66 16.53 ? 336 VAL A CG1   1 
ATOM   5522  C  CG2   A VAL A 1 336 ? 2.558   -8.465  -39.370 0.34 17.46 ? 336 VAL A CG2   1 
ATOM   5523  C  CG2   B VAL A 1 336 ? 4.209   -8.801  -41.542 0.66 17.99 ? 336 VAL A CG2   1 
ATOM   5524  H  H     A VAL A 1 336 ? 0.040   -8.615  -40.655 0.34 21.69 ? 336 VAL A H     1 
ATOM   5525  H  H     B VAL A 1 336 ? 0.041   -8.622  -40.659 0.66 21.69 ? 336 VAL A H     1 
ATOM   5526  H  HA    . VAL A 1 336 ? 1.858   -8.741  -42.657 0.66 19.65 ? 336 VAL A HA    1 
ATOM   5527  H  HB    A VAL A 1 336 ? 3.564   -9.299  -40.940 0.34 21.06 ? 336 VAL A HB    1 
ATOM   5528  H  HB    B VAL A 1 336 ? 2.843   -7.402  -40.912 0.66 20.76 ? 336 VAL A HB    1 
ATOM   5529  H  HG11  A VAL A 1 336 ? 4.347   -7.125  -40.807 0.34 21.77 ? 336 VAL A HG11  1 
ATOM   5530  H  HG11  B VAL A 1 336 ? 3.539   -8.483  -38.969 0.66 19.78 ? 336 VAL A HG11  1 
ATOM   5531  H  HG12  A VAL A 1 336 ? 3.868   -7.458  -42.267 0.34 21.77 ? 336 VAL A HG12  1 
ATOM   5532  H  HG12  B VAL A 1 336 ? 1.969   -8.485  -39.070 0.66 19.78 ? 336 VAL A HG12  1 
ATOM   5533  H  HG13  A VAL A 1 336 ? 2.960   -6.590  -41.321 0.34 21.77 ? 336 VAL A HG13  1 
ATOM   5534  H  HG13  B VAL A 1 336 ? 2.781   -9.786  -39.417 0.66 19.78 ? 336 VAL A HG13  1 
ATOM   5535  H  HG21  A VAL A 1 336 ? 1.621   -8.647  -39.260 0.34 20.89 ? 336 VAL A HG21  1 
ATOM   5536  H  HG21  B VAL A 1 336 ? 4.931   -8.455  -41.012 0.66 21.52 ? 336 VAL A HG21  1 
ATOM   5537  H  HG22  A VAL A 1 336 ? 3.076   -9.107  -38.878 0.34 20.89 ? 336 VAL A HG22  1 
ATOM   5538  H  HG22  B VAL A 1 336 ? 4.253   -9.760  -41.570 0.66 21.52 ? 336 VAL A HG22  1 
ATOM   5539  H  HG23  A VAL A 1 336 ? 2.758   -7.578  -39.064 0.34 20.89 ? 336 VAL A HG23  1 
ATOM   5540  H  HG23  B VAL A 1 336 ? 4.255   -8.445  -42.432 0.66 21.52 ? 336 VAL A HG23  1 
ATOM   5541  N  N     . ARG A 1 337 ? 2.079   -11.194 -42.388 1.00 12.58 ? 337 ARG A N     1 
ATOM   5542  C  CA    . ARG A 1 337 ? 2.076   -12.634 -42.276 1.00 11.09 ? 337 ARG A CA    1 
ATOM   5543  C  C     . ARG A 1 337 ? 3.509   -13.161 -42.383 1.00 17.78 ? 337 ARG A C     1 
ATOM   5544  O  O     . ARG A 1 337 ? 4.238   -12.789 -43.295 1.00 18.11 ? 337 ARG A O     1 
ATOM   5545  C  CB    . ARG A 1 337 ? 1.202   -13.248 -43.345 1.00 12.60 ? 337 ARG A CB    1 
ATOM   5546  C  CG    . ARG A 1 337 ? -0.307  -12.821 -43.228 1.00 18.42 ? 337 ARG A CG    1 
ATOM   5547  C  CD    . ARG A 1 337 ? -1.164  -13.565 -44.248 1.00 19.48 ? 337 ARG A CD    1 
ATOM   5548  N  NE    . ARG A 1 337 ? -1.142  -14.995 -44.020 1.00 20.16 ? 337 ARG A NE    1 
ATOM   5549  C  CZ    . ARG A 1 337 ? -1.713  -15.897 -44.829 1.00 18.80 ? 337 ARG A CZ    1 
ATOM   5550  N  NH1   . ARG A 1 337 ? -2.351  -15.532 -45.931 1.00 19.35 ? 337 ARG A NH1   1 
ATOM   5551  N  NH2   . ARG A 1 337 ? -1.644  -17.176 -44.508 1.00 21.09 ? 337 ARG A NH2   1 
ATOM   5552  H  H     . ARG A 1 337 ? 2.528   -10.903 -43.062 1.00 15.04 ? 337 ARG A H     1 
ATOM   5553  H  HA    . ARG A 1 337 ? 1.717   -12.890 -41.401 1.00 13.25 ? 337 ARG A HA    1 
ATOM   5554  H  HB2   . ARG A 1 337 ? 1.525   -12.969 -44.216 1.00 15.05 ? 337 ARG A HB2   1 
ATOM   5555  H  HB3   . ARG A 1 337 ? 1.246   -14.214 -43.270 1.00 15.05 ? 337 ARG A HB3   1 
ATOM   5556  H  HG2   . ARG A 1 337 ? -0.634  -13.035 -42.340 1.00 22.04 ? 337 ARG A HG2   1 
ATOM   5557  H  HG3   . ARG A 1 337 ? -0.386  -11.870 -43.397 1.00 22.04 ? 337 ARG A HG3   1 
ATOM   5558  H  HD2   . ARG A 1 337 ? -2.082  -13.260 -44.176 1.00 23.31 ? 337 ARG A HD2   1 
ATOM   5559  H  HD3   . ARG A 1 337 ? -0.821  -13.393 -45.139 1.00 23.31 ? 337 ARG A HD3   1 
ATOM   5560  H  HE    . ARG A 1 337 ? -0.735  -15.284 -43.320 1.00 24.14 ? 337 ARG A HE    1 
ATOM   5561  H  HH11  . ARG A 1 337 ? -2.405  -14.700 -46.142 1.00 23.16 ? 337 ARG A HH11  1 
ATOM   5562  H  HH12  . ARG A 1 337 ? -2.711  -16.127 -46.437 1.00 23.16 ? 337 ARG A HH12  1 
ATOM   5563  H  HH21  . ARG A 1 337 ? -1.229  -17.418 -43.795 1.00 25.25 ? 337 ARG A HH21  1 
ATOM   5564  H  HH22  . ARG A 1 337 ? -2.000  -17.768 -45.020 1.00 25.25 ? 337 ARG A HH22  1 
ATOM   5565  N  N     . PHE A 1 338 ? 3.883   -14.039 -41.465 1.00 14.61 ? 338 PHE A N     1 
ATOM   5566  C  CA    . PHE A 1 338 ? 5.219   -14.628 -41.443 1.00 14.09 ? 338 PHE A CA    1 
ATOM   5567  C  C     . PHE A 1 338 ? 5.120   -16.113 -41.727 1.00 17.23 ? 338 PHE A C     1 
ATOM   5568  O  O     . PHE A 1 338 ? 4.216   -16.786 -41.228 1.00 15.07 ? 338 PHE A O     1 
ATOM   5569  C  CB    . PHE A 1 338 ? 5.862   -14.393 -40.085 1.00 15.67 ? 338 PHE A CB    1 
ATOM   5570  C  CG    . PHE A 1 338 ? 6.180   -12.955 -39.824 1.00 14.88 ? 338 PHE A CG    1 
ATOM   5571  C  CD1   . PHE A 1 338 ? 7.351   -12.388 -40.324 1.00 16.63 ? 338 PHE A CD1   1 
ATOM   5572  C  CD2   . PHE A 1 338 ? 5.294   -12.159 -39.100 1.00 15.07 ? 338 PHE A CD2   1 
ATOM   5573  C  CE1   . PHE A 1 338 ? 7.649   -11.052 -40.091 1.00 18.65 ? 338 PHE A CE1   1 
ATOM   5574  C  CE2   . PHE A 1 338 ? 5.579   -10.823 -38.850 1.00 18.63 ? 338 PHE A CE2   1 
ATOM   5575  C  CZ    . PHE A 1 338 ? 6.747   -10.247 -39.376 1.00 15.60 ? 338 PHE A CZ    1 
ATOM   5576  H  H     . PHE A 1 338 ? 3.373   -14.317 -40.830 1.00 17.47 ? 338 PHE A H     1 
ATOM   5577  H  HA    . PHE A 1 338 ? 5.777   -14.211 -42.132 1.00 16.84 ? 338 PHE A HA    1 
ATOM   5578  H  HB2   . PHE A 1 338 ? 5.253   -14.694 -39.393 1.00 18.74 ? 338 PHE A HB2   1 
ATOM   5579  H  HB3   . PHE A 1 338 ? 6.690   -14.895 -40.038 1.00 18.74 ? 338 PHE A HB3   1 
ATOM   5580  H  HD1   . PHE A 1 338 ? 7.943   -12.913 -40.814 1.00 19.90 ? 338 PHE A HD1   1 
ATOM   5581  H  HD2   . PHE A 1 338 ? 4.510   -12.532 -38.765 1.00 18.02 ? 338 PHE A HD2   1 
ATOM   5582  H  HE1   . PHE A 1 338 ? 8.431   -10.684 -40.433 1.00 22.32 ? 338 PHE A HE1   1 
ATOM   5583  H  HE2   . PHE A 1 338 ? 4.977   -10.300 -38.371 1.00 22.29 ? 338 PHE A HE2   1 
ATOM   5584  H  HZ    . PHE A 1 338 ? 6.948   -9.355  -39.206 1.00 18.66 ? 338 PHE A HZ    1 
ATOM   5585  N  N     . SER A 1 339 ? 6.065   -16.635 -42.499 1.00 16.40 ? 339 SER A N     1 
ATOM   5586  C  CA    . SER A 1 339 ? 6.036   -18.038 -42.882 1.00 15.46 ? 339 SER A CA    1 
ATOM   5587  C  C     . SER A 1 339 ? 7.461   -18.563 -43.186 1.00 18.99 ? 339 SER A C     1 
ATOM   5588  O  O     . SER A 1 339 ? 8.434   -17.846 -43.010 1.00 17.15 ? 339 SER A O     1 
ATOM   5589  C  CB    . SER A 1 339 ? 5.154   -18.195 -44.119 1.00 15.50 ? 339 SER A CB    1 
ATOM   5590  O  OG    . SER A 1 339 ? 5.685   -17.430 -45.186 1.00 17.82 ? 339 SER A OG    1 
ATOM   5591  H  H     . SER A 1 339 ? 6.734   -16.197 -42.814 1.00 19.61 ? 339 SER A H     1 
ATOM   5592  H  HA    . SER A 1 339 ? 5.654   -18.571 -42.154 1.00 18.49 ? 339 SER A HA    1 
ATOM   5593  H  HB2   . SER A 1 339 ? 5.130   -19.130 -44.378 1.00 18.54 ? 339 SER A HB2   1 
ATOM   5594  H  HB3   . SER A 1 339 ? 4.259   -17.881 -43.915 1.00 18.54 ? 339 SER A HB3   1 
ATOM   5595  H  HG    . SER A 1 339 ? 5.214   -17.512 -45.852 1.00 21.32 ? 339 SER A HG    1 
ATOM   5596  N  N     . LYS A 1 340 ? 7.548   -19.809 -43.629 1.00 20.28 ? 340 LYS A N     1 
ATOM   5597  C  CA    . LYS A 1 340 ? 8.827   -20.445 -43.976 1.00 25.81 ? 340 LYS A CA    1 
ATOM   5598  C  C     . LYS A 1 340 ? 9.718   -20.448 -42.741 1.00 23.92 ? 340 LYS A C     1 
ATOM   5599  O  O     . LYS A 1 340 ? 10.776  -19.857 -42.736 1.00 21.98 ? 340 LYS A O     1 
ATOM   5600  C  CB    . LYS A 1 340 ? 9.491   -19.734 -45.167 1.00 17.00 ? 340 LYS A CB    1 
ATOM   5601  C  CG    . LYS A 1 340 ? 8.608   -19.753 -46.373 1.00 18.13 ? 340 LYS A CG    1 
ATOM   5602  C  CD    . LYS A 1 340 ? 9.326   -19.406 -47.674 1.00 22.06 ? 340 LYS A CD    1 
ATOM   5603  C  CE    . LYS A 1 340 ? 8.324   -19.239 -48.830 1.00 20.90 ? 340 LYS A CE    1 
ATOM   5604  N  NZ    . LYS A 1 340 ? 9.047   -18.809 -50.078 1.00 23.28 ? 340 LYS A NZ    1 
ATOM   5605  H  H     . LYS A 1 340 ? 6.869   -20.324 -43.743 1.00 24.27 ? 340 LYS A H     1 
ATOM   5606  H  HA    . LYS A 1 340 ? 8.662   -21.377 -44.233 1.00 30.91 ? 340 LYS A HA    1 
ATOM   5607  H  HB2   . LYS A 1 340 ? 9.664   -18.809 -44.931 1.00 20.33 ? 340 LYS A HB2   1 
ATOM   5608  H  HB3   . LYS A 1 340 ? 10.320  -20.186 -45.389 1.00 20.33 ? 340 LYS A HB3   1 
ATOM   5609  H  HG2   . LYS A 1 340 ? 8.232   -20.642 -46.471 1.00 21.69 ? 340 LYS A HG2   1 
ATOM   5610  H  HG3   . LYS A 1 340 ? 7.895   -19.107 -46.248 1.00 21.69 ? 340 LYS A HG3   1 
ATOM   5611  H  HD2   . LYS A 1 340 ? 9.808   -18.572 -47.564 1.00 26.42 ? 340 LYS A HD2   1 
ATOM   5612  H  HD3   . LYS A 1 340 ? 9.940   -20.122 -47.903 1.00 26.42 ? 340 LYS A HD3   1 
ATOM   5613  H  HE2   . LYS A 1 340 ? 7.884   -20.085 -49.004 1.00 25.01 ? 340 LYS A HE2   1 
ATOM   5614  H  HE3   . LYS A 1 340 ? 7.674   -18.557 -48.600 1.00 25.01 ? 340 LYS A HE3   1 
ATOM   5615  H  HZ1   . LYS A 1 340 ? 8.468   -18.712 -50.747 1.00 27.87 ? 340 LYS A HZ1   1 
ATOM   5616  H  HZ2   . LYS A 1 340 ? 9.460   -18.034 -49.938 1.00 27.87 ? 340 LYS A HZ2   1 
ATOM   5617  H  HZ3   . LYS A 1 340 ? 9.651   -19.422 -50.305 1.00 27.87 ? 340 LYS A HZ3   1 
ATOM   5618  N  N     . PHE A 1 341 ? 9.261   -21.134 -41.699 1.00 17.53 ? 341 PHE A N     1 
ATOM   5619  C  CA    . PHE A 1 341 ? 9.948   -21.126 -40.407 1.00 23.56 ? 341 PHE A CA    1 
ATOM   5620  C  C     . PHE A 1 341 ? 11.162  -22.027 -40.454 1.00 25.72 ? 341 PHE A C     1 
ATOM   5621  O  O     . PHE A 1 341 ? 11.137  -23.082 -41.079 1.00 24.80 ? 341 PHE A O     1 
ATOM   5622  C  CB    . PHE A 1 341 ? 9.048   -21.642 -39.301 1.00 21.39 ? 341 PHE A CB    1 
ATOM   5623  C  CG    . PHE A 1 341 ? 7.730   -20.918 -39.189 1.00 20.89 ? 341 PHE A CG    1 
ATOM   5624  C  CD1   . PHE A 1 341 ? 7.671   -19.550 -39.332 1.00 21.63 ? 341 PHE A CD1   1 
ATOM   5625  C  CD2   . PHE A 1 341 ? 6.563   -21.604 -38.915 1.00 31.90 ? 341 PHE A CD2   1 
ATOM   5626  C  CE1   . PHE A 1 341 ? 6.462   -18.863 -39.217 1.00 22.68 ? 341 PHE A CE1   1 
ATOM   5627  C  CE2   . PHE A 1 341 ? 5.351   -20.925 -38.800 1.00 30.15 ? 341 PHE A CE2   1 
ATOM   5628  C  CZ    . PHE A 1 341 ? 5.313   -19.543 -38.965 1.00 20.02 ? 341 PHE A CZ    1 
ATOM   5629  H  H     . PHE A 1 341 ? 8.549   -21.616 -41.713 1.00 20.97 ? 341 PHE A H     1 
ATOM   5630  H  HA    . PHE A 1 341 ? 10.236  -20.215 -40.186 1.00 28.21 ? 341 PHE A HA    1 
ATOM   5631  H  HB2   . PHE A 1 341 ? 8.857   -22.579 -39.467 1.00 25.61 ? 341 PHE A HB2   1 
ATOM   5632  H  HB3   . PHE A 1 341 ? 9.510   -21.547 -38.454 1.00 25.61 ? 341 PHE A HB3   1 
ATOM   5633  H  HD1   . PHE A 1 341 ? 8.451   -19.076 -39.512 1.00 25.89 ? 341 PHE A HD1   1 
ATOM   5634  H  HD2   . PHE A 1 341 ? 6.585   -22.528 -38.812 1.00 38.22 ? 341 PHE A HD2   1 
ATOM   5635  H  HE1   . PHE A 1 341 ? 6.440   -17.940 -39.326 1.00 27.16 ? 341 PHE A HE1   1 
ATOM   5636  H  HE2   . PHE A 1 341 ? 4.568   -21.395 -38.624 1.00 36.12 ? 341 PHE A HE2   1 
ATOM   5637  H  HZ    . PHE A 1 341 ? 4.507   -19.085 -38.886 1.00 23.97 ? 341 PHE A HZ    1 
ATOM   5638  N  N     . ILE A 1 342 ? 12.209  -21.629 -39.757 1.00 28.51 ? 342 ILE A N     1 
ATOM   5639  C  CA    . ILE A 1 342 ? 13.434  -22.405 -39.767 1.00 31.15 ? 342 ILE A CA    1 
ATOM   5640  C  C     . ILE A 1 342 ? 13.262  -23.729 -39.001 1.00 34.22 ? 342 ILE A C     1 
ATOM   5641  O  O     . ILE A 1 342 ? 12.785  -23.738 -37.857 1.00 33.61 ? 342 ILE A O     1 
ATOM   5642  C  CB    . ILE A 1 342 ? 14.590  -21.572 -39.207 1.00 26.29 ? 342 ILE A CB    1 
ATOM   5643  C  CG1   . ILE A 1 342 ? 14.959  -20.506 -40.216 1.00 26.86 ? 342 ILE A CG1   1 
ATOM   5644  C  CG2   . ILE A 1 342 ? 15.805  -22.446 -38.978 1.00 42.14 ? 342 ILE A CG2   1 
ATOM   5645  C  CD1   . ILE A 1 342 ? 16.069  -19.590 -39.779 1.00 28.89 ? 342 ILE A CD1   1 
ATOM   5646  H  H     . ILE A 1 342 ? 12.237  -20.919 -39.272 1.00 34.15 ? 342 ILE A H     1 
ATOM   5647  H  HA    . ILE A 1 342 ? 13.654  -22.628 -40.695 1.00 37.32 ? 342 ILE A HA    1 
ATOM   5648  H  HB    . ILE A 1 342 ? 14.322  -21.155 -38.373 1.00 31.49 ? 342 ILE A HB    1 
ATOM   5649  H  HG12  . ILE A 1 342 ? 15.242  -20.940 -41.036 1.00 32.18 ? 342 ILE A HG12  1 
ATOM   5650  H  HG13  . ILE A 1 342 ? 14.177  -19.959 -40.389 1.00 32.18 ? 342 ILE A HG13  1 
ATOM   5651  H  HG21  . ILE A 1 342 ? 16.517  -21.906 -38.628 1.00 50.51 ? 342 ILE A HG21  1 
ATOM   5652  H  HG22  . ILE A 1 342 ? 15.578  -23.137 -38.350 1.00 50.51 ? 342 ILE A HG22  1 
ATOM   5653  H  HG23  . ILE A 1 342 ? 16.070  -22.837 -39.814 1.00 50.51 ? 342 ILE A HG23  1 
ATOM   5654  H  HD11  . ILE A 1 342 ? 15.802  -19.139 -38.975 1.00 34.61 ? 342 ILE A HD11  1 
ATOM   5655  H  HD12  . ILE A 1 342 ? 16.858  -20.112 -39.617 1.00 34.61 ? 342 ILE A HD12  1 
ATOM   5656  H  HD13  . ILE A 1 342 ? 16.237  -18.950 -40.474 1.00 34.61 ? 342 ILE A HD13  1 
ATOM   5657  O  "O5'" . DG  B 2 1   ? 6.716   -31.014 -73.488 1.00 48.67 ? 1   DG  P "O5'" 1 
ATOM   5658  C  "C5'" . DG  B 2 1   ? 7.726   -30.247 -72.853 1.00 32.91 ? 1   DG  P "C5'" 1 
ATOM   5659  C  "C4'" . DG  B 2 1   ? 8.439   -31.191 -71.935 1.00 33.99 ? 1   DG  P "C4'" 1 
ATOM   5660  O  "O4'" . DG  B 2 1   ? 9.791   -30.723 -71.776 1.00 28.79 ? 1   DG  P "O4'" 1 
ATOM   5661  C  "C3'" . DG  B 2 1   ? 7.831   -31.277 -70.525 1.00 23.64 ? 1   DG  P "C3'" 1 
ATOM   5662  O  "O3'" . DG  B 2 1   ? 7.986   -32.614 -70.168 1.00 38.49 ? 1   DG  P "O3'" 1 
ATOM   5663  C  "C2'" . DG  B 2 1   ? 8.743   -30.386 -69.689 1.00 30.42 ? 1   DG  P "C2'" 1 
ATOM   5664  C  "C1'" . DG  B 2 1   ? 10.080  -30.416 -70.438 1.00 33.24 ? 1   DG  P "C1'" 1 
ATOM   5665  N  N9    . DG  B 2 1   ? 10.775  -29.135 -70.490 1.00 28.75 ? 1   DG  P N9    1 
ATOM   5666  C  C8    . DG  B 2 1   ? 10.322  -27.990 -71.122 1.00 24.32 ? 1   DG  P C8    1 
ATOM   5667  N  N7    . DG  B 2 1   ? 11.153  -27.001 -71.001 1.00 23.28 ? 1   DG  P N7    1 
ATOM   5668  C  C5    . DG  B 2 1   ? 12.220  -27.517 -70.255 1.00 23.54 ? 1   DG  P C5    1 
ATOM   5669  C  C6    . DG  B 2 1   ? 13.409  -26.904 -69.802 1.00 19.82 ? 1   DG  P C6    1 
ATOM   5670  O  O6    . DG  B 2 1   ? 13.820  -25.741 -69.982 1.00 23.90 ? 1   DG  P O6    1 
ATOM   5671  N  N1    . DG  B 2 1   ? 14.207  -27.791 -69.064 1.00 24.83 ? 1   DG  P N1    1 
ATOM   5672  C  C2    . DG  B 2 1   ? 13.875  -29.106 -68.796 1.00 23.36 ? 1   DG  P C2    1 
ATOM   5673  N  N2    . DG  B 2 1   ? 14.752  -29.819 -68.086 1.00 27.36 ? 1   DG  P N2    1 
ATOM   5674  N  N3    . DG  B 2 1   ? 12.770  -29.682 -69.202 1.00 24.62 ? 1   DG  P N3    1 
ATOM   5675  C  C4    . DG  B 2 1   ? 11.994  -28.833 -69.930 1.00 27.10 ? 1   DG  P C4    1 
ATOM   5676  P  P     . DG  B 2 2   ? 7.053   -33.260 -69.034 1.00 41.15 ? 2   DG  P P     1 
ATOM   5677  O  OP1   . DG  B 2 2   ? 7.166   -34.727 -69.154 1.00 42.77 ? 2   DG  P OP1   1 
ATOM   5678  O  OP2   . DG  B 2 2   ? 5.728   -32.602 -69.104 1.00 48.21 ? 2   DG  P OP2   1 
ATOM   5679  O  "O5'" . DG  B 2 2   ? 7.729   -32.771 -67.699 1.00 36.31 ? 2   DG  P "O5'" 1 
ATOM   5680  C  "C5'" . DG  B 2 2   ? 8.999   -33.326 -67.394 1.00 40.62 ? 2   DG  P "C5'" 1 
ATOM   5681  C  "C4'" . DG  B 2 2   ? 9.627   -32.565 -66.255 1.00 54.16 ? 2   DG  P "C4'" 1 
ATOM   5682  O  "O4'" . DG  B 2 2   ? 10.182  -31.314 -66.752 1.00 53.61 ? 2   DG  P "O4'" 1 
ATOM   5683  C  "C3'" . DG  B 2 2   ? 8.648   -32.180 -65.141 1.00 45.66 ? 2   DG  P "C3'" 1 
ATOM   5684  O  "O3'" . DG  B 2 2   ? 9.369   -32.191 -63.928 1.00 55.52 ? 2   DG  P "O3'" 1 
ATOM   5685  C  "C2'" . DG  B 2 2   ? 8.318   -30.736 -65.504 1.00 44.19 ? 2   DG  P "C2'" 1 
ATOM   5686  C  "C1'" . DG  B 2 2   ? 9.730   -30.295 -65.882 1.00 47.41 ? 2   DG  P "C1'" 1 
ATOM   5687  N  N9    . DG  B 2 2   ? 9.816   -28.991 -66.526 1.00 39.33 ? 2   DG  P N9    1 
ATOM   5688  C  C8    . DG  B 2 2   ? 8.863   -28.376 -67.311 1.00 37.68 ? 2   DG  P C8    1 
ATOM   5689  N  N7    . DG  B 2 2   ? 9.239   -27.193 -67.746 1.00 36.05 ? 2   DG  P N7    1 
ATOM   5690  C  C5    . DG  B 2 2   ? 10.515  -27.039 -67.207 1.00 35.22 ? 2   DG  P C5    1 
ATOM   5691  C  C6    . DG  B 2 2   ? 11.408  -25.960 -67.336 1.00 32.31 ? 2   DG  P C6    1 
ATOM   5692  O  O6    . DG  B 2 2   ? 11.215  -24.904 -67.964 1.00 36.43 ? 2   DG  P O6    1 
ATOM   5693  N  N1    . DG  B 2 2   ? 12.580  -26.192 -66.632 1.00 25.78 ? 2   DG  P N1    1 
ATOM   5694  C  C2    . DG  B 2 2   ? 12.864  -27.336 -65.912 1.00 35.00 ? 2   DG  P C2    1 
ATOM   5695  N  N2    . DG  B 2 2   ? 14.058  -27.383 -65.299 1.00 29.37 ? 2   DG  P N2    1 
ATOM   5696  N  N3    . DG  B 2 2   ? 12.030  -28.360 -65.779 1.00 36.23 ? 2   DG  P N3    1 
ATOM   5697  C  C4    . DG  B 2 2   ? 10.880  -28.129 -66.449 1.00 29.54 ? 2   DG  P C4    1 
ATOM   5698  P  P     . DC  B 2 3   ? 8.755   -32.898 -62.612 1.00 63.08 ? 3   DC  P P     1 
ATOM   5699  O  OP1   . DC  B 2 3   ? 8.853   -34.363 -62.793 1.00 53.61 ? 3   DC  P OP1   1 
ATOM   5700  O  OP2   . DC  B 2 3   ? 7.460   -32.249 -62.299 1.00 56.75 ? 3   DC  P OP2   1 
ATOM   5701  O  "O5'" . DC  B 2 3   ? 9.791   -32.494 -61.487 1.00 46.01 ? 3   DC  P "O5'" 1 
ATOM   5702  C  "C5'" . DC  B 2 3   ? 11.129  -32.821 -61.730 1.00 44.07 ? 3   DC  P "C5'" 1 
ATOM   5703  C  "C4'" . DC  B 2 3   ? 11.961  -31.752 -61.070 1.00 50.29 ? 3   DC  P "C4'" 1 
ATOM   5704  O  "O4'" . DC  B 2 3   ? 11.911  -30.559 -61.882 1.00 45.65 ? 3   DC  P "O4'" 1 
ATOM   5705  C  "C3'" . DC  B 2 3   ? 11.425  -31.340 -59.712 1.00 43.14 ? 3   DC  P "C3'" 1 
ATOM   5706  O  "O3'" . DC  B 2 3   ? 12.517  -31.374 -58.830 1.00 57.06 ? 3   DC  P "O3'" 1 
ATOM   5707  C  "C2'" . DC  B 2 3   ? 10.860  -29.931 -59.917 1.00 41.49 ? 3   DC  P "C2'" 1 
ATOM   5708  C  "C1'" . DC  B 2 3   ? 11.691  -29.416 -61.090 1.00 44.10 ? 3   DC  P "C1'" 1 
ATOM   5709  N  N1    . DC  B 2 3   ? 11.047  -28.410 -61.988 1.00 33.79 ? 3   DC  P N1    1 
ATOM   5710  C  C2    . DC  B 2 3   ? 11.719  -27.232 -62.300 1.00 33.62 ? 3   DC  P C2    1 
ATOM   5711  O  O2    . DC  B 2 3   ? 12.825  -27.021 -61.819 1.00 34.82 ? 3   DC  P O2    1 
ATOM   5712  N  N3    . DC  B 2 3   ? 11.135  -26.324 -63.114 1.00 31.95 ? 3   DC  P N3    1 
ATOM   5713  C  C4    . DC  B 2 3   ? 9.942   -26.572 -63.633 1.00 34.27 ? 3   DC  P C4    1 
ATOM   5714  N  N4    . DC  B 2 3   ? 9.419   -25.644 -64.442 1.00 31.03 ? 3   DC  P N4    1 
ATOM   5715  C  C5    . DC  B 2 3   ? 9.232   -27.774 -63.341 1.00 40.64 ? 3   DC  P C5    1 
ATOM   5716  C  C6    . DC  B 2 3   ? 9.814   -28.655 -62.518 1.00 38.07 ? 3   DC  P C6    1 
ATOM   5717  P  P     . DA  B 2 4   ? 12.277  -31.278 -57.244 1.00 57.42 ? 4   DA  P P     1 
ATOM   5718  O  OP1   . DA  B 2 4   ? 13.384  -31.999 -56.579 1.00 50.27 ? 4   DA  P OP1   1 
ATOM   5719  O  OP2   . DA  B 2 4   ? 10.864  -31.639 -56.973 1.00 51.60 ? 4   DA  P OP2   1 
ATOM   5720  O  "O5'" . DA  B 2 4   ? 12.465  -29.721 -56.947 1.00 51.52 ? 4   DA  P "O5'" 1 
ATOM   5721  C  "C5'" . DA  B 2 4   ? 13.772  -29.242 -57.193 1.00 50.34 ? 4   DA  P "C5'" 1 
ATOM   5722  C  "C4'" . DA  B 2 4   ? 13.855  -27.776 -56.872 1.00 50.56 ? 4   DA  P "C4'" 1 
ATOM   5723  O  "O4'" . DA  B 2 4   ? 13.174  -27.022 -57.899 1.00 50.13 ? 4   DA  P "O4'" 1 
ATOM   5724  C  "C3'" . DA  B 2 4   ? 13.190  -27.413 -55.554 1.00 53.64 ? 4   DA  P "C3'" 1 
ATOM   5725  O  "O3'" . DA  B 2 4   ? 14.113  -26.543 -54.902 1.00 52.96 ? 4   DA  P "O3'" 1 
ATOM   5726  C  "C2'" . DA  B 2 4   ? 11.874  -26.753 -55.979 1.00 43.65 ? 4   DA  P "C2'" 1 
ATOM   5727  C  "C1'" . DA  B 2 4   ? 12.293  -26.105 -57.295 1.00 36.84 ? 4   DA  P "C1'" 1 
ATOM   5728  N  N9    . DA  B 2 4   ? 11.241  -25.896 -58.272 1.00 34.90 ? 4   DA  P N9    1 
ATOM   5729  C  C8    . DA  B 2 4   ? 10.222  -26.736 -58.584 1.00 33.11 ? 4   DA  P C8    1 
ATOM   5730  N  N7    . DA  B 2 4   ? 9.457   -26.278 -59.541 1.00 36.13 ? 4   DA  P N7    1 
ATOM   5731  C  C5    . DA  B 2 4   ? 10.005  -25.058 -59.878 1.00 32.16 ? 4   DA  P C5    1 
ATOM   5732  C  C6    . DA  B 2 4   ? 9.630   -24.067 -60.823 1.00 34.32 ? 4   DA  P C6    1 
ATOM   5733  N  N6    . DA  B 2 4   ? 8.555   -24.148 -61.633 1.00 25.92 ? 4   DA  P N6    1 
ATOM   5734  N  N1    . DA  B 2 4   ? 10.413  -22.974 -60.887 1.00 36.06 ? 4   DA  P N1    1 
ATOM   5735  C  C2    . DA  B 2 4   ? 11.456  -22.892 -60.075 1.00 30.91 ? 4   DA  P C2    1 
ATOM   5736  N  N3    . DA  B 2 4   ? 11.905  -23.748 -59.153 1.00 38.02 ? 4   DA  P N3    1 
ATOM   5737  C  C4    . DA  B 2 4   ? 11.116  -24.819 -59.110 1.00 34.22 ? 4   DA  P C4    1 
ATOM   5738  P  P     . DC  B 2 5   ? 13.825  -26.028 -53.409 1.00 54.51 ? 5   DC  P P     1 
ATOM   5739  O  OP1   . DC  B 2 5   ? 15.124  -25.638 -52.812 1.00 46.54 ? 5   DC  P OP1   1 
ATOM   5740  O  OP2   . DC  B 2 5   ? 12.887  -26.971 -52.772 1.00 47.22 ? 5   DC  P OP2   1 
ATOM   5741  O  "O5'" . DC  B 2 5   ? 12.990  -24.695 -53.640 1.00 44.80 ? 5   DC  P "O5'" 1 
ATOM   5742  C  "C5'" . DC  B 2 5   ? 13.723  -23.702 -54.307 1.00 43.31 ? 5   DC  P "C5'" 1 
ATOM   5743  C  "C4'" . DC  B 2 5   ? 12.797  -22.582 -54.697 1.00 38.92 ? 5   DC  P "C4'" 1 
ATOM   5744  O  "O4'" . DC  B 2 5   ? 11.879  -23.041 -55.695 1.00 32.81 ? 5   DC  P "O4'" 1 
ATOM   5745  C  "C3'" . DC  B 2 5   ? 11.951  -22.053 -53.538 1.00 30.95 ? 5   DC  P "C3'" 1 
ATOM   5746  O  "O3'" . DC  B 2 5   ? 12.634  -20.878 -53.102 1.00 40.59 ? 5   DC  P "O3'" 1 
ATOM   5747  C  "C2'" . DC  B 2 5   ? 10.589  -21.826 -54.191 1.00 37.99 ? 5   DC  P "C2'" 1 
ATOM   5748  C  "C1'" . DC  B 2 5   ? 10.903  -22.065 -55.680 1.00 37.25 ? 5   DC  P "C1'" 1 
ATOM   5749  N  N1    . DC  B 2 5   ? 9.806   -22.602 -56.447 1.00 36.62 ? 5   DC  P N1    1 
ATOM   5750  C  C2    . DC  B 2 5   ? 9.381   -21.850 -57.533 1.00 30.64 ? 5   DC  P C2    1 
ATOM   5751  O  O2    . DC  B 2 5   ? 9.977   -20.786 -57.761 1.00 35.32 ? 5   DC  P O2    1 
ATOM   5752  N  N3    . DC  B 2 5   ? 8.354   -22.322 -58.259 1.00 30.38 ? 5   DC  P N3    1 
ATOM   5753  C  C4    . DC  B 2 5   ? 7.778   -23.479 -57.935 1.00 32.20 ? 5   DC  P C4    1 
ATOM   5754  N  N4    . DC  B 2 5   ? 6.758   -23.903 -58.678 1.00 29.60 ? 5   DC  P N4    1 
ATOM   5755  C  C5    . DC  B 2 5   ? 8.209   -24.246 -56.818 1.00 29.41 ? 5   DC  P C5    1 
ATOM   5756  C  C6    . DC  B 2 5   ? 9.232   -23.781 -56.113 1.00 33.28 ? 5   DC  P C6    1 
ATOM   5757  P  P     . DT  B 2 6   ? 11.953  -19.874 -52.053 1.00 36.59 ? 6   DT  P P     1 
ATOM   5758  O  OP1   . DT  B 2 6   ? 13.017  -19.018 -51.507 1.00 41.27 ? 6   DT  P OP1   1 
ATOM   5759  O  OP2   . DT  B 2 6   ? 11.068  -20.666 -51.176 1.00 26.83 ? 6   DT  P OP2   1 
ATOM   5760  O  "O5'" . DT  B 2 6   ? 11.022  -18.947 -52.966 1.00 29.80 ? 6   DT  P "O5'" 1 
ATOM   5761  C  "C5'" . DT  B 2 6   ? 11.694  -18.077 -53.864 1.00 29.60 ? 6   DT  P "C5'" 1 
ATOM   5762  C  "C4'" . DT  B 2 6   ? 10.655  -17.390 -54.708 1.00 34.89 ? 6   DT  P "C4'" 1 
ATOM   5763  O  "O4'" . DT  B 2 6   ? 9.911   -18.363 -55.462 1.00 32.92 ? 6   DT  P "O4'" 1 
ATOM   5764  C  "C3'" . DT  B 2 6   ? 9.587   -16.699 -53.872 1.00 26.41 ? 6   DT  P "C3'" 1 
ATOM   5765  O  "O3'" . DT  B 2 6   ? 10.039  -15.409 -53.710 1.00 24.65 ? 6   DT  P "O3'" 1 
ATOM   5766  C  "C2'" . DT  B 2 6   ? 8.357   -16.703 -54.772 1.00 32.07 ? 6   DT  P "C2'" 1 
ATOM   5767  C  "C1'" . DT  B 2 6   ? 8.648   -17.818 -55.763 1.00 33.05 ? 6   DT  P "C1'" 1 
ATOM   5768  N  N1    . DT  B 2 6   ? 7.692   -18.966 -55.770 1.00 29.60 ? 6   DT  P N1    1 
ATOM   5769  C  C2    . DT  B 2 6   ? 6.722   -18.940 -56.737 1.00 31.31 ? 6   DT  P C2    1 
ATOM   5770  O  O2    . DT  B 2 6   ? 6.602   -18.015 -57.507 1.00 29.65 ? 6   DT  P O2    1 
ATOM   5771  N  N3    . DT  B 2 6   ? 5.879   -20.011 -56.750 1.00 28.56 ? 6   DT  P N3    1 
ATOM   5772  C  C4    . DT  B 2 6   ? 5.923   -21.087 -55.896 1.00 26.97 ? 6   DT  P C4    1 
ATOM   5773  O  O4    . DT  B 2 6   ? 5.128   -22.009 -56.029 1.00 28.27 ? 6   DT  P O4    1 
ATOM   5774  C  C5    . DT  B 2 6   ? 6.964   -21.078 -54.902 1.00 30.46 ? 6   DT  P C5    1 
ATOM   5775  C  C7    . DT  B 2 6   ? 7.095   -22.231 -53.940 1.00 36.57 ? 6   DT  P C7    1 
ATOM   5776  C  C6    . DT  B 2 6   ? 7.809   -20.019 -54.877 1.00 30.99 ? 6   DT  P C6    1 
ATOM   5777  P  P     . DG  B 2 7   ? 9.341   -14.436 -52.636 1.00 25.17 ? 7   DG  P P     1 
ATOM   5778  O  OP1   . DG  B 2 7   ? 10.334  -13.388 -52.271 1.00 21.18 ? 7   DG  P OP1   1 
ATOM   5779  O  OP2   . DG  B 2 7   ? 8.729   -15.288 -51.600 1.00 23.29 ? 7   DG  P OP2   1 
ATOM   5780  O  "O5'" . DG  B 2 7   ? 8.151   -13.755 -53.448 1.00 24.97 ? 7   DG  P "O5'" 1 
ATOM   5781  C  "C5'" . DG  B 2 7   ? 8.366   -12.951 -54.600 1.00 21.32 ? 7   DG  P "C5'" 1 
ATOM   5782  C  "C4'" . DG  B 2 7   ? 7.035   -12.656 -55.254 1.00 22.60 ? 7   DG  P "C4'" 1 
ATOM   5783  O  "O4'" . DG  B 2 7   ? 6.302   -13.880 -55.546 1.00 23.33 ? 7   DG  P "O4'" 1 
ATOM   5784  C  "C3'" . DG  B 2 7   ? 6.139   -11.827 -54.355 1.00 23.52 ? 7   DG  P "C3'" 1 
ATOM   5785  O  "O3'" . DG  B 2 7   ? 5.384   -10.982 -55.181 1.00 25.06 ? 7   DG  P "O3'" 1 
ATOM   5786  C  "C2'" . DG  B 2 7   ? 5.243   -12.857 -53.688 1.00 20.74 ? 7   DG  P "C2'" 1 
ATOM   5787  C  "C1'" . DG  B 2 7   ? 5.081   -13.885 -54.791 1.00 23.15 ? 7   DG  P "C1'" 1 
ATOM   5788  N  N9    . DG  B 2 7   ? 4.923   -15.248 -54.330 1.00 19.68 ? 7   DG  P N9    1 
ATOM   5789  C  C8    . DG  B 2 7   ? 5.580   -15.858 -53.301 1.00 21.76 ? 7   DG  P C8    1 
ATOM   5790  N  N7    . DG  B 2 7   ? 5.245   -17.113 -53.170 1.00 20.59 ? 7   DG  P N7    1 
ATOM   5791  C  C5    . DG  B 2 7   ? 4.323   -17.356 -54.178 1.00 20.91 ? 7   DG  P C5    1 
ATOM   5792  C  C6    . DG  B 2 7   ? 3.598   -18.523 -54.550 1.00 22.94 ? 7   DG  P C6    1 
ATOM   5793  O  O6    . DG  B 2 7   ? 3.631   -19.658 -54.058 1.00 25.95 ? 7   DG  P O6    1 
ATOM   5794  N  N1    . DG  B 2 7   ? 2.757   -18.295 -55.644 1.00 18.39 ? 7   DG  P N1    1 
ATOM   5795  C  C2    . DG  B 2 7   ? 2.633   -17.088 -56.307 1.00 22.63 ? 7   DG  P C2    1 
ATOM   5796  N  N2    . DG  B 2 7   ? 1.797   -17.028 -57.363 1.00 23.49 ? 7   DG  P N2    1 
ATOM   5797  N  N3    . DG  B 2 7   ? 3.297   -16.001 -55.963 1.00 24.55 ? 7   DG  P N3    1 
ATOM   5798  C  C4    . DG  B 2 7   ? 4.132   -16.208 -54.908 1.00 21.93 ? 7   DG  P C4    1 
ATOM   5799  P  P     . DA  B 2 8   ? 4.509   -9.803  -54.551 1.00 27.36 ? 8   DA  P P     1 
ATOM   5800  O  OP1   . DA  B 2 8   ? 4.781   -8.586  -55.311 1.00 28.84 ? 8   DA  P OP1   1 
ATOM   5801  O  OP2   . DA  B 2 8   ? 4.684   -9.825  -53.067 1.00 28.06 ? 8   DA  P OP2   1 
ATOM   5802  O  "O5'" . DA  B 2 8   ? 3.010   -10.271 -54.811 1.00 24.97 ? 8   DA  P "O5'" 1 
ATOM   5803  C  "C5'" . DA  B 2 8   ? 2.507   -10.555 -56.099 1.00 32.24 ? 8   DA  P "C5'" 1 
ATOM   5804  C  "C4'" . DA  B 2 8   ? 1.163   -11.221 -55.894 1.00 35.46 ? 8   DA  P "C4'" 1 
ATOM   5805  O  "O4'" . DA  B 2 8   ? 1.427   -12.586 -55.509 1.00 33.96 ? 8   DA  P "O4'" 1 
ATOM   5806  C  "C3'" . DA  B 2 8   ? 0.240   -10.607 -54.805 1.00 27.40 ? 8   DA  P "C3'" 1 
ATOM   5807  O  "O3'" . DA  B 2 8   ? -0.798  -9.969  -55.529 1.00 33.08 ? 8   DA  P "O3'" 1 
ATOM   5808  C  "C2'" . DA  B 2 8   ? -0.180  -11.816 -53.978 1.00 23.23 ? 8   DA  P "C2'" 1 
ATOM   5809  C  "C1'" . DA  B 2 8   ? 0.303   -13.017 -54.792 1.00 32.13 ? 8   DA  P "C1'" 1 
ATOM   5810  N  N9    . DA  B 2 8   ? 0.720   -14.127 -53.952 1.00 24.15 ? 8   DA  P N9    1 
ATOM   5811  C  C8    . DA  B 2 8   ? 1.577   -14.063 -52.895 1.00 23.25 ? 8   DA  P C8    1 
ATOM   5812  N  N7    . DA  B 2 8   ? 1.767   -15.230 -52.305 1.00 25.96 ? 8   DA  P N7    1 
ATOM   5813  C  C5    . DA  B 2 8   ? 0.946   -16.100 -53.021 1.00 21.37 ? 8   DA  P C5    1 
ATOM   5814  C  C6    . DA  B 2 8   ? 0.699   -17.479 -52.905 1.00 19.79 ? 8   DA  P C6    1 
ATOM   5815  N  N6    . DA  B 2 8   ? 1.255   -18.248 -51.967 1.00 20.01 ? 8   DA  P N6    1 
ATOM   5816  N  N1    . DA  B 2 8   ? -0.156  -18.023 -53.791 1.00 22.57 ? 8   DA  P N1    1 
ATOM   5817  C  C2    . DA  B 2 8   ? -0.714  -17.258 -54.733 1.00 21.03 ? 8   DA  P C2    1 
ATOM   5818  N  N3    . DA  B 2 8   ? -0.548  -15.956 -54.949 1.00 23.92 ? 8   DA  P N3    1 
ATOM   5819  C  C4    . DA  B 2 8   ? 0.310   -15.439 -54.048 1.00 21.77 ? 8   DA  P C4    1 
ATOM   5820  P  P     . DT  B 2 9   ? -2.200  -9.557  -54.839 1.00 29.14 ? 9   DT  P P     1 
ATOM   5821  O  OP1   . DT  B 2 9   ? -2.722  -8.396  -55.575 1.00 34.01 ? 9   DT  P OP1   1 
ATOM   5822  O  OP2   . DT  B 2 9   ? -1.985  -9.370  -53.377 1.00 28.40 ? 9   DT  P OP2   1 
ATOM   5823  O  "O5'" . DT  B 2 9   ? -3.119  -10.842 -55.097 1.00 27.81 ? 9   DT  P "O5'" 1 
ATOM   5824  C  "C5'" . DT  B 2 9   ? -3.120  -11.420 -56.409 1.00 32.79 ? 9   DT  P "C5'" 1 
ATOM   5825  C  "C4'" . DT  B 2 9   ? -4.047  -12.616 -56.410 1.00 32.78 ? 9   DT  P "C4'" 1 
ATOM   5826  O  "O4'" . DT  B 2 9   ? -3.499  -13.669 -55.591 1.00 30.47 ? 9   DT  P "O4'" 1 
ATOM   5827  C  "C3'" . DT  B 2 9   ? -5.447  -12.361 -55.846 1.00 32.33 ? 9   DT  P "C3'" 1 
ATOM   5828  O  "O3'" . DT  B 2 9   ? -6.278  -12.922 -56.809 1.00 37.84 ? 9   DT  P "O3'" 1 
ATOM   5829  C  "C2'" . DT  B 2 9   ? -5.538  -13.163 -54.542 1.00 27.98 ? 9   DT  P "C2'" 1 
ATOM   5830  C  "C1'" . DT  B 2 9   ? -4.507  -14.259 -54.793 1.00 27.10 ? 9   DT  P "C1'" 1 
ATOM   5831  N  N1    . DT  B 2 9   ? -3.726  -14.721 -53.627 1.00 24.41 ? 9   DT  P N1    1 
ATOM   5832  C  C2    . DT  B 2 9   ? -3.698  -16.069 -53.333 1.00 26.14 ? 9   DT  P C2    1 
ATOM   5833  O  O2    . DT  B 2 9   ? -4.308  -16.928 -53.962 1.00 27.72 ? 9   DT  P O2    1 
ATOM   5834  N  N3    . DT  B 2 9   ? -2.921  -16.396 -52.258 1.00 17.86 ? 9   DT  P N3    1 
ATOM   5835  C  C4    . DT  B 2 9   ? -2.188  -15.522 -51.474 1.00 22.74 ? 9   DT  P C4    1 
ATOM   5836  O  O4    . DT  B 2 9   ? -1.537  -15.937 -50.533 1.00 17.73 ? 9   DT  P O4    1 
ATOM   5837  C  C5    . DT  B 2 9   ? -2.264  -14.123 -51.821 1.00 25.35 ? 9   DT  P C5    1 
ATOM   5838  C  C7    . DT  B 2 9   ? -1.501  -13.088 -51.017 1.00 22.33 ? 9   DT  P C7    1 
ATOM   5839  C  C6    . DT  B 2 9   ? -3.010  -13.794 -52.888 1.00 22.64 ? 9   DT  P C6    1 
ATOM   5840  P  P     . DC  B 2 10  ? -7.865  -12.955 -56.596 1.00 42.27 ? 10  DC  P P     1 
ATOM   5841  O  OP1   . DC  B 2 10  ? -8.492  -12.932 -57.934 1.00 55.46 ? 10  DC  P OP1   1 
ATOM   5842  O  OP2   . DC  B 2 10  ? -8.232  -11.898 -55.617 1.00 30.02 ? 10  DC  P OP2   1 
ATOM   5843  O  "O5'" . DC  B 2 10  ? -8.114  -14.371 -55.895 1.00 39.60 ? 10  DC  P "O5'" 1 
ATOM   5844  C  "C5'" . DC  B 2 10  ? -8.297  -15.610 -56.585 1.00 44.61 ? 10  DC  P "C5'" 1 
ATOM   5845  C  "C4'" . DC  B 2 10  ? -8.905  -16.587 -55.593 1.00 46.52 ? 10  DC  P "C4'" 1 
ATOM   5846  O  "O4'" . DC  B 2 10  ? -7.864  -16.846 -54.606 1.00 38.18 ? 10  DC  P "O4'" 1 
ATOM   5847  C  "C3'" . DC  B 2 10  ? -10.070 -16.003 -54.786 1.00 46.18 ? 10  DC  P "C3'" 1 
ATOM   5848  O  "O3'" . DC  B 2 10  ? -11.450 -16.150 -55.349 1.00 76.29 ? 10  DC  P "O3'" 1 
ATOM   5849  C  "C2'" . DC  B 2 10  ? -9.896  -16.570 -53.383 1.00 35.26 ? 10  DC  P "C2'" 1 
ATOM   5850  C  "C1'" . DC  B 2 10  ? -8.465  -17.127 -53.355 1.00 39.57 ? 10  DC  P "C1'" 1 
ATOM   5851  N  N1    . DC  B 2 10  ? -7.538  -16.589 -52.307 1.00 29.42 ? 10  DC  P N1    1 
ATOM   5852  C  C2    . DC  B 2 10  ? -7.055  -17.474 -51.359 1.00 27.68 ? 10  DC  P C2    1 
ATOM   5853  O  O2    . DC  B 2 10  ? -7.413  -18.655 -51.416 1.00 27.28 ? 10  DC  P O2    1 
ATOM   5854  N  N3    . DC  B 2 10  ? -6.187  -17.017 -50.416 1.00 27.15 ? 10  DC  P N3    1 
ATOM   5855  C  C4    . DC  B 2 10  ? -5.819  -15.730 -50.388 1.00 19.86 ? 10  DC  P C4    1 
ATOM   5856  N  N4    . DC  B 2 10  ? -4.936  -15.361 -49.443 1.00 21.37 ? 10  DC  P N4    1 
ATOM   5857  C  C5    . DC  B 2 10  ? -6.322  -14.793 -51.350 1.00 26.08 ? 10  DC  P C5    1 
ATOM   5858  C  C6    . DC  B 2 10  ? -7.166  -15.267 -52.291 1.00 28.51 ? 10  DC  P C6    1 
ATOM   5859  P  P     . DG  B 2 11  ? -12.183 -17.590 -55.416 1.00 55.40 ? 11  DG  P P     1 
ATOM   5860  O  OP1   . DG  B 2 11  ? -11.207 -18.570 -55.940 1.00 63.45 ? 11  DG  P OP1   1 
ATOM   5861  O  OP2   . DG  B 2 11  ? -13.503 -17.396 -56.055 1.00 77.28 ? 11  DG  P OP2   1 
ATOM   5862  O  "O5'" . DG  B 2 11  ? -12.464 -17.962 -53.879 1.00 43.10 ? 11  DG  P "O5'" 1 
ATOM   5863  C  "C5'" . DG  B 2 11  ? -12.387 -19.353 -53.552 1.00 42.85 ? 11  DG  P "C5'" 1 
ATOM   5864  C  "C4'" . DG  B 2 11  ? -12.292 -19.618 -52.064 1.00 47.27 ? 11  DG  P "C4'" 1 
ATOM   5865  O  "O4'" . DG  B 2 11  ? -11.111 -18.948 -51.523 1.00 37.38 ? 11  DG  P "O4'" 1 
ATOM   5866  C  "C3'" . DG  B 2 11  ? -13.481 -19.113 -51.248 1.00 42.02 ? 11  DG  P "C3'" 1 
ATOM   5867  O  "O3'" . DG  B 2 11  ? -13.686 -19.965 -50.116 1.00 52.90 ? 11  DG  P "O3'" 1 
ATOM   5868  C  "C2'" . DG  B 2 11  ? -12.914 -17.787 -50.765 1.00 46.04 ? 11  DG  P "C2'" 1 
ATOM   5869  C  "C1'" . DG  B 2 11  ? -11.547 -18.325 -50.347 1.00 30.51 ? 11  DG  P "C1'" 1 
ATOM   5870  N  N9    . DG  B 2 11  ? -10.635 -17.288 -49.891 1.00 30.31 ? 11  DG  P N9    1 
ATOM   5871  C  C8    . DG  B 2 11  ? -10.518 -16.000 -50.356 1.00 30.23 ? 11  DG  P C8    1 
ATOM   5872  N  N7    . DG  B 2 11  ? -9.618  -15.304 -49.696 1.00 33.27 ? 11  DG  P N7    1 
ATOM   5873  C  C5    . DG  B 2 11  ? -9.128  -16.207 -48.743 1.00 24.81 ? 11  DG  P C5    1 
ATOM   5874  C  C6    . DG  B 2 11  ? -8.141  -16.056 -47.756 1.00 23.67 ? 11  DG  P C6    1 
ATOM   5875  O  O6    . DG  B 2 11  ? -7.498  -15.046 -47.523 1.00 26.69 ? 11  DG  P O6    1 
ATOM   5876  N  N1    . DG  B 2 11  ? -7.944  -17.204 -46.994 1.00 23.61 ? 11  DG  P N1    1 
ATOM   5877  C  C2    . DG  B 2 11  ? -8.630  -18.381 -47.195 1.00 27.68 ? 11  DG  P C2    1 
ATOM   5878  N  N2    . DG  B 2 11  ? -8.339  -19.406 -46.396 1.00 25.21 ? 11  DG  P N2    1 
ATOM   5879  N  N3    . DG  B 2 11  ? -9.556  -18.536 -48.120 1.00 23.82 ? 11  DG  P N3    1 
ATOM   5880  C  C4    . DG  B 2 11  ? -9.737  -17.426 -48.860 1.00 23.43 ? 11  DG  P C4    1 
ATOM   5881  P  P     . DG  B 2 12  ? -14.994 -20.903 -50.023 1.00 49.15 ? 12  DG  P P     1 
ATOM   5882  O  OP1   . DG  B 2 12  ? -15.048 -21.725 -51.243 1.00 52.87 ? 12  DG  P OP1   1 
ATOM   5883  O  OP2   . DG  B 2 12  ? -16.134 -20.046 -49.635 1.00 55.13 ? 12  DG  P OP2   1 
ATOM   5884  O  "O5'" . DG  B 2 12  ? -14.684 -21.846 -48.769 1.00 50.46 ? 12  DG  P "O5'" 1 
ATOM   5885  C  "C5'" . DG  B 2 12  ? -13.612 -22.769 -48.793 1.00 42.00 ? 12  DG  P "C5'" 1 
ATOM   5886  C  "C4'" . DG  B 2 12  ? -13.263 -23.127 -47.362 1.00 47.82 ? 12  DG  P "C4'" 1 
ATOM   5887  O  "O4'" . DG  B 2 12  ? -12.414 -22.122 -46.740 1.00 42.63 ? 12  DG  P "O4'" 1 
ATOM   5888  C  "C3'" . DG  B 2 12  ? -14.465 -23.241 -46.438 1.00 34.52 ? 12  DG  P "C3'" 1 
ATOM   5889  O  "O3'" . DG  B 2 12  ? -14.047 -24.173 -45.468 1.00 37.80 ? 12  DG  P "O3'" 1 
ATOM   5890  C  "C2'" . DG  B 2 12  ? -14.617 -21.792 -45.957 1.00 31.58 ? 12  DG  P "C2'" 1 
ATOM   5891  C  "C1'" . DG  B 2 12  ? -13.148 -21.370 -45.780 1.00 39.59 ? 12  DG  P "C1'" 1 
ATOM   5892  N  N9    . DG  B 2 12  ? -12.785 -19.946 -45.946 1.00 32.80 ? 12  DG  P N9    1 
ATOM   5893  C  C8    . DG  B 2 12  ? -13.205 -19.068 -46.913 1.00 30.59 ? 12  DG  P C8    1 
ATOM   5894  N  N7    . DG  B 2 12  ? -12.679 -17.875 -46.802 1.00 31.36 ? 12  DG  P N7    1 
ATOM   5895  C  C5    . DG  B 2 12  ? -11.851 -17.952 -45.690 1.00 28.27 ? 12  DG  P C5    1 
ATOM   5896  C  C6    . DG  B 2 12  ? -11.020 -16.959 -45.107 1.00 25.61 ? 12  DG  P C6    1 
ATOM   5897  O  O6    . DG  B 2 12  ? -10.882 -15.793 -45.494 1.00 25.57 ? 12  DG  P O6    1 
ATOM   5898  N  N1    . DG  B 2 12  ? -10.343 -17.433 -43.993 1.00 24.29 ? 12  DG  P N1    1 
ATOM   5899  C  C2    . DG  B 2 12  ? -10.441 -18.731 -43.534 1.00 25.03 ? 12  DG  P C2    1 
ATOM   5900  N  N2    . DG  B 2 12  ? -9.737  -19.035 -42.453 1.00 24.22 ? 12  DG  P N2    1 
ATOM   5901  N  N3    . DG  B 2 12  ? -11.217 -19.676 -44.079 1.00 28.33 ? 12  DG  P N3    1 
ATOM   5902  C  C4    . DG  B 2 12  ? -11.891 -19.216 -45.157 1.00 28.09 ? 12  DG  P C4    1 
ATOM   5903  P  P     . DC  B 2 13  ? -15.112 -24.819 -44.452 1.00 40.25 ? 13  DC  P P     1 
ATOM   5904  O  OP1   . DC  B 2 13  ? -14.759 -26.254 -44.265 1.00 35.84 ? 13  DC  P OP1   1 
ATOM   5905  O  OP2   . DC  B 2 13  ? -16.470 -24.330 -44.846 1.00 31.76 ? 13  DC  P OP2   1 
ATOM   5906  O  "O5'" . DC  B 2 13  ? -14.728 -24.139 -43.041 1.00 44.23 ? 13  DC  P "O5'" 1 
ATOM   5907  C  "C5'" . DC  B 2 13  ? -13.562 -24.567 -42.319 1.00 34.93 ? 13  DC  P "C5'" 1 
ATOM   5908  C  "C4'" . DC  B 2 13  ? -13.335 -23.512 -41.243 1.00 35.68 ? 13  DC  P "C4'" 1 
ATOM   5909  O  "O4'" . DC  B 2 13  ? -13.225 -22.220 -41.885 1.00 33.33 ? 13  DC  P "O4'" 1 
ATOM   5910  C  "C3'" . DC  B 2 13  ? -14.576 -23.392 -40.396 1.00 39.41 ? 13  DC  P "C3'" 1 
ATOM   5911  O  "O3'" . DC  B 2 13  ? -14.446 -24.227 -39.236 1.00 34.32 ? 13  DC  P "O3'" 1 
ATOM   5912  C  "C2'" . DC  B 2 13  ? -14.767 -21.886 -40.173 1.00 27.81 ? 13  DC  P "C2'" 1 
ATOM   5913  C  "C1'" . DC  B 2 13  ? -13.586 -21.256 -40.903 1.00 37.35 ? 13  DC  P "C1'" 1 
ATOM   5914  N  N1    . DC  B 2 13  ? -13.765 -19.927 -41.597 1.00 27.73 ? 13  DC  P N1    1 
ATOM   5915  C  C2    . DC  B 2 13  ? -13.056 -18.764 -41.165 1.00 22.66 ? 13  DC  P C2    1 
ATOM   5916  O  O2    . DC  B 2 13  ? -12.341 -18.827 -40.162 1.00 26.59 ? 13  DC  P O2    1 
ATOM   5917  N  N3    . DC  B 2 13  ? -13.238 -17.597 -41.820 1.00 23.77 ? 13  DC  P N3    1 
ATOM   5918  C  C4    . DC  B 2 13  ? -14.031 -17.544 -42.893 1.00 26.54 ? 13  DC  P C4    1 
ATOM   5919  N  N4    . DC  B 2 13  ? -14.184 -16.385 -43.549 1.00 23.87 ? 13  DC  P N4    1 
ATOM   5920  C  C5    . DC  B 2 13  ? -14.736 -18.696 -43.348 1.00 23.70 ? 13  DC  P C5    1 
ATOM   5921  C  C6    . DC  B 2 13  ? -14.565 -19.841 -42.683 1.00 26.48 ? 13  DC  P C6    1 
ATOM   5922  P  P     . DC  C 3 4   ? -19.316 -0.268  -43.379 1.00 77.86 ? 4   DC  T P     1 
ATOM   5923  O  OP1   . DC  C 3 4   ? -20.318 -0.678  -44.394 1.00 73.66 ? 4   DC  T OP1   1 
ATOM   5924  O  OP2   . DC  C 3 4   ? -19.689 0.541   -42.189 1.00 50.37 ? 4   DC  T OP2   1 
ATOM   5925  O  "O5'" . DC  C 3 4   ? -18.619 -1.595  -42.827 1.00 38.78 ? 4   DC  T "O5'" 1 
ATOM   5926  C  "C5'" . DC  C 3 4   ? -18.960 -2.084  -41.552 1.00 41.12 ? 4   DC  T "C5'" 1 
ATOM   5927  C  "C4'" . DC  C 3 4   ? -18.260 -3.405  -41.439 1.00 25.96 ? 4   DC  T "C4'" 1 
ATOM   5928  O  "O4'" . DC  C 3 4   ? -18.774 -4.323  -42.418 1.00 28.16 ? 4   DC  T "O4'" 1 
ATOM   5929  C  "C3'" . DC  C 3 4   ? -16.791 -3.247  -41.794 1.00 23.23 ? 4   DC  T "C3'" 1 
ATOM   5930  O  "O3'" . DC  C 3 4   ? -16.139 -3.962  -40.787 1.00 27.25 ? 4   DC  T "O3'" 1 
ATOM   5931  C  "C2'" . DC  C 3 4   ? -16.620 -3.883  -43.158 1.00 28.71 ? 4   DC  T "C2'" 1 
ATOM   5932  C  "C1'" . DC  C 3 4   ? -17.716 -4.929  -43.127 1.00 39.49 ? 4   DC  T "C1'" 1 
ATOM   5933  N  N1    . DC  C 3 4   ? -18.197 -5.201  -44.472 1.00 39.62 ? 4   DC  T N1    1 
ATOM   5934  C  C2    . DC  C 3 4   ? -18.027 -6.466  -45.038 1.00 44.45 ? 4   DC  T C2    1 
ATOM   5935  O  O2    . DC  C 3 4   ? -17.488 -7.369  -44.381 1.00 46.20 ? 4   DC  T O2    1 
ATOM   5936  N  N3    . DC  C 3 4   ? -18.494 -6.669  -46.294 1.00 52.78 ? 4   DC  T N3    1 
ATOM   5937  C  C4    . DC  C 3 4   ? -19.075 -5.673  -46.962 1.00 56.66 ? 4   DC  T C4    1 
ATOM   5938  N  N4    . DC  C 3 4   ? -19.509 -5.927  -48.205 1.00 63.38 ? 4   DC  T N4    1 
ATOM   5939  C  C5    . DC  C 3 4   ? -19.235 -4.373  -46.397 1.00 51.26 ? 4   DC  T C5    1 
ATOM   5940  C  C6    . DC  C 3 4   ? -18.785 -4.180  -45.160 1.00 41.66 ? 4   DC  T C6    1 
ATOM   5941  P  P     . DG  C 3 5   ? -14.633 -3.606  -40.419 1.00 23.17 ? 5   DG  T P     1 
ATOM   5942  O  OP1   . DG  C 3 5   ? -14.641 -2.366  -39.581 1.00 23.22 ? 5   DG  T OP1   1 
ATOM   5943  O  OP2   . DG  C 3 5   ? -13.842 -3.672  -41.679 1.00 27.88 ? 5   DG  T OP2   1 
ATOM   5944  O  "O5'" . DG  C 3 5   ? -14.253 -4.753  -39.381 1.00 22.10 ? 5   DG  T "O5'" 1 
ATOM   5945  C  "C5'" . DG  C 3 5   ? -14.402 -6.110  -39.740 1.00 18.15 ? 5   DG  T "C5'" 1 
ATOM   5946  C  "C4'" . DG  C 3 5   ? -13.747 -6.888  -38.615 1.00 16.74 ? 5   DG  T "C4'" 1 
ATOM   5947  O  "O4'" . DG  C 3 5   ? -14.068 -8.289  -38.720 1.00 19.45 ? 5   DG  T "O4'" 1 
ATOM   5948  C  "C3'" . DG  C 3 5   ? -12.217 -6.839  -38.714 1.00 15.47 ? 5   DG  T "C3'" 1 
ATOM   5949  O  "O3'" . DG  C 3 5   ? -11.713 -6.935  -37.395 1.00 17.73 ? 5   DG  T "O3'" 1 
ATOM   5950  C  "C2'" . DG  C 3 5   ? -11.916 -8.045  -39.616 1.00 17.31 ? 5   DG  T "C2'" 1 
ATOM   5951  C  "C1'" . DG  C 3 5   ? -12.891 -9.071  -39.048 1.00 20.23 ? 5   DG  T "C1'" 1 
ATOM   5952  N  N9    . DG  C 3 5   ? -13.502 -10.029 -39.976 1.00 18.38 ? 5   DG  T N9    1 
ATOM   5953  C  C8    . DG  C 3 5   ? -14.004 -9.788  -41.237 1.00 21.04 ? 5   DG  T C8    1 
ATOM   5954  N  N7    . DG  C 3 5   ? -14.578 -10.846 -41.760 1.00 20.41 ? 5   DG  T N7    1 
ATOM   5955  C  C5    . DG  C 3 5   ? -14.463 -11.820 -40.757 1.00 19.62 ? 5   DG  T C5    1 
ATOM   5956  C  C6    . DG  C 3 5   ? -14.926 -13.152 -40.706 1.00 19.01 ? 5   DG  T C6    1 
ATOM   5957  O  O6    . DG  C 3 5   ? -15.546 -13.756 -41.596 1.00 18.97 ? 5   DG  T O6    1 
ATOM   5958  N  N1    . DG  C 3 5   ? -14.629 -13.788 -39.504 1.00 17.01 ? 5   DG  T N1    1 
ATOM   5959  C  C2    . DG  C 3 5   ? -13.970 -13.212 -38.447 1.00 17.70 ? 5   DG  T C2    1 
ATOM   5960  N  N2    . DG  C 3 5   ? -13.751 -13.951 -37.318 1.00 16.03 ? 5   DG  T N2    1 
ATOM   5961  N  N3    . DG  C 3 5   ? -13.560 -11.956 -38.492 1.00 16.29 ? 5   DG  T N3    1 
ATOM   5962  C  C4    . DG  C 3 5   ? -13.842 -11.324 -39.656 1.00 18.72 ? 5   DG  T C4    1 
ATOM   5963  P  P     . DG  C 3 6   ? -10.173 -6.587  -37.068 1.00 18.81 ? 6   DG  T P     1 
ATOM   5964  O  OP1   . DG  C 3 6   ? -10.099 -6.184  -35.649 1.00 17.19 ? 6   DG  T OP1   1 
ATOM   5965  O  OP2   . DG  C 3 6   ? -9.652  -5.773  -38.194 1.00 19.53 ? 6   DG  T OP2   1 
ATOM   5966  O  "O5'" . DG  C 3 6   ? -9.478  -8.020  -37.171 1.00 19.14 ? 6   DG  T "O5'" 1 
ATOM   5967  C  "C5'" . DG  C 3 6   ? -9.864  -8.980  -36.230 1.00 16.20 ? 6   DG  T "C5'" 1 
ATOM   5968  C  "C4'" . DG  C 3 6   ? -9.283  -10.323 -36.598 1.00 17.48 ? 6   DG  T "C4'" 1 
ATOM   5969  O  "O4'" . DG  C 3 6   ? -10.094 -10.898 -37.619 1.00 16.51 ? 6   DG  T "O4'" 1 
ATOM   5970  C  "C3'" . DG  C 3 6   ? -7.843  -10.285 -37.169 1.00 16.41 ? 6   DG  T "C3'" 1 
ATOM   5971  O  "O3'" . DG  C 3 6   ? -7.187  -11.315 -36.448 1.00 19.15 ? 6   DG  T "O3'" 1 
ATOM   5972  C  "C2'" . DG  C 3 6   ? -8.068  -10.670 -38.645 1.00 17.96 ? 6   DG  T "C2'" 1 
ATOM   5973  C  "C1'" . DG  C 3 6   ? -9.276  -11.616 -38.489 1.00 20.15 ? 6   DG  T "C1'" 1 
ATOM   5974  N  N9    . DG  C 3 6   ? -10.026 -11.951 -39.700 1.00 22.16 ? 6   DG  T N9    1 
ATOM   5975  C  C8    . DG  C 3 6   ? -10.259 -11.161 -40.791 1.00 22.31 ? 6   DG  T C8    1 
ATOM   5976  N  N7    . DG  C 3 6   ? -10.926 -11.748 -41.737 1.00 19.86 ? 6   DG  T N7    1 
ATOM   5977  C  C5    . DG  C 3 6   ? -11.170 -12.999 -41.228 1.00 20.77 ? 6   DG  T C5    1 
ATOM   5978  C  C6    . DG  C 3 6   ? -11.861 -14.073 -41.797 1.00 18.02 ? 6   DG  T C6    1 
ATOM   5979  O  O6    . DG  C 3 6   ? -12.360 -14.064 -42.905 1.00 21.17 ? 6   DG  T O6    1 
ATOM   5980  N  N1    . DG  C 3 6   ? -11.885 -15.208 -40.990 1.00 19.33 ? 6   DG  T N1    1 
ATOM   5981  C  C2    . DG  C 3 6   ? -11.317 -15.281 -39.763 1.00 21.19 ? 6   DG  T C2    1 
ATOM   5982  N  N2    . DG  C 3 6   ? -11.423 -16.446 -39.109 1.00 21.91 ? 6   DG  T N2    1 
ATOM   5983  N  N3    . DG  C 3 6   ? -10.678 -14.259 -39.215 1.00 20.12 ? 6   DG  T N3    1 
ATOM   5984  C  C4    . DG  C 3 6   ? -10.622 -13.163 -39.999 1.00 20.08 ? 6   DG  T C4    1 
ATOM   5985  P  P     . DC  C 3 7   ? -5.574  -11.402 -36.408 1.00 21.26 ? 7   DC  T P     1 
ATOM   5986  O  OP1   . DC  C 3 7   ? -5.217  -12.537 -35.586 1.00 20.26 ? 7   DC  T OP1   1 
ATOM   5987  O  OP2   . DC  C 3 7   ? -5.030  -10.034 -36.170 1.00 21.36 ? 7   DC  T OP2   1 
ATOM   5988  O  "O5'" . DC  C 3 7   ? -5.185  -11.788 -37.883 1.00 26.89 ? 7   DC  T "O5'" 1 
ATOM   5989  C  "C5'" . DC  C 3 7   ? -4.668  -13.080 -38.050 1.00 26.87 ? 7   DC  T "C5'" 1 
ATOM   5990  C  "C4'" . DC  C 3 7   ? -5.640  -14.240 -37.952 1.00 27.35 ? 7   DC  T "C4'" 1 
ATOM   5991  O  "O4'" . DC  C 3 7   ? -6.901  -13.971 -38.642 1.00 30.65 ? 7   DC  T "O4'" 1 
ATOM   5992  C  "C3'" . DC  C 3 7   ? -5.072  -15.426 -38.751 1.00 17.85 ? 7   DC  T "C3'" 1 
ATOM   5993  O  "O3'" . DC  C 3 7   ? -4.167  -16.091 -37.972 1.00 22.50 ? 7   DC  T "O3'" 1 
ATOM   5994  C  "C2'" . DC  C 3 7   ? -6.315  -16.270 -39.105 1.00 24.18 ? 7   DC  T "C2'" 1 
ATOM   5995  C  "C1'" . DC  C 3 7   ? -7.326  -15.134 -39.340 1.00 19.84 ? 7   DC  T "C1'" 1 
ATOM   5996  N  N1    . DC  C 3 7   ? -7.668  -14.782 -40.740 1.00 20.08 ? 7   DC  T N1    1 
ATOM   5997  C  C2    . DC  C 3 7   ? -8.433  -15.730 -41.439 1.00 21.90 ? 7   DC  T C2    1 
ATOM   5998  O  O2    . DC  C 3 7   ? -8.688  -16.809 -40.890 1.00 28.08 ? 7   DC  T O2    1 
ATOM   5999  N  N3    . DC  C 3 7   ? -8.823  -15.464 -42.683 1.00 21.23 ? 7   DC  T N3    1 
ATOM   6000  C  C4    . DC  C 3 7   ? -8.518  -14.300 -43.253 1.00 22.82 ? 7   DC  T C4    1 
ATOM   6001  N  N4    . DC  C 3 7   ? -8.928  -14.101 -44.495 1.00 26.07 ? 7   DC  T N4    1 
ATOM   6002  C  C5    . DC  C 3 7   ? -7.775  -13.292 -42.562 1.00 26.11 ? 7   DC  T C5    1 
ATOM   6003  C  C6    . DC  C 3 7   ? -7.380  -13.562 -41.307 1.00 22.44 ? 7   DC  T C6    1 
ATOM   6004  P  P     . DC  C 3 8   ? -2.696  -16.401 -38.593 1.00 22.88 ? 8   DC  T P     1 
ATOM   6005  O  OP1   . DC  C 3 8   ? -1.826  -16.769 -37.487 1.00 27.29 ? 8   DC  T OP1   1 
ATOM   6006  O  OP2   . DC  C 3 8   ? -2.368  -15.316 -39.566 1.00 22.49 ? 8   DC  T OP2   1 
ATOM   6007  O  "O5'" . DC  C 3 8   ? -2.990  -17.666 -39.552 1.00 23.53 ? 8   DC  T "O5'" 1 
ATOM   6008  C  "C5'" . DC  C 3 8   ? -3.483  -18.880 -39.002 1.00 23.88 ? 8   DC  T "C5'" 1 
ATOM   6009  C  "C4'" . DC  C 3 8   ? -4.100  -19.732 -40.088 1.00 22.33 ? 8   DC  T "C4'" 1 
ATOM   6010  O  "O4'" . DC  C 3 8   ? -5.193  -19.024 -40.715 1.00 24.22 ? 8   DC  T "O4'" 1 
ATOM   6011  C  "C3'" . DC  C 3 8   ? -3.147  -20.072 -41.243 1.00 25.39 ? 8   DC  T "C3'" 1 
ATOM   6012  O  "O3'" . DC  C 3 8   ? -2.600  -21.306 -40.888 1.00 20.70 ? 8   DC  T "O3'" 1 
ATOM   6013  C  "C2'" . DC  C 3 8   ? -4.096  -20.311 -42.397 1.00 31.37 ? 8   DC  T "C2'" 1 
ATOM   6014  C  "C1'" . DC  C 3 8   ? -5.244  -19.385 -42.077 1.00 30.67 ? 8   DC  T "C1'" 1 
ATOM   6015  N  N1    . DC  C 3 8   ? -5.292  -18.139 -42.874 1.00 20.68 ? 8   DC  T N1    1 
ATOM   6016  C  C2    . DC  C 3 8   ? -6.014  -18.247 -44.025 1.00 21.98 ? 8   DC  T C2    1 
ATOM   6017  O  O2    . DC  C 3 8   ? -6.478  -19.364 -44.259 1.00 23.90 ? 8   DC  T O2    1 
ATOM   6018  N  N3    . DC  C 3 8   ? -6.157  -17.168 -44.818 1.00 19.98 ? 8   DC  T N3    1 
ATOM   6019  C  C4    . DC  C 3 8   ? -5.597  -16.017 -44.458 1.00 19.69 ? 8   DC  T C4    1 
ATOM   6020  N  N4    . DC  C 3 8   ? -5.788  -15.006 -45.295 1.00 18.85 ? 8   DC  T N4    1 
ATOM   6021  C  C5    . DC  C 3 8   ? -4.813  -15.869 -43.270 1.00 24.04 ? 8   DC  T C5    1 
ATOM   6022  C  C6    . DC  C 3 8   ? -4.685  -16.963 -42.491 1.00 23.67 ? 8   DC  T C6    1 
ATOM   6023  P  P     . DG  C 3 9   ? -1.502  -22.029 -41.808 1.00 22.14 ? 9   DG  T P     1 
ATOM   6024  O  OP1   . DG  C 3 9   ? -0.853  -23.047 -40.966 1.00 20.47 ? 9   DG  T OP1   1 
ATOM   6025  O  OP2   . DG  C 3 9   ? -0.686  -20.983 -42.490 1.00 21.52 ? 9   DG  T OP2   1 
ATOM   6026  O  "O5'" . DG  C 3 9   ? -2.332  -22.741 -42.948 1.00 25.44 ? 9   DG  T "O5'" 1 
ATOM   6027  C  "C5'" . DG  C 3 9   ? -3.240  -23.785 -42.597 1.00 28.21 ? 9   DG  T "C5'" 1 
ATOM   6028  C  "C4'" . DG  C 3 9   ? -3.859  -24.311 -43.866 1.00 23.05 ? 9   DG  T "C4'" 1 
ATOM   6029  O  "O4'" . DG  C 3 9   ? -4.505  -23.237 -44.589 1.00 21.10 ? 9   DG  T "O4'" 1 
ATOM   6030  C  "C3'" . DG  C 3 9   ? -2.874  -24.929 -44.872 1.00 27.56 ? 9   DG  T "C3'" 1 
ATOM   6031  O  "O3'" . DG  C 3 9   ? -3.596  -25.990 -45.491 1.00 33.11 ? 9   DG  T "O3'" 1 
ATOM   6032  C  "C2'" . DG  C 3 9   ? -2.574  -23.813 -45.881 1.00 23.73 ? 9   DG  T "C2'" 1 
ATOM   6033  C  "C1'" . DG  C 3 9   ? -3.878  -23.019 -45.845 1.00 26.93 ? 9   DG  T "C1'" 1 
ATOM   6034  N  N9    . DG  C 3 9   ? -3.656  -21.591 -46.065 1.00 28.67 ? 9   DG  T N9    1 
ATOM   6035  C  C8    . DG  C 3 9   ? -2.764  -20.769 -45.430 1.00 25.58 ? 9   DG  T C8    1 
ATOM   6036  N  N7    . DG  C 3 9   ? -2.813  -19.526 -45.852 1.00 22.97 ? 9   DG  T N7    1 
ATOM   6037  C  C5    . DG  C 3 9   ? -3.789  -19.526 -46.831 1.00 19.52 ? 9   DG  T C5    1 
ATOM   6038  C  C6    . DG  C 3 9   ? -4.270  -18.469 -47.651 1.00 21.14 ? 9   DG  T C6    1 
ATOM   6039  O  O6    . DG  C 3 9   ? -3.899  -17.274 -47.672 1.00 20.53 ? 9   DG  T O6    1 
ATOM   6040  N  N1    . DG  C 3 9   ? -5.255  -18.931 -48.534 1.00 21.29 ? 9   DG  T N1    1 
ATOM   6041  C  C2    . DG  C 3 9   ? -5.728  -20.231 -48.573 1.00 22.32 ? 9   DG  T C2    1 
ATOM   6042  N  N2    . DG  C 3 9   ? -6.693  -20.487 -49.466 1.00 24.70 ? 9   DG  T N2    1 
ATOM   6043  N  N3    . DG  C 3 9   ? -5.281  -21.218 -47.808 1.00 21.53 ? 9   DG  T N3    1 
ATOM   6044  C  C4    . DG  C 3 9   ? -4.307  -20.799 -46.979 1.00 25.09 ? 9   DG  T C4    1 
ATOM   6045  P  P     . DA  C 3 10  ? -2.955  -26.800 -46.738 1.00 37.61 ? 10  DA  T P     1 
ATOM   6046  O  OP1   . DA  C 3 10  ? -3.484  -28.188 -46.691 1.00 49.49 ? 10  DA  T OP1   1 
ATOM   6047  O  OP2   . DA  C 3 10  ? -1.513  -26.541 -46.754 1.00 33.73 ? 10  DA  T OP2   1 
ATOM   6048  O  "O5'" . DA  C 3 10  ? -3.607  -26.101 -47.992 1.00 32.75 ? 10  DA  T "O5'" 1 
ATOM   6049  C  "C5'" . DA  C 3 10  ? -4.987  -26.124 -48.101 1.00 33.76 ? 10  DA  T "C5'" 1 
ATOM   6050  C  "C4'" . DA  C 3 10  ? -5.417  -25.682 -49.491 1.00 41.80 ? 10  DA  T "C4'" 1 
ATOM   6051  O  "O4'" . DA  C 3 10  ? -5.211  -24.264 -49.683 1.00 33.14 ? 10  DA  T "O4'" 1 
ATOM   6052  C  "C3'" . DA  C 3 10  ? -4.760  -26.367 -50.701 1.00 33.83 ? 10  DA  T "C3'" 1 
ATOM   6053  O  "O3'" . DA  C 3 10  ? -5.806  -26.470 -51.618 1.00 43.31 ? 10  DA  T "O3'" 1 
ATOM   6054  C  "C2'" . DA  C 3 10  ? -3.684  -25.378 -51.137 1.00 33.49 ? 10  DA  T "C2'" 1 
ATOM   6055  C  "C1'" . DA  C 3 10  ? -4.366  -24.048 -50.811 1.00 36.51 ? 10  DA  T "C1'" 1 
ATOM   6056  N  N9    . DA  C 3 10  ? -3.469  -22.972 -50.391 1.00 25.61 ? 10  DA  T N9    1 
ATOM   6057  C  C8    . DA  C 3 10  ? -2.464  -23.029 -49.455 1.00 24.67 ? 10  DA  T C8    1 
ATOM   6058  N  N7    . DA  C 3 10  ? -1.859  -21.885 -49.269 1.00 25.08 ? 10  DA  T N7    1 
ATOM   6059  C  C5    . DA  C 3 10  ? -2.515  -21.015 -50.137 1.00 24.54 ? 10  DA  T C5    1 
ATOM   6060  C  C6    . DA  C 3 10  ? -2.377  -19.637 -50.422 1.00 19.65 ? 10  DA  T C6    1 
ATOM   6061  N  N6    . DA  C 3 10  ? -1.459  -18.830 -49.877 1.00 22.12 ? 10  DA  T N6    1 
ATOM   6062  N  N1    . DA  C 3 10  ? -3.212  -19.130 -51.351 1.00 21.25 ? 10  DA  T N1    1 
ATOM   6063  C  C2    . DA  C 3 10  ? -4.135  -19.894 -51.944 1.00 21.94 ? 10  DA  T C2    1 
ATOM   6064  N  N3    . DA  C 3 10  ? -4.366  -21.182 -51.747 1.00 25.34 ? 10  DA  T N3    1 
ATOM   6065  C  C4    . DA  C 3 10  ? -3.522  -21.678 -50.827 1.00 25.38 ? 10  DA  T C4    1 
ATOM   6066  P  P     . DT  C 3 11  ? -5.604  -27.259 -53.009 1.00 45.23 ? 11  DT  T P     1 
ATOM   6067  O  OP1   . DT  C 3 11  ? -6.895  -27.885 -53.365 1.00 45.18 ? 11  DT  T OP1   1 
ATOM   6068  O  OP2   . DT  C 3 11  ? -4.353  -28.052 -52.905 1.00 31.22 ? 11  DT  T OP2   1 
ATOM   6069  O  "O5'" . DT  C 3 11  ? -5.319  -26.082 -54.049 1.00 30.99 ? 11  DT  T "O5'" 1 
ATOM   6070  C  "C5'" . DT  C 3 11  ? -6.250  -25.045 -54.262 1.00 35.78 ? 11  DT  T "C5'" 1 
ATOM   6071  C  "C4'" . DT  C 3 11  ? -5.553  -23.981 -55.080 1.00 34.07 ? 11  DT  T "C4'" 1 
ATOM   6072  O  "O4'" . DT  C 3 11  ? -4.570  -23.274 -54.292 1.00 31.54 ? 11  DT  T "O4'" 1 
ATOM   6073  C  "C3'" . DT  C 3 11  ? -4.790  -24.502 -56.304 1.00 34.73 ? 11  DT  T "C3'" 1 
ATOM   6074  O  "O3'" . DT  C 3 11  ? -5.584  -23.994 -57.338 1.00 36.79 ? 11  DT  T "O3'" 1 
ATOM   6075  C  "C2'" . DT  C 3 11  ? -3.386  -23.867 -56.259 1.00 30.40 ? 11  DT  T "C2'" 1 
ATOM   6076  C  "C1'" . DT  C 3 11  ? -3.587  -22.773 -55.201 1.00 34.17 ? 11  DT  T "C1'" 1 
ATOM   6077  N  N1    . DT  C 3 11  ? -2.406  -22.348 -54.353 1.00 23.42 ? 11  DT  T N1    1 
ATOM   6078  C  C2    . DT  C 3 11  ? -2.066  -21.016 -54.379 1.00 27.69 ? 11  DT  T C2    1 
ATOM   6079  O  O2    . DT  C 3 11  ? -2.633  -20.188 -55.083 1.00 26.28 ? 11  DT  T O2    1 
ATOM   6080  N  N3    . DT  C 3 11  ? -1.013  -20.685 -53.571 1.00 19.78 ? 11  DT  T N3    1 
ATOM   6081  C  C4    . DT  C 3 11  ? -0.307  -21.526 -52.752 1.00 23.65 ? 11  DT  T C4    1 
ATOM   6082  O  O4    . DT  C 3 11  ? 0.598   -21.101 -52.045 1.00 23.69 ? 11  DT  T O4    1 
ATOM   6083  C  C5    . DT  C 3 11  ? -0.712  -22.907 -52.751 1.00 24.63 ? 11  DT  T C5    1 
ATOM   6084  C  C7    . DT  C 3 11  ? 0.029   -23.884 -51.878 1.00 30.75 ? 11  DT  T C7    1 
ATOM   6085  C  C6    . DT  C 3 11  ? -1.745  -23.248 -53.539 1.00 25.11 ? 11  DT  T C6    1 
ATOM   6086  P  P     . DC  C 3 12  ? -5.362  -24.465 -58.860 1.00 37.55 ? 12  DC  T P     1 
ATOM   6087  O  OP1   . DC  C 3 12  ? -6.655  -24.287 -59.575 1.00 36.56 ? 12  DC  T OP1   1 
ATOM   6088  O  OP2   . DC  C 3 12  ? -4.658  -25.770 -58.854 1.00 30.97 ? 12  DC  T OP2   1 
ATOM   6089  O  "O5'" . DC  C 3 12  ? -4.270  -23.437 -59.401 1.00 31.37 ? 12  DC  T "O5'" 1 
ATOM   6090  C  "C5'" . DC  C 3 12  ? -4.697  -22.094 -59.468 1.00 34.86 ? 12  DC  T "C5'" 1 
ATOM   6091  C  "C4'" . DC  C 3 12  ? -3.513  -21.277 -59.932 1.00 38.86 ? 12  DC  T "C4'" 1 
ATOM   6092  O  "O4'" . DC  C 3 12  ? -2.625  -20.971 -58.826 1.00 32.19 ? 12  DC  T "O4'" 1 
ATOM   6093  C  "C3'" . DC  C 3 12  ? -2.640  -22.027 -60.938 1.00 36.99 ? 12  DC  T "C3'" 1 
ATOM   6094  O  "O3'" . DC  C 3 12  ? -2.138  -21.077 -61.822 1.00 48.92 ? 12  DC  T "O3'" 1 
ATOM   6095  C  "C2'" . DC  C 3 12  ? -1.471  -22.522 -60.106 1.00 37.70 ? 12  DC  T "C2'" 1 
ATOM   6096  C  "C1'" . DC  C 3 12  ? -1.316  -21.263 -59.245 1.00 32.24 ? 12  DC  T "C1'" 1 
ATOM   6097  N  N1    . DC  C 3 12  ? -0.410  -21.466 -58.082 1.00 29.18 ? 12  DC  T N1    1 
ATOM   6098  C  C2    . DC  C 3 12  ? 0.286   -20.379 -57.564 1.00 25.83 ? 12  DC  T C2    1 
ATOM   6099  O  O2    . DC  C 3 12  ? 0.108   -19.256 -58.045 1.00 28.98 ? 12  DC  T O2    1 
ATOM   6100  N  N3    . DC  C 3 12  ? 1.093   -20.582 -56.507 1.00 24.64 ? 12  DC  T N3    1 
ATOM   6101  C  C4    . DC  C 3 12  ? 1.235   -21.806 -56.012 1.00 23.79 ? 12  DC  T C4    1 
ATOM   6102  N  N4    . DC  C 3 12  ? 2.060   -21.976 -54.978 1.00 22.51 ? 12  DC  T N4    1 
ATOM   6103  C  C5    . DC  C 3 12  ? 0.535   -22.930 -56.532 1.00 31.51 ? 12  DC  T C5    1 
ATOM   6104  C  C6    . DC  C 3 12  ? -0.271  -22.705 -57.569 1.00 27.95 ? 12  DC  T C6    1 
ATOM   6105  P  P     . DA  C 3 13  ? -2.512  -21.160 -63.376 1.00 43.72 ? 13  DA  T P     1 
ATOM   6106  O  OP1   . DA  C 3 13  ? -3.914  -20.733 -63.512 1.00 40.96 ? 13  DA  T OP1   1 
ATOM   6107  O  OP2   . DA  C 3 13  ? -1.974  -22.439 -63.888 1.00 36.95 ? 13  DA  T OP2   1 
ATOM   6108  O  "O5'" . DA  C 3 13  ? -1.667  -19.967 -64.014 1.00 40.81 ? 13  DA  T "O5'" 1 
ATOM   6109  C  "C5'" . DA  C 3 13  ? -2.000  -18.659 -63.553 1.00 39.08 ? 13  DA  T "C5'" 1 
ATOM   6110  C  "C4'" . DA  C 3 13  ? -0.775  -17.775 -63.495 1.00 40.92 ? 13  DA  T "C4'" 1 
ATOM   6111  O  "O4'" . DA  C 3 13  ? 0.101   -18.165 -62.406 1.00 36.25 ? 13  DA  T "O4'" 1 
ATOM   6112  C  "C3'" . DA  C 3 13  ? 0.097   -17.846 -64.743 1.00 47.90 ? 13  DA  T "C3'" 1 
ATOM   6113  O  "O3'" . DA  C 3 13  ? 0.742   -16.598 -64.865 1.00 56.67 ? 13  DA  T "O3'" 1 
ATOM   6114  C  "C2'" . DA  C 3 13  ? 1.084   -18.950 -64.396 1.00 43.20 ? 13  DA  T "C2'" 1 
ATOM   6115  C  "C1'" . DA  C 3 13  ? 1.338   -18.591 -62.936 1.00 45.75 ? 13  DA  T "C1'" 1 
ATOM   6116  N  N9    . DA  C 3 13  ? 1.711   -19.678 -62.063 1.00 31.52 ? 13  DA  T N9    1 
ATOM   6117  C  C8    . DA  C 3 13  ? 1.318   -20.982 -62.108 1.00 36.66 ? 13  DA  T C8    1 
ATOM   6118  N  N7    . DA  C 3 13  ? 1.813   -21.701 -61.135 1.00 33.52 ? 13  DA  T N7    1 
ATOM   6119  C  C5    . DA  C 3 13  ? 2.568   -20.796 -60.387 1.00 24.98 ? 13  DA  T C5    1 
ATOM   6120  C  C6    . DA  C 3 13  ? 3.349   -20.933 -59.239 1.00 25.41 ? 13  DA  T C6    1 
ATOM   6121  N  N6    . DA  C 3 13  ? 3.519   -22.084 -58.577 1.00 34.28 ? 13  DA  T N6    1 
ATOM   6122  N  N1    . DA  C 3 13  ? 3.974   -19.832 -58.780 1.00 27.45 ? 13  DA  T N1    1 
ATOM   6123  C  C2    . DA  C 3 13  ? 3.819   -18.671 -59.420 1.00 32.71 ? 13  DA  T C2    1 
ATOM   6124  N  N3    . DA  C 3 13  ? 3.107   -18.421 -60.525 1.00 31.18 ? 13  DA  T N3    1 
ATOM   6125  C  C4    . DA  C 3 13  ? 2.513   -19.546 -60.948 1.00 31.59 ? 13  DA  T C4    1 
ATOM   6126  P  P     . DG  C 3 14  ? 1.656   -16.282 -66.143 1.00 51.88 ? 14  DG  T P     1 
ATOM   6127  O  OP1   . DG  C 3 14  ? 1.001   -15.202 -66.904 1.00 55.28 ? 14  DG  T OP1   1 
ATOM   6128  O  OP2   . DG  C 3 14  ? 2.064   -17.564 -66.756 1.00 45.47 ? 14  DG  T OP2   1 
ATOM   6129  O  "O5'" . DG  C 3 14  ? 3.029   -15.794 -65.510 1.00 41.41 ? 14  DG  T "O5'" 1 
ATOM   6130  C  "C5'" . DG  C 3 14  ? 3.131   -14.974 -64.377 1.00 42.12 ? 14  DG  T "C5'" 1 
ATOM   6131  C  "C4'" . DG  C 3 14  ? 4.587   -15.007 -63.942 1.00 45.35 ? 14  DG  T "C4'" 1 
ATOM   6132  O  "O4'" . DG  C 3 14  ? 4.828   -16.151 -63.094 1.00 39.81 ? 14  DG  T "O4'" 1 
ATOM   6133  C  "C3'" . DG  C 3 14  ? 5.609   -15.118 -65.073 1.00 42.16 ? 14  DG  T "C3'" 1 
ATOM   6134  O  "O3'" . DG  C 3 14  ? 6.611   -14.153 -64.840 1.00 39.33 ? 14  DG  T "O3'" 1 
ATOM   6135  C  "C2'" . DG  C 3 14  ? 6.184   -16.529 -64.929 1.00 36.79 ? 14  DG  T "C2'" 1 
ATOM   6136  C  "C1'" . DG  C 3 14  ? 6.043   -16.766 -63.428 1.00 35.88 ? 14  DG  T "C1'" 1 
ATOM   6137  N  N9    . DG  C 3 14  ? 5.836   -18.158 -63.045 1.00 32.78 ? 14  DG  T N9    1 
ATOM   6138  C  C8    . DG  C 3 14  ? 4.925   -19.025 -63.591 1.00 29.21 ? 14  DG  T C8    1 
ATOM   6139  N  N7    . DG  C 3 14  ? 4.944   -20.211 -63.044 1.00 25.75 ? 14  DG  T N7    1 
ATOM   6140  C  C5    . DG  C 3 14  ? 5.913   -20.115 -62.052 1.00 30.82 ? 14  DG  T C5    1 
ATOM   6141  C  C6    . DG  C 3 14  ? 6.376   -21.078 -61.120 1.00 31.06 ? 14  DG  T C6    1 
ATOM   6142  O  O6    . DG  C 3 14  ? 6.009   -22.257 -60.976 1.00 36.10 ? 14  DG  T O6    1 
ATOM   6143  N  N1    . DG  C 3 14  ? 7.365   -20.560 -60.285 1.00 26.81 ? 14  DG  T N1    1 
ATOM   6144  C  C2    . DG  C 3 14  ? 7.871   -19.282 -60.347 1.00 32.85 ? 14  DG  T C2    1 
ATOM   6145  N  N2    . DG  C 3 14  ? 8.840   -18.983 -59.470 1.00 34.11 ? 14  DG  T N2    1 
ATOM   6146  N  N3    . DG  C 3 14  ? 7.440   -18.370 -61.212 1.00 36.96 ? 14  DG  T N3    1 
ATOM   6147  C  C4    . DG  C 3 14  ? 6.470   -18.849 -62.032 1.00 30.65 ? 14  DG  T C4    1 
ATOM   6148  P  P     . DT  C 3 15  ? 7.791   -13.935 -65.913 1.00 48.06 ? 15  DT  T P     1 
ATOM   6149  O  OP1   . DT  C 3 15  ? 8.101   -12.489 -65.955 1.00 50.93 ? 15  DT  T OP1   1 
ATOM   6150  O  OP2   . DT  C 3 15  ? 7.439   -14.694 -67.131 1.00 42.67 ? 15  DT  T OP2   1 
ATOM   6151  O  "O5'" . DT  C 3 15  ? 9.030   -14.666 -65.258 1.00 35.70 ? 15  DT  T "O5'" 1 
ATOM   6152  C  "C5'" . DT  C 3 15  ? 9.497   -14.175 -64.032 1.00 40.72 ? 15  DT  T "C5'" 1 
ATOM   6153  C  "C4'" . DT  C 3 15  ? 10.497  -15.148 -63.446 1.00 47.64 ? 15  DT  T "C4'" 1 
ATOM   6154  O  "O4'" . DT  C 3 15  ? 9.894   -16.447 -63.249 1.00 38.56 ? 15  DT  T "O4'" 1 
ATOM   6155  C  "C3'" . DT  C 3 15  ? 11.714  -15.415 -64.330 1.00 45.58 ? 15  DT  T "C3'" 1 
ATOM   6156  O  "O3'" . DT  C 3 15  ? 12.869  -14.925 -63.660 1.00 60.06 ? 15  DT  T "O3'" 1 
ATOM   6157  C  "C2'" . DT  C 3 15  ? 11.748  -16.937 -64.494 1.00 43.38 ? 15  DT  T "C2'" 1 
ATOM   6158  C  "C1'" . DT  C 3 15  ? 10.947  -17.391 -63.273 1.00 39.78 ? 15  DT  T "C1'" 1 
ATOM   6159  N  N1    . DT  C 3 15  ? 10.277  -18.712 -63.369 1.00 36.95 ? 15  DT  T N1    1 
ATOM   6160  C  C2    . DT  C 3 15  ? 10.576  -19.727 -62.477 1.00 31.92 ? 15  DT  T C2    1 
ATOM   6161  O  O2    . DT  C 3 15  ? 11.396  -19.638 -61.582 1.00 36.24 ? 15  DT  T O2    1 
ATOM   6162  N  N3    . DT  C 3 15  ? 9.869   -20.888 -62.671 1.00 28.99 ? 15  DT  T N3    1 
ATOM   6163  C  C4    . DT  C 3 15  ? 8.917   -21.128 -63.623 1.00 29.51 ? 15  DT  T C4    1 
ATOM   6164  O  O4    . DT  C 3 15  ? 8.322   -22.210 -63.707 1.00 32.82 ? 15  DT  T O4    1 
ATOM   6165  C  C5    . DT  C 3 15  ? 8.660   -20.030 -64.525 1.00 32.40 ? 15  DT  T C5    1 
ATOM   6166  C  C7    . DT  C 3 15  ? 7.638   -20.193 -65.598 1.00 40.93 ? 15  DT  T C7    1 
ATOM   6167  C  C6    . DT  C 3 15  ? 9.331   -18.885 -64.362 1.00 31.13 ? 15  DT  T C6    1 
ATOM   6168  P  P     . DG  C 3 16  ? 14.241  -14.710 -64.472 1.00 67.78 ? 16  DG  T P     1 
ATOM   6169  O  OP1   . DG  C 3 16  ? 14.933  -13.537 -63.882 1.00 57.09 ? 16  DG  T OP1   1 
ATOM   6170  O  OP2   . DG  C 3 16  ? 13.946  -14.871 -65.920 1.00 38.08 ? 16  DG  T OP2   1 
ATOM   6171  O  "O5'" . DG  C 3 16  ? 15.092  -15.991 -64.096 1.00 45.33 ? 16  DG  T "O5'" 1 
ATOM   6172  C  "C5'" . DG  C 3 16  ? 15.293  -16.240 -62.751 1.00 41.15 ? 16  DG  T "C5'" 1 
ATOM   6173  C  "C4'" . DG  C 3 16  ? 15.893  -17.610 -62.668 1.00 46.54 ? 16  DG  T "C4'" 1 
ATOM   6174  O  "O4'" . DG  C 3 16  ? 14.838  -18.572 -62.873 1.00 36.96 ? 16  DG  T "O4'" 1 
ATOM   6175  C  "C3'" . DG  C 3 16  ? 16.968  -17.866 -63.724 1.00 37.25 ? 16  DG  T "C3'" 1 
ATOM   6176  O  "O3'" . DG  C 3 16  ? 18.156  -18.027 -62.977 1.00 42.30 ? 16  DG  T "O3'" 1 
ATOM   6177  C  "C2'" . DG  C 3 16  ? 16.468  -19.115 -64.448 1.00 35.61 ? 16  DG  T "C2'" 1 
ATOM   6178  C  "C1'" . DG  C 3 16  ? 15.441  -19.694 -63.472 1.00 33.14 ? 16  DG  T "C1'" 1 
ATOM   6179  N  N9    . DG  C 3 16  ? 14.303  -20.363 -64.047 1.00 32.59 ? 16  DG  T N9    1 
ATOM   6180  C  C8    . DG  C 3 16  ? 13.443  -19.857 -64.992 1.00 28.70 ? 16  DG  T C8    1 
ATOM   6181  N  N7    . DG  C 3 16  ? 12.480  -20.677 -65.299 1.00 32.90 ? 16  DG  T N7    1 
ATOM   6182  C  C5    . DG  C 3 16  ? 12.729  -21.784 -64.504 1.00 29.47 ? 16  DG  T C5    1 
ATOM   6183  C  C6    . DG  C 3 16  ? 12.028  -22.996 -64.389 1.00 27.85 ? 16  DG  T C6    1 
ATOM   6184  O  O6    . DG  C 3 16  ? 11.043  -23.343 -64.998 1.00 27.15 ? 16  DG  T O6    1 
ATOM   6185  N  N1    . DG  C 3 16  ? 12.594  -23.861 -63.461 1.00 31.06 ? 16  DG  T N1    1 
ATOM   6186  C  C2    . DG  C 3 16  ? 13.713  -23.577 -62.734 1.00 27.63 ? 16  DG  T C2    1 
ATOM   6187  N  N2    . DG  C 3 16  ? 14.131  -24.530 -61.886 1.00 30.22 ? 16  DG  T N2    1 
ATOM   6188  N  N3    . DG  C 3 16  ? 14.389  -22.443 -62.813 1.00 34.14 ? 16  DG  T N3    1 
ATOM   6189  C  C4    . DG  C 3 16  ? 13.836  -21.602 -63.716 1.00 36.19 ? 16  DG  T C4    1 
ATOM   6190  P  P     . DC  C 3 17  ? 19.533  -18.426 -63.696 1.00 49.77 ? 17  DC  T P     1 
ATOM   6191  O  OP1   . DC  C 3 17  ? 20.627  -18.185 -62.731 1.00 50.77 ? 17  DC  T OP1   1 
ATOM   6192  O  OP2   . DC  C 3 17  ? 19.580  -17.749 -65.022 1.00 42.48 ? 17  DC  T OP2   1 
ATOM   6193  O  "O5'" . DC  C 3 17  ? 19.402  -19.997 -63.890 1.00 46.39 ? 17  DC  T "O5'" 1 
ATOM   6194  C  "C5'" . DC  C 3 17  ? 19.220  -20.754 -62.714 1.00 45.08 ? 17  DC  T "C5'" 1 
ATOM   6195  C  "C4'" . DC  C 3 17  ? 18.929  -22.198 -63.053 1.00 43.26 ? 17  DC  T "C4'" 1 
ATOM   6196  O  "O4'" . DC  C 3 17  ? 17.627  -22.334 -63.650 1.00 45.38 ? 17  DC  T "O4'" 1 
ATOM   6197  C  "C3'" . DC  C 3 17  ? 19.909  -22.786 -64.059 1.00 44.31 ? 17  DC  T "C3'" 1 
ATOM   6198  O  "O3'" . DC  C 3 17  ? 20.869  -23.501 -63.280 1.00 43.09 ? 17  DC  T "O3'" 1 
ATOM   6199  C  "C2'" . DC  C 3 17  ? 19.037  -23.646 -64.986 1.00 36.26 ? 17  DC  T "C2'" 1 
ATOM   6200  C  "C1'" . DC  C 3 17  ? 17.603  -23.500 -64.454 1.00 36.08 ? 17  DC  T "C1'" 1 
ATOM   6201  N  N1    . DC  C 3 17  ? 16.513  -23.313 -65.468 1.00 34.32 ? 17  DC  T N1    1 
ATOM   6202  C  C2    . DC  C 3 17  ? 15.563  -24.312 -65.630 1.00 30.09 ? 17  DC  T C2    1 
ATOM   6203  O  O2    . DC  C 3 17  ? 15.676  -25.316 -64.925 1.00 36.18 ? 17  DC  T O2    1 
ATOM   6204  N  N3    . DC  C 3 17  ? 14.548  -24.163 -66.529 1.00 32.37 ? 17  DC  T N3    1 
ATOM   6205  C  C4    . DC  C 3 17  ? 14.488  -23.051 -67.262 1.00 32.78 ? 17  DC  T C4    1 
ATOM   6206  N  N4    . DC  C 3 17  ? 13.485  -22.937 -68.125 1.00 31.13 ? 17  DC  T N4    1 
ATOM   6207  C  C5    . DC  C 3 17  ? 15.463  -22.010 -67.121 1.00 35.12 ? 17  DC  T C5    1 
ATOM   6208  C  C6    . DC  C 3 17  ? 16.430  -22.177 -66.220 1.00 32.88 ? 17  DC  T C6    1 
ATOM   6209  P  P     . DC  C 3 18  ? 22.256  -23.982 -63.930 1.00 53.70 ? 18  DC  T P     1 
ATOM   6210  O  OP1   . DC  C 3 18  ? 23.175  -24.324 -62.834 1.00 43.45 ? 18  DC  T OP1   1 
ATOM   6211  O  OP2   . DC  C 3 18  ? 22.649  -22.992 -64.970 1.00 46.74 ? 18  DC  T OP2   1 
ATOM   6212  O  "O5'" . DC  C 3 18  ? 21.878  -25.368 -64.615 1.00 44.95 ? 18  DC  T "O5'" 1 
ATOM   6213  C  "C5'" . DC  C 3 18  ? 21.824  -26.513 -63.803 1.00 40.19 ? 18  DC  T "C5'" 1 
ATOM   6214  C  "C4'" . DC  C 3 18  ? 21.334  -27.631 -64.682 1.00 38.66 ? 18  DC  T "C4'" 1 
ATOM   6215  O  "O4'" . DC  C 3 18  ? 19.989  -27.297 -65.068 1.00 32.06 ? 18  DC  T "O4'" 1 
ATOM   6216  C  "C3'" . DC  C 3 18  ? 22.081  -27.715 -66.007 1.00 31.96 ? 18  DC  T "C3'" 1 
ATOM   6217  O  "O3'" . DC  C 3 18  ? 23.296  -28.469 -65.853 1.00 34.97 ? 18  DC  T "O3'" 1 
ATOM   6218  C  "C2'" . DC  C 3 18  ? 21.053  -28.409 -66.903 1.00 24.40 ? 18  DC  T "C2'" 1 
ATOM   6219  C  "C1'" . DC  C 3 18  ? 19.713  -28.017 -66.264 1.00 40.99 ? 18  DC  T "C1'" 1 
ATOM   6220  N  N1    . DC  C 3 18  ? 18.881  -27.109 -67.086 1.00 30.69 ? 18  DC  T N1    1 
ATOM   6221  C  C2    . DC  C 3 18  ? 17.594  -27.510 -67.430 1.00 27.64 ? 18  DC  T C2    1 
ATOM   6222  O  O2    . DC  C 3 18  ? 17.156  -28.627 -67.083 1.00 29.52 ? 18  DC  T O2    1 
ATOM   6223  N  N3    . DC  C 3 18  ? 16.849  -26.666 -68.164 1.00 24.78 ? 18  DC  T N3    1 
ATOM   6224  C  C4    . DC  C 3 18  ? 17.334  -25.491 -68.539 1.00 26.56 ? 18  DC  T C4    1 
ATOM   6225  N  N4    . DC  C 3 18  ? 16.525  -24.731 -69.266 1.00 24.69 ? 18  DC  T N4    1 
ATOM   6226  C  C5    . DC  C 3 18  ? 18.648  -25.061 -68.199 1.00 30.51 ? 18  DC  T C5    1 
ATOM   6227  C  C6    . DC  C 3 18  ? 19.395  -25.903 -67.466 1.00 31.56 ? 18  DC  T C6    1 
ATOM   6228  N  N     . MET D 1 1   ? 9.937   -0.655  7.129   1.00 53.44 ? 1   MET B N     1 
ATOM   6229  C  CA    . MET D 1 1   ? 9.761   -1.313  8.452   1.00 46.80 ? 1   MET B CA    1 
ATOM   6230  C  C     . MET D 1 1   ? 11.128  -1.695  9.031   1.00 35.40 ? 1   MET B C     1 
ATOM   6231  O  O     . MET D 1 1   ? 12.144  -1.640  8.339   1.00 31.28 ? 1   MET B O     1 
ATOM   6232  C  CB    . MET D 1 1   ? 8.859   -2.554  8.314   1.00 48.42 ? 1   MET B CB    1 
ATOM   6233  C  CG    . MET D 1 1   ? 9.456   -3.715  7.515   1.00 51.61 ? 1   MET B CG    1 
ATOM   6234  S  SD    . MET D 1 1   ? 8.409   -5.202  7.408   1.00 61.65 ? 1   MET B SD    1 
ATOM   6235  C  CE    . MET D 1 1   ? 7.632   -4.951  5.808   1.00 55.77 ? 1   MET B CE    1 
ATOM   6236  H  H1    . MET D 1 1   ? 9.077   -0.423  6.771   1.00 64.07 ? 1   MET B H1    1 
ATOM   6237  H  H2    . MET D 1 1   ? 10.465  0.139   7.235   1.00 64.07 ? 1   MET B H2    1 
ATOM   6238  H  H3    . MET D 1 1   ? 10.381  -1.258  6.528   1.00 64.07 ? 1   MET B H3    1 
ATOM   6239  H  HA    . MET D 1 1   ? 9.321   -0.686  9.063   1.00 56.10 ? 1   MET B HA    1 
ATOM   6240  H  HB2   . MET D 1 1   ? 8.657   -2.887  9.203   1.00 58.05 ? 1   MET B HB2   1 
ATOM   6241  H  HB3   . MET D 1 1   ? 8.037   -2.289  7.873   1.00 58.05 ? 1   MET B HB3   1 
ATOM   6242  H  HG2   . MET D 1 1   ? 9.624   -3.411  6.609   1.00 61.87 ? 1   MET B HG2   1 
ATOM   6243  H  HG3   . MET D 1 1   ? 10.293  -3.977  7.929   1.00 61.87 ? 1   MET B HG3   1 
ATOM   6244  H  HE1   . MET D 1 1   ? 7.041   -5.686  5.629   1.00 66.86 ? 1   MET B HE1   1 
ATOM   6245  H  HE2   . MET D 1 1   ? 7.137   -4.129  5.827   1.00 66.86 ? 1   MET B HE2   1 
ATOM   6246  H  HE3   . MET D 1 1   ? 8.314   -4.907  5.133   1.00 66.86 ? 1   MET B HE3   1 
ATOM   6247  N  N     . ILE D 1 2   ? 11.155  -2.035  10.317  1.00 34.32 ? 2   ILE B N     1 
ATOM   6248  C  CA    A ILE D 1 2   ? 12.357  -2.562  10.941  0.13 31.90 ? 2   ILE B CA    1 
ATOM   6249  C  CA    B ILE D 1 2   ? 12.364  -2.561  10.935  0.87 31.44 ? 2   ILE B CA    1 
ATOM   6250  C  C     . ILE D 1 2   ? 12.065  -3.968  11.435  1.00 33.24 ? 2   ILE B C     1 
ATOM   6251  O  O     . ILE D 1 2   ? 11.174  -4.163  12.261  1.00 29.23 ? 2   ILE B O     1 
ATOM   6252  C  CB    A ILE D 1 2   ? 12.788  -1.711  12.150  0.13 35.94 ? 2   ILE B CB    1 
ATOM   6253  C  CB    B ILE D 1 2   ? 12.878  -1.657  12.067  0.87 35.68 ? 2   ILE B CB    1 
ATOM   6254  C  CG1   A ILE D 1 2   ? 12.725  -0.219  11.815  0.13 40.98 ? 2   ILE B CG1   1 
ATOM   6255  C  CG1   B ILE D 1 2   ? 13.132  -0.251  11.531  0.87 40.18 ? 2   ILE B CG1   1 
ATOM   6256  C  CG2   A ILE D 1 2   ? 14.184  -2.110  12.611  0.13 36.40 ? 2   ILE B CG2   1 
ATOM   6257  C  CG2   B ILE D 1 2   ? 14.174  -2.195  12.638  0.87 36.33 ? 2   ILE B CG2   1 
ATOM   6258  C  CD1   A ILE D 1 2   ? 13.825  0.242   10.905  0.13 41.63 ? 2   ILE B CD1   1 
ATOM   6259  C  CD1   B ILE D 1 2   ? 13.549  0.746   12.593  0.87 41.78 ? 2   ILE B CD1   1 
ATOM   6260  H  H     . ILE D 1 2   ? 10.485  -1.970  10.851  1.00 41.12 ? 2   ILE B H     1 
ATOM   6261  H  HA    . ILE D 1 2   ? 13.079  -2.610  10.273  0.87 37.67 ? 2   ILE B HA    1 
ATOM   6262  H  HB    A ILE D 1 2   ? 12.169  -1.884  12.877  0.13 43.07 ? 2   ILE B HB    1 
ATOM   6263  H  HB    B ILE D 1 2   ? 12.211  -1.615  12.771  0.87 42.75 ? 2   ILE B HB    1 
ATOM   6264  H  HG12  A ILE D 1 2   ? 11.880  -0.032  11.378  0.13 49.12 ? 2   ILE B HG12  1 
ATOM   6265  H  HG12  B ILE D 1 2   ? 13.841  -0.293  10.870  0.87 48.16 ? 2   ILE B HG12  1 
ATOM   6266  H  HG13  A ILE D 1 2   ? 12.789  0.289   12.639  0.13 49.12 ? 2   ILE B HG13  1 
ATOM   6267  H  HG13  B ILE D 1 2   ? 12.318  0.078   11.120  0.87 48.16 ? 2   ILE B HG13  1 
ATOM   6268  H  HG21  A ILE D 1 2   ? 14.177  -3.036  12.862  0.13 43.62 ? 2   ILE B HG21  1 
ATOM   6269  H  HG21  B ILE D 1 2   ? 14.832  -2.229  11.940  0.87 43.53 ? 2   ILE B HG21  1 
ATOM   6270  H  HG22  A ILE D 1 2   ? 14.802  -1.970  11.890  0.13 43.62 ? 2   ILE B HG22  1 
ATOM   6271  H  HG22  B ILE D 1 2   ? 14.471  -1.613  13.341  0.87 43.53 ? 2   ILE B HG22  1 
ATOM   6272  H  HG23  A ILE D 1 2   ? 14.430  -1.568  13.364  0.13 43.62 ? 2   ILE B HG23  1 
ATOM   6273  H  HG23  B ILE D 1 2   ? 14.020  -3.077  12.985  0.87 43.53 ? 2   ILE B HG23  1 
ATOM   6274  H  HD11  A ILE D 1 2   ? 13.770  -0.243  10.079  0.13 49.89 ? 2   ILE B HD11  1 
ATOM   6275  H  HD11  B ILE D 1 2   ? 13.690  1.601   12.180  0.87 50.08 ? 2   ILE B HD11  1 
ATOM   6276  H  HD12  A ILE D 1 2   ? 13.721  1.182   10.741  0.13 49.89 ? 2   ILE B HD12  1 
ATOM   6277  H  HD12  B ILE D 1 2   ? 12.853  0.810   13.251  0.87 50.08 ? 2   ILE B HD12  1 
ATOM   6278  H  HD13  A ILE D 1 2   ? 14.671  0.075   11.328  0.13 49.89 ? 2   ILE B HD13  1 
ATOM   6279  H  HD13  B ILE D 1 2   ? 14.362  0.443   13.004  0.87 50.08 ? 2   ILE B HD13  1 
ATOM   6280  N  N     . VAL D 1 3   ? 12.802  -4.942  10.909  1.00 28.89 ? 3   VAL B N     1 
ATOM   6281  C  CA    . VAL D 1 3   ? 12.608  -6.327  11.293  1.00 34.28 ? 3   VAL B CA    1 
ATOM   6282  C  C     . VAL D 1 3   ? 13.776  -6.878  12.107  1.00 26.89 ? 3   VAL B C     1 
ATOM   6283  O  O     . VAL D 1 3   ? 14.926  -6.672  11.772  1.00 22.98 ? 3   VAL B O     1 
ATOM   6284  C  CB    . VAL D 1 3   ? 12.481  -7.247  10.070  1.00 27.25 ? 3   VAL B CB    1 
ATOM   6285  C  CG1   . VAL D 1 3   ? 12.272  -8.697  10.554  1.00 26.97 ? 3   VAL B CG1   1 
ATOM   6286  C  CG2   . VAL D 1 3   ? 11.345  -6.812  9.177   1.00 31.97 ? 3   VAL B CG2   1 
ATOM   6287  H  H     . VAL D 1 3   ? 13.422  -4.821  10.325  1.00 34.61 ? 3   VAL B H     1 
ATOM   6288  H  HA    . VAL D 1 3   ? 11.791  -6.406  11.828  1.00 41.07 ? 3   VAL B HA    1 
ATOM   6289  H  HB    . VAL D 1 3   ? 13.311  -7.212  9.550   1.00 32.64 ? 3   VAL B HB    1 
ATOM   6290  H  HG11  . VAL D 1 3   ? 12.193  -9.273  9.790   1.00 32.30 ? 3   VAL B HG11  1 
ATOM   6291  H  HG12  . VAL D 1 3   ? 13.027  -8.960  11.086  1.00 32.30 ? 3   VAL B HG12  1 
ATOM   6292  H  HG13  . VAL D 1 3   ? 11.470  -8.738  11.080  1.00 32.30 ? 3   VAL B HG13  1 
ATOM   6293  H  HG21  . VAL D 1 3   ? 11.294  -7.406  8.425   1.00 38.31 ? 3   VAL B HG21  1 
ATOM   6294  H  HG22  . VAL D 1 3   ? 10.526  -6.844  9.677   1.00 38.31 ? 3   VAL B HG22  1 
ATOM   6295  H  HG23  . VAL D 1 3   ? 11.510  -5.915  8.876   1.00 38.31 ? 3   VAL B HG23  1 
ATOM   6296  N  N     . ILE D 1 4   ? 13.469  -7.619  13.166  1.00 23.90 ? 4   ILE B N     1 
ATOM   6297  C  CA    . ILE D 1 4   ? 14.488  -8.390  13.886  1.00 22.39 ? 4   ILE B CA    1 
ATOM   6298  C  C     . ILE D 1 4   ? 14.118  -9.851  13.739  1.00 17.67 ? 4   ILE B C     1 
ATOM   6299  O  O     . ILE D 1 4   ? 13.008  -10.247 14.125  1.00 21.88 ? 4   ILE B O     1 
ATOM   6300  C  CB    . ILE D 1 4   ? 14.534  -8.041  15.395  1.00 26.84 ? 4   ILE B CB    1 
ATOM   6301  C  CG1   . ILE D 1 4   ? 14.883  -6.567  15.600  1.00 24.21 ? 4   ILE B CG1   1 
ATOM   6302  C  CG2   . ILE D 1 4   ? 15.594  -8.873  16.107  1.00 25.01 ? 4   ILE B CG2   1 
ATOM   6303  C  CD1   . ILE D 1 4   ? 14.768  -6.095  17.042  1.00 32.18 ? 4   ILE B CD1   1 
ATOM   6304  H  H     . ILE D 1 4   ? 12.676  -7.696  13.491  1.00 28.62 ? 4   ILE B H     1 
ATOM   6305  H  HA    . ILE D 1 4   ? 15.372  -8.238  13.491  1.00 26.81 ? 4   ILE B HA    1 
ATOM   6306  H  HB    . ILE D 1 4   ? 13.667  -8.222  15.791  1.00 32.15 ? 4   ILE B HB    1 
ATOM   6307  H  HG12  . ILE D 1 4   ? 15.798  -6.422  15.314  1.00 29.00 ? 4   ILE B HG12  1 
ATOM   6308  H  HG13  . ILE D 1 4   ? 14.282  -6.027  15.064  1.00 29.00 ? 4   ILE B HG13  1 
ATOM   6309  H  HG21  . ILE D 1 4   ? 16.451  -8.689  15.714  1.00 29.95 ? 4   ILE B HG21  1 
ATOM   6310  H  HG22  . ILE D 1 4   ? 15.602  -8.638  17.037  1.00 29.95 ? 4   ILE B HG22  1 
ATOM   6311  H  HG23  . ILE D 1 4   ? 15.380  -9.804  16.005  1.00 29.95 ? 4   ILE B HG23  1 
ATOM   6312  H  HD11  . ILE D 1 4   ? 15.003  -5.165  17.085  1.00 38.56 ? 4   ILE B HD11  1 
ATOM   6313  H  HD12  . ILE D 1 4   ? 13.864  -6.219  17.340  1.00 38.56 ? 4   ILE B HD12  1 
ATOM   6314  H  HD13  . ILE D 1 4   ? 15.367  -6.610  17.588  1.00 38.56 ? 4   ILE B HD13  1 
ATOM   6315  N  N     . PHE D 1 5   ? 15.023  -10.635 13.144  1.00 20.85 ? 5   PHE B N     1 
ATOM   6316  C  CA    . PHE D 1 5   ? 14.836  -12.070 12.995  1.00 24.17 ? 5   PHE B CA    1 
ATOM   6317  C  C     . PHE D 1 5   ? 15.708  -12.741 14.038  1.00 21.77 ? 5   PHE B C     1 
ATOM   6318  O  O     . PHE D 1 5   ? 16.848  -12.321 14.269  1.00 20.43 ? 5   PHE B O     1 
ATOM   6319  C  CB    . PHE D 1 5   ? 15.224  -12.514 11.578  1.00 21.18 ? 5   PHE B CB    1 
ATOM   6320  C  CG    . PHE D 1 5   ? 15.303  -14.012 11.389  1.00 17.53 ? 5   PHE B CG    1 
ATOM   6321  C  CD1   . PHE D 1 5   ? 14.145  -14.784 11.309  1.00 19.85 ? 5   PHE B CD1   1 
ATOM   6322  C  CD2   . PHE D 1 5   ? 16.531  -14.642 11.256  1.00 19.63 ? 5   PHE B CD2   1 
ATOM   6323  C  CE1   . PHE D 1 5   ? 14.230  -16.148 11.119  1.00 21.62 ? 5   PHE B CE1   1 
ATOM   6324  C  CE2   . PHE D 1 5   ? 16.619  -16.002 11.066  1.00 22.97 ? 5   PHE B CE2   1 
ATOM   6325  C  CZ    . PHE D 1 5   ? 15.460  -16.759 10.996  1.00 25.61 ? 5   PHE B CZ    1 
ATOM   6326  H  H     . PHE D 1 5   ? 15.763  -10.348 12.814  1.00 24.96 ? 5   PHE B H     1 
ATOM   6327  H  HA    . PHE D 1 5   ? 13.899  -12.307 13.160  1.00 28.94 ? 5   PHE B HA    1 
ATOM   6328  H  HB2   . PHE D 1 5   ? 14.563  -12.174 10.954  1.00 25.35 ? 5   PHE B HB2   1 
ATOM   6329  H  HB3   . PHE D 1 5   ? 16.095  -12.144 11.365  1.00 25.35 ? 5   PHE B HB3   1 
ATOM   6330  H  HD1   . PHE D 1 5   ? 13.312  -14.378 11.390  1.00 23.75 ? 5   PHE B HD1   1 
ATOM   6331  H  HD2   . PHE D 1 5   ? 17.310  -14.136 11.301  1.00 23.49 ? 5   PHE B HD2   1 
ATOM   6332  H  HE1   . PHE D 1 5   ? 13.454  -16.658 11.073  1.00 25.88 ? 5   PHE B HE1   1 
ATOM   6333  H  HE2   . PHE D 1 5   ? 17.451  -16.410 10.985  1.00 27.50 ? 5   PHE B HE2   1 
ATOM   6334  H  HZ    . PHE D 1 5   ? 15.512  -17.679 10.871  1.00 30.68 ? 5   PHE B HZ    1 
ATOM   6335  N  N     . VAL D 1 6   ? 15.174  -13.786 14.667  1.00 17.36 ? 6   VAL B N     1 
ATOM   6336  C  CA    . VAL D 1 6   ? 15.893  -14.506 15.707  1.00 17.77 ? 6   VAL B CA    1 
ATOM   6337  C  C     . VAL D 1 6   ? 15.869  -16.009 15.391  1.00 18.28 ? 6   VAL B C     1 
ATOM   6338  O  O     . VAL D 1 6   ? 14.803  -16.584 15.117  1.00 18.92 ? 6   VAL B O     1 
ATOM   6339  C  CB    . VAL D 1 6   ? 15.238  -14.293 17.100  1.00 20.44 ? 6   VAL B CB    1 
ATOM   6340  C  CG1   . VAL D 1 6   ? 16.073  -14.939 18.179  1.00 17.29 ? 6   VAL B CG1   1 
ATOM   6341  C  CG2   . VAL D 1 6   ? 15.025  -12.811 17.376  1.00 18.46 ? 6   VAL B CG2   1 
ATOM   6342  H  H     . VAL D 1 6   ? 14.390  -14.099 14.505  1.00 20.77 ? 6   VAL B H     1 
ATOM   6343  H  HA    . VAL D 1 6   ? 16.824  -14.202 15.743  1.00 21.26 ? 6   VAL B HA    1 
ATOM   6344  H  HB    . VAL D 1 6   ? 14.359  -14.726 17.103  1.00 24.46 ? 6   VAL B HB    1 
ATOM   6345  H  HG11  . VAL D 1 6   ? 16.841  -15.350 17.775  1.00 20.69 ? 6   VAL B HG11  1 
ATOM   6346  H  HG12  . VAL D 1 6   ? 16.353  -14.265 18.803  1.00 20.69 ? 6   VAL B HG12  1 
ATOM   6347  H  HG13  . VAL D 1 6   ? 15.544  -15.603 18.627  1.00 20.69 ? 6   VAL B HG13  1 
ATOM   6348  H  HG21  . VAL D 1 6   ? 14.621  -12.709 18.240  1.00 22.10 ? 6   VAL B HG21  1 
ATOM   6349  H  HG22  . VAL D 1 6   ? 15.875  -12.364 17.357  1.00 22.10 ? 6   VAL B HG22  1 
ATOM   6350  H  HG23  . VAL D 1 6   ? 14.449  -12.447 16.699  1.00 22.10 ? 6   VAL B HG23  1 
ATOM   6351  N  N     . ASP D 1 7   ? 17.033  -16.632 15.464  1.00 17.39 ? 7   ASP B N     1 
ATOM   6352  C  CA    . ASP D 1 7   ? 17.183  -18.048 15.125  1.00 18.23 ? 7   ASP B CA    1 
ATOM   6353  C  C     . ASP D 1 7   ? 18.056  -18.685 16.213  1.00 17.58 ? 7   ASP B C     1 
ATOM   6354  O  O     . ASP D 1 7   ? 19.201  -18.278 16.412  1.00 19.53 ? 7   ASP B O     1 
ATOM   6355  C  CB    . ASP D 1 7   ? 17.818  -18.156 13.745  1.00 21.61 ? 7   ASP B CB    1 
ATOM   6356  C  CG    . ASP D 1 7   ? 17.824  -19.574 13.204  1.00 29.08 ? 7   ASP B CG    1 
ATOM   6357  O  OD1   . ASP D 1 7   ? 18.124  -20.490 13.953  1.00 27.69 ? 7   ASP B OD1   1 
ATOM   6358  O  OD2   . ASP D 1 7   ? 17.558  -19.762 12.008  1.00 32.68 ? 7   ASP B OD2   1 
ATOM   6359  H  H     . ASP D 1 7   ? 17.765  -16.256 15.711  1.00 20.81 ? 7   ASP B H     1 
ATOM   6360  H  HA    . ASP D 1 7   ? 16.307  -18.489 15.113  1.00 21.81 ? 7   ASP B HA    1 
ATOM   6361  H  HB2   . ASP D 1 7   ? 17.320  -17.601 13.125  1.00 25.87 ? 7   ASP B HB2   1 
ATOM   6362  H  HB3   . ASP D 1 7   ? 18.737  -17.852 13.797  1.00 25.87 ? 7   ASP B HB3   1 
ATOM   6363  N  N     . PHE D 1 8   ? 17.521  -19.655 16.959  1.00 17.26 ? 8   PHE B N     1 
ATOM   6364  C  CA    . PHE D 1 8   ? 18.231  -20.125 18.137  1.00 13.98 ? 8   PHE B CA    1 
ATOM   6365  C  C     . PHE D 1 8   ? 19.434  -20.986 17.693  1.00 17.09 ? 8   PHE B C     1 
ATOM   6366  O  O     . PHE D 1 8   ? 19.312  -21.791 16.785  1.00 18.67 ? 8   PHE B O     1 
ATOM   6367  C  CB    . PHE D 1 8   ? 17.322  -20.956 19.062  1.00 18.82 ? 8   PHE B CB    1 
ATOM   6368  C  CG    . PHE D 1 8   ? 16.022  -20.305 19.417  1.00 16.55 ? 8   PHE B CG    1 
ATOM   6369  C  CD1   . PHE D 1 8   ? 14.935  -21.084 19.772  1.00 13.60 ? 8   PHE B CD1   1 
ATOM   6370  C  CD2   . PHE D 1 8   ? 15.870  -18.931 19.386  1.00 15.29 ? 8   PHE B CD2   1 
ATOM   6371  C  CE1   . PHE D 1 8   ? 13.713  -20.498 20.082  1.00 20.30 ? 8   PHE B CE1   1 
ATOM   6372  C  CE2   . PHE D 1 8   ? 14.640  -18.343 19.703  1.00 16.90 ? 8   PHE B CE2   1 
ATOM   6373  C  CZ    . PHE D 1 8   ? 13.578  -19.118 20.047  1.00 16.68 ? 8   PHE B CZ    1 
ATOM   6374  H  H     . PHE D 1 8   ? 16.771  -20.045 16.805  1.00 20.66 ? 8   PHE B H     1 
ATOM   6375  H  HA    . PHE D 1 8   ? 18.569  -19.357 18.643  1.00 16.71 ? 8   PHE B HA    1 
ATOM   6376  H  HB2   . PHE D 1 8   ? 17.118  -21.796 18.622  1.00 22.52 ? 8   PHE B HB2   1 
ATOM   6377  H  HB3   . PHE D 1 8   ? 17.798  -21.129 19.890  1.00 22.52 ? 8   PHE B HB3   1 
ATOM   6378  H  HD1   . PHE D 1 8   ? 15.019  -22.010 19.791  1.00 16.25 ? 8   PHE B HD1   1 
ATOM   6379  H  HD2   . PHE D 1 8   ? 16.589  -18.393 19.146  1.00 18.29 ? 8   PHE B HD2   1 
ATOM   6380  H  HE1   . PHE D 1 8   ? 12.989  -21.031 20.322  1.00 24.30 ? 8   PHE B HE1   1 
ATOM   6381  H  HE2   . PHE D 1 8   ? 14.549  -17.418 19.681  1.00 20.22 ? 8   PHE B HE2   1 
ATOM   6382  H  HZ    . PHE D 1 8   ? 12.764  -18.724 20.263  1.00 19.95 ? 8   PHE B HZ    1 
ATOM   6383  N  N     . ASP D 1 9   ? 20.593  -20.856 18.324  1.00 16.59 ? 9   ASP B N     1 
ATOM   6384  C  CA    . ASP D 1 9   ? 21.756  -21.639 17.858  1.00 16.66 ? 9   ASP B CA    1 
ATOM   6385  C  C     . ASP D 1 9   ? 21.659  -23.132 18.203  1.00 16.18 ? 9   ASP B C     1 
ATOM   6386  O  O     . ASP D 1 9   ? 21.300  -23.466 19.321  1.00 15.92 ? 9   ASP B O     1 
ATOM   6387  C  CB    . ASP D 1 9   ? 23.051  -21.087 18.464  1.00 19.26 ? 9   ASP B CB    1 
ATOM   6388  C  CG    . ASP D 1 9   ? 23.354  -19.663 18.022  1.00 23.07 ? 9   ASP B CG    1 
ATOM   6389  O  OD1   . ASP D 1 9   ? 24.023  -18.961 18.800  1.00 29.07 ? 9   ASP B OD1   1 
ATOM   6390  O  OD2   . ASP D 1 9   ? 22.939  -19.249 16.918  1.00 23.41 ? 9   ASP B OD2   1 
ATOM   6391  H  H     . ASP D 1 9   ? 20.740  -20.345 19.000  1.00 19.85 ? 9   ASP B H     1 
ATOM   6392  H  HA    . ASP D 1 9   ? 21.822  -21.559 16.883  1.00 19.93 ? 9   ASP B HA    1 
ATOM   6393  H  HB2   . ASP D 1 9   ? 22.972  -21.091 19.430  1.00 23.05 ? 9   ASP B HB2   1 
ATOM   6394  H  HB3   . ASP D 1 9   ? 23.792  -21.650 18.189  1.00 23.05 ? 9   ASP B HB3   1 
ATOM   6395  N  N     . TYR D 1 10  ? 22.011  -24.009 17.243  1.00 15.91 ? 10  TYR B N     1 
ATOM   6396  C  CA    . TYR D 1 10  ? 22.031  -25.491 17.395  1.00 15.74 ? 10  TYR B CA    1 
ATOM   6397  C  C     . TYR D 1 10  ? 20.993  -25.983 18.384  1.00 13.62 ? 10  TYR B C     1 
ATOM   6398  O  O     . TYR D 1 10  ? 21.307  -26.710 19.352  1.00 12.82 ? 10  TYR B O     1 
ATOM   6399  C  CB    . TYR D 1 10  ? 23.435  -26.062 17.731  1.00 16.40 ? 10  TYR B CB    1 
ATOM   6400  C  CG    . TYR D 1 10  ? 24.112  -25.633 19.051  1.00 15.09 ? 10  TYR B CG    1 
ATOM   6401  C  CD1   . TYR D 1 10  ? 24.338  -26.541 20.056  1.00 17.84 ? 10  TYR B CD1   1 
ATOM   6402  C  CD2   . TYR D 1 10  ? 24.592  -24.338 19.227  1.00 20.42 ? 10  TYR B CD2   1 
ATOM   6403  C  CE1   . TYR D 1 10  ? 24.993  -26.166 21.260  1.00 20.85 ? 10  TYR B CE1   1 
ATOM   6404  C  CE2   . TYR D 1 10  ? 25.223  -23.950 20.411  1.00 21.79 ? 10  TYR B CE2   1 
ATOM   6405  C  CZ    . TYR D 1 10  ? 25.423  -24.868 21.413  1.00 19.89 ? 10  TYR B CZ    1 
ATOM   6406  O  OH    . TYR D 1 10  ? 26.051  -24.486 22.578  1.00 18.63 ? 10  TYR B OH    1 
ATOM   6407  H  H     . TYR D 1 10  ? 22.253  -23.760 16.456  1.00 19.03 ? 10  TYR B H     1 
ATOM   6408  H  HA    . TYR D 1 10  ? 21.783  -25.872 16.527  1.00 18.83 ? 10  TYR B HA    1 
ATOM   6409  H  HB2   . TYR D 1 10  ? 23.363  -27.029 17.754  1.00 19.62 ? 10  TYR B HB2   1 
ATOM   6410  H  HB3   . TYR D 1 10  ? 24.036  -25.808 17.013  1.00 19.62 ? 10  TYR B HB3   1 
ATOM   6411  H  HD1   . TYR D 1 10  ? 24.043  -27.417 19.953  1.00 21.35 ? 10  TYR B HD1   1 
ATOM   6412  H  HD2   . TYR D 1 10  ? 24.457  -23.708 18.557  1.00 24.44 ? 10  TYR B HD2   1 
ATOM   6413  H  HE1   . TYR D 1 10  ? 25.121  -26.787 21.940  1.00 24.96 ? 10  TYR B HE1   1 
ATOM   6414  H  HE2   . TYR D 1 10  ? 25.521  -23.075 20.515  1.00 26.08 ? 10  TYR B HE2   1 
ATOM   6415  H  HH    . TYR D 1 10  ? 25.627  -23.887 22.942  1.00 22.29 ? 10  TYR B HH    1 
ATOM   6416  N  N     . PHE D 1 11  ? 19.746  -25.601 18.105  1.00 16.06 ? 11  PHE B N     1 
ATOM   6417  C  CA    . PHE D 1 11  ? 18.747  -25.507 19.172  1.00 12.27 ? 11  PHE B CA    1 
ATOM   6418  C  C     . PHE D 1 11  ? 18.583  -26.731 20.081  1.00 17.35 ? 11  PHE B C     1 
ATOM   6419  O  O     . PHE D 1 11  ? 18.788  -26.619 21.290  1.00 15.73 ? 11  PHE B O     1 
ATOM   6420  C  CB    . PHE D 1 11  ? 17.415  -25.026 18.621  1.00 12.39 ? 11  PHE B CB    1 
ATOM   6421  C  CG    . PHE D 1 11  ? 16.400  -24.779 19.698  1.00 16.36 ? 11  PHE B CG    1 
ATOM   6422  C  CD1   . PHE D 1 11  ? 16.743  -24.073 20.841  1.00 15.50 ? 11  PHE B CD1   1 
ATOM   6423  C  CD2   . PHE D 1 11  ? 15.101  -25.243 19.553  1.00 15.42 ? 11  PHE B CD2   1 
ATOM   6424  C  CE1   . PHE D 1 11  ? 15.794  -23.848 21.853  1.00 16.57 ? 11  PHE B CE1   1 
ATOM   6425  C  CE2   . PHE D 1 11  ? 14.150  -25.011 20.553  1.00 16.37 ? 11  PHE B CE2   1 
ATOM   6426  C  CZ    . PHE D 1 11  ? 14.509  -24.322 21.698  1.00 18.11 ? 11  PHE B CZ    1 
ATOM   6427  H  H     . PHE D 1 11  ? 19.457  -25.394 17.323  1.00 19.20 ? 11  PHE B H     1 
ATOM   6428  H  HA    . PHE D 1 11  ? 19.054  -24.790 19.767  1.00 14.66 ? 11  PHE B HA    1 
ATOM   6429  H  HB2   . PHE D 1 11  ? 17.553  -24.194 18.141  1.00 14.81 ? 11  PHE B HB2   1 
ATOM   6430  H  HB3   . PHE D 1 11  ? 17.059  -25.700 18.021  1.00 14.81 ? 11  PHE B HB3   1 
ATOM   6431  H  HD1   . PHE D 1 11  ? 17.613  -23.762 20.947  1.00 18.54 ? 11  PHE B HD1   1 
ATOM   6432  H  HD2   . PHE D 1 11  ? 14.861  -25.713 18.787  1.00 18.44 ? 11  PHE B HD2   1 
ATOM   6433  H  HE1   . PHE D 1 11  ? 16.030  -23.378 22.620  1.00 19.83 ? 11  PHE B HE1   1 
ATOM   6434  H  HE2   . PHE D 1 11  ? 13.282  -25.331 20.454  1.00 19.58 ? 11  PHE B HE2   1 
ATOM   6435  H  HZ    . PHE D 1 11  ? 13.876  -24.167 22.362  1.00 21.67 ? 11  PHE B HZ    1 
ATOM   6436  N  N     . PHE D 1 12  ? 18.199  -27.887 19.545  1.00 13.40 ? 12  PHE B N     1 
ATOM   6437  C  CA    . PHE D 1 12  ? 17.914  -29.014 20.424  1.00 17.19 ? 12  PHE B CA    1 
ATOM   6438  C  C     . PHE D 1 12  ? 19.146  -29.424 21.221  1.00 15.78 ? 12  PHE B C     1 
ATOM   6439  O  O     . PHE D 1 12  ? 19.046  -29.754 22.378  1.00 16.15 ? 12  PHE B O     1 
ATOM   6440  C  CB    . PHE D 1 12  ? 17.415  -30.244 19.638  1.00 17.28 ? 12  PHE B CB    1 
ATOM   6441  C  CG    . PHE D 1 12  ? 16.085  -30.058 18.942  1.00 16.15 ? 12  PHE B CG    1 
ATOM   6442  C  CD1   . PHE D 1 12  ? 15.378  -28.859 19.006  1.00 16.22 ? 12  PHE B CD1   1 
ATOM   6443  C  CD2   . PHE D 1 12  ? 15.547  -31.117 18.211  1.00 17.49 ? 12  PHE B CD2   1 
ATOM   6444  C  CE1   . PHE D 1 12  ? 14.193  -28.702 18.333  1.00 17.50 ? 12  PHE B CE1   1 
ATOM   6445  C  CE2   . PHE D 1 12  ? 14.373  -30.984 17.547  1.00 19.01 ? 12  PHE B CE2   1 
ATOM   6446  C  CZ    . PHE D 1 12  ? 13.677  -29.769 17.587  1.00 17.14 ? 12  PHE B CZ    1 
ATOM   6447  H  H     . PHE D 1 12  ? 18.099  -28.042 18.704  1.00 16.02 ? 12  PHE B H     1 
ATOM   6448  H  HA    . PHE D 1 12  ? 17.214  -28.755 21.058  1.00 20.57 ? 12  PHE B HA    1 
ATOM   6449  H  HB2   . PHE D 1 12  ? 18.072  -30.465 18.960  1.00 20.67 ? 12  PHE B HB2   1 
ATOM   6450  H  HB3   . PHE D 1 12  ? 17.321  -30.987 20.255  1.00 20.67 ? 12  PHE B HB3   1 
ATOM   6451  H  HD1   . PHE D 1 12  ? 15.732  -28.142 19.482  1.00 19.41 ? 12  PHE B HD1   1 
ATOM   6452  H  HD2   . PHE D 1 12  ? 16.013  -31.920 18.159  1.00 20.92 ? 12  PHE B HD2   1 
ATOM   6453  H  HE1   . PHE D 1 12  ? 13.732  -27.896 18.378  1.00 20.93 ? 12  PHE B HE1   1 
ATOM   6454  H  HE2   . PHE D 1 12  ? 14.033  -31.699 17.058  1.00 22.75 ? 12  PHE B HE2   1 
ATOM   6455  H  HZ    . PHE D 1 12  ? 12.861  -29.682 17.148  1.00 20.51 ? 12  PHE B HZ    1 
ATOM   6456  N  N     . ALA D 1 13  ? 20.329  -29.431 20.589  1.00 14.42 ? 13  ALA B N     1 
ATOM   6457  C  CA    . ALA D 1 13  ? 21.535  -29.822 21.289  1.00 15.16 ? 13  ALA B CA    1 
ATOM   6458  C  C     . ALA D 1 13  ? 21.872  -28.800 22.379  1.00 16.23 ? 13  ALA B C     1 
ATOM   6459  O  O     . ALA D 1 13  ? 22.311  -29.168 23.465  1.00 16.26 ? 13  ALA B O     1 
ATOM   6460  C  CB    . ALA D 1 13  ? 22.721  -29.984 20.295  1.00 16.25 ? 13  ALA B CB    1 
ATOM   6461  H  H     . ALA D 1 13  ? 20.448  -29.214 19.765  1.00 17.24 ? 13  ALA B H     1 
ATOM   6462  H  HA    . ALA D 1 13  ? 21.384  -30.687 21.723  1.00 18.13 ? 13  ALA B HA    1 
ATOM   6463  H  HB1   . ALA D 1 13  ? 23.506  -30.243 20.784  1.00 19.44 ? 13  ALA B HB1   1 
ATOM   6464  H  HB2   . ALA D 1 13  ? 22.499  -30.660 19.651  1.00 19.44 ? 13  ALA B HB2   1 
ATOM   6465  H  HB3   . ALA D 1 13  ? 22.874  -29.146 19.851  1.00 19.44 ? 13  ALA B HB3   1 
ATOM   6466  N  N     . GLN D 1 14  ? 21.665  -27.524 22.080  1.00 15.17 ? 14  GLN B N     1 
ATOM   6467  C  CA    . GLN D 1 14  ? 21.955  -26.498 23.056  1.00 16.88 ? 14  GLN B CA    1 
ATOM   6468  C  C     . GLN D 1 14  ? 21.047  -26.634 24.279  1.00 16.09 ? 14  GLN B C     1 
ATOM   6469  O  O     . GLN D 1 14  ? 21.502  -26.497 25.402  1.00 15.78 ? 14  GLN B O     1 
ATOM   6470  C  CB    . GLN D 1 14  ? 21.860  -25.091 22.457  1.00 18.64 ? 14  GLN B CB    1 
ATOM   6471  C  CG    . GLN D 1 14  ? 22.441  -24.069 23.430  1.00 19.21 ? 14  GLN B CG    1 
ATOM   6472  C  CD    . GLN D 1 14  ? 22.325  -22.608 23.030  1.00 22.34 ? 14  GLN B CD    1 
ATOM   6473  O  OE1   . GLN D 1 14  ? 22.712  -21.739 23.807  1.00 18.87 ? 14  GLN B OE1   1 
ATOM   6474  N  NE2   . GLN D 1 14  ? 21.793  -22.322 21.827  1.00 18.36 ? 14  GLN B NE2   1 
ATOM   6475  H  H     . GLN D 1 14  ? 21.362  -27.234 21.329  1.00 18.15 ? 14  GLN B H     1 
ATOM   6476  H  HA    . GLN D 1 14  ? 22.877  -26.621 23.365  1.00 20.19 ? 14  GLN B HA    1 
ATOM   6477  H  HB2   . GLN D 1 14  ? 22.368  -25.054 21.632  1.00 22.31 ? 14  GLN B HB2   1 
ATOM   6478  H  HB3   . GLN D 1 14  ? 20.930  -24.868 22.295  1.00 22.31 ? 14  GLN B HB3   1 
ATOM   6479  H  HG2   . GLN D 1 14  ? 21.989  -24.170 24.282  1.00 23.00 ? 14  GLN B HG2   1 
ATOM   6480  H  HG3   . GLN D 1 14  ? 23.385  -24.261 23.544  1.00 23.00 ? 14  GLN B HG3   1 
ATOM   6481  H  HE21  . GLN D 1 14  ? 21.716  -21.504 21.575  1.00 21.97 ? 14  GLN B HE21  1 
ATOM   6482  H  HE22  . GLN D 1 14  ? 21.531  -22.958 21.311  1.00 21.97 ? 14  GLN B HE22  1 
ATOM   6483  N  N     . VAL D 1 15  ? 19.759  -26.890 24.062  1.00 14.53 ? 15  VAL B N     1 
ATOM   6484  C  CA    . VAL D 1 15  ? 18.868  -27.160 25.191  1.00 18.51 ? 15  VAL B CA    1 
ATOM   6485  C  C     . VAL D 1 15  ? 19.405  -28.349 25.993  1.00 21.09 ? 15  VAL B C     1 
ATOM   6486  O  O     . VAL D 1 15  ? 19.460  -28.302 27.220  1.00 16.58 ? 15  VAL B O     1 
ATOM   6487  C  CB    . VAL D 1 15  ? 17.450  -27.435 24.752  1.00 18.11 ? 15  VAL B CB    1 
ATOM   6488  C  CG1   . VAL D 1 15  ? 16.582  -27.861 25.962  1.00 16.23 ? 15  VAL B CG1   1 
ATOM   6489  C  CG2   . VAL D 1 15  ? 16.871  -26.219 24.081  1.00 14.92 ? 15  VAL B CG2   1 
ATOM   6490  H  H     . VAL D 1 15  ? 19.381  -26.913 23.289  1.00 17.37 ? 15  VAL B H     1 
ATOM   6491  H  HA    . VAL D 1 15  ? 18.856  -26.378 25.781  1.00 22.15 ? 15  VAL B HA    1 
ATOM   6492  H  HB    . VAL D 1 15  ? 17.451  -28.170 24.103  1.00 21.67 ? 15  VAL B HB    1 
ATOM   6493  H  HG11  . VAL D 1 15  ? 15.687  -28.030 25.659  1.00 19.42 ? 15  VAL B HG11  1 
ATOM   6494  H  HG12  . VAL D 1 15  ? 16.954  -28.657 26.348  1.00 19.42 ? 15  VAL B HG12  1 
ATOM   6495  H  HG13  . VAL D 1 15  ? 16.581  -27.152 26.610  1.00 19.42 ? 15  VAL B HG13  1 
ATOM   6496  H  HG21  . VAL D 1 15  ? 17.532  -25.522 24.075  1.00 17.84 ? 15  VAL B HG21  1 
ATOM   6497  H  HG22  . VAL D 1 15  ? 16.626  -26.446 23.181  1.00 17.84 ? 15  VAL B HG22  1 
ATOM   6498  H  HG23  . VAL D 1 15  ? 16.096  -25.932 24.569  1.00 17.84 ? 15  VAL B HG23  1 
ATOM   6499  N  N     . GLU D 1 16  ? 19.848  -29.401 25.322  1.00 16.77 ? 16  GLU B N     1 
ATOM   6500  C  CA    . GLU D 1 16  ? 20.385  -30.550 26.061  1.00 18.50 ? 16  GLU B CA    1 
ATOM   6501  C  C     . GLU D 1 16  ? 21.624  -30.148 26.866  1.00 18.49 ? 16  GLU B C     1 
ATOM   6502  O  O     . GLU D 1 16  ? 21.841  -30.667 27.959  1.00 18.82 ? 16  GLU B O     1 
ATOM   6503  C  CB    . GLU D 1 16  ? 20.677  -31.726 25.123  1.00 21.44 ? 16  GLU B CB    1 
ATOM   6504  C  CG    . GLU D 1 16  ? 19.430  -32.380 24.510  1.00 18.75 ? 16  GLU B CG    1 
ATOM   6505  C  CD    . GLU D 1 16  ? 18.644  -33.220 25.508  1.00 24.81 ? 16  GLU B CD    1 
ATOM   6506  O  OE1   . GLU D 1 16  ? 17.493  -33.610 25.202  1.00 23.80 ? 16  GLU B OE1   1 
ATOM   6507  O  OE2   . GLU D 1 16  ? 19.183  -33.484 26.604  1.00 24.40 ? 16  GLU B OE2   1 
ATOM   6508  H  H     . GLU D 1 16  ? 19.853  -29.481 24.466  1.00 20.06 ? 16  GLU B H     1 
ATOM   6509  H  HA    . GLU D 1 16  ? 19.706  -30.849 26.701  1.00 22.14 ? 16  GLU B HA    1 
ATOM   6510  H  HB2   . GLU D 1 16  ? 21.232  -31.410 24.393  1.00 25.66 ? 16  GLU B HB2   1 
ATOM   6511  H  HB3   . GLU D 1 16  ? 21.152  -32.410 25.622  1.00 25.66 ? 16  GLU B HB3   1 
ATOM   6512  H  HG2   . GLU D 1 16  ? 18.842  -31.684 24.176  1.00 22.44 ? 16  GLU B HG2   1 
ATOM   6513  H  HG3   . GLU D 1 16  ? 19.704  -32.959 23.782  1.00 22.44 ? 16  GLU B HG3   1 
ATOM   6514  N  N     . GLU D 1 17  ? 22.442  -29.229 26.331  1.00 19.70 ? 17  GLU B N     1 
ATOM   6515  C  CA    . GLU D 1 17  ? 23.587  -28.714 27.074  1.00 20.02 ? 17  GLU B CA    1 
ATOM   6516  C  C     . GLU D 1 17  ? 23.171  -27.897 28.294  1.00 24.88 ? 17  GLU B C     1 
ATOM   6517  O  O     . GLU D 1 17  ? 23.838  -27.928 29.322  1.00 22.67 ? 17  GLU B O     1 
ATOM   6518  C  CB    . GLU D 1 17  ? 24.489  -27.830 26.220  1.00 15.47 ? 17  GLU B CB    1 
ATOM   6519  C  CG    . GLU D 1 17  ? 25.297  -28.581 25.168  1.00 16.75 ? 17  GLU B CG    1 
ATOM   6520  C  CD    . GLU D 1 17  ? 26.068  -27.665 24.226  1.00 26.21 ? 17  GLU B CD    1 
ATOM   6521  O  OE1   . GLU D 1 17  ? 25.970  -26.429 24.383  1.00 22.49 ? 17  GLU B OE1   1 
ATOM   6522  O  OE2   . GLU D 1 17  ? 26.737  -28.195 23.292  1.00 21.12 ? 17  GLU B OE2   1 
ATOM   6523  H  H     . GLU D 1 17  ? 22.351  -28.895 25.544  1.00 23.58 ? 17  GLU B H     1 
ATOM   6524  H  HA    . GLU D 1 17  ? 24.122  -29.471 27.390  1.00 23.97 ? 17  GLU B HA    1 
ATOM   6525  H  HB2   . GLU D 1 17  ? 23.938  -27.178 25.758  1.00 18.51 ? 17  GLU B HB2   1 
ATOM   6526  H  HB3   . GLU D 1 17  ? 25.117  -27.373 26.802  1.00 18.51 ? 17  GLU B HB3   1 
ATOM   6527  H  HG2   . GLU D 1 17  ? 25.938  -29.155 25.616  1.00 20.04 ? 17  GLU B HG2   1 
ATOM   6528  H  HG3   . GLU D 1 17  ? 24.692  -29.117 24.632  1.00 20.04 ? 17  GLU B HG3   1 
ATOM   6529  N  N     . VAL D 1 18  ? 22.103  -27.127 28.168  1.00 18.83 ? 18  VAL B N     1 
ATOM   6530  C  CA    . VAL D 1 18  ? 21.605  -26.377 29.313  1.00 21.92 ? 18  VAL B CA    1 
ATOM   6531  C  C     . VAL D 1 18  ? 21.178  -27.334 30.434  1.00 19.34 ? 18  VAL B C     1 
ATOM   6532  O  O     . VAL D 1 18  ? 21.485  -27.089 31.602  1.00 26.64 ? 18  VAL B O     1 
ATOM   6533  C  CB    . VAL D 1 18  ? 20.445  -25.445 28.893  1.00 19.43 ? 18  VAL B CB    1 
ATOM   6534  C  CG1   . VAL D 1 18  ? 19.784  -24.806 30.098  1.00 21.88 ? 18  VAL B CG1   1 
ATOM   6535  C  CG2   . VAL D 1 18  ? 20.982  -24.352 27.956  1.00 19.43 ? 18  VAL B CG2   1 
ATOM   6536  H  H     . VAL D 1 18  ? 21.653  -27.020 27.443  1.00 22.53 ? 18  VAL B H     1 
ATOM   6537  H  HA    . VAL D 1 18  ? 22.329  -25.815 29.659  1.00 26.25 ? 18  VAL B HA    1 
ATOM   6538  H  HB    . VAL D 1 18  ? 19.769  -25.963 28.408  1.00 23.25 ? 18  VAL B HB    1 
ATOM   6539  H  HG11  . VAL D 1 18  ? 20.225  -25.112 30.894  1.00 26.20 ? 18  VAL B HG11  1 
ATOM   6540  H  HG12  . VAL D 1 18  ? 19.862  -23.851 30.027  1.00 26.20 ? 18  VAL B HG12  1 
ATOM   6541  H  HG13  . VAL D 1 18  ? 18.859  -25.059 30.117  1.00 26.20 ? 18  VAL B HG13  1 
ATOM   6542  H  HG21  . VAL D 1 18  ? 20.258  -23.777 27.700  1.00 23.25 ? 18  VAL B HG21  1 
ATOM   6543  H  HG22  . VAL D 1 18  ? 21.654  -23.846 28.420  1.00 23.25 ? 18  VAL B HG22  1 
ATOM   6544  H  HG23  . VAL D 1 18  ? 21.363  -24.766 27.179  1.00 23.25 ? 18  VAL B HG23  1 
ATOM   6545  N  N     . LEU D 1 19  ? 20.500  -28.425 30.068  1.00 20.54 ? 19  LEU B N     1 
ATOM   6546  C  CA    . LEU D 1 19  ? 20.020  -29.407 31.061  1.00 21.16 ? 19  LEU B CA    1 
ATOM   6547  C  C     . LEU D 1 19  ? 21.146  -30.329 31.541  1.00 24.73 ? 19  LEU B C     1 
ATOM   6548  O  O     . LEU D 1 19  ? 21.006  -30.951 32.588  1.00 24.97 ? 19  LEU B O     1 
ATOM   6549  C  CB    . LEU D 1 19  ? 18.923  -30.307 30.503  1.00 21.64 ? 19  LEU B CB    1 
ATOM   6550  C  CG    . LEU D 1 19  ? 17.642  -29.650 29.987  1.00 36.91 ? 19  LEU B CG    1 
ATOM   6551  C  CD1   . LEU D 1 19  ? 16.452  -30.523 30.327  1.00 38.37 ? 19  LEU B CD1   1 
ATOM   6552  C  CD2   . LEU D 1 19  ? 17.478  -28.253 30.525  1.00 28.93 ? 19  LEU B CD2   1 
ATOM   6553  H  H     . LEU D 1 19  ? 20.303  -28.624 29.255  1.00 24.59 ? 19  LEU B H     1 
ATOM   6554  H  HA    . LEU D 1 19  ? 19.660  -28.931 31.839  1.00 25.33 ? 19  LEU B HA    1 
ATOM   6555  H  HB2   . LEU D 1 19  ? 19.299  -30.810 29.764  1.00 25.90 ? 19  LEU B HB2   1 
ATOM   6556  H  HB3   . LEU D 1 19  ? 18.660  -30.924 31.204  1.00 25.90 ? 19  LEU B HB3   1 
ATOM   6557  H  HG    . LEU D 1 19  ? 17.694  -29.588 29.020  1.00 44.24 ? 19  LEU B HG    1 
ATOM   6558  H  HD11  . LEU D 1 19  ? 15.653  -30.103 29.999  1.00 45.98 ? 19  LEU B HD11  1 
ATOM   6559  H  HD12  . LEU D 1 19  ? 16.565  -31.381 29.911  1.00 45.98 ? 19  LEU B HD12  1 
ATOM   6560  H  HD13  . LEU D 1 19  ? 16.401  -30.625 31.280  1.00 45.98 ? 19  LEU B HD13  1 
ATOM   6561  H  HD21  . LEU D 1 19  ? 16.665  -27.879 30.178  1.00 34.65 ? 19  LEU B HD21  1 
ATOM   6562  H  HD22  . LEU D 1 19  ? 17.438  -28.290 31.483  1.00 34.65 ? 19  LEU B HD22  1 
ATOM   6563  H  HD23  . LEU D 1 19  ? 18.228  -27.722 30.248  1.00 34.65 ? 19  LEU B HD23  1 
ATOM   6564  N  N     . ASN D 1 20  ? 22.226  -30.412 30.764  1.00 21.06 ? 20  ASN B N     1 
ATOM   6565  C  CA    . ASN D 1 20  ? 23.389  -31.276 31.059  1.00 21.45 ? 20  ASN B CA    1 
ATOM   6566  C  C     . ASN D 1 20  ? 24.683  -30.566 30.639  1.00 25.86 ? 20  ASN B C     1 
ATOM   6567  O  O     . ASN D 1 20  ? 25.264  -30.874 29.604  1.00 24.55 ? 20  ASN B O     1 
ATOM   6568  C  CB    . ASN D 1 20  ? 23.263  -32.591 30.280  1.00 28.31 ? 20  ASN B CB    1 
ATOM   6569  C  CG    . ASN D 1 20  ? 21.896  -33.243 30.416  1.00 41.53 ? 20  ASN B CG    1 
ATOM   6570  O  OD1   . ASN D 1 20  ? 21.627  -33.917 31.410  1.00 45.88 ? 20  ASN B OD1   1 
ATOM   6571  N  ND2   . ASN D 1 20  ? 21.030  -33.080 29.385  1.00 34.26 ? 20  ASN B ND2   1 
ATOM   6572  H  H     . ASN D 1 20  ? 22.317  -29.965 30.035  1.00 25.21 ? 20  ASN B H     1 
ATOM   6573  H  HA    . ASN D 1 20  ? 23.429  -31.474 32.018  1.00 25.68 ? 20  ASN B HA    1 
ATOM   6574  H  HB2   . ASN D 1 20  ? 23.417  -32.415 29.339  1.00 33.91 ? 20  ASN B HB2   1 
ATOM   6575  H  HB3   . ASN D 1 20  ? 23.926  -33.217 30.612  1.00 33.91 ? 20  ASN B HB3   1 
ATOM   6576  H  HD21  . ASN D 1 20  ? 21.264  -32.624 28.695  1.00 41.05 ? 20  ASN B HD21  1 
ATOM   6577  H  HD22  . ASN D 1 20  ? 20.246  -33.433 29.422  1.00 41.05 ? 20  ASN B HD22  1 
ATOM   6578  N  N     . PRO D 1 21  ? 25.138  -29.593 31.432  1.00 20.97 ? 21  PRO B N     1 
ATOM   6579  C  CA    . PRO D 1 21  ? 26.241  -28.723 31.018  1.00 24.22 ? 21  PRO B CA    1 
ATOM   6580  C  C     . PRO D 1 21  ? 27.563  -29.474 30.826  1.00 24.83 ? 21  PRO B C     1 
ATOM   6581  O  O     . PRO D 1 21  ? 28.446  -28.979 30.147  1.00 24.74 ? 21  PRO B O     1 
ATOM   6582  C  CB    . PRO D 1 21  ? 26.337  -27.718 32.169  1.00 31.45 ? 21  PRO B CB    1 
ATOM   6583  C  CG    . PRO D 1 21  ? 24.971  -27.706 32.766  1.00 25.12 ? 21  PRO B CG    1 
ATOM   6584  C  CD    . PRO D 1 21  ? 24.498  -29.132 32.671  1.00 24.96 ? 21  PRO B CD    1 
ATOM   6585  H  HA    . PRO D 1 21  ? 26.012  -28.249 30.191  1.00 29.01 ? 21  PRO B HA    1 
ATOM   6586  H  HB2   . PRO D 1 21  ? 26.994  -28.021 32.815  1.00 37.68 ? 21  PRO B HB2   1 
ATOM   6587  H  HB3   . PRO D 1 21  ? 26.570  -26.843 31.822  1.00 37.68 ? 21  PRO B HB3   1 
ATOM   6588  H  HG2   . PRO D 1 21  ? 25.021  -27.420 33.692  1.00 30.08 ? 21  PRO B HG2   1 
ATOM   6589  H  HG3   . PRO D 1 21  ? 24.394  -27.117 32.254  1.00 30.08 ? 21  PRO B HG3   1 
ATOM   6590  H  HD2   . PRO D 1 21  ? 24.813  -29.647 33.430  1.00 29.89 ? 21  PRO B HD2   1 
ATOM   6591  H  HD3   . PRO D 1 21  ? 23.532  -29.166 32.590  1.00 29.89 ? 21  PRO B HD3   1 
ATOM   6592  N  N     . GLN D 1 22  ? 27.663  -30.668 31.391  1.00 20.53 ? 22  GLN B N     1 
ATOM   6593  C  CA    . GLN D 1 22  ? 28.810  -31.546 31.139  1.00 30.47 ? 22  GLN B CA    1 
ATOM   6594  C  C     . GLN D 1 22  ? 29.011  -31.839 29.626  1.00 33.34 ? 22  GLN B C     1 
ATOM   6595  O  O     . GLN D 1 22  ? 30.133  -32.152 29.182  1.00 31.64 ? 22  GLN B O     1 
ATOM   6596  C  CB    . GLN D 1 22  ? 28.669  -32.854 31.941  1.00 28.35 ? 22  GLN B CB    1 
ATOM   6597  C  CG    . GLN D 1 22  ? 27.542  -33.802 31.533  1.00 37.94 ? 22  GLN B CG    1 
ATOM   6598  C  CD    . GLN D 1 22  ? 26.178  -33.497 32.194  1.00 36.70 ? 22  GLN B CD    1 
ATOM   6599  O  OE1   . GLN D 1 22  ? 25.905  -32.370 32.583  1.00 32.87 ? 22  GLN B OE1   1 
ATOM   6600  N  NE2   . GLN D 1 22  ? 25.329  -34.515 32.303  1.00 44.08 ? 22  GLN B NE2   1 
ATOM   6601  H  H     . GLN D 1 22  ? 27.079  -31.001 31.928  1.00 24.57 ? 22  GLN B H     1 
ATOM   6602  H  HA    . GLN D 1 22  ? 29.619  -31.094 31.458  1.00 36.50 ? 22  GLN B HA    1 
ATOM   6603  H  HB2   . GLN D 1 22  ? 29.500  -33.348 31.861  1.00 33.96 ? 22  GLN B HB2   1 
ATOM   6604  H  HB3   . GLN D 1 22  ? 28.524  -32.623 32.872  1.00 33.96 ? 22  GLN B HB3   1 
ATOM   6605  H  HG2   . GLN D 1 22  ? 27.422  -33.746 30.572  1.00 45.46 ? 22  GLN B HG2   1 
ATOM   6606  H  HG3   . GLN D 1 22  ? 27.792  -34.706 31.779  1.00 45.46 ? 22  GLN B HG3   1 
ATOM   6607  H  HE21  . GLN D 1 22  ? 25.551  -35.293 32.013  1.00 52.84 ? 22  GLN B HE21  1 
ATOM   6608  H  HE22  . GLN D 1 22  ? 24.558  -34.395 32.664  1.00 52.84 ? 22  GLN B HE22  1 
ATOM   6609  N  N     . TYR D 1 23  ? 27.947  -31.686 28.835  1.00 23.83 ? 23  TYR B N     1 
ATOM   6610  C  CA    . TYR D 1 23  ? 28.007  -31.958 27.396  1.00 21.12 ? 23  TYR B CA    1 
ATOM   6611  C  C     . TYR D 1 23  ? 28.644  -30.809 26.643  1.00 23.99 ? 23  TYR B C     1 
ATOM   6612  O  O     . TYR D 1 23  ? 29.126  -30.964 25.524  1.00 23.09 ? 23  TYR B O     1 
ATOM   6613  C  CB    . TYR D 1 23  ? 26.601  -32.136 26.858  1.00 21.15 ? 23  TYR B CB    1 
ATOM   6614  C  CG    . TYR D 1 23  ? 25.884  -33.387 27.297  1.00 24.00 ? 23  TYR B CG    1 
ATOM   6615  C  CD1   . TYR D 1 23  ? 24.499  -33.474 27.186  1.00 34.61 ? 23  TYR B CD1   1 
ATOM   6616  C  CD2   . TYR D 1 23  ? 26.566  -34.479 27.824  1.00 30.99 ? 23  TYR B CD2   1 
ATOM   6617  C  CE1   . TYR D 1 23  ? 23.823  -34.589 27.568  1.00 34.43 ? 23  TYR B CE1   1 
ATOM   6618  C  CE2   . TYR D 1 23  ? 25.881  -35.615 28.207  1.00 35.70 ? 23  TYR B CE2   1 
ATOM   6619  C  CZ    . TYR D 1 23  ? 24.509  -35.659 28.079  1.00 38.17 ? 23  TYR B CZ    1 
ATOM   6620  O  OH    . TYR D 1 23  ? 23.796  -36.775 28.451  1.00 46.20 ? 23  TYR B OH    1 
ATOM   6621  H  H     . TYR D 1 23  ? 27.175  -31.425 29.109  1.00 28.53 ? 23  TYR B H     1 
ATOM   6622  H  HA    . TYR D 1 23  ? 28.521  -32.775 27.228  1.00 25.28 ? 23  TYR B HA    1 
ATOM   6623  H  HB2   . TYR D 1 23  ? 26.066  -31.380 27.144  1.00 25.31 ? 23  TYR B HB2   1 
ATOM   6624  H  HB3   . TYR D 1 23  ? 26.645  -32.152 25.889  1.00 25.31 ? 23  TYR B HB3   1 
ATOM   6625  H  HD1   . TYR D 1 23  ? 24.026  -32.753 26.837  1.00 41.47 ? 23  TYR B HD1   1 
ATOM   6626  H  HD2   . TYR D 1 23  ? 27.492  -34.448 27.906  1.00 37.13 ? 23  TYR B HD2   1 
ATOM   6627  H  HE1   . TYR D 1 23  ? 22.898  -34.626 27.481  1.00 41.26 ? 23  TYR B HE1   1 
ATOM   6628  H  HE2   . TYR D 1 23  ? 26.342  -36.343 28.556  1.00 42.78 ? 23  TYR B HE2   1 
ATOM   6629  H  HH    . TYR D 1 23  ? 23.393  -37.078 27.805  1.00 55.38 ? 23  TYR B HH    1 
ATOM   6630  N  N     . LYS D 1 24  ? 28.632  -29.630 27.247  1.00 20.26 ? 24  LYS B N     1 
ATOM   6631  C  CA    . LYS D 1 24  ? 29.043  -28.436 26.525  1.00 24.62 ? 24  LYS B CA    1 
ATOM   6632  C  C     . LYS D 1 24  ? 30.525  -28.514 26.134  1.00 32.48 ? 24  LYS B C     1 
ATOM   6633  O  O     . LYS D 1 24  ? 31.335  -29.018 26.895  1.00 25.62 ? 24  LYS B O     1 
ATOM   6634  C  CB    . LYS D 1 24  ? 28.792  -27.205 27.389  1.00 27.27 ? 24  LYS B CB    1 
ATOM   6635  C  CG    . LYS D 1 24  ? 29.116  -25.881 26.680  1.00 30.56 ? 24  LYS B CG    1 
ATOM   6636  C  CD    . LYS D 1 24  ? 28.668  -24.706 27.513  1.00 33.79 ? 24  LYS B CD    1 
ATOM   6637  C  CE    . LYS D 1 24  ? 29.117  -23.413 26.916  1.00 32.85 ? 24  LYS B CE    1 
ATOM   6638  N  NZ    . LYS D 1 24  ? 28.431  -23.133 25.632  1.00 34.60 ? 24  LYS B NZ    1 
ATOM   6639  H  H     . LYS D 1 24  ? 28.393  -29.494 28.062  1.00 24.25 ? 24  LYS B H     1 
ATOM   6640  H  HA    . LYS D 1 24  ? 28.512  -28.352 25.706  1.00 29.49 ? 24  LYS B HA    1 
ATOM   6641  H  HB2   . LYS D 1 24  ? 27.856  -27.186 27.641  1.00 32.67 ? 24  LYS B HB2   1 
ATOM   6642  H  HB3   . LYS D 1 24  ? 29.347  -27.261 28.183  1.00 32.67 ? 24  LYS B HB3   1 
ATOM   6643  H  HG2   . LYS D 1 24  ? 30.075  -25.813 26.546  1.00 36.61 ? 24  LYS B HG2   1 
ATOM   6644  H  HG3   . LYS D 1 24  ? 28.652  -25.848 25.829  1.00 36.61 ? 24  LYS B HG3   1 
ATOM   6645  H  HD2   . LYS D 1 24  ? 27.699  -24.699 27.562  1.00 40.49 ? 24  LYS B HD2   1 
ATOM   6646  H  HD3   . LYS D 1 24  ? 29.049  -24.780 28.403  1.00 40.49 ? 24  LYS B HD3   1 
ATOM   6647  H  HE2   . LYS D 1 24  ? 28.917  -22.691 27.531  1.00 39.36 ? 24  LYS B HE2   1 
ATOM   6648  H  HE3   . LYS D 1 24  ? 30.072  -23.454 26.747  1.00 39.36 ? 24  LYS B HE3   1 
ATOM   6649  H  HZ1   . LYS D 1 24  ? 27.552  -23.086 25.761  1.00 41.46 ? 24  LYS B HZ1   1 
ATOM   6650  H  HZ2   . LYS D 1 24  ? 28.716  -22.358 25.298  1.00 41.46 ? 24  LYS B HZ2   1 
ATOM   6651  H  HZ3   . LYS D 1 24  ? 28.604  -23.781 25.047  1.00 41.46 ? 24  LYS B HZ3   1 
ATOM   6652  N  N     . GLY D 1 25  ? 30.858  -28.027 24.943  1.00 26.67 ? 25  GLY B N     1 
ATOM   6653  C  CA    . GLY D 1 25  ? 32.225  -28.016 24.453  1.00 29.16 ? 25  GLY B CA    1 
ATOM   6654  C  C     . GLY D 1 25  ? 32.796  -29.351 23.983  1.00 30.21 ? 25  GLY B C     1 
ATOM   6655  O  O     . GLY D 1 25  ? 33.982  -29.426 23.669  1.00 27.58 ? 25  GLY B O     1 
ATOM   6656  H  H     . GLY D 1 25  ? 30.293  -27.689 24.390  1.00 31.94 ? 25  GLY B H     1 
ATOM   6657  H  HA2   . GLY D 1 25  ? 32.281  -27.396 23.709  1.00 34.93 ? 25  GLY B HA2   1 
ATOM   6658  H  HA3   . GLY D 1 25  ? 32.803  -27.684 25.158  1.00 34.93 ? 25  GLY B HA3   1 
ATOM   6659  N  N     . LYS D 1 26  ? 31.982  -30.404 23.975  1.00 27.41 ? 26  LYS B N     1 
ATOM   6660  C  CA    . LYS D 1 26  ? 32.366  -31.688 23.385  1.00 26.37 ? 26  LYS B CA    1 
ATOM   6661  C  C     . LYS D 1 26  ? 31.279  -32.087 22.365  1.00 24.43 ? 26  LYS B C     1 
ATOM   6662  O  O     . LYS D 1 26  ? 30.140  -31.651 22.490  1.00 21.29 ? 26  LYS B O     1 
ATOM   6663  C  CB    . LYS D 1 26  ? 32.457  -32.791 24.438  1.00 24.10 ? 26  LYS B CB    1 
ATOM   6664  C  CG    . LYS D 1 26  ? 33.456  -32.550 25.599  1.00 38.43 ? 26  LYS B CG    1 
ATOM   6665  C  CD    . LYS D 1 26  ? 34.906  -32.615 25.110  1.00 48.95 ? 26  LYS B CD    1 
ATOM   6666  C  CE    . LYS D 1 26  ? 35.925  -32.553 26.264  1.00 62.41 ? 26  LYS B CE    1 
ATOM   6667  N  NZ    . LYS D 1 26  ? 35.957  -33.806 27.089  1.00 52.55 ? 26  LYS B NZ    1 
ATOM   6668  H  H     . LYS D 1 26  ? 31.190  -30.401 24.310  1.00 32.84 ? 26  LYS B H     1 
ATOM   6669  H  HA    . LYS D 1 26  ? 33.228  -31.607 22.925  1.00 31.59 ? 26  LYS B HA    1 
ATOM   6670  H  HB2   . LYS D 1 26  ? 31.579  -32.907 24.833  1.00 28.86 ? 26  LYS B HB2   1 
ATOM   6671  H  HB3   . LYS D 1 26  ? 32.722  -33.613 23.996  1.00 28.86 ? 26  LYS B HB3   1 
ATOM   6672  H  HG2   . LYS D 1 26  ? 33.301  -31.670 25.977  1.00 46.05 ? 26  LYS B HG2   1 
ATOM   6673  H  HG3   . LYS D 1 26  ? 33.332  -33.234 26.275  1.00 46.05 ? 26  LYS B HG3   1 
ATOM   6674  H  HD2   . LYS D 1 26  ? 35.042  -33.450 24.634  1.00 58.67 ? 26  LYS B HD2   1 
ATOM   6675  H  HD3   . LYS D 1 26  ? 35.075  -31.865 24.519  1.00 58.67 ? 26  LYS B HD3   1 
ATOM   6676  H  HE2   . LYS D 1 26  ? 36.812  -32.415 25.895  1.00 74.83 ? 26  LYS B HE2   1 
ATOM   6677  H  HE3   . LYS D 1 26  ? 35.693  -31.815 26.850  1.00 74.83 ? 26  LYS B HE3   1 
ATOM   6678  H  HZ1   . LYS D 1 26  ? 36.558  -33.725 27.741  1.00 63.00 ? 26  LYS B HZ1   1 
ATOM   6679  H  HZ2   . LYS D 1 26  ? 35.157  -33.953 27.449  1.00 63.00 ? 26  LYS B HZ2   1 
ATOM   6680  H  HZ3   . LYS D 1 26  ? 36.177  -34.500 26.578  1.00 63.00 ? 26  LYS B HZ3   1 
ATOM   6681  N  N     . PRO D 1 27  ? 31.625  -32.930 21.377  1.00 22.53 ? 27  PRO B N     1 
ATOM   6682  C  CA    . PRO D 1 27  ? 30.591  -33.317 20.398  1.00 23.08 ? 27  PRO B CA    1 
ATOM   6683  C  C     . PRO D 1 27  ? 29.375  -33.959 21.082  1.00 19.56 ? 27  PRO B C     1 
ATOM   6684  O  O     . PRO D 1 27  ? 29.467  -34.904 21.871  1.00 17.81 ? 27  PRO B O     1 
ATOM   6685  C  CB    . PRO D 1 27  ? 31.287  -34.327 19.498  1.00 25.93 ? 27  PRO B CB    1 
ATOM   6686  C  CG    . PRO D 1 27  ? 32.737  -33.999 19.617  1.00 25.22 ? 27  PRO B CG    1 
ATOM   6687  C  CD    . PRO D 1 27  ? 32.932  -33.535 21.062  1.00 24.12 ? 27  PRO B CD    1 
ATOM   6688  H  HA    . PRO D 1 27  ? 30.305  -32.543 19.869  1.00 27.63 ? 27  PRO B HA    1 
ATOM   6689  H  HB2   . PRO D 1 27  ? 31.109  -35.226 19.816  1.00 31.06 ? 27  PRO B HB2   1 
ATOM   6690  H  HB3   . PRO D 1 27  ? 30.982  -34.217 18.584  1.00 31.06 ? 27  PRO B HB3   1 
ATOM   6691  H  HG2   . PRO D 1 27  ? 33.266  -34.792 19.438  1.00 30.20 ? 27  PRO B HG2   1 
ATOM   6692  H  HG3   . PRO D 1 27  ? 32.963  -33.289 18.996  1.00 30.20 ? 27  PRO B HG3   1 
ATOM   6693  H  HD2   . PRO D 1 27  ? 33.107  -34.292 21.643  1.00 28.88 ? 27  PRO B HD2   1 
ATOM   6694  H  HD3   . PRO D 1 27  ? 33.637  -32.871 21.114  1.00 28.88 ? 27  PRO B HD3   1 
ATOM   6695  N  N     . LEU D 1 28  ? 28.230  -33.406 20.717  1.00 16.62 ? 28  LEU B N     1 
ATOM   6696  C  CA    . LEU D 1 28  ? 26.920  -33.866 21.185  1.00 18.35 ? 28  LEU B CA    1 
ATOM   6697  C  C     . LEU D 1 28  ? 25.992  -34.005 19.983  1.00 15.75 ? 28  LEU B C     1 
ATOM   6698  O  O     . LEU D 1 28  ? 25.930  -33.103 19.175  1.00 17.56 ? 28  LEU B O     1 
ATOM   6699  C  CB    . LEU D 1 28  ? 26.320  -32.828 22.105  1.00 19.10 ? 28  LEU B CB    1 
ATOM   6700  C  CG    . LEU D 1 28  ? 24.927  -33.188 22.677  1.00 15.48 ? 28  LEU B CG    1 
ATOM   6701  C  CD1   . LEU D 1 28  ? 24.945  -34.483 23.450  1.00 19.66 ? 28  LEU B CD1   1 
ATOM   6702  C  CD2   . LEU D 1 28  ? 24.442  -32.062 23.537  1.00 21.06 ? 28  LEU B CD2   1 
ATOM   6703  H  H     . LEU D 1 28  ? 28.179  -32.738 20.179  1.00 19.88 ? 28  LEU B H     1 
ATOM   6704  H  HA    . LEU D 1 28  ? 26.995  -34.724 21.652  1.00 21.96 ? 28  LEU B HA    1 
ATOM   6705  H  HB2   . LEU D 1 28  ? 26.920  -32.698 22.856  1.00 22.86 ? 28  LEU B HB2   1 
ATOM   6706  H  HB3   . LEU D 1 28  ? 26.229  -31.997 21.614  1.00 22.86 ? 28  LEU B HB3   1 
ATOM   6707  H  HG    . LEU D 1 28  ? 24.303  -33.291 21.941  1.00 18.52 ? 28  LEU B HG    1 
ATOM   6708  H  HD11  . LEU D 1 28  ? 24.062  -34.661 23.783  1.00 23.53 ? 28  LEU B HD11  1 
ATOM   6709  H  HD12  . LEU D 1 28  ? 25.225  -35.192 22.866  1.00 23.53 ? 28  LEU B HD12  1 
ATOM   6710  H  HD13  . LEU D 1 28  ? 25.561  -34.400 24.183  1.00 23.53 ? 28  LEU B HD13  1 
ATOM   6711  H  HD21  . LEU D 1 28  ? 23.578  -32.288 23.890  1.00 25.21 ? 28  LEU B HD21  1 
ATOM   6712  H  HD22  . LEU D 1 28  ? 25.065  -31.928 24.256  1.00 25.21 ? 28  LEU B HD22  1 
ATOM   6713  H  HD23  . LEU D 1 28  ? 24.380  -31.266 23.004  1.00 25.21 ? 28  LEU B HD23  1 
ATOM   6714  N  N     . VAL D 1 29  ? 25.304  -35.133 19.869  1.00 15.16 ? 29  VAL B N     1 
ATOM   6715  C  CA    . VAL D 1 29  ? 24.411  -35.385 18.742  1.00 17.65 ? 29  VAL B CA    1 
ATOM   6716  C  C     . VAL D 1 29  ? 23.014  -35.778 19.260  1.00 16.98 ? 29  VAL B C     1 
ATOM   6717  O  O     . VAL D 1 29  ? 22.867  -36.782 19.973  1.00 16.20 ? 29  VAL B O     1 
ATOM   6718  C  CB    . VAL D 1 29  ? 24.955  -36.514 17.823  1.00 16.97 ? 29  VAL B CB    1 
ATOM   6719  C  CG1   . VAL D 1 29  ? 24.061  -36.682 16.596  1.00 17.76 ? 29  VAL B CG1   1 
ATOM   6720  C  CG2   . VAL D 1 29  ? 26.412  -36.170 17.378  1.00 16.22 ? 29  VAL B CG2   1 
ATOM   6721  H  H     . VAL D 1 29  ? 25.337  -35.778 20.437  1.00 18.13 ? 29  VAL B H     1 
ATOM   6722  H  HA    . VAL D 1 29  ? 24.323  -34.568 18.208  1.00 21.12 ? 29  VAL B HA    1 
ATOM   6723  H  HB    . VAL D 1 29  ? 24.971  -37.360 18.316  1.00 20.30 ? 29  VAL B HB    1 
ATOM   6724  H  HG11  . VAL D 1 29  ? 23.340  -36.050 16.646  1.00 21.25 ? 29  VAL B HG11  1 
ATOM   6725  H  HG12  . VAL D 1 29  ? 24.582  -36.522 15.805  1.00 21.25 ? 29  VAL B HG12  1 
ATOM   6726  H  HG13  . VAL D 1 29  ? 23.712  -37.576 16.584  1.00 21.25 ? 29  VAL B HG13  1 
ATOM   6727  H  HG21  . VAL D 1 29  ? 26.667  -35.330 17.768  1.00 19.41 ? 29  VAL B HG21  1 
ATOM   6728  H  HG22  . VAL D 1 29  ? 27.002  -36.864 17.680  1.00 19.41 ? 29  VAL B HG22  1 
ATOM   6729  H  HG23  . VAL D 1 29  ? 26.440  -36.109 16.421  1.00 19.41 ? 29  VAL B HG23  1 
ATOM   6730  N  N     . VAL D 1 30  ? 22.010  -35.006 18.870  1.00 15.81 ? 30  VAL B N     1 
ATOM   6731  C  CA    . VAL D 1 30  ? 20.607  -35.293 19.268  1.00 13.80 ? 30  VAL B CA    1 
ATOM   6732  C  C     . VAL D 1 30  ? 19.958  -36.128 18.156  1.00 16.65 ? 30  VAL B C     1 
ATOM   6733  O  O     . VAL D 1 30  ? 19.916  -35.743 16.984  1.00 17.62 ? 30  VAL B O     1 
ATOM   6734  C  CB    . VAL D 1 30  ? 19.770  -34.017 19.477  1.00 16.59 ? 30  VAL B CB    1 
ATOM   6735  C  CG1   . VAL D 1 30  ? 18.270  -34.403 19.772  1.00 16.53 ? 30  VAL B CG1   1 
ATOM   6736  C  CG2   . VAL D 1 30  ? 20.352  -33.172 20.575  1.00 20.21 ? 30  VAL B CG2   1 
ATOM   6737  H  H     . VAL D 1 30  ? 22.098  -34.308 18.376  1.00 18.91 ? 30  VAL B H     1 
ATOM   6738  H  HA    . VAL D 1 30  ? 20.599  -35.813 20.098  1.00 16.49 ? 30  VAL B HA    1 
ATOM   6739  H  HB    . VAL D 1 30  ? 19.787  -33.489 18.651  1.00 19.85 ? 30  VAL B HB    1 
ATOM   6740  H  HG11  . VAL D 1 30  ? 18.185  -35.360 19.761  1.00 19.78 ? 30  VAL B HG11  1 
ATOM   6741  H  HG12  . VAL D 1 30  ? 18.024  -34.063 20.635  1.00 19.78 ? 30  VAL B HG12  1 
ATOM   6742  H  HG13  . VAL D 1 30  ? 17.709  -34.017 19.095  1.00 19.78 ? 30  VAL B HG13  1 
ATOM   6743  H  HG21  . VAL D 1 30  ? 21.134  -33.607 20.923  1.00 24.19 ? 30  VAL B HG21  1 
ATOM   6744  H  HG22  . VAL D 1 30  ? 20.588  -32.313 20.217  1.00 24.19 ? 30  VAL B HG22  1 
ATOM   6745  H  HG23  . VAL D 1 30  ? 19.697  -33.069 21.270  1.00 24.19 ? 30  VAL B HG23  1 
ATOM   6746  N  N     . CYS D 1 31  ? 19.511  -37.300 18.556  1.00 15.42 ? 31  CYS B N     1 
ATOM   6747  C  CA    . CYS D 1 31  ? 19.150  -38.356 17.652  1.00 17.43 ? 31  CYS B CA    1 
ATOM   6748  C  C     . CYS D 1 31  ? 17.669  -38.690 17.770  1.00 19.67 ? 31  CYS B C     1 
ATOM   6749  O  O     . CYS D 1 31  ? 17.097  -38.698 18.876  1.00 16.93 ? 31  CYS B O     1 
ATOM   6750  C  CB    . CYS D 1 31  ? 19.895  -39.621 18.016  1.00 21.60 ? 31  CYS B CB    1 
ATOM   6751  S  SG    . CYS D 1 31  ? 21.660  -39.413 17.786  1.00 23.89 ? 31  CYS B SG    1 
ATOM   6752  H  H     . CYS D 1 31  ? 19.405  -37.511 19.383  1.00 18.44 ? 31  CYS B H     1 
ATOM   6753  H  HA    . CYS D 1 31  ? 19.359  -38.107 16.728  1.00 20.86 ? 31  CYS B HA    1 
ATOM   6754  H  HB2   . CYS D 1 31  ? 19.731  -39.834 18.948  1.00 25.86 ? 31  CYS B HB2   1 
ATOM   6755  H  HB3   . CYS D 1 31  ? 19.595  -40.347 17.446  1.00 25.86 ? 31  CYS B HB3   1 
ATOM   6756  H  HG    . CYS D 1 31  ? 21.876  -39.151 16.635  1.00 28.61 ? 31  CYS B HG    1 
ATOM   6757  N  N     . VAL D 1 32  ? 17.130  -39.082 16.629  1.00 16.10 ? 32  VAL B N     1 
ATOM   6758  C  CA    . VAL D 1 32  ? 15.737  -39.558 16.549  1.00 17.57 ? 32  VAL B CA    1 
ATOM   6759  C  C     . VAL D 1 32  ? 15.763  -41.066 16.318  1.00 14.87 ? 32  VAL B C     1 
ATOM   6760  O  O     . VAL D 1 32  ? 15.959  -41.522 15.171  1.00 17.31 ? 32  VAL B O     1 
ATOM   6761  C  CB    . VAL D 1 32  ? 15.015  -38.869 15.390  1.00 17.75 ? 32  VAL B CB    1 
ATOM   6762  C  CG1   . VAL D 1 32  ? 13.519  -39.227 15.410  1.00 18.55 ? 32  VAL B CG1   1 
ATOM   6763  C  CG2   . VAL D 1 32  ? 15.227  -37.350 15.488  1.00 16.61 ? 32  VAL B CG2   1 
ATOM   6764  H  H     . VAL D 1 32  ? 17.544  -39.087 15.876  1.00 19.26 ? 32  VAL B H     1 
ATOM   6765  H  HA    . VAL D 1 32  ? 15.263  -39.366 17.385  1.00 21.02 ? 32  VAL B HA    1 
ATOM   6766  H  HB    . VAL D 1 32  ? 15.395  -39.180 14.541  1.00 21.23 ? 32  VAL B HB    1 
ATOM   6767  H  HG11  . VAL D 1 32  ? 13.349  -39.813 16.152  1.00 22.20 ? 32  VAL B HG11  1 
ATOM   6768  H  HG12  . VAL D 1 32  ? 13.007  -38.421 15.504  1.00 22.20 ? 32  VAL B HG12  1 
ATOM   6769  H  HG13  . VAL D 1 32  ? 13.292  -39.666 14.587  1.00 22.20 ? 32  VAL B HG13  1 
ATOM   6770  H  HG21  . VAL D 1 32  ? 15.768  -37.159 16.257  1.00 19.88 ? 32  VAL B HG21  1 
ATOM   6771  H  HG22  . VAL D 1 32  ? 15.669  -37.045 14.692  1.00 19.88 ? 32  VAL B HG22  1 
ATOM   6772  H  HG23  . VAL D 1 32  ? 14.373  -36.921 15.573  1.00 19.88 ? 32  VAL B HG23  1 
ATOM   6773  N  N     . TYR D 1 33  ? 15.631  -41.812 17.409  1.00 16.45 ? 33  TYR B N     1 
ATOM   6774  C  CA    . TYR D 1 33  ? 15.705  -43.260 17.370  1.00 22.89 ? 33  TYR B CA    1 
ATOM   6775  C  C     . TYR D 1 33  ? 14.362  -43.831 16.982  1.00 26.05 ? 33  TYR B C     1 
ATOM   6776  O  O     . TYR D 1 33  ? 13.375  -43.583 17.671  1.00 22.17 ? 33  TYR B O     1 
ATOM   6777  C  CB    . TYR D 1 33  ? 16.070  -43.811 18.749  1.00 22.09 ? 33  TYR B CB    1 
ATOM   6778  C  CG    . TYR D 1 33  ? 17.506  -43.526 19.139  1.00 25.22 ? 33  TYR B CG    1 
ATOM   6779  C  CD1   . TYR D 1 33  ? 17.818  -42.487 19.999  1.00 24.04 ? 33  TYR B CD1   1 
ATOM   6780  C  CD2   . TYR D 1 33  ? 18.547  -44.304 18.648  1.00 25.54 ? 33  TYR B CD2   1 
ATOM   6781  C  CE1   . TYR D 1 33  ? 19.142  -42.236 20.375  1.00 24.65 ? 33  TYR B CE1   1 
ATOM   6782  C  CE2   . TYR D 1 33  ? 19.876  -44.046 19.009  1.00 29.44 ? 33  TYR B CE2   1 
ATOM   6783  C  CZ    . TYR D 1 33  ? 20.153  -43.009 19.867  1.00 30.53 ? 33  TYR B CZ    1 
ATOM   6784  O  OH    . TYR D 1 33  ? 21.448  -42.737 20.244  1.00 28.16 ? 33  TYR B OH    1 
ATOM   6785  H  H     . TYR D 1 33  ? 15.497  -41.494 18.196  1.00 19.67 ? 33  TYR B H     1 
ATOM   6786  H  HA    . TYR D 1 33  ? 16.379  -43.548 16.719  1.00 27.41 ? 33  TYR B HA    1 
ATOM   6787  H  HB2   . TYR D 1 33  ? 15.493  -43.403 19.414  1.00 26.45 ? 33  TYR B HB2   1 
ATOM   6788  H  HB3   . TYR D 1 33  ? 15.946  -44.773 18.748  1.00 26.45 ? 33  TYR B HB3   1 
ATOM   6789  H  HD1   . TYR D 1 33  ? 17.136  -41.959 20.346  1.00 28.79 ? 33  TYR B HD1   1 
ATOM   6790  H  HD2   . TYR D 1 33  ? 18.359  -45.005 18.066  1.00 30.59 ? 33  TYR B HD2   1 
ATOM   6791  H  HE1   . TYR D 1 33  ? 19.337  -41.532 20.951  1.00 29.52 ? 33  TYR B HE1   1 
ATOM   6792  H  HE2   . TYR D 1 33  ? 20.564  -44.573 18.673  1.00 35.27 ? 33  TYR B HE2   1 
ATOM   6793  H  HH    . TYR D 1 33  ? 21.525  -42.811 21.057  1.00 33.73 ? 33  TYR B HH    1 
ATOM   6794  N  N     . SER D 1 34  ? 14.336  -44.608 15.914  1.00 21.42 ? 34  SER B N     1 
ATOM   6795  C  CA    . SER D 1 34  ? 13.060  -45.125 15.375  1.00 25.92 ? 34  SER B CA    1 
ATOM   6796  C  C     . SER D 1 34  ? 12.603  -46.374 16.119  1.00 35.73 ? 34  SER B C     1 
ATOM   6797  O  O     . SER D 1 34  ? 11.427  -46.721 16.090  1.00 30.40 ? 34  SER B O     1 
ATOM   6798  C  CB    . SER D 1 34  ? 13.190  -45.453 13.892  1.00 25.47 ? 34  SER B CB    1 
ATOM   6799  O  OG    . SER D 1 34  ? 14.159  -46.463 13.670  1.00 30.77 ? 34  SER B OG    1 
ATOM   6800  H  H     . SER D 1 34  ? 15.033  -44.857 15.475  1.00 25.64 ? 34  SER B H     1 
ATOM   6801  H  HA    . SER D 1 34  ? 12.368  -44.438 15.476  1.00 31.04 ? 34  SER B HA    1 
ATOM   6802  H  HB2   . SER D 1 34  ? 12.332  -45.764 13.563  1.00 30.51 ? 34  SER B HB2   1 
ATOM   6803  H  HB3   . SER D 1 34  ? 13.456  -44.652 13.415  1.00 30.51 ? 34  SER B HB3   1 
ATOM   6804  H  HG    . SER D 1 34  ? 14.487  -46.699 14.384  1.00 36.87 ? 34  SER B HG    1 
ATOM   6805  N  N     . GLY D 1 35  ? 13.539  -47.054 16.768  1.00 26.67 ? 35  GLY B N     1 
ATOM   6806  C  CA    . GLY D 1 35  ? 13.205  -48.191 17.608  1.00 35.05 ? 35  GLY B CA    1 
ATOM   6807  C  C     . GLY D 1 35  ? 13.270  -49.526 16.889  1.00 39.44 ? 35  GLY B C     1 
ATOM   6808  O  O     . GLY D 1 35  ? 13.151  -50.589 17.499  1.00 44.03 ? 35  GLY B O     1 
ATOM   6809  H  H     . GLY D 1 35  ? 14.379  -46.875 16.737  1.00 31.94 ? 35  GLY B H     1 
ATOM   6810  H  HA2   . GLY D 1 35  ? 13.818  -48.222 18.359  1.00 42.00 ? 35  GLY B HA2   1 
ATOM   6811  H  HA3   . GLY D 1 35  ? 12.306  -48.078 17.954  1.00 42.00 ? 35  GLY B HA3   1 
ATOM   6812  N  N     . ARG D 1 36  ? 13.453  -49.489 15.582  1.00 32.48 ? 36  ARG B N     1 
ATOM   6813  C  CA    . ARG D 1 36  ? 13.598  -50.726 14.835  1.00 39.34 ? 36  ARG B CA    1 
ATOM   6814  C  C     . ARG D 1 36  ? 14.842  -51.510 15.267  1.00 43.76 ? 36  ARG B C     1 
ATOM   6815  O  O     . ARG D 1 36  ? 14.766  -52.716 15.447  1.00 42.51 ? 36  ARG B O     1 
ATOM   6816  C  CB    . ARG D 1 36  ? 13.631  -50.450 13.345  1.00 35.31 ? 36  ARG B CB    1 
ATOM   6817  C  CG    . ARG D 1 36  ? 14.071  -51.623 12.582  1.00 47.64 ? 36  ARG B CG    1 
ATOM   6818  C  CD    . ARG D 1 36  ? 13.593  -51.528 11.208  1.00 42.54 ? 36  ARG B CD    1 
ATOM   6819  N  NE    . ARG D 1 36  ? 12.148  -51.437 11.158  1.00 42.91 ? 36  ARG B NE    1 
ATOM   6820  C  CZ    . ARG D 1 36  ? 11.466  -51.586 10.038  1.00 38.23 ? 36  ARG B CZ    1 
ATOM   6821  N  NH1   . ARG D 1 36  ? 12.120  -51.852 8.916   1.00 37.82 ? 36  ARG B NH1   1 
ATOM   6822  N  NH2   . ARG D 1 36  ? 10.143  -51.483 10.040  1.00 39.28 ? 36  ARG B NH2   1 
ATOM   6823  H  H     . ARG D 1 36  ? 13.496  -48.773 15.108  1.00 38.92 ? 36  ARG B H     1 
ATOM   6824  H  HA    . ARG D 1 36  ? 12.818  -51.291 15.014  1.00 47.14 ? 36  ARG B HA    1 
ATOM   6825  H  HB2   . ARG D 1 36  ? 12.739  -50.211 13.046  1.00 42.32 ? 36  ARG B HB2   1 
ATOM   6826  H  HB3   . ARG D 1 36  ? 14.249  -49.724 13.168  1.00 42.32 ? 36  ARG B HB3   1 
ATOM   6827  H  HG2   . ARG D 1 36  ? 15.040  -51.658 12.571  1.00 57.11 ? 36  ARG B HG2   1 
ATOM   6828  H  HG3   . ARG D 1 36  ? 13.704  -52.427 12.982  1.00 57.11 ? 36  ARG B HG3   1 
ATOM   6829  H  HD2   . ARG D 1 36  ? 13.963  -50.732 10.795  1.00 50.99 ? 36  ARG B HD2   1 
ATOM   6830  H  HD3   . ARG D 1 36  ? 13.866  -52.319 10.718  1.00 50.99 ? 36  ARG B HD3   1 
ATOM   6831  H  HE    . ARG D 1 36  ? 11.716  -51.481 11.901  1.00 51.44 ? 36  ARG B HE    1 
ATOM   6832  H  HH11  . ARG D 1 36  ? 12.977  -51.915 8.923   1.00 45.32 ? 36  ARG B HH11  1 
ATOM   6833  H  HH12  . ARG D 1 36  ? 11.687  -51.955 8.180   1.00 45.32 ? 36  ARG B HH12  1 
ATOM   6834  H  HH21  . ARG D 1 36  ? 9.725   -51.315 10.773  1.00 47.08 ? 36  ARG B HH21  1 
ATOM   6835  H  HH22  . ARG D 1 36  ? 9.702   -51.589 9.309   1.00 47.08 ? 36  ARG B HH22  1 
ATOM   6836  N  N     . THR D 1 37  ? 15.976  -50.823 15.432  1.00 36.92 ? 37  THR B N     1 
ATOM   6837  C  CA    . THR D 1 37  ? 17.172  -51.420 16.011  1.00 40.25 ? 37  THR B CA    1 
ATOM   6838  C  C     . THR D 1 37  ? 17.619  -50.507 17.149  1.00 44.86 ? 37  THR B C     1 
ATOM   6839  O  O     . THR D 1 37  ? 16.974  -49.501 17.439  1.00 34.02 ? 37  THR B O     1 
ATOM   6840  C  CB    . THR D 1 37  ? 18.317  -51.599 14.973  1.00 37.21 ? 37  THR B CB    1 
ATOM   6841  O  OG1   . THR D 1 37  ? 18.794  -50.319 14.529  1.00 36.09 ? 37  THR B OG1   1 
ATOM   6842  C  CG2   . THR D 1 37  ? 17.837  -52.398 13.772  1.00 46.46 ? 37  THR B CG2   1 
ATOM   6843  H  H     . THR D 1 37  ? 16.075  -49.997 15.211  1.00 44.24 ? 37  THR B H     1 
ATOM   6844  H  HA    . THR D 1 37  ? 16.951  -52.299 16.385  1.00 48.24 ? 37  THR B HA    1 
ATOM   6845  H  HB    . THR D 1 37  ? 19.048  -52.084 15.387  1.00 44.60 ? 37  THR B HB    1 
ATOM   6846  H  HG1   . THR D 1 37  ? 19.397  -50.419 13.982  1.00 43.25 ? 37  THR B HG1   1 
ATOM   6847  H  HG21  . THR D 1 37  ? 18.552  -52.501 13.140  1.00 55.69 ? 37  THR B HG21  1 
ATOM   6848  H  HG22  . THR D 1 37  ? 17.542  -53.267 14.053  1.00 55.69 ? 37  THR B HG22  1 
ATOM   6849  H  HG23  . THR D 1 37  ? 17.107  -51.943 13.346  1.00 55.69 ? 37  THR B HG23  1 
ATOM   6850  N  N     . LYS D 1 38  ? 18.716  -50.848 17.804  1.00 37.42 ? 38  LYS B N     1 
ATOM   6851  C  CA    . LYS D 1 38  ? 19.223  -50.005 18.881  1.00 41.25 ? 38  LYS B CA    1 
ATOM   6852  C  C     . LYS D 1 38  ? 19.738  -48.654 18.360  1.00 35.75 ? 38  LYS B C     1 
ATOM   6853  O  O     . LYS D 1 38  ? 19.743  -47.661 19.089  1.00 39.53 ? 38  LYS B O     1 
ATOM   6854  C  CB    . LYS D 1 38  ? 20.328  -50.734 19.646  1.00 43.79 ? 38  LYS B CB    1 
ATOM   6855  C  CG    . LYS D 1 38  ? 19.801  -51.834 20.542  1.00 52.41 ? 38  LYS B CG    1 
ATOM   6856  C  CD    . LYS D 1 38  ? 20.411  -51.757 21.933  1.00 53.27 ? 38  LYS B CD    1 
ATOM   6857  C  CE    . LYS D 1 38  ? 19.553  -52.512 22.944  1.00 62.41 ? 38  LYS B CE    1 
ATOM   6858  N  NZ    . LYS D 1 38  ? 20.192  -52.593 24.288  1.00 68.49 ? 38  LYS B NZ    1 
ATOM   6859  H  H     . LYS D 1 38  ? 19.183  -51.553 17.651  1.00 44.84 ? 38  LYS B H     1 
ATOM   6860  H  HA    . LYS D 1 38  ? 18.493  -49.824 19.510  1.00 49.44 ? 38  LYS B HA    1 
ATOM   6861  H  HB2   . LYS D 1 38  ? 20.940  -51.134 19.010  1.00 52.49 ? 38  LYS B HB2   1 
ATOM   6862  H  HB3   . LYS D 1 38  ? 20.800  -50.095 20.203  1.00 52.49 ? 38  LYS B HB3   1 
ATOM   6863  H  HG2   . LYS D 1 38  ? 18.839  -51.745 20.626  1.00 62.83 ? 38  LYS B HG2   1 
ATOM   6864  H  HG3   . LYS D 1 38  ? 20.027  -52.695 20.158  1.00 62.83 ? 38  LYS B HG3   1 
ATOM   6865  H  HD2   . LYS D 1 38  ? 21.294  -52.158 21.920  1.00 63.86 ? 38  LYS B HD2   1 
ATOM   6866  H  HD3   . LYS D 1 38  ? 20.466  -50.829 22.210  1.00 63.86 ? 38  LYS B HD3   1 
ATOM   6867  H  HE2   . LYS D 1 38  ? 18.703  -52.055 23.043  1.00 74.83 ? 38  LYS B HE2   1 
ATOM   6868  H  HE3   . LYS D 1 38  ? 19.409  -53.417 22.625  1.00 74.83 ? 38  LYS B HE3   1 
ATOM   6869  H  HZ1   . LYS D 1 38  ? 19.664  -53.039 24.850  1.00 82.12 ? 38  LYS B HZ1   1 
ATOM   6870  H  HZ2   . LYS D 1 38  ? 20.973  -53.015 24.229  1.00 82.12 ? 38  LYS B HZ2   1 
ATOM   6871  H  HZ3   . LYS D 1 38  ? 20.330  -51.774 24.609  1.00 82.12 ? 38  LYS B HZ3   1 
ATOM   6872  N  N     . THR D 1 39  ? 20.138  -48.619 17.096  1.00 29.85 ? 39  THR B N     1 
ATOM   6873  C  CA    . THR D 1 39  ? 20.778  -47.440 16.534  1.00 32.78 ? 39  THR B CA    1 
ATOM   6874  C  C     . THR D 1 39  ? 20.097  -46.910 15.286  1.00 33.36 ? 39  THR B C     1 
ATOM   6875  O  O     . THR D 1 39  ? 20.570  -45.943 14.706  1.00 31.45 ? 39  THR B O     1 
ATOM   6876  C  CB    . THR D 1 39  ? 22.244  -47.745 16.170  1.00 35.04 ? 39  THR B CB    1 
ATOM   6877  O  OG1   . THR D 1 39  ? 22.287  -48.827 15.235  1.00 34.21 ? 39  THR B OG1   1 
ATOM   6878  C  CG2   . THR D 1 39  ? 23.047  -48.110 17.414  1.00 39.34 ? 39  THR B CG2   1 
ATOM   6879  H  H     . THR D 1 39  ? 20.050  -49.270 16.540  1.00 35.76 ? 39  THR B H     1 
ATOM   6880  H  HA    . THR D 1 39  ? 20.775  -46.727 17.206  1.00 39.28 ? 39  THR B HA    1 
ATOM   6881  H  HB    . THR D 1 39  ? 22.645  -46.958 15.768  1.00 41.99 ? 39  THR B HB    1 
ATOM   6882  H  HG1   . THR D 1 39  ? 23.064  -48.995 15.036  1.00 40.99 ? 39  THR B HG1   1 
ATOM   6883  H  HG21  . THR D 1 39  ? 23.957  -48.297 17.174  1.00 47.15 ? 39  THR B HG21  1 
ATOM   6884  H  HG22  . THR D 1 39  ? 23.032  -47.382 18.039  1.00 47.15 ? 39  THR B HG22  1 
ATOM   6885  H  HG23  . THR D 1 39  ? 22.668  -48.888 17.831  1.00 47.15 ? 39  THR B HG23  1 
ATOM   6886  N  N     . SER D 1 40  ? 18.989  -47.516 14.855  1.00 26.93 ? 40  SER B N     1 
ATOM   6887  C  CA    . SER D 1 40  ? 18.307  -47.020 13.677  1.00 26.09 ? 40  SER B CA    1 
ATOM   6888  C  C     . SER D 1 40  ? 17.702  -45.657 14.013  1.00 24.23 ? 40  SER B C     1 
ATOM   6889  O  O     . SER D 1 40  ? 17.124  -45.492 15.094  1.00 23.99 ? 40  SER B O     1 
ATOM   6890  C  CB    . SER D 1 40  ? 17.187  -47.980 13.249  1.00 30.69 ? 40  SER B CB    1 
ATOM   6891  O  OG    . SER D 1 40  ? 16.280  -48.145 14.315  1.00 24.54 ? 40  SER B OG    1 
ATOM   6892  H  H     . SER D 1 40  ? 18.624  -48.201 15.224  1.00 32.26 ? 40  SER B H     1 
ATOM   6893  H  HA    . SER D 1 40  ? 18.942  -46.917 12.937  1.00 31.24 ? 40  SER B HA    1 
ATOM   6894  H  HB2   . SER D 1 40  ? 16.719  -47.607 12.485  1.00 36.77 ? 40  SER B HB2   1 
ATOM   6895  H  HB3   . SER D 1 40  ? 17.572  -48.840 13.020  1.00 36.77 ? 40  SER B HB3   1 
ATOM   6896  H  HG    . SER D 1 40  ? 15.678  -48.657 14.095  1.00 29.38 ? 40  SER B HG    1 
ATOM   6897  N  N     . GLY D 1 41  ? 17.850  -44.701 13.094  1.00 24.86 ? 41  GLY B N     1 
ATOM   6898  C  CA    . GLY D 1 41  ? 17.265  -43.366 13.242  1.00 22.60 ? 41  GLY B CA    1 
ATOM   6899  C  C     . GLY D 1 41  ? 18.039  -42.308 12.481  1.00 22.73 ? 41  GLY B C     1 
ATOM   6900  O  O     . GLY D 1 41  ? 18.970  -42.609 11.713  1.00 18.33 ? 41  GLY B O     1 
ATOM   6901  H  H     . GLY D 1 41  ? 18.291  -44.803 12.363  1.00 29.77 ? 41  GLY B H     1 
ATOM   6902  H  HA2   . GLY D 1 41  ? 16.352  -43.375 12.914  1.00 27.06 ? 41  GLY B HA2   1 
ATOM   6903  H  HA3   . GLY D 1 41  ? 17.253  -43.122 14.181  1.00 27.06 ? 41  GLY B HA3   1 
ATOM   6904  N  N     . ALA D 1 42  ? 17.658  -41.050 12.678  1.00 19.67 ? 42  ALA B N     1 
ATOM   6905  C  CA    . ALA D 1 42  ? 18.331  -39.948 12.012  1.00 16.16 ? 42  ALA B CA    1 
ATOM   6906  C  C     . ALA D 1 42  ? 18.750  -38.880 12.996  1.00 21.49 ? 42  ALA B C     1 
ATOM   6907  O  O     . ALA D 1 42  ? 18.191  -38.789 14.052  1.00 15.03 ? 42  ALA B O     1 
ATOM   6908  C  CB    . ALA D 1 42  ? 17.454  -39.347 10.944  1.00 22.68 ? 42  ALA B CB    1 
ATOM   6909  H  H     . ALA D 1 42  ? 17.013  -40.810 13.193  1.00 23.54 ? 42  ALA B H     1 
ATOM   6910  H  HA    . ALA D 1 42  ? 19.141  -40.289 11.578  1.00 19.33 ? 42  ALA B HA    1 
ATOM   6911  H  HB1   . ALA D 1 42  ? 17.925  -38.623 10.524  1.00 27.15 ? 42  ALA B HB1   1 
ATOM   6912  H  HB2   . ALA D 1 42  ? 17.245  -40.023 10.296  1.00 27.15 ? 42  ALA B HB2   1 
ATOM   6913  H  HB3   . ALA D 1 42  ? 16.647  -39.021 11.350  1.00 27.15 ? 42  ALA B HB3   1 
ATOM   6914  N  N     . VAL D 1 43  ? 19.739  -38.057 12.628  1.00 17.69 ? 43  VAL B N     1 
ATOM   6915  C  CA    . VAL D 1 43  ? 20.193  -36.999 13.504  1.00 17.00 ? 43  VAL B CA    1 
ATOM   6916  C  C     . VAL D 1 43  ? 19.270  -35.802 13.368  1.00 16.95 ? 43  VAL B C     1 
ATOM   6917  O  O     . VAL D 1 43  ? 19.008  -35.334 12.244  1.00 15.21 ? 43  VAL B O     1 
ATOM   6918  C  CB    . VAL D 1 43  ? 21.637  -36.562 13.156  1.00 21.77 ? 43  VAL B CB    1 
ATOM   6919  C  CG1   . VAL D 1 43  ? 22.001  -35.306 13.939  1.00 16.34 ? 43  VAL B CG1   1 
ATOM   6920  C  CG2   . VAL D 1 43  ? 22.629  -37.710 13.448  1.00 20.88 ? 43  VAL B CG2   1 
ATOM   6921  H  H     . VAL D 1 43  ? 20.156  -38.099 11.877  1.00 21.16 ? 43  VAL B H     1 
ATOM   6922  H  HA    . VAL D 1 43  ? 20.174  -37.308 14.434  1.00 20.34 ? 43  VAL B HA    1 
ATOM   6923  H  HB    . VAL D 1 43  ? 21.687  -36.351 12.200  1.00 26.06 ? 43  VAL B HB    1 
ATOM   6924  H  HG11  . VAL D 1 43  ? 21.254  -35.051 14.485  1.00 19.54 ? 43  VAL B HG11  1 
ATOM   6925  H  HG12  . VAL D 1 43  ? 22.763  -35.493 14.492  1.00 19.54 ? 43  VAL B HG12  1 
ATOM   6926  H  HG13  . VAL D 1 43  ? 22.210  -34.602 13.320  1.00 19.54 ? 43  VAL B HG13  1 
ATOM   6927  H  HG21  . VAL D 1 43  ? 23.516  -37.420 13.226  1.00 25.00 ? 43  VAL B HG21  1 
ATOM   6928  H  HG22  . VAL D 1 43  ? 22.581  -37.935 14.380  1.00 25.00 ? 43  VAL B HG22  1 
ATOM   6929  H  HG23  . VAL D 1 43  ? 22.390  -38.472 12.914  1.00 25.00 ? 43  VAL B HG23  1 
ATOM   6930  N  N     . ALA D 1 44  ? 18.787  -35.294 14.511  1.00 16.83 ? 44  ALA B N     1 
ATOM   6931  C  CA    . ALA D 1 44  ? 17.972  -34.072 14.503  1.00 16.36 ? 44  ALA B CA    1 
ATOM   6932  C  C     . ALA D 1 44  ? 18.882  -32.842 14.463  1.00 14.90 ? 44  ALA B C     1 
ATOM   6933  O  O     . ALA D 1 44  ? 18.650  -31.915 13.683  1.00 18.49 ? 44  ALA B O     1 
ATOM   6934  C  CB    . ALA D 1 44  ? 17.064  -33.987 15.707  1.00 15.65 ? 44  ALA B CB    1 
ATOM   6935  H  H     . ALA D 1 44  ? 18.914  -35.633 15.291  1.00 20.14 ? 44  ALA B H     1 
ATOM   6936  H  HA    . ALA D 1 44  ? 17.412  -34.065 13.699  1.00 19.57 ? 44  ALA B HA    1 
ATOM   6937  H  HB1   . ALA D 1 44  ? 16.474  -34.745 15.707  1.00 18.72 ? 44  ALA B HB1   1 
ATOM   6938  H  HB2   . ALA D 1 44  ? 17.600  -33.989 16.503  1.00 18.72 ? 44  ALA B HB2   1 
ATOM   6939  H  HB3   . ALA D 1 44  ? 16.554  -33.175 15.657  1.00 18.72 ? 44  ALA B HB3   1 
ATOM   6940  N  N     . THR D 1 45  ? 19.897  -32.828 15.310  1.00 17.82 ? 45  THR B N     1 
ATOM   6941  C  CA    . THR D 1 45  ? 20.911  -31.791 15.204  1.00 19.55 ? 45  THR B CA    1 
ATOM   6942  C  C     . THR D 1 45  ? 22.153  -32.152 15.983  1.00 16.77 ? 45  THR B C     1 
ATOM   6943  O  O     . THR D 1 45  ? 22.144  -33.069 16.804  1.00 17.76 ? 45  THR B O     1 
ATOM   6944  C  CB    . THR D 1 45  ? 20.377  -30.434 15.602  1.00 31.21 ? 45  THR B CB    1 
ATOM   6945  O  OG1   . THR D 1 45  ? 21.193  -29.408 15.002  1.00 27.72 ? 45  THR B OG1   1 
ATOM   6946  C  CG2   . THR D 1 45  ? 20.345  -30.266 17.111  1.00 18.17 ? 45  THR B CG2   1 
ATOM   6947  H  H     . THR D 1 45  ? 20.022  -33.396 15.944  1.00 21.33 ? 45  THR B H     1 
ATOM   6948  H  HA    . THR D 1 45  ? 21.176  -31.726 14.263  1.00 23.40 ? 45  THR B HA    1 
ATOM   6949  H  HB    . THR D 1 45  ? 19.469  -30.345 15.273  1.00 37.39 ? 45  THR B HB    1 
ATOM   6950  H  HG1   . THR D 1 45  ? 21.969  -29.481 15.259  1.00 33.21 ? 45  THR B HG1   1 
ATOM   6951  H  HG21  . THR D 1 45  ? 21.231  -30.355 17.470  1.00 21.75 ? 45  THR B HG21  1 
ATOM   6952  H  HG22  . THR D 1 45  ? 20.003  -29.398 17.338  1.00 21.75 ? 45  THR B HG22  1 
ATOM   6953  H  HG23  . THR D 1 45  ? 19.780  -30.936 17.504  1.00 21.75 ? 45  THR B HG23  1 
ATOM   6954  N  N     . ALA D 1 46  ? 23.250  -31.459 15.698  1.00 14.10 ? 46  ALA B N     1 
ATOM   6955  C  CA    . ALA D 1 46  ? 24.476  -31.711 16.441  1.00 19.82 ? 46  ALA B CA    1 
ATOM   6956  C  C     . ALA D 1 46  ? 25.019  -30.361 16.867  1.00 16.88 ? 46  ALA B C     1 
ATOM   6957  O  O     . ALA D 1 46  ? 24.780  -29.344 16.207  1.00 17.58 ? 46  ALA B O     1 
ATOM   6958  C  CB    . ALA D 1 46  ? 25.501  -32.452 15.566  1.00 20.86 ? 46  ALA B CB    1 
ATOM   6959  H  H     . ALA D 1 46  ? 23.310  -30.851 15.092  1.00 16.85 ? 46  ALA B H     1 
ATOM   6960  H  HA    . ALA D 1 46  ? 24.284  -32.248 17.238  1.00 23.73 ? 46  ALA B HA    1 
ATOM   6961  H  HB1   . ALA D 1 46  ? 26.297  -32.604 16.080  1.00 24.97 ? 46  ALA B HB1   1 
ATOM   6962  H  HB2   . ALA D 1 46  ? 25.125  -33.290 15.286  1.00 24.97 ? 46  ALA B HB2   1 
ATOM   6963  H  HB3   . ALA D 1 46  ? 25.704  -31.912 14.799  1.00 24.97 ? 46  ALA B HB3   1 
ATOM   6964  N  N     . ASN D 1 47  ? 25.749  -30.340 17.965  1.00 15.51 ? 47  ASN B N     1 
ATOM   6965  C  CA    . ASN D 1 47  ? 26.397  -29.116 18.306  1.00 17.39 ? 47  ASN B CA    1 
ATOM   6966  C  C     . ASN D 1 47  ? 27.587  -28.869 17.365  1.00 19.09 ? 47  ASN B C     1 
ATOM   6967  O  O     . ASN D 1 47  ? 27.948  -29.707 16.527  1.00 15.89 ? 47  ASN B O     1 
ATOM   6968  C  CB    . ASN D 1 47  ? 26.749  -29.051 19.793  1.00 18.32 ? 47  ASN B CB    1 
ATOM   6969  C  CG    . ASN D 1 47  ? 27.844  -30.056 20.217  1.00 20.69 ? 47  ASN B CG    1 
ATOM   6970  O  OD1   . ASN D 1 47  ? 28.397  -30.816 19.412  1.00 17.25 ? 47  ASN B OD1   1 
ATOM   6971  N  ND2   . ASN D 1 47  ? 28.147  -30.043 21.496  1.00 18.59 ? 47  ASN B ND2   1 
ATOM   6972  H  H     . ASN D 1 47  ? 25.876  -30.998 18.505  1.00 18.56 ? 47  ASN B H     1 
ATOM   6973  H  HA    . ASN D 1 47  ? 25.759  -28.390 18.142  1.00 20.81 ? 47  ASN B HA    1 
ATOM   6974  H  HB2   . ASN D 1 47  ? 27.069  -28.159 20.000  1.00 21.92 ? 47  ASN B HB2   1 
ATOM   6975  H  HB3   . ASN D 1 47  ? 25.952  -29.243 20.311  1.00 21.92 ? 47  ASN B HB3   1 
ATOM   6976  H  HD21  . ASN D 1 47  ? 28.748  -30.578 21.801  1.00 22.25 ? 47  ASN B HD21  1 
ATOM   6977  H  HD22  . ASN D 1 47  ? 27.744  -29.501 22.028  1.00 22.25 ? 47  ASN B HD22  1 
ATOM   6978  N  N     . TYR D 1 48  ? 28.165  -27.692 17.480  1.00 18.87 ? 48  TYR B N     1 
ATOM   6979  C  CA    . TYR D 1 48  ? 29.164  -27.273 16.511  1.00 23.80 ? 48  TYR B CA    1 
ATOM   6980  C  C     . TYR D 1 48  ? 30.404  -28.168 16.611  1.00 22.03 ? 48  TYR B C     1 
ATOM   6981  O  O     . TYR D 1 48  ? 31.014  -28.483 15.598  1.00 22.84 ? 48  TYR B O     1 
ATOM   6982  C  CB    . TYR D 1 48  ? 29.496  -25.793 16.688  1.00 21.93 ? 48  TYR B CB    1 
ATOM   6983  C  CG    . TYR D 1 48  ? 28.303  -24.883 16.539  1.00 32.90 ? 48  TYR B CG    1 
ATOM   6984  C  CD1   . TYR D 1 48  ? 27.336  -25.120 15.574  1.00 31.89 ? 48  TYR B CD1   1 
ATOM   6985  C  CD2   . TYR D 1 48  ? 28.128  -23.796 17.385  1.00 37.45 ? 48  TYR B CD2   1 
ATOM   6986  C  CE1   . TYR D 1 48  ? 26.237  -24.297 15.439  1.00 23.27 ? 48  TYR B CE1   1 
ATOM   6987  C  CE2   . TYR D 1 48  ? 27.032  -22.971 17.262  1.00 40.62 ? 48  TYR B CE2   1 
ATOM   6988  C  CZ    . TYR D 1 48  ? 26.084  -23.231 16.278  1.00 30.78 ? 48  TYR B CZ    1 
ATOM   6989  O  OH    . TYR D 1 48  ? 24.987  -22.409 16.132  1.00 43.47 ? 48  TYR B OH    1 
ATOM   6990  H  H     . TYR D 1 48  ? 28.002  -27.119 18.100  1.00 22.59 ? 48  TYR B H     1 
ATOM   6991  H  HA    . TYR D 1 48  ? 28.792  -27.386 15.612  1.00 28.50 ? 48  TYR B HA    1 
ATOM   6992  H  HB2   . TYR D 1 48  ? 29.863  -25.659 17.576  1.00 26.26 ? 48  TYR B HB2   1 
ATOM   6993  H  HB3   . TYR D 1 48  ? 30.151  -25.537 16.020  1.00 26.26 ? 48  TYR B HB3   1 
ATOM   6994  H  HD1   . TYR D 1 48  ? 27.434  -25.846 15.000  1.00 38.21 ? 48  TYR B HD1   1 
ATOM   6995  H  HD2   . TYR D 1 48  ? 28.761  -23.622 18.044  1.00 44.88 ? 48  TYR B HD2   1 
ATOM   6996  H  HE1   . TYR D 1 48  ? 25.602  -24.469 14.781  1.00 27.86 ? 48  TYR B HE1   1 
ATOM   6997  H  HE2   . TYR D 1 48  ? 26.929  -22.241 17.830  1.00 48.68 ? 48  TYR B HE2   1 
ATOM   6998  H  HH    . TYR D 1 48  ? 24.298  -22.842 16.231  1.00 52.10 ? 48  TYR B HH    1 
ATOM   6999  N  N     . GLU D 1 49  ? 30.738  -28.629 17.813  1.00 20.28 ? 49  GLU B N     1 
ATOM   7000  C  CA    . GLU D 1 49  ? 31.853  -29.552 17.984  1.00 20.41 ? 49  GLU B CA    1 
ATOM   7001  C  C     . GLU D 1 49  ? 31.660  -30.836 17.201  1.00 28.07 ? 49  GLU B C     1 
ATOM   7002  O  O     . GLU D 1 49  ? 32.607  -31.369 16.638  1.00 19.06 ? 49  GLU B O     1 
ATOM   7003  C  CB    . GLU D 1 49  ? 32.071  -29.884 19.463  1.00 24.05 ? 49  GLU B CB    1 
ATOM   7004  C  CG    . GLU D 1 49  ? 32.599  -28.691 20.300  1.00 29.58 ? 49  GLU B CG    1 
ATOM   7005  C  CD    . GLU D 1 49  ? 31.552  -27.643 20.637  1.00 36.08 ? 49  GLU B CD    1 
ATOM   7006  O  OE1   . GLU D 1 49  ? 30.330  -27.910 20.463  1.00 20.92 ? 49  GLU B OE1   1 
ATOM   7007  O  OE2   . GLU D 1 49  ? 31.965  -26.537 21.083  1.00 29.36 ? 49  GLU B OE2   1 
ATOM   7008  H  H     . GLU D 1 49  ? 30.335  -28.423 18.544  1.00 24.27 ? 49  GLU B H     1 
ATOM   7009  H  HA    . GLU D 1 49  ? 32.669  -29.122 17.652  1.00 24.43 ? 49  GLU B HA    1 
ATOM   7010  H  HB2   . GLU D 1 49  ? 31.227  -30.166 19.847  1.00 28.80 ? 49  GLU B HB2   1 
ATOM   7011  H  HB3   . GLU D 1 49  ? 32.719  -30.603 19.530  1.00 28.80 ? 49  GLU B HB3   1 
ATOM   7012  H  HG2   . GLU D 1 49  ? 32.953  -29.032 21.136  1.00 35.44 ? 49  GLU B HG2   1 
ATOM   7013  H  HG3   . GLU D 1 49  ? 33.305  -28.251 19.802  1.00 35.44 ? 49  GLU B HG3   1 
ATOM   7014  N  N     . ALA D 1 50  ? 30.432  -31.353 17.182  1.00 19.48 ? 50  ALA B N     1 
ATOM   7015  C  CA    . ALA D 1 50  ? 30.122  -32.528 16.385  1.00 16.05 ? 50  ALA B CA    1 
ATOM   7016  C  C     . ALA D 1 50  ? 30.085  -32.231 14.903  1.00 18.01 ? 50  ALA B C     1 
ATOM   7017  O  O     . ALA D 1 50  ? 30.476  -33.092 14.100  1.00 20.70 ? 50  ALA B O     1 
ATOM   7018  C  CB    . ALA D 1 50  ? 28.818  -33.151 16.814  1.00 17.27 ? 50  ALA B CB    1 
ATOM   7019  H  H     . ALA D 1 50  ? 29.764  -31.040 17.623  1.00 23.31 ? 50  ALA B H     1 
ATOM   7020  H  HA    . ALA D 1 50  ? 30.826  -33.193 16.531  1.00 19.20 ? 50  ALA B HA    1 
ATOM   7021  H  HB1   . ALA D 1 50  ? 28.114  -32.508 16.704  1.00 20.67 ? 50  ALA B HB1   1 
ATOM   7022  H  HB2   . ALA D 1 50  ? 28.646  -33.921 16.268  1.00 20.67 ? 50  ALA B HB2   1 
ATOM   7023  H  HB3   . ALA D 1 50  ? 28.884  -33.410 17.736  1.00 20.67 ? 50  ALA B HB3   1 
ATOM   7024  N  N     . ARG D 1 51  ? 29.620  -31.040 14.524  1.00 16.23 ? 51  ARG B N     1 
ATOM   7025  C  CA    . ARG D 1 51  ? 29.580  -30.675 13.129  1.00 17.53 ? 51  ARG B CA    1 
ATOM   7026  C  C     . ARG D 1 51  ? 31.010  -30.621 12.547  1.00 22.26 ? 51  ARG B C     1 
ATOM   7027  O  O     . ARG D 1 51  ? 31.215  -30.905 11.378  1.00 18.32 ? 51  ARG B O     1 
ATOM   7028  C  CB    . ARG D 1 51  ? 28.885  -29.337 12.922  1.00 22.13 ? 51  ARG B CB    1 
ATOM   7029  C  CG    . ARG D 1 51  ? 27.373  -29.399 13.232  1.00 18.13 ? 51  ARG B CG    1 
ATOM   7030  C  CD    . ARG D 1 51  ? 26.714  -28.080 12.994  1.00 24.40 ? 51  ARG B CD    1 
ATOM   7031  N  NE    . ARG D 1 51  ? 25.454  -28.036 13.725  1.00 21.69 ? 51  ARG B NE    1 
ATOM   7032  C  CZ    . ARG D 1 51  ? 24.549  -27.075 13.591  1.00 24.69 ? 51  ARG B CZ    1 
ATOM   7033  N  NH1   . ARG D 1 51  ? 24.778  -26.067 12.761  1.00 23.05 ? 51  ARG B NH1   1 
ATOM   7034  N  NH2   . ARG D 1 51  ? 23.402  -27.137 14.285  1.00 21.62 ? 51  ARG B NH2   1 
ATOM   7035  H  H     . ARG D 1 51  ? 29.325  -30.435 15.059  1.00 19.41 ? 51  ARG B H     1 
ATOM   7036  H  HA    . ARG D 1 51  ? 29.078  -31.357 12.636  1.00 20.97 ? 51  ARG B HA    1 
ATOM   7037  H  HB2   . ARG D 1 51  ? 29.285  -28.678 13.510  1.00 26.50 ? 51  ARG B HB2   1 
ATOM   7038  H  HB3   . ARG D 1 51  ? 28.990  -29.066 11.997  1.00 26.50 ? 51  ARG B HB3   1 
ATOM   7039  H  HG2   . ARG D 1 51  ? 26.954  -30.057 12.656  1.00 21.69 ? 51  ARG B HG2   1 
ATOM   7040  H  HG3   . ARG D 1 51  ? 27.247  -29.638 14.164  1.00 21.69 ? 51  ARG B HG3   1 
ATOM   7041  H  HD2   . ARG D 1 51  ? 27.286  -27.365 13.316  1.00 29.21 ? 51  ARG B HD2   1 
ATOM   7042  H  HD3   . ARG D 1 51  ? 26.529  -27.972 12.048  1.00 29.21 ? 51  ARG B HD3   1 
ATOM   7043  H  HE    . ARG D 1 51  ? 25.305  -28.650 14.309  1.00 25.96 ? 51  ARG B HE    1 
ATOM   7044  H  HH11  . ARG D 1 51  ? 25.511  -26.039 12.312  1.00 27.60 ? 51  ARG B HH11  1 
ATOM   7045  H  HH12  . ARG D 1 51  ? 24.195  -25.442 12.673  1.00 27.60 ? 51  ARG B HH12  1 
ATOM   7046  H  HH21  . ARG D 1 51  ? 23.261  -27.791 14.826  1.00 25.88 ? 51  ARG B HH21  1 
ATOM   7047  H  HH22  . ARG D 1 51  ? 22.819  -26.510 14.208  1.00 25.88 ? 51  ARG B HH22  1 
ATOM   7048  N  N     . LYS D 1 52  ? 31.967  -30.234 13.365  1.00 22.60 ? 52  LYS B N     1 
ATOM   7049  C  CA    . LYS D 1 52  ? 33.373  -30.175 12.925  1.00 23.83 ? 52  LYS B CA    1 
ATOM   7050  C  C     . LYS D 1 52  ? 33.889  -31.538 12.491  1.00 26.09 ? 52  LYS B C     1 
ATOM   7051  O  O     . LYS D 1 52  ? 34.867  -31.617 11.728  1.00 29.22 ? 52  LYS B O     1 
ATOM   7052  C  CB    . LYS D 1 52  ? 34.237  -29.599 14.042  1.00 22.62 ? 52  LYS B CB    1 
ATOM   7053  C  CG    . LYS D 1 52  ? 34.014  -28.094 14.242  1.00 29.89 ? 52  LYS B CG    1 
ATOM   7054  C  CD    . LYS D 1 52  ? 35.011  -27.482 15.245  1.00 39.23 ? 52  LYS B CD    1 
ATOM   7055  C  CE    . LYS D 1 52  ? 34.918  -25.957 15.226  1.00 50.83 ? 52  LYS B CE    1 
ATOM   7056  N  NZ    . LYS D 1 52  ? 35.967  -25.297 16.047  1.00 69.89 ? 52  LYS B NZ    1 
ATOM   7057  H  H     . LYS D 1 52  ? 31.844  -29.998 14.183  1.00 27.06 ? 52  LYS B H     1 
ATOM   7058  H  HA    . LYS D 1 52  ? 33.438  -29.573 12.155  1.00 28.54 ? 52  LYS B HA    1 
ATOM   7059  H  HB2   . LYS D 1 52  ? 34.021  -30.048 14.874  1.00 27.08 ? 52  LYS B HB2   1 
ATOM   7060  H  HB3   . LYS D 1 52  ? 35.172  -29.737 13.823  1.00 27.08 ? 52  LYS B HB3   1 
ATOM   7061  H  HG2   . LYS D 1 52  ? 34.125  -27.641 13.392  1.00 35.81 ? 52  LYS B HG2   1 
ATOM   7062  H  HG3   . LYS D 1 52  ? 33.117  -27.949 14.583  1.00 35.81 ? 52  LYS B HG3   1 
ATOM   7063  H  HD2   . LYS D 1 52  ? 34.802  -27.792 16.140  1.00 47.01 ? 52  LYS B HD2   1 
ATOM   7064  H  HD3   . LYS D 1 52  ? 35.914  -27.738 15.000  1.00 47.01 ? 52  LYS B HD3   1 
ATOM   7065  H  HE2   . LYS D 1 52  ? 35.015  -25.648 14.312  1.00 60.94 ? 52  LYS B HE2   1 
ATOM   7066  H  HE3   . LYS D 1 52  ? 34.053  -25.691 15.575  1.00 60.94 ? 52  LYS B HE3   1 
ATOM   7067  H  HZ1   . LYS D 1 52  ? 35.897  -25.556 16.895  1.00 83.80 ? 52  LYS B HZ1   1 
ATOM   7068  H  HZ2   . LYS D 1 52  ? 36.774  -25.517 15.743  1.00 83.80 ? 52  LYS B HZ2   1 
ATOM   7069  H  HZ3   . LYS D 1 52  ? 35.874  -24.413 16.006  1.00 83.80 ? 52  LYS B HZ3   1 
ATOM   7070  N  N     . LEU D 1 53  ? 33.252  -32.611 12.972  1.00 21.45 ? 53  LEU B N     1 
ATOM   7071  C  CA    . LEU D 1 53  ? 33.627  -33.977 12.610  1.00 20.46 ? 53  LEU B CA    1 
ATOM   7072  C  C     . LEU D 1 53  ? 32.786  -34.540 11.452  1.00 24.58 ? 53  LEU B C     1 
ATOM   7073  O  O     . LEU D 1 53  ? 32.955  -35.686 11.046  1.00 22.81 ? 53  LEU B O     1 
ATOM   7074  C  CB    . LEU D 1 53  ? 33.513  -34.896 13.815  1.00 20.93 ? 53  LEU B CB    1 
ATOM   7075  C  CG    . LEU D 1 53  ? 34.318  -34.398 15.023  1.00 21.79 ? 53  LEU B CG    1 
ATOM   7076  C  CD1   . LEU D 1 53  ? 34.165  -35.295 16.191  1.00 27.41 ? 53  LEU B CD1   1 
ATOM   7077  C  CD2   . LEU D 1 53  ? 35.789  -34.317 14.628  1.00 26.52 ? 53  LEU B CD2   1 
ATOM   7078  H  H     . LEU D 1 53  ? 32.589  -32.570 13.519  1.00 25.68 ? 53  LEU B H     1 
ATOM   7079  H  HA    . LEU D 1 53  ? 34.564  -33.977 12.323  1.00 24.49 ? 53  LEU B HA    1 
ATOM   7080  H  HB2   . LEU D 1 53  ? 32.581  -34.955 14.080  1.00 25.06 ? 53  LEU B HB2   1 
ATOM   7081  H  HB3   . LEU D 1 53  ? 33.846  -35.774 13.575  1.00 25.06 ? 53  LEU B HB3   1 
ATOM   7082  H  HG    . LEU D 1 53  ? 34.016  -33.511 15.273  1.00 26.09 ? 53  LEU B HG    1 
ATOM   7083  H  HD11  . LEU D 1 53  ? 34.479  -36.171 15.954  1.00 32.83 ? 53  LEU B HD11  1 
ATOM   7084  H  HD12  . LEU D 1 53  ? 34.683  -34.948 16.921  1.00 32.83 ? 53  LEU B HD12  1 
ATOM   7085  H  HD13  . LEU D 1 53  ? 33.238  -35.334 16.435  1.00 32.83 ? 53  LEU B HD13  1 
ATOM   7086  H  HD21  . LEU D 1 53  ? 35.882  -33.706 13.894  1.00 31.77 ? 53  LEU B HD21  1 
ATOM   7087  H  HD22  . LEU D 1 53  ? 36.298  -34.006 15.380  1.00 31.77 ? 53  LEU B HD22  1 
ATOM   7088  H  HD23  . LEU D 1 53  ? 36.091  -35.191 14.367  1.00 31.77 ? 53  LEU B HD23  1 
ATOM   7089  N  N     . GLY D 1 54  ? 31.873  -33.737 10.940  1.00 20.30 ? 54  GLY B N     1 
ATOM   7090  C  CA    . GLY D 1 54  ? 31.112  -34.134 9.768   1.00 26.10 ? 54  GLY B CA    1 
ATOM   7091  C  C     . GLY D 1 54  ? 29.661  -34.536 10.065  1.00 26.65 ? 54  GLY B C     1 
ATOM   7092  O  O     . GLY D 1 54  ? 28.920  -34.895 9.158   1.00 25.26 ? 54  GLY B O     1 
ATOM   7093  H  H     . GLY D 1 54  ? 31.673  -32.959 11.249  1.00 24.30 ? 54  GLY B H     1 
ATOM   7094  H  HA2   . GLY D 1 54  ? 31.097  -33.398 9.136   1.00 31.26 ? 54  GLY B HA2   1 
ATOM   7095  H  HA3   . GLY D 1 54  ? 31.552  -34.887 9.344   1.00 31.26 ? 54  GLY B HA3   1 
ATOM   7096  N  N     . VAL D 1 55  ? 29.245  -34.474 11.317  1.00 21.22 ? 55  VAL B N     1 
ATOM   7097  C  CA    . VAL D 1 55  ? 27.849  -34.842 11.642  1.00 20.59 ? 55  VAL B CA    1 
ATOM   7098  C  C     . VAL D 1 55  ? 26.918  -33.733 11.157  1.00 21.69 ? 55  VAL B C     1 
ATOM   7099  O  O     . VAL D 1 55  ? 27.187  -32.533 11.373  1.00 20.28 ? 55  VAL B O     1 
ATOM   7100  C  CB    . VAL D 1 55  ? 27.636  -35.104 13.151  1.00 19.79 ? 55  VAL B CB    1 
ATOM   7101  C  CG1   . VAL D 1 55  ? 26.200  -35.610 13.410  1.00 24.70 ? 55  VAL B CG1   1 
ATOM   7102  C  CG2   . VAL D 1 55  ? 28.633  -36.099 13.694  1.00 18.94 ? 55  VAL B CG2   1 
ATOM   7103  H  H     . VAL D 1 55  ? 29.723  -34.232 11.989  1.00 25.40 ? 55  VAL B H     1 
ATOM   7104  H  HA    . VAL D 1 55  ? 27.616  -35.662 11.159  1.00 24.64 ? 55  VAL B HA    1 
ATOM   7105  H  HB    . VAL D 1 55  ? 27.753  -34.263 13.640  1.00 23.69 ? 55  VAL B HB    1 
ATOM   7106  H  HG11  . VAL D 1 55  ? 26.088  -35.767 14.350  1.00 29.58 ? 55  VAL B HG11  1 
ATOM   7107  H  HG12  . VAL D 1 55  ? 25.576  -34.943 13.112  1.00 29.58 ? 55  VAL B HG12  1 
ATOM   7108  H  HG13  . VAL D 1 55  ? 26.064  -36.426 12.923  1.00 29.58 ? 55  VAL B HG13  1 
ATOM   7109  H  HG21  . VAL D 1 55  ? 29.214  -36.378 12.983  1.00 22.66 ? 55  VAL B HG21  1 
ATOM   7110  H  HG22  . VAL D 1 55  ? 29.145  -35.680 14.390  1.00 22.66 ? 55  VAL B HG22  1 
ATOM   7111  H  HG23  . VAL D 1 55  ? 28.159  -36.855 14.047  1.00 22.66 ? 55  VAL B HG23  1 
ATOM   7112  N  N     . LYS D 1 56  ? 25.849  -34.132 10.456  1.00 22.45 ? 56  LYS B N     1 
ATOM   7113  C  CA    . LYS D 1 56  ? 24.884  -33.189 9.882   1.00 23.17 ? 56  LYS B CA    1 
ATOM   7114  C  C     . LYS D 1 56  ? 23.444  -33.619 10.220  1.00 20.10 ? 56  LYS B C     1 
ATOM   7115  O  O     . LYS D 1 56  ? 23.160  -34.803 10.348  1.00 19.47 ? 56  LYS B O     1 
ATOM   7116  C  CB    . LYS D 1 56  ? 25.007  -33.132 8.346   1.00 28.96 ? 56  LYS B CB    1 
ATOM   7117  C  CG    . LYS D 1 56  ? 26.369  -32.713 7.819   1.00 45.29 ? 56  LYS B CG    1 
ATOM   7118  C  CD    . LYS D 1 56  ? 26.385  -32.607 6.286   1.00 48.10 ? 56  LYS B CD    1 
ATOM   7119  C  CE    . LYS D 1 56  ? 26.504  -33.976 5.595   1.00 65.53 ? 56  LYS B CE    1 
ATOM   7120  N  NZ    . LYS D 1 56  ? 26.729  -33.869 4.106   1.00 61.95 ? 56  LYS B NZ    1 
ATOM   7121  H  H     . LYS D 1 56  ? 25.659  -34.955 10.298  1.00 26.88 ? 56  LYS B H     1 
ATOM   7122  H  HA    . LYS D 1 56  ? 25.040  -32.292 10.245  1.00 27.75 ? 56  LYS B HA    1 
ATOM   7123  H  HB2   . LYS D 1 56  ? 24.816  -34.014 7.989   1.00 34.69 ? 56  LYS B HB2   1 
ATOM   7124  H  HB3   . LYS D 1 56  ? 24.356  -32.498 8.008   1.00 34.69 ? 56  LYS B HB3   1 
ATOM   7125  H  HG2   . LYS D 1 56  ? 26.599  -31.845 8.184   1.00 54.28 ? 56  LYS B HG2   1 
ATOM   7126  H  HG3   . LYS D 1 56  ? 27.029  -33.373 8.083   1.00 54.28 ? 56  LYS B HG3   1 
ATOM   7127  H  HD2   . LYS D 1 56  ? 25.560  -32.192 5.989   1.00 57.66 ? 56  LYS B HD2   1 
ATOM   7128  H  HD3   . LYS D 1 56  ? 27.144  -32.067 6.015   1.00 57.66 ? 56  LYS B HD3   1 
ATOM   7129  H  HE2   . LYS D 1 56  ? 27.255  -34.457 5.977   1.00 78.58 ? 56  LYS B HE2   1 
ATOM   7130  H  HE3   . LYS D 1 56  ? 25.684  -34.474 5.739   1.00 78.58 ? 56  LYS B HE3   1 
ATOM   7131  H  HZ1   . LYS D 1 56  ? 26.050  -33.438 3.726   1.00 74.28 ? 56  LYS B HZ1   1 
ATOM   7132  H  HZ2   . LYS D 1 56  ? 27.482  -33.423 3.943   1.00 74.28 ? 56  LYS B HZ2   1 
ATOM   7133  H  HZ3   . LYS D 1 56  ? 26.792  -34.682 3.749   1.00 74.28 ? 56  LYS B HZ3   1 
ATOM   7134  N  N     . ALA D 1 57  ? 22.554  -32.650 10.394  1.00 17.79 ? 57  ALA B N     1 
ATOM   7135  C  CA    . ALA D 1 57  ? 21.124  -32.943 10.633  1.00 20.85 ? 57  ALA B CA    1 
ATOM   7136  C  C     . ALA D 1 57  ? 20.637  -33.775 9.476   1.00 21.96 ? 57  ALA B C     1 
ATOM   7137  O  O     . ALA D 1 57  ? 21.028  -33.515 8.343   1.00 18.57 ? 57  ALA B O     1 
ATOM   7138  C  CB    . ALA D 1 57  ? 20.310  -31.644 10.710  1.00 20.85 ? 57  ALA B CB    1 
ATOM   7139  H  H     . ALA D 1 57  ? 22.741  -31.810 10.379  1.00 21.28 ? 57  ALA B H     1 
ATOM   7140  H  HA    . ALA D 1 57  ? 21.013  -33.448 11.466  1.00 24.96 ? 57  ALA B HA    1 
ATOM   7141  H  HB1   . ALA D 1 57  ? 19.388  -31.862 10.866  1.00 24.96 ? 57  ALA B HB1   1 
ATOM   7142  H  HB2   . ALA D 1 57  ? 20.646  -31.107 11.431  1.00 24.96 ? 57  ALA B HB2   1 
ATOM   7143  H  HB3   . ALA D 1 57  ? 20.399  -31.170 9.880   1.00 24.96 ? 57  ALA B HB3   1 
ATOM   7144  N  N     . GLY D 1 58  ? 19.798  -34.766 9.761   1.00 19.68 ? 58  GLY B N     1 
ATOM   7145  C  CA    . GLY D 1 58  ? 19.183  -35.595 8.742   1.00 20.00 ? 58  GLY B CA    1 
ATOM   7146  C  C     . GLY D 1 58  ? 19.976  -36.864 8.472   1.00 28.38 ? 58  GLY B C     1 
ATOM   7147  O  O     . GLY D 1 58  ? 19.480  -37.820 7.887   1.00 22.57 ? 58  GLY B O     1 
ATOM   7148  H  H     . GLY D 1 58  ? 19.567  -34.980 10.561  1.00 23.56 ? 58  GLY B H     1 
ATOM   7149  H  HA2   . GLY D 1 58  ? 18.289  -35.846 9.026   1.00 23.94 ? 58  GLY B HA2   1 
ATOM   7150  H  HA3   . GLY D 1 58  ? 19.114  -35.093 7.915   1.00 23.94 ? 58  GLY B HA3   1 
ATOM   7151  N  N     . MET D 1 59  ? 21.240  -36.887 8.876   1.00 18.97 ? 59  MET B N     1 
ATOM   7152  C  CA    . MET D 1 59  ? 22.058  -38.043 8.536   1.00 18.65 ? 59  MET B CA    1 
ATOM   7153  C  C     . MET D 1 59  ? 21.692  -39.211 9.418   1.00 22.36 ? 59  MET B C     1 
ATOM   7154  O  O     . MET D 1 59  ? 21.364  -39.046 10.602  1.00 21.92 ? 59  MET B O     1 
ATOM   7155  C  CB    . MET D 1 59  ? 23.562  -37.698 8.633   1.00 27.88 ? 59  MET B CB    1 
ATOM   7156  C  CG    . MET D 1 59  ? 24.314  -38.364 9.756   1.00 31.37 ? 59  MET B CG    1 
ATOM   7157  S  SD    . MET D 1 59  ? 26.050  -37.766 9.875   1.00 27.51 ? 59  MET B SD    1 
ATOM   7158  C  CE    . MET D 1 59  ? 26.584  -37.666 8.177   1.00 35.09 ? 59  MET B CE    1 
ATOM   7159  H  H     . MET D 1 59  ? 21.636  -36.274 9.330   1.00 22.70 ? 59  MET B H     1 
ATOM   7160  H  HA    . MET D 1 59  ? 21.874  -38.289 7.605   1.00 22.31 ? 59  MET B HA    1 
ATOM   7161  H  HB2   . MET D 1 59  ? 23.990  -37.959 7.803   1.00 33.40 ? 59  MET B HB2   1 
ATOM   7162  H  HB3   . MET D 1 59  ? 23.649  -36.740 8.754   1.00 33.40 ? 59  MET B HB3   1 
ATOM   7163  H  HG2   . MET D 1 59  ? 23.870  -38.171 10.596  1.00 37.58 ? 59  MET B HG2   1 
ATOM   7164  H  HG3   . MET D 1 59  ? 24.335  -39.322 9.601   1.00 37.58 ? 59  MET B HG3   1 
ATOM   7165  H  HE1   . MET D 1 59  ? 27.493  -37.357 8.154   1.00 42.04 ? 59  MET B HE1   1 
ATOM   7166  H  HE2   . MET D 1 59  ? 26.524  -38.537 7.779   1.00 42.04 ? 59  MET B HE2   1 
ATOM   7167  H  HE3   . MET D 1 59  ? 26.016  -37.050 7.707   1.00 42.04 ? 59  MET B HE3   1 
ATOM   7168  N  N     . PRO D 1 60  ? 21.770  -40.417 8.859   1.00 19.17 ? 60  PRO B N     1 
ATOM   7169  C  CA    . PRO D 1 60  ? 21.563  -41.634 9.634   1.00 24.16 ? 60  PRO B CA    1 
ATOM   7170  C  C     . PRO D 1 60  ? 22.412  -41.711 10.896  1.00 21.68 ? 60  PRO B C     1 
ATOM   7171  O  O     . PRO D 1 60  ? 23.622  -41.426 10.829  1.00 23.51 ? 60  PRO B O     1 
ATOM   7172  C  CB    . PRO D 1 60  ? 21.982  -42.738 8.649   1.00 21.34 ? 60  PRO B CB    1 
ATOM   7173  C  CG    . PRO D 1 60  ? 21.805  -42.136 7.303   1.00 27.48 ? 60  PRO B CG    1 
ATOM   7174  C  CD    . PRO D 1 60  ? 22.173  -40.701 7.468   1.00 27.93 ? 60  PRO B CD    1 
ATOM   7175  H  HA    . PRO D 1 60  ? 20.616  -41.740 9.864   1.00 28.94 ? 60  PRO B HA    1 
ATOM   7176  H  HB2   . PRO D 1 60  ? 22.910  -42.976 8.800   1.00 25.55 ? 60  PRO B HB2   1 
ATOM   7177  H  HB3   . PRO D 1 60  ? 21.406  -43.511 8.759   1.00 25.55 ? 60  PRO B HB3   1 
ATOM   7178  H  HG2   . PRO D 1 60  ? 22.396  -42.571 6.670   1.00 32.92 ? 60  PRO B HG2   1 
ATOM   7179  H  HG3   . PRO D 1 60  ? 20.880  -42.223 7.025   1.00 32.92 ? 60  PRO B HG3   1 
ATOM   7180  H  HD2   . PRO D 1 60  ? 23.129  -40.581 7.359   1.00 33.45 ? 60  PRO B HD2   1 
ATOM   7181  H  HD3   . PRO D 1 60  ? 21.670  -40.148 6.849   1.00 33.45 ? 60  PRO B HD3   1 
ATOM   7182  N  N     . ILE D 1 61  ? 21.818  -42.124 12.015  1.00 19.73 ? 61  ILE B N     1 
ATOM   7183  C  CA    . ILE D 1 61  ? 22.553  -42.227 13.286  1.00 19.00 ? 61  ILE B CA    1 
ATOM   7184  C  C     . ILE D 1 61  ? 23.806  -43.087 13.120  1.00 32.48 ? 61  ILE B C     1 
ATOM   7185  O  O     . ILE D 1 61  ? 24.876  -42.749 13.621  1.00 20.65 ? 61  ILE B O     1 
ATOM   7186  C  CB    . ILE D 1 61  ? 21.706  -42.824 14.372  1.00 23.82 ? 61  ILE B CB    1 
ATOM   7187  C  CG1   . ILE D 1 61  ? 20.552  -41.867 14.706  1.00 19.97 ? 61  ILE B CG1   1 
ATOM   7188  C  CG2   . ILE D 1 61  ? 22.537  -43.085 15.646  1.00 27.04 ? 61  ILE B CG2   1 
ATOM   7189  C  CD1   . ILE D 1 61  ? 19.568  -42.503 15.647  1.00 23.12 ? 61  ILE B CD1   1 
ATOM   7190  H  H     . ILE D 1 61  ? 20.991  -42.351 12.070  1.00 23.62 ? 61  ILE B H     1 
ATOM   7191  H  HA    . ILE D 1 61  ? 22.831  -41.332 13.572  1.00 22.74 ? 61  ILE B HA    1 
ATOM   7192  H  HB    . ILE D 1 61  ? 21.337  -43.665 14.059  1.00 28.53 ? 61  ILE B HB    1 
ATOM   7193  H  HG12  . ILE D 1 61  ? 20.909  -41.070 15.130  1.00 23.91 ? 61  ILE B HG12  1 
ATOM   7194  H  HG13  . ILE D 1 61  ? 20.084  -41.632 13.889  1.00 23.91 ? 61  ILE B HG13  1 
ATOM   7195  H  HG21  . ILE D 1 61  ? 22.900  -42.253 15.957  1.00 32.39 ? 61  ILE B HG21  1 
ATOM   7196  H  HG22  . ILE D 1 61  ? 21.966  -43.466 16.318  1.00 32.39 ? 61  ILE B HG22  1 
ATOM   7197  H  HG23  . ILE D 1 61  ? 23.247  -43.695 15.435  1.00 32.39 ? 61  ILE B HG23  1 
ATOM   7198  H  HD11  . ILE D 1 61  ? 20.020  -42.737 16.461  1.00 27.69 ? 61  ILE B HD11  1 
ATOM   7199  H  HD12  . ILE D 1 61  ? 18.864  -41.877 15.832  1.00 27.69 ? 61  ILE B HD12  1 
ATOM   7200  H  HD13  . ILE D 1 61  ? 19.206  -43.291 15.235  1.00 27.69 ? 61  ILE B HD13  1 
ATOM   7201  N  N     . ILE D 1 62  ? 23.665  -44.194 12.408  1.00 24.62 ? 62  ILE B N     1 
ATOM   7202  C  CA    . ILE D 1 62  ? 24.759  -45.154 12.293  1.00 33.29 ? 62  ILE B CA    1 
ATOM   7203  C  C     . ILE D 1 62  ? 25.950  -44.521 11.565  1.00 30.44 ? 62  ILE B C     1 
ATOM   7204  O  O     . ILE D 1 62  ? 27.107  -44.768 11.922  1.00 30.81 ? 62  ILE B O     1 
ATOM   7205  C  CB    . ILE D 1 62  ? 24.301  -46.447 11.577  1.00 28.45 ? 62  ILE B CB    1 
ATOM   7206  C  CG1   . ILE D 1 62  ? 25.387  -47.516 11.678  1.00 45.45 ? 62  ILE B CG1   1 
ATOM   7207  C  CG2   . ILE D 1 62  ? 24.013  -46.178 10.139  1.00 31.01 ? 62  ILE B CG2   1 
ATOM   7208  C  CD1   . ILE D 1 62  ? 25.785  -47.832 13.090  1.00 41.04 ? 62  ILE B CD1   1 
ATOM   7209  H  H     . ILE D 1 62  ? 22.951  -44.415 11.983  1.00 29.49 ? 62  ILE B H     1 
ATOM   7210  H  HA    . ILE D 1 62  ? 25.057  -45.401 13.193  1.00 39.89 ? 62  ILE B HA    1 
ATOM   7211  H  HB    . ILE D 1 62  ? 23.495  -46.775 12.005  1.00 34.08 ? 62  ILE B HB    1 
ATOM   7212  H  HG12  . ILE D 1 62  ? 25.062  -48.333 11.270  1.00 54.48 ? 62  ILE B HG12  1 
ATOM   7213  H  HG13  . ILE D 1 62  ? 26.177  -47.205 11.208  1.00 54.48 ? 62  ILE B HG13  1 
ATOM   7214  H  HG21  . ILE D 1 62  ? 23.316  -45.521 10.078  1.00 37.15 ? 62  ILE B HG21  1 
ATOM   7215  H  HG22  . ILE D 1 62  ? 24.811  -45.850 9.717   1.00 37.15 ? 62  ILE B HG22  1 
ATOM   7216  H  HG23  . ILE D 1 62  ? 23.732  -46.994 9.719   1.00 37.15 ? 62  ILE B HG23  1 
ATOM   7217  H  HD11  . ILE D 1 62  ? 25.016  -48.152 13.566  1.00 49.19 ? 62  ILE B HD11  1 
ATOM   7218  H  HD12  . ILE D 1 62  ? 26.467  -48.508 13.078  1.00 49.19 ? 62  ILE B HD12  1 
ATOM   7219  H  HD13  . ILE D 1 62  ? 26.121  -47.035 13.506  1.00 49.19 ? 62  ILE B HD13  1 
ATOM   7220  N  N     . LYS D 1 63  ? 25.659  -43.696 10.561  1.00 23.34 ? 63  LYS B N     1 
ATOM   7221  C  CA    . LYS D 1 63  ? 26.680  -42.984 9.816   1.00 26.89 ? 63  LYS B CA    1 
ATOM   7222  C  C     . LYS D 1 63  ? 27.345  -41.899 10.636  1.00 32.79 ? 63  LYS B C     1 
ATOM   7223  O  O     . LYS D 1 63  ? 28.542  -41.639 10.478  1.00 27.02 ? 63  LYS B O     1 
ATOM   7224  C  CB    . LYS D 1 63  ? 26.098  -42.381 8.542   1.00 29.35 ? 63  LYS B CB    1 
ATOM   7225  C  CG    . LYS D 1 63  ? 25.645  -43.448 7.526   1.00 47.17 ? 63  LYS B CG    1 
ATOM   7226  C  CD    . LYS D 1 63  ? 26.812  -44.250 6.930   1.00 48.44 ? 63  LYS B CD    1 
ATOM   7227  C  CE    . LYS D 1 63  ? 26.339  -45.556 6.298   1.00 50.92 ? 63  LYS B CE    1 
ATOM   7228  N  NZ    . LYS D 1 63  ? 26.468  -46.705 7.253   1.00 58.85 ? 63  LYS B NZ    1 
ATOM   7229  H  H     . LYS D 1 63  ? 24.859  -43.533 10.291  1.00 27.95 ? 63  LYS B H     1 
ATOM   7230  H  HA    . LYS D 1 63  ? 27.374  -43.622 9.551   1.00 32.20 ? 63  LYS B HA    1 
ATOM   7231  H  HB2   . LYS D 1 63  ? 25.326  -41.840 8.773   1.00 35.16 ? 63  LYS B HB2   1 
ATOM   7232  H  HB3   . LYS D 1 63  ? 26.773  -41.830 8.116   1.00 35.16 ? 63  LYS B HB3   1 
ATOM   7233  H  HG2   . LYS D 1 63  ? 25.049  -44.072 7.970   1.00 56.54 ? 63  LYS B HG2   1 
ATOM   7234  H  HG3   . LYS D 1 63  ? 25.180  -43.010 6.796   1.00 56.54 ? 63  LYS B HG3   1 
ATOM   7235  H  HD2   . LYS D 1 63  ? 27.245  -43.720 6.243   1.00 58.06 ? 63  LYS B HD2   1 
ATOM   7236  H  HD3   . LYS D 1 63  ? 27.443  -44.466 7.635   1.00 58.06 ? 63  LYS B HD3   1 
ATOM   7237  H  HE2   . LYS D 1 63  ? 25.406  -45.471 6.048   1.00 61.05 ? 63  LYS B HE2   1 
ATOM   7238  H  HE3   . LYS D 1 63  ? 26.881  -45.748 5.516   1.00 61.05 ? 63  LYS B HE3   1 
ATOM   7239  H  HZ1   . LYS D 1 63  ? 27.319  -46.804 7.496   1.00 70.56 ? 63  LYS B HZ1   1 
ATOM   7240  H  HZ2   . LYS D 1 63  ? 25.977  -46.553 7.980   1.00 70.56 ? 63  LYS B HZ2   1 
ATOM   7241  H  HZ3   . LYS D 1 63  ? 26.188  -47.455 6.866   1.00 70.56 ? 63  LYS B HZ3   1 
ATOM   7242  N  N     . ALA D 1 64  ? 26.577  -41.237 11.496  1.00 23.72 ? 64  ALA B N     1 
ATOM   7243  C  CA    . ALA D 1 64  ? 27.179  -40.266 12.396  1.00 24.31 ? 64  ALA B CA    1 
ATOM   7244  C  C     . ALA D 1 64  ? 28.146  -41.030 13.289  1.00 27.24 ? 64  ALA B C     1 
ATOM   7245  O  O     . ALA D 1 64  ? 29.284  -40.608 13.480  1.00 25.14 ? 64  ALA B O     1 
ATOM   7246  C  CB    . ALA D 1 64  ? 26.113  -39.556 13.240  1.00 27.80 ? 64  ALA B CB    1 
ATOM   7247  H  H     . ALA D 1 64  ? 25.726  -41.329 11.577  1.00 28.41 ? 64  ALA B H     1 
ATOM   7248  H  HA    . ALA D 1 64  ? 27.679  -39.597 11.883  1.00 29.11 ? 64  ALA B HA    1 
ATOM   7249  H  HB1   . ALA D 1 64  ? 26.544  -38.925 13.820  1.00 33.30 ? 64  ALA B HB1   1 
ATOM   7250  H  HB2   . ALA D 1 64  ? 25.504  -39.101 12.654  1.00 33.30 ? 64  ALA B HB2   1 
ATOM   7251  H  HB3   . ALA D 1 64  ? 25.640  -40.210 13.760  1.00 33.30 ? 64  ALA B HB3   1 
ATOM   7252  N  N     . MET D 1 65  ? 27.680  -42.146 13.846  1.00 25.34 ? 65  MET B N     1 
ATOM   7253  C  CA    . MET D 1 65  ? 28.488  -42.921 14.785  1.00 26.45 ? 65  MET B CA    1 
ATOM   7254  C  C     . MET D 1 65  ? 29.776  -43.403 14.091  1.00 33.42 ? 65  MET B C     1 
ATOM   7255  O  O     . MET D 1 65  ? 30.817  -43.530 14.732  1.00 29.03 ? 65  MET B O     1 
ATOM   7256  C  CB    . MET D 1 65  ? 27.700  -44.102 15.346  1.00 29.12 ? 65  MET B CB    1 
ATOM   7257  C  CG    . MET D 1 65  ? 26.627  -43.701 16.360  1.00 31.82 ? 65  MET B CG    1 
ATOM   7258  S  SD    . MET D 1 65  ? 25.542  -45.082 16.790  1.00 30.08 ? 65  MET B SD    1 
ATOM   7259  C  CE    . MET D 1 65  ? 26.226  -45.486 18.393  1.00 42.03 ? 65  MET B CE    1 
ATOM   7260  H  H     . MET D 1 65  ? 26.900  -42.476 13.696  1.00 30.34 ? 65  MET B H     1 
ATOM   7261  H  HA    . MET D 1 65  ? 28.735  -42.344 15.537  1.00 31.68 ? 65  MET B HA    1 
ATOM   7262  H  HB2   . MET D 1 65  ? 27.259  -44.560 14.614  1.00 34.88 ? 65  MET B HB2   1 
ATOM   7263  H  HB3   . MET D 1 65  ? 28.316  -44.707 15.789  1.00 34.88 ? 65  MET B HB3   1 
ATOM   7264  H  HG2   . MET D 1 65  ? 27.058  -43.392 17.173  1.00 38.13 ? 65  MET B HG2   1 
ATOM   7265  H  HG3   . MET D 1 65  ? 26.081  -42.994 15.982  1.00 38.13 ? 65  MET B HG3   1 
ATOM   7266  H  HE1   . MET D 1 65  ? 25.739  -46.226 18.762  1.00 50.37 ? 65  MET B HE1   1 
ATOM   7267  H  HE2   . MET D 1 65  ? 27.150  -45.722 18.288  1.00 50.37 ? 65  MET B HE2   1 
ATOM   7268  H  HE3   . MET D 1 65  ? 26.146  -44.722 18.968  1.00 50.37 ? 65  MET B HE3   1 
ATOM   7269  N  N     . GLN D 1 66  ? 29.711  -43.633 12.785  1.00 33.74 ? 66  GLN B N     1 
ATOM   7270  C  CA    . GLN D 1 66  ? 30.905  -44.077 12.041  1.00 35.97 ? 66  GLN B CA    1 
ATOM   7271  C  C     . GLN D 1 66  ? 31.978  -42.991 11.992  1.00 35.36 ? 66  GLN B C     1 
ATOM   7272  O  O     . GLN D 1 66  ? 33.170  -43.298 12.088  1.00 39.24 ? 66  GLN B O     1 
ATOM   7273  C  CB    . GLN D 1 66  ? 30.546  -44.586 10.630  1.00 37.42 ? 66  GLN B CB    1 
ATOM   7274  C  CG    . GLN D 1 66  ? 30.213  -46.094 10.626  1.00 54.95 ? 66  GLN B CG    1 
ATOM   7275  C  CD    . GLN D 1 66  ? 29.371  -46.599 9.424   1.00 64.65 ? 66  GLN B CD    1 
ATOM   7276  O  OE1   . GLN D 1 66  ? 29.306  -45.977 8.353   1.00 63.84 ? 66  GLN B OE1   1 
ATOM   7277  N  NE2   . GLN D 1 66  ? 28.730  -47.758 9.617   1.00 62.47 ? 66  GLN B NE2   1 
ATOM   7278  H  H     . GLN D 1 66  ? 29.004  -43.545 12.305  1.00 40.43 ? 66  GLN B H     1 
ATOM   7279  H  HA    . GLN D 1 66  ? 31.293  -44.835 12.525  1.00 43.10 ? 66  GLN B HA    1 
ATOM   7280  H  HB2   . GLN D 1 66  ? 29.769  -44.104 10.306  1.00 44.84 ? 66  GLN B HB2   1 
ATOM   7281  H  HB3   . GLN D 1 66  ? 31.300  -44.441 10.038  1.00 44.84 ? 66  GLN B HB3   1 
ATOM   7282  H  HG2   . GLN D 1 66  ? 31.046  -46.591 10.625  1.00 65.87 ? 66  GLN B HG2   1 
ATOM   7283  H  HG3   . GLN D 1 66  ? 29.716  -46.300 11.434  1.00 65.87 ? 66  GLN B HG3   1 
ATOM   7284  H  HE21  . GLN D 1 66  ? 28.802  -48.169 10.369  1.00 74.90 ? 66  GLN B HE21  1 
ATOM   7285  H  HE22  . GLN D 1 66  ? 28.247  -48.092 8.990   1.00 74.90 ? 66  GLN B HE22  1 
ATOM   7286  N  N     . ILE D 1 67  ? 31.581  -41.727 11.875  1.00 33.13 ? 67  ILE B N     1 
ATOM   7287  C  CA    . ILE D 1 67  ? 32.564  -40.649 11.731  1.00 30.56 ? 67  ILE B CA    1 
ATOM   7288  C  C     . ILE D 1 67  ? 32.871  -39.908 13.030  1.00 34.65 ? 67  ILE B C     1 
ATOM   7289  O  O     . ILE D 1 67  ? 33.857  -39.174 13.113  1.00 30.94 ? 67  ILE B O     1 
ATOM   7290  C  CB    . ILE D 1 67  ? 32.161  -39.623 10.661  1.00 23.34 ? 67  ILE B CB    1 
ATOM   7291  C  CG1   . ILE D 1 67  ? 30.746  -39.072 10.940  1.00 24.83 ? 67  ILE B CG1   1 
ATOM   7292  C  CG2   . ILE D 1 67  ? 32.229  -40.251 9.308   1.00 36.10 ? 67  ILE B CG2   1 
ATOM   7293  C  CD1   . ILE D 1 67  ? 30.441  -37.842 10.140  1.00 31.97 ? 67  ILE B CD1   1 
ATOM   7294  H  H     . ILE D 1 67  ? 30.761  -41.467 11.875  1.00 39.70 ? 67  ILE B H     1 
ATOM   7295  H  HA    . ILE D 1 67  ? 33.405  -41.053 11.431  1.00 36.61 ? 67  ILE B HA    1 
ATOM   7296  H  HB    . ILE D 1 67  ? 32.790  -38.885 10.690  1.00 27.95 ? 67  ILE B HB    1 
ATOM   7297  H  HG12  . ILE D 1 67  ? 30.091  -39.750 10.710  1.00 29.74 ? 67  ILE B HG12  1 
ATOM   7298  H  HG13  . ILE D 1 67  ? 30.674  -38.845 11.880  1.00 29.74 ? 67  ILE B HG13  1 
ATOM   7299  H  HG21  . ILE D 1 67  ? 33.127  -40.548 9.147   1.00 43.26 ? 67  ILE B HG21  1 
ATOM   7300  H  HG22  . ILE D 1 67  ? 31.626  -40.998 9.281   1.00 43.26 ? 67  ILE B HG22  1 
ATOM   7301  H  HG23  . ILE D 1 67  ? 31.975  -39.600 8.649   1.00 43.26 ? 67  ILE B HG23  1 
ATOM   7302  H  HD11  . ILE D 1 67  ? 29.554  -37.544 10.351  1.00 38.30 ? 67  ILE B HD11  1 
ATOM   7303  H  HD12  . ILE D 1 67  ? 31.078  -37.159 10.363  1.00 38.30 ? 67  ILE B HD12  1 
ATOM   7304  H  HD13  . ILE D 1 67  ? 30.502  -38.054 9.205   1.00 38.30 ? 67  ILE B HD13  1 
ATOM   7305  N  N     . ALA D 1 68  ? 32.031  -40.081 14.043  1.00 19.20 ? 68  ALA B N     1 
ATOM   7306  C  CA    . ALA D 1 68  ? 32.260  -39.423 15.324  1.00 23.06 ? 68  ALA B CA    1 
ATOM   7307  C  C     . ALA D 1 68  ? 31.846  -40.370 16.421  1.00 24.83 ? 68  ALA B C     1 
ATOM   7308  O  O     . ALA D 1 68  ? 30.920  -40.090 17.182  1.00 23.31 ? 68  ALA B O     1 
ATOM   7309  C  CB    . ALA D 1 68  ? 31.522  -38.082 15.410  1.00 20.13 ? 68  ALA B CB    1 
ATOM   7310  H  H     . ALA D 1 68  ? 31.324  -40.571 14.015  1.00 22.98 ? 68  ALA B H     1 
ATOM   7311  H  HA    . ALA D 1 68  ? 33.218  -39.246 15.424  1.00 27.61 ? 68  ALA B HA    1 
ATOM   7312  H  HB1   . ALA D 1 68  ? 31.698  -37.683 16.266  1.00 24.10 ? 68  ALA B HB1   1 
ATOM   7313  H  HB2   . ALA D 1 68  ? 31.838  -37.507 14.709  1.00 24.10 ? 68  ALA B HB2   1 
ATOM   7314  H  HB3   . ALA D 1 68  ? 30.580  -38.236 15.308  1.00 24.10 ? 68  ALA B HB3   1 
ATOM   7315  N  N     . PRO D 1 69  ? 32.538  -41.516 16.500  1.00 25.67 ? 69  PRO B N     1 
ATOM   7316  C  CA    . PRO D 1 69  ? 32.173  -42.564 17.452  1.00 28.81 ? 69  PRO B CA    1 
ATOM   7317  C  C     . PRO D 1 69  ? 32.264  -42.125 18.888  1.00 29.60 ? 69  PRO B C     1 
ATOM   7318  O  O     . PRO D 1 69  ? 31.590  -42.731 19.714  1.00 32.08 ? 69  PRO B O     1 
ATOM   7319  C  CB    . PRO D 1 69  ? 33.180  -43.690 17.162  1.00 35.70 ? 69  PRO B CB    1 
ATOM   7320  C  CG    . PRO D 1 69  ? 33.812  -43.353 15.884  1.00 36.50 ? 69  PRO B CG    1 
ATOM   7321  C  CD    . PRO D 1 69  ? 33.719  -41.883 15.697  1.00 29.80 ? 69  PRO B CD    1 
ATOM   7322  H  HA    . PRO D 1 69  ? 31.266  -42.887 17.270  1.00 34.51 ? 69  PRO B HA    1 
ATOM   7323  H  HB2   . PRO D 1 69  ? 33.842  -43.723 17.871  1.00 42.78 ? 69  PRO B HB2   1 
ATOM   7324  H  HB3   . PRO D 1 69  ? 32.710  -44.536 17.096  1.00 42.78 ? 69  PRO B HB3   1 
ATOM   7325  H  HG2   . PRO D 1 69  ? 34.742  -43.628 15.907  1.00 43.74 ? 69  PRO B HG2   1 
ATOM   7326  H  HG3   . PRO D 1 69  ? 33.346  -43.812 15.168  1.00 43.74 ? 69  PRO B HG3   1 
ATOM   7327  H  HD2   . PRO D 1 69  ? 34.513  -41.446 16.042  1.00 35.70 ? 69  PRO B HD2   1 
ATOM   7328  H  HD3   . PRO D 1 69  ? 33.572  -41.670 14.762  1.00 35.70 ? 69  PRO B HD3   1 
ATOM   7329  N  N     . SER D 1 70  ? 33.046  -41.090 19.191  1.00 24.74 ? 70  SER B N     1 
ATOM   7330  C  CA    . SER D 1 70  ? 33.221  -40.660 20.577  1.00 26.19 ? 70  SER B CA    1 
ATOM   7331  C  C     . SER D 1 70  ? 32.291  -39.510 20.978  1.00 24.85 ? 70  SER B C     1 
ATOM   7332  O  O     . SER D 1 70  ? 32.343  -39.023 22.091  1.00 22.60 ? 70  SER B O     1 
ATOM   7333  C  CB    . SER D 1 70  ? 34.671  -40.239 20.816  1.00 35.39 ? 70  SER B CB    1 
ATOM   7334  O  OG    . SER D 1 70  ? 35.504  -41.389 20.708  1.00 44.17 ? 70  SER B OG    1 
ATOM   7335  H  H     . SER D 1 70  ? 33.483  -40.623 18.616  1.00 29.63 ? 70  SER B H     1 
ATOM   7336  H  HA    . SER D 1 70  ? 33.028  -41.418 21.167  1.00 31.37 ? 70  SER B HA    1 
ATOM   7337  H  HB2   . SER D 1 70  ? 34.933  -39.587 20.147  1.00 42.41 ? 70  SER B HB2   1 
ATOM   7338  H  HB3   . SER D 1 70  ? 34.755  -39.862 21.706  1.00 42.41 ? 70  SER B HB3   1 
ATOM   7339  H  HG    . SER D 1 70  ? 35.049  -42.050 20.540  1.00 52.94 ? 70  SER B HG    1 
ATOM   7340  N  N     . ALA D 1 71  ? 31.461  -39.057 20.060  1.00 23.22 ? 71  ALA B N     1 
ATOM   7341  C  CA    . ALA D 1 71  ? 30.441  -38.075 20.414  1.00 26.10 ? 71  ALA B CA    1 
ATOM   7342  C  C     . ALA D 1 71  ? 29.462  -38.657 21.436  1.00 22.51 ? 71  ALA B C     1 
ATOM   7343  O  O     . ALA D 1 71  ? 29.336  -39.866 21.560  1.00 23.69 ? 71  ALA B O     1 
ATOM   7344  C  CB    . ALA D 1 71  ? 29.691  -37.656 19.168  1.00 19.24 ? 71  ALA B CB    1 
ATOM   7345  H  H     . ALA D 1 71  ? 31.461  -39.295 19.234  1.00 27.81 ? 71  ALA B H     1 
ATOM   7346  H  HA    . ALA D 1 71  ? 30.867  -37.284 20.804  1.00 31.26 ? 71  ALA B HA    1 
ATOM   7347  H  HB1   . ALA D 1 71  ? 29.275  -38.428 18.779  1.00 23.03 ? 71  ALA B HB1   1 
ATOM   7348  H  HB2   . ALA D 1 71  ? 29.022  -37.010 19.409  1.00 23.03 ? 71  ALA B HB2   1 
ATOM   7349  H  HB3   . ALA D 1 71  ? 30.311  -37.268 18.546  1.00 23.03 ? 71  ALA B HB3   1 
ATOM   7350  N  N     . ILE D 1 72  ? 28.778  -37.778 22.165  1.00 21.96 ? 72  ILE B N     1 
ATOM   7351  C  CA    . ILE D 1 72  ? 27.692  -38.197 23.032  1.00 22.50 ? 72  ILE B CA    1 
ATOM   7352  C  C     . ILE D 1 72  ? 26.421  -38.191 22.178  1.00 20.02 ? 72  ILE B C     1 
ATOM   7353  O  O     . ILE D 1 72  ? 26.146  -37.217 21.479  1.00 18.92 ? 72  ILE B O     1 
ATOM   7354  C  CB    . ILE D 1 72  ? 27.522  -37.268 24.224  1.00 23.89 ? 72  ILE B CB    1 
ATOM   7355  C  CG1   . ILE D 1 72  ? 28.859  -37.136 24.964  1.00 34.22 ? 72  ILE B CG1   1 
ATOM   7356  C  CG2   . ILE D 1 72  ? 26.415  -37.792 25.143  1.00 25.94 ? 72  ILE B CG2   1 
ATOM   7357  C  CD1   . ILE D 1 72  ? 29.472  -38.495 25.327  1.00 45.91 ? 72  ILE B CD1   1 
ATOM   7358  H  H     . ILE D 1 72  ? 28.926  -36.931 22.172  1.00 26.29 ? 72  ILE B H     1 
ATOM   7359  H  HA    . ILE D 1 72  ? 27.854  -39.107 23.358  1.00 26.94 ? 72  ILE B HA    1 
ATOM   7360  H  HB    . ILE D 1 72  ? 27.263  -36.392 23.898  1.00 28.61 ? 72  ILE B HB    1 
ATOM   7361  H  HG12  . ILE D 1 72  ? 29.489  -36.664 24.396  1.00 41.01 ? 72  ILE B HG12  1 
ATOM   7362  H  HG13  . ILE D 1 72  ? 28.718  -36.641 25.786  1.00 41.01 ? 72  ILE B HG13  1 
ATOM   7363  H  HG21  . ILE D 1 72  ? 26.320  -37.196 25.889  1.00 31.06 ? 72  ILE B HG21  1 
ATOM   7364  H  HG22  . ILE D 1 72  ? 25.593  -37.833 24.649  1.00 31.06 ? 72  ILE B HG22  1 
ATOM   7365  H  HG23  . ILE D 1 72  ? 26.655  -38.669 25.452  1.00 31.06 ? 72  ILE B HG23  1 
ATOM   7366  H  HD11  . ILE D 1 72  ? 28.863  -38.971 25.896  1.00 55.03 ? 72  ILE B HD11  1 
ATOM   7367  H  HD12  . ILE D 1 72  ? 29.625  -38.994 24.522  1.00 55.03 ? 72  ILE B HD12  1 
ATOM   7368  H  HD13  . ILE D 1 72  ? 30.303  -38.350 25.786  1.00 55.03 ? 72  ILE B HD13  1 
ATOM   7369  N  N     . TYR D 1 73  ? 25.717  -39.312 22.204  1.00 19.07 ? 73  TYR B N     1 
ATOM   7370  C  CA    . TYR D 1 73  ? 24.495  -39.510 21.417  1.00 22.02 ? 73  TYR B CA    1 
ATOM   7371  C  C     . TYR D 1 73  ? 23.360  -39.559 22.403  1.00 25.04 ? 73  TYR B C     1 
ATOM   7372  O  O     . TYR D 1 73  ? 23.389  -40.372 23.337  1.00 23.28 ? 73  TYR B O     1 
ATOM   7373  C  CB    . TYR D 1 73  ? 24.592  -40.799 20.621  1.00 18.69 ? 73  TYR B CB    1 
ATOM   7374  C  CG    . TYR D 1 73  ? 25.577  -40.658 19.499  1.00 18.30 ? 73  TYR B CG    1 
ATOM   7375  C  CD1   . TYR D 1 73  ? 26.931  -40.918 19.693  1.00 22.52 ? 73  TYR B CD1   1 
ATOM   7376  C  CD2   . TYR D 1 73  ? 25.182  -40.158 18.277  1.00 21.27 ? 73  TYR B CD2   1 
ATOM   7377  C  CE1   . TYR D 1 73  ? 27.838  -40.734 18.672  1.00 19.38 ? 73  TYR B CE1   1 
ATOM   7378  C  CE2   . TYR D 1 73  ? 26.089  -39.978 17.248  1.00 19.08 ? 73  TYR B CE2   1 
ATOM   7379  C  CZ    . TYR D 1 73  ? 27.421  -40.252 17.469  1.00 26.50 ? 73  TYR B CZ    1 
ATOM   7380  O  OH    . TYR D 1 73  ? 28.311  -40.046 16.461  1.00 21.35 ? 73  TYR B OH    1 
ATOM   7381  H  H     . TYR D 1 73  ? 25.929  -39.995 22.681  1.00 22.82 ? 73  TYR B H     1 
ATOM   7382  H  HA    . TYR D 1 73  ? 24.359  -38.758 20.803  1.00 26.36 ? 73  TYR B HA    1 
ATOM   7383  H  HB2   . TYR D 1 73  ? 24.890  -41.516 21.203  1.00 22.37 ? 73  TYR B HB2   1 
ATOM   7384  H  HB3   . TYR D 1 73  ? 23.724  -41.010 20.242  1.00 22.37 ? 73  TYR B HB3   1 
ATOM   7385  H  HD1   . TYR D 1 73  ? 27.225  -41.236 20.516  1.00 26.97 ? 73  TYR B HD1   1 
ATOM   7386  H  HD2   . TYR D 1 73  ? 24.285  -39.962 18.133  1.00 25.47 ? 73  TYR B HD2   1 
ATOM   7387  H  HE1   . TYR D 1 73  ? 28.738  -40.918 18.812  1.00 23.20 ? 73  TYR B HE1   1 
ATOM   7388  H  HE2   . TYR D 1 73  ? 25.808  -39.645 16.426  1.00 22.84 ? 73  TYR B HE2   1 
ATOM   7389  H  HH    . TYR D 1 73  ? 28.309  -39.256 16.242  1.00 25.55 ? 73  TYR B HH    1 
ATOM   7390  N  N     . VAL D 1 74  ? 22.416  -38.634 22.261  1.00 21.06 ? 74  VAL B N     1 
ATOM   7391  C  CA    . VAL D 1 74  ? 21.235  -38.604 23.151  1.00 19.39 ? 74  VAL B CA    1 
ATOM   7392  C  C     . VAL D 1 74  ? 19.922  -38.565 22.355  1.00 20.28 ? 74  VAL B C     1 
ATOM   7393  O  O     . VAL D 1 74  ? 19.874  -38.099 21.197  1.00 18.02 ? 74  VAL B O     1 
ATOM   7394  C  CB    . VAL D 1 74  ? 21.263  -37.414 24.133  1.00 20.20 ? 74  VAL B CB    1 
ATOM   7395  C  CG1   . VAL D 1 74  ? 22.564  -37.399 24.936  1.00 25.72 ? 74  VAL B CG1   1 
ATOM   7396  C  CG2   . VAL D 1 74  ? 21.115  -36.131 23.396  1.00 21.37 ? 74  VAL B CG2   1 
ATOM   7397  H  H     . VAL D 1 74  ? 22.425  -38.014 21.665  1.00 25.21 ? 74  VAL B H     1 
ATOM   7398  H  HA    . VAL D 1 74  ? 21.230  -39.425 23.685  1.00 23.20 ? 74  VAL B HA    1 
ATOM   7399  H  HB    . VAL D 1 74  ? 20.515  -37.496 24.761  1.00 24.18 ? 74  VAL B HB    1 
ATOM   7400  H  HG11  . VAL D 1 74  ? 23.108  -38.141 24.664  1.00 30.80 ? 74  VAL B HG11  1 
ATOM   7401  H  HG12  . VAL D 1 74  ? 23.026  -36.574 24.766  1.00 30.80 ? 74  VAL B HG12  1 
ATOM   7402  H  HG13  . VAL D 1 74  ? 22.355  -37.470 25.871  1.00 30.80 ? 74  VAL B HG13  1 
ATOM   7403  H  HG21  . VAL D 1 74  ? 21.135  -35.406 24.025  1.00 25.58 ? 74  VAL B HG21  1 
ATOM   7404  H  HG22  . VAL D 1 74  ? 21.839  -36.044 22.772  1.00 25.58 ? 74  VAL B HG22  1 
ATOM   7405  H  HG23  . VAL D 1 74  ? 20.277  -36.136 22.928  1.00 25.58 ? 74  VAL B HG23  1 
ATOM   7406  N  N     . PRO D 1 75  ? 18.854  -39.107 22.955  1.00 19.15 ? 75  PRO B N     1 
ATOM   7407  C  CA    . PRO D 1 75  ? 17.554  -39.139 22.278  1.00 18.90 ? 75  PRO B CA    1 
ATOM   7408  C  C     . PRO D 1 75  ? 16.854  -37.783 22.277  1.00 17.48 ? 75  PRO B C     1 
ATOM   7409  O  O     . PRO D 1 75  ? 16.992  -36.994 23.215  1.00 18.99 ? 75  PRO B O     1 
ATOM   7410  C  CB    . PRO D 1 75  ? 16.757  -40.150 23.112  1.00 22.94 ? 75  PRO B CB    1 
ATOM   7411  C  CG    . PRO D 1 75  ? 17.323  -40.065 24.452  1.00 26.93 ? 75  PRO B CG    1 
ATOM   7412  C  CD    . PRO D 1 75  ? 18.820  -39.839 24.225  1.00 22.22 ? 75  PRO B CD    1 
ATOM   7413  H  HA    . PRO D 1 75  ? 17.647  -39.467 21.359  1.00 22.61 ? 75  PRO B HA    1 
ATOM   7414  H  HB2   . PRO D 1 75  ? 15.819  -39.901 23.119  1.00 27.47 ? 75  PRO B HB2   1 
ATOM   7415  H  HB3   . PRO D 1 75  ? 16.873  -41.040 22.745  1.00 27.47 ? 75  PRO B HB3   1 
ATOM   7416  H  HG2   . PRO D 1 75  ? 16.930  -39.317 24.928  1.00 32.25 ? 75  PRO B HG2   1 
ATOM   7417  H  HG3   . PRO D 1 75  ? 17.169  -40.897 24.927  1.00 32.25 ? 75  PRO B HG3   1 
ATOM   7418  H  HD2   . PRO D 1 75  ? 19.194  -39.298 24.938  1.00 26.60 ? 75  PRO B HD2   1 
ATOM   7419  H  HD3   . PRO D 1 75  ? 19.283  -40.687 24.140  1.00 26.60 ? 75  PRO B HD3   1 
ATOM   7420  N  N     . MET D 1 76  ? 16.095  -37.538 21.213  1.00 19.43 ? 76  MET B N     1 
ATOM   7421  C  CA    . MET D 1 76  ? 15.320  -36.310 21.069  1.00 23.15 ? 76  MET B CA    1 
ATOM   7422  C  C     . MET D 1 76  ? 14.300  -36.249 22.207  1.00 24.37 ? 76  MET B C     1 
ATOM   7423  O  O     . MET D 1 76  ? 13.599  -37.218 22.461  1.00 22.47 ? 76  MET B O     1 
ATOM   7424  C  CB    . MET D 1 76  ? 14.591  -36.303 19.710  1.00 29.61 ? 76  MET B CB    1 
ATOM   7425  C  CG    . MET D 1 76  ? 14.667  -34.958 18.951  1.00 21.85 ? 76  MET B CG    1 
ATOM   7426  S  SD    . MET D 1 76  ? 13.334  -34.704 17.789  1.00 30.52 ? 76  MET B SD    1 
ATOM   7427  C  CE    . MET D 1 76  ? 12.202  -36.060 18.185  1.00 36.62 ? 76  MET B CE    1 
ATOM   7428  H  H     . MET D 1 76  ? 16.011  -38.078 20.549  1.00 23.26 ? 76  MET B H     1 
ATOM   7429  H  HA    . MET D 1 76  ? 15.916  -35.533 21.114  1.00 27.72 ? 76  MET B HA    1 
ATOM   7430  H  HB2   . MET D 1 76  ? 14.985  -36.984 19.143  1.00 35.48 ? 76  MET B HB2   1 
ATOM   7431  H  HB3   . MET D 1 76  ? 13.654  -36.504 19.860  1.00 35.48 ? 76  MET B HB3   1 
ATOM   7432  H  HG2   . MET D 1 76  ? 14.639  -34.233 19.595  1.00 26.16 ? 76  MET B HG2   1 
ATOM   7433  H  HG3   . MET D 1 76  ? 15.501  -34.925 18.456  1.00 26.16 ? 76  MET B HG3   1 
ATOM   7434  H  HE1   . MET D 1 76  ? 12.658  -36.895 18.056  1.00 43.88 ? 76  MET B HE1   1 
ATOM   7435  H  HE2   . MET D 1 76  ? 11.923  -35.977 19.100  1.00 43.88 ? 76  MET B HE2   1 
ATOM   7436  H  HE3   . MET D 1 76  ? 11.440  -36.010 17.604  1.00 43.88 ? 76  MET B HE3   1 
ATOM   7437  N  N     . ARG D 1 77  ? 14.232  -35.119 22.903  1.00 20.41 ? 77  ARG B N     1 
ATOM   7438  C  CA    . ARG D 1 77  ? 13.170  -34.897 23.910  1.00 22.99 ? 77  ARG B CA    1 
ATOM   7439  C  C     . ARG D 1 77  ? 12.353  -33.669 23.488  1.00 17.90 ? 77  ARG B C     1 
ATOM   7440  O  O     . ARG D 1 77  ? 12.461  -32.584 24.081  1.00 19.29 ? 77  ARG B O     1 
ATOM   7441  C  CB    . ARG D 1 77  ? 13.751  -34.700 25.303  1.00 22.37 ? 77  ARG B CB    1 
ATOM   7442  C  CG    . ARG D 1 77  ? 14.442  -35.947 25.877  1.00 26.14 ? 77  ARG B CG    1 
ATOM   7443  C  CD    . ARG D 1 77  ? 14.886  -35.804 27.335  1.00 26.65 ? 77  ARG B CD    1 
ATOM   7444  N  NE    . ARG D 1 77  ? 16.026  -34.897 27.523  1.00 22.30 ? 77  ARG B NE    1 
ATOM   7445  C  CZ    . ARG D 1 77  ? 16.473  -34.481 28.703  1.00 28.32 ? 77  ARG B CZ    1 
ATOM   7446  N  NH1   . ARG D 1 77  ? 15.890  -34.884 29.838  1.00 30.47 ? 77  ARG B NH1   1 
ATOM   7447  N  NH2   . ARG D 1 77  ? 17.508  -33.660 28.759  1.00 28.64 ? 77  ARG B NH2   1 
ATOM   7448  H  H     . ARG D 1 77  ? 14.781  -34.462 22.820  1.00 24.43 ? 77  ARG B H     1 
ATOM   7449  H  HA    . ARG D 1 77  ? 12.573  -35.674 23.930  1.00 27.53 ? 77  ARG B HA    1 
ATOM   7450  H  HB2   . ARG D 1 77  ? 14.409  -33.987 25.269  1.00 26.79 ? 77  ARG B HB2   1 
ATOM   7451  H  HB3   . ARG D 1 77  ? 13.034  -34.455 25.908  1.00 26.79 ? 77  ARG B HB3   1 
ATOM   7452  H  HG2   . ARG D 1 77  ? 13.825  -36.694 25.828  1.00 31.31 ? 77  ARG B HG2   1 
ATOM   7453  H  HG3   . ARG D 1 77  ? 15.231  -36.138 25.346  1.00 31.31 ? 77  ARG B HG3   1 
ATOM   7454  H  HD2   . ARG D 1 77  ? 14.144  -35.458 27.855  1.00 31.92 ? 77  ARG B HD2   1 
ATOM   7455  H  HD3   . ARG D 1 77  ? 15.144  -36.677 27.670  1.00 31.92 ? 77  ARG B HD3   1 
ATOM   7456  H  HE    . ARG D 1 77  ? 16.434  -34.616 26.819  1.00 26.70 ? 77  ARG B HE    1 
ATOM   7457  H  HH11  . ARG D 1 77  ? 15.216  -35.417 29.810  1.00 36.50 ? 77  ARG B HH11  1 
ATOM   7458  H  HH12  . ARG D 1 77  ? 16.189  -34.608 30.596  1.00 36.50 ? 77  ARG B HH12  1 
ATOM   7459  H  HH21  . ARG D 1 77  ? 17.888  -33.398 28.034  1.00 34.31 ? 77  ARG B HH21  1 
ATOM   7460  H  HH22  . ARG D 1 77  ? 17.801  -33.390 29.521  1.00 34.31 ? 77  ARG B HH22  1 
ATOM   7461  N  N     . LYS D 1 78  ? 11.597  -33.830 22.413  1.00 19.64 ? 78  LYS B N     1 
ATOM   7462  C  CA    . LYS D 1 78  ? 10.961  -32.690 21.762  1.00 23.59 ? 78  LYS B CA    1 
ATOM   7463  C  C     . LYS D 1 78  ? 10.078  -31.851 22.693  1.00 18.70 ? 78  LYS B C     1 
ATOM   7464  O  O     . LYS D 1 78  ? 10.053  -30.635 22.581  1.00 16.68 ? 78  LYS B O     1 
ATOM   7465  C  CB    . LYS D 1 78  ? 10.170  -33.132 20.531  1.00 26.72 ? 78  LYS B CB    1 
ATOM   7466  C  CG    . LYS D 1 78  ? 9.941   -32.004 19.541  1.00 27.54 ? 78  LYS B CG    1 
ATOM   7467  C  CD    . LYS D 1 78  ? 9.246   -32.521 18.287  1.00 40.55 ? 78  LYS B CD    1 
ATOM   7468  C  CE    . LYS D 1 78  ? 8.749   -31.389 17.421  1.00 43.91 ? 78  LYS B CE    1 
ATOM   7469  N  NZ    . LYS D 1 78  ? 7.577   -31.826 16.597  1.00 60.47 ? 78  LYS B NZ    1 
ATOM   7470  H  H     . LYS D 1 78  ? 11.434  -34.587 22.039  1.00 23.51 ? 78  LYS B H     1 
ATOM   7471  H  HA    . LYS D 1 78  ? 11.673  -32.097 21.441  1.00 28.25 ? 78  LYS B HA    1 
ATOM   7472  H  HB2   . LYS D 1 78  ? 10.661  -33.835 20.076  1.00 32.00 ? 78  LYS B HB2   1 
ATOM   7473  H  HB3   . LYS D 1 78  ? 9.303   -33.463 20.815  1.00 32.00 ? 78  LYS B HB3   1 
ATOM   7474  H  HG2   . LYS D 1 78  ? 9.377   -31.328 19.947  1.00 32.99 ? 78  LYS B HG2   1 
ATOM   7475  H  HG3   . LYS D 1 78  ? 10.795  -31.623 19.283  1.00 32.99 ? 78  LYS B HG3   1 
ATOM   7476  H  HD2   . LYS D 1 78  ? 9.873   -33.048 17.768  1.00 48.60 ? 78  LYS B HD2   1 
ATOM   7477  H  HD3   . LYS D 1 78  ? 8.484   -33.063 18.544  1.00 48.60 ? 78  LYS B HD3   1 
ATOM   7478  H  HE2   . LYS D 1 78  ? 8.469   -30.651 17.985  1.00 52.62 ? 78  LYS B HE2   1 
ATOM   7479  H  HE3   . LYS D 1 78  ? 9.458   -31.107 16.822  1.00 52.62 ? 78  LYS B HE3   1 
ATOM   7480  H  HZ1   . LYS D 1 78  ? 6.913   -32.089 17.128  1.00 72.51 ? 78  LYS B HZ1   1 
ATOM   7481  H  HZ2   . LYS D 1 78  ? 7.293   -31.152 16.091  1.00 72.51 ? 78  LYS B HZ2   1 
ATOM   7482  H  HZ3   . LYS D 1 78  ? 7.812   -32.504 16.070  1.00 72.51 ? 78  LYS B HZ3   1 
ATOM   7483  N  N     . PRO D 1 79  ? 9.388   -32.482 23.655  1.00 22.16 ? 79  PRO B N     1 
ATOM   7484  C  CA    . PRO D 1 79  ? 8.551   -31.619 24.504  1.00 21.66 ? 79  PRO B CA    1 
ATOM   7485  C  C     . PRO D 1 79  ? 9.331   -30.607 25.308  1.00 20.31 ? 79  PRO B C     1 
ATOM   7486  O  O     . PRO D 1 79  ? 8.822   -29.505 25.555  1.00 16.59 ? 79  PRO B O     1 
ATOM   7487  C  CB    . PRO D 1 79  ? 7.836   -32.619 25.439  1.00 26.75 ? 79  PRO B CB    1 
ATOM   7488  C  CG    . PRO D 1 79  ? 7.721   -33.874 24.601  1.00 22.16 ? 79  PRO B CG    1 
ATOM   7489  C  CD    . PRO D 1 79  ? 9.111   -33.909 23.887  1.00 25.95 ? 79  PRO B CD    1 
ATOM   7490  H  HA    . PRO D 1 79  ? 7.883   -31.153 23.959  1.00 25.93 ? 79  PRO B HA    1 
ATOM   7491  H  HB2   . PRO D 1 79  ? 8.376   -32.778 26.229  1.00 32.04 ? 79  PRO B HB2   1 
ATOM   7492  H  HB3   . PRO D 1 79  ? 6.960   -32.280 25.679  1.00 32.04 ? 79  PRO B HB3   1 
ATOM   7493  H  HG2   . PRO D 1 79  ? 7.597   -34.649 25.170  1.00 26.53 ? 79  PRO B HG2   1 
ATOM   7494  H  HG3   . PRO D 1 79  ? 6.998   -33.785 23.960  1.00 26.53 ? 79  PRO B HG3   1 
ATOM   7495  H  HD2   . PRO D 1 79  ? 9.783   -34.296 24.470  1.00 31.08 ? 79  PRO B HD2   1 
ATOM   7496  H  HD3   . PRO D 1 79  ? 9.049   -34.385 23.044  1.00 31.08 ? 79  PRO B HD3   1 
ATOM   7497  N  N     . ILE D 1 80  ? 10.531  -30.964 25.744  1.00 17.73 ? 80  ILE B N     1 
ATOM   7498  C  CA    . ILE D 1 80  ? 11.330  -30.016 26.475  1.00 21.14 ? 80  ILE B CA    1 
ATOM   7499  C  C     . ILE D 1 80  ? 11.747  -28.862 25.560  1.00 20.28 ? 80  ILE B C     1 
ATOM   7500  O  O     . ILE D 1 80  ? 11.723  -27.698 25.982  1.00 16.77 ? 80  ILE B O     1 
ATOM   7501  C  CB    . ILE D 1 80  ? 12.584  -30.645 27.109  1.00 20.24 ? 80  ILE B CB    1 
ATOM   7502  C  CG1   . ILE D 1 80  ? 12.216  -31.824 28.007  1.00 22.92 ? 80  ILE B CG1   1 
ATOM   7503  C  CG2   . ILE D 1 80  ? 13.332  -29.592 27.897  1.00 21.12 ? 80  ILE B CG2   1 
ATOM   7504  C  CD1   . ILE D 1 80  ? 13.368  -32.447 28.718  1.00 28.54 ? 80  ILE B CD1   1 
ATOM   7505  H  H     . ILE D 1 80  ? 10.894  -31.735 25.629  1.00 21.21 ? 80  ILE B H     1 
ATOM   7506  H  HA    . ILE D 1 80  ? 10.787  -29.641 27.199  1.00 25.31 ? 80  ILE B HA    1 
ATOM   7507  H  HB    . ILE D 1 80  ? 13.161  -30.967 26.399  1.00 24.23 ? 80  ILE B HB    1 
ATOM   7508  H  HG12  . ILE D 1 80  ? 11.588  -31.518 28.679  1.00 27.44 ? 80  ILE B HG12  1 
ATOM   7509  H  HG13  . ILE D 1 80  ? 11.801  -32.511 27.462  1.00 27.44 ? 80  ILE B HG13  1 
ATOM   7510  H  HG21  . ILE D 1 80  ? 14.112  -29.991 28.290  1.00 25.28 ? 80  ILE B HG21  1 
ATOM   7511  H  HG22  . ILE D 1 80  ? 13.590  -28.883 27.304  1.00 25.28 ? 80  ILE B HG22  1 
ATOM   7512  H  HG23  . ILE D 1 80  ? 12.757  -29.250 28.586  1.00 25.28 ? 80  ILE B HG23  1 
ATOM   7513  H  HD11  . ILE D 1 80  ? 13.046  -33.175 29.256  1.00 34.19 ? 80  ILE B HD11  1 
ATOM   7514  H  HD12  . ILE D 1 80  ? 13.996  -32.772 28.069  1.00 34.19 ? 80  ILE B HD12  1 
ATOM   7515  H  HD13  . ILE D 1 80  ? 13.785  -31.787 29.276  1.00 34.19 ? 80  ILE B HD13  1 
ATOM   7516  N  N     . TYR D 1 81  ? 12.144  -29.180 24.333  1.00 17.65 ? 81  TYR B N     1 
ATOM   7517  C  CA    . TYR D 1 81  ? 12.560  -28.138 23.376  1.00 14.57 ? 81  TYR B CA    1 
ATOM   7518  C  C     . TYR D 1 81  ? 11.384  -27.185 23.074  1.00 14.73 ? 81  TYR B C     1 
ATOM   7519  O  O     . TYR D 1 81  ? 11.564  -25.964 22.963  1.00 15.89 ? 81  TYR B O     1 
ATOM   7520  C  CB    . TYR D 1 81  ? 13.149  -28.763 22.089  1.00 18.26 ? 81  TYR B CB    1 
ATOM   7521  C  CG    . TYR D 1 81  ? 14.094  -29.949 22.328  1.00 17.00 ? 81  TYR B CG    1 
ATOM   7522  C  CD1   . TYR D 1 81  ? 14.234  -30.947 21.367  1.00 15.42 ? 81  TYR B CD1   1 
ATOM   7523  C  CD2   . TYR D 1 81  ? 14.847  -30.049 23.500  1.00 16.10 ? 81  TYR B CD2   1 
ATOM   7524  C  CE1   . TYR D 1 81  ? 15.045  -32.019 21.555  1.00 17.80 ? 81  TYR B CE1   1 
ATOM   7525  C  CE2   . TYR D 1 81  ? 15.687  -31.152 23.720  1.00 15.63 ? 81  TYR B CE2   1 
ATOM   7526  C  CZ    . TYR D 1 81  ? 15.772  -32.136 22.735  1.00 18.13 ? 81  TYR B CZ    1 
ATOM   7527  O  OH    . TYR D 1 81  ? 16.562  -33.230 22.909  1.00 17.01 ? 81  TYR B OH    1 
ATOM   7528  H  H     . TYR D 1 81  ? 12.185  -29.981 24.024  1.00 21.12 ? 81  TYR B H     1 
ATOM   7529  H  HA    . TYR D 1 81  ? 13.269  -27.604 23.791  1.00 17.42 ? 81  TYR B HA    1 
ATOM   7530  H  HB2   . TYR D 1 81  ? 12.418  -29.078 21.535  1.00 21.86 ? 81  TYR B HB2   1 
ATOM   7531  H  HB3   . TYR D 1 81  ? 13.648  -28.081 21.614  1.00 21.86 ? 81  TYR B HB3   1 
ATOM   7532  H  HD1   . TYR D 1 81  ? 13.737  -30.891 20.583  1.00 18.44 ? 81  TYR B HD1   1 
ATOM   7533  H  HD2   . TYR D 1 81  ? 14.764  -29.396 24.156  1.00 19.26 ? 81  TYR B HD2   1 
ATOM   7534  H  HE1   . TYR D 1 81  ? 15.102  -32.680 20.904  1.00 21.30 ? 81  TYR B HE1   1 
ATOM   7535  H  HE2   . TYR D 1 81  ? 16.175  -31.227 24.509  1.00 18.69 ? 81  TYR B HE2   1 
ATOM   7536  H  HH    . TYR D 1 81  ? 16.321  -33.647 23.573  1.00 20.35 ? 81  TYR B HH    1 
ATOM   7537  N  N     . GLU D 1 82  ? 10.177  -27.748 22.976  1.00 16.91 ? 82  GLU B N     1 
ATOM   7538  C  CA    . GLU D 1 82  ? 8.981   -26.957 22.730  1.00 19.84 ? 82  GLU B CA    1 
ATOM   7539  C  C     . GLU D 1 82  ? 8.723   -26.003 23.880  1.00 20.72 ? 82  GLU B C     1 
ATOM   7540  O  O     . GLU D 1 82  ? 8.282   -24.868 23.671  1.00 19.70 ? 82  GLU B O     1 
ATOM   7541  C  CB    . GLU D 1 82  ? 7.792   -27.893 22.484  1.00 17.20 ? 82  GLU B CB    1 
ATOM   7542  C  CG    . GLU D 1 82  ? 7.938   -28.655 21.200  1.00 26.36 ? 82  GLU B CG    1 
ATOM   7543  C  CD    . GLU D 1 82  ? 6.770   -29.570 20.900  1.00 44.60 ? 82  GLU B CD    1 
ATOM   7544  O  OE1   . GLU D 1 82  ? 5.945   -29.804 21.814  1.00 52.10 ? 82  GLU B OE1   1 
ATOM   7545  O  OE2   . GLU D 1 82  ? 6.686   -30.050 19.740  1.00 47.60 ? 82  GLU B OE2   1 
ATOM   7546  H  H     . GLU D 1 82  ? 10.029  -28.592 23.050  1.00 20.24 ? 82  GLU B H     1 
ATOM   7547  H  HA    . GLU D 1 82  ? 9.116   -26.422 21.920  1.00 23.75 ? 82  GLU B HA    1 
ATOM   7548  H  HB2   . GLU D 1 82  ? 7.734   -28.532 23.211  1.00 20.58 ? 82  GLU B HB2   1 
ATOM   7549  H  HB3   . GLU D 1 82  ? 6.978   -27.368 22.434  1.00 20.58 ? 82  GLU B HB3   1 
ATOM   7550  H  HG2   . GLU D 1 82  ? 8.016   -28.023 20.469  1.00 31.57 ? 82  GLU B HG2   1 
ATOM   7551  H  HG3   . GLU D 1 82  ? 8.738   -29.201 21.250  1.00 31.57 ? 82  GLU B HG3   1 
ATOM   7552  N  N     . ALA D 1 83  ? 9.027   -26.449 25.098  1.00 18.33 ? 83  ALA B N     1 
ATOM   7553  C  CA    . ALA D 1 83  ? 8.813   -25.630 26.286  1.00 18.35 ? 83  ALA B CA    1 
ATOM   7554  C  C     . ALA D 1 83  ? 9.783   -24.474 26.294  1.00 21.46 ? 83  ALA B C     1 
ATOM   7555  O  O     . ALA D 1 83  ? 9.418   -23.320 26.554  1.00 16.57 ? 83  ALA B O     1 
ATOM   7556  C  CB    . ALA D 1 83  ? 9.014   -26.472 27.539  1.00 23.09 ? 83  ALA B CB    1 
ATOM   7557  H  H     . ALA D 1 83  ? 9.359   -27.225 25.262  1.00 21.94 ? 83  ALA B H     1 
ATOM   7558  H  HA    . ALA D 1 83  ? 7.899   -25.276 26.286  1.00 21.96 ? 83  ALA B HA    1 
ATOM   7559  H  HB1   . ALA D 1 83  ? 9.910   -26.816 27.544  1.00 27.64 ? 83  ALA B HB1   1 
ATOM   7560  H  HB2   . ALA D 1 83  ? 8.870   -25.920 28.312  1.00 27.64 ? 83  ALA B HB2   1 
ATOM   7561  H  HB3   . ALA D 1 83  ? 8.384   -27.197 27.532  1.00 27.64 ? 83  ALA B HB3   1 
ATOM   7562  N  N     . PHE D 1 84  ? 11.043  -24.774 25.995  1.00 16.20 ? 84  PHE B N     1 
ATOM   7563  C  CA    . PHE D 1 84  ? 12.031  -23.716 25.883  1.00 17.89 ? 84  PHE B CA    1 
ATOM   7564  C  C     . PHE D 1 84  ? 11.589  -22.749 24.808  1.00 15.67 ? 84  PHE B C     1 
ATOM   7565  O  O     . PHE D 1 84  ? 11.660  -21.530 24.981  1.00 19.18 ? 84  PHE B O     1 
ATOM   7566  C  CB    . PHE D 1 84  ? 13.422  -24.262 25.526  1.00 19.67 ? 84  PHE B CB    1 
ATOM   7567  C  CG    . PHE D 1 84  ? 14.275  -24.595 26.709  1.00 19.75 ? 84  PHE B CG    1 
ATOM   7568  C  CD1   . PHE D 1 84  ? 14.025  -25.705 27.484  1.00 16.24 ? 84  PHE B CD1   1 
ATOM   7569  C  CD2   . PHE D 1 84  ? 15.383  -23.815 27.007  1.00 20.21 ? 84  PHE B CD2   1 
ATOM   7570  C  CE1   . PHE D 1 84  ? 14.867  -26.012 28.580  1.00 16.61 ? 84  PHE B CE1   1 
ATOM   7571  C  CE2   . PHE D 1 84  ? 16.198  -24.118 28.101  1.00 23.85 ? 84  PHE B CE2   1 
ATOM   7572  C  CZ    . PHE D 1 84  ? 15.930  -25.223 28.872  1.00 16.32 ? 84  PHE B CZ    1 
ATOM   7573  H  H     . PHE D 1 84  ? 11.345  -25.568 25.857  1.00 19.38 ? 84  PHE B H     1 
ATOM   7574  H  HA    . PHE D 1 84  ? 12.093  -23.232 26.733  1.00 21.41 ? 84  PHE B HA    1 
ATOM   7575  H  HB2   . PHE D 1 84  ? 13.313  -25.072 25.004  1.00 23.55 ? 84  PHE B HB2   1 
ATOM   7576  H  HB3   . PHE D 1 84  ? 13.892  -23.596 25.002  1.00 23.55 ? 84  PHE B HB3   1 
ATOM   7577  H  HD1   . PHE D 1 84  ? 13.297  -26.250 27.293  1.00 19.43 ? 84  PHE B HD1   1 
ATOM   7578  H  HD2   . PHE D 1 84  ? 15.568  -23.064 26.491  1.00 24.20 ? 84  PHE B HD2   1 
ATOM   7579  H  HE1   . PHE D 1 84  ? 14.684  -26.755 29.108  1.00 19.87 ? 84  PHE B HE1   1 
ATOM   7580  H  HE2   . PHE D 1 84  ? 16.932  -23.581 28.297  1.00 28.56 ? 84  PHE B HE2   1 
ATOM   7581  H  HZ    . PHE D 1 84  ? 16.476  -25.429 29.596  1.00 19.52 ? 84  PHE B HZ    1 
ATOM   7582  N  N     . SER D 1 85  ? 11.176  -23.291 23.673  1.00 16.87 ? 85  SER B N     1 
ATOM   7583  C  CA    . SER D 1 85  ? 10.804  -22.436 22.567  1.00 15.97 ? 85  SER B CA    1 
ATOM   7584  C  C     . SER D 1 85  ? 9.656   -21.536 22.995  1.00 16.29 ? 85  SER B C     1 
ATOM   7585  O  O     . SER D 1 85  ? 9.681   -20.328 22.807  1.00 16.25 ? 85  SER B O     1 
ATOM   7586  C  CB    . SER D 1 85  ? 10.423  -23.265 21.363  1.00 19.84 ? 85  SER B CB    1 
ATOM   7587  O  OG    . SER D 1 85  ? 9.954   -22.426 20.322  1.00 17.72 ? 85  SER B OG    1 
ATOM   7588  H  H     . SER D 1 85  ? 11.104  -24.135 23.522  1.00 20.18 ? 85  SER B H     1 
ATOM   7589  H  HA    . SER D 1 85  ? 11.567  -21.870 22.324  1.00 19.10 ? 85  SER B HA    1 
ATOM   7590  H  HB2   . SER D 1 85  ? 11.202  -23.752 21.053  1.00 23.75 ? 85  SER B HB2   1 
ATOM   7591  H  HB3   . SER D 1 85  ? 9.720   -23.884 21.614  1.00 23.75 ? 85  SER B HB3   1 
ATOM   7592  H  HG    . SER D 1 85  ? 9.747   -22.877 19.669  1.00 21.21 ? 85  SER B HG    1 
ATOM   7593  N  N     . ASN D 1 86  ? 8.637   -22.132 23.589  1.00 18.70 ? 86  ASN B N     1 
ATOM   7594  C  CA    . ASN D 1 86  ? 7.479   -21.346 24.010  1.00 21.86 ? 86  ASN B CA    1 
ATOM   7595  C  C     . ASN D 1 86  ? 7.866   -20.212 24.957  1.00 16.75 ? 86  ASN B C     1 
ATOM   7596  O  O     . ASN D 1 86  ? 7.332   -19.096 24.846  1.00 21.42 ? 86  ASN B O     1 
ATOM   7597  C  CB    . ASN D 1 86  ? 6.397   -22.253 24.627  1.00 22.39 ? 86  ASN B CB    1 
ATOM   7598  C  CG    . ASN D 1 86  ? 5.714   -23.149 23.604  1.00 31.20 ? 86  ASN B CG    1 
ATOM   7599  O  OD1   . ASN D 1 86  ? 5.687   -22.856 22.406  1.00 37.94 ? 86  ASN B OD1   1 
ATOM   7600  N  ND2   . ASN D 1 86  ? 5.136   -24.249 24.082  1.00 41.61 ? 86  ASN B ND2   1 
ATOM   7601  H  H     . ASN D 1 86  ? 8.586   -22.973 23.760  1.00 22.38 ? 86  ASN B H     1 
ATOM   7602  H  HA    . ASN D 1 86  ? 7.087   -20.932 23.212  1.00 26.17 ? 86  ASN B HA    1 
ATOM   7603  H  HB2   . ASN D 1 86  ? 6.808   -22.822 25.296  1.00 26.81 ? 86  ASN B HB2   1 
ATOM   7604  H  HB3   . ASN D 1 86  ? 5.717   -21.697 25.038  1.00 26.81 ? 86  ASN B HB3   1 
ATOM   7605  H  HD21  . ASN D 1 86  ? 4.736   -24.791 23.548  1.00 49.87 ? 86  ASN B HD21  1 
ATOM   7606  H  HD22  . ASN D 1 86  ? 5.163   -24.417 24.925  1.00 49.87 ? 86  ASN B HD22  1 
ATOM   7607  N  N     . ARG D 1 87  ? 8.778   -20.456 25.894  1.00 16.41 ? 87  ARG B N     1 
ATOM   7608  C  CA    . ARG D 1 87  ? 9.154   -19.404 26.824  1.00 20.96 ? 87  ARG B CA    1 
ATOM   7609  C  C     . ARG D 1 87  ? 9.906   -18.301 26.104  1.00 25.61 ? 87  ARG B C     1 
ATOM   7610  O  O     . ARG D 1 87  ? 9.664   -17.117 26.336  1.00 21.31 ? 87  ARG B O     1 
ATOM   7611  C  CB    . ARG D 1 87  ? 10.001  -19.930 27.978  1.00 18.54 ? 87  ARG B CB    1 
ATOM   7612  C  CG    . ARG D 1 87  ? 9.269   -20.889 28.854  1.00 19.90 ? 87  ARG B CG    1 
ATOM   7613  C  CD    . ARG D 1 87  ? 9.991   -21.097 30.167  1.00 22.10 ? 87  ARG B CD    1 
ATOM   7614  N  NE    . ARG D 1 87  ? 11.314  -21.718 30.053  1.00 21.50 ? 87  ARG B NE    1 
ATOM   7615  C  CZ    . ARG D 1 87  ? 11.564  -23.033 30.066  1.00 22.57 ? 87  ARG B CZ    1 
ATOM   7616  N  NH1   . ARG D 1 87  ? 10.587  -23.922 30.163  1.00 21.60 ? 87  ARG B NH1   1 
ATOM   7617  N  NH2   . ARG D 1 87  ? 12.831  -23.466 29.998  1.00 19.27 ? 87  ARG B NH2   1 
ATOM   7618  H  H     . ARG D 1 87  ? 9.184   -21.205 26.008  1.00 19.63 ? 87  ARG B H     1 
ATOM   7619  H  HA    . ARG D 1 87  ? 8.340   -19.013 27.205  1.00 25.09 ? 87  ARG B HA    1 
ATOM   7620  H  HB2   . ARG D 1 87  ? 10.776  -20.388 27.617  1.00 22.19 ? 87  ARG B HB2   1 
ATOM   7621  H  HB3   . ARG D 1 87  ? 10.285  -19.182 28.527  1.00 22.19 ? 87  ARG B HB3   1 
ATOM   7622  H  HG2   . ARG D 1 87  ? 8.385   -20.538 29.044  1.00 23.82 ? 87  ARG B HG2   1 
ATOM   7623  H  HG3   . ARG D 1 87  ? 9.202   -21.746 28.404  1.00 23.82 ? 87  ARG B HG3   1 
ATOM   7624  H  HD2   . ARG D 1 87  ? 10.109  -20.234 30.595  1.00 26.46 ? 87  ARG B HD2   1 
ATOM   7625  H  HD3   . ARG D 1 87  ? 9.447   -21.668 30.732  1.00 26.46 ? 87  ARG B HD3   1 
ATOM   7626  H  HE    . ARG D 1 87  ? 11.989  -21.191 29.970  1.00 25.74 ? 87  ARG B HE    1 
ATOM   7627  H  HH11  . ARG D 1 87  ? 9.770   -23.658 30.220  1.00 25.85 ? 87  ARG B HH11  1 
ATOM   7628  H  HH12  . ARG D 1 87  ? 10.768  -24.762 30.166  1.00 25.85 ? 87  ARG B HH12  1 
ATOM   7629  H  HH21  . ARG D 1 87  ? 13.475  -22.901 29.928  1.00 23.07 ? 87  ARG B HH21  1 
ATOM   7630  H  HH22  . ARG D 1 87  ? 12.996  -24.310 29.991  1.00 23.07 ? 87  ARG B HH22  1 
ATOM   7631  N  N     . ILE D 1 88  ? 10.790  -18.693 25.196  1.00 22.12 ? 88  ILE B N     1 
ATOM   7632  C  CA    . ILE D 1 88  ? 11.531  -17.707 24.436  1.00 23.33 ? 88  ILE B CA    1 
ATOM   7633  C  C     . ILE D 1 88  ? 10.641  -16.846 23.543  1.00 20.95 ? 88  ILE B C     1 
ATOM   7634  O  O     . ILE D 1 88  ? 10.784  -15.622 23.553  1.00 25.06 ? 88  ILE B O     1 
ATOM   7635  C  CB    . ILE D 1 88  ? 12.671  -18.358 23.646  1.00 18.35 ? 88  ILE B CB    1 
ATOM   7636  C  CG1   . ILE D 1 88  ? 13.649  -18.990 24.655  1.00 22.29 ? 88  ILE B CG1   1 
ATOM   7637  C  CG2   . ILE D 1 88  ? 13.407  -17.310 22.855  1.00 18.60 ? 88  ILE B CG2   1 
ATOM   7638  C  CD1   . ILE D 1 88  ? 14.836  -19.740 24.012  1.00 22.82 ? 88  ILE B CD1   1 
ATOM   7639  H  H     . ILE D 1 88  ? 10.976  -19.511 25.006  1.00 26.49 ? 88  ILE B H     1 
ATOM   7640  H  HA    . ILE D 1 88  ? 11.951  -17.097 25.078  1.00 27.94 ? 88  ILE B HA    1 
ATOM   7641  H  HB    . ILE D 1 88  ? 12.319  -19.038 23.051  1.00 21.96 ? 88  ILE B HB    1 
ATOM   7642  H  HG12  . ILE D 1 88  ? 14.014  -18.288 25.215  1.00 26.69 ? 88  ILE B HG12  1 
ATOM   7643  H  HG13  . ILE D 1 88  ? 13.162  -19.625 25.203  1.00 26.69 ? 88  ILE B HG13  1 
ATOM   7644  H  HG21  . ILE D 1 88  ? 13.767  -16.658 23.461  1.00 22.26 ? 88  ILE B HG21  1 
ATOM   7645  H  HG22  . ILE D 1 88  ? 14.117  -17.730 22.366  1.00 22.26 ? 88  ILE B HG22  1 
ATOM   7646  H  HG23  . ILE D 1 88  ? 12.794  -16.890 22.248  1.00 22.26 ? 88  ILE B HG23  1 
ATOM   7647  H  HD11  . ILE D 1 88  ? 15.340  -19.124 23.475  1.00 27.32 ? 88  ILE B HD11  1 
ATOM   7648  H  HD12  . ILE D 1 88  ? 15.391  -20.100 24.707  1.00 27.32 ? 88  ILE B HD12  1 
ATOM   7649  H  HD13  . ILE D 1 88  ? 14.495  -20.450 23.463  1.00 27.32 ? 88  ILE B HD13  1 
ATOM   7650  N  N     . MET D 1 89  ? 9.741   -17.462 22.774  1.00 19.31 ? 89  MET B N     1 
ATOM   7651  C  CA    . MET D 1 89  ? 8.833   -16.692 21.921  1.00 21.18 ? 89  MET B CA    1 
ATOM   7652  C  C     . MET D 1 89  ? 8.008   -15.715 22.767  1.00 26.65 ? 89  MET B C     1 
ATOM   7653  O  O     . MET D 1 89  ? 7.733   -14.597 22.344  1.00 27.28 ? 89  MET B O     1 
ATOM   7654  C  CB    . MET D 1 89  ? 7.897   -17.605 21.148  1.00 21.26 ? 89  MET B CB    1 
ATOM   7655  C  CG    . MET D 1 89  ? 8.589   -18.570 20.198  1.00 20.86 ? 89  MET B CG    1 
ATOM   7656  S  SD    . MET D 1 89  ? 9.814   -17.736 19.153  1.00 20.79 ? 89  MET B SD    1 
ATOM   7657  C  CE    . MET D 1 89  ? 10.547  -19.104 18.247  1.00 20.81 ? 89  MET B CE    1 
ATOM   7658  H  H     . MET D 1 89  ? 9.636   -18.314 22.728  1.00 23.11 ? 89  MET B H     1 
ATOM   7659  H  HA    . MET D 1 89  ? 9.362   -16.183 21.272  1.00 25.36 ? 89  MET B HA    1 
ATOM   7660  H  HB2   . MET D 1 89  ? 7.387   -18.133 21.782  1.00 25.46 ? 89  MET B HB2   1 
ATOM   7661  H  HB3   . MET D 1 89  ? 7.295   -17.057 20.622  1.00 25.46 ? 89  MET B HB3   1 
ATOM   7662  H  HG2   . MET D 1 89  ? 9.047   -19.252 20.714  1.00 24.97 ? 89  MET B HG2   1 
ATOM   7663  H  HG3   . MET D 1 89  ? 7.926   -18.978 19.619  1.00 24.97 ? 89  MET B HG3   1 
ATOM   7664  H  HE1   . MET D 1 89  ? 11.220  -18.760 17.656  1.00 24.91 ? 89  MET B HE1   1 
ATOM   7665  H  HE2   . MET D 1 89  ? 10.941  -19.717 18.872  1.00 24.91 ? 89  MET B HE2   1 
ATOM   7666  H  HE3   . MET D 1 89  ? 9.861   -19.546 17.742  1.00 24.91 ? 89  MET B HE3   1 
ATOM   7667  N  N     . ASN D 1 90  ? 7.621   -16.129 23.967  1.00 27.20 ? 90  ASN B N     1 
ATOM   7668  C  CA    . ASN D 1 90  ? 6.938   -15.210 24.881  1.00 27.71 ? 90  ASN B CA    1 
ATOM   7669  C  C     . ASN D 1 90  ? 7.811   -14.026 25.312  1.00 25.50 ? 90  ASN B C     1 
ATOM   7670  O  O     . ASN D 1 90  ? 7.327   -12.900 25.418  1.00 28.55 ? 90  ASN B O     1 
ATOM   7671  C  CB    . ASN D 1 90  ? 6.385   -15.953 26.099  1.00 27.75 ? 90  ASN B CB    1 
ATOM   7672  C  CG    . ASN D 1 90  ? 5.231   -16.847 25.746  1.00 30.61 ? 90  ASN B CG    1 
ATOM   7673  O  OD1   . ASN D 1 90  ? 4.503   -16.595 24.787  1.00 39.27 ? 90  ASN B OD1   1 
ATOM   7674  N  ND2   . ASN D 1 90  ? 5.046   -17.908 26.527  1.00 41.45 ? 90  ASN B ND2   1 
ATOM   7675  H  H     . ASN D 1 90  ? 7.738   -16.923 24.276  1.00 32.58 ? 90  ASN B H     1 
ATOM   7676  H  HA    . ASN D 1 90  ? 6.168   -14.834 24.406  1.00 33.19 ? 90  ASN B HA    1 
ATOM   7677  H  HB2   . ASN D 1 90  ? 7.087   -16.503 26.480  1.00 33.23 ? 90  ASN B HB2   1 
ATOM   7678  H  HB3   . ASN D 1 90  ? 6.076   -15.306 26.752  1.00 33.23 ? 90  ASN B HB3   1 
ATOM   7679  H  HD21  . ASN D 1 90  ? 5.573   -18.050 27.191  1.00 49.68 ? 90  ASN B HD21  1 
ATOM   7680  H  HD22  . ASN D 1 90  ? 4.399   -18.451 26.367  1.00 49.68 ? 90  ASN B HD22  1 
ATOM   7681  N  N     . LEU D 1 91  ? 9.099   -14.240 25.524  1.00 23.01 ? 91  LEU B N     1 
ATOM   7682  C  CA    . LEU D 1 91  ? 9.965   -13.101 25.812  1.00 23.93 ? 91  LEU B CA    1 
ATOM   7683  C  C     . LEU D 1 91  ? 10.037  -12.172 24.587  1.00 34.40 ? 91  LEU B C     1 
ATOM   7684  O  O     . LEU D 1 91  ? 9.938   -10.945 24.709  1.00 29.85 ? 91  LEU B O     1 
ATOM   7685  C  CB    . LEU D 1 91  ? 11.357  -13.545 26.184  1.00 26.97 ? 91  LEU B CB    1 
ATOM   7686  C  CG    . LEU D 1 91  ? 11.450  -14.427 27.418  1.00 37.65 ? 91  LEU B CG    1 
ATOM   7687  C  CD1   . LEU D 1 91  ? 12.885  -14.896 27.580  1.00 30.02 ? 91  LEU B CD1   1 
ATOM   7688  C  CD2   . LEU D 1 91  ? 10.969  -13.666 28.646  1.00 37.02 ? 91  LEU B CD2   1 
ATOM   7689  H  H     . LEU D 1 91  ? 9.490   -15.005 25.508  1.00 27.55 ? 91  LEU B H     1 
ATOM   7690  H  HA    . LEU D 1 91  ? 9.593   -12.592 26.563  1.00 28.66 ? 91  LEU B HA    1 
ATOM   7691  H  HB2   . LEU D 1 91  ? 11.729  -14.044 25.440  1.00 32.30 ? 91  LEU B HB2   1 
ATOM   7692  H  HB3   . LEU D 1 91  ? 11.897  -12.756 26.348  1.00 32.30 ? 91  LEU B HB3   1 
ATOM   7693  H  HG    . LEU D 1 91  ? 10.885  -15.207 27.300  1.00 45.12 ? 91  LEU B HG    1 
ATOM   7694  H  HD11  . LEU D 1 91  ? 13.140  -15.394 26.800  1.00 35.96 ? 91  LEU B HD11  1 
ATOM   7695  H  HD12  . LEU D 1 91  ? 13.454  -14.130 27.681  1.00 35.96 ? 91  LEU B HD12  1 
ATOM   7696  H  HD13  . LEU D 1 91  ? 12.945  -15.454 28.359  1.00 35.96 ? 91  LEU B HD13  1 
ATOM   7697  H  HD21  . LEU D 1 91  ? 11.035  -14.238 29.414  1.00 44.36 ? 91  LEU B HD21  1 
ATOM   7698  H  HD22  . LEU D 1 91  ? 11.520  -12.889 28.767  1.00 44.36 ? 91  LEU B HD22  1 
ATOM   7699  H  HD23  . LEU D 1 91  ? 10.056  -13.402 28.511  1.00 44.36 ? 91  LEU B HD23  1 
ATOM   7700  N  N     . LEU D 1 92  ? 10.234  -12.763 23.413  1.00 29.45 ? 92  LEU B N     1 
ATOM   7701  C  CA    . LEU D 1 92  ? 10.313  -11.984 22.172  1.00 26.70 ? 92  LEU B CA    1 
ATOM   7702  C  C     . LEU D 1 92  ? 9.046   -11.140 21.954  1.00 32.23 ? 92  LEU B C     1 
ATOM   7703  O  O     . LEU D 1 92  ? 9.115   -9.973  21.587  1.00 32.87 ? 92  LEU B O     1 
ATOM   7704  C  CB    . LEU D 1 92  ? 10.510  -12.925 20.989  1.00 27.49 ? 92  LEU B CB    1 
ATOM   7705  C  CG    . LEU D 1 92  ? 11.848  -13.666 20.945  1.00 24.83 ? 92  LEU B CG    1 
ATOM   7706  C  CD1   . LEU D 1 92  ? 11.862  -14.654 19.785  1.00 27.86 ? 92  LEU B CD1   1 
ATOM   7707  C  CD2   . LEU D 1 92  ? 13.028  -12.671 20.838  1.00 29.08 ? 92  LEU B CD2   1 
ATOM   7708  H  H     . LEU D 1 92  ? 10.325  -13.611 23.303  1.00 35.27 ? 92  LEU B H     1 
ATOM   7709  H  HA    . LEU D 1 92  ? 11.082  -11.379 22.217  1.00 31.98 ? 92  LEU B HA    1 
ATOM   7710  H  HB2   . LEU D 1 92  ? 9.808   -13.595 21.010  1.00 32.93 ? 92  LEU B HB2   1 
ATOM   7711  H  HB3   . LEU D 1 92  ? 10.438  -12.408 20.171  1.00 32.93 ? 92  LEU B HB3   1 
ATOM   7712  H  HG    . LEU D 1 92  ? 11.956  -14.170 21.767  1.00 29.74 ? 92  LEU B HG    1 
ATOM   7713  H  HD11  . LEU D 1 92  ? 12.707  -15.109 19.773  1.00 33.37 ? 92  LEU B HD11  1 
ATOM   7714  H  HD12  . LEU D 1 92  ? 11.150  -15.287 19.906  1.00 33.37 ? 92  LEU B HD12  1 
ATOM   7715  H  HD13  . LEU D 1 92  ? 11.737  -14.172 18.964  1.00 33.37 ? 92  LEU B HD13  1 
ATOM   7716  H  HD21  . LEU D 1 92  ? 13.018  -12.091 21.603  1.00 34.84 ? 92  LEU B HD21  1 
ATOM   7717  H  HD22  . LEU D 1 92  ? 13.851  -13.165 20.813  1.00 34.84 ? 92  LEU B HD22  1 
ATOM   7718  H  HD23  . LEU D 1 92  ? 12.930  -12.156 20.034  1.00 34.84 ? 92  LEU B HD23  1 
ATOM   7719  N  N     . ASN D 1 93  ? 7.886   -11.737 22.191  1.00 34.41 ? 93  ASN B N     1 
ATOM   7720  C  CA    . ASN D 1 93  ? 6.606   -11.109 21.866  1.00 36.34 ? 93  ASN B CA    1 
ATOM   7721  C  C     . ASN D 1 93  ? 6.463   -9.728  22.495  1.00 37.40 ? 93  ASN B C     1 
ATOM   7722  O  O     . ASN D 1 93  ? 5.816   -8.825  21.961  1.00 36.97 ? 93  ASN B O     1 
ATOM   7723  C  CB    . ASN D 1 93  ? 5.468   -12.011 22.329  1.00 39.90 ? 93  ASN B CB    1 
ATOM   7724  C  CG    . ASN D 1 93  ? 4.118   -11.407 22.069  1.00 46.93 ? 93  ASN B CG    1 
ATOM   7725  O  OD1   . ASN D 1 93  ? 3.707   -11.254 20.919  1.00 55.36 ? 93  ASN B OD1   1 
ATOM   7726  N  ND2   . ASN D 1 93  ? 3.415   -11.056 23.132  1.00 50.06 ? 93  ASN B ND2   1 
ATOM   7727  H  H     . ASN D 1 93  ? 7.810   -12.518 22.545  1.00 41.23 ? 93  ASN B H     1 
ATOM   7728  H  HA    . ASN D 1 93  ? 6.537   -11.008 20.893  1.00 43.55 ? 93  ASN B HA    1 
ATOM   7729  H  HB2   . ASN D 1 93  ? 5.517   -12.854 21.853  1.00 47.82 ? 93  ASN B HB2   1 
ATOM   7730  H  HB3   . ASN D 1 93  ? 5.551   -12.162 23.284  1.00 47.82 ? 93  ASN B HB3   1 
ATOM   7731  H  HD21  . ASN D 1 93  ? 3.737   -11.178 23.920  1.00 60.01 ? 93  ASN B HD21  1 
ATOM   7732  H  HD22  . ASN D 1 93  ? 2.635   -10.706 23.036  1.00 60.01 ? 93  ASN B HD22  1 
ATOM   7733  N  N     . LYS D 1 94  ? 7.122   -9.587  23.629  1.00 43.16 ? 94  LYS B N     1 
ATOM   7734  C  CA    A LYS D 1 94  ? 7.054   -8.398  24.456  0.48 41.32 ? 94  LYS B CA    1 
ATOM   7735  C  CA    B LYS D 1 94  ? 7.080   -8.362  24.436  0.52 41.33 ? 94  LYS B CA    1 
ATOM   7736  C  C     . LYS D 1 94  ? 7.808   -7.208  23.816  1.00 45.93 ? 94  LYS B C     1 
ATOM   7737  O  O     . LYS D 1 94  ? 7.517   -6.052  24.106  1.00 43.27 ? 94  LYS B O     1 
ATOM   7738  C  CB    A LYS D 1 94  ? 7.548   -8.856  25.838  0.48 46.83 ? 94  LYS B CB    1 
ATOM   7739  C  CB    B LYS D 1 94  ? 7.833   -8.549  25.740  0.52 46.61 ? 94  LYS B CB    1 
ATOM   7740  C  CG    A LYS D 1 94  ? 8.120   -7.880  26.813  0.48 40.84 ? 94  LYS B CG    1 
ATOM   7741  C  CG    B LYS D 1 94  ? 7.265   -9.535  26.652  0.52 41.36 ? 94  LYS B CG    1 
ATOM   7742  C  CD    A LYS D 1 94  ? 7.312   -8.019  28.116  0.48 50.99 ? 94  LYS B CD    1 
ATOM   7743  C  CD    B LYS D 1 94  ? 6.147   -8.929  27.436  0.52 49.83 ? 94  LYS B CD    1 
ATOM   7744  C  CE    A LYS D 1 94  ? 7.536   -9.311  28.954  0.48 51.31 ? 94  LYS B CE    1 
ATOM   7745  C  CE    B LYS D 1 94  ? 5.896   -9.868  28.531  0.52 50.74 ? 94  LYS B CE    1 
ATOM   7746  N  NZ    A LYS D 1 94  ? 8.499   -10.276 28.351  0.48 44.43 ? 94  LYS B NZ    1 
ATOM   7747  N  NZ    B LYS D 1 94  ? 4.614   -9.555  29.199  0.52 45.06 ? 94  LYS B NZ    1 
ATOM   7748  H  H     . LYS D 1 94  ? 7.628   -10.200 23.959  1.00 51.73 ? 94  LYS B H     1 
ATOM   7749  H  HA    . LYS D 1 94  ? 6.134   -8.117  24.588  0.52 49.53 ? 94  LYS B HA    1 
ATOM   7750  H  HB2   A LYS D 1 94  ? 6.799   -9.279  26.285  0.48 56.14 ? 94  LYS B HB2   1 
ATOM   7751  H  HB2   B LYS D 1 94  ? 8.738   -8.830  25.535  0.52 55.87 ? 94  LYS B HB2   1 
ATOM   7752  H  HB3   A LYS D 1 94  ? 8.235   -9.525  25.690  0.48 56.14 ? 94  LYS B HB3   1 
ATOM   7753  H  HB3   B LYS D 1 94  ? 7.855   -7.699  26.207  0.52 55.87 ? 94  LYS B HB3   1 
ATOM   7754  H  HG2   A LYS D 1 94  ? 9.050   -8.092  26.991  0.48 48.95 ? 94  LYS B HG2   1 
ATOM   7755  H  HG2   B LYS D 1 94  ? 6.915   -10.283 26.144  0.52 49.58 ? 94  LYS B HG2   1 
ATOM   7756  H  HG3   A LYS D 1 94  ? 8.025   -6.976  26.475  0.48 48.95 ? 94  LYS B HG3   1 
ATOM   7757  H  HG3   B LYS D 1 94  ? 7.949   -9.835  27.272  0.52 49.58 ? 94  LYS B HG3   1 
ATOM   7758  H  HD2   A LYS D 1 94  ? 7.460   -7.245  28.682  0.48 61.13 ? 94  LYS B HD2   1 
ATOM   7759  H  HD2   B LYS D 1 94  ? 6.388   -8.063  27.825  0.52 59.73 ? 94  LYS B HD2   1 
ATOM   7760  H  HD3   B LYS D 1 94  ? 5.350   -8.859  26.886  0.52 59.73 ? 94  LYS B HD3   1 
ATOM   7761  H  HE2   A LYS D 1 94  ? 7.914   -9.042  29.806  0.48 61.51 ? 94  LYS B HE2   1 
ATOM   7762  H  HE2   B LYS D 1 94  ? 5.853   -10.772 28.182  0.52 60.83 ? 94  LYS B HE2   1 
ATOM   7763  H  HE3   . LYS D 1 94  ? 6.669   -9.762  29.123  0.52 60.83 ? 94  LYS B HE3   1 
ATOM   7764  H  HZ1   A LYS D 1 94  ? 8.208   -10.537 27.552  0.48 53.25 ? 94  LYS B HZ1   1 
ATOM   7765  H  HZ1   B LYS D 1 94  ? 3.945   -9.614  28.615  0.52 54.01 ? 94  LYS B HZ1   1 
ATOM   7766  H  HZ2   A LYS D 1 94  ? 9.296   -9.892  28.258  0.48 53.25 ? 94  LYS B HZ2   1 
ATOM   7767  H  HZ2   B LYS D 1 94  ? 4.470   -10.130 29.863  0.52 54.01 ? 94  LYS B HZ2   1 
ATOM   7768  H  HZ3   A LYS D 1 94  ? 8.582   -10.990 28.876  0.48 53.25 ? 94  LYS B HZ3   1 
ATOM   7769  H  HZ3   B LYS D 1 94  ? 4.638   -8.730  29.531  0.52 54.01 ? 94  LYS B HZ3   1 
ATOM   7770  N  N     . HIS D 1 95  ? 8.778   -7.513  22.963  1.00 34.06 ? 95  HIS B N     1 
ATOM   7771  C  CA    . HIS D 1 95  ? 9.586   -6.479  22.334  1.00 40.67 ? 95  HIS B CA    1 
ATOM   7772  C  C     . HIS D 1 95  ? 9.110   -6.147  20.935  1.00 39.26 ? 95  HIS B C     1 
ATOM   7773  O  O     . HIS D 1 95  ? 9.716   -5.311  20.257  1.00 43.30 ? 95  HIS B O     1 
ATOM   7774  C  CB    . HIS D 1 95  ? 11.015  -6.957  22.229  1.00 35.36 ? 95  HIS B CB    1 
ATOM   7775  C  CG    . HIS D 1 95  ? 11.631  -7.295  23.536  1.00 39.09 ? 95  HIS B CG    1 
ATOM   7776  N  ND1   . HIS D 1 95  ? 12.075  -6.332  24.415  1.00 34.82 ? 95  HIS B ND1   1 
ATOM   7777  C  CD2   . HIS D 1 95  ? 11.908  -8.488  24.106  1.00 36.97 ? 95  HIS B CD2   1 
ATOM   7778  C  CE1   . HIS D 1 95  ? 12.598  -6.922  25.475  1.00 48.25 ? 95  HIS B CE1   1 
ATOM   7779  N  NE2   . HIS D 1 95  ? 12.510  -8.230  25.310  1.00 34.50 ? 95  HIS B NE2   1 
ATOM   7780  H  H     . HIS D 1 95  ? 8.988   -8.314  22.731  1.00 40.81 ? 95  HIS B H     1 
ATOM   7781  H  HA    . HIS D 1 95  ? 9.564   -5.664  22.878  1.00 48.74 ? 95  HIS B HA    1 
ATOM   7782  H  HB2   . HIS D 1 95  ? 11.038  -7.754  21.676  1.00 42.37 ? 95  HIS B HB2   1 
ATOM   7783  H  HB3   . HIS D 1 95  ? 11.549  -6.258  21.821  1.00 42.37 ? 95  HIS B HB3   1 
ATOM   7784  H  HD1   . HIS D 1 95  ? 12.025  -5.482  24.292  1.00 41.72 ? 95  HIS B HD1   1 
ATOM   7785  H  HD2   . HIS D 1 95  ? 11.730  -9.327  23.746  1.00 44.30 ? 95  HIS B HD2   1 
ATOM   7786  H  HE1   . HIS D 1 95  ? 12.961  -6.490  26.214  1.00 57.84 ? 95  HIS B HE1   1 
ATOM   7787  H  HE2   . HIS D 1 95  ? 12.777  -8.823  25.873  1.00 41.34 ? 95  HIS B HE2   1 
ATOM   7788  N  N     . ALA D 1 96  ? 8.044   -6.806  20.495  1.00 36.24 ? 96  ALA B N     1 
ATOM   7789  C  CA    . ALA D 1 96  ? 7.571   -6.640  19.125  1.00 39.12 ? 96  ALA B CA    1 
ATOM   7790  C  C     . ALA D 1 96  ? 6.225   -5.946  19.062  1.00 45.94 ? 96  ALA B C     1 
ATOM   7791  O  O     . ALA D 1 96  ? 5.321   -6.228  19.855  1.00 37.34 ? 96  ALA B O     1 
ATOM   7792  C  CB    . ALA D 1 96  ? 7.458   -7.974  18.442  1.00 30.83 ? 96  ALA B CB    1 
ATOM   7793  H  H     . ALA D 1 96  ? 7.579   -7.355  20.967  1.00 43.42 ? 96  ALA B H     1 
ATOM   7794  H  HA    . ALA D 1 96  ? 8.217   -6.096  18.627  1.00 46.89 ? 96  ALA B HA    1 
ATOM   7795  H  HB1   . ALA D 1 96  ? 7.146   -7.839  17.544  1.00 36.94 ? 96  ALA B HB1   1 
ATOM   7796  H  HB2   . ALA D 1 96  ? 8.322   -8.392  18.429  1.00 36.94 ? 96  ALA B HB2   1 
ATOM   7797  H  HB3   . ALA D 1 96  ? 6.836   -8.521  18.926  1.00 36.94 ? 96  ALA B HB3   1 
ATOM   7798  N  N     . ASP D 1 97  ? 6.094   -5.055  18.091  1.00 36.82 ? 97  ASP B N     1 
ATOM   7799  C  CA    . ASP D 1 97  ? 4.787   -4.582  17.689  1.00 42.68 ? 97  ASP B CA    1 
ATOM   7800  C  C     . ASP D 1 97  ? 3.978   -5.780  17.209  1.00 42.89 ? 97  ASP B C     1 
ATOM   7801  O  O     . ASP D 1 97  ? 2.788   -5.898  17.488  1.00 34.78 ? 97  ASP B O     1 
ATOM   7802  C  CB    . ASP D 1 97  ? 4.933   -3.549  16.572  1.00 43.62 ? 97  ASP B CB    1 
ATOM   7803  C  CG    . ASP D 1 97  ? 5.885   -2.416  16.942  1.00 41.51 ? 97  ASP B CG    1 
ATOM   7804  O  OD1   . ASP D 1 97  ? 6.014   -2.095  18.135  1.00 52.88 ? 97  ASP B OD1   1 
ATOM   7805  O  OD2   . ASP D 1 97  ? 6.494   -1.835  16.028  1.00 53.61 ? 97  ASP B OD2   1 
ATOM   7806  H  H     . ASP D 1 97  ? 6.748   -4.711  17.651  1.00 44.12 ? 97  ASP B H     1 
ATOM   7807  H  HA    . ASP D 1 97  ? 4.328   -4.169  18.450  1.00 51.16 ? 97  ASP B HA    1 
ATOM   7808  H  HB2   . ASP D 1 97  ? 5.280   -3.987  15.780  1.00 52.28 ? 97  ASP B HB2   1 
ATOM   7809  H  HB3   . ASP D 1 97  ? 4.063   -3.162  16.384  1.00 52.28 ? 97  ASP B HB3   1 
ATOM   7810  N  N     . LYS D 1 98  ? 4.633   -6.678  16.480  1.00 41.15 ? 98  LYS B N     1 
ATOM   7811  C  CA    . LYS D 1 98  ? 3.984   -7.885  15.980  1.00 34.81 ? 98  LYS B CA    1 
ATOM   7812  C  C     . LYS D 1 98  ? 5.039   -8.961  15.802  1.00 36.28 ? 98  LYS B C     1 
ATOM   7813  O  O     . LYS D 1 98  ? 6.200   -8.660  15.504  1.00 32.55 ? 98  LYS B O     1 
ATOM   7814  C  CB    . LYS D 1 98  ? 3.275   -7.621  14.648  1.00 43.21 ? 98  LYS B CB    1 
ATOM   7815  C  CG    . LYS D 1 98  ? 2.237   -8.687  14.260  1.00 50.70 ? 98  LYS B CG    1 
ATOM   7816  C  CD    . LYS D 1 98  ? 1.548   -8.377  12.900  1.00 62.06 ? 98  LYS B CD    1 
ATOM   7817  C  CE    . LYS D 1 98  ? 0.408   -9.376  12.575  1.00 63.06 ? 98  LYS B CE    1 
ATOM   7818  N  NZ    . LYS D 1 98  ? -0.296  -9.124  11.264  1.00 63.71 ? 98  LYS B NZ    1 
ATOM   7819  H  H     . LYS D 1 98  ? 5.462   -6.610  16.259  1.00 49.32 ? 98  LYS B H     1 
ATOM   7820  H  HA    . LYS D 1 98  ? 3.322   -8.198  16.632  1.00 41.71 ? 98  LYS B HA    1 
ATOM   7821  H  HB2   . LYS D 1 98  ? 2.815   -6.769  14.704  1.00 51.79 ? 98  LYS B HB2   1 
ATOM   7822  H  HB3   . LYS D 1 98  ? 3.940   -7.588  13.943  1.00 51.79 ? 98  LYS B HB3   1 
ATOM   7823  H  HG2   . LYS D 1 98  ? 2.678   -9.547  14.185  1.00 60.78 ? 98  LYS B HG2   1 
ATOM   7824  H  HG3   . LYS D 1 98  ? 1.549   -8.724  14.944  1.00 60.78 ? 98  LYS B HG3   1 
ATOM   7825  H  HD2   . LYS D 1 98  ? 1.167   -7.486  12.933  1.00 74.41 ? 98  LYS B HD2   1 
ATOM   7826  H  HD3   . LYS D 1 98  ? 2.208   -8.432  12.191  1.00 74.41 ? 98  LYS B HD3   1 
ATOM   7827  H  HE2   . LYS D 1 98  ? 0.781   -10.271 12.541  1.00 75.62 ? 98  LYS B HE2   1 
ATOM   7828  H  HE3   . LYS D 1 98  ? -0.257  -9.327  13.280  1.00 75.62 ? 98  LYS B HE3   1 
ATOM   7829  H  HZ1   . LYS D 1 98  ? -0.935  -9.731  11.140  1.00 76.39 ? 98  LYS B HZ1   1 
ATOM   7830  H  HZ2   . LYS D 1 98  ? -0.663  -8.314  11.267  1.00 76.39 ? 98  LYS B HZ2   1 
ATOM   7831  H  HZ3   . LYS D 1 98  ? 0.285   -9.176  10.592  1.00 76.39 ? 98  LYS B HZ3   1 
ATOM   7832  N  N     . ILE D 1 99  ? 4.647   -10.215 15.991  1.00 28.62 ? 99  ILE B N     1 
ATOM   7833  C  CA    . ILE D 1 99  ? 5.610   -11.305 15.901  1.00 32.74 ? 99  ILE B CA    1 
ATOM   7834  C  C     . ILE D 1 99  ? 5.100   -12.424 15.038  1.00 33.05 ? 99  ILE B C     1 
ATOM   7835  O  O     . ILE D 1 99  ? 3.926   -12.812 15.089  1.00 30.16 ? 99  ILE B O     1 
ATOM   7836  C  CB    . ILE D 1 99  ? 6.000   -11.865 17.295  1.00 30.76 ? 99  ILE B CB    1 
ATOM   7837  C  CG1   . ILE D 1 99  ? 7.004   -13.005 17.147  1.00 27.92 ? 99  ILE B CG1   1 
ATOM   7838  C  CG2   . ILE D 1 99  ? 4.766   -12.402 18.038  1.00 37.82 ? 99  ILE B CG2   1 
ATOM   7839  C  CD1   . ILE D 1 99  ? 7.731   -13.307 18.439  1.00 32.94 ? 99  ILE B CD1   1 
ATOM   7840  H  H     . ILE D 1 99  ? 3.842   -10.460 16.170  1.00 34.28 ? 99  ILE B H     1 
ATOM   7841  H  HA    . ILE D 1 99  ? 6.427   -10.961 15.484  1.00 39.23 ? 99  ILE B HA    1 
ATOM   7842  H  HB    . ILE D 1 99  ? 6.403   -11.156 17.820  1.00 36.85 ? 99  ILE B HB    1 
ATOM   7843  H  HG12  . ILE D 1 99  ? 6.534   -13.807 16.872  1.00 33.44 ? 99  ILE B HG12  1 
ATOM   7844  H  HG13  . ILE D 1 99  ? 7.665   -12.761 16.481  1.00 33.44 ? 99  ILE B HG13  1 
ATOM   7845  H  HG21  . ILE D 1 99  ? 5.040   -12.740 18.894  1.00 45.33 ? 99  ILE B HG21  1 
ATOM   7846  H  HG22  . ILE D 1 99  ? 4.137   -11.686 18.155  1.00 45.33 ? 99  ILE B HG22  1 
ATOM   7847  H  HG23  . ILE D 1 99  ? 4.370   -13.105 17.519  1.00 45.33 ? 99  ILE B HG23  1 
ATOM   7848  H  HD11  . ILE D 1 99  ? 8.207   -12.522 18.720  1.00 39.46 ? 99  ILE B HD11  1 
ATOM   7849  H  HD12  . ILE D 1 99  ? 7.088   -13.557 19.107  1.00 39.46 ? 99  ILE B HD12  1 
ATOM   7850  H  HD13  . ILE D 1 99  ? 8.346   -14.028 18.290  1.00 39.46 ? 99  ILE B HD13  1 
ATOM   7851  N  N     . GLU D 1 100 ? 6.011   -12.957 14.245  1.00 25.54 ? 100 GLU B N     1 
ATOM   7852  C  CA    . GLU D 1 100 ? 5.734   -14.112 13.423  1.00 25.85 ? 100 GLU B CA    1 
ATOM   7853  C  C     . GLU D 1 100 ? 6.622   -15.290 13.842  1.00 29.48 ? 100 GLU B C     1 
ATOM   7854  O  O     . GLU D 1 100 ? 7.804   -15.337 13.512  1.00 25.45 ? 100 GLU B O     1 
ATOM   7855  C  CB    . GLU D 1 100 ? 5.979   -13.793 11.957  1.00 24.51 ? 100 GLU B CB    1 
ATOM   7856  C  CG    . GLU D 1 100 ? 5.792   -14.972 11.030  1.00 24.76 ? 100 GLU B CG    1 
ATOM   7857  C  CD    . GLU D 1 100 ? 5.832   -14.585 9.552   1.00 39.18 ? 100 GLU B CD    1 
ATOM   7858  O  OE1   . GLU D 1 100 ? 6.099   -15.456 8.697   1.00 37.46 ? 100 GLU B OE1   1 
ATOM   7859  O  OE2   . GLU D 1 100 ? 5.580   -13.405 9.244   1.00 33.59 ? 100 GLU B OE2   1 
ATOM   7860  H  H     . GLU D 1 100 ? 6.814   -12.660 14.166  1.00 30.59 ? 100 GLU B H     1 
ATOM   7861  H  HA    . GLU D 1 100 ? 4.796   -14.374 13.532  1.00 30.96 ? 100 GLU B HA    1 
ATOM   7862  H  HB2   . GLU D 1 100 ? 5.360   -13.099 11.681  1.00 29.35 ? 100 GLU B HB2   1 
ATOM   7863  H  HB3   . GLU D 1 100 ? 6.891   -13.479 11.854  1.00 29.35 ? 100 GLU B HB3   1 
ATOM   7864  H  HG2   . GLU D 1 100 ? 6.501   -15.614 11.190  1.00 29.65 ? 100 GLU B HG2   1 
ATOM   7865  H  HG3   . GLU D 1 100 ? 4.930   -15.379 11.209  1.00 29.65 ? 100 GLU B HG3   1 
ATOM   7866  N  N     . VAL D 1 101 ? 6.031   -16.258 14.533  1.00 26.80 ? 101 VAL B N     1 
ATOM   7867  C  CA    . VAL D 1 101 ? 6.768   -17.440 14.951  1.00 25.72 ? 101 VAL B CA    1 
ATOM   7868  C  C     . VAL D 1 101 ? 6.790   -18.391 13.789  1.00 29.11 ? 101 VAL B C     1 
ATOM   7869  O  O     . VAL D 1 101 ? 5.758   -18.969 13.417  1.00 30.87 ? 101 VAL B O     1 
ATOM   7870  C  CB    . VAL D 1 101 ? 6.121   -18.086 16.207  1.00 25.78 ? 101 VAL B CB    1 
ATOM   7871  C  CG1   . VAL D 1 101 ? 6.751   -19.446 16.515  1.00 32.44 ? 101 VAL B CG1   1 
ATOM   7872  C  CG2   . VAL D 1 101 ? 6.266   -17.154 17.341  1.00 24.60 ? 101 VAL B CG2   1 
ATOM   7873  H  H     . VAL D 1 101 ? 5.205   -16.254 14.771  1.00 32.10 ? 101 VAL B H     1 
ATOM   7874  H  HA    . VAL D 1 101 ? 7.691   -17.191 15.169  1.00 30.80 ? 101 VAL B HA    1 
ATOM   7875  H  HB    . VAL D 1 101 ? 5.164   -18.221 16.042  1.00 30.87 ? 101 VAL B HB    1 
ATOM   7876  H  HG11  . VAL D 1 101 ? 7.430   -19.631 15.862  1.00 38.86 ? 101 VAL B HG11  1 
ATOM   7877  H  HG12  . VAL D 1 101 ? 7.139   -19.419 17.392  1.00 38.86 ? 101 VAL B HG12  1 
ATOM   7878  H  HG13  . VAL D 1 101 ? 6.069   -20.121 16.479  1.00 38.86 ? 101 VAL B HG13  1 
ATOM   7879  H  HG21  . VAL D 1 101 ? 6.725   -16.366 17.042  1.00 29.45 ? 101 VAL B HG21  1 
ATOM   7880  H  HG22  . VAL D 1 101 ? 5.393   -16.920 17.667  1.00 29.45 ? 101 VAL B HG22  1 
ATOM   7881  H  HG23  . VAL D 1 101 ? 6.770   -17.584 18.036  1.00 29.45 ? 101 VAL B HG23  1 
ATOM   7882  N  N     . ALA D 1 102 ? 7.968   -18.550 13.191  1.00 25.94 ? 102 ALA B N     1 
ATOM   7883  C  CA    . ALA D 1 102 ? 8.070   -19.248 11.918  1.00 27.08 ? 102 ALA B CA    1 
ATOM   7884  C  C     . ALA D 1 102 ? 8.346   -20.717 12.095  1.00 33.61 ? 102 ALA B C     1 
ATOM   7885  O  O     . ALA D 1 102 ? 8.034   -21.515 11.222  1.00 28.05 ? 102 ALA B O     1 
ATOM   7886  C  CB    . ALA D 1 102 ? 9.131   -18.609 11.031  1.00 28.56 ? 102 ALA B CB    1 
ATOM   7887  H  H     . ALA D 1 102 ? 8.718   -18.265 13.502  1.00 31.07 ? 102 ALA B H     1 
ATOM   7888  H  HA    . ALA D 1 102 ? 7.212   -19.167 11.453  1.00 32.44 ? 102 ALA B HA    1 
ATOM   7889  H  HB1   . ALA D 1 102 ? 8.892   -17.694 10.868  1.00 34.22 ? 102 ALA B HB1   1 
ATOM   7890  H  HB2   . ALA D 1 102 ? 9.979   -18.651 11.480  1.00 34.22 ? 102 ALA B HB2   1 
ATOM   7891  H  HB3   . ALA D 1 102 ? 9.175   -19.090 10.202  1.00 34.22 ? 102 ALA B HB3   1 
ATOM   7892  N  N     . SER D 1 103 ? 8.936   -21.086 13.225  1.00 25.82 ? 103 SER B N     1 
ATOM   7893  C  CA    . SER D 1 103 ? 9.249   -22.488 13.494  1.00 23.90 ? 103 SER B CA    1 
ATOM   7894  C  C     . SER D 1 103 ? 9.534   -22.624 14.976  1.00 19.26 ? 103 SER B C     1 
ATOM   7895  O  O     . SER D 1 103 ? 9.480   -21.650 15.698  1.00 19.93 ? 103 SER B O     1 
ATOM   7896  C  CB    . SER D 1 103 ? 10.464  -22.970 12.695  1.00 24.62 ? 103 SER B CB    1 
ATOM   7897  O  OG    . SER D 1 103 ? 11.679  -22.516 13.271  1.00 24.74 ? 103 SER B OG    1 
ATOM   7898  H  H     . SER D 1 103 ? 9.166   -20.546 13.854  1.00 30.92 ? 103 SER B H     1 
ATOM   7899  H  HA    . SER D 1 103 ? 8.478   -23.050 13.267  1.00 28.62 ? 103 SER B HA    1 
ATOM   7900  H  HB2   . SER D 1 103 ? 10.466  -23.940 12.683  1.00 29.48 ? 103 SER B HB2   1 
ATOM   7901  H  HB3   . SER D 1 103 ? 10.400  -22.629 11.790  1.00 29.48 ? 103 SER B HB3   1 
ATOM   7902  H  HG    . SER D 1 103 ? 12.316  -22.784 12.830  1.00 29.62 ? 103 SER B HG    1 
ATOM   7903  N  N     . ILE D 1 104 ? 9.866   -23.828 15.407  1.00 23.40 ? 104 ILE B N     1 
ATOM   7904  C  CA    . ILE D 1 104 ? 10.183  -24.056 16.816  1.00 22.10 ? 104 ILE B CA    1 
ATOM   7905  C  C     . ILE D 1 104 ? 11.379  -23.210 17.270  1.00 22.02 ? 104 ILE B C     1 
ATOM   7906  O  O     . ILE D 1 104 ? 11.573  -22.906 18.465  1.00 18.29 ? 104 ILE B O     1 
ATOM   7907  C  CB    . ILE D 1 104 ? 10.441  -25.557 17.080  1.00 21.42 ? 104 ILE B CB    1 
ATOM   7908  C  CG1   . ILE D 1 104 ? 10.481  -25.808 18.592  1.00 26.53 ? 104 ILE B CG1   1 
ATOM   7909  C  CG2   . ILE D 1 104 ? 11.698  -26.043 16.380  1.00 21.99 ? 104 ILE B CG2   1 
ATOM   7910  C  CD1   . ILE D 1 104 ? 10.605  -27.244 18.947  1.00 22.13 ? 104 ILE B CD1   1 
ATOM   7911  H  H     . ILE D 1 104 ? 9.917   -24.529 14.912  1.00 28.02 ? 104 ILE B H     1 
ATOM   7912  H  HA    . ILE D 1 104 ? 9.410   -23.790 17.356  1.00 26.46 ? 104 ILE B HA    1 
ATOM   7913  H  HB    . ILE D 1 104 ? 9.691   -26.053 16.718  1.00 25.65 ? 104 ILE B HB    1 
ATOM   7914  H  HG12  . ILE D 1 104 ? 11.243  -25.341 18.969  1.00 31.77 ? 104 ILE B HG12  1 
ATOM   7915  H  HG13  . ILE D 1 104 ? 9.660   -25.474 18.988  1.00 31.77 ? 104 ILE B HG13  1 
ATOM   7916  H  HG21  . ILE D 1 104 ? 11.819  -26.977 16.570  1.00 26.33 ? 104 ILE B HG21  1 
ATOM   7917  H  HG22  . ILE D 1 104 ? 11.599  -25.912 15.434  1.00 26.33 ? 104 ILE B HG22  1 
ATOM   7918  H  HG23  . ILE D 1 104 ? 12.450  -25.542 16.704  1.00 26.33 ? 104 ILE B HG23  1 
ATOM   7919  H  HD11  . ILE D 1 104 ? 10.623  -27.329 19.903  1.00 26.49 ? 104 ILE B HD11  1 
ATOM   7920  H  HD12  . ILE D 1 104 ? 9.851   -27.719 18.590  1.00 26.49 ? 104 ILE B HD12  1 
ATOM   7921  H  HD13  . ILE D 1 104 ? 11.418  -27.589 18.571  1.00 26.49 ? 104 ILE B HD13  1 
ATOM   7922  N  N     . ASP D 1 105 ? 12.204  -22.802 16.326  1.00 16.14 ? 105 ASP B N     1 
ATOM   7923  C  CA    . ASP D 1 105 ? 13.370  -22.052 16.777  1.00 21.19 ? 105 ASP B CA    1 
ATOM   7924  C  C     . ASP D 1 105 ? 13.639  -20.756 16.065  1.00 19.24 ? 105 ASP B C     1 
ATOM   7925  O  O     . ASP D 1 105 ? 14.731  -20.226 16.208  1.00 16.19 ? 105 ASP B O     1 
ATOM   7926  C  CB    . ASP D 1 105 ? 14.635  -22.923 16.857  1.00 24.52 ? 105 ASP B CB    1 
ATOM   7927  C  CG    . ASP D 1 105 ? 15.489  -22.856 15.601  1.00 23.30 ? 105 ASP B CG    1 
ATOM   7928  O  OD1   . ASP D 1 105 ? 14.956  -22.685 14.518  1.00 25.89 ? 105 ASP B OD1   1 
ATOM   7929  O  OD2   . ASP D 1 105 ? 16.700  -23.019 15.723  1.00 16.00 ? 105 ASP B OD2   1 
ATOM   7930  H  H     . ASP D 1 105 ? 12.129  -22.930 15.479  1.00 19.31 ? 105 ASP B H     1 
ATOM   7931  H  HA    . ASP D 1 105 ? 13.180  -21.794 17.703  1.00 25.37 ? 105 ASP B HA    1 
ATOM   7932  H  HB2   . ASP D 1 105 ? 15.178  -22.623 17.603  1.00 29.36 ? 105 ASP B HB2   1 
ATOM   7933  H  HB3   . ASP D 1 105 ? 14.373  -23.847 16.990  1.00 29.36 ? 105 ASP B HB3   1 
ATOM   7934  N  N     . GLU D 1 106 ? 12.643  -20.199 15.377  1.00 17.92 ? 106 GLU B N     1 
ATOM   7935  C  CA    . GLU D 1 106 ? 12.874  -18.885 14.774  1.00 18.28 ? 106 GLU B CA    1 
ATOM   7936  C  C     . GLU D 1 106 ? 11.630  -18.016 14.667  1.00 20.02 ? 106 GLU B C     1 
ATOM   7937  O  O     . GLU D 1 106 ? 10.489  -18.511 14.546  1.00 20.42 ? 106 GLU B O     1 
ATOM   7938  C  CB    . GLU D 1 106 ? 13.614  -19.038 13.427  1.00 25.12 ? 106 GLU B CB    1 
ATOM   7939  C  CG    . GLU D 1 106 ? 12.791  -19.595 12.367  1.00 23.67 ? 106 GLU B CG    1 
ATOM   7940  C  CD    . GLU D 1 106 ? 13.584  -19.997 11.132  1.00 33.09 ? 106 GLU B CD    1 
ATOM   7941  O  OE1   . GLU D 1 106 ? 14.341  -20.958 11.195  1.00 38.09 ? 106 GLU B OE1   1 
ATOM   7942  O  OE2   . GLU D 1 106 ? 13.419  -19.371 10.086  1.00 26.62 ? 106 GLU B OE2   1 
ATOM   7943  H  H     . GLU D 1 106 ? 11.864  -20.538 15.248  1.00 21.44 ? 106 GLU B H     1 
ATOM   7944  H  HA    . GLU D 1 106 ? 13.488  -18.403 15.367  1.00 21.87 ? 106 GLU B HA    1 
ATOM   7945  H  HB2   . GLU D 1 106 ? 13.919  -18.164 13.138  1.00 30.08 ? 106 GLU B HB2   1 
ATOM   7946  H  HB3   . GLU D 1 106 ? 14.374  -19.627 13.553  1.00 30.08 ? 106 GLU B HB3   1 
ATOM   7947  H  HG2   . GLU D 1 106 ? 12.341  -20.386 12.702  1.00 28.34 ? 106 GLU B HG2   1 
ATOM   7948  H  HG3   . GLU D 1 106 ? 12.136  -18.932 12.097  1.00 28.34 ? 106 GLU B HG3   1 
ATOM   7949  N  N     . ALA D 1 107 ? 11.849  -16.705 14.774  1.00 19.15 ? 107 ALA B N     1 
ATOM   7950  C  CA    . ALA D 1 107 ? 10.763  -15.761 14.711  1.00 19.28 ? 107 ALA B CA    1 
ATOM   7951  C  C     . ALA D 1 107 ? 11.192  -14.429 14.098  1.00 21.97 ? 107 ALA B C     1 
ATOM   7952  O  O     . ALA D 1 107 ? 12.365  -14.027 14.173  1.00 16.63 ? 107 ALA B O     1 
ATOM   7953  C  CB    . ALA D 1 107 ? 10.151  -15.534 16.054  1.00 19.59 ? 107 ALA B CB    1 
ATOM   7954  H  H     . ALA D 1 107 ? 12.623  -16.347 14.884  1.00 22.91 ? 107 ALA B H     1 
ATOM   7955  H  HA    . ALA D 1 107 ? 10.065  -16.136 14.134  1.00 23.07 ? 107 ALA B HA    1 
ATOM   7956  H  HB1   . ALA D 1 107 ? 9.435   -14.901 15.968  1.00 23.44 ? 107 ALA B HB1   1 
ATOM   7957  H  HB2   . ALA D 1 107 ? 9.814   -16.368 16.389  1.00 23.44 ? 107 ALA B HB2   1 
ATOM   7958  H  HB3   . ALA D 1 107 ? 10.822  -15.189 16.648  1.00 23.44 ? 107 ALA B HB3   1 
ATOM   7959  N  N     . TYR D 1 108 ? 10.211  -13.783 13.469  1.00 20.09 ? 108 TYR B N     1 
ATOM   7960  C  CA    . TYR D 1 108 ? 10.350  -12.426 12.941  1.00 23.11 ? 108 TYR B CA    1 
ATOM   7961  C  C     . TYR D 1 108 ? 9.580   -11.465 13.814  1.00 21.89 ? 108 TYR B C     1 
ATOM   7962  O  O     . TYR D 1 108 ? 8.405   -11.694 14.135  1.00 27.60 ? 108 TYR B O     1 
ATOM   7963  C  CB    . TYR D 1 108 ? 9.798   -12.356 11.509  1.00 23.59 ? 108 TYR B CB    1 
ATOM   7964  C  CG    . TYR D 1 108 ? 10.503  -13.250 10.532  1.00 20.86 ? 108 TYR B CG    1 
ATOM   7965  C  CD1   . TYR D 1 108 ? 10.114  -14.574 10.361  1.00 25.43 ? 108 TYR B CD1   1 
ATOM   7966  C  CD2   . TYR D 1 108 ? 11.569  -12.783 9.784   1.00 26.47 ? 108 TYR B CD2   1 
ATOM   7967  C  CE1   . TYR D 1 108 ? 10.754  -15.395 9.478   1.00 24.98 ? 108 TYR B CE1   1 
ATOM   7968  C  CE2   . TYR D 1 108 ? 12.209  -13.589 8.895   1.00 25.96 ? 108 TYR B CE2   1 
ATOM   7969  C  CZ    . TYR D 1 108 ? 11.793  -14.900 8.731   1.00 33.34 ? 108 TYR B CZ    1 
ATOM   7970  O  OH    . TYR D 1 108 ? 12.456  -15.718 7.846   1.00 32.00 ? 108 TYR B OH    1 
ATOM   7971  H  H     . TYR D 1 108 ? 9.433   -14.121 13.332  1.00 24.05 ? 108 TYR B H     1 
ATOM   7972  H  HA    . TYR D 1 108 ? 11.294  -12.163 12.933  1.00 27.68 ? 108 TYR B HA    1 
ATOM   7973  H  HB2   . TYR D 1 108 ? 8.863   -12.614 11.523  1.00 28.25 ? 108 TYR B HB2   1 
ATOM   7974  H  HB3   . TYR D 1 108 ? 9.881   -11.445 11.188  1.00 28.25 ? 108 TYR B HB3   1 
ATOM   7975  H  HD1   . TYR D 1 108 ? 9.402   -14.907 10.858  1.00 30.46 ? 108 TYR B HD1   1 
ATOM   7976  H  HD2   . TYR D 1 108 ? 11.844  -11.900 9.881   1.00 31.70 ? 108 TYR B HD2   1 
ATOM   7977  H  HE1   . TYR D 1 108 ? 10.478  -16.276 9.371   1.00 29.91 ? 108 TYR B HE1   1 
ATOM   7978  H  HE2   . TYR D 1 108 ? 12.921  -13.259 8.396   1.00 31.10 ? 108 TYR B HE2   1 
ATOM   7979  H  HH    . TYR D 1 108 ? 11.933  -16.005 7.283   1.00 38.33 ? 108 TYR B HH    1 
ATOM   7980  N  N     . LEU D 1 109 ? 10.232  -10.386 14.206  1.00 19.42 ? 109 LEU B N     1 
ATOM   7981  C  CA    . LEU D 1 109 ? 9.602   -9.342  14.972  1.00 25.50 ? 109 LEU B CA    1 
ATOM   7982  C  C     . LEU D 1 109 ? 9.552   -8.063  14.165  1.00 30.00 ? 109 LEU B C     1 
ATOM   7983  O  O     . LEU D 1 109 ? 10.557  -7.653  13.604  1.00 24.73 ? 109 LEU B O     1 
ATOM   7984  C  CB    . LEU D 1 109 ? 10.382  -9.046  16.247  1.00 24.72 ? 109 LEU B CB    1 
ATOM   7985  C  CG    . LEU D 1 109 ? 10.425  -10.100 17.356  1.00 27.17 ? 109 LEU B CG    1 
ATOM   7986  C  CD1   . LEU D 1 109 ? 11.104  -11.368 16.927  1.00 29.90 ? 109 LEU B CD1   1 
ATOM   7987  C  CD2   . LEU D 1 109 ? 11.138  -9.482  18.526  1.00 31.32 ? 109 LEU B CD2   1 
ATOM   7988  H  H     . LEU D 1 109 ? 11.062  -10.236 14.035  1.00 23.24 ? 109 LEU B H     1 
ATOM   7989  H  HA    . LEU D 1 109 ? 8.688   -9.605  15.210  1.00 30.54 ? 109 LEU B HA    1 
ATOM   7990  H  HB2   . LEU D 1 109 ? 11.302  -8.871  15.994  1.00 29.60 ? 109 LEU B HB2   1 
ATOM   7991  H  HB3   . LEU D 1 109 ? 10.008  -8.243  16.642  1.00 29.60 ? 109 LEU B HB3   1 
ATOM   7992  H  HG    . LEU D 1 109 ? 9.520   -10.316 17.629  1.00 32.54 ? 109 LEU B HG    1 
ATOM   7993  H  HD11  . LEU D 1 109 ? 12.008  -11.167 16.672  1.00 35.81 ? 109 LEU B HD11  1 
ATOM   7994  H  HD12  . LEU D 1 109 ? 11.100  -11.987 17.660  1.00 35.81 ? 109 LEU B HD12  1 
ATOM   7995  H  HD13  . LEU D 1 109 ? 10.628  -11.739 16.180  1.00 35.81 ? 109 LEU B HD13  1 
ATOM   7996  H  HD21  . LEU D 1 109 ? 10.653  -8.705  18.812  1.00 37.52 ? 109 LEU B HD21  1 
ATOM   7997  H  HD22  . LEU D 1 109 ? 11.180  -10.123 19.240  1.00 37.52 ? 109 LEU B HD22  1 
ATOM   7998  H  HD23  . LEU D 1 109 ? 12.025  -9.235  18.255  1.00 37.52 ? 109 LEU B HD23  1 
ATOM   7999  N  N     . ASP D 1 110 ? 8.392   -7.417  14.129  1.00 32.94 ? 110 ASP B N     1 
ATOM   8000  C  CA    . ASP D 1 110 ? 8.321   -6.071  13.577  1.00 29.00 ? 110 ASP B CA    1 
ATOM   8001  C  C     . ASP D 1 110 ? 8.375   -5.101  14.752  1.00 29.87 ? 110 ASP B C     1 
ATOM   8002  O  O     . ASP D 1 110 ? 7.477   -5.074  15.595  1.00 32.45 ? 110 ASP B O     1 
ATOM   8003  C  CB    . ASP D 1 110 ? 7.054   -5.910  12.735  1.00 32.31 ? 110 ASP B CB    1 
ATOM   8004  C  CG    . ASP D 1 110 ? 6.857   -4.492  12.213  1.00 39.37 ? 110 ASP B CG    1 
ATOM   8005  O  OD1   . ASP D 1 110 ? 7.577   -3.577  12.658  1.00 37.22 ? 110 ASP B OD1   1 
ATOM   8006  O  OD2   . ASP D 1 110 ? 5.953   -4.307  11.376  1.00 44.72 ? 110 ASP B OD2   1 
ATOM   8007  H  H     . ASP D 1 110 ? 7.644   -7.730  14.413  1.00 39.47 ? 110 ASP B H     1 
ATOM   8008  H  HA    . ASP D 1 110 ? 9.099   -5.910  13.003  1.00 34.73 ? 110 ASP B HA    1 
ATOM   8009  H  HB2   . ASP D 1 110 ? 7.106   -6.505  11.971  1.00 38.71 ? 110 ASP B HB2   1 
ATOM   8010  H  HB3   . ASP D 1 110 ? 6.284   -6.138  13.279  1.00 38.71 ? 110 ASP B HB3   1 
ATOM   8011  N  N     . VAL D 1 111 ? 9.462   -4.337  14.821  1.00 30.30 ? 111 VAL B N     1 
ATOM   8012  C  CA    . VAL D 1 111 ? 9.722   -3.438  15.940  1.00 34.81 ? 111 VAL B CA    1 
ATOM   8013  C  C     . VAL D 1 111 ? 9.767   -1.977  15.474  1.00 36.39 ? 111 VAL B C     1 
ATOM   8014  O  O     . VAL D 1 111 ? 10.299  -1.091  16.156  1.00 39.62 ? 111 VAL B O     1 
ATOM   8015  C  CB    . VAL D 1 111 ? 11.037  -3.806  16.648  1.00 33.52 ? 111 VAL B CB    1 
ATOM   8016  C  CG1   . VAL D 1 111 ? 11.022  -5.286  17.036  1.00 30.69 ? 111 VAL B CG1   1 
ATOM   8017  C  CG2   . VAL D 1 111 ? 12.236  -3.503  15.762  1.00 30.49 ? 111 VAL B CG2   1 
ATOM   8018  H  H     . VAL D 1 111 ? 10.075  -4.321  14.219  1.00 36.29 ? 111 VAL B H     1 
ATOM   8019  H  HA    . VAL D 1 111 ? 8.995   -3.524  16.592  1.00 41.71 ? 111 VAL B HA    1 
ATOM   8020  H  HB    . VAL D 1 111 ? 11.121  -3.276  17.468  1.00 40.17 ? 111 VAL B HB    1 
ATOM   8021  H  HG11  . VAL D 1 111 ? 11.847  -5.501  17.477  1.00 36.77 ? 111 VAL B HG11  1 
ATOM   8022  H  HG12  . VAL D 1 111 ? 10.283  -5.445  17.628  1.00 36.77 ? 111 VAL B HG12  1 
ATOM   8023  H  HG13  . VAL D 1 111 ? 10.926  -5.816  16.242  1.00 36.77 ? 111 VAL B HG13  1 
ATOM   8024  H  HG21  . VAL D 1 111 ? 13.039  -3.743  16.231  1.00 36.53 ? 111 VAL B HG21  1 
ATOM   8025  H  HG22  . VAL D 1 111 ? 12.163  -4.014  14.953  1.00 36.53 ? 111 VAL B HG22  1 
ATOM   8026  H  HG23  . VAL D 1 111 ? 12.243  -2.565  15.558  1.00 36.53 ? 111 VAL B HG23  1 
ATOM   8027  N  N     . THR D 1 112 ? 9.196   -1.750  14.302  1.00 40.24 ? 112 THR B N     1 
ATOM   8028  C  CA    . THR D 1 112 ? 9.143   -0.431  13.690  1.00 41.25 ? 112 THR B CA    1 
ATOM   8029  C  C     . THR D 1 112 ? 8.658   0.601   14.713  1.00 41.79 ? 112 THR B C     1 
ATOM   8030  O  O     . THR D 1 112 ? 9.393   1.499   15.103  1.00 39.11 ? 112 THR B O     1 
ATOM   8031  C  CB    . THR D 1 112 ? 8.188   -0.445  12.467  1.00 47.96 ? 112 THR B CB    1 
ATOM   8032  O  OG1   . THR D 1 112 ? 8.640   -1.399  11.492  1.00 40.47 ? 112 THR B OG1   1 
ATOM   8033  C  CG2   . THR D 1 112 ? 8.112   0.929   11.811  1.00 54.80 ? 112 THR B CG2   1 
ATOM   8034  H  H     . THR D 1 112 ? 8.821   -2.362  13.828  1.00 48.23 ? 112 THR B H     1 
ATOM   8035  H  HA    . THR D 1 112 ? 10.038  -0.173  13.385  1.00 49.43 ? 112 THR B HA    1 
ATOM   8036  H  HB    . THR D 1 112 ? 7.297   -0.689  12.761  1.00 57.49 ? 112 THR B HB    1 
ATOM   8037  H  HG1   . THR D 1 112 ? 8.657   -2.149  11.821  1.00 48.50 ? 112 THR B HG1   1 
ATOM   8038  H  HG21  . THR D 1 112 ? 8.983   1.198   11.510  1.00 65.70 ? 112 THR B HG21  1 
ATOM   8039  H  HG22  . THR D 1 112 ? 7.517   0.900   11.058  1.00 65.70 ? 112 THR B HG22  1 
ATOM   8040  H  HG23  . THR D 1 112 ? 7.786   1.576   12.441  1.00 65.70 ? 112 THR B HG23  1 
ATOM   8041  N  N     . ASN D 1 113 ? 7.415   0.464   15.154  1.00 47.78 ? 113 ASN B N     1 
ATOM   8042  C  CA    . ASN D 1 113 ? 6.842   1.426   16.087  1.00 50.05 ? 113 ASN B CA    1 
ATOM   8043  C  C     . ASN D 1 113 ? 7.520   1.395   17.437  1.00 50.27 ? 113 ASN B C     1 
ATOM   8044  O  O     . ASN D 1 113 ? 7.729   2.438   18.044  1.00 49.28 ? 113 ASN B O     1 
ATOM   8045  C  CB    . ASN D 1 113 ? 5.341   1.200   16.233  1.00 53.76 ? 113 ASN B CB    1 
ATOM   8046  C  CG    . ASN D 1 113 ? 4.600   1.440   14.932  1.00 61.24 ? 113 ASN B CG    1 
ATOM   8047  O  OD1   . ASN D 1 113 ? 5.036   2.242   14.103  1.00 67.50 ? 113 ASN B OD1   1 
ATOM   8048  N  ND2   . ASN D 1 113 ? 3.489   0.741   14.738  1.00 62.80 ? 113 ASN B ND2   1 
ATOM   8049  H  H     . ASN D 1 113 ? 6.884   -0.174  14.930  1.00 57.28 ? 113 ASN B H     1 
ATOM   8050  H  HA    . ASN D 1 113 ? 6.968   2.325   15.718  1.00 59.99 ? 113 ASN B HA    1 
ATOM   8051  H  HB2   . ASN D 1 113 ? 5.182   0.284   16.507  1.00 64.45 ? 113 ASN B HB2   1 
ATOM   8052  H  HB3   . ASN D 1 113 ? 4.990   1.813   16.898  1.00 64.45 ? 113 ASN B HB3   1 
ATOM   8053  H  HD21  . ASN D 1 113 ? 3.036   0.845   14.014  1.00 75.30 ? 113 ASN B HD21  1 
ATOM   8054  H  HD22  . ASN D 1 113 ? 3.221   0.184   15.336  1.00 75.30 ? 113 ASN B HD22  1 
ATOM   8055  N  N     . LYS D 1 114 ? 7.883   0.200   17.892  1.00 46.60 ? 114 LYS B N     1 
ATOM   8056  C  CA    . LYS D 1 114 ? 8.555   0.042   19.176  1.00 52.06 ? 114 LYS B CA    1 
ATOM   8057  C  C     . LYS D 1 114 ? 9.788   0.936   19.271  1.00 49.10 ? 114 LYS B C     1 
ATOM   8058  O  O     . LYS D 1 114 ? 10.068  1.484   20.333  1.00 56.74 ? 114 LYS B O     1 
ATOM   8059  C  CB    . LYS D 1 114 ? 8.949   -1.425  19.426  1.00 46.26 ? 114 LYS B CB    1 
ATOM   8060  C  CG    . LYS D 1 114 ? 9.270   -1.729  20.890  1.00 59.92 ? 114 LYS B CG    1 
ATOM   8061  C  CD    . LYS D 1 114 ? 8.146   -2.530  21.565  1.00 60.76 ? 114 LYS B CD    1 
ATOM   8062  C  CE    . LYS D 1 114 ? 8.150   -2.334  23.080  1.00 66.02 ? 114 LYS B CE    1 
ATOM   8063  N  NZ    . LYS D 1 114 ? 7.144   -3.184  23.800  1.00 62.52 ? 114 LYS B NZ    1 
ATOM   8064  H  H     . LYS D 1 114 ? 7.751   -0.539  17.473  1.00 55.86 ? 114 LYS B H     1 
ATOM   8065  H  HA    . LYS D 1 114 ? 7.937   0.310   19.888  1.00 62.41 ? 114 LYS B HA    1 
ATOM   8066  H  HB2   . LYS D 1 114 ? 8.214   -1.997  19.157  1.00 55.46 ? 114 LYS B HB2   1 
ATOM   8067  H  HB3   . LYS D 1 114 ? 9.737   -1.632  18.900  1.00 55.46 ? 114 LYS B HB3   1 
ATOM   8068  H  HG2   . LYS D 1 114 ? 10.085  -2.253  20.937  1.00 71.84 ? 114 LYS B HG2   1 
ATOM   8069  H  HG3   . LYS D 1 114 ? 9.380   -0.895  21.373  1.00 71.84 ? 114 LYS B HG3   1 
ATOM   8070  H  HD2   . LYS D 1 114 ? 7.290   -2.230  21.222  1.00 72.85 ? 114 LYS B HD2   1 
ATOM   8071  H  HD3   . LYS D 1 114 ? 8.270   -3.474  21.380  1.00 72.85 ? 114 LYS B HD3   1 
ATOM   8072  H  HE2   . LYS D 1 114 ? 9.030   -2.560  23.422  1.00 79.17 ? 114 LYS B HE2   1 
ATOM   8073  H  HE3   . LYS D 1 114 ? 7.949   -1.406  23.276  1.00 79.17 ? 114 LYS B HE3   1 
ATOM   8074  H  HZ1   . LYS D 1 114 ? 7.310   -4.046  23.647  1.00 74.96 ? 114 LYS B HZ1   1 
ATOM   8075  H  HZ2   . LYS D 1 114 ? 7.189   -3.032  24.675  1.00 74.96 ? 114 LYS B HZ2   1 
ATOM   8076  H  HZ3   . LYS D 1 114 ? 6.324   -2.992  23.514  1.00 74.96 ? 114 LYS B HZ3   1 
ATOM   8077  N  N     . VAL D 1 115 ? 10.528  1.090   18.176  1.00 42.11 ? 115 VAL B N     1 
ATOM   8078  C  CA    . VAL D 1 115 ? 11.741  1.903   18.224  1.00 44.28 ? 115 VAL B CA    1 
ATOM   8079  C  C     . VAL D 1 115 ? 11.571  3.257   17.518  1.00 47.35 ? 115 VAL B C     1 
ATOM   8080  O  O     . VAL D 1 115 ? 12.552  3.927   17.216  1.00 43.06 ? 115 VAL B O     1 
ATOM   8081  C  CB    . VAL D 1 115 ? 12.976  1.154   17.651  1.00 49.64 ? 115 VAL B CB    1 
ATOM   8082  C  CG1   . VAL D 1 115 ? 13.199  -0.136  18.416  1.00 40.77 ? 115 VAL B CG1   1 
ATOM   8083  C  CG2   . VAL D 1 115 ? 12.814  0.878   16.155  1.00 39.52 ? 115 VAL B CG2   1 
ATOM   8084  H  H     . VAL D 1 115 ? 10.356  0.742   17.409  1.00 50.47 ? 115 VAL B H     1 
ATOM   8085  H  HA    . VAL D 1 115 ? 11.936  2.095   19.165  1.00 53.08 ? 115 VAL B HA    1 
ATOM   8086  H  HB    . VAL D 1 115 ? 13.770  1.716   17.770  1.00 59.51 ? 115 VAL B HB    1 
ATOM   8087  H  HG11  . VAL D 1 115 ? 12.526  -0.216  19.096  1.00 48.86 ? 115 VAL B HG11  1 
ATOM   8088  H  HG12  . VAL D 1 115 ? 13.139  -0.875  17.807  1.00 48.86 ? 115 VAL B HG12  1 
ATOM   8089  H  HG13  . VAL D 1 115 ? 14.070  -0.113  18.819  1.00 48.86 ? 115 VAL B HG13  1 
ATOM   8090  H  HG21  . VAL D 1 115 ? 11.969  1.228   15.863  1.00 47.37 ? 115 VAL B HG21  1 
ATOM   8091  H  HG22  . VAL D 1 115 ? 13.528  1.308   15.679  1.00 47.37 ? 115 VAL B HG22  1 
ATOM   8092  H  HG23  . VAL D 1 115 ? 12.845  -0.070  16.007  1.00 47.37 ? 115 VAL B HG23  1 
ATOM   8093  N  N     . GLU D 1 116 ? 10.328  3.668   17.281  1.00 52.69 ? 116 GLU B N     1 
ATOM   8094  C  CA    . GLU D 1 116 ? 10.074  4.964   16.654  1.00 59.32 ? 116 GLU B CA    1 
ATOM   8095  C  C     . GLU D 1 116 ? 10.759  5.027   15.292  1.00 54.15 ? 116 GLU B C     1 
ATOM   8096  O  O     . GLU D 1 116 ? 11.422  6.011   14.959  1.00 52.63 ? 116 GLU B O     1 
ATOM   8097  C  CB    . GLU D 1 116 ? 10.603  6.104   17.527  1.00 66.15 ? 116 GLU B CB    1 
ATOM   8098  C  CG    . GLU D 1 116 ? 10.058  6.141   18.943  1.00 69.07 ? 116 GLU B CG    1 
ATOM   8099  C  CD    . GLU D 1 116 ? 10.371  7.458   19.639  1.00 72.10 ? 116 GLU B CD    1 
ATOM   8100  O  OE1   . GLU D 1 116 ? 11.442  7.557   20.280  1.00 73.85 ? 116 GLU B OE1   1 
ATOM   8101  O  OE2   . GLU D 1 116 ? 9.546   8.394   19.534  1.00 63.39 ? 116 GLU B OE2   1 
ATOM   8102  H  H     . GLU D 1 116 ? 9.619   3.220   17.472  1.00 63.16 ? 116 GLU B H     1 
ATOM   8103  H  HA    . GLU D 1 116 ? 9.110   5.087   16.527  1.00 71.12 ? 116 GLU B HA    1 
ATOM   8104  H  HB2   . GLU D 1 116 ? 11.568  6.023   17.588  1.00 79.32 ? 116 GLU B HB2   1 
ATOM   8105  H  HB3   . GLU D 1 116 ? 10.375  6.947   17.105  1.00 79.32 ? 116 GLU B HB3   1 
ATOM   8106  H  HG2   . GLU D 1 116 ? 9.095   6.035   18.916  1.00 82.83 ? 116 GLU B HG2   1 
ATOM   8107  H  HG3   . GLU D 1 116 ? 10.460  5.424   19.458  1.00 82.83 ? 116 GLU B HG3   1 
ATOM   8108  N  N     . GLY D 1 117 ? 10.606  3.956   14.521  1.00 50.12 ? 117 GLY B N     1 
ATOM   8109  C  CA    . GLY D 1 117 ? 11.166  3.873   13.187  1.00 47.07 ? 117 GLY B CA    1 
ATOM   8110  C  C     . GLY D 1 117 ? 12.628  4.239   13.102  1.00 44.96 ? 117 GLY B C     1 
ATOM   8111  O  O     . GLY D 1 117 ? 13.131  4.540   12.023  1.00 47.06 ? 117 GLY B O     1 
ATOM   8112  H  H     . GLY D 1 117 ? 10.172  3.253   14.758  1.00 60.09 ? 117 GLY B H     1 
ATOM   8113  H  HA2   . GLY D 1 117 ? 11.063  2.967   12.856  1.00 56.42 ? 117 GLY B HA2   1 
ATOM   8114  H  HA3   . GLY D 1 117 ? 10.673  4.467   12.599  1.00 56.42 ? 117 GLY B HA3   1 
ATOM   8115  N  N     . ASN D 1 118 ? 13.340  4.212   14.221  1.00 39.82 ? 118 ASN B N     1 
ATOM   8116  C  CA    . ASN D 1 118 ? 14.750  4.536   14.150  1.00 41.16 ? 118 ASN B CA    1 
ATOM   8117  C  C     . ASN D 1 118 ? 15.630  3.286   14.234  1.00 51.73 ? 118 ASN B C     1 
ATOM   8118  O  O     . ASN D 1 118 ? 15.620  2.523   15.224  1.00 35.92 ? 118 ASN B O     1 
ATOM   8119  C  CB    . ASN D 1 118 ? 15.108  5.600   15.177  1.00 50.63 ? 118 ASN B CB    1 
ATOM   8120  C  CG    . ASN D 1 118 ? 16.044  5.106   16.214  1.00 54.34 ? 118 ASN B CG    1 
ATOM   8121  O  OD1   . ASN D 1 118 ? 15.611  4.772   17.314  1.00 66.39 ? 118 ASN B OD1   1 
ATOM   8122  N  ND2   . ASN D 1 118 ? 17.342  5.063   15.895  1.00 40.92 ? 118 ASN B ND2   1 
ATOM   8123  H  H     . ASN D 1 118 ? 13.042  4.018   15.004  1.00 47.72 ? 118 ASN B H     1 
ATOM   8124  H  HA    . ASN D 1 118 ? 14.916  4.933   13.270  1.00 49.34 ? 118 ASN B HA    1 
ATOM   8125  H  HB2   . ASN D 1 118 ? 15.530  6.346   14.724  1.00 60.69 ? 118 ASN B HB2   1 
ATOM   8126  H  HB3   . ASN D 1 118 ? 14.298  5.896   15.621  1.00 60.69 ? 118 ASN B HB3   1 
ATOM   8127  H  HD21  . ASN D 1 118 ? 17.917  4.783   16.470  1.00 49.05 ? 118 ASN B HD21  1 
ATOM   8128  H  HD22  . ASN D 1 118 ? 17.602  5.316   15.116  1.00 49.05 ? 118 ASN B HD22  1 
ATOM   8129  N  N     . PHE D 1 119 ? 16.396  3.100   13.166  1.00 42.72 ? 119 PHE B N     1 
ATOM   8130  C  CA    . PHE D 1 119 ? 17.030  1.830   12.877  1.00 41.60 ? 119 PHE B CA    1 
ATOM   8131  C  C     . PHE D 1 119 ? 18.134  1.457   13.870  1.00 46.03 ? 119 PHE B C     1 
ATOM   8132  O  O     . PHE D 1 119 ? 18.283  0.276   14.228  1.00 38.20 ? 119 PHE B O     1 
ATOM   8133  C  CB    . PHE D 1 119 ? 17.569  1.824   11.437  1.00 39.82 ? 119 PHE B CB    1 
ATOM   8134  C  CG    . PHE D 1 119 ? 17.928  0.451   10.944  1.00 34.26 ? 119 PHE B CG    1 
ATOM   8135  C  CD1   . PHE D 1 119 ? 17.019  -0.308  10.225  1.00 42.15 ? 119 PHE B CD1   1 
ATOM   8136  C  CD2   . PHE D 1 119 ? 19.161  -0.100  11.242  1.00 41.86 ? 119 PHE B CD2   1 
ATOM   8137  C  CE1   . PHE D 1 119 ? 17.350  -1.589  9.784   1.00 35.90 ? 119 PHE B CE1   1 
ATOM   8138  C  CE2   . PHE D 1 119 ? 19.490  -1.371  10.812  1.00 34.81 ? 119 PHE B CE2   1 
ATOM   8139  C  CZ    . PHE D 1 119 ? 18.588  -2.117  10.087  1.00 29.34 ? 119 PHE B CZ    1 
ATOM   8140  H  H     . PHE D 1 119 ? 16.565  3.709   12.584  1.00 51.21 ? 119 PHE B H     1 
ATOM   8141  H  HA    . PHE D 1 119 ? 16.346  1.130   12.932  1.00 49.85 ? 119 PHE B HA    1 
ATOM   8142  H  HB2   . PHE D 1 119 ? 16.891  2.185   10.845  1.00 47.72 ? 119 PHE B HB2   1 
ATOM   8143  H  HB3   . PHE D 1 119 ? 18.368  2.373   11.398  1.00 47.72 ? 119 PHE B HB3   1 
ATOM   8144  H  HD1   . PHE D 1 119 ? 16.184  0.047   10.022  1.00 50.52 ? 119 PHE B HD1   1 
ATOM   8145  H  HD2   . PHE D 1 119 ? 19.778  0.394   11.732  1.00 50.17 ? 119 PHE B HD2   1 
ATOM   8146  H  HE1   . PHE D 1 119 ? 16.736  -2.089  9.296   1.00 43.02 ? 119 PHE B HE1   1 
ATOM   8147  H  HE2   . PHE D 1 119 ? 20.326  -1.724  11.013  1.00 41.72 ? 119 PHE B HE2   1 
ATOM   8148  H  HZ    . PHE D 1 119 ? 18.816  -2.970  9.795   1.00 35.15 ? 119 PHE B HZ    1 
ATOM   8149  N  N     . GLU D 1 120 ? 18.913  2.444   14.311  1.00 41.14 ? 120 GLU B N     1 
ATOM   8150  C  CA    . GLU D 1 120 ? 19.975  2.171   15.279  1.00 42.28 ? 120 GLU B CA    1 
ATOM   8151  C  C     . GLU D 1 120 ? 19.398  1.724   16.633  1.00 40.78 ? 120 GLU B C     1 
ATOM   8152  O  O     . GLU D 1 120 ? 19.970  0.866   17.302  1.00 42.68 ? 120 GLU B O     1 
ATOM   8153  C  CB    . GLU D 1 120 ? 20.880  3.387   15.454  1.00 51.88 ? 120 GLU B CB    1 
ATOM   8154  C  CG    . GLU D 1 120 ? 21.535  3.854   14.159  1.00 60.86 ? 120 GLU B CG    1 
ATOM   8155  C  CD    . GLU D 1 120 ? 22.596  2.895   13.656  1.00 61.26 ? 120 GLU B CD    1 
ATOM   8156  O  OE1   . GLU D 1 120 ? 22.633  2.639   12.430  1.00 56.02 ? 120 GLU B OE1   1 
ATOM   8157  O  OE2   . GLU D 1 120 ? 23.400  2.413   14.485  1.00 54.27 ? 120 GLU B OE2   1 
ATOM   8158  H  H     . GLU D 1 120 ? 18.850  3.267   14.070  1.00 49.30 ? 120 GLU B H     1 
ATOM   8159  H  HA    . GLU D 1 120 ? 20.528  1.438   14.937  1.00 50.67 ? 120 GLU B HA    1 
ATOM   8160  H  HB2   . GLU D 1 120 ? 20.352  4.123   15.801  1.00 62.19 ? 120 GLU B HB2   1 
ATOM   8161  H  HB3   . GLU D 1 120 ? 21.586  3.164   16.080  1.00 62.19 ? 120 GLU B HB3   1 
ATOM   8162  H  HG2   . GLU D 1 120 ? 20.854  3.934   13.472  1.00 72.97 ? 120 GLU B HG2   1 
ATOM   8163  H  HG3   . GLU D 1 120 ? 21.956  4.715   14.310  1.00 72.97 ? 120 GLU B HG3   1 
ATOM   8164  N  N     . ASN D 1 121 ? 18.258  2.272   17.034  1.00 35.91 ? 121 ASN B N     1 
ATOM   8165  C  CA    . ASN D 1 121 ? 17.633  1.797   18.264  1.00 43.76 ? 121 ASN B CA    1 
ATOM   8166  C  C     . ASN D 1 121 ? 17.080  0.388   18.052  1.00 39.57 ? 121 ASN B C     1 
ATOM   8167  O  O     . ASN D 1 121 ? 16.954  -0.387  18.998  1.00 37.28 ? 121 ASN B O     1 
ATOM   8168  C  CB    . ASN D 1 121 ? 16.514  2.722   18.723  1.00 44.93 ? 121 ASN B CB    1 
ATOM   8169  C  CG    . ASN D 1 121 ? 17.035  4.043   19.265  1.00 48.54 ? 121 ASN B CG    1 
ATOM   8170  O  OD1   . ASN D 1 121 ? 18.215  4.172   19.609  1.00 43.65 ? 121 ASN B OD1   1 
ATOM   8171  N  ND2   . ASN D 1 121 ? 16.149  5.029   19.354  1.00 52.80 ? 121 ASN B ND2   1 
ATOM   8172  H  H     . ASN D 1 121 ? 17.836  2.901   16.628  1.00 43.03 ? 121 ASN B H     1 
ATOM   8173  H  HA    . ASN D 1 121 ? 18.308  1.758   18.974  1.00 52.45 ? 121 ASN B HA    1 
ATOM   8174  H  HB2   . ASN D 1 121 ? 15.933  2.915   17.969  1.00 53.86 ? 121 ASN B HB2   1 
ATOM   8175  H  HB3   . ASN D 1 121 ? 16.010  2.285   19.427  1.00 53.86 ? 121 ASN B HB3   1 
ATOM   8176  H  HD21  . ASN D 1 121 ? 15.335  4.899   19.110  1.00 63.30 ? 121 ASN B HD21  1 
ATOM   8177  H  HD22  . ASN D 1 121 ? 16.390  5.798   19.654  1.00 63.30 ? 121 ASN B HD22  1 
ATOM   8178  N  N     . GLY D 1 122 ? 16.747  0.061   16.809  1.00 36.49 ? 122 GLY B N     1 
ATOM   8179  C  CA    . GLY D 1 122 ? 16.396  -1.305  16.464  1.00 34.59 ? 122 GLY B CA    1 
ATOM   8180  C  C     . GLY D 1 122 ? 17.562  -2.244  16.728  1.00 34.10 ? 122 GLY B C     1 
ATOM   8181  O  O     . GLY D 1 122 ? 17.390  -3.369  17.207  1.00 35.73 ? 122 GLY B O     1 
ATOM   8182  H  H     . GLY D 1 122 ? 16.717  0.612   16.149  1.00 43.72 ? 122 GLY B H     1 
ATOM   8183  H  HA2   . GLY D 1 122 ? 15.636  -1.592  16.994  1.00 41.45 ? 122 GLY B HA2   1 
ATOM   8184  H  HA3   . GLY D 1 122 ? 16.159  -1.356  15.525  1.00 41.45 ? 122 GLY B HA3   1 
ATOM   8185  N  N     . ILE D 1 123 ? 18.758  -1.782  16.407  1.00 28.14 ? 123 ILE B N     1 
ATOM   8186  C  CA    . ILE D 1 123 ? 19.956  -2.571  16.638  1.00 29.40 ? 123 ILE B CA    1 
ATOM   8187  C  C     . ILE D 1 123 ? 20.187  -2.759  18.128  1.00 33.66 ? 123 ILE B C     1 
ATOM   8188  O  O     . ILE D 1 123 ? 20.500  -3.854  18.568  1.00 35.07 ? 123 ILE B O     1 
ATOM   8189  C  CB    . ILE D 1 123 ? 21.188  -1.931  16.016  1.00 39.67 ? 123 ILE B CB    1 
ATOM   8190  C  CG1   . ILE D 1 123 ? 21.096  -1.986  14.490  1.00 38.05 ? 123 ILE B CG1   1 
ATOM   8191  C  CG2   . ILE D 1 123 ? 22.420  -2.654  16.463  1.00 39.96 ? 123 ILE B CG2   1 
ATOM   8192  C  CD1   . ILE D 1 123 ? 22.219  -1.273  13.780  1.00 38.45 ? 123 ILE B CD1   1 
ATOM   8193  H  H     . ILE D 1 123 ? 18.905  -1.012  16.052  1.00 33.71 ? 123 ILE B H     1 
ATOM   8194  H  HA    . ILE D 1 123 ? 19.837  -3.456  16.235  1.00 35.22 ? 123 ILE B HA    1 
ATOM   8195  H  HB    . ILE D 1 123 ? 21.243  -1.005  16.298  1.00 47.54 ? 123 ILE B HB    1 
ATOM   8196  H  HG12  . ILE D 1 123 ? 21.111  -2.914  14.210  1.00 45.59 ? 123 ILE B HG12  1 
ATOM   8197  H  HG13  . ILE D 1 123 ? 20.262  -1.573  14.214  1.00 45.59 ? 123 ILE B HG13  1 
ATOM   8198  H  HG21  . ILE D 1 123 ? 23.187  -2.240  16.062  1.00 47.89 ? 123 ILE B HG21  1 
ATOM   8199  H  HG22  . ILE D 1 123 ? 22.481  -2.604  17.419  1.00 47.89 ? 123 ILE B HG22  1 
ATOM   8200  H  HG23  . ILE D 1 123 ? 22.360  -3.572  16.186  1.00 47.89 ? 123 ILE B HG23  1 
ATOM   8201  H  HD11  . ILE D 1 123 ? 23.053  -1.676  14.032  1.00 46.07 ? 123 ILE B HD11  1 
ATOM   8202  H  HD12  . ILE D 1 123 ? 22.089  -1.352  12.832  1.00 46.07 ? 123 ILE B HD12  1 
ATOM   8203  H  HD13  . ILE D 1 123 ? 22.212  -0.348  14.036  1.00 46.07 ? 123 ILE B HD13  1 
ATOM   8204  N  N     . GLU D 1 124 ? 20.022  -1.696  18.909  1.00 32.63 ? 124 GLU B N     1 
ATOM   8205  C  CA    . GLU D 1 124 ? 20.212  -1.805  20.356  1.00 41.64 ? 124 GLU B CA    1 
ATOM   8206  C  C     . GLU D 1 124 ? 19.147  -2.735  20.945  1.00 27.89 ? 124 GLU B C     1 
ATOM   8207  O  O     . GLU D 1 124 ? 19.411  -3.482  21.881  1.00 34.36 ? 124 GLU B O     1 
ATOM   8208  C  CB    . GLU D 1 124 ? 20.178  -0.417  21.021  1.00 43.47 ? 124 GLU B CB    1 
ATOM   8209  C  CG    . GLU D 1 124 ? 20.286  -0.419  22.562  1.00 56.58 ? 124 GLU B CG    1 
ATOM   8210  C  CD    . GLU D 1 124 ? 21.491  -1.193  23.125  1.00 63.82 ? 124 GLU B CD    1 
ATOM   8211  O  OE1   . GLU D 1 124 ? 22.588  -1.137  22.532  1.00 58.69 ? 124 GLU B OE1   1 
ATOM   8212  O  OE2   . GLU D 1 124 ? 21.335  -1.857  24.179  1.00 65.74 ? 124 GLU B OE2   1 
ATOM   8213  H  H     . GLU D 1 124 ? 19.802  -0.912  18.634  1.00 39.10 ? 124 GLU B H     1 
ATOM   8214  H  HA    . GLU D 1 124 ? 21.090  -2.202  20.533  1.00 49.90 ? 124 GLU B HA    1 
ATOM   8215  H  HB2   . GLU D 1 124 ? 20.920  0.106   20.678  1.00 52.10 ? 124 GLU B HB2   1 
ATOM   8216  H  HB3   . GLU D 1 124 ? 19.342  0.015   20.788  1.00 52.10 ? 124 GLU B HB3   1 
ATOM   8217  H  HG2   . GLU D 1 124 ? 20.358  0.499   22.868  1.00 67.84 ? 124 GLU B HG2   1 
ATOM   8218  H  HG3   . GLU D 1 124 ? 19.482  -0.821  22.928  1.00 67.84 ? 124 GLU B HG3   1 
ATOM   8219  N  N     . LEU D 1 125 ? 17.944  -2.697  20.392  1.00 31.49 ? 125 LEU B N     1 
ATOM   8220  C  CA    . LEU D 1 125 ? 16.883  -3.576  20.868  1.00 31.80 ? 125 LEU B CA    1 
ATOM   8221  C  C     . LEU D 1 125 ? 17.308  -5.036  20.664  1.00 35.21 ? 125 LEU B C     1 
ATOM   8222  O  O     . LEU D 1 125 ? 17.113  -5.890  21.538  1.00 31.31 ? 125 LEU B O     1 
ATOM   8223  C  CB    . LEU D 1 125 ? 15.584  -3.303  20.135  1.00 34.06 ? 125 LEU B CB    1 
ATOM   8224  C  CG    . LEU D 1 125 ? 14.462  -4.245  20.547  1.00 29.71 ? 125 LEU B CG    1 
ATOM   8225  C  CD1   . LEU D 1 125 ? 14.380  -4.314  22.074  1.00 28.56 ? 125 LEU B CD1   1 
ATOM   8226  C  CD2   . LEU D 1 125 ? 13.140  -3.804  19.949  1.00 33.41 ? 125 LEU B CD2   1 
ATOM   8227  H  H     . LEU D 1 125 ? 17.715  -2.176  19.747  1.00 37.73 ? 125 LEU B H     1 
ATOM   8228  H  HA    . LEU D 1 125 ? 16.738  -3.425  21.825  1.00 38.10 ? 125 LEU B HA    1 
ATOM   8229  H  HB2   . LEU D 1 125 ? 15.298  -2.396  20.327  1.00 40.82 ? 125 LEU B HB2   1 
ATOM   8230  H  HB3   . LEU D 1 125 ? 15.730  -3.410  19.183  1.00 40.82 ? 125 LEU B HB3   1 
ATOM   8231  H  HG    . LEU D 1 125 ? 14.659  -5.136  20.216  1.00 35.60 ? 125 LEU B HG    1 
ATOM   8232  H  HD11  . LEU D 1 125 ? 14.204  -3.434  22.417  1.00 34.21 ? 125 LEU B HD11  1 
ATOM   8233  H  HD12  . LEU D 1 125 ? 13.670  -4.910  22.322  1.00 34.21 ? 125 LEU B HD12  1 
ATOM   8234  H  HD13  . LEU D 1 125 ? 15.216  -4.638  22.417  1.00 34.21 ? 125 LEU B HD13  1 
ATOM   8235  H  HD21  . LEU D 1 125 ? 12.454  -4.416  20.225  1.00 40.03 ? 125 LEU B HD21  1 
ATOM   8236  H  HD22  . LEU D 1 125 ? 12.936  -2.919  20.261  1.00 40.03 ? 125 LEU B HD22  1 
ATOM   8237  H  HD23  . LEU D 1 125 ? 13.215  -3.805  18.992  1.00 40.03 ? 125 LEU B HD23  1 
ATOM   8238  N  N     . ALA D 1 126 ? 17.903  -5.296  19.507  1.00 28.65 ? 126 ALA B N     1 
ATOM   8239  C  CA    . ALA D 1 126 ? 18.401  -6.617  19.164  1.00 31.07 ? 126 ALA B CA    1 
ATOM   8240  C  C     . ALA D 1 126 ? 19.427  -7.118  20.189  1.00 29.64 ? 126 ALA B C     1 
ATOM   8241  O  O     . ALA D 1 126 ? 19.360  -8.262  20.645  1.00 24.45 ? 126 ALA B O     1 
ATOM   8242  C  CB    . ALA D 1 126 ? 19.015  -6.585  17.763  1.00 31.09 ? 126 ALA B CB    1 
ATOM   8243  H  H     . ALA D 1 126 ? 18.032  -4.709  18.892  1.00 34.32 ? 126 ALA B H     1 
ATOM   8244  H  HA    . ALA D 1 126 ? 17.651  -7.248  19.152  1.00 37.22 ? 126 ALA B HA    1 
ATOM   8245  H  HB1   . ALA D 1 126 ? 18.341  -6.320  17.133  1.00 37.25 ? 126 ALA B HB1   1 
ATOM   8246  H  HB2   . ALA D 1 126 ? 19.739  -5.955  17.754  1.00 37.25 ? 126 ALA B HB2   1 
ATOM   8247  H  HB3   . ALA D 1 126 ? 19.341  -7.462  17.545  1.00 37.25 ? 126 ALA B HB3   1 
ATOM   8248  N  N     . ARG D 1 127 ? 20.373  -6.256  20.553  1.00 29.54 ? 127 ARG B N     1 
ATOM   8249  C  CA    . ARG D 1 127 ? 21.333  -6.567  21.597  1.00 30.78 ? 127 ARG B CA    1 
ATOM   8250  C  C     . ARG D 1 127 ? 20.640  -6.879  22.920  1.00 31.27 ? 127 ARG B C     1 
ATOM   8251  O  O     . ARG D 1 127 ? 21.012  -7.814  23.599  1.00 31.36 ? 127 ARG B O     1 
ATOM   8252  C  CB    . ARG D 1 127 ? 22.326  -5.415  21.785  1.00 37.69 ? 127 ARG B CB    1 
ATOM   8253  C  CG    . ARG D 1 127 ? 23.427  -5.386  20.760  1.00 43.21 ? 127 ARG B CG    1 
ATOM   8254  C  CD    . ARG D 1 127 ? 24.467  -4.298  21.064  1.00 54.13 ? 127 ARG B CD    1 
ATOM   8255  N  NE    . ARG D 1 127 ? 24.003  -2.960  20.690  1.00 55.21 ? 127 ARG B NE    1 
ATOM   8256  C  CZ    . ARG D 1 127 ? 24.243  -2.370  19.517  1.00 55.67 ? 127 ARG B CZ    1 
ATOM   8257  N  NH1   . ARG D 1 127 ? 24.955  -2.989  18.580  1.00 57.88 ? 127 ARG B NH1   1 
ATOM   8258  N  NH2   . ARG D 1 127 ? 23.765  -1.152  19.276  1.00 49.77 ? 127 ARG B NH2   1 
ATOM   8259  H  H     . ARG D 1 127 ? 20.477  -5.476  20.205  1.00 35.38 ? 127 ARG B H     1 
ATOM   8260  H  HA    . ARG D 1 127 ? 21.842  -7.361  21.331  1.00 36.87 ? 127 ARG B HA    1 
ATOM   8261  H  HB2   . ARG D 1 127 ? 21.844  -4.575  21.727  1.00 45.17 ? 127 ARG B HB2   1 
ATOM   8262  H  HB3   . ARG D 1 127 ? 22.737  -5.498  22.660  1.00 45.17 ? 127 ARG B HB3   1 
ATOM   8263  H  HG2   . ARG D 1 127 ? 23.879  -6.244  20.753  1.00 51.79 ? 127 ARG B HG2   1 
ATOM   8264  H  HG3   . ARG D 1 127 ? 23.045  -5.203  19.887  1.00 51.79 ? 127 ARG B HG3   1 
ATOM   8265  H  HD2   . ARG D 1 127 ? 24.655  -4.297  22.016  1.00 64.90 ? 127 ARG B HD2   1 
ATOM   8266  H  HD3   . ARG D 1 127 ? 25.278  -4.486  20.566  1.00 64.90 ? 127 ARG B HD3   1 
ATOM   8267  H  HE    . ARG D 1 127 ? 23.542  -2.522  21.269  1.00 66.19 ? 127 ARG B HE    1 
ATOM   8268  H  HH11  . ARG D 1 127 ? 25.266  -3.778  18.726  1.00 69.39 ? 127 ARG B HH11  1 
ATOM   8269  H  HH12  . ARG D 1 127 ? 25.105  -2.601  17.827  1.00 69.39 ? 127 ARG B HH12  1 
ATOM   8270  H  HH21  . ARG D 1 127 ? 23.305  -0.743  19.877  1.00 59.66 ? 127 ARG B HH21  1 
ATOM   8271  H  HH22  . ARG D 1 127 ? 23.923  -0.770  18.521  1.00 59.66 ? 127 ARG B HH22  1 
ATOM   8272  N  N     . LYS D 1 128 ? 19.634  -6.109  23.290  1.00 32.23 ? 128 LYS B N     1 
ATOM   8273  C  CA    . LYS D 1 128 ? 18.955  -6.367  24.556  1.00 37.44 ? 128 LYS B CA    1 
ATOM   8274  C  C     . LYS D 1 128 ? 18.185  -7.687  24.483  1.00 33.07 ? 128 LYS B C     1 
ATOM   8275  O  O     . LYS D 1 128 ? 18.046  -8.396  25.476  1.00 28.77 ? 128 LYS B O     1 
ATOM   8276  C  CB    . LYS D 1 128 ? 18.011  -5.217  24.946  1.00 38.27 ? 128 LYS B CB    1 
ATOM   8277  C  CG    . LYS D 1 128 ? 18.688  -4.074  25.726  1.00 55.01 ? 128 LYS B CG    1 
ATOM   8278  C  CD    . LYS D 1 128 ? 19.149  -4.505  27.137  1.00 55.49 ? 128 LYS B CD    1 
ATOM   8279  C  CE    . LYS D 1 128 ? 20.447  -3.824  27.551  1.00 61.53 ? 128 LYS B CE    1 
ATOM   8280  N  NZ    . LYS D 1 128 ? 21.603  -4.147  26.646  1.00 65.40 ? 128 LYS B NZ    1 
ATOM   8281  H  H     . LYS D 1 128 ? 19.326  -5.443  22.842  1.00 38.61 ? 128 LYS B H     1 
ATOM   8282  H  HA    . LYS D 1 128 ? 19.628  -6.453  25.263  1.00 44.87 ? 128 LYS B HA    1 
ATOM   8283  H  HB2   . LYS D 1 128 ? 17.632  -4.839  24.138  1.00 45.86 ? 128 LYS B HB2   1 
ATOM   8284  H  HB3   . LYS D 1 128 ? 17.301  -5.574  25.504  1.00 45.86 ? 128 LYS B HB3   1 
ATOM   8285  H  HG2   . LYS D 1 128 ? 19.469  -3.774  25.233  1.00 65.95 ? 128 LYS B HG2   1 
ATOM   8286  H  HG3   . LYS D 1 128 ? 18.058  -3.343  25.826  1.00 65.95 ? 128 LYS B HG3   1 
ATOM   8287  H  HD2   . LYS D 1 128 ? 18.464  -4.267  27.782  1.00 66.53 ? 128 LYS B HD2   1 
ATOM   8288  H  HD3   . LYS D 1 128 ? 19.295  -5.464  27.145  1.00 66.53 ? 128 LYS B HD3   1 
ATOM   8289  H  HE2   . LYS D 1 128 ? 20.316  -2.863  27.536  1.00 73.78 ? 128 LYS B HE2   1 
ATOM   8290  H  HE3   . LYS D 1 128 ? 20.680  -4.111  28.447  1.00 73.78 ? 128 LYS B HE3   1 
ATOM   8291  H  HZ1   . LYS D 1 128 ? 22.336  -3.728  26.927  1.00 78.42 ? 128 LYS B HZ1   1 
ATOM   8292  H  HZ2   . LYS D 1 128 ? 21.753  -5.025  26.646  1.00 78.42 ? 128 LYS B HZ2   1 
ATOM   8293  H  HZ3   . LYS D 1 128 ? 21.420  -3.886  25.815  1.00 78.42 ? 128 LYS B HZ3   1 
ATOM   8294  N  N     . ILE D 1 129 ? 17.686  -8.029  23.306  1.00 28.86 ? 129 ILE B N     1 
ATOM   8295  C  CA    . ILE D 1 129 ? 16.947  -9.274  23.174  1.00 29.93 ? 129 ILE B CA    1 
ATOM   8296  C  C     . ILE D 1 129 ? 17.871  -10.466 23.386  1.00 23.22 ? 129 ILE B C     1 
ATOM   8297  O  O     . ILE D 1 129 ? 17.516  -11.390 24.137  1.00 26.69 ? 129 ILE B O     1 
ATOM   8298  C  CB    . ILE D 1 129 ? 16.181  -9.348  21.829  1.00 28.64 ? 129 ILE B CB    1 
ATOM   8299  C  CG1   . ILE D 1 129 ? 14.962  -8.426  21.879  1.00 27.48 ? 129 ILE B CG1   1 
ATOM   8300  C  CG2   . ILE D 1 129 ? 15.703  -10.779 21.556  1.00 27.22 ? 129 ILE B CG2   1 
ATOM   8301  C  CD1   . ILE D 1 129 ? 14.332  -8.127  20.496  1.00 26.09 ? 129 ILE B CD1   1 
ATOM   8302  H  H     . ILE D 1 129 ? 17.759  -7.570  22.582  1.00 34.57 ? 129 ILE B H     1 
ATOM   8303  H  HA    . ILE D 1 129 ? 16.275  -9.303  23.887  1.00 35.85 ? 129 ILE B HA    1 
ATOM   8304  H  HB    . ILE D 1 129 ? 16.767  -9.064  21.111  1.00 34.31 ? 129 ILE B HB    1 
ATOM   8305  H  HG12  . ILE D 1 129 ? 14.280  -8.841  22.430  1.00 32.92 ? 129 ILE B HG12  1 
ATOM   8306  H  HG13  . ILE D 1 129 ? 15.228  -7.579  22.271  1.00 32.92 ? 129 ILE B HG13  1 
ATOM   8307  H  HG21  . ILE D 1 129 ? 15.119  -11.054 22.266  1.00 32.60 ? 129 ILE B HG21  1 
ATOM   8308  H  HG22  . ILE D 1 129 ? 15.232  -10.796 20.719  1.00 32.60 ? 129 ILE B HG22  1 
ATOM   8309  H  HG23  . ILE D 1 129 ? 16.466  -11.360 21.515  1.00 32.60 ? 129 ILE B HG23  1 
ATOM   8310  H  HD11  . ILE D 1 129 ? 14.049  -8.953  20.097  1.00 31.24 ? 129 ILE B HD11  1 
ATOM   8311  H  HD12  . ILE D 1 129 ? 13.578  -7.545  20.616  1.00 31.24 ? 129 ILE B HD12  1 
ATOM   8312  H  HD13  . ILE D 1 129 ? 14.988  -7.702  19.939  1.00 31.24 ? 129 ILE B HD13  1 
ATOM   8313  N  N     . LYS D 1 130 ? 19.052  -10.434 22.751  1.00 23.19 ? 130 LYS B N     1 
ATOM   8314  C  CA    . LYS D 1 130 ? 20.059  -11.478 22.900  1.00 23.58 ? 130 LYS B CA    1 
ATOM   8315  C  C     . LYS D 1 130 ? 20.474  -11.624 24.337  1.00 29.80 ? 130 LYS B C     1 
ATOM   8316  O  O     . LYS D 1 130 ? 20.629  -12.733 24.852  1.00 24.34 ? 130 LYS B O     1 
ATOM   8317  C  CB    . LYS D 1 130 ? 21.324  -11.180 22.073  1.00 28.83 ? 130 LYS B CB    1 
ATOM   8318  C  CG    . LYS D 1 130 ? 21.190  -11.405 20.571  1.00 28.69 ? 130 LYS B CG    1 
ATOM   8319  C  CD    . LYS D 1 130 ? 22.510  -11.210 19.839  1.00 28.97 ? 130 LYS B CD    1 
ATOM   8320  C  CE    . LYS D 1 130 ? 23.611  -12.067 20.410  1.00 33.40 ? 130 LYS B CE    1 
ATOM   8321  N  NZ    . LYS D 1 130 ? 24.008  -13.194 19.536  1.00 25.06 ? 130 LYS B NZ    1 
ATOM   8322  H  H     . LYS D 1 130 ? 19.291  -9.802  22.219  1.00 27.77 ? 130 LYS B H     1 
ATOM   8323  H  HA    . LYS D 1 130 ? 19.688  -12.333 22.598  1.00 28.23 ? 130 LYS B HA    1 
ATOM   8324  H  HB2   . LYS D 1 130 ? 21.567  -10.251 22.209  1.00 34.53 ? 130 LYS B HB2   1 
ATOM   8325  H  HB3   . LYS D 1 130 ? 22.040  -11.752 22.391  1.00 34.53 ? 130 LYS B HB3   1 
ATOM   8326  H  HG2   . LYS D 1 130 ? 20.887  -12.312 20.411  1.00 34.37 ? 130 LYS B HG2   1 
ATOM   8327  H  HG3   . LYS D 1 130 ? 20.549  -10.771 20.211  1.00 34.37 ? 130 LYS B HG3   1 
ATOM   8328  H  HD2   . LYS D 1 130 ? 22.395  -11.449 18.907  1.00 34.70 ? 130 LYS B HD2   1 
ATOM   8329  H  HD3   . LYS D 1 130 ? 22.781  -10.282 19.915  1.00 34.70 ? 130 LYS B HD3   1 
ATOM   8330  H  HE2   . LYS D 1 130 ? 24.395  -11.513 20.553  1.00 40.01 ? 130 LYS B HE2   1 
ATOM   8331  H  HE3   . LYS D 1 130 ? 23.312  -12.438 21.254  1.00 40.01 ? 130 LYS B HE3   1 
ATOM   8332  H  HZ1   . LYS D 1 130 ? 23.310  -13.728 19.394  1.00 30.01 ? 130 LYS B HZ1   1 
ATOM   8333  H  HZ2   . LYS D 1 130 ? 24.299  -12.884 18.754  1.00 30.01 ? 130 LYS B HZ2   1 
ATOM   8334  H  HZ3   . LYS D 1 130 ? 24.658  -13.663 19.922  1.00 30.01 ? 130 LYS B HZ3   1 
ATOM   8335  N  N     . GLN D 1 131 ? 20.681  -10.496 24.996  1.00 27.58 ? 131 GLN B N     1 
ATOM   8336  C  CA    . GLN D 1 131 ? 21.117  -10.547 26.379  1.00 27.11 ? 131 GLN B CA    1 
ATOM   8337  C  C     . GLN D 1 131 ? 20.056  -11.134 27.297  1.00 21.56 ? 131 GLN B C     1 
ATOM   8338  O  O     . GLN D 1 131 ? 20.369  -11.955 28.179  1.00 29.74 ? 131 GLN B O     1 
ATOM   8339  C  CB    . GLN D 1 131 ? 21.535  -9.160  26.861  1.00 33.57 ? 131 GLN B CB    1 
ATOM   8340  C  CG    . GLN D 1 131 ? 22.261  -9.210  28.205  1.00 42.08 ? 131 GLN B CG    1 
ATOM   8341  C  CD    . GLN D 1 131 ? 23.278  -10.365 28.296  1.00 44.33 ? 131 GLN B CD    1 
ATOM   8342  O  OE1   . GLN D 1 131 ? 23.109  -11.296 29.106  1.00 51.73 ? 131 GLN B OE1   1 
ATOM   8343  N  NE2   . GLN D 1 131 ? 24.336  -10.304 27.476  1.00 40.02 ? 131 GLN B NE2   1 
ATOM   8344  H  H     . GLN D 1 131 ? 20.578  -9.705  24.675  1.00 33.04 ? 131 GLN B H     1 
ATOM   8345  H  HA    . GLN D 1 131 ? 21.905  -11.126 26.433  1.00 32.47 ? 131 GLN B HA    1 
ATOM   8346  H  HB2   . GLN D 1 131 ? 22.134  -8.763  26.209  1.00 40.22 ? 131 GLN B HB2   1 
ATOM   8347  H  HB3   . GLN D 1 131 ? 20.744  -8.608  26.966  1.00 40.22 ? 131 GLN B HB3   1 
ATOM   8348  H  HG2   . GLN D 1 131 ? 22.741  -8.378  28.336  1.00 50.44 ? 131 GLN B HG2   1 
ATOM   8349  H  HG3   . GLN D 1 131 ? 21.608  -9.331  28.912  1.00 50.44 ? 131 GLN B HG3   1 
ATOM   8350  H  HE21  . GLN D 1 131 ? 24.422  -9.643  26.933  1.00 47.97 ? 131 GLN B HE21  1 
ATOM   8351  H  HE22  . GLN D 1 131 ? 24.929  -10.927 27.493  1.00 47.97 ? 131 GLN B HE22  1 
ATOM   8352  N  N     . GLU D 1 132 ? 18.802  -10.755 27.089  1.00 24.66 ? 132 GLU B N     1 
ATOM   8353  C  CA    . GLU D 1 132 ? 17.734  -11.251 27.930  1.00 28.78 ? 132 GLU B CA    1 
ATOM   8354  C  C     . GLU D 1 132 ? 17.527  -12.770 27.789  1.00 33.95 ? 132 GLU B C     1 
ATOM   8355  O  O     . GLU D 1 132 ? 17.297  -13.483 28.778  1.00 26.01 ? 132 GLU B O     1 
ATOM   8356  C  CB    . GLU D 1 132 ? 16.441  -10.498 27.632  1.00 29.20 ? 132 GLU B CB    1 
ATOM   8357  C  CG    . GLU D 1 132 ? 15.225  -11.046 28.346  1.00 40.63 ? 132 GLU B CG    1 
ATOM   8358  C  CD    . GLU D 1 132 ? 13.986  -10.223 28.074  1.00 39.62 ? 132 GLU B CD    1 
ATOM   8359  O  OE1   . GLU D 1 132 ? 12.969  -10.446 28.752  1.00 50.11 ? 132 GLU B OE1   1 
ATOM   8360  O  OE2   . GLU D 1 132 ? 14.027  -9.351  27.183  1.00 43.56 ? 132 GLU B OE2   1 
ATOM   8361  H  H     . GLU D 1 132 ? 18.548  -10.214 26.470  1.00 29.53 ? 132 GLU B H     1 
ATOM   8362  H  HA    . GLU D 1 132 ? 17.968  -11.073 28.865  1.00 34.47 ? 132 GLU B HA    1 
ATOM   8363  H  HB2   . GLU D 1 132 ? 16.550  -9.573  27.903  1.00 34.98 ? 132 GLU B HB2   1 
ATOM   8364  H  HB3   . GLU D 1 132 ? 16.269  -10.542 26.678  1.00 34.98 ? 132 GLU B HB3   1 
ATOM   8365  H  HG2   . GLU D 1 132 ? 15.058  -11.952 28.040  1.00 48.69 ? 132 GLU B HG2   1 
ATOM   8366  H  HG3   . GLU D 1 132 ? 15.388  -11.041 29.302  1.00 48.69 ? 132 GLU B HG3   1 
ATOM   8367  N  N     . ILE D 1 133 ? 17.581  -13.267 26.560  1.00 23.53 ? 133 ILE B N     1 
ATOM   8368  C  CA    . ILE D 1 133 ? 17.404  -14.698 26.332  1.00 21.99 ? 133 ILE B CA    1 
ATOM   8369  C  C     . ILE D 1 133 ? 18.541  -15.475 26.979  1.00 17.14 ? 133 ILE B C     1 
ATOM   8370  O  O     . ILE D 1 133 ? 18.336  -16.559 27.527  1.00 22.35 ? 133 ILE B O     1 
ATOM   8371  C  CB    . ILE D 1 133 ? 17.325  -15.009 24.835  1.00 23.73 ? 133 ILE B CB    1 
ATOM   8372  C  CG1   . ILE D 1 133 ? 16.037  -14.394 24.259  1.00 21.12 ? 133 ILE B CG1   1 
ATOM   8373  C  CG2   . ILE D 1 133 ? 17.355  -16.521 24.595  1.00 22.09 ? 133 ILE B CG2   1 
ATOM   8374  C  CD1   . ILE D 1 133 ? 16.027  -14.377 22.759  1.00 23.37 ? 133 ILE B CD1   1 
ATOM   8375  H  H     . ILE D 1 133 ? 17.717  -12.804 25.848  1.00 28.17 ? 133 ILE B H     1 
ATOM   8376  H  HA    . ILE D 1 133 ? 16.564  -14.987 26.746  1.00 26.33 ? 133 ILE B HA    1 
ATOM   8377  H  HB    . ILE D 1 133 ? 18.088  -14.607 24.392  1.00 28.41 ? 133 ILE B HB    1 
ATOM   8378  H  HG12  . ILE D 1 133 ? 15.276  -14.915 24.559  1.00 25.28 ? 133 ILE B HG12  1 
ATOM   8379  H  HG13  . ILE D 1 133 ? 15.957  -13.479 24.571  1.00 25.28 ? 133 ILE B HG13  1 
ATOM   8380  H  HG21  . ILE D 1 133 ? 17.305  -16.688 23.651  1.00 26.44 ? 133 ILE B HG21  1 
ATOM   8381  H  HG22  . ILE D 1 133 ? 18.174  -16.877 24.948  1.00 26.44 ? 133 ILE B HG22  1 
ATOM   8382  H  HG23  . ILE D 1 133 ? 16.605  -16.923 25.040  1.00 26.44 ? 133 ILE B HG23  1 
ATOM   8383  H  HD11  . ILE D 1 133 ? 16.772  -13.858 22.448  1.00 27.98 ? 133 ILE B HD11  1 
ATOM   8384  H  HD12  . ILE D 1 133 ? 16.098  -15.279 22.437  1.00 27.98 ? 133 ILE B HD12  1 
ATOM   8385  H  HD13  . ILE D 1 133 ? 15.205  -13.985 22.457  1.00 27.98 ? 133 ILE B HD13  1 
ATOM   8386  N  N     . LEU D 1 134 ? 19.741  -14.926 26.918  1.00 18.84 ? 134 LEU B N     1 
ATOM   8387  C  CA    . LEU D 1 134 ? 20.890  -15.563 27.551  1.00 22.46 ? 134 LEU B CA    1 
ATOM   8388  C  C     . LEU D 1 134 ? 20.769  -15.565 29.074  1.00 29.01 ? 134 LEU B C     1 
ATOM   8389  O  O     . LEU D 1 134 ? 21.016  -16.582 29.722  1.00 27.04 ? 134 LEU B O     1 
ATOM   8390  C  CB    . LEU D 1 134 ? 22.173  -14.868 27.149  1.00 21.60 ? 134 LEU B CB    1 
ATOM   8391  C  CG    . LEU D 1 134 ? 23.457  -15.526 27.634  1.00 37.66 ? 134 LEU B CG    1 
ATOM   8392  C  CD1   . LEU D 1 134 ? 23.534  -16.980 27.159  1.00 26.74 ? 134 LEU B CD1   1 
ATOM   8393  C  CD2   . LEU D 1 134 ? 24.651  -14.711 27.151  1.00 35.15 ? 134 LEU B CD2   1 
ATOM   8394  H  H     . LEU D 1 134 ? 19.922  -14.186 26.518  1.00 22.55 ? 134 LEU B H     1 
ATOM   8395  H  HA    . LEU D 1 134 ? 20.943  -16.495 27.251  1.00 26.89 ? 134 LEU B HA    1 
ATOM   8396  H  HB2   . LEU D 1 134 ? 22.212  -14.833 26.181  1.00 25.85 ? 134 LEU B HB2   1 
ATOM   8397  H  HB3   . LEU D 1 134 ? 22.156  -13.966 27.505  1.00 25.85 ? 134 LEU B HB3   1 
ATOM   8398  H  HG    . LEU D 1 134 ? 23.466  -15.526 28.604  1.00 45.13 ? 134 LEU B HG    1 
ATOM   8399  H  HD11  . LEU D 1 134 ? 22.782  -17.463 27.509  1.00 32.03 ? 134 LEU B HD11  1 
ATOM   8400  H  HD12  . LEU D 1 134 ? 23.516  -16.996 26.199  1.00 32.03 ? 134 LEU B HD12  1 
ATOM   8401  H  HD13  . LEU D 1 134 ? 24.351  -17.369 27.478  1.00 32.03 ? 134 LEU B HD13  1 
ATOM   8402  H  HD21  . LEU D 1 134 ? 24.642  -14.682 26.192  1.00 42.12 ? 134 LEU B HD21  1 
ATOM   8403  H  HD22  . LEU D 1 134 ? 24.586  -13.822 27.506  1.00 42.12 ? 134 LEU B HD22  1 
ATOM   8404  H  HD23  . LEU D 1 134 ? 25.459  -15.129 27.459  1.00 42.12 ? 134 LEU B HD23  1 
ATOM   8405  N  N     . GLU D 1 135 ? 20.402  -14.422 29.640  1.00 30.02 ? 135 GLU B N     1 
ATOM   8406  C  CA    . GLU D 1 135 ? 20.221  -14.313 31.084  1.00 33.15 ? 135 GLU B CA    1 
ATOM   8407  C  C     . GLU D 1 135 ? 19.164  -15.260 31.581  1.00 29.82 ? 135 GLU B C     1 
ATOM   8408  O  O     . GLU D 1 135 ? 19.381  -16.003 32.540  1.00 29.71 ? 135 GLU B O     1 
ATOM   8409  C  CB    . GLU D 1 135 ? 19.819  -12.883 31.466  1.00 31.99 ? 135 GLU B CB    1 
ATOM   8410  C  CG    . GLU D 1 135 ? 21.002  -11.942 31.409  1.00 39.13 ? 135 GLU B CG    1 
ATOM   8411  C  CD    . GLU D 1 135 ? 20.646  -10.460 31.609  1.00 41.84 ? 135 GLU B CD    1 
ATOM   8412  O  OE1   . GLU D 1 135 ? 19.440  -10.129 31.773  1.00 52.19 ? 135 GLU B OE1   1 
ATOM   8413  O  OE2   . GLU D 1 135 ? 21.591  -9.634  31.587  1.00 49.00 ? 135 GLU B OE2   1 
ATOM   8414  H  H     . GLU D 1 135 ? 20.250  -13.693 29.209  1.00 35.97 ? 135 GLU B H     1 
ATOM   8415  H  HA    . GLU D 1 135 ? 21.065  -14.528 31.534  1.00 39.72 ? 135 GLU B HA    1 
ATOM   8416  H  HB2   . GLU D 1 135 ? 19.145  -12.563 30.846  1.00 38.33 ? 135 GLU B HB2   1 
ATOM   8417  H  HB3   . GLU D 1 135 ? 19.471  -12.880 32.372  1.00 38.33 ? 135 GLU B HB3   1 
ATOM   8418  H  HG2   . GLU D 1 135 ? 21.631  -12.190 32.104  1.00 46.90 ? 135 GLU B HG2   1 
ATOM   8419  H  HG3   . GLU D 1 135 ? 21.425  -12.028 30.540  1.00 46.90 ? 135 GLU B HG3   1 
ATOM   8420  N  N     . LYS D 1 136 ? 18.003  -15.218 30.939  1.00 25.44 ? 136 LYS B N     1 
ATOM   8421  C  CA    . LYS D 1 136 ? 16.848  -15.940 31.430  1.00 27.36 ? 136 LYS B CA    1 
ATOM   8422  C  C     . LYS D 1 136 ? 16.851  -17.432 31.119  1.00 30.93 ? 136 LYS B C     1 
ATOM   8423  O  O     . LYS D 1 136 ? 16.430  -18.226 31.958  1.00 29.55 ? 136 LYS B O     1 
ATOM   8424  C  CB    . LYS D 1 136 ? 15.553  -15.300 30.919  1.00 31.59 ? 136 LYS B CB    1 
ATOM   8425  C  CG    . LYS D 1 136 ? 15.318  -13.892 31.466  1.00 35.69 ? 136 LYS B CG    1 
ATOM   8426  C  CD    . LYS D 1 136 ? 13.869  -13.479 31.313  1.00 42.90 ? 136 LYS B CD    1 
ATOM   8427  C  CE    . LYS D 1 136 ? 13.538  -12.264 32.163  1.00 51.02 ? 136 LYS B CE    1 
ATOM   8428  N  NZ    . LYS D 1 136 ? 13.851  -10.987 31.478  1.00 53.93 ? 136 LYS B NZ    1 
ATOM   8429  H  H     . LYS D 1 136 ? 17.861  -14.776 30.215  1.00 30.47 ? 136 LYS B H     1 
ATOM   8430  H  HA    . LYS D 1 136 ? 16.839  -15.857 32.406  1.00 32.77 ? 136 LYS B HA    1 
ATOM   8431  H  HB2   . LYS D 1 136 ? 15.592  -15.242 29.952  1.00 37.85 ? 136 LYS B HB2   1 
ATOM   8432  H  HB3   . LYS D 1 136 ? 14.802  -15.854 31.186  1.00 37.85 ? 136 LYS B HB3   1 
ATOM   8433  H  HG2   . LYS D 1 136 ? 15.542  -13.873 32.410  1.00 42.77 ? 136 LYS B HG2   1 
ATOM   8434  H  HG3   . LYS D 1 136 ? 15.869  -13.262 30.977  1.00 42.77 ? 136 LYS B HG3   1 
ATOM   8435  H  HD2   . LYS D 1 136 ? 13.697  -13.256 30.384  1.00 51.41 ? 136 LYS B HD2   1 
ATOM   8436  H  HD3   . LYS D 1 136 ? 13.297  -14.211 31.593  1.00 51.41 ? 136 LYS B HD3   1 
ATOM   8437  H  HE2   . LYS D 1 136 ? 12.591  -12.271 32.369  1.00 61.17 ? 136 LYS B HE2   1 
ATOM   8438  H  HE3   . LYS D 1 136 ? 14.057  -12.301 32.982  1.00 61.17 ? 136 LYS B HE3   1 
ATOM   8439  H  HZ1   . LYS D 1 136 ? 13.644  -10.300 32.006  1.00 64.65 ? 136 LYS B HZ1   1 
ATOM   8440  H  HZ2   . LYS D 1 136 ? 14.718  -10.951 31.283  1.00 64.65 ? 136 LYS B HZ2   1 
ATOM   8441  H  HZ3   . LYS D 1 136 ? 13.382  -10.923 30.724  1.00 64.65 ? 136 LYS B HZ3   1 
ATOM   8442  N  N     . GLU D 1 137 ? 17.310  -17.826 29.932  1.00 24.34 ? 137 GLU B N     1 
ATOM   8443  C  CA    . GLU D 1 137 ? 17.238  -19.242 29.542  1.00 28.10 ? 137 GLU B CA    1 
ATOM   8444  C  C     . GLU D 1 137 ? 18.605  -19.903 29.311  1.00 25.55 ? 137 GLU B C     1 
ATOM   8445  O  O     . GLU D 1 137 ? 18.680  -21.118 29.117  1.00 21.88 ? 137 GLU B O     1 
ATOM   8446  C  CB    . GLU D 1 137 ? 16.374  -19.414 28.286  1.00 24.38 ? 137 GLU B CB    1 
ATOM   8447  C  CG    . GLU D 1 137 ? 14.915  -19.034 28.476  1.00 19.62 ? 137 GLU B CG    1 
ATOM   8448  C  CD    . GLU D 1 137 ? 14.186  -19.930 29.452  1.00 27.54 ? 137 GLU B CD    1 
ATOM   8449  O  OE1   . GLU D 1 137 ? 14.705  -21.013 29.790  1.00 27.75 ? 137 GLU B OE1   1 
ATOM   8450  O  OE2   . GLU D 1 137 ? 13.084  -19.541 29.898  1.00 24.84 ? 137 GLU B OE2   1 
ATOM   8451  H  H     . GLU D 1 137 ? 17.661  -17.308 29.342  1.00 29.15 ? 137 GLU B H     1 
ATOM   8452  H  HA    . GLU D 1 137 ? 16.798  -19.734 30.266  1.00 33.66 ? 137 GLU B HA    1 
ATOM   8453  H  HB2   . GLU D 1 137 ? 16.734  -18.853 27.581  1.00 29.19 ? 137 GLU B HB2   1 
ATOM   8454  H  HB3   . GLU D 1 137 ? 16.403  -20.344 28.012  1.00 29.19 ? 137 GLU B HB3   1 
ATOM   8455  H  HG2   . GLU D 1 137 ? 14.868  -18.126 28.813  1.00 23.49 ? 137 GLU B HG2   1 
ATOM   8456  H  HG3   . GLU D 1 137 ? 14.461  -19.093 27.621  1.00 23.49 ? 137 GLU B HG3   1 
ATOM   8457  N  N     . LYS D 1 138 ? 19.671  -19.118 29.330  1.00 19.33 ? 138 LYS B N     1 
ATOM   8458  C  CA    . LYS D 1 138 ? 21.006  -19.648 29.087  1.00 22.54 ? 138 LYS B CA    1 
ATOM   8459  C  C     . LYS D 1 138 ? 21.144  -20.168 27.650  1.00 25.36 ? 138 LYS B C     1 
ATOM   8460  O  O     . LYS D 1 138 ? 21.944  -21.081 27.372  1.00 23.17 ? 138 LYS B O     1 
ATOM   8461  C  CB    . LYS D 1 138 ? 21.320  -20.792 30.043  1.00 31.00 ? 138 LYS B CB    1 
ATOM   8462  C  CG    . LYS D 1 138 ? 21.797  -20.345 31.427  1.00 45.69 ? 138 LYS B CG    1 
ATOM   8463  C  CD    . LYS D 1 138 ? 21.169  -19.023 31.852  1.00 45.47 ? 138 LYS B CD    1 
ATOM   8464  C  CE    . LYS D 1 138 ? 21.303  -18.793 33.374  1.00 52.36 ? 138 LYS B CE    1 
ATOM   8465  N  NZ    . LYS D 1 138 ? 21.731  -17.393 33.728  1.00 53.02 ? 138 LYS B NZ    1 
ATOM   8466  H  H     . LYS D 1 138 ? 19.650  -18.271 29.480  1.00 23.14 ? 138 LYS B H     1 
ATOM   8467  H  HA    . LYS D 1 138 ? 21.668  -18.939 29.225  1.00 26.99 ? 138 LYS B HA    1 
ATOM   8468  H  HB2   . LYS D 1 138 ? 20.518  -21.324 30.165  1.00 37.14 ? 138 LYS B HB2   1 
ATOM   8469  H  HB3   . LYS D 1 138 ? 22.019  -21.340 29.653  1.00 37.14 ? 138 LYS B HB3   1 
ATOM   8470  H  HG2   . LYS D 1 138 ? 21.554  -21.019 32.080  1.00 54.77 ? 138 LYS B HG2   1 
ATOM   8471  H  HG3   . LYS D 1 138 ? 22.760  -20.230 31.409  1.00 54.77 ? 138 LYS B HG3   1 
ATOM   8472  H  HD2   . LYS D 1 138 ? 21.617  -18.294 31.394  1.00 54.51 ? 138 LYS B HD2   1 
ATOM   8473  H  HD3   . LYS D 1 138 ? 20.225  -19.030 31.628  1.00 54.51 ? 138 LYS B HD3   1 
ATOM   8474  H  HE2   . LYS D 1 138 ? 20.444  -18.957 33.793  1.00 62.77 ? 138 LYS B HE2   1 
ATOM   8475  H  HE3   . LYS D 1 138 ? 21.966  -19.406 33.727  1.00 62.77 ? 138 LYS B HE3   1 
ATOM   8476  H  HZ1   . LYS D 1 138 ? 21.135  -16.806 33.423  1.00 63.56 ? 138 LYS B HZ1   1 
ATOM   8477  H  HZ2   . LYS D 1 138 ? 21.794  -17.309 34.611  1.00 63.56 ? 138 LYS B HZ2   1 
ATOM   8478  H  HZ3   . LYS D 1 138 ? 22.524  -17.216 33.363  1.00 63.56 ? 138 LYS B HZ3   1 
ATOM   8479  N  N     . ILE D 1 139 ? 20.358  -19.581 26.755  1.00 19.19 ? 139 ILE B N     1 
ATOM   8480  C  CA    . ILE D 1 139 ? 20.378  -19.930 25.327  1.00 23.28 ? 139 ILE B CA    1 
ATOM   8481  C  C     . ILE D 1 139 ? 20.970  -18.798 24.476  1.00 21.04 ? 139 ILE B C     1 
ATOM   8482  O  O     . ILE D 1 139 ? 20.568  -17.646 24.597  1.00 22.47 ? 139 ILE B O     1 
ATOM   8483  C  CB    . ILE D 1 139 ? 18.964  -20.213 24.844  1.00 16.27 ? 139 ILE B CB    1 
ATOM   8484  C  CG1   . ILE D 1 139 ? 18.439  -21.503 25.466  1.00 22.81 ? 139 ILE B CG1   1 
ATOM   8485  C  CG2   . ILE D 1 139 ? 18.868  -20.217 23.301  1.00 15.79 ? 139 ILE B CG2   1 
ATOM   8486  C  CD1   . ILE D 1 139 ? 19.160  -22.759 25.027  1.00 21.27 ? 139 ILE B CD1   1 
ATOM   8487  H  H     . ILE D 1 139 ? 19.791  -18.964 26.948  1.00 22.96 ? 139 ILE B H     1 
ATOM   8488  H  HA    . ILE D 1 139 ? 20.919  -20.736 25.194  1.00 27.87 ? 139 ILE B HA    1 
ATOM   8489  H  HB    . ILE D 1 139 ? 18.402  -19.490 25.164  1.00 19.46 ? 139 ILE B HB    1 
ATOM   8490  H  HG12  . ILE D 1 139 ? 18.523  -21.438 26.430  1.00 27.32 ? 139 ILE B HG12  1 
ATOM   8491  H  HG13  . ILE D 1 139 ? 17.504  -21.603 25.227  1.00 27.32 ? 139 ILE B HG13  1 
ATOM   8492  H  HG21  . ILE D 1 139 ? 17.961  -20.399 23.045  1.00 18.89 ? 139 ILE B HG21  1 
ATOM   8493  H  HG22  . ILE D 1 139 ? 19.136  -19.357 22.969  1.00 18.89 ? 139 ILE B HG22  1 
ATOM   8494  H  HG23  . ILE D 1 139 ? 19.450  -20.897 22.954  1.00 18.89 ? 139 ILE B HG23  1 
ATOM   8495  H  HD11  . ILE D 1 139 ? 19.075  -22.850 24.075  1.00 25.47 ? 139 ILE B HD11  1 
ATOM   8496  H  HD12  . ILE D 1 139 ? 20.086  -22.687 25.268  1.00 25.47 ? 139 ILE B HD12  1 
ATOM   8497  H  HD13  . ILE D 1 139 ? 18.764  -23.515 25.465  1.00 25.47 ? 139 ILE B HD13  1 
ATOM   8498  N  N     . THR D 1 140 ? 21.944  -19.136 23.631  1.00 17.82 ? 140 THR B N     1 
ATOM   8499  C  CA    . THR D 1 140 ? 22.497  -18.179 22.672  1.00 17.07 ? 140 THR B CA    1 
ATOM   8500  C  C     . THR D 1 140 ? 21.728  -18.266 21.372  1.00 22.42 ? 140 THR B C     1 
ATOM   8501  O  O     . THR D 1 140 ? 21.304  -19.342 20.973  1.00 18.10 ? 140 THR B O     1 
ATOM   8502  C  CB    . THR D 1 140 ? 23.967  -18.475 22.350  1.00 22.06 ? 140 THR B CB    1 
ATOM   8503  O  OG1   . THR D 1 140 ? 24.056  -19.805 21.832  1.00 25.28 ? 140 THR B OG1   1 
ATOM   8504  C  CG2   . THR D 1 140 ? 24.830  -18.384 23.618  1.00 25.70 ? 140 THR B CG2   1 
ATOM   8505  H  H     . THR D 1 140 ? 22.303  -19.917 23.593  1.00 21.32 ? 140 THR B H     1 
ATOM   8506  H  HA    . THR D 1 140 ? 22.424  -17.268 23.026  1.00 20.42 ? 140 THR B HA    1 
ATOM   8507  H  HB    . THR D 1 140 ? 24.299  -17.841 21.696  1.00 26.42 ? 140 THR B HB    1 
ATOM   8508  H  HG1   . THR D 1 140 ? 24.836  -19.985 21.653  1.00 30.28 ? 140 THR B HG1   1 
ATOM   8509  H  HG21  . THR D 1 140 ? 24.770  -17.503 23.992  1.00 30.78 ? 140 THR B HG21  1 
ATOM   8510  H  HG22  . THR D 1 140 ? 24.525  -19.021 24.268  1.00 30.78 ? 140 THR B HG22  1 
ATOM   8511  H  HG23  . THR D 1 140 ? 25.747  -18.571 23.404  1.00 30.78 ? 140 THR B HG23  1 
ATOM   8512  N  N     . VAL D 1 141 ? 21.554  -17.119 20.723  1.00 18.69 ? 141 VAL B N     1 
ATOM   8513  C  CA    . VAL D 1 141 ? 20.792  -17.030 19.504  1.00 16.64 ? 141 VAL B CA    1 
ATOM   8514  C  C     . VAL D 1 141 ? 21.566  -16.152 18.540  1.00 21.66 ? 141 VAL B C     1 
ATOM   8515  O  O     . VAL D 1 141 ? 22.475  -15.394 18.940  1.00 19.07 ? 141 VAL B O     1 
ATOM   8516  C  CB    . VAL D 1 141 ? 19.368  -16.420 19.766  1.00 20.45 ? 141 VAL B CB    1 
ATOM   8517  C  CG1   . VAL D 1 141 ? 18.624  -17.205 20.860  1.00 21.38 ? 141 VAL B CG1   1 
ATOM   8518  C  CG2   . VAL D 1 141 ? 19.443  -14.936 20.163  1.00 21.22 ? 141 VAL B CG2   1 
ATOM   8519  H  H     . VAL D 1 141 ? 21.878  -16.366 20.983  1.00 22.37 ? 141 VAL B H     1 
ATOM   8520  H  HA    . VAL D 1 141 ? 20.689  -17.921 19.109  1.00 19.90 ? 141 VAL B HA    1 
ATOM   8521  H  HB    . VAL D 1 141 ? 18.841  -16.482 18.942  1.00 24.48 ? 141 VAL B HB    1 
ATOM   8522  H  HG11  . VAL D 1 141 ? 19.185  -17.920 21.168  1.00 25.59 ? 141 VAL B HG11  1 
ATOM   8523  H  HG12  . VAL D 1 141 ? 18.421  -16.612 21.587  1.00 25.59 ? 141 VAL B HG12  1 
ATOM   8524  H  HG13  . VAL D 1 141 ? 17.812  -17.561 20.491  1.00 25.59 ? 141 VAL B HG13  1 
ATOM   8525  H  HG21  . VAL D 1 141 ? 18.554  -14.607 20.313  1.00 25.41 ? 141 VAL B HG21  1 
ATOM   8526  H  HG22  . VAL D 1 141 ? 19.963  -14.854 20.966  1.00 25.41 ? 141 VAL B HG22  1 
ATOM   8527  H  HG23  . VAL D 1 141 ? 19.860  -14.444 19.452  1.00 25.41 ? 141 VAL B HG23  1 
ATOM   8528  N  N     . THR D 1 142 ? 21.194  -16.263 17.273  1.00 20.21 ? 142 THR B N     1 
ATOM   8529  C  CA    . THR D 1 142 ? 21.681  -15.376 16.231  1.00 19.47 ? 142 THR B CA    1 
ATOM   8530  C  C     . THR D 1 142 ? 20.546  -14.514 15.767  1.00 23.54 ? 142 THR B C     1 
ATOM   8531  O  O     . THR D 1 142 ? 19.411  -14.973 15.551  1.00 20.15 ? 142 THR B O     1 
ATOM   8532  C  CB    . THR D 1 142 ? 22.337  -16.183 15.077  1.00 21.32 ? 142 THR B CB    1 
ATOM   8533  O  OG1   . THR D 1 142 ? 23.495  -16.827 15.590  1.00 22.41 ? 142 THR B OG1   1 
ATOM   8534  C  CG2   . THR D 1 142 ? 22.751  -15.272 13.917  1.00 24.39 ? 142 THR B CG2   1 
ATOM   8535  H  H     . THR D 1 142 ? 20.647  -16.861 16.986  1.00 24.19 ? 142 THR B H     1 
ATOM   8536  H  HA    . THR D 1 142 ? 22.367  -14.788 16.612  1.00 23.30 ? 142 THR B HA    1 
ATOM   8537  H  HB    . THR D 1 142 ? 21.712  -16.847 14.745  1.00 25.52 ? 142 THR B HB    1 
ATOM   8538  H  HG1   . THR D 1 142 ? 23.860  -17.261 14.997  1.00 26.83 ? 142 THR B HG1   1 
ATOM   8539  H  HG21  . THR D 1 142 ? 23.385  -14.619 14.223  1.00 29.20 ? 142 THR B HG21  1 
ATOM   8540  H  HG22  . THR D 1 142 ? 23.153  -15.793 13.218  1.00 29.20 ? 142 THR B HG22  1 
ATOM   8541  H  HG23  . THR D 1 142 ? 21.981  -14.819 13.565  1.00 29.20 ? 142 THR B HG23  1 
ATOM   8542  N  N     . VAL D 1 143 ? 20.850  -13.231 15.664  1.00 22.71 ? 143 VAL B N     1 
ATOM   8543  C  CA    . VAL D 1 143 ? 19.862  -12.249 15.307  1.00 15.98 ? 143 VAL B CA    1 
ATOM   8544  C  C     . VAL D 1 143 ? 20.280  -11.546 14.029  1.00 20.97 ? 143 VAL B C     1 
ATOM   8545  O  O     . VAL D 1 143 ? 21.475  -11.441 13.752  1.00 22.33 ? 143 VAL B O     1 
ATOM   8546  C  CB    . VAL D 1 143 ? 19.682  -11.240 16.438  1.00 28.80 ? 143 VAL B CB    1 
ATOM   8547  C  CG1   . VAL D 1 143 ? 18.945  -10.038 15.951  1.00 33.13 ? 143 VAL B CG1   1 
ATOM   8548  C  CG2   . VAL D 1 143 ? 18.937  -11.906 17.603  1.00 26.84 ? 143 VAL B CG2   1 
ATOM   8549  H  H     . VAL D 1 143 ? 21.635  -12.906 15.800  1.00 27.19 ? 143 VAL B H     1 
ATOM   8550  H  HA    . VAL D 1 143 ? 19.003  -12.694 15.149  1.00 19.11 ? 143 VAL B HA    1 
ATOM   8551  H  HB    . VAL D 1 143 ? 20.562  -10.952 16.759  1.00 34.50 ? 143 VAL B HB    1 
ATOM   8552  H  HG11  . VAL D 1 143 ? 18.844  -9.419  16.677  1.00 39.70 ? 143 VAL B HG11  1 
ATOM   8553  H  HG12  . VAL D 1 143 ? 19.447  -9.631  15.241  1.00 39.70 ? 143 VAL B HG12  1 
ATOM   8554  H  HG13  . VAL D 1 143 ? 18.083  -10.310 15.629  1.00 39.70 ? 143 VAL B HG13  1 
ATOM   8555  H  HG21  . VAL D 1 143 ? 18.827  -11.266 18.310  1.00 32.15 ? 143 VAL B HG21  1 
ATOM   8556  H  HG22  . VAL D 1 143 ? 18.078  -12.204 17.294  1.00 32.15 ? 143 VAL B HG22  1 
ATOM   8557  H  HG23  . VAL D 1 143 ? 19.451  -12.654 17.915  1.00 32.15 ? 143 VAL B HG23  1 
ATOM   8558  N  N     . GLY D 1 144 ? 19.289  -11.106 13.262  1.00 22.75 ? 144 GLY B N     1 
ATOM   8559  C  CA    . GLY D 1 144 ? 19.508  -10.294 12.080  1.00 25.59 ? 144 GLY B CA    1 
ATOM   8560  C  C     . GLY D 1 144 ? 18.564  -9.119  12.108  1.00 26.77 ? 144 GLY B C     1 
ATOM   8561  O  O     . GLY D 1 144 ? 17.379  -9.286  12.414  1.00 21.47 ? 144 GLY B O     1 
ATOM   8562  H  H     . GLY D 1 144 ? 18.458  -11.271 13.413  1.00 27.23 ? 144 GLY B H     1 
ATOM   8563  H  HA2   . GLY D 1 144 ? 20.422  -9.968  12.064  1.00 30.64 ? 144 GLY B HA2   1 
ATOM   8564  H  HA3   . GLY D 1 144 ? 19.342  -10.817 11.280  1.00 30.64 ? 144 GLY B HA3   1 
ATOM   8565  N  N     . VAL D 1 145 ? 19.080  -7.923  11.811  1.00 25.16 ? 145 VAL B N     1 
ATOM   8566  C  CA    . VAL D 1 145 ? 18.260  -6.721  11.807  1.00 20.20 ? 145 VAL B CA    1 
ATOM   8567  C  C     . VAL D 1 145 ? 18.289  -6.107  10.410  1.00 18.96 ? 145 VAL B C     1 
ATOM   8568  O  O     . VAL D 1 145 ? 19.366  -5.873  9.872   1.00 25.68 ? 145 VAL B O     1 
ATOM   8569  C  CB    . VAL D 1 145 ? 18.794  -5.676  12.827  1.00 28.76 ? 145 VAL B CB    1 
ATOM   8570  C  CG1   . VAL D 1 145 ? 17.820  -4.523  12.955  1.00 27.30 ? 145 VAL B CG1   1 
ATOM   8571  C  CG2   . VAL D 1 145 ? 19.082  -6.322  14.195  1.00 35.41 ? 145 VAL B CG2   1 
ATOM   8572  H  H     . VAL D 1 145 ? 19.904  -7.786  11.609  1.00 30.13 ? 145 VAL B H     1 
ATOM   8573  H  HA    . VAL D 1 145 ? 17.335  -6.947  12.037  1.00 24.18 ? 145 VAL B HA    1 
ATOM   8574  H  HB    . VAL D 1 145 ? 19.639  -5.313  12.487  1.00 34.45 ? 145 VAL B HB    1 
ATOM   8575  H  HG11  . VAL D 1 145 ? 18.167  -3.890  13.587  1.00 32.70 ? 145 VAL B HG11  1 
ATOM   8576  H  HG12  . VAL D 1 145 ? 17.716  -4.105  12.096  1.00 32.70 ? 145 VAL B HG12  1 
ATOM   8577  H  HG13  . VAL D 1 145 ? 16.975  -4.861  13.259  1.00 32.70 ? 145 VAL B HG13  1 
ATOM   8578  H  HG21  . VAL D 1 145 ? 18.873  -7.258  14.149  1.00 42.43 ? 145 VAL B HG21  1 
ATOM   8579  H  HG22  . VAL D 1 145 ? 20.011  -6.204  14.406  1.00 42.43 ? 145 VAL B HG22  1 
ATOM   8580  H  HG23  . VAL D 1 145 ? 18.538  -5.897  14.862  1.00 42.43 ? 145 VAL B HG23  1 
ATOM   8581  N  N     . ALA D 1 146 ? 17.124  -5.883  9.815   1.00 23.35 ? 146 ALA B N     1 
ATOM   8582  C  CA    . ALA D 1 146 ? 17.073  -5.404  8.430   1.00 27.63 ? 146 ALA B CA    1 
ATOM   8583  C  C     . ALA D 1 146 ? 15.712  -4.806  8.120   1.00 27.04 ? 146 ALA B C     1 
ATOM   8584  O  O     . ALA D 1 146 ? 14.796  -4.897  8.937   1.00 27.20 ? 146 ALA B O     1 
ATOM   8585  C  CB    . ALA D 1 146 ? 17.404  -6.543  7.462   1.00 22.02 ? 146 ALA B CB    1 
ATOM   8586  H  H     . ALA D 1 146 ? 16.355  -5.998  10.182  1.00 27.96 ? 146 ALA B H     1 
ATOM   8587  H  HA    . ALA D 1 146 ? 17.746  -4.701  8.312   1.00 33.10 ? 146 ALA B HA    1 
ATOM   8588  H  HB1   . ALA D 1 146 ? 16.762  -7.247  7.578   1.00 26.37 ? 146 ALA B HB1   1 
ATOM   8589  H  HB2   . ALA D 1 146 ? 17.365  -6.209  6.563   1.00 26.37 ? 146 ALA B HB2   1 
ATOM   8590  H  HB3   . ALA D 1 146 ? 18.286  -6.868  7.653   1.00 26.37 ? 146 ALA B HB3   1 
ATOM   8591  N  N     . PRO D 1 147 ? 15.570  -4.179  6.930   1.00 25.97 ? 147 PRO B N     1 
ATOM   8592  C  CA    . PRO D 1 147 ? 14.316  -3.528  6.541   1.00 25.91 ? 147 PRO B CA    1 
ATOM   8593  C  C     . PRO D 1 147 ? 13.178  -4.493  6.166   1.00 27.05 ? 147 PRO B C     1 
ATOM   8594  O  O     . PRO D 1 147 ? 12.034  -4.066  6.137   1.00 33.57 ? 147 PRO B O     1 
ATOM   8595  C  CB    . PRO D 1 147 ? 14.721  -2.675  5.323   1.00 27.89 ? 147 PRO B CB    1 
ATOM   8596  C  CG    . PRO D 1 147 ? 16.200  -2.548  5.409   1.00 27.91 ? 147 PRO B CG    1 
ATOM   8597  C  CD    . PRO D 1 147 ? 16.686  -3.811  6.037   1.00 23.12 ? 147 PRO B CD    1 
ATOM   8598  H  HA    . PRO D 1 147 ? 14.009  -2.935  7.258   1.00 31.03 ? 147 PRO B HA    1 
ATOM   8599  H  HB2   . PRO D 1 147 ? 14.463  -3.130  4.506   1.00 33.40 ? 147 PRO B HB2   1 
ATOM   8600  H  HB3   . PRO D 1 147 ? 14.298  -1.804  5.379   1.00 33.40 ? 147 PRO B HB3   1 
ATOM   8601  H  HG2   . PRO D 1 147 ? 16.568  -2.447  4.517   1.00 33.43 ? 147 PRO B HG2   1 
ATOM   8602  H  HG3   . PRO D 1 147 ? 16.428  -1.784  5.960   1.00 33.43 ? 147 PRO B HG3   1 
ATOM   8603  H  HD2   . PRO D 1 147 ? 16.823  -4.495  5.363   1.00 27.69 ? 147 PRO B HD2   1 
ATOM   8604  H  HD3   . PRO D 1 147 ? 17.493  -3.647  6.550   1.00 27.69 ? 147 PRO B HD3   1 
ATOM   8605  N  N     . ASN D 1 148 ? 13.495  -5.752  5.871   1.00 28.16 ? 148 ASN B N     1 
ATOM   8606  C  CA    . ASN D 1 148 ? 12.456  -6.747  5.613   1.00 36.13 ? 148 ASN B CA    1 
ATOM   8607  C  C     . ASN D 1 148 ? 12.858  -8.115  6.139   1.00 30.34 ? 148 ASN B C     1 
ATOM   8608  O  O     . ASN D 1 148 ? 14.022  -8.335  6.509   1.00 26.31 ? 148 ASN B O     1 
ATOM   8609  C  CB    . ASN D 1 148 ? 12.128  -6.846  4.110   1.00 34.58 ? 148 ASN B CB    1 
ATOM   8610  C  CG    . ASN D 1 148 ? 13.293  -7.350  3.285   1.00 39.91 ? 148 ASN B CG    1 
ATOM   8611  O  OD1   . ASN D 1 148 ? 13.781  -8.469  3.469   1.00 34.33 ? 148 ASN B OD1   1 
ATOM   8612  N  ND2   . ASN D 1 148 ? 13.732  -6.531  2.339   1.00 41.52 ? 148 ASN B ND2   1 
ATOM   8613  H  H     . ASN D 1 148 ? 14.298  -6.054  5.814   1.00 33.73 ? 148 ASN B H     1 
ATOM   8614  H  HA    . ASN D 1 148 ? 11.638  -6.477  6.080   1.00 43.29 ? 148 ASN B HA    1 
ATOM   8615  H  HB2   . ASN D 1 148 ? 11.387  -7.459  3.989   1.00 41.44 ? 148 ASN B HB2   1 
ATOM   8616  H  HB3   . ASN D 1 148 ? 11.887  -5.965  3.782   1.00 41.44 ? 148 ASN B HB3   1 
ATOM   8617  H  HD21  . ASN D 1 148 ? 14.392  -6.766  1.839   1.00 49.77 ? 148 ASN B HD21  1 
ATOM   8618  H  HD22  . ASN D 1 148 ? 13.358  -5.765  2.225   1.00 49.77 ? 148 ASN B HD22  1 
ATOM   8619  N  N     . LYS D 1 149 ? 11.902  -9.043  6.116   1.00 30.46 ? 149 LYS B N     1 
ATOM   8620  C  CA    . LYS D 1 149 ? 12.119  -10.400 6.622   1.00 25.97 ? 149 LYS B CA    1 
ATOM   8621  C  C     . LYS D 1 149 ? 13.230  -11.173 5.940   1.00 28.87 ? 149 LYS B C     1 
ATOM   8622  O  O     . LYS D 1 149 ? 14.057  -11.787 6.611   1.00 24.27 ? 149 LYS B O     1 
ATOM   8623  C  CB    . LYS D 1 149 ? 10.817  -11.223 6.539   1.00 28.71 ? 149 LYS B CB    1 
ATOM   8624  C  CG    . LYS D 1 149 ? 9.749   -10.750 7.464   1.00 28.02 ? 149 LYS B CG    1 
ATOM   8625  C  CD    . LYS D 1 149 ? 8.635   -11.812 7.671   1.00 34.52 ? 149 LYS B CD    1 
ATOM   8626  C  CE    . LYS D 1 149 ? 7.990   -12.253 6.378   1.00 33.44 ? 149 LYS B CE    1 
ATOM   8627  N  NZ    . LYS D 1 149 ? 6.786   -13.111 6.609   1.00 29.22 ? 149 LYS B NZ    1 
ATOM   8628  H  H     . LYS D 1 149 ? 11.109  -8.910  5.810   1.00 36.49 ? 149 LYS B H     1 
ATOM   8629  H  HA    . LYS D 1 149 ? 12.357  -10.334 7.570   1.00 31.10 ? 149 LYS B HA    1 
ATOM   8630  H  HB2   . LYS D 1 149 ? 10.472  -11.171 5.634   1.00 34.40 ? 149 LYS B HB2   1 
ATOM   8631  H  HB3   . LYS D 1 149 ? 11.016  -12.146 6.762   1.00 34.40 ? 149 LYS B HB3   1 
ATOM   8632  H  HG2   . LYS D 1 149 ? 10.142  -10.552 8.328   1.00 33.56 ? 149 LYS B HG2   1 
ATOM   8633  H  HG3   . LYS D 1 149 ? 9.339   -9.952  7.094   1.00 33.56 ? 149 LYS B HG3   1 
ATOM   8634  H  HD2   . LYS D 1 149 ? 9.021   -12.595 8.095   1.00 41.36 ? 149 LYS B HD2   1 
ATOM   8635  H  HD3   . LYS D 1 149 ? 7.943   -11.437 8.238   1.00 41.36 ? 149 LYS B HD3   1 
ATOM   8636  H  HE2   . LYS D 1 149 ? 7.711   -11.470 5.879   1.00 40.07 ? 149 LYS B HE2   1 
ATOM   8637  H  HE3   . LYS D 1 149 ? 8.632   -12.766 5.862   1.00 40.07 ? 149 LYS B HE3   1 
ATOM   8638  H  HZ1   . LYS D 1 149 ? 6.177   -12.661 7.077   1.00 35.01 ? 149 LYS B HZ1   1 
ATOM   8639  H  HZ2   . LYS D 1 149 ? 6.431   -13.353 5.830   1.00 35.01 ? 149 LYS B HZ2   1 
ATOM   8640  H  HZ3   . LYS D 1 149 ? 7.016   -13.842 7.062   1.00 35.01 ? 149 LYS B HZ3   1 
ATOM   8641  N  N     . ILE D 1 150 ? 13.249  -11.202 4.607   1.00 28.87 ? 150 ILE B N     1 
ATOM   8642  C  CA    . ILE D 1 150 ? 14.239  -12.041 3.943   1.00 25.76 ? 150 ILE B CA    1 
ATOM   8643  C  C     . ILE D 1 150 ? 15.661  -11.564 4.207   1.00 23.45 ? 150 ILE B C     1 
ATOM   8644  O  O     . ILE D 1 150 ? 16.566  -12.373 4.397   1.00 23.62 ? 150 ILE B O     1 
ATOM   8645  C  CB    . ILE D 1 150 ? 13.998  -12.220 2.399   1.00 36.71 ? 150 ILE B CB    1 
ATOM   8646  C  CG1   . ILE D 1 150 ? 13.848  -13.686 2.011   1.00 44.24 ? 150 ILE B CG1   1 
ATOM   8647  C  CG2   . ILE D 1 150 ? 15.197  -11.825 1.657   1.00 41.63 ? 150 ILE B CG2   1 
ATOM   8648  C  CD1   . ILE D 1 150 ? 12.942  -14.503 2.890   1.00 48.99 ? 150 ILE B CD1   1 
ATOM   8649  H  H     . ILE D 1 150 ? 12.723  -10.764 4.085   1.00 34.58 ? 150 ILE B H     1 
ATOM   8650  H  HA    . ILE D 1 150 ? 14.171  -12.936 4.336   1.00 30.86 ? 150 ILE B HA    1 
ATOM   8651  H  HB    . ILE D 1 150 ? 13.229  -11.706 2.107   1.00 43.99 ? 150 ILE B HB    1 
ATOM   8652  H  HG12  . ILE D 1 150 ? 13.494  -13.730 1.109   1.00 53.02 ? 150 ILE B HG12  1 
ATOM   8653  H  HG13  . ILE D 1 150 ? 14.725  -14.100 2.034   1.00 53.02 ? 150 ILE B HG13  1 
ATOM   8654  H  HG21  . ILE D 1 150 ? 15.931  -12.379 1.932   1.00 49.90 ? 150 ILE B HG21  1 
ATOM   8655  H  HG22  . ILE D 1 150 ? 15.035  -11.939 0.718   1.00 49.90 ? 150 ILE B HG22  1 
ATOM   8656  H  HG23  . ILE D 1 150 ? 15.393  -10.904 1.846   1.00 49.90 ? 150 ILE B HG23  1 
ATOM   8657  H  HD11  . ILE D 1 150 ? 12.918  -15.404 2.561   1.00 58.72 ? 150 ILE B HD11  1 
ATOM   8658  H  HD12  . ILE D 1 150 ? 13.284  -14.490 3.787   1.00 58.72 ? 150 ILE B HD12  1 
ATOM   8659  H  HD13  . ILE D 1 150 ? 12.061  -14.122 2.869   1.00 58.72 ? 150 ILE B HD13  1 
ATOM   8660  N  N     . LEU D 1 151 ? 15.877  -10.253 4.217   1.00 30.70 ? 151 LEU B N     1 
ATOM   8661  C  CA    . LEU D 1 151 ? 17.220  -9.754  4.450   1.00 27.41 ? 151 LEU B CA    1 
ATOM   8662  C  C     . LEU D 1 151 ? 17.609  -10.007 5.903   1.00 20.21 ? 151 LEU B C     1 
ATOM   8663  O  O     . LEU D 1 151 ? 18.784  -10.288 6.193   1.00 24.96 ? 151 LEU B O     1 
ATOM   8664  C  CB    . LEU D 1 151 ? 17.326  -8.268  4.100   1.00 32.77 ? 151 LEU B CB    1 
ATOM   8665  C  CG    . LEU D 1 151 ? 17.224  -7.979  2.585   1.00 32.31 ? 151 LEU B CG    1 
ATOM   8666  C  CD1   . LEU D 1 151 ? 17.025  -6.508  2.360   1.00 38.80 ? 151 LEU B CD1   1 
ATOM   8667  C  CD2   . LEU D 1 151 ? 18.464  -8.490  1.851   1.00 35.87 ? 151 LEU B CD2   1 
ATOM   8668  H  H     . LEU D 1 151 ? 15.278  -9.648  4.096   1.00 36.78 ? 151 LEU B H     1 
ATOM   8669  H  HA    . LEU D 1 151 ? 17.847  -10.245 3.879   1.00 32.83 ? 151 LEU B HA    1 
ATOM   8670  H  HB2   . LEU D 1 151 ? 16.607  -7.790  4.542   1.00 39.26 ? 151 LEU B HB2   1 
ATOM   8671  H  HB3   . LEU D 1 151 ? 18.182  -7.933  4.409   1.00 39.26 ? 151 LEU B HB3   1 
ATOM   8672  H  HG    . LEU D 1 151 ? 16.452  -8.444  2.226   1.00 38.71 ? 151 LEU B HG    1 
ATOM   8673  H  HD11  . LEU D 1 151 ? 16.964  -6.341  1.417   1.00 46.50 ? 151 LEU B HD11  1 
ATOM   8674  H  HD12  . LEU D 1 151 ? 16.215  -6.233  2.795   1.00 46.50 ? 151 LEU B HD12  1 
ATOM   8675  H  HD13  . LEU D 1 151 ? 17.773  -6.032  2.729   1.00 46.50 ? 151 LEU B HD13  1 
ATOM   8676  H  HD21  . LEU D 1 151 ? 18.374  -8.298  0.915   1.00 42.98 ? 151 LEU B HD21  1 
ATOM   8677  H  HD22  . LEU D 1 151 ? 19.240  -8.048  2.203   1.00 42.98 ? 151 LEU B HD22  1 
ATOM   8678  H  HD23  . LEU D 1 151 ? 18.538  -9.438  1.985   1.00 42.98 ? 151 LEU B HD23  1 
ATOM   8679  N  N     . ALA D 1 152 ? 16.641  -9.888  6.812   1.00 26.43 ? 152 ALA B N     1 
ATOM   8680  C  CA    . ALA D 1 152 ? 16.921  -10.173 8.228   1.00 24.76 ? 152 ALA B CA    1 
ATOM   8681  C  C     . ALA D 1 152 ? 17.400  -11.623 8.372   1.00 21.31 ? 152 ALA B C     1 
ATOM   8682  O  O     . ALA D 1 152 ? 18.377  -11.889 9.061   1.00 20.11 ? 152 ALA B O     1 
ATOM   8683  C  CB    . ALA D 1 152 ? 15.693  -9.899  9.122   1.00 20.38 ? 152 ALA B CB    1 
ATOM   8684  H  H     . ALA D 1 152 ? 15.831  -9.651  6.645   1.00 31.65 ? 152 ALA B H     1 
ATOM   8685  H  HA    . ALA D 1 152 ? 17.647  -9.587  8.530   1.00 29.65 ? 152 ALA B HA    1 
ATOM   8686  H  HB1   . ALA D 1 152 ? 14.967  -10.458 8.836   1.00 24.40 ? 152 ALA B HB1   1 
ATOM   8687  H  HB2   . ALA D 1 152 ? 15.920  -10.097 10.034  1.00 24.40 ? 152 ALA B HB2   1 
ATOM   8688  H  HB3   . ALA D 1 152 ? 15.447  -8.974  9.039   1.00 24.40 ? 152 ALA B HB3   1 
ATOM   8689  N  N     . LYS D 1 153 ? 16.732  -12.549 7.685   1.00 23.15 ? 153 LYS B N     1 
ATOM   8690  C  CA    . LYS D 1 153 ? 17.130  -13.954 7.743   1.00 24.16 ? 153 LYS B CA    1 
ATOM   8691  C  C     . LYS D 1 153 ? 18.483  -14.180 7.110   1.00 25.48 ? 153 LYS B C     1 
ATOM   8692  O  O     . LYS D 1 153 ? 19.331  -14.857 7.685   1.00 23.01 ? 153 LYS B O     1 
ATOM   8693  C  CB    . LYS D 1 153 ? 16.081  -14.866 7.083   1.00 25.76 ? 153 LYS B CB    1 
ATOM   8694  C  CG    . LYS D 1 153 ? 16.476  -16.354 7.095   1.00 28.61 ? 153 LYS B CG    1 
ATOM   8695  C  CD    . LYS D 1 153 ? 15.315  -17.200 6.601   1.00 32.48 ? 153 LYS B CD    1 
ATOM   8696  C  CE    . LYS D 1 153 ? 15.558  -18.692 6.786   1.00 44.05 ? 153 LYS B CE    1 
ATOM   8697  N  NZ    . LYS D 1 153 ? 15.135  -19.181 8.142   1.00 34.54 ? 153 LYS B NZ    1 
ATOM   8698  H  H     . LYS D 1 153 ? 16.052  -12.392 7.183   1.00 27.72 ? 153 LYS B H     1 
ATOM   8699  H  HA    . LYS D 1 153 ? 17.198  -14.218 8.684   1.00 28.93 ? 153 LYS B HA    1 
ATOM   8700  H  HB2   . LYS D 1 153 ? 15.241  -14.777 7.561   1.00 30.85 ? 153 LYS B HB2   1 
ATOM   8701  H  HB3   . LYS D 1 153 ? 15.965  -14.595 6.159   1.00 30.85 ? 153 LYS B HB3   1 
ATOM   8702  H  HG2   . LYS D 1 153 ? 17.233  -16.493 6.505   1.00 34.27 ? 153 LYS B HG2   1 
ATOM   8703  H  HG3   . LYS D 1 153 ? 16.694  -16.625 8.000   1.00 34.27 ? 153 LYS B HG3   1 
ATOM   8704  H  HD2   . LYS D 1 153 ? 14.516  -16.962 7.098   1.00 38.91 ? 153 LYS B HD2   1 
ATOM   8705  H  HD3   . LYS D 1 153 ? 15.180  -17.033 5.655   1.00 38.91 ? 153 LYS B HD3   1 
ATOM   8706  H  HE2   . LYS D 1 153 ? 15.050  -19.180 6.119   1.00 52.79 ? 153 LYS B HE2   1 
ATOM   8707  H  HE3   . LYS D 1 153 ? 16.505  -18.874 6.682   1.00 52.79 ? 153 LYS B HE3   1 
ATOM   8708  H  HZ1   . LYS D 1 153 ? 15.591  -18.754 8.775   1.00 41.39 ? 153 LYS B HZ1   1 
ATOM   8709  H  HZ2   . LYS D 1 153 ? 14.266  -19.033 8.261   1.00 41.39 ? 153 LYS B HZ2   1 
ATOM   8710  H  HZ3   . LYS D 1 153 ? 15.292  -20.055 8.212   1.00 41.39 ? 153 LYS B HZ3   1 
ATOM   8711  N  N     . ILE D 1 154 ? 18.710  -13.621 5.926   1.00 27.48 ? 154 ILE B N     1 
ATOM   8712  C  CA    . ILE D 1 154 ? 20.003  -13.855 5.257   1.00 29.04 ? 154 ILE B CA    1 
ATOM   8713  C  C     . ILE D 1 154 ? 21.156  -13.321 6.092   1.00 20.76 ? 154 ILE B C     1 
ATOM   8714  O  O     . ILE D 1 154 ? 22.156  -14.014 6.299   1.00 29.26 ? 154 ILE B O     1 
ATOM   8715  C  CB    . ILE D 1 154 ? 20.075  -13.210 3.869   1.00 33.67 ? 154 ILE B CB    1 
ATOM   8716  C  CG1   . ILE D 1 154 ? 19.099  -13.900 2.909   1.00 35.60 ? 154 ILE B CG1   1 
ATOM   8717  C  CG2   . ILE D 1 154 ? 21.514  -13.293 3.352   1.00 33.11 ? 154 ILE B CG2   1 
ATOM   8718  C  CD1   . ILE D 1 154 ? 18.625  -13.024 1.753   1.00 29.46 ? 154 ILE B CD1   1 
ATOM   8719  H  H     . ILE D 1 154 ? 18.160  -13.119 5.496   1.00 32.91 ? 154 ILE B H     1 
ATOM   8720  H  HA    . ILE D 1 154 ? 20.133  -14.820 5.147   1.00 34.79 ? 154 ILE B HA    1 
ATOM   8721  H  HB    . ILE D 1 154 ? 19.826  -12.276 3.947   1.00 40.34 ? 154 ILE B HB    1 
ATOM   8722  H  HG12  . ILE D 1 154 ? 19.535  -14.678 2.529   1.00 42.66 ? 154 ILE B HG12  1 
ATOM   8723  H  HG13  . ILE D 1 154 ? 18.315  -14.176 3.409   1.00 42.66 ? 154 ILE B HG13  1 
ATOM   8724  H  HG21  . ILE D 1 154 ? 21.557  -12.889 2.482   1.00 39.67 ? 154 ILE B HG21  1 
ATOM   8725  H  HG22  . ILE D 1 154 ? 22.092  -12.826 3.960   1.00 39.67 ? 154 ILE B HG22  1 
ATOM   8726  H  HG23  . ILE D 1 154 ? 21.773  -14.216 3.297   1.00 39.67 ? 154 ILE B HG23  1 
ATOM   8727  H  HD11  . ILE D 1 154 ? 18.021  -13.531 1.205   1.00 35.29 ? 154 ILE B HD11  1 
ATOM   8728  H  HD12  . ILE D 1 154 ? 18.177  -12.253 2.109   1.00 35.29 ? 154 ILE B HD12  1 
ATOM   8729  H  HD13  . ILE D 1 154 ? 19.387  -12.752 1.236   1.00 35.29 ? 154 ILE B HD13  1 
ATOM   8730  N  N     . ILE D 1 155 ? 21.012  -12.117 6.637   1.00 27.64 ? 155 ILE B N     1 
ATOM   8731  C  CA    . ILE D 1 155 ? 22.109  -11.574 7.445   1.00 25.71 ? 155 ILE B CA    1 
ATOM   8732  C  C     . ILE D 1 155 ? 22.335  -12.368 8.747   1.00 27.91 ? 155 ILE B C     1 
ATOM   8733  O  O     . ILE D 1 155 ? 23.469  -12.584 9.149   1.00 26.56 ? 155 ILE B O     1 
ATOM   8734  C  CB    . ILE D 1 155 ? 21.976  -10.030 7.700   1.00 25.80 ? 155 ILE B CB    1 
ATOM   8735  C  CG1   . ILE D 1 155 ? 23.357  -9.437  8.038   1.00 28.61 ? 155 ILE B CG1   1 
ATOM   8736  C  CG2   . ILE D 1 155 ? 20.959  -9.707  8.774   1.00 26.04 ? 155 ILE B CG2   1 
ATOM   8737  C  CD1   . ILE D 1 155 ? 24.342  -9.451  6.841   1.00 30.71 ? 155 ILE B CD1   1 
ATOM   8738  H  H     . ILE D 1 155 ? 20.321  -11.610 6.563   1.00 33.11 ? 155 ILE B H     1 
ATOM   8739  H  HA    . ILE D 1 155 ? 22.929  -11.686 6.919   1.00 30.79 ? 155 ILE B HA    1 
ATOM   8740  H  HB    . ILE D 1 155 ? 21.673  -9.620  6.875   1.00 30.90 ? 155 ILE B HB    1 
ATOM   8741  H  HG12  . ILE D 1 155 ? 23.243  -8.515  8.319   1.00 34.28 ? 155 ILE B HG12  1 
ATOM   8742  H  HG13  . ILE D 1 155 ? 23.754  -9.954  8.757   1.00 34.28 ? 155 ILE B HG13  1 
ATOM   8743  H  HG21  . ILE D 1 155 ? 20.918  -8.755  8.889   1.00 31.18 ? 155 ILE B HG21  1 
ATOM   8744  H  HG22  . ILE D 1 155 ? 20.101  -10.042 8.503   1.00 31.18 ? 155 ILE B HG22  1 
ATOM   8745  H  HG23  . ILE D 1 155 ? 21.228  -10.125 9.595   1.00 31.18 ? 155 ILE B HG23  1 
ATOM   8746  H  HD11  . ILE D 1 155 ? 23.969  -8.935  6.124   1.00 36.79 ? 155 ILE B HD11  1 
ATOM   8747  H  HD12  . ILE D 1 155 ? 25.178  -9.070  7.120   1.00 36.79 ? 155 ILE B HD12  1 
ATOM   8748  H  HD13  . ILE D 1 155 ? 24.474  -10.359 6.558   1.00 36.79 ? 155 ILE B HD13  1 
ATOM   8749  N  N     . ALA D 1 156 ? 21.271  -12.825 9.400   1.00 24.47 ? 156 ALA B N     1 
ATOM   8750  C  CA    . ALA D 1 156 ? 21.423  -13.729 10.544  1.00 26.98 ? 156 ALA B CA    1 
ATOM   8751  C  C     . ALA D 1 156 ? 22.215  -14.981 10.136  1.00 19.86 ? 156 ALA B C     1 
ATOM   8752  O  O     . ALA D 1 156 ? 23.152  -15.390 10.812  1.00 24.82 ? 156 ALA B O     1 
ATOM   8753  C  CB    . ALA D 1 156 ? 20.021  -14.144 11.084  1.00 23.58 ? 156 ALA B CB    1 
ATOM   8754  H  H     . ALA D 1 156 ? 20.456  -12.630 9.206   1.00 29.30 ? 156 ALA B H     1 
ATOM   8755  H  HA    . ALA D 1 156 ? 21.910  -13.272 11.261  1.00 32.31 ? 156 ALA B HA    1 
ATOM   8756  H  HB1   . ALA D 1 156 ? 20.137  -14.735 11.831  1.00 28.24 ? 156 ALA B HB1   1 
ATOM   8757  H  HB2   . ALA D 1 156 ? 19.547  -13.356 11.359  1.00 28.24 ? 156 ALA B HB2   1 
ATOM   8758  H  HB3   . ALA D 1 156 ? 19.538  -14.591 10.385  1.00 28.24 ? 156 ALA B HB3   1 
ATOM   8759  N  N     . ASP D 1 157 ? 21.774  -15.619 9.061   1.00 22.03 ? 157 ASP B N     1 
ATOM   8760  C  CA    . ASP D 1 157 ? 22.419  -16.830 8.581   1.00 27.25 ? 157 ASP B CA    1 
ATOM   8761  C  C     . ASP D 1 157 ? 23.920  -16.594 8.396   1.00 38.04 ? 157 ASP B C     1 
ATOM   8762  O  O     . ASP D 1 157 ? 24.748  -17.445 8.721   1.00 36.25 ? 157 ASP B O     1 
ATOM   8763  C  CB    . ASP D 1 157 ? 21.783  -17.288 7.273   1.00 35.05 ? 157 ASP B CB    1 
ATOM   8764  C  CG    . ASP D 1 157 ? 20.476  -18.034 7.481   1.00 35.34 ? 157 ASP B CG    1 
ATOM   8765  O  OD1   . ASP D 1 157 ? 20.197  -18.458 8.614   1.00 39.14 ? 157 ASP B OD1   1 
ATOM   8766  O  OD2   . ASP D 1 157 ? 19.728  -18.200 6.501   1.00 41.03 ? 157 ASP B OD2   1 
ATOM   8767  H  H     . ASP D 1 157 ? 21.100  -15.368 8.589   1.00 26.37 ? 157 ASP B H     1 
ATOM   8768  H  HA    . ASP D 1 157 ? 22.301  -17.542 9.244   1.00 32.64 ? 157 ASP B HA    1 
ATOM   8769  H  HB2   . ASP D 1 157 ? 21.601  -16.511 6.721   1.00 42.00 ? 157 ASP B HB2   1 
ATOM   8770  H  HB3   . ASP D 1 157 ? 22.398  -17.883 6.814   1.00 42.00 ? 157 ASP B HB3   1 
ATOM   8771  N  N     . LYS D 1 158 ? 24.272  -15.410 7.918   1.00 32.72 ? 158 LYS B N     1 
ATOM   8772  C  CA    . LYS D 1 158 ? 25.670  -15.103 7.657   1.00 37.68 ? 158 LYS B CA    1 
ATOM   8773  C  C     . LYS D 1 158 ? 26.458  -14.822 8.929   1.00 38.36 ? 158 LYS B C     1 
ATOM   8774  O  O     . LYS D 1 158 ? 27.682  -14.730 8.873   1.00 35.09 ? 158 LYS B O     1 
ATOM   8775  C  CB    . LYS D 1 158 ? 25.778  -13.920 6.688   1.00 38.73 ? 158 LYS B CB    1 
ATOM   8776  C  CG    . LYS D 1 158 ? 25.376  -14.292 5.266   1.00 34.29 ? 158 LYS B CG    1 
ATOM   8777  C  CD    . LYS D 1 158 ? 25.353  -13.094 4.313   1.00 50.40 ? 158 LYS B CD    1 
ATOM   8778  C  CE    . LYS D 1 158 ? 26.753  -12.715 3.844   1.00 56.93 ? 158 LYS B CE    1 
ATOM   8779  N  NZ    . LYS D 1 158 ? 27.375  -13.785 3.014   1.00 39.53 ? 158 LYS B NZ    1 
ATOM   8780  H  H     . LYS D 1 158 ? 23.725  -14.771 7.737   1.00 39.20 ? 158 LYS B H     1 
ATOM   8781  H  HA    . LYS D 1 158 ? 26.081  -15.878 7.221   1.00 45.16 ? 158 LYS B HA    1 
ATOM   8782  H  HB2   . LYS D 1 158 ? 25.192  -13.208 6.990   1.00 46.41 ? 158 LYS B HB2   1 
ATOM   8783  H  HB3   . LYS D 1 158 ? 26.696  -13.609 6.669   1.00 46.41 ? 158 LYS B HB3   1 
ATOM   8784  H  HG2   . LYS D 1 158 ? 26.010  -14.938 4.919   1.00 41.09 ? 158 LYS B HG2   1 
ATOM   8785  H  HG3   . LYS D 1 158 ? 24.486  -14.678 5.282   1.00 41.09 ? 158 LYS B HG3   1 
ATOM   8786  H  HD2   . LYS D 1 158 ? 24.822  -13.318 3.533   1.00 60.42 ? 158 LYS B HD2   1 
ATOM   8787  H  HD3   . LYS D 1 158 ? 24.969  -12.330 4.771   1.00 60.42 ? 158 LYS B HD3   1 
ATOM   8788  H  HE2   . LYS D 1 158 ? 26.701  -11.908 3.308   1.00 68.25 ? 158 LYS B HE2   1 
ATOM   8789  H  HE3   . LYS D 1 158 ? 27.318  -12.566 4.618   1.00 68.25 ? 158 LYS B HE3   1 
ATOM   8790  H  HZ1   . LYS D 1 158 ? 28.189  -13.535 2.756   1.00 47.37 ? 158 LYS B HZ1   1 
ATOM   8791  H  HZ2   . LYS D 1 158 ? 27.439  -14.537 3.485   1.00 47.37 ? 158 LYS B HZ2   1 
ATOM   8792  H  HZ3   . LYS D 1 158 ? 26.877  -13.938 2.292   1.00 47.37 ? 158 LYS B HZ3   1 
ATOM   8793  N  N     . SER D 1 159 ? 25.765  -14.701 10.070  1.00 25.33 ? 159 SER B N     1 
ATOM   8794  C  CA    . SER D 1 159 ? 26.400  -14.301 11.310  1.00 27.55 ? 159 SER B CA    1 
ATOM   8795  C  C     . SER D 1 159 ? 26.412  -15.410 12.354  1.00 27.40 ? 159 SER B C     1 
ATOM   8796  O  O     . SER D 1 159 ? 26.841  -15.175 13.470  1.00 26.39 ? 159 SER B O     1 
ATOM   8797  C  CB    . SER D 1 159 ? 25.699  -13.069 11.884  1.00 32.06 ? 159 SER B CB    1 
ATOM   8798  O  OG    . SER D 1 159 ? 25.491  -12.090 10.875  1.00 29.81 ? 159 SER B OG    1 
ATOM   8799  H  H     . SER D 1 159 ? 24.921  -14.847 10.141  1.00 30.34 ? 159 SER B H     1 
ATOM   8800  H  HA    . SER D 1 159 ? 27.330  -14.057 11.123  1.00 32.99 ? 159 SER B HA    1 
ATOM   8801  H  HB2   . SER D 1 159 ? 24.840  -13.336 12.248  1.00 38.41 ? 159 SER B HB2   1 
ATOM   8802  H  HB3   . SER D 1 159 ? 26.252  -12.689 12.584  1.00 38.41 ? 159 SER B HB3   1 
ATOM   8803  H  HG    . SER D 1 159 ? 25.115  -11.435 11.193  1.00 35.72 ? 159 SER B HG    1 
ATOM   8804  N  N     . LYS D 1 160 ? 25.960  -16.615 12.004  1.00 24.83 ? 160 LYS B N     1 
ATOM   8805  C  CA    . LYS D 1 160 ? 25.936  -17.711 12.980  1.00 23.58 ? 160 LYS B CA    1 
ATOM   8806  C  C     . LYS D 1 160 ? 27.361  -18.108 13.299  1.00 29.23 ? 160 LYS B C     1 
ATOM   8807  O  O     . LYS D 1 160 ? 28.219  -18.056 12.433  1.00 35.89 ? 160 LYS B O     1 
ATOM   8808  C  CB    . LYS D 1 160 ? 25.166  -18.936 12.459  1.00 31.96 ? 160 LYS B CB    1 
ATOM   8809  C  CG    . LYS D 1 160 ? 23.654  -18.768 12.348  1.00 36.36 ? 160 LYS B CG    1 
ATOM   8810  C  CD    . LYS D 1 160 ? 22.903  -20.114 12.072  1.00 44.31 ? 160 LYS B CD    1 
ATOM   8811  C  CE    . LYS D 1 160 ? 21.401  -19.887 11.754  1.00 38.72 ? 160 LYS B CE    1 
ATOM   8812  N  NZ    . LYS D 1 160 ? 20.619  -21.112 11.246  1.00 32.96 ? 160 LYS B NZ    1 
ATOM   8813  H  H     . LYS D 1 160 ? 25.666  -16.823 11.222  1.00 29.74 ? 160 LYS B H     1 
ATOM   8814  H  HA    . LYS D 1 160 ? 25.507  -17.403 13.806  1.00 28.23 ? 160 LYS B HA    1 
ATOM   8815  H  HB2   . LYS D 1 160 ? 25.500  -19.155 11.575  1.00 38.29 ? 160 LYS B HB2   1 
ATOM   8816  H  HB3   . LYS D 1 160 ? 25.332  -19.680 13.060  1.00 38.29 ? 160 LYS B HB3   1 
ATOM   8817  H  HG2   . LYS D 1 160 ? 23.316  -18.402 13.180  1.00 43.57 ? 160 LYS B HG2   1 
ATOM   8818  H  HG3   . LYS D 1 160 ? 23.459  -18.161 11.616  1.00 43.57 ? 160 LYS B HG3   1 
ATOM   8819  H  HD2   . LYS D 1 160 ? 23.310  -20.556 11.310  1.00 53.12 ? 160 LYS B HD2   1 
ATOM   8820  H  HD3   . LYS D 1 160 ? 22.964  -20.679 12.857  1.00 53.12 ? 160 LYS B HD3   1 
ATOM   8821  H  HE2   . LYS D 1 160 ? 20.962  -19.581 12.563  1.00 46.40 ? 160 LYS B HE2   1 
ATOM   8822  H  HE3   . LYS D 1 160 ? 21.334  -19.200 11.072  1.00 46.40 ? 160 LYS B HE3   1 
ATOM   8823  H  HZ1   . LYS D 1 160 ? 20.640  -21.761 11.855  1.00 39.49 ? 160 LYS B HZ1   1 
ATOM   8824  H  HZ2   . LYS D 1 160 ? 19.771  -20.889 11.091  1.00 39.49 ? 160 LYS B HZ2   1 
ATOM   8825  H  HZ3   . LYS D 1 160 ? 20.981  -21.412 10.491  1.00 39.49 ? 160 LYS B HZ3   1 
ATOM   8826  N  N     . PRO D 1 161 ? 27.618  -18.546 14.527  1.00 28.27 ? 161 PRO B N     1 
ATOM   8827  C  CA    . PRO D 1 161 ? 26.689  -18.696 15.648  1.00 29.76 ? 161 PRO B CA    1 
ATOM   8828  C  C     . PRO D 1 161 ? 26.746  -17.496 16.590  1.00 27.71 ? 161 PRO B C     1 
ATOM   8829  O  O     . PRO D 1 161 ? 27.695  -16.711 16.527  1.00 27.82 ? 161 PRO B O     1 
ATOM   8830  C  CB    . PRO D 1 161 ? 27.231  -19.935 16.345  1.00 37.01 ? 161 PRO B CB    1 
ATOM   8831  C  CG    . PRO D 1 161 ? 28.711  -19.833 16.153  1.00 39.59 ? 161 PRO B CG    1 
ATOM   8832  C  CD    . PRO D 1 161 ? 28.943  -19.107 14.850  1.00 44.28 ? 161 PRO B CD    1 
ATOM   8833  H  HA    . PRO D 1 161 ? 25.772  -18.850 15.337  1.00 35.65 ? 161 PRO B HA    1 
ATOM   8834  H  HB2   . PRO D 1 161 ? 27.000  -19.913 17.287  1.00 44.35 ? 161 PRO B HB2   1 
ATOM   8835  H  HB3   . PRO D 1 161 ? 26.881  -20.734 15.920  1.00 44.35 ? 161 PRO B HB3   1 
ATOM   8836  H  HG2   . PRO D 1 161 ? 29.096  -19.333 16.890  1.00 47.45 ? 161 PRO B HG2   1 
ATOM   8837  H  HG3   . PRO D 1 161 ? 29.093  -20.724 16.115  1.00 47.45 ? 161 PRO B HG3   1 
ATOM   8838  H  HD2   . PRO D 1 161 ? 29.591  -18.395 14.970  1.00 53.07 ? 161 PRO B HD2   1 
ATOM   8839  H  HD3   . PRO D 1 161 ? 29.223  -19.730 14.161  1.00 53.07 ? 161 PRO B HD3   1 
ATOM   8840  N  N     . ASN D 1 162 ? 25.718  -17.324 17.412  1.00 22.35 ? 162 ASN B N     1 
ATOM   8841  C  CA    . ASN D 1 162 ? 25.694  -16.247 18.391  1.00 26.02 ? 162 ASN B CA    1 
ATOM   8842  C  C     . ASN D 1 162 ? 25.944  -14.878 17.773  1.00 24.37 ? 162 ASN B C     1 
ATOM   8843  O  O     . ASN D 1 162 ? 26.697  -14.065 18.312  1.00 34.76 ? 162 ASN B O     1 
ATOM   8844  C  CB    . ASN D 1 162 ? 26.736  -16.495 19.486  1.00 31.48 ? 162 ASN B CB    1 
ATOM   8845  C  CG    . ASN D 1 162 ? 26.478  -15.664 20.735  1.00 33.78 ? 162 ASN B CG    1 
ATOM   8846  O  OD1   . ASN D 1 162 ? 25.458  -14.966 20.852  1.00 33.37 ? 162 ASN B OD1   1 
ATOM   8847  N  ND2   . ASN D 1 162 ? 27.395  -15.747 21.685  1.00 40.40 ? 162 ASN B ND2   1 
ATOM   8848  H  H     . ASN D 1 162 ? 25.017  -17.822 17.423  1.00 26.76 ? 162 ASN B H     1 
ATOM   8849  H  HA    . ASN D 1 162 ? 24.811  -16.227 18.816  1.00 31.16 ? 162 ASN B HA    1 
ATOM   8850  H  HB2   . ASN D 1 162 ? 26.714  -17.432 19.738  1.00 37.72 ? 162 ASN B HB2   1 
ATOM   8851  H  HB3   . ASN D 1 162 ? 27.614  -16.263 19.146  1.00 37.72 ? 162 ASN B HB3   1 
ATOM   8852  H  HD21  . ASN D 1 162 ? 27.301  -15.300 22.413  1.00 48.42 ? 162 ASN B HD21  1 
ATOM   8853  H  HD22  . ASN D 1 162 ? 28.084  -16.249 21.574  1.00 48.42 ? 162 ASN B HD22  1 
ATOM   8854  N  N     . GLY D 1 163 ? 25.320  -14.614 16.644  1.00 25.59 ? 163 GLY B N     1 
ATOM   8855  C  CA    . GLY D 1 163 ? 25.626  -13.404 15.898  1.00 27.41 ? 163 GLY B CA    1 
ATOM   8856  C  C     . GLY D 1 163 ? 24.597  -12.307 16.049  1.00 27.00 ? 163 GLY B C     1 
ATOM   8857  O  O     . GLY D 1 163 ? 23.521  -12.489 16.627  1.00 22.84 ? 163 GLY B O     1 
ATOM   8858  H  H     . GLY D 1 163 ? 24.718  -15.113 16.286  1.00 30.65 ? 163 GLY B H     1 
ATOM   8859  H  HA2   . GLY D 1 163 ? 26.482  -13.057 16.193  1.00 32.84 ? 163 GLY B HA2   1 
ATOM   8860  H  HA3   . GLY D 1 163 ? 25.697  -13.623 14.955  1.00 32.84 ? 163 GLY B HA3   1 
ATOM   8861  N  N     . LEU D 1 164 ? 24.950  -11.150 15.505  1.00 24.68 ? 164 LEU B N     1 
ATOM   8862  C  CA    . LEU D 1 164 ? 24.072  -10.025 15.420  1.00 25.10 ? 164 LEU B CA    1 
ATOM   8863  C  C     . LEU D 1 164 ? 24.381  -9.366  14.102  1.00 32.94 ? 164 LEU B C     1 
ATOM   8864  O  O     . LEU D 1 164 ? 25.277  -8.533  14.016  1.00 32.76 ? 164 LEU B O     1 
ATOM   8865  C  CB    . LEU D 1 164 ? 24.290  -9.061  16.593  1.00 31.42 ? 164 LEU B CB    1 
ATOM   8866  C  CG    . LEU D 1 164 ? 23.045  -8.235  16.935  1.00 38.56 ? 164 LEU B CG    1 
ATOM   8867  C  CD1   . LEU D 1 164 ? 23.258  -7.451  18.225  1.00 44.83 ? 164 LEU B CD1   1 
ATOM   8868  C  CD2   . LEU D 1 164 ? 22.698  -7.293  15.808  1.00 42.17 ? 164 LEU B CD2   1 
ATOM   8869  H  H     . LEU D 1 164 ? 25.727  -11.000 15.168  1.00 29.55 ? 164 LEU B H     1 
ATOM   8870  H  HA    . LEU D 1 164 ? 23.139  -10.325 15.419  1.00 30.06 ? 164 LEU B HA    1 
ATOM   8871  H  HB2   . LEU D 1 164 ? 24.535  -9.573  17.379  1.00 37.64 ? 164 LEU B HB2   1 
ATOM   8872  H  HB3   . LEU D 1 164 ? 25.004  -8.445  16.364  1.00 37.64 ? 164 LEU B HB3   1 
ATOM   8873  H  HG    . LEU D 1 164 ? 22.294  -8.834  17.068  1.00 46.21 ? 164 LEU B HG    1 
ATOM   8874  H  HD11  . LEU D 1 164 ? 23.433  -8.068  18.939  1.00 53.73 ? 164 LEU B HD11  1 
ATOM   8875  H  HD12  . LEU D 1 164 ? 24.006  -6.861  18.111  1.00 53.73 ? 164 LEU B HD12  1 
ATOM   8876  H  HD13  . LEU D 1 164 ? 22.466  -6.944  18.416  1.00 53.73 ? 164 LEU B HD13  1 
ATOM   8877  H  HD21  . LEU D 1 164 ? 22.525  -7.806  15.015  1.00 50.54 ? 164 LEU B HD21  1 
ATOM   8878  H  HD22  . LEU D 1 164 ? 21.917  -6.791  16.050  1.00 50.54 ? 164 LEU B HD22  1 
ATOM   8879  H  HD23  . LEU D 1 164 ? 23.437  -6.699  15.659  1.00 50.54 ? 164 LEU B HD23  1 
ATOM   8880  N  N     . GLY D 1 165 ? 23.657  -9.784  13.069  1.00 24.63 ? 165 GLY B N     1 
ATOM   8881  C  CA    . GLY D 1 165 ? 23.864  -9.290  11.712  1.00 26.55 ? 165 GLY B CA    1 
ATOM   8882  C  C     . GLY D 1 165 ? 22.999  -8.088  11.442  1.00 28.78 ? 165 GLY B C     1 
ATOM   8883  O  O     . GLY D 1 165 ? 21.870  -8.026  11.899  1.00 24.48 ? 165 GLY B O     1 
ATOM   8884  H  H     . GLY D 1 165 ? 23.026  -10.365 13.130  1.00 29.50 ? 165 GLY B H     1 
ATOM   8885  H  HA2   . GLY D 1 165 ? 24.794  -9.039  11.592  1.00 31.80 ? 165 GLY B HA2   1 
ATOM   8886  H  HA3   . GLY D 1 165 ? 23.643  -9.985  11.073  1.00 31.80 ? 165 GLY B HA3   1 
ATOM   8887  N  N     . VAL D 1 166 ? 23.524  -7.126  10.683  1.00 27.28 ? 166 VAL B N     1 
ATOM   8888  C  CA    . VAL D 1 166 ? 22.784  -5.913  10.395  1.00 25.53 ? 166 VAL B CA    1 
ATOM   8889  C  C     . VAL D 1 166 ? 22.916  -5.518  8.917   1.00 27.21 ? 166 VAL B C     1 
ATOM   8890  O  O     . VAL D 1 166 ? 24.008  -5.571  8.350   1.00 23.61 ? 166 VAL B O     1 
ATOM   8891  C  CB    . VAL D 1 166 ? 23.307  -4.757  11.271  1.00 28.61 ? 166 VAL B CB    1 
ATOM   8892  C  CG1   . VAL D 1 166 ? 22.615  -3.451  10.895  1.00 29.76 ? 166 VAL B CG1   1 
ATOM   8893  C  CG2   . VAL D 1 166 ? 23.116  -5.100  12.782  1.00 30.31 ? 166 VAL B CG2   1 
ATOM   8894  H  H     . VAL D 1 166 ? 24.306  -7.157  10.327  1.00 32.68 ? 166 VAL B H     1 
ATOM   8895  H  HA    . VAL D 1 166 ? 21.835  -6.052  10.597  1.00 30.58 ? 166 VAL B HA    1 
ATOM   8896  H  HB    . VAL D 1 166 ? 24.267  -4.646  11.108  1.00 34.27 ? 166 VAL B HB    1 
ATOM   8897  H  HG11  . VAL D 1 166 ? 21.992  -3.622  10.185  1.00 35.65 ? 166 VAL B HG11  1 
ATOM   8898  H  HG12  . VAL D 1 166 ? 22.151  -3.111  11.663  1.00 35.65 ? 166 VAL B HG12  1 
ATOM   8899  H  HG13  . VAL D 1 166 ? 23.277  -2.819  10.605  1.00 35.65 ? 166 VAL B HG13  1 
ATOM   8900  H  HG21  . VAL D 1 166 ? 22.709  -5.966  12.856  1.00 36.31 ? 166 VAL B HG21  1 
ATOM   8901  H  HG22  . VAL D 1 166 ? 23.974  -5.103  13.212  1.00 36.31 ? 166 VAL B HG22  1 
ATOM   8902  H  HG23  . VAL D 1 166 ? 22.550  -4.436  13.183  1.00 36.31 ? 166 VAL B HG23  1 
ATOM   8903  N  N     . ILE D 1 167 ? 21.799  -5.144  8.305   1.00 28.70 ? 167 ILE B N     1 
ATOM   8904  C  CA    . ILE D 1 167 ? 21.809  -4.544  6.974   1.00 26.85 ? 167 ILE B CA    1 
ATOM   8905  C  C     . ILE D 1 167 ? 20.952  -3.276  7.036   1.00 28.97 ? 167 ILE B C     1 
ATOM   8906  O  O     . ILE D 1 167 ? 19.740  -3.338  7.212   1.00 23.65 ? 167 ILE B O     1 
ATOM   8907  C  CB    . ILE D 1 167 ? 21.288  -5.512  5.903   1.00 33.21 ? 167 ILE B CB    1 
ATOM   8908  C  CG1   . ILE D 1 167 ? 22.138  -6.784  5.889   1.00 31.97 ? 167 ILE B CG1   1 
ATOM   8909  C  CG2   . ILE D 1 167 ? 21.320  -4.868  4.523   1.00 36.55 ? 167 ILE B CG2   1 
ATOM   8910  C  CD1   . ILE D 1 167 ? 21.523  -7.901  4.998   1.00 37.54 ? 167 ILE B CD1   1 
ATOM   8911  H  H     . ILE D 1 167 ? 21.013  -5.229  8.642   1.00 34.37 ? 167 ILE B H     1 
ATOM   8912  H  HA    . ILE D 1 167 ? 22.725  -4.287  6.739   1.00 32.16 ? 167 ILE B HA    1 
ATOM   8913  H  HB    . ILE D 1 167 ? 20.372  -5.751  6.115   1.00 39.79 ? 167 ILE B HB    1 
ATOM   8914  H  HG12  . ILE D 1 167 ? 23.018  -6.572  5.541   1.00 38.30 ? 167 ILE B HG12  1 
ATOM   8915  H  HG13  . ILE D 1 167 ? 22.210  -7.126  6.793   1.00 38.30 ? 167 ILE B HG13  1 
ATOM   8916  H  HG21  . ILE D 1 167 ? 22.225  -4.627  4.313   1.00 43.79 ? 167 ILE B HG21  1 
ATOM   8917  H  HG22  . ILE D 1 167 ? 20.989  -5.497  3.878   1.00 43.79 ? 167 ILE B HG22  1 
ATOM   8918  H  HG23  . ILE D 1 167 ? 20.765  -4.084  4.532   1.00 43.79 ? 167 ILE B HG23  1 
ATOM   8919  H  HD11  . ILE D 1 167 ? 21.452  -7.578  4.097   1.00 44.98 ? 167 ILE B HD11  1 
ATOM   8920  H  HD12  . ILE D 1 167 ? 22.094  -8.672  5.025   1.00 44.98 ? 167 ILE B HD12  1 
ATOM   8921  H  HD13  . ILE D 1 167 ? 20.653  -8.126  5.335   1.00 44.98 ? 167 ILE B HD13  1 
ATOM   8922  N  N     . ARG D 1 168 ? 21.598  -2.122  6.924   1.00 29.79 ? 168 ARG B N     1 
ATOM   8923  C  CA    . ARG D 1 168 ? 20.899  -0.854  7.019   1.00 36.70 ? 168 ARG B CA    1 
ATOM   8924  C  C     . ARG D 1 168 ? 20.200  -0.539  5.731   1.00 35.26 ? 168 ARG B C     1 
ATOM   8925  O  O     . ARG D 1 168 ? 20.590  -1.035  4.682   1.00 33.08 ? 168 ARG B O     1 
ATOM   8926  C  CB    . ARG D 1 168 ? 21.877  0.264   7.365   1.00 38.97 ? 168 ARG B CB    1 
ATOM   8927  C  CG    . ARG D 1 168 ? 22.437  0.119   8.762   1.00 35.33 ? 168 ARG B CG    1 
ATOM   8928  C  CD    . ARG D 1 168 ? 23.468  1.192   9.081   1.00 44.66 ? 168 ARG B CD    1 
ATOM   8929  N  NE    . ARG D 1 168 ? 23.809  1.186   10.501  1.00 46.99 ? 168 ARG B NE    1 
ATOM   8930  C  CZ    . ARG D 1 168 ? 24.680  0.351   11.061  1.00 56.76 ? 168 ARG B CZ    1 
ATOM   8931  N  NH1   . ARG D 1 168 ? 25.315  -0.553  10.322  1.00 51.17 ? 168 ARG B NH1   1 
ATOM   8932  N  NH2   . ARG D 1 168 ? 24.914  0.422   12.365  1.00 47.85 ? 168 ARG B NH2   1 
ATOM   8933  H  H     . ARG D 1 168 ? 22.445  -2.048  6.791   1.00 35.69 ? 168 ARG B H     1 
ATOM   8934  H  HA    . ARG D 1 168 ? 20.227  -0.907  7.731   1.00 43.98 ? 168 ARG B HA    1 
ATOM   8935  H  HB2   . ARG D 1 168 ? 22.617  0.244   6.739   1.00 46.71 ? 168 ARG B HB2   1 
ATOM   8936  H  HB3   . ARG D 1 168 ? 21.417  1.116   7.311   1.00 46.71 ? 168 ARG B HB3   1 
ATOM   8937  H  HG2   . ARG D 1 168 ? 21.714  0.195   9.404   1.00 42.33 ? 168 ARG B HG2   1 
ATOM   8938  H  HG3   . ARG D 1 168 ? 22.867  -0.747  8.844   1.00 42.33 ? 168 ARG B HG3   1 
ATOM   8939  H  HD2   . ARG D 1 168 ? 24.276  1.024   8.571   1.00 53.54 ? 168 ARG B HD2   1 
ATOM   8940  H  HD3   . ARG D 1 168 ? 23.104  2.064   8.858   1.00 53.54 ? 168 ARG B HD3   1 
ATOM   8941  H  HE    . ARG D 1 168 ? 23.421  1.760   11.009  1.00 56.33 ? 168 ARG B HE    1 
ATOM   8942  H  HH11  . ARG D 1 168 ? 25.163  -0.602  9.477   1.00 61.34 ? 168 ARG B HH11  1 
ATOM   8943  H  HH12  . ARG D 1 168 ? 25.878  -1.090  10.689  1.00 61.34 ? 168 ARG B HH12  1 
ATOM   8944  H  HH21  . ARG D 1 168 ? 24.505  1.008   12.844  1.00 57.36 ? 168 ARG B HH21  1 
ATOM   8945  H  HH22  . ARG D 1 168 ? 25.478  -0.114  12.730  1.00 57.36 ? 168 ARG B HH22  1 
ATOM   8946  N  N     . PRO D 1 169 ? 19.160  0.297   5.803   1.00 31.09 ? 169 PRO B N     1 
ATOM   8947  C  CA    . PRO D 1 169 ? 18.445  0.639   4.580   1.00 33.31 ? 169 PRO B CA    1 
ATOM   8948  C  C     . PRO D 1 169 ? 19.395  1.069   3.473   1.00 44.44 ? 169 PRO B C     1 
ATOM   8949  O  O     . PRO D 1 169 ? 19.174  0.709   2.329   1.00 35.55 ? 169 PRO B O     1 
ATOM   8950  C  CB    . PRO D 1 169 ? 17.552  1.796   5.021   1.00 42.59 ? 169 PRO B CB    1 
ATOM   8951  C  CG    . PRO D 1 169 ? 17.255  1.485   6.439   1.00 37.29 ? 169 PRO B CG    1 
ATOM   8952  C  CD    . PRO D 1 169 ? 18.542  0.917   6.988   1.00 34.31 ? 169 PRO B CD    1 
ATOM   8953  H  HA    . PRO D 1 169 ? 17.893  -0.112  4.275   1.00 39.91 ? 169 PRO B HA    1 
ATOM   8954  H  HB2   . PRO D 1 169 ? 18.032  2.635   4.941   1.00 51.05 ? 169 PRO B HB2   1 
ATOM   8955  H  HB3   . PRO D 1 169 ? 16.739  1.808   4.490   1.00 51.05 ? 169 PRO B HB3   1 
ATOM   8956  H  HG2   . PRO D 1 169 ? 17.011  2.298   6.908   1.00 44.69 ? 169 PRO B HG2   1 
ATOM   8957  H  HG3   . PRO D 1 169 ? 16.541  0.831   6.488   1.00 44.69 ? 169 PRO B HG3   1 
ATOM   8958  H  HD2   . PRO D 1 169 ? 19.106  1.626   7.333   1.00 41.11 ? 169 PRO B HD2   1 
ATOM   8959  H  HD3   . PRO D 1 169 ? 18.355  0.247   7.664   1.00 41.11 ? 169 PRO B HD3   1 
ATOM   8960  N  N     . THR D 1 170 ? 20.457  1.788   3.826   1.00 40.25 ? 170 THR B N     1 
ATOM   8961  C  CA    . THR D 1 170 ? 21.346  2.372   2.833   1.00 51.71 ? 170 THR B CA    1 
ATOM   8962  C  C     . THR D 1 170 ? 22.262  1.328   2.217   1.00 48.38 ? 170 THR B C     1 
ATOM   8963  O  O     . THR D 1 170 ? 22.837  1.558   1.151   1.00 40.36 ? 170 THR B O     1 
ATOM   8964  C  CB    . THR D 1 170 ? 22.196  3.504   3.444   1.00 46.97 ? 170 THR B CB    1 
ATOM   8965  O  OG1   . THR D 1 170 ? 22.965  2.991   4.531   1.00 51.97 ? 170 THR B OG1   1 
ATOM   8966  C  CG2   . THR D 1 170 ? 21.308  4.628   3.958   1.00 51.77 ? 170 THR B CG2   1 
ATOM   8967  H  H     . THR D 1 170 ? 20.683  1.952   4.639   1.00 48.24 ? 170 THR B H     1 
ATOM   8968  H  HA    . THR D 1 170 ? 20.805  2.758   2.113   1.00 61.99 ? 170 THR B HA    1 
ATOM   8969  H  HB    . THR D 1 170 ? 22.790  3.865   2.768   1.00 56.30 ? 170 THR B HB    1 
ATOM   8970  H  HG1   . THR D 1 170 ? 23.420  3.589   4.860   1.00 62.30 ? 170 THR B HG1   1 
ATOM   8971  H  HG21  . THR D 1 170 ? 21.848  5.326   4.336   1.00 62.06 ? 170 THR B HG21  1 
ATOM   8972  H  HG22  . THR D 1 170 ? 20.788  4.991   3.238   1.00 62.06 ? 170 THR B HG22  1 
ATOM   8973  H  HG23  . THR D 1 170 ? 20.714  4.294   4.634   1.00 62.06 ? 170 THR B HG23  1 
ATOM   8974  N  N     . GLU D 1 171 ? 22.373  0.179   2.880   1.00 38.04 ? 171 GLU B N     1 
ATOM   8975  C  CA    . GLU D 1 171 ? 23.255  -0.902  2.439   1.00 41.65 ? 171 GLU B CA    1 
ATOM   8976  C  C     . GLU D 1 171 ? 22.523  -1.934  1.571   1.00 33.53 ? 171 GLU B C     1 
ATOM   8977  O  O     . GLU D 1 171 ? 23.153  -2.787  0.960   1.00 35.77 ? 171 GLU B O     1 
ATOM   8978  C  CB    . GLU D 1 171 ? 23.869  -1.603  3.655   1.00 44.29 ? 171 GLU B CB    1 
ATOM   8979  C  CG    . GLU D 1 171 ? 24.730  -0.693  4.537   1.00 43.27 ? 171 GLU B CG    1 
ATOM   8980  C  CD    . GLU D 1 171 ? 25.042  -1.289  5.916   1.00 55.76 ? 171 GLU B CD    1 
ATOM   8981  O  OE1   . GLU D 1 171 ? 24.156  -1.952  6.502   1.00 39.97 ? 171 GLU B OE1   1 
ATOM   8982  O  OE2   . GLU D 1 171 ? 26.176  -1.084  6.421   1.00 59.01 ? 171 GLU B OE2   1 
ATOM   8983  H  H     . GLU D 1 171 ? 21.941  -0.002  3.602   1.00 45.58 ? 171 GLU B H     1 
ATOM   8984  H  HA    . GLU D 1 171 ? 23.985  -0.521  1.908   1.00 49.92 ? 171 GLU B HA    1 
ATOM   8985  H  HB2   . GLU D 1 171 ? 23.153  -1.956  4.206   1.00 53.09 ? 171 GLU B HB2   1 
ATOM   8986  H  HB3   . GLU D 1 171 ? 24.431  -2.330  3.344   1.00 53.09 ? 171 GLU B HB3   1 
ATOM   8987  H  HG2   . GLU D 1 171 ? 25.573  -0.527  4.087   1.00 51.86 ? 171 GLU B HG2   1 
ATOM   8988  H  HG3   . GLU D 1 171 ? 24.260  0.145   4.675   1.00 51.86 ? 171 GLU B HG3   1 
ATOM   8989  N  N     . VAL D 1 172 ? 21.199  -1.866  1.522   1.00 32.45 ? 172 VAL B N     1 
ATOM   8990  C  CA    . VAL D 1 172 ? 20.425  -2.914  0.861   1.00 31.78 ? 172 VAL B CA    1 
ATOM   8991  C  C     . VAL D 1 172 ? 20.811  -3.100  -0.608  1.00 38.16 ? 172 VAL B C     1 
ATOM   8992  O  O     . VAL D 1 172 ? 20.986  -4.230  -1.056  1.00 31.28 ? 172 VAL B O     1 
ATOM   8993  C  CB    . VAL D 1 172 ? 18.907  -2.654  0.962   1.00 34.12 ? 172 VAL B CB    1 
ATOM   8994  C  CG1   . VAL D 1 172 ? 18.128  -3.613  0.072   1.00 40.97 ? 172 VAL B CG1   1 
ATOM   8995  C  CG2   . VAL D 1 172 ? 18.440  -2.755  2.433   1.00 34.35 ? 172 VAL B CG2   1 
ATOM   8996  H  H     . VAL D 1 172 ? 20.726  -1.232  1.859   1.00 38.88 ? 172 VAL B H     1 
ATOM   8997  H  HA    . VAL D 1 172 ? 20.606  -3.762  1.318   1.00 38.07 ? 172 VAL B HA    1 
ATOM   8998  H  HB    . VAL D 1 172 ? 18.722  -1.743  0.652   1.00 40.89 ? 172 VAL B HB    1 
ATOM   8999  H  HG11  . VAL D 1 172 ? 17.190  -3.426  0.158   1.00 49.11 ? 172 VAL B HG11  1 
ATOM   9000  H  HG12  . VAL D 1 172 ? 18.406  -3.489  -0.838  1.00 49.11 ? 172 VAL B HG12  1 
ATOM   9001  H  HG13  . VAL D 1 172 ? 18.309  -4.514  0.351   1.00 49.11 ? 172 VAL B HG13  1 
ATOM   9002  H  HG21  . VAL D 1 172 ? 19.197  -2.960  2.987   1.00 41.16 ? 172 VAL B HG21  1 
ATOM   9003  H  HG22  . VAL D 1 172 ? 18.058  -1.915  2.698   1.00 41.16 ? 172 VAL B HG22  1 
ATOM   9004  H  HG23  . VAL D 1 172 ? 17.783  -3.451  2.506   1.00 41.16 ? 172 VAL B HG23  1 
ATOM   9005  N  N     . GLN D 1 173 ? 20.921  -2.004  -1.363  1.00 41.59 ? 173 GLN B N     1 
ATOM   9006  C  CA    . GLN D 1 173 ? 21.205  -2.117  -2.801  1.00 48.36 ? 173 GLN B CA    1 
ATOM   9007  C  C     . GLN D 1 173 ? 22.522  -2.841  -3.060  1.00 33.78 ? 173 GLN B C     1 
ATOM   9008  O  O     . GLN D 1 173 ? 22.558  -3.829  -3.804  1.00 38.49 ? 173 GLN B O     1 
ATOM   9009  C  CB    . GLN D 1 173 ? 21.188  -0.746  -3.506  1.00 43.01 ? 173 GLN B CB    1 
ATOM   9010  C  CG    . GLN D 1 173 ? 19.773  -0.257  -3.843  1.00 52.53 ? 173 GLN B CG    1 
ATOM   9011  C  CD    . GLN D 1 173 ? 19.724  0.698   -5.042  1.00 65.65 ? 173 GLN B CD    1 
ATOM   9012  O  OE1   . GLN D 1 173 ? 20.738  0.929   -5.726  1.00 66.07 ? 173 GLN B OE1   1 
ATOM   9013  N  NE2   . GLN D 1 173 ? 18.532  1.254   -5.304  1.00 61.07 ? 173 GLN B NE2   1 
ATOM   9014  H  H     . GLN D 1 173 ? 20.839  -1.197  -1.076  1.00 49.84 ? 173 GLN B H     1 
ATOM   9015  H  HA    . GLN D 1 173 ? 20.496  -2.657  -3.208  1.00 57.98 ? 173 GLN B HA    1 
ATOM   9016  H  HB2   . GLN D 1 173 ? 21.600  -0.088  -2.924  1.00 51.56 ? 173 GLN B HB2   1 
ATOM   9017  H  HB3   . GLN D 1 173 ? 21.686  -0.812  -4.335  1.00 51.56 ? 173 GLN B HB3   1 
ATOM   9018  H  HG2   . GLN D 1 173 ? 19.218  -1.024  -4.051  1.00 62.98 ? 173 GLN B HG2   1 
ATOM   9019  H  HG3   . GLN D 1 173 ? 19.412  0.212   -3.075  1.00 62.98 ? 173 GLN B HG3   1 
ATOM   9020  H  HE21  . GLN D 1 173 ? 17.852  1.067   -4.811  1.00 73.22 ? 173 GLN B HE21  1 
ATOM   9021  H  HE22  . GLN D 1 173 ? 18.447  1.798   -5.965  1.00 73.22 ? 173 GLN B HE22  1 
ATOM   9022  N  N     . ASP D 1 174 ? 23.599  -2.372  -2.441  1.00 40.30 ? 174 ASP B N     1 
ATOM   9023  C  CA    . ASP D 1 174 ? 24.891  -3.031  -2.604  1.00 40.26 ? 174 ASP B CA    1 
ATOM   9024  C  C     . ASP D 1 174 ? 24.845  -4.487  -2.108  1.00 46.99 ? 174 ASP B C     1 
ATOM   9025  O  O     . ASP D 1 174 ? 25.413  -5.399  -2.724  1.00 40.03 ? 174 ASP B O     1 
ATOM   9026  C  CB    . ASP D 1 174 ? 25.993  -2.258  -1.868  1.00 40.56 ? 174 ASP B CB    1 
ATOM   9027  C  CG    . ASP D 1 174 ? 26.074  -0.773  -2.291  1.00 45.32 ? 174 ASP B CG    1 
ATOM   9028  O  OD1   . ASP D 1 174 ? 25.749  -0.437  -3.466  1.00 50.33 ? 174 ASP B OD1   1 
ATOM   9029  O  OD2   . ASP D 1 174 ? 26.462  0.060   -1.429  1.00 57.42 ? 174 ASP B OD2   1 
ATOM   9030  H  H     . ASP D 1 174 ? 23.610  -1.683  -1.928  1.00 48.30 ? 174 ASP B H     1 
ATOM   9031  H  HA    . ASP D 1 174 ? 25.121  -3.046  -3.556  1.00 48.26 ? 174 ASP B HA    1 
ATOM   9032  H  HB2   . ASP D 1 174 ? 25.816  -2.289  -0.915  1.00 48.61 ? 174 ASP B HB2   1 
ATOM   9033  H  HB3   . ASP D 1 174 ? 26.849  -2.671  -2.060  1.00 48.61 ? 174 ASP B HB3   1 
ATOM   9034  N  N     . PHE D 1 175 ? 24.169  -4.718  -0.989  1.00 38.58 ? 175 PHE B N     1 
ATOM   9035  C  CA    . PHE D 1 175 ? 24.074  -6.074  -0.468  1.00 33.01 ? 175 PHE B CA    1 
ATOM   9036  C  C     . PHE D 1 175 ? 23.384  -7.030  -1.464  1.00 31.78 ? 175 PHE B C     1 
ATOM   9037  O  O     . PHE D 1 175 ? 23.848  -8.144  -1.691  1.00 34.84 ? 175 PHE B O     1 
ATOM   9038  C  CB    . PHE D 1 175 ? 23.351  -6.076  0.882   1.00 36.66 ? 175 PHE B CB    1 
ATOM   9039  C  CG    . PHE D 1 175 ? 23.340  -7.412  1.534   1.00 27.47 ? 175 PHE B CG    1 
ATOM   9040  C  CD1   . PHE D 1 175 ? 24.420  -7.831  2.297   1.00 32.74 ? 175 PHE B CD1   1 
ATOM   9041  C  CD2   . PHE D 1 175 ? 22.282  -8.272  1.347   1.00 33.43 ? 175 PHE B CD2   1 
ATOM   9042  C  CE1   . PHE D 1 175 ? 24.417  -9.076  2.902   1.00 37.50 ? 175 PHE B CE1   1 
ATOM   9043  C  CE2   . PHE D 1 175 ? 22.276  -9.516  1.947   1.00 34.89 ? 175 PHE B CE2   1 
ATOM   9044  C  CZ    . PHE D 1 175 ? 23.346  -9.916  2.726   1.00 35.03 ? 175 PHE B CZ    1 
ATOM   9045  H  H     . PHE D 1 175 ? 23.765  -4.120  -0.521  1.00 46.24 ? 175 PHE B H     1 
ATOM   9046  H  HA    . PHE D 1 175 ? 24.981  -6.412  -0.316  1.00 39.55 ? 175 PHE B HA    1 
ATOM   9047  H  HB2   . PHE D 1 175 ? 23.798  -5.455  1.479   1.00 43.94 ? 175 PHE B HB2   1 
ATOM   9048  H  HB3   . PHE D 1 175 ? 22.431  -5.801  0.747   1.00 43.94 ? 175 PHE B HB3   1 
ATOM   9049  H  HD1   . PHE D 1 175 ? 25.142  -7.259  2.426   1.00 39.23 ? 175 PHE B HD1   1 
ATOM   9050  H  HD2   . PHE D 1 175 ? 21.556  -8.005  0.832   1.00 40.05 ? 175 PHE B HD2   1 
ATOM   9051  H  HE1   . PHE D 1 175 ? 25.140  -9.345  3.422   1.00 44.94 ? 175 PHE B HE1   1 
ATOM   9052  H  HE2   . PHE D 1 175 ? 21.552  -10.086 1.825   1.00 41.81 ? 175 PHE B HE2   1 
ATOM   9053  H  HZ    . PHE D 1 175 ? 23.344  -10.757 3.123   1.00 41.97 ? 175 PHE B HZ    1 
ATOM   9054  N  N     . LEU D 1 176 ? 22.271  -6.600  -2.045  1.00 33.71 ? 176 LEU B N     1 
ATOM   9055  C  CA    . LEU D 1 176 ? 21.531  -7.442  -2.990  1.00 36.79 ? 176 LEU B CA    1 
ATOM   9056  C  C     . LEU D 1 176 ? 22.349  -7.623  -4.257  1.00 40.83 ? 176 LEU B C     1 
ATOM   9057  O  O     . LEU D 1 176 ? 22.268  -8.642  -4.937  1.00 40.37 ? 176 LEU B O     1 
ATOM   9058  C  CB    . LEU D 1 176 ? 20.202  -6.795  -3.352  1.00 40.10 ? 176 LEU B CB    1 
ATOM   9059  C  CG    . LEU D 1 176 ? 19.112  -6.839  -2.287  1.00 39.87 ? 176 LEU B CG    1 
ATOM   9060  C  CD1   . LEU D 1 176 ? 17.875  -6.119  -2.776  1.00 35.58 ? 176 LEU B CD1   1 
ATOM   9061  C  CD2   . LEU D 1 176 ? 18.801  -8.273  -1.933  1.00 29.84 ? 176 LEU B CD2   1 
ATOM   9062  H  H     . LEU D 1 176 ? 21.919  -5.827  -1.912  1.00 40.40 ? 176 LEU B H     1 
ATOM   9063  H  HA    . LEU D 1 176 ? 21.360  -8.321  -2.592  1.00 44.08 ? 176 LEU B HA    1 
ATOM   9064  H  HB2   . LEU D 1 176 ? 20.365  -5.862  -3.559  1.00 48.06 ? 176 LEU B HB2   1 
ATOM   9065  H  HB3   . LEU D 1 176 ? 19.853  -7.241  -4.140  1.00 48.06 ? 176 LEU B HB3   1 
ATOM   9066  H  HG    . LEU D 1 176 ? 19.428  -6.390  -1.487  1.00 47.78 ? 176 LEU B HG    1 
ATOM   9067  H  HD11  . LEU D 1 176 ? 18.100  -5.205  -2.965  1.00 42.63 ? 176 LEU B HD11  1 
ATOM   9068  H  HD12  . LEU D 1 176 ? 17.558  -6.549  -3.574  1.00 42.63 ? 176 LEU B HD12  1 
ATOM   9069  H  HD13  . LEU D 1 176 ? 17.201  -6.156  -2.094  1.00 42.63 ? 176 LEU B HD13  1 
ATOM   9070  H  HD21  . LEU D 1 176 ? 19.596  -8.691  -1.596  1.00 35.75 ? 176 LEU B HD21  1 
ATOM   9071  H  HD22  . LEU D 1 176 ? 18.114  -8.287  -1.263  1.00 35.75 ? 176 LEU B HD22  1 
ATOM   9072  H  HD23  . LEU D 1 176 ? 18.499  -8.730  -2.721  1.00 35.75 ? 176 LEU B HD23  1 
ATOM   9073  N  N     . ASN D 1 177 ? 23.136  -6.608  -4.570  1.00 39.27 ? 177 ASN B N     1 
ATOM   9074  C  CA    . ASN D 1 177 ? 23.956  -6.628  -5.769  1.00 51.44 ? 177 ASN B CA    1 
ATOM   9075  C  C     . ASN D 1 177 ? 25.084  -7.659  -5.664  1.00 48.53 ? 177 ASN B C     1 
ATOM   9076  O  O     . ASN D 1 177 ? 25.601  -8.134  -6.670  1.00 51.91 ? 177 ASN B O     1 
ATOM   9077  C  CB    . ASN D 1 177 ? 24.520  -5.229  -6.031  1.00 48.80 ? 177 ASN B CB    1 
ATOM   9078  C  CG    . ASN D 1 177 ? 24.978  -5.050  -7.458  1.00 60.24 ? 177 ASN B CG    1 
ATOM   9079  O  OD1   . ASN D 1 177 ? 24.297  -5.476  -8.393  1.00 54.57 ? 177 ASN B OD1   1 
ATOM   9080  N  ND2   . ASN D 1 177 ? 26.147  -4.437  -7.638  1.00 59.25 ? 177 ASN B ND2   1 
ATOM   9081  H  H     . ASN D 1 177 ? 23.214  -5.891  -4.102  1.00 47.06 ? 177 ASN B H     1 
ATOM   9082  H  HA    . ASN D 1 177 ? 23.394  -6.874  -6.533  1.00 61.67 ? 177 ASN B HA    1 
ATOM   9083  H  HB2   . ASN D 1 177 ? 23.832  -4.570  -5.851  1.00 58.50 ? 177 ASN B HB2   1 
ATOM   9084  H  HB3   . ASN D 1 177 ? 25.283  -5.081  -5.449  1.00 58.50 ? 177 ASN B HB3   1 
ATOM   9085  H  HD21  . ASN D 1 177 ? 26.449  -4.313  -8.433  1.00 71.04 ? 177 ASN B HD21  1 
ATOM   9086  H  HD22  . ASN D 1 177 ? 26.600  -4.166  -6.959  1.00 71.04 ? 177 ASN B HD22  1 
ATOM   9087  N  N     . GLU D 1 178 ? 25.464  -8.027  -4.448  1.00 41.21 ? 178 GLU B N     1 
ATOM   9088  C  CA    . GLU D 1 178 ? 26.568  -8.961  -4.293  1.00 38.93 ? 178 GLU B CA    1 
ATOM   9089  C  C     . GLU D 1 178 ? 26.122  -10.332 -3.787  1.00 39.56 ? 178 GLU B C     1 
ATOM   9090  O  O     . GLU D 1 178 ? 26.909  -11.271 -3.727  1.00 38.97 ? 178 GLU B O     1 
ATOM   9091  C  CB    . GLU D 1 178 ? 27.634  -8.361  -3.370  1.00 47.56 ? 178 GLU B CB    1 
ATOM   9092  C  CG    . GLU D 1 178 ? 28.214  -7.021  -3.871  1.00 57.37 ? 178 GLU B CG    1 
ATOM   9093  C  CD    . GLU D 1 178 ? 28.893  -7.122  -5.236  1.00 66.54 ? 178 GLU B CD    1 
ATOM   9094  O  OE1   . GLU D 1 178 ? 29.272  -8.249  -5.636  1.00 68.95 ? 178 GLU B OE1   1 
ATOM   9095  O  OE2   . GLU D 1 178 ? 29.045  -6.074  -5.912  1.00 67.32 ? 178 GLU B OE2   1 
ATOM   9096  H  H     . GLU D 1 178 ? 25.109  -7.757  -3.713  1.00 49.39 ? 178 GLU B H     1 
ATOM   9097  H  HA    . GLU D 1 178 ? 26.983  -9.095  -5.171  1.00 46.65 ? 178 GLU B HA    1 
ATOM   9098  H  HB2   . GLU D 1 178 ? 27.239  -8.205  -2.498  1.00 57.01 ? 178 GLU B HB2   1 
ATOM   9099  H  HB3   . GLU D 1 178 ? 28.368  -8.990  -3.291  1.00 57.01 ? 178 GLU B HB3   1 
ATOM   9100  H  HG2   . GLU D 1 178 ? 27.493  -6.376  -3.944  1.00 68.78 ? 178 GLU B HG2   1 
ATOM   9101  H  HG3   . GLU D 1 178 ? 28.873  -6.707  -3.233  1.00 68.78 ? 178 GLU B HG3   1 
ATOM   9102  N  N     . LEU D 1 179 ? 24.852  -10.461 -3.438  1.00 38.91 ? 179 LEU B N     1 
ATOM   9103  C  CA    . LEU D 1 179 ? 24.370  -11.702 -2.849  1.00 34.57 ? 179 LEU B CA    1 
ATOM   9104  C  C     . LEU D 1 179 ? 24.497  -12.891 -3.804  1.00 35.22 ? 179 LEU B C     1 
ATOM   9105  O  O     . LEU D 1 179 ? 24.081  -12.821 -4.961  1.00 34.71 ? 179 LEU B O     1 
ATOM   9106  C  CB    . LEU D 1 179 ? 22.916  -11.513 -2.396  1.00 28.89 ? 179 LEU B CB    1 
ATOM   9107  C  CG    . LEU D 1 179 ? 22.290  -12.614 -1.540  1.00 38.88 ? 179 LEU B CG    1 
ATOM   9108  C  CD1   . LEU D 1 179 ? 23.078  -12.839 -0.265  1.00 40.74 ? 179 LEU B CD1   1 
ATOM   9109  C  CD2   . LEU D 1 179 ? 20.848  -12.244 -1.223  1.00 36.16 ? 179 LEU B CD2   1 
ATOM   9110  H  H     . LEU D 1 179 ? 24.252  -9.852  -3.529  1.00 46.63 ? 179 LEU B H     1 
ATOM   9111  H  HA    . LEU D 1 179 ? 24.907  -11.901 -2.054  1.00 41.43 ? 179 LEU B HA    1 
ATOM   9112  H  HB2   . LEU D 1 179 ? 22.867  -10.693 -1.881  1.00 34.61 ? 179 LEU B HB2   1 
ATOM   9113  H  HB3   . LEU D 1 179 ? 22.365  -11.423 -3.189  1.00 34.61 ? 179 LEU B HB3   1 
ATOM   9114  H  HG    . LEU D 1 179 ? 22.285  -13.444 -2.043  1.00 46.59 ? 179 LEU B HG    1 
ATOM   9115  H  HD11  . LEU D 1 179 ? 23.091  -12.024 0.241   1.00 48.83 ? 179 LEU B HD11  1 
ATOM   9116  H  HD12  . LEU D 1 179 ? 22.656  -13.535 0.244   1.00 48.83 ? 179 LEU B HD12  1 
ATOM   9117  H  HD13  . LEU D 1 179 ? 23.974  -13.097 -0.494  1.00 48.83 ? 179 LEU B HD13  1 
ATOM   9118  H  HD21  . LEU D 1 179 ? 20.360  -12.154 -2.045  1.00 43.33 ? 179 LEU B HD21  1 
ATOM   9119  H  HD22  . LEU D 1 179 ? 20.459  -12.938 -0.685  1.00 43.33 ? 179 LEU B HD22  1 
ATOM   9120  H  HD23  . LEU D 1 179 ? 20.837  -11.413 -0.742  1.00 43.33 ? 179 LEU B HD23  1 
ATOM   9121  N  N     . ASP D 1 180 ? 25.072  -13.981 -3.299  1.00 39.92 ? 180 ASP B N     1 
ATOM   9122  C  CA    . ASP D 1 180 ? 25.163  -15.246 -4.033  1.00 39.37 ? 180 ASP B CA    1 
ATOM   9123  C  C     . ASP D 1 180 ? 23.842  -16.001 -4.077  1.00 48.19 ? 180 ASP B C     1 
ATOM   9124  O  O     . ASP D 1 180 ? 23.065  -16.016 -3.122  1.00 35.90 ? 180 ASP B O     1 
ATOM   9125  C  CB    . ASP D 1 180 ? 26.217  -16.154 -3.392  1.00 52.61 ? 180 ASP B CB    1 
ATOM   9126  C  CG    . ASP D 1 180 ? 27.521  -16.204 -4.179  1.00 60.02 ? 180 ASP B CG    1 
ATOM   9127  O  OD1   . ASP D 1 180 ? 27.700  -15.399 -5.114  1.00 54.28 ? 180 ASP B OD1   1 
ATOM   9128  O  OD2   . ASP D 1 180 ? 28.374  -17.054 -3.848  1.00 63.40 ? 180 ASP B OD2   1 
ATOM   9129  H  H     . ASP D 1 180 ? 25.426  -14.015 -2.516  1.00 47.85 ? 180 ASP B H     1 
ATOM   9130  H  HA    . ASP D 1 180 ? 25.440  -15.062 -4.955  1.00 47.18 ? 180 ASP B HA    1 
ATOM   9131  H  HB2   . ASP D 1 180 ? 26.417  -15.825 -2.502  1.00 63.07 ? 180 ASP B HB2   1 
ATOM   9132  H  HB3   . ASP D 1 180 ? 25.865  -17.057 -3.340  1.00 63.07 ? 180 ASP B HB3   1 
ATOM   9133  N  N     . ILE D 1 181 ? 23.605  -16.651 -5.200  1.00 42.66 ? 181 ILE B N     1 
ATOM   9134  C  CA    . ILE D 1 181 ? 22.387  -17.401 -5.398  1.00 41.04 ? 181 ILE B CA    1 
ATOM   9135  C  C     . ILE D 1 181 ? 22.228  -18.488 -4.331  1.00 41.12 ? 181 ILE B C     1 
ATOM   9136  O  O     . ILE D 1 181 ? 21.117  -18.786 -3.881  1.00 39.93 ? 181 ILE B O     1 
ATOM   9137  C  CB    . ILE D 1 181 ? 22.411  -18.041 -6.795  1.00 41.33 ? 181 ILE B CB    1 
ATOM   9138  C  CG1   . ILE D 1 181 ? 20.994  -18.238 -7.300  1.00 47.00 ? 181 ILE B CG1   1 
ATOM   9139  C  CG2   . ILE D 1 181 ? 23.263  -19.332 -6.797  1.00 50.72 ? 181 ILE B CG2   1 
ATOM   9140  C  CD1   . ILE D 1 181 ? 20.332  -16.909 -7.712  1.00 45.92 ? 181 ILE B CD1   1 
ATOM   9141  H  H     . ILE D 1 181 ? 24.143  -16.673 -5.871  1.00 51.13 ? 181 ILE B H     1 
ATOM   9142  H  HA    . ILE D 1 181 ? 21.617  -16.797 -5.345  1.00 49.19 ? 181 ILE B HA    1 
ATOM   9143  H  HB    . ILE D 1 181 ? 22.844  -17.411 -7.393  1.00 49.54 ? 181 ILE B HB    1 
ATOM   9144  H  HG12  . ILE D 1 181 ? 21.011  -18.819 -8.076  1.00 56.34 ? 181 ILE B HG12  1 
ATOM   9145  H  HG13  . ILE D 1 181 ? 20.458  -18.636 -6.596  1.00 56.34 ? 181 ILE B HG13  1 
ATOM   9146  H  HG21  . ILE D 1 181 ? 22.884  -19.957 -6.173  1.00 60.81 ? 181 ILE B HG21  1 
ATOM   9147  H  HG22  . ILE D 1 181 ? 23.259  -19.708 -7.680  1.00 60.81 ? 181 ILE B HG22  1 
ATOM   9148  H  HG23  . ILE D 1 181 ? 24.161  -19.114 -6.537  1.00 60.81 ? 181 ILE B HG23  1 
ATOM   9149  H  HD11  . ILE D 1 181 ? 20.849  -16.507 -8.414  1.00 55.04 ? 181 ILE B HD11  1 
ATOM   9150  H  HD12  . ILE D 1 181 ? 19.441  -17.087 -8.022  1.00 55.04 ? 181 ILE B HD12  1 
ATOM   9151  H  HD13  . ILE D 1 181 ? 20.303  -16.326 -6.950  1.00 55.04 ? 181 ILE B HD13  1 
ATOM   9152  N  N     . ASP D 1 182 ? 23.357  -19.063 -3.926  1.00 50.71 ? 182 ASP B N     1 
ATOM   9153  C  CA    . ASP D 1 182 ? 23.374  -20.147 -2.950  1.00 51.09 ? 182 ASP B CA    1 
ATOM   9154  C  C     . ASP D 1 182 ? 22.834  -19.680 -1.609  1.00 47.54 ? 182 ASP B C     1 
ATOM   9155  O  O     . ASP D 1 182 ? 22.355  -20.484 -0.815  1.00 51.74 ? 182 ASP B O     1 
ATOM   9156  C  CB    . ASP D 1 182 ? 24.810  -20.654 -2.743  1.00 52.59 ? 182 ASP B CB    1 
ATOM   9157  C  CG    . ASP D 1 182 ? 25.420  -21.226 -4.010  1.00 61.90 ? 182 ASP B CG    1 
ATOM   9158  O  OD1   . ASP D 1 182 ? 24.802  -22.124 -4.623  1.00 62.17 ? 182 ASP B OD1   1 
ATOM   9159  O  OD2   . ASP D 1 182 ? 26.518  -20.769 -4.399  1.00 62.35 ? 182 ASP B OD2   1 
ATOM   9160  H  H     . ASP D 1 182 ? 24.139  -18.838 -4.206  1.00 60.79 ? 182 ASP B H     1 
ATOM   9161  H  HA    . ASP D 1 182 ? 22.821  -20.890 -3.271  1.00 61.24 ? 182 ASP B HA    1 
ATOM   9162  H  HB2   . ASP D 1 182 ? 25.366  -19.915 -2.450  1.00 63.05 ? 182 ASP B HB2   1 
ATOM   9163  H  HB3   . ASP D 1 182 ? 24.805  -21.353 -2.071  1.00 63.05 ? 182 ASP B HB3   1 
ATOM   9164  N  N     . GLU D 1 183 ? 22.930  -18.380 -1.351  1.00 42.61 ? 183 GLU B N     1 
ATOM   9165  C  CA    . GLU D 1 183 ? 22.663  -17.863 -0.018  1.00 38.63 ? 183 GLU B CA    1 
ATOM   9166  C  C     . GLU D 1 183 ? 21.228  -17.393 0.159   1.00 38.23 ? 183 GLU B C     1 
ATOM   9167  O  O     . GLU D 1 183 ? 20.902  -16.752 1.155   1.00 43.93 ? 183 GLU B O     1 
ATOM   9168  C  CB    . GLU D 1 183 ? 23.577  -16.687 0.271   1.00 35.57 ? 183 GLU B CB    1 
ATOM   9169  C  CG    . GLU D 1 183 ? 25.058  -16.951 0.053   1.00 50.90 ? 183 GLU B CG    1 
ATOM   9170  C  CD    . GLU D 1 183 ? 25.891  -15.700 0.280   1.00 56.76 ? 183 GLU B CD    1 
ATOM   9171  O  OE1   . GLU D 1 183 ? 26.372  -15.501 1.414   1.00 60.13 ? 183 GLU B OE1   1 
ATOM   9172  O  OE2   . GLU D 1 183 ? 26.050  -14.897 -0.667  1.00 56.19 ? 183 GLU B OE2   1 
ATOM   9173  H  H     . GLU D 1 183 ? 23.146  -17.781 -1.928  1.00 51.07 ? 183 GLU B H     1 
ATOM   9174  H  HA    . GLU D 1 183 ? 22.842  -18.563 0.643   1.00 46.30 ? 183 GLU B HA    1 
ATOM   9175  H  HB2   . GLU D 1 183 ? 23.324  -15.950 -0.307  1.00 42.62 ? 183 GLU B HB2   1 
ATOM   9176  H  HB3   . GLU D 1 183 ? 23.461  -16.427 1.198   1.00 42.62 ? 183 GLU B HB3   1 
ATOM   9177  H  HG2   . GLU D 1 183 ? 25.357  -17.632 0.676   1.00 61.01 ? 183 GLU B HG2   1 
ATOM   9178  H  HG3   . GLU D 1 183 ? 25.199  -17.248 -0.860  1.00 61.01 ? 183 GLU B HG3   1 
ATOM   9179  N  N     . ILE D 1 184 ? 20.372  -17.693 -0.800  1.00 30.37 ? 184 ILE B N     1 
ATOM   9180  C  CA    . ILE D 1 184 ? 19.011  -17.187 -0.768  1.00 31.05 ? 184 ILE B CA    1 
ATOM   9181  C  C     . ILE D 1 184 ? 18.125  -18.221 -0.135  1.00 31.60 ? 184 ILE B C     1 
ATOM   9182  O  O     . ILE D 1 184 ? 18.058  -19.339 -0.606  1.00 31.10 ? 184 ILE B O     1 
ATOM   9183  C  CB    . ILE D 1 184 ? 18.500  -16.898 -2.178  1.00 30.55 ? 184 ILE B CB    1 
ATOM   9184  C  CG1   . ILE D 1 184 ? 19.269  -15.707 -2.755  1.00 40.33 ? 184 ILE B CG1   1 
ATOM   9185  C  CG2   . ILE D 1 184 ? 17.014  -16.610 -2.184  1.00 33.39 ? 184 ILE B CG2   1 
ATOM   9186  C  CD1   . ILE D 1 184 ? 18.957  -15.471 -4.177  1.00 44.38 ? 184 ILE B CD1   1 
ATOM   9187  H  H     . ILE D 1 184 ? 20.551  -18.188 -1.481  1.00 36.38 ? 184 ILE B H     1 
ATOM   9188  H  HA    . ILE D 1 184 ? 18.971  -16.363 -0.238  1.00 37.20 ? 184 ILE B HA    1 
ATOM   9189  H  HB    . ILE D 1 184 ? 18.668  -17.675 -2.734  1.00 36.60 ? 184 ILE B HB    1 
ATOM   9190  H  HG12  . ILE D 1 184 ? 19.034  -14.908 -2.259  1.00 48.34 ? 184 ILE B HG12  1 
ATOM   9191  H  HG13  . ILE D 1 184 ? 20.221  -15.878 -2.680  1.00 48.34 ? 184 ILE B HG13  1 
ATOM   9192  H  HG21  . ILE D 1 184 ? 16.734  -16.434 -3.085  1.00 40.01 ? 184 ILE B HG21  1 
ATOM   9193  H  HG22  . ILE D 1 184 ? 16.547  -17.374 -1.838  1.00 40.01 ? 184 ILE B HG22  1 
ATOM   9194  H  HG23  . ILE D 1 184 ? 16.843  -15.843 -1.632  1.00 40.01 ? 184 ILE B HG23  1 
ATOM   9195  H  HD11  . ILE D 1 184 ? 18.018  -15.293 -4.265  1.00 53.19 ? 184 ILE B HD11  1 
ATOM   9196  H  HD12  . ILE D 1 184 ? 19.464  -14.717 -4.486  1.00 53.19 ? 184 ILE B HD12  1 
ATOM   9197  H  HD13  . ILE D 1 184 ? 19.192  -16.253 -4.682  1.00 53.19 ? 184 ILE B HD13  1 
ATOM   9198  N  N     . PRO D 1 185 ? 17.422  -17.836 0.924   1.00 31.95 ? 185 PRO B N     1 
ATOM   9199  C  CA    . PRO D 1 185 ? 16.458  -18.735 1.564   1.00 34.21 ? 185 PRO B CA    1 
ATOM   9200  C  C     . PRO D 1 185 ? 15.447  -19.271 0.560   1.00 34.65 ? 185 PRO B C     1 
ATOM   9201  O  O     . PRO D 1 185 ? 14.886  -18.528 -0.244  1.00 34.65 ? 185 PRO B O     1 
ATOM   9202  C  CB    . PRO D 1 185 ? 15.759  -17.830 2.588   1.00 30.53 ? 185 PRO B CB    1 
ATOM   9203  C  CG    . PRO D 1 185 ? 16.756  -16.785 2.904   1.00 37.33 ? 185 PRO B CG    1 
ATOM   9204  C  CD    . PRO D 1 185 ? 17.530  -16.548 1.624   1.00 31.71 ? 185 PRO B CD    1 
ATOM   9205  H  HA    . PRO D 1 185 ? 16.911  -19.475 2.020   1.00 40.99 ? 185 PRO B HA    1 
ATOM   9206  H  HB2   . PRO D 1 185 ? 14.964  -17.439 2.193   1.00 36.58 ? 185 PRO B HB2   1 
ATOM   9207  H  HB3   . PRO D 1 185 ? 15.535  -18.343 3.380   1.00 36.58 ? 185 PRO B HB3   1 
ATOM   9208  H  HG2   . PRO D 1 185 ? 16.301  -15.975 3.181   1.00 44.73 ? 185 PRO B HG2   1 
ATOM   9209  H  HG3   . PRO D 1 185 ? 17.347  -17.101 3.605   1.00 44.73 ? 185 PRO B HG3   1 
ATOM   9210  H  HD2   . PRO D 1 185 ? 17.115  -15.843 1.103   1.00 37.99 ? 185 PRO B HD2   1 
ATOM   9211  H  HD3   . PRO D 1 185 ? 18.458  -16.347 1.822   1.00 37.99 ? 185 PRO B HD3   1 
ATOM   9212  N  N     . GLY D 1 186 ? 15.223  -20.569 0.603   1.00 35.97 ? 186 GLY B N     1 
ATOM   9213  C  CA    . GLY D 1 186 ? 14.201  -21.160 -0.219  1.00 34.71 ? 186 GLY B CA    1 
ATOM   9214  C  C     . GLY D 1 186 ? 14.754  -21.637 -1.538  1.00 40.22 ? 186 GLY B C     1 
ATOM   9215  O  O     . GLY D 1 186 ? 14.005  -22.164 -2.343  1.00 41.93 ? 186 GLY B O     1 
ATOM   9216  H  H     . GLY D 1 186 ? 15.651  -21.127 1.099   1.00 43.11 ? 186 GLY B H     1 
ATOM   9217  H  HA2   . GLY D 1 186 ? 13.808  -21.916 0.244   1.00 41.59 ? 186 GLY B HA2   1 
ATOM   9218  H  HA3   . GLY D 1 186 ? 13.505  -20.507 -0.393  1.00 41.59 ? 186 GLY B HA3   1 
ATOM   9219  N  N     . ILE D 1 187 ? 16.053  -21.464 -1.766  1.00 32.45 ? 187 ILE B N     1 
ATOM   9220  C  CA    . ILE D 1 187 ? 16.672  -22.025 -2.959  1.00 35.82 ? 187 ILE B CA    1 
ATOM   9221  C  C     . ILE D 1 187 ? 17.588  -23.159 -2.537  1.00 38.51 ? 187 ILE B C     1 
ATOM   9222  O  O     . ILE D 1 187 ? 18.731  -22.940 -2.077  1.00 42.18 ? 187 ILE B O     1 
ATOM   9223  C  CB    . ILE D 1 187 ? 17.463  -20.978 -3.755  1.00 37.87 ? 187 ILE B CB    1 
ATOM   9224  C  CG1   . ILE D 1 187 ? 16.647  -19.697 -3.900  1.00 37.96 ? 187 ILE B CG1   1 
ATOM   9225  C  CG2   . ILE D 1 187 ? 17.806  -21.524 -5.138  1.00 42.72 ? 187 ILE B CG2   1 
ATOM   9226  C  CD1   . ILE D 1 187 ? 15.356  -19.876 -4.728  1.00 34.19 ? 187 ILE B CD1   1 
ATOM   9227  H  H     . ILE D 1 187 ? 16.590  -21.031 -1.253  1.00 38.88 ? 187 ILE B H     1 
ATOM   9228  H  HA    . ILE D 1 187 ? 15.975  -22.392 -3.542  1.00 42.93 ? 187 ILE B HA    1 
ATOM   9229  H  HB    . ILE D 1 187 ? 18.285  -20.777 -3.281  1.00 45.38 ? 187 ILE B HB    1 
ATOM   9230  H  HG12  . ILE D 1 187 ? 16.394  -19.385 -3.017  1.00 45.49 ? 187 ILE B HG12  1 
ATOM   9231  H  HG13  . ILE D 1 187 ? 17.193  -19.027 -4.341  1.00 45.49 ? 187 ILE B HG13  1 
ATOM   9232  H  HG21  . ILE D 1 187 ? 16.993  -21.731 -5.603  1.00 51.20 ? 187 ILE B HG21  1 
ATOM   9233  H  HG22  . ILE D 1 187 ? 18.300  -20.858 -5.622  1.00 51.20 ? 187 ILE B HG22  1 
ATOM   9234  H  HG23  . ILE D 1 187 ? 18.338  -22.317 -5.037  1.00 51.20 ? 187 ILE B HG23  1 
ATOM   9235  H  HD11  . ILE D 1 187 ? 14.897  -19.034 -4.777  1.00 40.97 ? 187 ILE B HD11  1 
ATOM   9236  H  HD12  . ILE D 1 187 ? 15.589  -20.173 -5.610  1.00 40.97 ? 187 ILE B HD12  1 
ATOM   9237  H  HD13  . ILE D 1 187 ? 14.798  -20.529 -4.299  1.00 40.97 ? 187 ILE B HD13  1 
ATOM   9238  N  N     . GLY D 1 188 ? 17.083  -24.377 -2.684  1.00 41.52 ? 188 GLY B N     1 
ATOM   9239  C  CA    . GLY D 1 188 ? 17.819  -25.554 -2.256  1.00 45.35 ? 188 GLY B CA    1 
ATOM   9240  C  C     . GLY D 1 188 ? 19.046  -25.799 -3.115  1.00 50.10 ? 188 GLY B C     1 
ATOM   9241  O  O     . GLY D 1 188 ? 19.179  -25.226 -4.203  1.00 45.83 ? 188 GLY B O     1 
ATOM   9242  H  H     . GLY D 1 188 ? 16.314  -24.548 -3.029  1.00 49.76 ? 188 GLY B H     1 
ATOM   9243  H  HA2   . GLY D 1 188 ? 18.103  -25.443 -1.336  1.00 54.36 ? 188 GLY B HA2   1 
ATOM   9244  H  HA3   . GLY D 1 188 ? 17.244  -26.334 -2.310  1.00 54.36 ? 188 GLY B HA3   1 
ATOM   9245  N  N     . SER D 1 189 ? 19.933  -26.661 -2.622  1.00 44.93 ? 189 SER B N     1 
ATOM   9246  C  CA    . SER D 1 189 ? 21.196  -26.998 -3.289  1.00 53.41 ? 189 SER B CA    1 
ATOM   9247  C  C     . SER D 1 189 ? 21.044  -27.372 -4.765  1.00 47.49 ? 189 SER B C     1 
ATOM   9248  O  O     . SER D 1 189 ? 21.876  -27.006 -5.599  1.00 46.24 ? 189 SER B O     1 
ATOM   9249  C  CB    . SER D 1 189 ? 21.860  -28.164 -2.552  1.00 55.34 ? 189 SER B CB    1 
ATOM   9250  O  OG    . SER D 1 189 ? 20.948  -29.246 -2.394  1.00 59.42 ? 189 SER B OG    1 
ATOM   9251  H  H     . SER D 1 189 ? 19.824  -27.078 -1.877  1.00 53.86 ? 189 SER B H     1 
ATOM   9252  H  HA    . SER D 1 189 ? 21.798  -26.226 -3.236  1.00 64.03 ? 189 SER B HA    1 
ATOM   9253  H  HB2   . SER D 1 189 ? 22.625  -28.468 -3.066  1.00 66.35 ? 189 SER B HB2   1 
ATOM   9254  H  HB3   . SER D 1 189 ? 22.147  -27.862 -1.676  1.00 66.35 ? 189 SER B HB3   1 
ATOM   9255  H  HG    . SER D 1 189 ? 20.224  -29.054 -2.727  1.00 71.25 ? 189 SER B HG    1 
ATOM   9256  N  N     . VAL D 1 190 ? 19.988  -28.115 -5.073  1.00 46.17 ? 190 VAL B N     1 
ATOM   9257  C  CA    . VAL D 1 190 ? 19.765  -28.625 -6.416  1.00 55.14 ? 190 VAL B CA    1 
ATOM   9258  C  C     . VAL D 1 190 ? 19.489  -27.481 -7.369  1.00 56.33 ? 190 VAL B C     1 
ATOM   9259  O  O     . VAL D 1 190 ? 20.233  -27.263 -8.340  1.00 49.56 ? 190 VAL B O     1 
ATOM   9260  C  CB    . VAL D 1 190 ? 18.568  -29.602 -6.430  1.00 50.80 ? 190 VAL B CB    1 
ATOM   9261  C  CG1   . VAL D 1 190 ? 17.872  -29.650 -7.801  1.00 53.06 ? 190 VAL B CG1   1 
ATOM   9262  C  CG2   . VAL D 1 190 ? 19.034  -30.982 -5.989  1.00 57.01 ? 190 VAL B CG2   1 
ATOM   9263  H  H     . VAL D 1 190 ? 19.377  -28.340 -4.512  1.00 55.34 ? 190 VAL B H     1 
ATOM   9264  H  HA    . VAL D 1 190 ? 20.564  -29.103 -6.724  1.00 66.11 ? 190 VAL B HA    1 
ATOM   9265  H  HB    . VAL D 1 190 ? 17.907  -29.292 -5.776  1.00 60.89 ? 190 VAL B HB    1 
ATOM   9266  H  HG11  . VAL D 1 190 ? 18.323  -29.052 -8.401  1.00 63.61 ? 190 VAL B HG11  1 
ATOM   9267  H  HG12  . VAL D 1 190 ? 17.913  -30.547 -8.141  1.00 63.61 ? 190 VAL B HG12  1 
ATOM   9268  H  HG13  . VAL D 1 190 ? 16.957  -29.381 -7.696  1.00 63.61 ? 190 VAL B HG13  1 
ATOM   9269  H  HG21  . VAL D 1 190 ? 19.974  -30.947 -5.797  1.00 68.36 ? 190 VAL B HG21  1 
ATOM   9270  H  HG22  . VAL D 1 190 ? 18.547  -31.239 -5.202  1.00 68.36 ? 190 VAL B HG22  1 
ATOM   9271  H  HG23  . VAL D 1 190 ? 18.867  -31.609 -6.697  1.00 68.36 ? 190 VAL B HG23  1 
ATOM   9272  N  N     . LEU D 1 191 ? 18.400  -26.775 -7.093  1.00 49.54 ? 191 LEU B N     1 
ATOM   9273  C  CA    . LEU D 1 191 ? 17.978  -25.650 -7.906  1.00 44.76 ? 191 LEU B CA    1 
ATOM   9274  C  C     . LEU D 1 191 ? 19.118  -24.657 -8.053  1.00 48.97 ? 191 LEU B C     1 
ATOM   9275  O  O     . LEU D 1 191 ? 19.345  -24.115 -9.135  1.00 44.62 ? 191 LEU B O     1 
ATOM   9276  C  CB    . LEU D 1 191 ? 16.776  -24.968 -7.269  1.00 42.93 ? 191 LEU B CB    1 
ATOM   9277  C  CG    . LEU D 1 191 ? 16.239  -23.776 -8.058  1.00 52.82 ? 191 LEU B CG    1 
ATOM   9278  C  CD1   . LEU D 1 191 ? 15.823  -24.205 -9.478  1.00 49.60 ? 191 LEU B CD1   1 
ATOM   9279  C  CD2   . LEU D 1 191 ? 15.077  -23.125 -7.336  1.00 46.82 ? 191 LEU B CD2   1 
ATOM   9280  H  H     . LEU D 1 191 ? 17.880  -26.933 -6.426  1.00 59.38 ? 191 LEU B H     1 
ATOM   9281  H  HA    . LEU D 1 191 ? 17.722  -25.967 -8.797  1.00 53.65 ? 191 LEU B HA    1 
ATOM   9282  H  HB2   . LEU D 1 191 ? 16.059  -25.616 -7.188  1.00 51.46 ? 191 LEU B HB2   1 
ATOM   9283  H  HB3   . LEU D 1 191 ? 17.030  -24.649 -6.389  1.00 51.46 ? 191 LEU B HB3   1 
ATOM   9284  H  HG    . LEU D 1 191 ? 16.943  -23.115 -8.142  1.00 63.33 ? 191 LEU B HG    1 
ATOM   9285  H  HD11  . LEU D 1 191 ? 16.589  -24.562 -9.932  1.00 59.46 ? 191 LEU B HD11  1 
ATOM   9286  H  HD12  . LEU D 1 191 ? 15.138  -24.874 -9.414  1.00 59.46 ? 191 LEU B HD12  1 
ATOM   9287  H  HD13  . LEU D 1 191 ? 15.490  -23.438 -9.950  1.00 59.46 ? 191 LEU B HD13  1 
ATOM   9288  H  HD21  . LEU D 1 191 ? 15.375  -22.820 -6.476  1.00 56.12 ? 191 LEU B HD21  1 
ATOM   9289  H  HD22  . LEU D 1 191 ? 14.763  -22.382 -7.857  1.00 56.12 ? 191 LEU B HD22  1 
ATOM   9290  H  HD23  . LEU D 1 191 ? 14.374  -23.770 -7.230  1.00 56.12 ? 191 LEU B HD23  1 
ATOM   9291  N  N     . ALA D 1 192 ? 19.843  -24.430 -6.967  1.00 43.27 ? 192 ALA B N     1 
ATOM   9292  C  CA    . ALA D 1 192 ? 20.952  -23.490 -6.991  1.00 43.58 ? 192 ALA B CA    1 
ATOM   9293  C  C     . ALA D 1 192 ? 21.930  -23.904 -8.073  1.00 51.32 ? 192 ALA B C     1 
ATOM   9294  O  O     . ALA D 1 192 ? 22.394  -23.073 -8.844  1.00 49.48 ? 192 ALA B O     1 
ATOM   9295  C  CB    . ALA D 1 192 ? 21.653  -23.443 -5.659  1.00 40.99 ? 192 ALA B CB    1 
ATOM   9296  H  H     . ALA D 1 192 ? 19.713  -24.806 -6.204  1.00 51.87 ? 192 ALA B H     1 
ATOM   9297  H  HA    . ALA D 1 192 ? 20.618  -22.593 -7.199  1.00 52.24 ? 192 ALA B HA    1 
ATOM   9298  H  HB1   . ALA D 1 192 ? 22.377  -22.815 -5.709  1.00 49.13 ? 192 ALA B HB1   1 
ATOM   9299  H  HB2   . ALA D 1 192 ? 21.026  -23.167 -4.986  1.00 49.13 ? 192 ALA B HB2   1 
ATOM   9300  H  HB3   . ALA D 1 192 ? 21.990  -24.318 -5.453  1.00 49.13 ? 192 ALA B HB3   1 
ATOM   9301  N  N     . ARG D 1 193 ? 22.252  -25.191 -8.122  1.00 50.26 ? 193 ARG B N     1 
ATOM   9302  C  CA    . ARG D 1 193 ? 23.261  -25.665 -9.063  1.00 52.93 ? 193 ARG B CA    1 
ATOM   9303  C  C     . ARG D 1 193 ? 22.731  -25.581 -10.494 1.00 47.12 ? 193 ARG B C     1 
ATOM   9304  O  O     . ARG D 1 193 ? 23.441  -25.154 -11.401 1.00 57.28 ? 193 ARG B O     1 
ATOM   9305  C  CB    . ARG D 1 193 ? 23.701  -27.084 -8.717  1.00 46.50 ? 193 ARG B CB    1 
ATOM   9306  C  CG    . ARG D 1 193 ? 24.595  -27.733 -9.770  1.00 42.91 ? 193 ARG B CG    1 
ATOM   9307  C  CD    . ARG D 1 193 ? 24.835  -29.198 -9.413  1.00 42.56 ? 193 ARG B CD    1 
ATOM   9308  N  NE    . ARG D 1 193 ? 23.562  -29.925 -9.326  1.00 51.93 ? 193 ARG B NE    1 
ATOM   9309  C  CZ    . ARG D 1 193 ? 23.294  -30.894 -8.446  1.00 46.43 ? 193 ARG B CZ    1 
ATOM   9310  N  NH1   . ARG D 1 193 ? 24.222  -31.287 -7.560  1.00 48.50 ? 193 ARG B NH1   1 
ATOM   9311  N  NH2   . ARG D 1 193 ? 22.096  -31.482 -8.463  1.00 48.08 ? 193 ARG B NH2   1 
ATOM   9312  H  H     . ARG D 1 193 ? 21.907  -25.804 -7.628  1.00 60.26 ? 193 ARG B H     1 
ATOM   9313  H  HA    . ARG D 1 193 ? 24.048  -25.084 -9.001  1.00 63.46 ? 193 ARG B HA    1 
ATOM   9314  H  HB2   . ARG D 1 193 ? 24.195  -27.063 -7.882  1.00 55.74 ? 193 ARG B HB2   1 
ATOM   9315  H  HB3   . ARG D 1 193 ? 22.912  -27.640 -8.617  1.00 55.74 ? 193 ARG B HB3   1 
ATOM   9316  H  HG2   . ARG D 1 193 ? 24.161  -27.693 -10.636 1.00 51.43 ? 193 ARG B HG2   1 
ATOM   9317  H  HG3   . ARG D 1 193 ? 25.451  -27.277 -9.796  1.00 51.43 ? 193 ARG B HG3   1 
ATOM   9318  H  HD2   . ARG D 1 193 ? 25.379  -29.614 -10.101 1.00 51.01 ? 193 ARG B HD2   1 
ATOM   9319  H  HD3   . ARG D 1 193 ? 25.278  -29.253 -8.552  1.00 51.01 ? 193 ARG B HD3   1 
ATOM   9320  H  HE    . ARG D 1 193 ? 22.943  -29.712 -9.883  1.00 62.25 ? 193 ARG B HE    1 
ATOM   9321  H  HH11  . ARG D 1 193 ? 24.994  -30.908 -7.549  1.00 58.14 ? 193 ARG B HH11  1 
ATOM   9322  H  HH12  . ARG D 1 193 ? 24.043  -31.912 -6.998  1.00 58.14 ? 193 ARG B HH12  1 
ATOM   9323  H  HH21  . ARG D 1 193 ? 21.503  -31.232 -9.033  1.00 57.63 ? 193 ARG B HH21  1 
ATOM   9324  H  HH22  . ARG D 1 193 ? 21.916  -32.109 -7.903  1.00 57.63 ? 193 ARG B HH22  1 
ATOM   9325  N  N     . ARG D 1 194 ? 21.479  -25.974 -10.686 1.00 39.90 ? 194 ARG B N     1 
ATOM   9326  C  CA    . ARG D 1 194 ? 20.786  -25.762 -11.959 1.00 49.35 ? 194 ARG B CA    1 
ATOM   9327  C  C     . ARG D 1 194 ? 20.898  -24.305 -12.447 1.00 51.78 ? 194 ARG B C     1 
ATOM   9328  O  O     . ARG D 1 194 ? 21.383  -24.061 -13.547 1.00 48.34 ? 194 ARG B O     1 
ATOM   9329  C  CB    . ARG D 1 194 ? 19.321  -26.163 -11.820 1.00 46.82 ? 194 ARG B CB    1 
ATOM   9330  C  CG    . ARG D 1 194 ? 18.554  -26.298 -13.116 1.00 53.02 ? 194 ARG B CG    1 
ATOM   9331  C  CD    . ARG D 1 194 ? 17.404  -27.304 -12.928 1.00 54.46 ? 194 ARG B CD    1 
ATOM   9332  N  NE    . ARG D 1 194 ? 16.265  -27.092 -13.825 1.00 57.41 ? 194 ARG B NE    1 
ATOM   9333  C  CZ    . ARG D 1 194 ? 16.318  -27.154 -15.158 1.00 59.59 ? 194 ARG B CZ    1 
ATOM   9334  N  NH1   . ARG D 1 194 ? 17.471  -27.396 -15.784 1.00 63.68 ? 194 ARG B NH1   1 
ATOM   9335  N  NH2   . ARG D 1 194 ? 15.212  -26.954 -15.875 1.00 55.42 ? 194 ARG B NH2   1 
ATOM   9336  H  H     . ARG D 1 194 ? 21.001  -26.370 -10.091 1.00 47.81 ? 194 ARG B H     1 
ATOM   9337  H  HA    . ARG D 1 194 ? 21.192  -26.339 -12.640 1.00 59.16 ? 194 ARG B HA    1 
ATOM   9338  H  HB2   . ARG D 1 194 ? 19.280  -27.021 -11.368 1.00 56.13 ? 194 ARG B HB2   1 
ATOM   9339  H  HB3   . ARG D 1 194 ? 18.870  -25.493 -11.283 1.00 56.13 ? 194 ARG B HB3   1 
ATOM   9340  H  HG2   . ARG D 1 194 ? 18.177  -25.439 -13.363 1.00 63.56 ? 194 ARG B HG2   1 
ATOM   9341  H  HG3   . ARG D 1 194 ? 19.144  -26.626 -13.812 1.00 63.56 ? 194 ARG B HG3   1 
ATOM   9342  H  HD2   . ARG D 1 194 ? 17.744  -28.198 -13.089 1.00 65.30 ? 194 ARG B HD2   1 
ATOM   9343  H  HD3   . ARG D 1 194 ? 17.078  -27.237 -12.016 1.00 65.30 ? 194 ARG B HD3   1 
ATOM   9344  H  HE    . ARG D 1 194 ? 15.504  -26.915 -13.466 1.00 68.83 ? 194 ARG B HE    1 
ATOM   9345  H  HH11  . ARG D 1 194 ? 18.188  -27.527 -15.328 1.00 76.35 ? 194 ARG B HH11  1 
ATOM   9346  H  HH12  . ARG D 1 194 ? 17.495  -27.429 -16.643 1.00 76.35 ? 194 ARG B HH12  1 
ATOM   9347  H  HH21  . ARG D 1 194 ? 14.466  -26.792 -15.479 1.00 66.44 ? 194 ARG B HH21  1 
ATOM   9348  H  HH22  . ARG D 1 194 ? 15.245  -26.984 -16.734 1.00 66.44 ? 194 ARG B HH22  1 
ATOM   9349  N  N     . LEU D 1 195 ? 20.455  -23.343 -11.637 1.00 46.60 ? 195 LEU B N     1 
ATOM   9350  C  CA    . LEU D 1 195 ? 20.596  -21.919 -11.982 1.00 44.11 ? 195 LEU B CA    1 
ATOM   9351  C  C     . LEU D 1 195 ? 22.046  -21.580 -12.305 1.00 44.98 ? 195 LEU B C     1 
ATOM   9352  O  O     . LEU D 1 195 ? 22.332  -20.888 -13.274 1.00 37.47 ? 195 LEU B O     1 
ATOM   9353  C  CB    . LEU D 1 195 ? 20.155  -21.031 -10.821 1.00 36.07 ? 195 LEU B CB    1 
ATOM   9354  C  CG    . LEU D 1 195 ? 18.662  -20.996 -10.560 1.00 42.87 ? 195 LEU B CG    1 
ATOM   9355  C  CD1   . LEU D 1 195 ? 18.430  -20.377 -9.202  1.00 43.46 ? 195 LEU B CD1   1 
ATOM   9356  C  CD2   . LEU D 1 195 ? 17.915  -20.237 -11.665 1.00 39.61 ? 195 LEU B CD2   1 
ATOM   9357  H  H     . LEU D 1 195 ? 20.069  -23.484 -10.882 1.00 55.86 ? 195 LEU B H     1 
ATOM   9358  H  HA    . LEU D 1 195 ? 20.043  -21.713 -12.765 1.00 52.87 ? 195 LEU B HA    1 
ATOM   9359  H  HB2   . LEU D 1 195 ? 20.585  -21.347 -10.012 1.00 43.22 ? 195 LEU B HB2   1 
ATOM   9360  H  HB3   . LEU D 1 195 ? 20.439  -20.122 -11.005 1.00 43.22 ? 195 LEU B HB3   1 
ATOM   9361  H  HG    . LEU D 1 195 ? 18.324  -21.904 -10.537 1.00 51.38 ? 195 LEU B HG    1 
ATOM   9362  H  HD11  . LEU D 1 195 ? 18.872  -20.909 -8.536  1.00 52.09 ? 195 LEU B HD11  1 
ATOM   9363  H  HD12  . LEU D 1 195 ? 18.789  -19.486 -9.199  1.00 52.09 ? 195 LEU B HD12  1 
ATOM   9364  H  HD13  . LEU D 1 195 ? 17.487  -20.351 -9.028  1.00 52.09 ? 195 LEU B HD13  1 
ATOM   9365  H  HD21  . LEU D 1 195 ? 16.977  -20.237 -11.464 1.00 47.47 ? 195 LEU B HD21  1 
ATOM   9366  H  HD22  . LEU D 1 195 ? 18.243  -19.335 -11.701 1.00 47.47 ? 195 LEU B HD22  1 
ATOM   9367  H  HD23  . LEU D 1 195 ? 18.071  -20.676 -12.505 1.00 47.47 ? 195 LEU B HD23  1 
ATOM   9368  N  N     . ASN D 1 196 ? 22.943  -22.076 -11.460 1.00 41.21 ? 196 ASN B N     1 
ATOM   9369  C  CA    . ASN D 1 196 ? 24.368  -21.795 -11.535 1.00 49.55 ? 196 ASN B CA    1 
ATOM   9370  C  C     . ASN D 1 196 ? 25.025  -22.320 -12.816 1.00 55.70 ? 196 ASN B C     1 
ATOM   9371  O  O     . ASN D 1 196 ? 26.026  -21.766 -13.292 1.00 48.56 ? 196 ASN B O     1 
ATOM   9372  C  CB    . ASN D 1 196 ? 25.043  -22.425 -10.325 1.00 50.38 ? 196 ASN B CB    1 
ATOM   9373  C  CG    . ASN D 1 196 ? 26.470  -21.978 -10.159 1.00 64.12 ? 196 ASN B CG    1 
ATOM   9374  O  OD1   . ASN D 1 196 ? 27.369  -22.435 -10.873 1.00 67.53 ? 196 ASN B OD1   1 
ATOM   9375  N  ND2   . ASN D 1 196 ? 26.698  -21.082 -9.203  1.00 64.06 ? 196 ASN B ND2   1 
ATOM   9376  H  H     . ASN D 1 196 ? 22.739  -22.600 -10.810 1.00 49.39 ? 196 ASN B H     1 
ATOM   9377  H  HA    . ASN D 1 196 ? 24.508  -20.826 -11.494 1.00 59.40 ? 196 ASN B HA    1 
ATOM   9378  H  HB2   . ASN D 1 196 ? 24.554  -22.175 -9.525  1.00 60.39 ? 196 ASN B HB2   1 
ATOM   9379  H  HB3   . ASN D 1 196 ? 25.040  -23.389 -10.428 1.00 60.39 ? 196 ASN B HB3   1 
ATOM   9380  H  HD21  . ASN D 1 196 ? 26.047  -20.792 -8.722  1.00 76.81 ? 196 ASN B HD21  1 
ATOM   9381  H  HD22  . ASN D 1 196 ? 27.496  -20.793 -9.066  1.00 76.81 ? 196 ASN B HD22  1 
ATOM   9382  N  N     . GLU D 1 197 ? 24.463  -23.393 -13.361 1.00 51.23 ? 197 GLU B N     1 
ATOM   9383  C  CA    . GLU D 1 197 ? 24.970  -23.957 -14.603 1.00 61.82 ? 197 GLU B CA    1 
ATOM   9384  C  C     . GLU D 1 197 ? 24.385  -23.189 -15.786 1.00 56.55 ? 197 GLU B C     1 
ATOM   9385  O  O     . GLU D 1 197 ? 24.935  -23.210 -16.881 1.00 51.08 ? 197 GLU B O     1 
ATOM   9386  C  CB    . GLU D 1 197 ? 24.653  -25.457 -14.702 1.00 57.27 ? 197 GLU B CB    1 
ATOM   9387  C  CG    . GLU D 1 197 ? 23.177  -25.790 -14.788 1.00 65.01 ? 197 GLU B CG    1 
ATOM   9388  C  CD    . GLU D 1 197 ? 22.911  -27.197 -15.308 1.00 77.22 ? 197 GLU B CD    1 
ATOM   9389  O  OE1   . GLU D 1 197 ? 23.855  -28.024 -15.299 1.00 79.10 ? 197 GLU B OE1   1 
ATOM   9390  O  OE2   . GLU D 1 197 ? 21.756  -27.463 -15.728 1.00 75.85 ? 197 GLU B OE2   1 
ATOM   9391  H  H     . GLU D 1 197 ? 23.788  -23.811 -13.032 1.00 61.41 ? 197 GLU B H     1 
ATOM   9392  H  HA    . GLU D 1 197 ? 25.944  -23.851 -14.626 1.00 74.13 ? 197 GLU B HA    1 
ATOM   9393  H  HB2   . GLU D 1 197 ? 25.081  -25.812 -15.497 1.00 68.66 ? 197 GLU B HB2   1 
ATOM   9394  H  HB3   . GLU D 1 197 ? 25.008  -25.901 -13.916 1.00 68.66 ? 197 GLU B HB3   1 
ATOM   9395  H  HG2   . GLU D 1 197 ? 22.786  -25.719 -13.903 1.00 77.96 ? 197 GLU B HG2   1 
ATOM   9396  H  HG3   . GLU D 1 197 ? 22.747  -25.162 -15.391 1.00 77.96 ? 197 GLU B HG3   1 
ATOM   9397  N  N     . LEU D 1 198 ? 23.273  -22.504 -15.554 1.00 45.20 ? 198 LEU B N     1 
ATOM   9398  C  CA    . LEU D 1 198 ? 22.701  -21.613 -16.547 1.00 38.50 ? 198 LEU B CA    1 
ATOM   9399  C  C     . LEU D 1 198 ? 23.309  -20.199 -16.441 1.00 33.31 ? 198 LEU B C     1 
ATOM   9400  O  O     . LEU D 1 198 ? 22.817  -19.243 -17.054 1.00 34.63 ? 198 LEU B O     1 
ATOM   9401  C  CB    . LEU D 1 198 ? 21.180  -21.568 -16.387 1.00 48.64 ? 198 LEU B CB    1 
ATOM   9402  C  CG    . LEU D 1 198 ? 20.351  -22.714 -16.983 1.00 49.73 ? 198 LEU B CG    1 
ATOM   9403  C  CD1   . LEU D 1 198 ? 20.939  -24.073 -16.693 1.00 55.34 ? 198 LEU B CD1   1 
ATOM   9404  C  CD2   . LEU D 1 198 ? 18.917  -22.638 -16.457 1.00 56.95 ? 198 LEU B CD2   1 
ATOM   9405  H  H     . LEU D 1 198 ? 22.827  -22.539 -14.819 1.00 54.18 ? 198 LEU B H     1 
ATOM   9406  H  HA    . LEU D 1 198 ? 22.902  -21.962 -17.440 1.00 46.14 ? 198 LEU B HA    1 
ATOM   9407  H  HB2   . LEU D 1 198 ? 20.982  -21.542 -15.438 1.00 58.31 ? 198 LEU B HB2   1 
ATOM   9408  H  HB3   . LEU D 1 198 ? 20.863  -20.749 -16.798 1.00 58.31 ? 198 LEU B HB3   1 
ATOM   9409  H  HG    . LEU D 1 198 ? 20.319  -22.607 -17.946 1.00 59.62 ? 198 LEU B HG    1 
ATOM   9410  H  HD11  . LEU D 1 198 ? 21.821  -24.118 -17.068 1.00 66.34 ? 198 LEU B HD11  1 
ATOM   9411  H  HD12  . LEU D 1 198 ? 20.980  -24.198 -15.742 1.00 66.34 ? 198 LEU B HD12  1 
ATOM   9412  H  HD13  . LEU D 1 198 ? 20.380  -24.745 -17.088 1.00 66.34 ? 198 LEU B HD13  1 
ATOM   9413  H  HD21  . LEU D 1 198 ? 18.407  -23.359 -16.836 1.00 68.27 ? 198 LEU B HD21  1 
ATOM   9414  H  HD22  . LEU D 1 198 ? 18.930  -22.713 -15.501 1.00 68.27 ? 198 LEU B HD22  1 
ATOM   9415  H  HD23  . LEU D 1 198 ? 18.534  -21.796 -16.715 1.00 68.27 ? 198 LEU B HD23  1 
ATOM   9416  N  N     . GLY D 1 199 ? 24.367  -20.072 -15.655 1.00 28.67 ? 199 GLY B N     1 
ATOM   9417  C  CA    . GLY D 1 199 ? 25.105  -18.824 -15.551 1.00 44.32 ? 199 GLY B CA    1 
ATOM   9418  C  C     . GLY D 1 199 ? 24.511  -17.843 -14.553 1.00 41.84 ? 199 GLY B C     1 
ATOM   9419  O  O     . GLY D 1 199 ? 24.878  -16.673 -14.526 1.00 34.78 ? 199 GLY B O     1 
ATOM   9420  H  H     . GLY D 1 199 ? 24.682  -20.704 -15.164 1.00 34.34 ? 199 GLY B H     1 
ATOM   9421  H  HA2   . GLY D 1 199 ? 26.017  -19.015 -15.282 1.00 53.13 ? 199 GLY B HA2   1 
ATOM   9422  H  HA3   . GLY D 1 199 ? 25.129  -18.394 -16.421 1.00 53.13 ? 199 GLY B HA3   1 
ATOM   9423  N  N     . ILE D 1 200 ? 23.589  -18.329 -13.733 1.00 40.00 ? 200 ILE B N     1 
ATOM   9424  C  CA    . ILE D 1 200 ? 22.978  -17.517 -12.683 1.00 37.13 ? 200 ILE B CA    1 
ATOM   9425  C  C     . ILE D 1 200 ? 23.665  -17.854 -11.352 1.00 38.79 ? 200 ILE B C     1 
ATOM   9426  O  O     . ILE D 1 200 ? 23.350  -18.845 -10.693 1.00 41.63 ? 200 ILE B O     1 
ATOM   9427  C  CB    . ILE D 1 200 ? 21.452  -17.716 -12.676 1.00 40.84 ? 200 ILE B CB    1 
ATOM   9428  C  CG1   . ILE D 1 200 ? 20.887  -17.281 -14.023 1.00 41.19 ? 200 ILE B CG1   1 
ATOM   9429  C  CG2   . ILE D 1 200 ? 20.789  -16.881 -11.582 1.00 36.33 ? 200 ILE B CG2   1 
ATOM   9430  C  CD1   . ILE D 1 200 ? 19.509  -17.778 -14.307 1.00 45.15 ? 200 ILE B CD1   1 
ATOM   9431  H  H     . ILE D 1 200 ? 23.295  -19.137 -13.763 1.00 47.94 ? 200 ILE B H     1 
ATOM   9432  H  HA    . ILE D 1 200 ? 23.153  -16.573 -12.876 1.00 44.50 ? 200 ILE B HA    1 
ATOM   9433  H  HB    . ILE D 1 200 ? 21.251  -18.654 -12.531 1.00 48.94 ? 200 ILE B HB    1 
ATOM   9434  H  HG12  . ILE D 1 200 ? 20.861  -16.312 -14.050 1.00 49.36 ? 200 ILE B HG12  1 
ATOM   9435  H  HG13  . ILE D 1 200 ? 21.469  -17.611 -14.725 1.00 49.36 ? 200 ILE B HG13  1 
ATOM   9436  H  HG21  . ILE D 1 200 ? 19.841  -17.030 -11.608 1.00 43.53 ? 200 ILE B HG21  1 
ATOM   9437  H  HG22  . ILE D 1 200 ? 21.140  -17.148 -10.730 1.00 43.53 ? 200 ILE B HG22  1 
ATOM   9438  H  HG23  . ILE D 1 200 ? 20.979  -15.953 -11.739 1.00 43.53 ? 200 ILE B HG23  1 
ATOM   9439  H  HD11  . ILE D 1 200 ? 19.234  -17.460 -15.169 1.00 54.12 ? 200 ILE B HD11  1 
ATOM   9440  H  HD12  . ILE D 1 200 ? 19.516  -18.738 -14.299 1.00 54.12 ? 200 ILE B HD12  1 
ATOM   9441  H  HD13  . ILE D 1 200 ? 18.913  -17.450 -13.630 1.00 54.12 ? 200 ILE B HD13  1 
ATOM   9442  N  N     . GLN D 1 201 ? 24.662  -17.045 -11.004 1.00 32.11 ? 201 GLN B N     1 
ATOM   9443  C  CA    . GLN D 1 201 ? 25.492  -17.289 -9.830  1.00 44.40 ? 201 GLN B CA    1 
ATOM   9444  C  C     . GLN D 1 201 ? 25.252  -16.278 -8.697  1.00 43.21 ? 201 GLN B C     1 
ATOM   9445  O  O     . GLN D 1 201 ? 25.504  -16.570 -7.532  1.00 37.42 ? 201 GLN B O     1 
ATOM   9446  C  CB    . GLN D 1 201 ? 26.954  -17.276 -10.250 1.00 43.57 ? 201 GLN B CB    1 
ATOM   9447  C  CG    . GLN D 1 201 ? 27.255  -18.374 -11.287 1.00 47.26 ? 201 GLN B CG    1 
ATOM   9448  C  CD    . GLN D 1 201 ? 28.589  -18.201 -11.964 1.00 57.54 ? 201 GLN B CD    1 
ATOM   9449  O  OE1   . GLN D 1 201 ? 28.673  -17.632 -13.057 1.00 61.12 ? 201 GLN B OE1   1 
ATOM   9450  N  NE2   . GLN D 1 201 ? 29.648  -18.706 -11.327 1.00 57.46 ? 201 GLN B NE2   1 
ATOM   9451  H  H     . GLN D 1 201 ? 24.881  -16.337 -11.441 1.00 38.47 ? 201 GLN B H     1 
ATOM   9452  H  HA    . GLN D 1 201 ? 25.288  -18.182 -9.481  1.00 53.22 ? 201 GLN B HA    1 
ATOM   9453  H  HB2   . GLN D 1 201 ? 27.166  -16.417 -10.646 1.00 52.22 ? 201 GLN B HB2   1 
ATOM   9454  H  HB3   . GLN D 1 201 ? 27.512  -17.433 -9.471  1.00 52.22 ? 201 GLN B HB3   1 
ATOM   9455  H  HG2   . GLN D 1 201 ? 27.256  -19.236 -10.842 1.00 56.65 ? 201 GLN B HG2   1 
ATOM   9456  H  HG3   . GLN D 1 201 ? 26.568  -18.356 -11.972 1.00 56.65 ? 201 GLN B HG3   1 
ATOM   9457  H  HE21  . GLN D 1 201 ? 29.546  -19.104 -10.571 1.00 68.89 ? 201 GLN B HE21  1 
ATOM   9458  H  HE22  . GLN D 1 201 ? 30.433  -18.633 -11.672 1.00 68.89 ? 201 GLN B HE22  1 
ATOM   9459  N  N     . LYS D 1 202 ? 24.778  -15.092 -9.056  1.00 33.85 ? 202 LYS B N     1 
ATOM   9460  C  CA    . LYS D 1 202 ? 24.449  -14.072 -8.079  1.00 37.39 ? 202 LYS B CA    1 
ATOM   9461  C  C     . LYS D 1 202 ? 23.006  -13.661 -8.272  1.00 33.43 ? 202 LYS B C     1 
ATOM   9462  O  O     . LYS D 1 202 ? 22.452  -13.778 -9.375  1.00 26.44 ? 202 LYS B O     1 
ATOM   9463  C  CB    . LYS D 1 202 ? 25.372  -12.863 -8.226  1.00 42.69 ? 202 LYS B CB    1 
ATOM   9464  C  CG    . LYS D 1 202 ? 26.719  -13.039 -7.528  1.00 41.62 ? 202 LYS B CG    1 
ATOM   9465  C  CD    . LYS D 1 202 ? 27.453  -11.723 -7.352  1.00 50.63 ? 202 LYS B CD    1 
ATOM   9466  C  CE    . LYS D 1 202 ? 28.557  -11.844 -6.315  1.00 55.92 ? 202 LYS B CE    1 
ATOM   9467  N  NZ    . LYS D 1 202 ? 29.591  -12.838 -6.705  1.00 67.39 ? 202 LYS B NZ    1 
ATOM   9468  H  H     . LYS D 1 202 ? 24.637  -14.853 -9.870  1.00 40.56 ? 202 LYS B H     1 
ATOM   9469  H  HA    . LYS D 1 202 ? 24.553  -14.436 -7.175  1.00 44.80 ? 202 LYS B HA    1 
ATOM   9470  H  HB2   . LYS D 1 202 ? 25.543  -12.713 -9.169  1.00 51.17 ? 202 LYS B HB2   1 
ATOM   9471  H  HB3   . LYS D 1 202 ? 24.936  -12.087 -7.842  1.00 51.17 ? 202 LYS B HB3   1 
ATOM   9472  H  HG2   . LYS D 1 202 ? 26.573  -13.423 -6.649  1.00 49.88 ? 202 LYS B HG2   1 
ATOM   9473  H  HG3   . LYS D 1 202 ? 27.278  -13.627 -8.060  1.00 49.88 ? 202 LYS B HG3   1 
ATOM   9474  H  HD2   . LYS D 1 202 ? 27.854  -11.464 -8.196  1.00 60.69 ? 202 LYS B HD2   1 
ATOM   9475  H  HD3   . LYS D 1 202 ? 26.828  -11.044 -7.054  1.00 60.69 ? 202 LYS B HD3   1 
ATOM   9476  H  HE2   . LYS D 1 202 ? 28.991  -10.983 -6.212  1.00 67.05 ? 202 LYS B HE2   1 
ATOM   9477  H  HE3   . LYS D 1 202 ? 28.171  -12.126 -5.471  1.00 67.05 ? 202 LYS B HE3   1 
ATOM   9478  H  HZ1   . LYS D 1 202 ? 30.221  -12.883 -6.077  1.00 80.81 ? 202 LYS B HZ1   1 
ATOM   9479  H  HZ2   . LYS D 1 202 ? 29.220  -13.641 -6.800  1.00 80.81 ? 202 LYS B HZ2   1 
ATOM   9480  H  HZ3   . LYS D 1 202 ? 29.967  -12.599 -7.475  1.00 80.81 ? 202 LYS B HZ3   1 
ATOM   9481  N  N     . LEU D 1 203 ? 22.389  -13.158 -7.205  1.00 30.81 ? 203 LEU B N     1 
ATOM   9482  C  CA    . LEU D 1 203 ? 20.989  -12.753 -7.280  1.00 32.71 ? 203 LEU B CA    1 
ATOM   9483  C  C     . LEU D 1 203 ? 20.749  -11.782 -8.446  1.00 22.49 ? 203 LEU B C     1 
ATOM   9484  O  O     . LEU D 1 203 ? 19.774  -11.911 -9.187  1.00 27.64 ? 203 LEU B O     1 
ATOM   9485  C  CB    . LEU D 1 203 ? 20.566  -12.096 -5.965  1.00 27.15 ? 203 LEU B CB    1 
ATOM   9486  C  CG    . LEU D 1 203 ? 19.130  -11.542 -5.922  1.00 28.68 ? 203 LEU B CG    1 
ATOM   9487  C  CD1   . LEU D 1 203 ? 18.076  -12.596 -6.212  1.00 28.55 ? 203 LEU B CD1   1 
ATOM   9488  C  CD2   . LEU D 1 203 ? 18.886  -10.908 -4.556  1.00 32.38 ? 203 LEU B CD2   1 
ATOM   9489  H  H     . LEU D 1 203 ? 22.753  -13.042 -6.435  1.00 36.91 ? 203 LEU B H     1 
ATOM   9490  H  HA    . LEU D 1 203 ? 20.430  -13.546 -7.421  1.00 39.19 ? 203 LEU B HA    1 
ATOM   9491  H  HB2   . LEU D 1 203 ? 20.645  -12.754 -5.256  1.00 32.52 ? 203 LEU B HB2   1 
ATOM   9492  H  HB3   . LEU D 1 203 ? 21.168  -11.356 -5.787  1.00 32.52 ? 203 LEU B HB3   1 
ATOM   9493  H  HG    . LEU D 1 203 ? 19.044  -10.846 -6.591  1.00 34.35 ? 203 LEU B HG    1 
ATOM   9494  H  HD11  . LEU D 1 203 ? 18.228  -12.956 -7.089  1.00 34.20 ? 203 LEU B HD11  1 
ATOM   9495  H  HD12  . LEU D 1 203 ? 18.144  -13.294 -5.556  1.00 34.20 ? 203 LEU B HD12  1 
ATOM   9496  H  HD13  . LEU D 1 203 ? 17.208  -12.190 -6.170  1.00 34.20 ? 203 LEU B HD13  1 
ATOM   9497  H  HD21  . LEU D 1 203 ? 19.001  -11.576 -3.877  1.00 38.79 ? 203 LEU B HD21  1 
ATOM   9498  H  HD22  . LEU D 1 203 ? 19.517  -10.196 -4.426  1.00 38.79 ? 203 LEU B HD22  1 
ATOM   9499  H  HD23  . LEU D 1 203 ? 17.991  -10.562 -4.528  1.00 38.79 ? 203 LEU B HD23  1 
ATOM   9500  N  N     . ARG D 1 204 ? 21.639  -10.812 -8.589  1.00 31.33 ? 204 ARG B N     1 
ATOM   9501  C  CA    . ARG D 1 204 ? 21.511  -9.809  -9.658  1.00 34.22 ? 204 ARG B CA    1 
ATOM   9502  C  C     . ARG D 1 204 ? 21.421  -10.452 -11.052 1.00 27.28 ? 204 ARG B C     1 
ATOM   9503  O  O     . ARG D 1 204 ? 20.827  -9.888  -11.978 1.00 29.99 ? 204 ARG B O     1 
ATOM   9504  C  CB    . ARG D 1 204 ? 22.681  -8.796  -9.592  1.00 34.43 ? 204 ARG B CB    1 
ATOM   9505  C  CG    . ARG D 1 204 ? 24.089  -9.394  -9.836  1.00 40.67 ? 204 ARG B CG    1 
ATOM   9506  C  CD    . ARG D 1 204 ? 25.186  -8.304  -9.867  1.00 49.77 ? 204 ARG B CD    1 
ATOM   9507  N  NE    . ARG D 1 204 ? 26.477  -8.800  -10.370 1.00 53.28 ? 204 ARG B NE    1 
ATOM   9508  C  CZ    . ARG D 1 204 ? 27.612  -8.866  -9.665  1.00 54.02 ? 204 ARG B CZ    1 
ATOM   9509  N  NH1   . ARG D 1 204 ? 27.670  -8.466  -8.397  1.00 50.97 ? 204 ARG B NH1   1 
ATOM   9510  N  NH2   . ARG D 1 204 ? 28.713  -9.337  -10.241 1.00 56.50 ? 204 ARG B NH2   1 
ATOM   9511  H  H     . ARG D 1 204 ? 22.329  -10.706 -8.087  1.00 37.53 ? 204 ARG B H     1 
ATOM   9512  H  HA    . ARG D 1 204 ? 20.681  -9.307  -9.513  1.00 41.00 ? 204 ARG B HA    1 
ATOM   9513  H  HB2   . ARG D 1 204 ? 22.534  -8.113  -10.265 1.00 41.26 ? 204 ARG B HB2   1 
ATOM   9514  H  HB3   . ARG D 1 204 ? 22.686  -8.388  -8.712  1.00 41.26 ? 204 ARG B HB3   1 
ATOM   9515  H  HG2   . ARG D 1 204 ? 24.299  -10.014 -9.120  1.00 48.75 ? 204 ARG B HG2   1 
ATOM   9516  H  HG3   . ARG D 1 204 ? 24.096  -9.854  -10.690 1.00 48.75 ? 204 ARG B HG3   1 
ATOM   9517  H  HD2   . ARG D 1 204 ? 24.897  -7.582  -10.447 1.00 59.66 ? 204 ARG B HD2   1 
ATOM   9518  H  HD3   . ARG D 1 204 ? 25.325  -7.970  -8.967  1.00 59.66 ? 204 ARG B HD3   1 
ATOM   9519  H  HE    . ARG D 1 204 ? 26.503  -9.070  -11.186 1.00 63.88 ? 204 ARG B HE    1 
ATOM   9520  H  HH11  . ARG D 1 204 ? 26.966  -8.158  -8.011  1.00 61.10 ? 204 ARG B HH11  1 
ATOM   9521  H  HH12  . ARG D 1 204 ? 28.411  -8.517  -7.963  1.00 61.10 ? 204 ARG B HH12  1 
ATOM   9522  H  HH21  . ARG D 1 204 ? 28.692  -9.599  -11.060 1.00 67.74 ? 204 ARG B HH21  1 
ATOM   9523  H  HH22  . ARG D 1 204 ? 29.446  -9.381  -9.794  1.00 67.74 ? 204 ARG B HH22  1 
ATOM   9524  N  N     . ASP D 1 205 ? 21.985  -11.642 -11.201 1.00 31.18 ? 205 ASP B N     1 
ATOM   9525  C  CA    . ASP D 1 205 ? 21.941  -12.342 -12.487 1.00 30.04 ? 205 ASP B CA    1 
ATOM   9526  C  C     . ASP D 1 205 ? 20.525  -12.717 -12.896 1.00 40.08 ? 205 ASP B C     1 
ATOM   9527  O  O     . ASP D 1 205 ? 20.276  -12.996 -14.065 1.00 31.37 ? 205 ASP B O     1 
ATOM   9528  C  CB    . ASP D 1 205 ? 22.822  -13.598 -12.448 1.00 34.25 ? 205 ASP B CB    1 
ATOM   9529  C  CG    . ASP D 1 205 ? 24.305  -13.272 -12.344 1.00 40.24 ? 205 ASP B CG    1 
ATOM   9530  O  OD1   . ASP D 1 205 ? 24.712  -12.185 -12.823 1.00 39.40 ? 205 ASP B OD1   1 
ATOM   9531  O  OD2   . ASP D 1 205 ? 25.069  -14.099 -11.801 1.00 35.24 ? 205 ASP B OD2   1 
ATOM   9532  H  H     . ASP D 1 205 ? 22.399  -12.068 -10.579 1.00 37.35 ? 205 ASP B H     1 
ATOM   9533  H  HA    . ASP D 1 205 ? 22.302  -11.748 -13.178 1.00 35.99 ? 205 ASP B HA    1 
ATOM   9534  H  HB2   . ASP D 1 205 ? 22.577  -14.132 -11.675 1.00 41.04 ? 205 ASP B HB2   1 
ATOM   9535  H  HB3   . ASP D 1 205 ? 22.683  -14.108 -13.261 1.00 41.04 ? 205 ASP B HB3   1 
ATOM   9536  N  N     . ILE D 1 206 ? 19.600  -12.725 -11.929 1.00 32.22 ? 206 ILE B N     1 
ATOM   9537  C  CA    . ILE D 1 206 ? 18.202  -13.030 -12.184 1.00 35.36 ? 206 ILE B CA    1 
ATOM   9538  C  C     . ILE D 1 206 ? 17.579  -12.000 -13.095 1.00 33.22 ? 206 ILE B C     1 
ATOM   9539  O  O     . ILE D 1 206 ? 16.664  -12.299 -13.855 1.00 37.11 ? 206 ILE B O     1 
ATOM   9540  C  CB    . ILE D 1 206 ? 17.405  -13.053 -10.829 1.00 29.32 ? 206 ILE B CB    1 
ATOM   9541  C  CG1   . ILE D 1 206 ? 17.866  -14.244 -9.983  1.00 33.05 ? 206 ILE B CG1   1 
ATOM   9542  C  CG2   . ILE D 1 206 ? 15.925  -13.118 -11.054 1.00 34.99 ? 206 ILE B CG2   1 
ATOM   9543  C  CD1   . ILE D 1 206 ? 17.586  -15.603 -10.607 1.00 38.23 ? 206 ILE B CD1   1 
ATOM   9544  H  H     . ILE D 1 206 ? 19.769  -12.552 -11.103 1.00 38.60 ? 206 ILE B H     1 
ATOM   9545  H  HA    . ILE D 1 206 ? 18.128  -13.911 -12.607 1.00 42.38 ? 206 ILE B HA    1 
ATOM   9546  H  HB    . ILE D 1 206 ? 17.605  -12.237 -10.343 1.00 35.12 ? 206 ILE B HB    1 
ATOM   9547  H  HG12  . ILE D 1 206 ? 18.824  -14.174 -9.845  1.00 39.60 ? 206 ILE B HG12  1 
ATOM   9548  H  HG13  . ILE D 1 206 ? 17.410  -14.213 -9.128  1.00 39.60 ? 206 ILE B HG13  1 
ATOM   9549  H  HG21  . ILE D 1 206 ? 15.481  -13.130 -10.203 1.00 41.92 ? 206 ILE B HG21  1 
ATOM   9550  H  HG22  . ILE D 1 206 ? 15.651  -12.347 -11.556 1.00 41.92 ? 206 ILE B HG22  1 
ATOM   9551  H  HG23  . ILE D 1 206 ? 15.719  -13.918 -11.542 1.00 41.92 ? 206 ILE B HG23  1 
ATOM   9552  H  HD11  . ILE D 1 206 ? 17.905  -16.289 -10.016 1.00 45.81 ? 206 ILE B HD11  1 
ATOM   9553  H  HD12  . ILE D 1 206 ? 16.640  -15.697 -10.739 1.00 45.81 ? 206 ILE B HD12  1 
ATOM   9554  H  HD13  . ILE D 1 206 ? 18.042  -15.659 -11.450 1.00 45.81 ? 206 ILE B HD13  1 
ATOM   9555  N  N     . LEU D 1 207 ? 18.041  -10.765 -12.995 1.00 32.96 ? 207 LEU B N     1 
ATOM   9556  C  CA    . LEU D 1 207 ? 17.431  -9.700  -13.777 1.00 41.86 ? 207 LEU B CA    1 
ATOM   9557  C  C     . LEU D 1 207 ? 17.683  -9.852  -15.281 1.00 45.61 ? 207 LEU B C     1 
ATOM   9558  O  O     . LEU D 1 207 ? 17.038  -9.191  -16.086 1.00 49.20 ? 207 LEU B O     1 
ATOM   9559  C  CB    . LEU D 1 207 ? 17.944  -8.360  -13.293 1.00 35.66 ? 207 LEU B CB    1 
ATOM   9560  C  CG    . LEU D 1 207 ? 17.553  -8.095  -11.838 1.00 42.98 ? 207 LEU B CG    1 
ATOM   9561  C  CD1   . LEU D 1 207 ? 18.319  -6.907  -11.285 1.00 42.39 ? 207 LEU B CD1   1 
ATOM   9562  C  CD2   . LEU D 1 207 ? 16.051  -7.889  -11.738 1.00 45.08 ? 207 LEU B CD2   1 
ATOM   9563  H  H     . LEU D 1 207 ? 18.693  -10.518 -12.492 1.00 39.50 ? 207 LEU B H     1 
ATOM   9564  H  HA    . LEU D 1 207 ? 16.462  -9.719  -13.633 1.00 50.17 ? 207 LEU B HA    1 
ATOM   9565  H  HB2   . LEU D 1 207 ? 18.912  -8.347  -13.354 1.00 42.74 ? 207 LEU B HB2   1 
ATOM   9566  H  HB3   . LEU D 1 207 ? 17.565  -7.656  -13.842 1.00 42.74 ? 207 LEU B HB3   1 
ATOM   9567  H  HG    . LEU D 1 207 ? 17.784  -8.872  -11.305 1.00 51.52 ? 207 LEU B HG    1 
ATOM   9568  H  HD11  . LEU D 1 207 ? 19.260  -7.094  -11.329 1.00 50.80 ? 207 LEU B HD11  1 
ATOM   9569  H  HD12  . LEU D 1 207 ? 18.114  -6.131  -11.812 1.00 50.80 ? 207 LEU B HD12  1 
ATOM   9570  H  HD13  . LEU D 1 207 ? 18.056  -6.763  -10.373 1.00 50.80 ? 207 LEU B HD13  1 
ATOM   9571  H  HD21  . LEU D 1 207 ? 15.819  -7.724  -10.821 1.00 54.03 ? 207 LEU B HD21  1 
ATOM   9572  H  HD22  . LEU D 1 207 ? 15.802  -7.137  -12.279 1.00 54.03 ? 207 LEU B HD22  1 
ATOM   9573  H  HD23  . LEU D 1 207 ? 15.606  -8.680  -12.051 1.00 54.03 ? 207 LEU B HD23  1 
ATOM   9574  N  N     . SER D 1 208 ? 18.613  -10.726 -15.648 1.00 45.51 ? 208 SER B N     1 
ATOM   9575  C  CA    . SER D 1 208 ? 18.952  -10.954 -17.050 1.00 55.36 ? 208 SER B CA    1 
ATOM   9576  C  C     . SER D 1 208 ? 17.917  -11.858 -17.704 1.00 58.66 ? 208 SER B C     1 
ATOM   9577  O  O     . SER D 1 208 ? 17.865  -11.969 -18.929 1.00 58.60 ? 208 SER B O     1 
ATOM   9578  C  CB    . SER D 1 208 ? 20.338  -11.596 -17.169 1.00 57.24 ? 208 SER B CB    1 
ATOM   9579  O  OG    . SER D 1 208 ? 20.317  -12.958 -16.740 1.00 59.42 ? 208 SER B OG    1 
ATOM   9580  H  H     . SER D 1 208 ? 19.068  -11.206 -15.098 1.00 54.55 ? 208 SER B H     1 
ATOM   9581  H  HA    . SER D 1 208 ? 18.963  -10.098 -17.527 1.00 66.37 ? 208 SER B HA    1 
ATOM   9582  H  HB2   . SER D 1 208 ? 20.621  -11.563 -18.096 1.00 68.62 ? 208 SER B HB2   1 
ATOM   9583  H  HB3   . SER D 1 208 ? 20.962  -11.101 -16.615 1.00 68.62 ? 208 SER B HB3   1 
ATOM   9584  H  HG    . SER D 1 208 ? 19.561  -13.165 -16.501 1.00 71.25 ? 208 SER B HG    1 
ATOM   9585  N  N     . LYS D 1 209 ? 17.101  -12.510 -16.880 1.00 52.75 ? 209 LYS B N     1 
ATOM   9586  C  CA    . LYS D 1 209 ? 16.045  -13.382 -17.374 1.00 57.78 ? 209 LYS B CA    1 
ATOM   9587  C  C     . LYS D 1 209 ? 14.666  -12.743 -17.168 1.00 57.59 ? 209 LYS B C     1 
ATOM   9588  O  O     . LYS D 1 209 ? 14.499  -11.863 -16.318 1.00 59.20 ? 209 LYS B O     1 
ATOM   9589  C  CB    . LYS D 1 209 ? 16.124  -14.738 -16.665 1.00 52.16 ? 209 LYS B CB    1 
ATOM   9590  C  CG    . LYS D 1 209 ? 17.221  -15.662 -17.179 1.00 54.76 ? 209 LYS B CG    1 
ATOM   9591  C  CD    . LYS D 1 209 ? 16.819  -16.230 -18.528 1.00 58.79 ? 209 LYS B CD    1 
ATOM   9592  C  CE    . LYS D 1 209 ? 17.632  -17.454 -18.921 1.00 52.67 ? 209 LYS B CE    1 
ATOM   9593  N  NZ    . LYS D 1 209 ? 16.829  -18.376 -19.790 1.00 56.13 ? 209 LYS B NZ    1 
ATOM   9594  H  H     . LYS D 1 209 ? 17.140  -12.462 -16.022 1.00 63.24 ? 209 LYS B H     1 
ATOM   9595  H  HA    . LYS D 1 209 ? 16.172  -13.531 -18.335 1.00 69.28 ? 209 LYS B HA    1 
ATOM   9596  H  HB2   . LYS D 1 209 ? 16.288  -14.585 -15.721 1.00 62.53 ? 209 LYS B HB2   1 
ATOM   9597  H  HB3   . LYS D 1 209 ? 15.277  -15.197 -16.778 1.00 62.53 ? 209 LYS B HB3   1 
ATOM   9598  H  HG2   . LYS D 1 209 ? 18.045  -15.162 -17.286 1.00 65.65 ? 209 LYS B HG2   1 
ATOM   9599  H  HG3   . LYS D 1 209 ? 17.345  -16.398 -16.558 1.00 65.65 ? 209 LYS B HG3   1 
ATOM   9600  H  HD2   . LYS D 1 209 ? 15.885  -16.488 -18.496 1.00 70.49 ? 209 LYS B HD2   1 
ATOM   9601  H  HD3   . LYS D 1 209 ? 16.952  -15.551 -19.208 1.00 70.49 ? 209 LYS B HD3   1 
ATOM   9602  H  HE2   . LYS D 1 209 ? 18.417  -17.173 -19.416 1.00 63.14 ? 209 LYS B HE2   1 
ATOM   9603  H  HE3   . LYS D 1 209 ? 17.892  -17.937 -18.121 1.00 63.14 ? 209 LYS B HE3   1 
ATOM   9604  H  HZ1   . LYS D 1 209 ? 17.317  -19.087 -20.012 1.00 67.29 ? 209 LYS B HZ1   1 
ATOM   9605  H  HZ2   . LYS D 1 209 ? 16.102  -18.649 -19.355 1.00 67.29 ? 209 LYS B HZ2   1 
ATOM   9606  H  HZ3   . LYS D 1 209 ? 16.580  -17.954 -20.533 1.00 67.29 ? 209 LYS B HZ3   1 
ATOM   9607  N  N     . ASN D 1 210 ? 13.684  -13.165 -17.961 1.00 61.31 ? 210 ASN B N     1 
ATOM   9608  C  CA    . ASN D 1 210 ? 12.298  -12.774 -17.720 1.00 61.40 ? 210 ASN B CA    1 
ATOM   9609  C  C     . ASN D 1 210 ? 11.549  -13.898 -17.006 1.00 64.03 ? 210 ASN B C     1 
ATOM   9610  O  O     . ASN D 1 210 ? 12.044  -15.022 -16.910 1.00 62.20 ? 210 ASN B O     1 
ATOM   9611  C  CB    . ASN D 1 210 ? 11.577  -12.427 -19.025 1.00 47.87 ? 210 ASN B CB    1 
ATOM   9612  C  CG    . ASN D 1 210 ? 11.227  -13.663 -19.856 1.00 50.64 ? 210 ASN B CG    1 
ATOM   9613  O  OD1   . ASN D 1 210 ? 10.509  -14.557 -19.396 1.00 61.04 ? 210 ASN B OD1   1 
ATOM   9614  N  ND2   . ASN D 1 210 ? 11.714  -13.700 -21.100 1.00 55.62 ? 210 ASN B ND2   1 
ATOM   9615  H  H     . ASN D 1 210 ? 13.793  -13.676 -18.643 1.00 73.51 ? 210 ASN B H     1 
ATOM   9616  H  HA    . ASN D 1 210 ? 12.283  -11.982 -17.143 1.00 73.62 ? 210 ASN B HA    1 
ATOM   9617  H  HB2   . ASN D 1 210 ? 10.752  -11.962 -18.815 1.00 57.39 ? 210 ASN B HB2   1 
ATOM   9618  H  HB3   . ASN D 1 210 ? 12.151  -11.858 -19.561 1.00 57.39 ? 210 ASN B HB3   1 
ATOM   9619  H  HD21  . ASN D 1 210 ? 12.196  -13.050 -21.392 1.00 66.69 ? 210 ASN B HD21  1 
ATOM   9620  H  HD22  . ASN D 1 210 ? 11.546  -14.373 -21.608 1.00 66.69 ? 210 ASN B HD22  1 
ATOM   9621  N  N     . TYR D 1 211 ? 10.354  -13.601 -16.512 1.00 51.00 ? 211 TYR B N     1 
ATOM   9622  C  CA    . TYR D 1 211 ? 9.588   -14.600 -15.776 1.00 57.24 ? 211 TYR B CA    1 
ATOM   9623  C  C     . TYR D 1 211 ? 9.455   -15.901 -16.576 1.00 59.16 ? 211 TYR B C     1 
ATOM   9624  O  O     . TYR D 1 211 ? 9.921   -16.965 -16.147 1.00 43.77 ? 211 TYR B O     1 
ATOM   9625  C  CB    . TYR D 1 211 ? 8.206   -14.072 -15.411 1.00 47.84 ? 211 TYR B CB    1 
ATOM   9626  C  CG    . TYR D 1 211 ? 7.296   -15.166 -14.908 1.00 55.47 ? 211 TYR B CG    1 
ATOM   9627  C  CD1   . TYR D 1 211 ? 7.402   -15.638 -13.605 1.00 53.72 ? 211 TYR B CD1   1 
ATOM   9628  C  CD2   . TYR D 1 211 ? 6.354   -15.755 -15.745 1.00 54.73 ? 211 TYR B CD2   1 
ATOM   9629  C  CE1   . TYR D 1 211 ? 6.586   -16.654 -13.146 1.00 51.02 ? 211 TYR B CE1   1 
ATOM   9630  C  CE2   . TYR D 1 211 ? 5.534   -16.771 -15.295 1.00 50.69 ? 211 TYR B CE2   1 
ATOM   9631  C  CZ    . TYR D 1 211 ? 5.654   -17.217 -13.994 1.00 55.55 ? 211 TYR B CZ    1 
ATOM   9632  O  OH    . TYR D 1 211 ? 4.845   -18.225 -13.531 1.00 62.19 ? 211 TYR B OH    1 
ATOM   9633  H  H     . TYR D 1 211 ? 9.966   -12.836 -16.587 1.00 61.14 ? 211 TYR B H     1 
ATOM   9634  H  HA    . TYR D 1 211 ? 10.059  -14.808 -14.943 1.00 68.63 ? 211 TYR B HA    1 
ATOM   9635  H  HB2   . TYR D 1 211 ? 8.294   -13.406 -14.710 1.00 57.34 ? 211 TYR B HB2   1 
ATOM   9636  H  HB3   . TYR D 1 211 ? 7.798   -13.677 -16.197 1.00 57.34 ? 211 TYR B HB3   1 
ATOM   9637  H  HD1   . TYR D 1 211 ? 8.031   -15.261 -13.032 1.00 64.41 ? 211 TYR B HD1   1 
ATOM   9638  H  HD2   . TYR D 1 211 ? 6.273   -15.458 -16.622 1.00 65.61 ? 211 TYR B HD2   1 
ATOM   9639  H  HE1   . TYR D 1 211 ? 6.663   -16.957 -12.270 1.00 61.16 ? 211 TYR B HE1   1 
ATOM   9640  H  HE2   . TYR D 1 211 ? 4.905   -17.152 -15.865 1.00 60.77 ? 211 TYR B HE2   1 
ATOM   9641  H  HH    . TYR D 1 211 ? 4.400   -17.959 -12.896 1.00 74.56 ? 211 TYR B HH    1 
ATOM   9642  N  N     . ASN D 1 212 ? 8.838   -15.802 -17.749 1.00 55.85 ? 212 ASN B N     1 
ATOM   9643  C  CA    . ASN D 1 212 ? 8.582   -16.969 -18.581 1.00 51.84 ? 212 ASN B CA    1 
ATOM   9644  C  C     . ASN D 1 212 ? 9.809   -17.851 -18.749 1.00 51.21 ? 212 ASN B C     1 
ATOM   9645  O  O     . ASN D 1 212 ? 9.715   -19.076 -18.708 1.00 56.05 ? 212 ASN B O     1 
ATOM   9646  C  CB    . ASN D 1 212 ? 8.082   -16.537 -19.952 1.00 51.95 ? 212 ASN B CB    1 
ATOM   9647  C  CG    . ASN D 1 212 ? 7.484   -17.678 -20.722 1.00 60.25 ? 212 ASN B CG    1 
ATOM   9648  O  OD1   . ASN D 1 212 ? 8.201   -18.471 -21.340 1.00 64.75 ? 212 ASN B OD1   1 
ATOM   9649  N  ND2   . ASN D 1 212 ? 6.160   -17.790 -20.675 1.00 63.37 ? 212 ASN B ND2   1 
ATOM   9650  H  H     . ASN D 1 212 ? 8.556   -15.063 -18.087 1.00 66.96 ? 212 ASN B H     1 
ATOM   9651  H  HA    . ASN D 1 212 ? 7.879   -17.509 -18.161 1.00 62.14 ? 212 ASN B HA    1 
ATOM   9652  H  HB2   . ASN D 1 212 ? 7.400   -15.857 -19.842 1.00 62.28 ? 212 ASN B HB2   1 
ATOM   9653  H  HB3   . ASN D 1 212 ? 8.826   -16.184 -20.465 1.00 62.28 ? 212 ASN B HB3   1 
ATOM   9654  H  HD21  . ASN D 1 212 ? 5.696   -17.225 -20.221 1.00 75.98 ? 212 ASN B HD21  1 
ATOM   9655  H  HD22  . ASN D 1 212 ? 5.767   -18.426 -21.099 1.00 75.98 ? 212 ASN B HD22  1 
ATOM   9656  N  N     . GLU D 1 213 ? 10.964  -17.227 -18.944 1.00 49.77 ? 213 GLU B N     1 
ATOM   9657  C  CA    . GLU D 1 213 ? 12.208  -17.969 -19.057 1.00 56.84 ? 213 GLU B CA    1 
ATOM   9658  C  C     . GLU D 1 213 ? 12.512  -18.624 -17.726 1.00 55.64 ? 213 GLU B C     1 
ATOM   9659  O  O     . GLU D 1 213 ? 12.747  -19.820 -17.656 1.00 52.38 ? 213 GLU B O     1 
ATOM   9660  C  CB    . GLU D 1 213 ? 13.356  -17.039 -19.438 1.00 64.71 ? 213 GLU B CB    1 
ATOM   9661  C  CG    . GLU D 1 213 ? 13.281  -16.518 -20.864 1.00 71.70 ? 213 GLU B CG    1 
ATOM   9662  C  CD    . GLU D 1 213 ? 14.219  -15.344 -21.114 1.00 76.98 ? 213 GLU B CD    1 
ATOM   9663  O  OE1   . GLU D 1 213 ? 14.611  -14.654 -20.140 1.00 74.99 ? 213 GLU B OE1   1 
ATOM   9664  O  OE2   . GLU D 1 213 ? 14.569  -15.116 -22.292 1.00 77.93 ? 213 GLU B OE2   1 
ATOM   9665  H  H     . GLU D 1 213 ? 11.053  -16.375 -19.016 1.00 59.66 ? 213 GLU B H     1 
ATOM   9666  H  HA    . GLU D 1 213 ? 12.121  -18.665 -19.741 1.00 68.14 ? 213 GLU B HA    1 
ATOM   9667  H  HB2   . GLU D 1 213 ? 13.348  -16.273 -18.842 1.00 77.59 ? 213 GLU B HB2   1 
ATOM   9668  H  HB3   . GLU D 1 213 ? 14.193  -17.521 -19.343 1.00 77.59 ? 213 GLU B HB3   1 
ATOM   9669  H  HG2   . GLU D 1 213 ? 13.524  -17.231 -21.475 1.00 85.98 ? 213 GLU B HG2   1 
ATOM   9670  H  HG3   . GLU D 1 213 ? 12.375  -16.221 -21.045 1.00 85.98 ? 213 GLU B HG3   1 
ATOM   9671  N  N     . LEU D 1 214 ? 12.492  -17.821 -16.668 1.00 51.50 ? 214 LEU B N     1 
ATOM   9672  C  CA    . LEU D 1 214 ? 12.872  -18.283 -15.342 1.00 49.87 ? 214 LEU B CA    1 
ATOM   9673  C  C     . LEU D 1 214 ? 11.935  -19.391 -14.860 1.00 39.39 ? 214 LEU B C     1 
ATOM   9674  O  O     . LEU D 1 214 ? 12.385  -20.377 -14.288 1.00 42.44 ? 214 LEU B O     1 
ATOM   9675  C  CB    . LEU D 1 214 ? 12.850  -17.104 -14.357 1.00 46.23 ? 214 LEU B CB    1 
ATOM   9676  C  CG    . LEU D 1 214 ? 13.510  -17.389 -13.009 1.00 44.09 ? 214 LEU B CG    1 
ATOM   9677  C  CD1   . LEU D 1 214 ? 14.965  -17.755 -13.207 1.00 37.58 ? 214 LEU B CD1   1 
ATOM   9678  C  CD2   . LEU D 1 214 ? 13.370  -16.183 -12.058 1.00 40.46 ? 214 LEU B CD2   1 
ATOM   9679  H  H     . LEU D 1 214 ? 12.260  -16.993 -16.695 1.00 61.74 ? 214 LEU B H     1 
ATOM   9680  H  HA    . LEU D 1 214 ? 13.784  -18.642 -15.372 1.00 59.78 ? 214 LEU B HA    1 
ATOM   9681  H  HB2   . LEU D 1 214 ? 13.315  -16.355 -14.760 1.00 55.42 ? 214 LEU B HB2   1 
ATOM   9682  H  HB3   . LEU D 1 214 ? 11.926  -16.861 -14.186 1.00 55.42 ? 214 LEU B HB3   1 
ATOM   9683  H  HG    . LEU D 1 214 ? 13.067  -18.147 -12.596 1.00 52.84 ? 214 LEU B HG    1 
ATOM   9684  H  HD11  . LEU D 1 214 ? 15.362  -17.930 -12.351 1.00 45.03 ? 214 LEU B HD11  1 
ATOM   9685  H  HD12  . LEU D 1 214 ? 15.017  -18.538 -13.759 1.00 45.03 ? 214 LEU B HD12  1 
ATOM   9686  H  HD13  . LEU D 1 214 ? 15.415  -17.022 -13.634 1.00 45.03 ? 214 LEU B HD13  1 
ATOM   9687  H  HD21  . LEU D 1 214 ? 13.794  -16.393 -11.223 1.00 48.49 ? 214 LEU B HD21  1 
ATOM   9688  H  HD22  . LEU D 1 214 ? 13.793  -15.419 -12.458 1.00 48.49 ? 214 LEU B HD22  1 
ATOM   9689  H  HD23  . LEU D 1 214 ? 12.437  -16.004 -11.917 1.00 48.49 ? 214 LEU B HD23  1 
ATOM   9690  N  N     . GLU D 1 215 ? 10.637  -19.216 -15.097 1.00 43.02 ? 215 GLU B N     1 
ATOM   9691  C  CA    . GLU D 1 215 ? 9.635   -20.170 -14.637 1.00 47.29 ? 215 GLU B CA    1 
ATOM   9692  C  C     . GLU D 1 215 ? 9.995   -21.565 -15.112 1.00 51.85 ? 215 GLU B C     1 
ATOM   9693  O  O     . GLU D 1 215 ? 9.916   -22.535 -14.355 1.00 50.01 ? 215 GLU B O     1 
ATOM   9694  C  CB    . GLU D 1 215 ? 8.242   -19.783 -15.132 1.00 49.22 ? 215 GLU B CB    1 
ATOM   9695  C  CG    . GLU D 1 215 ? 7.106   -20.729 -14.675 1.00 57.25 ? 215 GLU B CG    1 
ATOM   9696  C  CD    . GLU D 1 215 ? 7.144   -22.111 -15.344 1.00 62.05 ? 215 GLU B CD    1 
ATOM   9697  O  OE1   . GLU D 1 215 ? 7.387   -22.178 -16.564 1.00 56.89 ? 215 GLU B OE1   1 
ATOM   9698  O  OE2   . GLU D 1 215 ? 6.930   -23.135 -14.651 1.00 61.88 ? 215 GLU B OE2   1 
ATOM   9699  H  H     . GLU D 1 215 ? 10.309  -18.546 -15.526 1.00 51.57 ? 215 GLU B H     1 
ATOM   9700  H  HA    . GLU D 1 215 ? 9.620   -20.174 -13.657 1.00 56.68 ? 215 GLU B HA    1 
ATOM   9701  H  HB2   . GLU D 1 215 ? 8.033   -18.894 -14.804 1.00 59.01 ? 215 GLU B HB2   1 
ATOM   9702  H  HB3   . GLU D 1 215 ? 8.249   -19.779 -16.102 1.00 59.01 ? 215 GLU B HB3   1 
ATOM   9703  H  HG2   . GLU D 1 215 ? 7.176   -20.862 -13.716 1.00 68.64 ? 215 GLU B HG2   1 
ATOM   9704  H  HG3   . GLU D 1 215 ? 6.253   -20.320 -14.889 1.00 68.64 ? 215 GLU B HG3   1 
ATOM   9705  N  N     . LYS D 1 216 ? 10.413  -21.674 -16.365 1.00 50.96 ? 216 LYS B N     1 
ATOM   9706  C  CA    . LYS D 1 216 ? 10.759  -22.979 -16.909 1.00 55.62 ? 216 LYS B CA    1 
ATOM   9707  C  C     . LYS D 1 216 ? 11.885  -23.633 -16.093 1.00 50.17 ? 216 LYS B C     1 
ATOM   9708  O  O     . LYS D 1 216 ? 12.018  -24.855 -16.069 1.00 50.61 ? 216 LYS B O     1 
ATOM   9709  C  CB    . LYS D 1 216 ? 11.141  -22.853 -18.393 1.00 61.25 ? 216 LYS B CB    1 
ATOM   9710  C  CG    . LYS D 1 216 ? 10.009  -22.299 -19.280 1.00 64.49 ? 216 LYS B CG    1 
ATOM   9711  C  CD    . LYS D 1 216 ? 10.397  -22.282 -20.758 1.00 73.27 ? 216 LYS B CD    1 
ATOM   9712  C  CE    . LYS D 1 216 ? 9.180   -22.103 -21.668 1.00 78.43 ? 216 LYS B CE    1 
ATOM   9713  N  NZ    . LYS D 1 216 ? 9.066   -20.723 -22.235 1.00 74.78 ? 216 LYS B NZ    1 
ATOM   9714  H  H     . LYS D 1 216 ? 10.504  -21.019 -16.914 1.00 61.09 ? 216 LYS B H     1 
ATOM   9715  H  HA    . LYS D 1 216 ? 9.974   -23.562 -16.852 1.00 66.68 ? 216 LYS B HA    1 
ATOM   9716  H  HB2   . LYS D 1 216 ? 11.900  -22.253 -18.470 1.00 73.44 ? 216 LYS B HB2   1 
ATOM   9717  H  HB3   . LYS D 1 216 ? 11.380  -23.731 -18.730 1.00 73.44 ? 216 LYS B HB3   1 
ATOM   9718  H  HG2   . LYS D 1 216 ? 9.223   -22.858 -19.180 1.00 77.33 ? 216 LYS B HG2   1 
ATOM   9719  H  HG3   . LYS D 1 216 ? 9.808   -21.389 -19.010 1.00 77.33 ? 216 LYS B HG3   1 
ATOM   9720  H  HD2   . LYS D 1 216 ? 11.007  -21.545 -20.919 1.00 87.86 ? 216 LYS B HD2   1 
ATOM   9721  H  HD3   . LYS D 1 216 ? 10.823  -23.124 -20.985 1.00 87.86 ? 216 LYS B HD3   1 
ATOM   9722  H  HE2   . LYS D 1 216 ? 9.246   -22.725 -22.408 1.00 94.06 ? 216 LYS B HE2   1 
ATOM   9723  H  HE3   . LYS D 1 216 ? 8.376   -22.282 -21.156 1.00 94.06 ? 216 LYS B HE3   1 
ATOM   9724  H  HZ1   . LYS D 1 216 ? 8.993   -20.129 -21.577 1.00 89.67 ? 216 LYS B HZ1   1 
ATOM   9725  H  HZ2   . LYS D 1 216 ? 9.788   -20.533 -22.719 1.00 89.67 ? 216 LYS B HZ2   1 
ATOM   9726  H  HZ3   . LYS D 1 216 ? 8.346   -20.667 -22.755 1.00 89.67 ? 216 LYS B HZ3   1 
ATOM   9727  N  N     . ILE D 1 217 ? 12.686  -22.817 -15.416 0.89 48.14 ? 217 ILE B N     1 
ATOM   9728  C  CA    . ILE D 1 217 ? 13.816  -23.323 -14.651 0.89 40.95 ? 217 ILE B CA    1 
ATOM   9729  C  C     . ILE D 1 217 ? 13.481  -23.509 -13.173 0.89 48.25 ? 217 ILE B C     1 
ATOM   9730  O  O     . ILE D 1 217 ? 14.008  -24.424 -12.538 0.89 48.70 ? 217 ILE B O     1 
ATOM   9731  C  CB    . ILE D 1 217 ? 15.029  -22.373 -14.717 0.89 45.60 ? 217 ILE B CB    1 
ATOM   9732  C  CG1   . ILE D 1 217 ? 15.510  -22.204 -16.154 0.89 54.46 ? 217 ILE B CG1   1 
ATOM   9733  C  CG2   . ILE D 1 217 ? 16.178  -22.893 -13.867 0.89 47.47 ? 217 ILE B CG2   1 
ATOM   9734  C  CD1   . ILE D 1 217 ? 14.820  -21.093 -16.867 0.89 55.39 ? 217 ILE B CD1   1 
ATOM   9735  H  H     . ILE D 1 217 ? 12.596  -21.962 -15.385 0.89 57.70 ? 217 ILE B H     1 
ATOM   9736  H  HA    . ILE D 1 217 ? 14.087  -24.192 -15.015 0.89 49.08 ? 217 ILE B HA    1 
ATOM   9737  H  HB    . ILE D 1 217 ? 14.761  -21.505 -14.377 0.89 54.66 ? 217 ILE B HB    1 
ATOM   9738  H  HG12  . ILE D 1 217 ? 16.460  -22.013 -16.149 0.89 65.29 ? 217 ILE B HG12  1 
ATOM   9739  H  HG13  . ILE D 1 217 ? 15.339  -23.025 -16.642 0.89 65.29 ? 217 ILE B HG13  1 
ATOM   9740  H  HG21  . ILE D 1 217 ? 15.885  -22.961 -12.955 0.89 56.90 ? 217 ILE B HG21  1 
ATOM   9741  H  HG22  . ILE D 1 217 ? 16.441  -23.757 -14.192 0.89 56.90 ? 217 ILE B HG22  1 
ATOM   9742  H  HG23  . ILE D 1 217 ? 16.915  -22.280 -13.931 0.89 56.90 ? 217 ILE B HG23  1 
ATOM   9743  H  HD11  . ILE D 1 217 ? 14.986  -20.271 -16.399 0.89 66.41 ? 217 ILE B HD11  1 
ATOM   9744  H  HD12  . ILE D 1 217 ? 15.163  -21.036 -17.762 0.89 66.41 ? 217 ILE B HD12  1 
ATOM   9745  H  HD13  . ILE D 1 217 ? 13.877  -21.273 -16.888 0.89 66.41 ? 217 ILE B HD13  1 
ATOM   9746  N  N     . THR D 1 218 ? 12.632  -22.641 -12.616 1.00 46.65 ? 218 THR B N     1 
ATOM   9747  C  CA    . THR D 1 218 ? 12.414  -22.619 -11.160 1.00 45.75 ? 218 THR B CA    1 
ATOM   9748  C  C     . THR D 1 218 ? 11.010  -23.005 -10.692 1.00 43.72 ? 218 THR B C     1 
ATOM   9749  O  O     . THR D 1 218 ? 10.792  -23.242 -9.502  1.00 40.36 ? 218 THR B O     1 
ATOM   9750  C  CB    . THR D 1 218 ? 12.690  -21.214 -10.559 1.00 33.58 ? 218 THR B CB    1 
ATOM   9751  O  OG1   . THR D 1 218 ? 11.808  -20.253 -11.153 1.00 36.82 ? 218 THR B OG1   1 
ATOM   9752  C  CG2   . THR D 1 218 ? 14.134  -20.792 -10.769 1.00 41.33 ? 218 THR B CG2   1 
ATOM   9753  H  H     . THR D 1 218 ? 12.172  -22.059 -13.052 1.00 55.92 ? 218 THR B H     1 
ATOM   9754  H  HA    . THR D 1 218 ? 13.044  -23.246 -10.745 1.00 54.83 ? 218 THR B HA    1 
ATOM   9755  H  HB    . THR D 1 218 ? 12.525  -21.244 -9.604  1.00 40.24 ? 218 THR B HB    1 
ATOM   9756  H  HG1   . THR D 1 218 ? 11.028  -20.459 -11.005 1.00 44.13 ? 218 THR B HG1   1 
ATOM   9757  H  HG21  . THR D 1 218 ? 14.280  -19.923 -10.390 1.00 49.53 ? 218 THR B HG21  1 
ATOM   9758  H  HG22  . THR D 1 218 ? 14.724  -21.420 -10.345 1.00 49.53 ? 218 THR B HG22  1 
ATOM   9759  H  HG23  . THR D 1 218 ? 14.334  -20.761 -11.707 1.00 49.53 ? 218 THR B HG23  1 
ATOM   9760  N  N     . GLY D 1 219 ? 10.055  -23.055 -11.605 1.00 35.31 ? 219 GLY B N     1 
ATOM   9761  C  CA    . GLY D 1 219 ? 8.668   -23.152 -11.198 1.00 39.23 ? 219 GLY B CA    1 
ATOM   9762  C  C     . GLY D 1 219 ? 8.197   -21.754 -10.859 1.00 37.96 ? 219 GLY B C     1 
ATOM   9763  O  O     . GLY D 1 219 ? 9.028   -20.884 -10.580 1.00 41.16 ? 219 GLY B O     1 
ATOM   9764  H  H     . GLY D 1 219 ? 10.181  -23.035 -12.455 1.00 42.31 ? 219 GLY B H     1 
ATOM   9765  H  HA2   . GLY D 1 219 ? 8.127   -23.509 -11.920 1.00 47.01 ? 219 GLY B HA2   1 
ATOM   9766  H  HA3   . GLY D 1 219 ? 8.582   -23.721 -10.417 1.00 47.01 ? 219 GLY B HA3   1 
ATOM   9767  N  N     . LYS D 1 220 ? 6.881   -21.553 -10.872 1.00 33.24 ? 220 LYS B N     1 
ATOM   9768  C  CA    . LYS D 1 220 ? 6.249   -20.235 -10.763 1.00 33.13 ? 220 LYS B CA    1 
ATOM   9769  C  C     . LYS D 1 220 ? 6.558   -19.476 -9.474  1.00 44.42 ? 220 LYS B C     1 
ATOM   9770  O  O     . LYS D 1 220 ? 6.999   -18.322 -9.501  1.00 35.50 ? 220 LYS B O     1 
ATOM   9771  C  CB    . LYS D 1 220 ? 4.740   -20.403 -10.856 1.00 34.83 ? 220 LYS B CB    1 
ATOM   9772  C  CG    . LYS D 1 220 ? 3.936   -19.192 -10.427 1.00 45.74 ? 220 LYS B CG    1 
ATOM   9773  C  CD    . LYS D 1 220 ? 2.454   -19.443 -10.643 1.00 48.32 ? 220 LYS B CD    1 
ATOM   9774  C  CE    . LYS D 1 220 ? 1.702   -18.165 -10.954 1.00 58.29 ? 220 LYS B CE    1 
ATOM   9775  N  NZ    . LYS D 1 220 ? 0.277   -18.438 -11.294 1.00 57.51 ? 220 LYS B NZ    1 
ATOM   9776  H  H     . LYS D 1 220 ? 6.310   -22.191 -10.945 1.00 39.82 ? 220 LYS B H     1 
ATOM   9777  H  HA    . LYS D 1 220 ? 6.539   -19.680 -11.517 1.00 39.69 ? 220 LYS B HA    1 
ATOM   9778  H  HB2   . LYS D 1 220 ? 4.507   -20.598 -11.777 1.00 41.73 ? 220 LYS B HB2   1 
ATOM   9779  H  HB3   . LYS D 1 220 ? 4.476   -21.145 -10.289 1.00 41.73 ? 220 LYS B HB3   1 
ATOM   9780  H  HG2   . LYS D 1 220 ? 4.086   -19.020 -9.484  1.00 54.83 ? 220 LYS B HG2   1 
ATOM   9781  H  HG3   . LYS D 1 220 ? 4.199   -18.424 -10.958 1.00 54.83 ? 220 LYS B HG3   1 
ATOM   9782  H  HD2   . LYS D 1 220 ? 2.340   -20.051 -11.390 1.00 57.93 ? 220 LYS B HD2   1 
ATOM   9783  H  HD3   . LYS D 1 220 ? 2.076   -19.828 -9.837  1.00 57.93 ? 220 LYS B HD3   1 
ATOM   9784  H  HE2   . LYS D 1 220 ? 1.723   -17.584 -10.178 1.00 69.89 ? 220 LYS B HE2   1 
ATOM   9785  H  HE3   . LYS D 1 220 ? 2.116   -17.726 -11.713 1.00 69.89 ? 220 LYS B HE3   1 
ATOM   9786  H  HZ1   . LYS D 1 220 ? 0.231   -18.968 -12.007 1.00 68.95 ? 220 LYS B HZ1   1 
ATOM   9787  H  HZ2   . LYS D 1 220 ? -0.127  -18.838 -10.609 1.00 68.95 ? 220 LYS B HZ2   1 
ATOM   9788  H  HZ3   . LYS D 1 220 ? -0.145  -17.675 -11.472 1.00 68.95 ? 220 LYS B HZ3   1 
ATOM   9789  N  N     . ALA D 1 221 ? 6.276   -20.119 -8.345  1.00 42.74 ? 221 ALA B N     1 
ATOM   9790  C  CA    . ALA D 1 221 ? 6.458   -19.492 -7.044  1.00 38.99 ? 221 ALA B CA    1 
ATOM   9791  C  C     . ALA D 1 221 ? 7.882   -18.969 -6.885  1.00 26.80 ? 221 ALA B C     1 
ATOM   9792  O  O     . ALA D 1 221 ? 8.081   -17.820 -6.503  1.00 28.07 ? 221 ALA B O     1 
ATOM   9793  C  CB    . ALA D 1 221 ? 6.146   -20.492 -5.938  1.00 38.29 ? 221 ALA B CB    1 
ATOM   9794  H  H     . ALA D 1 221 ? 5.976   -20.924 -8.307  1.00 51.22 ? 221 ALA B H     1 
ATOM   9795  H  HA    . ALA D 1 221 ? 5.841   -18.736 -6.959  1.00 46.72 ? 221 ALA B HA    1 
ATOM   9796  H  HB1   . ALA D 1 221 ? 5.235   -20.783 -6.028  1.00 45.89 ? 221 ALA B HB1   1 
ATOM   9797  H  HB2   . ALA D 1 221 ? 6.739   -21.242 -6.018  1.00 45.89 ? 221 ALA B HB2   1 
ATOM   9798  H  HB3   . ALA D 1 221 ? 6.270   -20.064 -5.087  1.00 45.89 ? 221 ALA B HB3   1 
ATOM   9799  N  N     . LYS D 1 222 ? 8.857   -19.828 -7.157  1.00 31.84 ? 222 LYS B N     1 
ATOM   9800  C  CA    . LYS D 1 222 ? 10.260  -19.466 -7.007  1.00 31.28 ? 222 LYS B CA    1 
ATOM   9801  C  C     . LYS D 1 222 ? 10.676  -18.359 -7.997  1.00 32.10 ? 222 LYS B C     1 
ATOM   9802  O  O     . LYS D 1 222 ? 11.479  -17.494 -7.660  1.00 25.54 ? 222 LYS B O     1 
ATOM   9803  C  CB    . LYS D 1 222 ? 11.161  -20.685 -7.176  1.00 39.04 ? 222 LYS B CB    1 
ATOM   9804  C  CG    . LYS D 1 222 ? 11.071  -21.706 -6.063  1.00 45.48 ? 222 LYS B CG    1 
ATOM   9805  C  CD    . LYS D 1 222 ? 11.549  -21.137 -4.751  1.00 45.28 ? 222 LYS B CD    1 
ATOM   9806  C  CE    . LYS D 1 222 ? 11.365  -22.149 -3.607  1.00 50.25 ? 222 LYS B CE    1 
ATOM   9807  N  NZ    . LYS D 1 222 ? 12.158  -23.404 -3.817  1.00 47.17 ? 222 LYS B NZ    1 
ATOM   9808  H  H     . LYS D 1 222 ? 8.730   -20.633 -7.433  1.00 38.14 ? 222 LYS B H     1 
ATOM   9809  H  HA    . LYS D 1 222 ? 10.397  -19.120 -6.100  1.00 37.47 ? 222 LYS B HA    1 
ATOM   9810  H  HB2   . LYS D 1 222 ? 10.923  -21.132 -8.003  1.00 46.78 ? 222 LYS B HB2   1 
ATOM   9811  H  HB3   . LYS D 1 222 ? 12.082  -20.383 -7.222  1.00 46.78 ? 222 LYS B HB3   1 
ATOM   9812  H  HG2   . LYS D 1 222 ? 10.147  -21.982 -5.955  1.00 54.51 ? 222 LYS B HG2   1 
ATOM   9813  H  HG3   . LYS D 1 222 ? 11.626  -22.470 -6.284  1.00 54.51 ? 222 LYS B HG3   1 
ATOM   9814  H  HD2   . LYS D 1 222 ? 12.493  -20.922 -4.819  1.00 54.28 ? 222 LYS B HD2   1 
ATOM   9815  H  HD3   . LYS D 1 222 ? 11.037  -20.341 -4.540  1.00 54.28 ? 222 LYS B HD3   1 
ATOM   9816  H  HE2   . LYS D 1 222 ? 11.658  -21.743 -2.776  1.00 60.24 ? 222 LYS B HE2   1 
ATOM   9817  H  HE3   . LYS D 1 222 ? 10.428  -22.392 -3.547  1.00 60.24 ? 222 LYS B HE3   1 
ATOM   9818  H  HZ1   . LYS D 1 222 ? 13.026  -23.210 -3.870  1.00 56.54 ? 222 LYS B HZ1   1 
ATOM   9819  H  HZ2   . LYS D 1 222 ? 12.027  -23.963 -3.138  1.00 56.54 ? 222 LYS B HZ2   1 
ATOM   9820  H  HZ3   . LYS D 1 222 ? 11.905  -23.801 -4.572  1.00 56.54 ? 222 LYS B HZ3   1 
ATOM   9821  N  N     . ALA D 1 223 ? 10.118  -18.377 -9.200  1.00 33.92 ? 223 ALA B N     1 
ATOM   9822  C  CA    . ALA D 1 223 ? 10.400  -17.309 -10.175 1.00 34.77 ? 223 ALA B CA    1 
ATOM   9823  C  C     . ALA D 1 223 ? 9.925   -15.932 -9.685  1.00 28.20 ? 223 ALA B C     1 
ATOM   9824  O  O     . ALA D 1 223 ? 10.653  -14.934 -9.761  1.00 30.59 ? 223 ALA B O     1 
ATOM   9825  C  CB    . ALA D 1 223 ? 9.763   -17.639 -11.519 1.00 30.65 ? 223 ALA B CB    1 
ATOM   9826  H  H     . ALA D 1 223 ? 9.577   -18.984 -9.482  1.00 40.65 ? 223 ALA B H     1 
ATOM   9827  H  HA    . ALA D 1 223 ? 11.370  -17.257 -10.311 1.00 41.66 ? 223 ALA B HA    1 
ATOM   9828  H  HB1   . ALA D 1 223 ? 9.959   -16.932 -12.139 1.00 36.72 ? 223 ALA B HB1   1 
ATOM   9829  H  HB2   . ALA D 1 223 ? 10.126  -18.467 -11.841 1.00 36.72 ? 223 ALA B HB2   1 
ATOM   9830  H  HB3   . ALA D 1 223 ? 8.814   -17.719 -11.403 1.00 36.72 ? 223 ALA B HB3   1 
ATOM   9831  N  N     . LEU D 1 224 ? 8.699   -15.863 -9.191  1.00 23.71 ? 224 LEU B N     1 
ATOM   9832  C  CA    . LEU D 1 224 ? 8.146   -14.599 -8.755  1.00 26.86 ? 224 LEU B CA    1 
ATOM   9833  C  C     . LEU D 1 224 ? 8.945   -14.067 -7.591  1.00 26.54 ? 224 LEU B C     1 
ATOM   9834  O  O     . LEU D 1 224 ? 9.198   -12.872 -7.485  1.00 22.98 ? 224 LEU B O     1 
ATOM   9835  C  CB    . LEU D 1 224 ? 6.709   -14.787 -8.292  1.00 35.65 ? 224 LEU B CB    1 
ATOM   9836  C  CG    . LEU D 1 224 ? 5.767   -15.325 -9.348  1.00 46.48 ? 224 LEU B CG    1 
ATOM   9837  C  CD1   . LEU D 1 224 ? 4.495   -15.835 -8.684  1.00 40.74 ? 224 LEU B CD1   1 
ATOM   9838  C  CD2   . LEU D 1 224 ? 5.487   -14.221 -10.355 1.00 40.40 ? 224 LEU B CD2   1 
ATOM   9839  H  H     . LEU D 1 224 ? 8.170   -16.535 -9.098  1.00 28.40 ? 224 LEU B H     1 
ATOM   9840  H  HA    . LEU D 1 224 ? 8.168   -13.948 -9.487  1.00 32.17 ? 224 LEU B HA    1 
ATOM   9841  H  HB2   . LEU D 1 224 ? 6.703   -15.411 -7.549  1.00 42.72 ? 224 LEU B HB2   1 
ATOM   9842  H  HB3   . LEU D 1 224 ? 6.363   -13.929 -8.000  1.00 42.72 ? 224 LEU B HB3   1 
ATOM   9843  H  HG    . LEU D 1 224 ? 6.190   -16.065 -9.812  1.00 55.72 ? 224 LEU B HG    1 
ATOM   9844  H  HD11  . LEU D 1 224 ? 4.075   -15.110 -8.215  1.00 48.83 ? 224 LEU B HD11  1 
ATOM   9845  H  HD12  . LEU D 1 224 ? 3.904   -16.174 -9.360  1.00 48.83 ? 224 LEU B HD12  1 
ATOM   9846  H  HD13  . LEU D 1 224 ? 4.723   -16.535 -8.068  1.00 48.83 ? 224 LEU B HD13  1 
ATOM   9847  H  HD21  . LEU D 1 224 ? 5.084   -13.479 -9.899  1.00 48.41 ? 224 LEU B HD21  1 
ATOM   9848  H  HD22  . LEU D 1 224 ? 6.315   -13.948 -10.757 1.00 48.41 ? 224 LEU B HD22  1 
ATOM   9849  H  HD23  . LEU D 1 224 ? 4.891   -14.557 -11.028 1.00 48.41 ? 224 LEU B HD23  1 
ATOM   9850  N  N     . TYR D 1 225 ? 9.300   -14.986 -6.697  1.00 24.91 ? 225 TYR B N     1 
ATOM   9851  C  CA    . TYR D 1 225 ? 10.064  -14.653 -5.483  1.00 26.26 ? 225 TYR B CA    1 
ATOM   9852  C  C     . TYR D 1 225 ? 11.446  -14.080 -5.824  1.00 24.71 ? 225 TYR B C     1 
ATOM   9853  O  O     . TYR D 1 225 ? 11.812  -13.007 -5.352  1.00 21.91 ? 225 TYR B O     1 
ATOM   9854  C  CB    . TYR D 1 225 ? 10.160  -15.915 -4.618  1.00 27.12 ? 225 TYR B CB    1 
ATOM   9855  C  CG    . TYR D 1 225 ? 11.230  -15.922 -3.548  1.00 26.64 ? 225 TYR B CG    1 
ATOM   9856  C  CD1   . TYR D 1 225 ? 11.243  -14.955 -2.554  1.00 26.28 ? 225 TYR B CD1   1 
ATOM   9857  C  CD2   . TYR D 1 225 ? 12.195  -16.920 -3.512  1.00 27.37 ? 225 TYR B CD2   1 
ATOM   9858  C  CE1   . TYR D 1 225 ? 12.191  -14.966 -1.575  1.00 31.89 ? 225 TYR B CE1   1 
ATOM   9859  C  CE2   . TYR D 1 225 ? 13.167  -16.942 -2.524  1.00 30.18 ? 225 TYR B CE2   1 
ATOM   9860  C  CZ    . TYR D 1 225 ? 13.147  -15.960 -1.550  1.00 34.28 ? 225 TYR B CZ    1 
ATOM   9861  O  OH    . TYR D 1 225 ? 14.092  -15.946 -0.547  1.00 35.29 ? 225 TYR B OH    1 
ATOM   9862  H  H     . TYR D 1 225 ? 9.111   -15.822 -6.767  1.00 29.83 ? 225 TYR B H     1 
ATOM   9863  H  HA    . TYR D 1 225 ? 9.573   -13.975 -4.974  1.00 31.46 ? 225 TYR B HA    1 
ATOM   9864  H  HB2   . TYR D 1 225 ? 9.308   -16.042 -4.173  1.00 32.48 ? 225 TYR B HB2   1 
ATOM   9865  H  HB3   . TYR D 1 225 ? 10.332  -16.670 -5.202  1.00 32.48 ? 225 TYR B HB3   1 
ATOM   9866  H  HD1   . TYR D 1 225 ? 10.598  -14.285 -2.559  1.00 31.47 ? 225 TYR B HD1   1 
ATOM   9867  H  HD2   . TYR D 1 225 ? 12.196  -17.579 -4.168  1.00 32.78 ? 225 TYR B HD2   1 
ATOM   9868  H  HE1   . TYR D 1 225 ? 12.187  -14.308 -0.917  1.00 38.21 ? 225 TYR B HE1   1 
ATOM   9869  H  HE2   . TYR D 1 225 ? 13.812  -17.612 -2.508  1.00 36.16 ? 225 TYR B HE2   1 
ATOM   9870  H  HH    . TYR D 1 225 ? 14.844  -15.888 -0.870  1.00 42.29 ? 225 TYR B HH    1 
ATOM   9871  N  N     . LEU D 1 226 ? 12.189  -14.788 -6.669  1.00 23.94 ? 226 LEU B N     1 
ATOM   9872  C  CA    . LEU D 1 226 ? 13.540  -14.377 -7.046  1.00 21.57 ? 226 LEU B CA    1 
ATOM   9873  C  C     . LEU D 1 226 ? 13.539  -13.033 -7.788  1.00 27.32 ? 226 LEU B C     1 
ATOM   9874  O  O     . LEU D 1 226 ? 14.396  -12.169 -7.553  1.00 23.05 ? 226 LEU B O     1 
ATOM   9875  C  CB    . LEU D 1 226 ? 14.163  -15.466 -7.901  1.00 26.18 ? 226 LEU B CB    1 
ATOM   9876  C  CG    . LEU D 1 226 ? 14.657  -16.662 -7.094  1.00 27.40 ? 226 LEU B CG    1 
ATOM   9877  C  CD1   . LEU D 1 226 ? 15.043  -17.812 -8.006  1.00 35.65 ? 226 LEU B CD1   1 
ATOM   9878  C  CD2   . LEU D 1 226 ? 15.847  -16.246 -6.237  1.00 29.96 ? 226 LEU B CD2   1 
ATOM   9879  H  H     . LEU D 1 226 ? 11.931  -15.518 -7.042  1.00 28.67 ? 226 LEU B H     1 
ATOM   9880  H  HA    . LEU D 1 226 ? 14.082  -14.277 -6.236  1.00 25.82 ? 226 LEU B HA    1 
ATOM   9881  H  HB2   . LEU D 1 226 ? 13.501  -15.787 -8.534  1.00 31.36 ? 226 LEU B HB2   1 
ATOM   9882  H  HB3   . LEU D 1 226 ? 14.922  -15.095 -8.378  1.00 31.36 ? 226 LEU B HB3   1 
ATOM   9883  H  HG    . LEU D 1 226 ? 13.948  -16.965 -6.505  1.00 32.82 ? 226 LEU B HG    1 
ATOM   9884  H  HD11  . LEU D 1 226 ? 15.348  -18.547 -7.469  1.00 42.72 ? 226 LEU B HD11  1 
ATOM   9885  H  HD12  . LEU D 1 226 ? 14.274  -18.077 -8.518  1.00 42.72 ? 226 LEU B HD12  1 
ATOM   9886  H  HD13  . LEU D 1 226 ? 15.744  -17.522 -8.594  1.00 42.72 ? 226 LEU B HD13  1 
ATOM   9887  H  HD21  . LEU D 1 226 ? 16.550  -15.931 -6.811  1.00 35.89 ? 226 LEU B HD21  1 
ATOM   9888  H  HD22  . LEU D 1 226 ? 15.573  -15.545 -5.641  1.00 35.89 ? 226 LEU B HD22  1 
ATOM   9889  H  HD23  . LEU D 1 226 ? 16.150  -17.005 -5.733  1.00 35.89 ? 226 LEU B HD23  1 
ATOM   9890  N  N     . LEU D 1 227 ? 12.580  -12.855 -8.682  1.00 24.31 ? 227 LEU B N     1 
ATOM   9891  C  CA    . LEU D 1 227 ? 12.521  -11.613 -9.463  1.00 27.20 ? 227 LEU B CA    1 
ATOM   9892  C  C     . LEU D 1 227 ? 12.185  -10.433 -8.553  1.00 29.13 ? 227 LEU B C     1 
ATOM   9893  O  O     . LEU D 1 227 ? 12.725  -9.353  -8.699  1.00 29.58 ? 227 LEU B O     1 
ATOM   9894  C  CB    . LEU D 1 227 ? 11.513  -11.736 -10.599 1.00 35.36 ? 227 LEU B CB    1 
ATOM   9895  C  CG    . LEU D 1 227 ? 12.008  -12.592 -11.784 1.00 39.77 ? 227 LEU B CG    1 
ATOM   9896  C  CD1   . LEU D 1 227 ? 10.854  -12.988 -12.695 1.00 37.86 ? 227 LEU B CD1   1 
ATOM   9897  C  CD2   . LEU D 1 227 ? 13.050  -11.838 -12.577 1.00 35.14 ? 227 LEU B CD2   1 
ATOM   9898  H  H     . LEU D 1 227 ? 11.959  -13.422 -8.860  1.00 29.11 ? 227 LEU B H     1 
ATOM   9899  H  HA    . LEU D 1 227 ? 13.402  -11.445 -9.859  1.00 32.58 ? 227 LEU B HA    1 
ATOM   9900  H  HB2   . LEU D 1 227 ? 10.704  -12.146 -10.255 1.00 42.37 ? 227 LEU B HB2   1 
ATOM   9901  H  HB3   . LEU D 1 227 ? 11.314  -10.849 -10.937 1.00 42.37 ? 227 LEU B HB3   1 
ATOM   9902  H  HG    . LEU D 1 227 ? 12.416  -13.403 -11.443 1.00 47.66 ? 227 LEU B HG    1 
ATOM   9903  H  HD11  . LEU D 1 227 ? 11.196  -13.518 -13.419 1.00 45.37 ? 227 LEU B HD11  1 
ATOM   9904  H  HD12  . LEU D 1 227 ? 10.217  -13.498 -12.188 1.00 45.37 ? 227 LEU B HD12  1 
ATOM   9905  H  HD13  . LEU D 1 227 ? 10.440  -12.193 -13.038 1.00 45.37 ? 227 LEU B HD13  1 
ATOM   9906  H  HD21  . LEU D 1 227 ? 12.661  -11.026 -12.912 1.00 42.11 ? 227 LEU B HD21  1 
ATOM   9907  H  HD22  . LEU D 1 227 ? 13.792  -11.633 -12.003 1.00 42.11 ? 227 LEU B HD22  1 
ATOM   9908  H  HD23  . LEU D 1 227 ? 13.344  -12.386 -13.308 1.00 42.11 ? 227 LEU B HD23  1 
ATOM   9909  N  N     . LYS D 1 228 ? 11.300  -10.651 -7.593  1.00 27.99 ? 228 LYS B N     1 
ATOM   9910  C  CA    . LYS D 1 228 ? 10.980  -9.610  -6.618  1.00 28.25 ? 228 LYS B CA    1 
ATOM   9911  C  C     . LYS D 1 228 ? 12.192  -9.273  -5.729  1.00 25.06 ? 228 LYS B C     1 
ATOM   9912  O  O     . LYS D 1 228 ? 12.502  -8.110  -5.486  1.00 25.67 ? 228 LYS B O     1 
ATOM   9913  C  CB    . LYS D 1 228 ? 9.797   -10.074 -5.755  1.00 35.75 ? 228 LYS B CB    1 
ATOM   9914  C  CG    . LYS D 1 228 ? 9.330   -9.051  -4.715  1.00 41.62 ? 228 LYS B CG    1 
ATOM   9915  C  CD    . LYS D 1 228 ? 8.159   -9.592  -3.886  1.00 52.52 ? 228 LYS B CD    1 
ATOM   9916  C  CE    . LYS D 1 228 ? 7.015   -10.109 -4.762  1.00 51.69 ? 228 LYS B CE    1 
ATOM   9917  N  NZ    . LYS D 1 228 ? 5.936   -10.726 -3.918  1.00 62.31 ? 228 LYS B NZ    1 
ATOM   9918  H  H     . LYS D 1 228 ? 10.870  -11.388 -7.481  1.00 33.52 ? 228 LYS B H     1 
ATOM   9919  H  HA    . LYS D 1 228 ? 10.712  -8.796  -7.092  1.00 33.83 ? 228 LYS B HA    1 
ATOM   9920  H  HB2   . LYS D 1 228 ? 9.046   -10.266 -6.337  1.00 42.84 ? 228 LYS B HB2   1 
ATOM   9921  H  HB3   . LYS D 1 228 ? 10.057  -10.879 -5.281  1.00 42.84 ? 228 LYS B HB3   1 
ATOM   9922  H  HG2   . LYS D 1 228 ? 10.063  -8.850  -4.112  1.00 49.88 ? 228 LYS B HG2   1 
ATOM   9923  H  HG3   . LYS D 1 228 ? 9.036   -8.246  -5.168  1.00 49.88 ? 228 LYS B HG3   1 
ATOM   9924  H  HD2   . LYS D 1 228 ? 8.473   -10.327 -3.336  1.00 62.96 ? 228 LYS B HD2   1 
ATOM   9925  H  HD3   . LYS D 1 228 ? 7.812   -8.881  -3.325  1.00 62.96 ? 228 LYS B HD3   1 
ATOM   9926  H  HE2   . LYS D 1 228 ? 6.630   -9.369  -5.259  1.00 61.97 ? 228 LYS B HE2   1 
ATOM   9927  H  HE3   . LYS D 1 228 ? 7.354   -10.785 -5.370  1.00 61.97 ? 228 LYS B HE3   1 
ATOM   9928  H  HZ1   . LYS D 1 228 ? 5.609   -10.122 -3.352  1.00 74.71 ? 228 LYS B HZ1   1 
ATOM   9929  H  HZ2   . LYS D 1 228 ? 5.276   -11.023 -4.437  1.00 74.71 ? 228 LYS B HZ2   1 
ATOM   9930  H  HZ3   . LYS D 1 228 ? 6.267   -11.409 -3.453  1.00 74.71 ? 228 LYS B HZ3   1 
ATOM   9931  N  N     . LEU D 1 229 ? 12.873  -10.302 -5.237  1.00 21.77 ? 229 LEU B N     1 
ATOM   9932  C  CA    . LEU D 1 229 ? 13.954  -10.101 -4.279  1.00 27.68 ? 229 LEU B CA    1 
ATOM   9933  C  C     . LEU D 1 229 ? 15.069  -9.356  -4.977  1.00 31.64 ? 229 LEU B C     1 
ATOM   9934  O  O     . LEU D 1 229 ? 15.698  -8.459  -4.403  1.00 24.91 ? 229 LEU B O     1 
ATOM   9935  C  CB    . LEU D 1 229 ? 14.458  -11.446 -3.777  1.00 24.89 ? 229 LEU B CB    1 
ATOM   9936  C  CG    . LEU D 1 229 ? 15.586  -11.432 -2.775  1.00 26.93 ? 229 LEU B CG    1 
ATOM   9937  C  CD1   . LEU D 1 229 ? 15.118  -10.793 -1.456  1.00 31.47 ? 229 LEU B CD1   1 
ATOM   9938  C  CD2   . LEU D 1 229 ? 16.129  -12.852 -2.577  1.00 31.52 ? 229 LEU B CD2   1 
ATOM   9939  H  H     . LEU D 1 229 ? 12.729  -11.125 -5.441  1.00 26.07 ? 229 LEU B H     1 
ATOM   9940  H  HA    . LEU D 1 229 ? 13.638  -9.570  -3.518  1.00 33.15 ? 229 LEU B HA    1 
ATOM   9941  H  HB2   . LEU D 1 229 ? 13.714  -11.910 -3.362  1.00 29.81 ? 229 LEU B HB2   1 
ATOM   9942  H  HB3   . LEU D 1 229 ? 14.764  -11.957 -4.543  1.00 29.81 ? 229 LEU B HB3   1 
ATOM   9943  H  HG    . LEU D 1 229 ? 16.308  -10.888 -3.127  1.00 32.26 ? 229 LEU B HG    1 
ATOM   9944  H  HD11  . LEU D 1 229 ? 14.385  -11.305 -1.104  1.00 37.70 ? 229 LEU B HD11  1 
ATOM   9945  H  HD12  . LEU D 1 229 ? 15.847  -10.794 -0.833  1.00 37.70 ? 229 LEU B HD12  1 
ATOM   9946  H  HD13  . LEU D 1 229 ? 14.835  -9.892  -1.629  1.00 37.70 ? 229 LEU B HD13  1 
ATOM   9947  H  HD21  . LEU D 1 229 ? 15.421  -13.414 -2.254  1.00 37.76 ? 229 LEU B HD21  1 
ATOM   9948  H  HD22  . LEU D 1 229 ? 16.452  -13.183 -3.418  1.00 37.76 ? 229 LEU B HD22  1 
ATOM   9949  H  HD23  . LEU D 1 229 ? 16.844  -12.826 -1.938  1.00 37.76 ? 229 LEU B HD23  1 
ATOM   9950  N  N     . ALA D 1 230 ? 15.298  -9.736  -6.230  1.00 21.76 ? 230 ALA B N     1 
ATOM   9951  C  CA    . ALA D 1 230 ? 16.393  -9.149  -6.999  1.00 30.14 ? 230 ALA B CA    1 
ATOM   9952  C  C     . ALA D 1 230 ? 16.197  -7.641  -7.134  1.00 30.10 ? 230 ALA B C     1 
ATOM   9953  O  O     . ALA D 1 230 ? 17.162  -6.883  -7.252  1.00 32.00 ? 230 ALA B O     1 
ATOM   9954  C  CB    . ALA D 1 230 ? 16.491  -9.806  -8.369  1.00 28.45 ? 230 ALA B CB    1 
ATOM   9955  H  H     . ALA D 1 230 ? 14.840  -10.326 -6.656  1.00 26.05 ? 230 ALA B H     1 
ATOM   9956  H  HA    . ALA D 1 230 ? 17.237  -9.305  -6.525  1.00 36.11 ? 230 ALA B HA    1 
ATOM   9957  H  HB1   . ALA D 1 230 ? 16.653  -10.745 -8.253  1.00 34.08 ? 230 ALA B HB1   1 
ATOM   9958  H  HB2   . ALA D 1 230 ? 15.665  -9.671  -8.839  1.00 34.08 ? 230 ALA B HB2   1 
ATOM   9959  H  HB3   . ALA D 1 230 ? 17.215  -9.406  -8.856  1.00 34.08 ? 230 ALA B HB3   1 
ATOM   9960  N  N     . GLN D 1 231 ? 14.943  -7.214  -7.123  1.00 25.94 ? 231 GLN B N     1 
ATOM   9961  C  CA    . GLN D 1 231 ? 14.612  -5.813  -7.328  1.00 32.78 ? 231 GLN B CA    1 
ATOM   9962  C  C     . GLN D 1 231 ? 14.402  -5.091  -6.003  1.00 32.08 ? 231 GLN B C     1 
ATOM   9963  O  O     . GLN D 1 231 ? 13.952  -3.950  -5.982  1.00 39.14 ? 231 GLN B O     1 
ATOM   9964  C  CB    . GLN D 1 231 ? 13.345  -5.707  -8.173  1.00 33.34 ? 231 GLN B CB    1 
ATOM   9965  C  CG    . GLN D 1 231 ? 13.450  -6.413  -9.527  1.00 36.62 ? 231 GLN B CG    1 
ATOM   9966  C  CD    . GLN D 1 231 ? 12.170  -6.354  -10.320 1.00 43.79 ? 231 GLN B CD    1 
ATOM   9967  O  OE1   . GLN D 1 231 ? 11.387  -7.312  -10.350 1.00 43.34 ? 231 GLN B OE1   1 
ATOM   9968  N  NE2   . GLN D 1 231 ? 11.944  -5.226  -10.981 1.00 43.92 ? 231 GLN B NE2   1 
ATOM   9969  H  H     . GLN D 1 231 ? 14.260  -7.720  -6.998  1.00 31.07 ? 231 GLN B H     1 
ATOM   9970  H  HA    . GLN D 1 231 ? 15.344  -5.372  -7.808  1.00 39.27 ? 231 GLN B HA    1 
ATOM   9971  H  HB2   . GLN D 1 231 ? 12.609  -6.108  -7.685  1.00 39.95 ? 231 GLN B HB2   1 
ATOM   9972  H  HB3   . GLN D 1 231 ? 13.158  -4.770  -8.341  1.00 39.95 ? 231 GLN B HB3   1 
ATOM   9973  H  HG2   . GLN D 1 231 ? 14.147  -5.989  -10.052 1.00 43.88 ? 231 GLN B HG2   1 
ATOM   9974  H  HG3   . GLN D 1 231 ? 13.668  -7.347  -9.380  1.00 43.88 ? 231 GLN B HG3   1 
ATOM   9975  H  HE21  . GLN D 1 231 ? 11.229  -5.138  -11.450 1.00 52.64 ? 231 GLN B HE21  1 
ATOM   9976  H  HE22  . GLN D 1 231 ? 12.514  -4.583  -10.940 1.00 52.64 ? 231 GLN B HE22  1 
ATOM   9977  N  N     . ASP D 1 232 ? 14.719  -5.755  -4.901  1.00 30.18 ? 232 ASP B N     1 
ATOM   9978  C  CA    . ASP D 1 232 ? 14.392  -5.243  -3.582  1.00 43.90 ? 232 ASP B CA    1 
ATOM   9979  C  C     . ASP D 1 232 ? 12.929  -4.840  -3.555  1.00 43.49 ? 232 ASP B C     1 
ATOM   9980  O  O     . ASP D 1 232 ? 12.578  -3.767  -3.065  1.00 38.38 ? 232 ASP B O     1 
ATOM   9981  C  CB    . ASP D 1 232 ? 15.263  -4.040  -3.199  1.00 44.52 ? 232 ASP B CB    1 
ATOM   9982  C  CG    . ASP D 1 232 ? 15.091  -3.641  -1.736  1.00 50.56 ? 232 ASP B CG    1 
ATOM   9983  O  OD1   . ASP D 1 232 ? 14.760  -4.528  -0.909  1.00 43.27 ? 232 ASP B OD1   1 
ATOM   9984  O  OD2   . ASP D 1 232 ? 15.278  -2.444  -1.417  1.00 56.12 ? 232 ASP B OD2   1 
ATOM   9985  H  H     . ASP D 1 232 ? 15.128  -6.512  -4.892  1.00 36.16 ? 232 ASP B H     1 
ATOM   9986  H  HA    . ASP D 1 232 ? 14.531  -5.949  -2.916  1.00 52.62 ? 232 ASP B HA    1 
ATOM   9987  H  HB2   . ASP D 1 232 ? 16.196  -4.264  -3.342  1.00 53.36 ? 232 ASP B HB2   1 
ATOM   9988  H  HB3   . ASP D 1 232 ? 15.015  -3.280  -3.749  1.00 53.36 ? 232 ASP B HB3   1 
ATOM   9989  N  N     . GLU D 1 233 ? 12.083  -5.709  -4.088  1.00 37.15 ? 233 GLU B N     1 
ATOM   9990  C  CA    . GLU D 1 233 ? 10.646  -5.483  -4.019  1.00 41.00 ? 233 GLU B CA    1 
ATOM   9991  C  C     . GLU D 1 233 ? 9.978   -6.520  -3.145  1.00 46.10 ? 233 GLU B C     1 
ATOM   9992  O  O     . GLU D 1 233 ? 8.763   -6.705  -3.186  1.00 48.72 ? 233 GLU B O     1 
ATOM   9993  C  CB    . GLU D 1 233 ? 10.044  -5.434  -5.420  1.00 30.38 ? 233 GLU B CB    1 
ATOM   9994  C  CG    . GLU D 1 233 ? 10.371  -4.100  -6.100  1.00 30.75 ? 233 GLU B CG    1 
ATOM   9995  C  CD    . GLU D 1 233 ? 10.055  -4.056  -7.572  1.00 30.70 ? 233 GLU B CD    1 
ATOM   9996  O  OE1   . GLU D 1 233 ? 9.352   -4.954  -8.099  1.00 31.36 ? 233 GLU B OE1   1 
ATOM   9997  O  OE2   . GLU D 1 233 ? 10.533  -3.107  -8.202  1.00 33.81 ? 233 GLU B OE2   1 
ATOM   9998  H  H     . GLU D 1 233 ? 12.311  -6.433  -4.492  1.00 44.51 ? 233 GLU B H     1 
ATOM   9999  H  HA    . GLU D 1 233 ? 10.491  -4.609  -3.604  1.00 49.14 ? 233 GLU B HA    1 
ATOM   10000 H  HB2   . GLU D 1 233 ? 10.415  -6.151  -5.957  1.00 36.39 ? 233 GLU B HB2   1 
ATOM   10001 H  HB3   . GLU D 1 233 ? 9.079   -5.519  -5.360  1.00 36.39 ? 233 GLU B HB3   1 
ATOM   10002 H  HG2   . GLU D 1 233 ? 9.859   -3.398  -5.669  1.00 36.84 ? 233 GLU B HG2   1 
ATOM   10003 H  HG3   . GLU D 1 233 ? 11.319  -3.923  -5.997  1.00 36.84 ? 233 GLU B HG3   1 
ATOM   10004 N  N     . TYR D 1 234 ? 10.786  -7.211  -2.355  1.00 37.82 ? 234 TYR B N     1 
ATOM   10005 C  CA    . TYR D 1 234 ? 10.257  -8.108  -1.367  1.00 41.61 ? 234 TYR B CA    1 
ATOM   10006 C  C     . TYR D 1 234 ? 9.969   -7.248  -0.154  1.00 49.20 ? 234 TYR B C     1 
ATOM   10007 O  O     . TYR D 1 234 ? 10.818  -6.452  0.266   1.00 42.50 ? 234 TYR B O     1 
ATOM   10008 C  CB    . TYR D 1 234 ? 11.268  -9.185  -1.015  1.00 50.33 ? 234 TYR B CB    1 
ATOM   10009 C  CG    . TYR D 1 234 ? 10.775  -10.098 0.061   1.00 39.75 ? 234 TYR B CG    1 
ATOM   10010 C  CD1   . TYR D 1 234 ? 10.304  -11.380 -0.245  1.00 39.75 ? 234 TYR B CD1   1 
ATOM   10011 C  CD2   . TYR D 1 234 ? 10.764  -9.684  1.394   1.00 46.28 ? 234 TYR B CD2   1 
ATOM   10012 C  CE1   . TYR D 1 234 ? 9.838   -12.233 0.765   1.00 48.67 ? 234 TYR B CE1   1 
ATOM   10013 C  CE2   . TYR D 1 234 ? 10.313  -10.520 2.416   1.00 34.99 ? 234 TYR B CE2   1 
ATOM   10014 C  CZ    . TYR D 1 234 ? 9.839   -11.794 2.099   1.00 51.03 ? 234 TYR B CZ    1 
ATOM   10015 O  OH    . TYR D 1 234 ? 9.387   -12.627 3.118   1.00 40.21 ? 234 TYR B OH    1 
ATOM   10016 H  H     . TYR D 1 234 ? 11.645  -7.172  -2.378  1.00 45.33 ? 234 TYR B H     1 
ATOM   10017 H  HA    . TYR D 1 234 ? 9.428   -8.522  -1.683  1.00 49.87 ? 234 TYR B HA    1 
ATOM   10018 H  HB2   . TYR D 1 234 ? 11.450  -9.719  -1.804  1.00 60.33 ? 234 TYR B HB2   1 
ATOM   10019 H  HB3   . TYR D 1 234 ? 12.084  -8.764  -0.703  1.00 60.33 ? 234 TYR B HB3   1 
ATOM   10020 H  HD1   . TYR D 1 234 ? 10.301  -11.670 -1.129  1.00 47.64 ? 234 TYR B HD1   1 
ATOM   10021 H  HD2   . TYR D 1 234 ? 11.077  -8.835  1.607   1.00 55.47 ? 234 TYR B HD2   1 
ATOM   10022 H  HE1   . TYR D 1 234 ? 9.528   -13.084 0.553   1.00 58.35 ? 234 TYR B HE1   1 
ATOM   10023 H  HE2   . TYR D 1 234 ? 10.313  -10.225 3.298   1.00 41.92 ? 234 TYR B HE2   1 
ATOM   10024 H  HH    . TYR D 1 234 ? 9.839   -13.311 3.143   1.00 48.19 ? 234 TYR B HH    1 
ATOM   10025 N  N     . ASN D 1 235 ? 8.770   -7.381  0.398   1.00 36.82 ? 235 ASN B N     1 
ATOM   10026 C  CA    . ASN D 1 235 ? 8.424   -6.603  1.572   1.00 42.66 ? 235 ASN B CA    1 
ATOM   10027 C  C     . ASN D 1 235 ? 7.263   -7.246  2.324   1.00 48.57 ? 235 ASN B C     1 
ATOM   10028 O  O     . ASN D 1 235 ? 6.468   -6.541  2.944   1.00 43.70 ? 235 ASN B O     1 
ATOM   10029 C  CB    . ASN D 1 235 ? 8.097   -5.155  1.162   1.00 48.21 ? 235 ASN B CB    1 
ATOM   10030 C  CG    . ASN D 1 235 ? 8.204   -4.154  2.333   1.00 56.88 ? 235 ASN B CG    1 
ATOM   10031 O  OD1   . ASN D 1 235 ? 9.261   -4.022  2.966   1.00 57.54 ? 235 ASN B OD1   1 
ATOM   10032 N  ND2   . ASN D 1 235 ? 7.114   -3.429  2.599   1.00 51.26 ? 235 ASN B ND2   1 
ATOM   10033 H  H     . ASN D 1 235 ? 8.150   -7.906  0.115   1.00 44.12 ? 235 ASN B H     1 
ATOM   10034 H  HA    . ASN D 1 235 ? 9.197   -6.578  2.175   1.00 51.13 ? 235 ASN B HA    1 
ATOM   10035 H  HB2   . ASN D 1 235 ? 8.718   -4.875  0.472   1.00 57.79 ? 235 ASN B HB2   1 
ATOM   10036 H  HB3   . ASN D 1 235 ? 7.189   -5.122  0.823   1.00 57.79 ? 235 ASN B HB3   1 
ATOM   10037 H  HD21  . ASN D 1 235 ? 6.402   -3.534  2.128   1.00 61.45 ? 235 ASN B HD21  1 
ATOM   10038 H  HD22  . ASN D 1 235 ? 7.124   -2.858  3.242   1.00 61.45 ? 235 ASN B HD22  1 
ATOM   10039 N  N     . GLU D 1 236 ? 7.192   -8.582  2.288   1.00 39.33 ? 236 GLU B N     1 
ATOM   10040 C  CA    . GLU D 1 236 ? 6.093   -9.318  2.919   1.00 38.11 ? 236 GLU B CA    1 
ATOM   10041 C  C     . GLU D 1 236 ? 5.922   -8.978  4.400   1.00 36.53 ? 236 GLU B C     1 
ATOM   10042 O  O     . GLU D 1 236 ? 6.892   -8.818  5.134   1.00 32.21 ? 236 GLU B O     1 
ATOM   10043 C  CB    . GLU D 1 236 ? 6.276   -10.833 2.777   1.00 37.26 ? 236 GLU B CB    1 
ATOM   10044 C  CG    . GLU D 1 236 ? 6.349   -11.356 1.333   1.00 47.38 ? 236 GLU B CG    1 
ATOM   10045 C  CD    . GLU D 1 236 ? 5.248   -10.822 0.427   1.00 60.41 ? 236 GLU B CD    1 
ATOM   10046 O  OE1   . GLU D 1 236 ? 4.108   -10.656 0.919   1.00 64.88 ? 236 GLU B OE1   1 
ATOM   10047 O  OE2   . GLU D 1 236 ? 5.525   -10.568 -0.778  1.00 60.34 ? 236 GLU B OE2   1 
ATOM   10048 H  H     . GLU D 1 236 ? 7.771   -9.086  1.902   1.00 47.14 ? 236 GLU B H     1 
ATOM   10049 H  HA    . GLU D 1 236 ? 5.259   -9.079  2.464   1.00 45.67 ? 236 GLU B HA    1 
ATOM   10050 H  HB2   . GLU D 1 236 ? 7.101   -11.085 3.220   1.00 44.65 ? 236 GLU B HB2   1 
ATOM   10051 H  HB3   . GLU D 1 236 ? 5.529   -11.274 3.209   1.00 44.65 ? 236 GLU B HB3   1 
ATOM   10052 H  HG2   . GLU D 1 236 ? 7.201   -11.096 0.949   1.00 56.79 ? 236 GLU B HG2   1 
ATOM   10053 H  HG3   . GLU D 1 236 ? 6.278   -12.324 1.348   1.00 56.79 ? 236 GLU B HG3   1 
ATOM   10054 N  N     . PRO D 1 237 ? 4.667   -8.890  4.847   1.00 34.83 ? 237 PRO B N     1 
ATOM   10055 C  CA    . PRO D 1 237 ? 4.368   -8.489  6.224   1.00 41.29 ? 237 PRO B CA    1 
ATOM   10056 C  C     . PRO D 1 237 ? 4.656   -9.596  7.230   1.00 30.71 ? 237 PRO B C     1 
ATOM   10057 O  O     . PRO D 1 237 ? 4.715   -10.781 6.899   1.00 29.63 ? 237 PRO B O     1 
ATOM   10058 C  CB    . PRO D 1 237 ? 2.870   -8.217  6.188   1.00 31.33 ? 237 PRO B CB    1 
ATOM   10059 C  CG    . PRO D 1 237 ? 2.362   -9.170  5.154   1.00 43.06 ? 237 PRO B CG    1 
ATOM   10060 C  CD    . PRO D 1 237 ? 3.458   -9.305  4.118   1.00 36.61 ? 237 PRO B CD    1 
ATOM   10061 H  HA    . PRO D 1 237 ? 4.853   -7.673  6.469   1.00 49.48 ? 237 PRO B HA    1 
ATOM   10062 H  HB2   . PRO D 1 237 ? 2.479   -8.405  7.055   1.00 37.53 ? 237 PRO B HB2   1 
ATOM   10063 H  HB3   . PRO D 1 237 ? 2.706   -7.299  5.924   1.00 37.53 ? 237 PRO B HB3   1 
ATOM   10064 H  HG2   . PRO D 1 237 ? 2.178   -10.028 5.568   1.00 51.62 ? 237 PRO B HG2   1 
ATOM   10065 H  HG3   . PRO D 1 237 ? 1.557   -8.809  4.750   1.00 51.62 ? 237 PRO B HG3   1 
ATOM   10066 H  HD2   . PRO D 1 237 ? 3.538   -10.227 3.828   1.00 43.87 ? 237 PRO B HD2   1 
ATOM   10067 H  HD3   . PRO D 1 237 ? 3.293   -8.710  3.371   1.00 43.87 ? 237 PRO B HD3   1 
ATOM   10068 N  N     . ILE D 1 238 ? 4.850   -9.178  8.462   1.00 28.22 ? 238 ILE B N     1 
ATOM   10069 C  CA    . ILE D 1 238 ? 4.965   -10.108 9.581   1.00 35.95 ? 238 ILE B CA    1 
ATOM   10070 C  C     . ILE D 1 238 ? 3.564   -10.591 9.904   1.00 41.44 ? 238 ILE B C     1 
ATOM   10071 O  O     . ILE D 1 238 ? 2.682   -9.787  10.189  1.00 35.70 ? 238 ILE B O     1 
ATOM   10072 C  CB    . ILE D 1 238 ? 5.590   -9.420  10.799  1.00 37.26 ? 238 ILE B CB    1 
ATOM   10073 C  CG1   . ILE D 1 238 ? 7.118   -9.477  10.728  1.00 35.41 ? 238 ILE B CG1   1 
ATOM   10074 C  CG2   . ILE D 1 238 ? 5.154   -10.103 12.099  1.00 41.28 ? 238 ILE B CG2   1 
ATOM   10075 C  CD1   . ILE D 1 238 ? 7.734   -8.672  9.667   1.00 40.76 ? 238 ILE B CD1   1 
ATOM   10076 H  H     . ILE D 1 238 ? 4.920   -8.351  8.687   1.00 33.80 ? 238 ILE B H     1 
ATOM   10077 H  HA    . ILE D 1 238 ? 5.519   -10.875 9.327   1.00 43.08 ? 238 ILE B HA    1 
ATOM   10078 H  HB    . ILE D 1 238 ? 5.307   -8.492  10.819  1.00 44.65 ? 238 ILE B HB    1 
ATOM   10079 H  HG12  . ILE D 1 238 ? 7.476   -9.165  11.574  1.00 42.43 ? 238 ILE B HG12  1 
ATOM   10080 H  HG13  . ILE D 1 238 ? 7.383   -10.398 10.584  1.00 42.43 ? 238 ILE B HG13  1 
ATOM   10081 H  HG21  . ILE D 1 238 ? 4.198   -10.057 12.170  1.00 49.48 ? 238 ILE B HG21  1 
ATOM   10082 H  HG22  . ILE D 1 238 ? 5.438   -11.020 12.079  1.00 49.48 ? 238 ILE B HG22  1 
ATOM   10083 H  HG23  . ILE D 1 238 ? 5.561   -9.651  12.841  1.00 49.48 ? 238 ILE B HG23  1 
ATOM   10084 H  HD11  . ILE D 1 238 ? 8.687   -8.777  9.709   1.00 48.85 ? 238 ILE B HD11  1 
ATOM   10085 H  HD12  . ILE D 1 238 ? 7.408   -8.974  8.816   1.00 48.85 ? 238 ILE B HD12  1 
ATOM   10086 H  HD13  . ILE D 1 238 ? 7.500   -7.750  9.799   1.00 48.85 ? 238 ILE B HD13  1 
ATOM   10087 N  N     . ARG D 1 239 ? 3.326   -11.894 9.823   1.00 29.03 ? 239 ARG B N     1 
ATOM   10088 C  CA    . ARG D 1 239 ? 1.996   -12.383 10.121  1.00 39.89 ? 239 ARG B CA    1 
ATOM   10089 C  C     . ARG D 1 239 ? 1.960   -13.509 11.140  1.00 42.00 ? 239 ARG B C     1 
ATOM   10090 O  O     . ARG D 1 239 ? 2.813   -14.391 11.146  1.00 31.72 ? 239 ARG B O     1 
ATOM   10091 C  CB    . ARG D 1 239 ? 1.269   -12.842 8.861   1.00 47.16 ? 239 ARG B CB    1 
ATOM   10092 C  CG    . ARG D 1 239 ? -0.265  -12.772 9.039   1.00 57.80 ? 239 ARG B CG    1 
ATOM   10093 C  CD    . ARG D 1 239 ? -1.047  -13.374 7.860   1.00 58.25 ? 239 ARG B CD    1 
ATOM   10094 N  NE    . ARG D 1 239 ? -0.374  -13.155 6.579   1.00 63.68 ? 239 ARG B NE    1 
ATOM   10095 C  CZ    . ARG D 1 239 ? 0.508   -13.995 6.037   1.00 61.34 ? 239 ARG B CZ    1 
ATOM   10096 N  NH1   . ARG D 1 239 ? 0.826   -15.132 6.657   1.00 58.74 ? 239 ARG B NH1   1 
ATOM   10097 N  NH2   . ARG D 1 239 ? 1.066   -13.702 4.866   1.00 62.65 ? 239 ARG B NH2   1 
ATOM   10098 H  H     . ARG D 1 239 ? 3.900   -12.496 9.604   1.00 34.78 ? 239 ARG B H     1 
ATOM   10099 H  HA    . ARG D 1 239 ? 1.479   -11.640 10.497  1.00 47.81 ? 239 ARG B HA    1 
ATOM   10100 H  HB2   . ARG D 1 239 ? 1.517   -12.266 8.121   1.00 56.53 ? 239 ARG B HB2   1 
ATOM   10101 H  HB3   . ARG D 1 239 ? 1.512   -13.761 8.668   1.00 56.53 ? 239 ARG B HB3   1 
ATOM   10102 H  HG2   . ARG D 1 239 ? -0.511  -13.261 9.840   1.00 69.30 ? 239 ARG B HG2   1 
ATOM   10103 H  HG3   . ARG D 1 239 ? -0.528  -11.842 9.126   1.00 69.30 ? 239 ARG B HG3   1 
ATOM   10104 H  HD2   . ARG D 1 239 ? -1.137  -14.330 7.995   1.00 69.84 ? 239 ARG B HD2   1 
ATOM   10105 H  HD3   . ARG D 1 239 ? -1.923  -12.960 7.816   1.00 69.84 ? 239 ARG B HD3   1 
ATOM   10106 H  HE    . ARG D 1 239 ? -0.561  -12.436 6.147   1.00 76.36 ? 239 ARG B HE    1 
ATOM   10107 H  HH11  . ARG D 1 239 ? 0.467   -15.325 7.414   1.00 70.43 ? 239 ARG B HH11  1 
ATOM   10108 H  HH12  . ARG D 1 239 ? 1.395   -15.671 6.301   1.00 70.43 ? 239 ARG B HH12  1 
ATOM   10109 H  HH21  . ARG D 1 239 ? 0.860   -12.971 4.462   1.00 75.12 ? 239 ARG B HH21  1 
ATOM   10110 H  HH22  . ARG D 1 239 ? 1.633   -14.243 4.512   1.00 75.12 ? 239 ARG B HH22  1 
ATOM   10111 N  N     . THR D 1 240 ? 0.925   -13.470 11.971  1.00 32.42 ? 240 THR B N     1 
ATOM   10112 C  CA    . THR D 1 240 ? 0.691   -14.493 12.976  1.00 38.05 ? 240 THR B CA    1 
ATOM   10113 C  C     . THR D 1 240 ? 0.492   -15.799 12.242  1.00 32.10 ? 240 THR B C     1 
ATOM   10114 O  O     . THR D 1 240 ? -0.350  -15.897 11.364  1.00 37.56 ? 240 THR B O     1 
ATOM   10115 C  CB    . THR D 1 240 ? -0.563  -14.155 13.832  1.00 41.03 ? 240 THR B CB    1 
ATOM   10116 O  OG1   . THR D 1 240 ? -0.310  -12.960 14.579  1.00 44.50 ? 240 THR B OG1   1 
ATOM   10117 C  CG2   . THR D 1 240 ? -0.912  -15.292 14.805  1.00 44.24 ? 240 THR B CG2   1 
ATOM   10118 H  H     . THR D 1 240 ? 0.332   -12.847 11.970  1.00 38.85 ? 240 THR B H     1 
ATOM   10119 H  HA    . THR D 1 240 ? 1.470   -14.571 13.565  1.00 45.59 ? 240 THR B HA    1 
ATOM   10120 H  HB    . THR D 1 240 ? -1.323  -14.012 13.245  1.00 49.18 ? 240 THR B HB    1 
ATOM   10121 H  HG1   . THR D 1 240 ? -0.965  -12.770 15.035  1.00 53.34 ? 240 THR B HG1   1 
ATOM   10122 H  HG21  . THR D 1 240 ? -1.094  -16.098 14.316  1.00 53.03 ? 240 THR B HG21  1 
ATOM   10123 H  HG22  . THR D 1 240 ? -0.177  -15.449 15.402  1.00 53.03 ? 240 THR B HG22  1 
ATOM   10124 H  HG23  . THR D 1 240 ? -1.688  -15.057 15.319  1.00 53.03 ? 240 THR B HG23  1 
ATOM   10125 N  N     . ARG D 1 241 ? 1.290   -16.798 12.570  1.00 31.42 ? 241 ARG B N     1 
ATOM   10126 C  CA    . ARG D 1 241 ? 1.138   -18.071 11.900  1.00 32.12 ? 241 ARG B CA    1 
ATOM   10127 C  C     . ARG D 1 241 ? 0.128   -18.933 12.652  1.00 26.09 ? 241 ARG B C     1 
ATOM   10128 O  O     . ARG D 1 241 ? 0.010   -18.870 13.871  1.00 31.46 ? 241 ARG B O     1 
ATOM   10129 C  CB    . ARG D 1 241 ? 2.479   -18.765 11.702  1.00 48.67 ? 241 ARG B CB    1 
ATOM   10130 C  CG    . ARG D 1 241 ? 3.241   -18.192 10.504  1.00 47.67 ? 241 ARG B CG    1 
ATOM   10131 C  CD    . ARG D 1 241 ? 4.481   -19.005 10.157  1.00 38.97 ? 241 ARG B CD    1 
ATOM   10132 N  NE    . ARG D 1 241 ? 5.395   -18.218 9.319   1.00 51.61 ? 241 ARG B NE    1 
ATOM   10133 C  CZ    . ARG D 1 241 ? 6.532   -18.670 8.793   1.00 46.96 ? 241 ARG B CZ    1 
ATOM   10134 N  NH1   . ARG D 1 241 ? 6.906   -19.931 8.983   1.00 51.11 ? 241 ARG B NH1   1 
ATOM   10135 N  NH2   . ARG D 1 241 ? 7.291   -17.858 8.054   1.00 46.23 ? 241 ARG B NH2   1 
ATOM   10136 H  H     . ARG D 1 241 ? 1.913   -16.767 13.163  1.00 37.64 ? 241 ARG B H     1 
ATOM   10137 H  HA    . ARG D 1 241 ? 0.767   -17.904 11.009  1.00 38.48 ? 241 ARG B HA    1 
ATOM   10138 H  HB2   . ARG D 1 241 ? 3.024   -18.640 12.496  1.00 58.35 ? 241 ARG B HB2   1 
ATOM   10139 H  HB3   . ARG D 1 241 ? 2.330   -19.710 11.543  1.00 58.35 ? 241 ARG B HB3   1 
ATOM   10140 H  HG2   . ARG D 1 241 ? 2.657   -18.189 9.730   1.00 57.14 ? 241 ARG B HG2   1 
ATOM   10141 H  HG3   . ARG D 1 241 ? 3.524   -17.287 10.711  1.00 57.14 ? 241 ARG B HG3   1 
ATOM   10142 H  HD2   . ARG D 1 241 ? 4.945   -19.249 10.973  1.00 46.71 ? 241 ARG B HD2   1 
ATOM   10143 H  HD3   . ARG D 1 241 ? 4.219   -19.799 9.665   1.00 46.71 ? 241 ARG B HD3   1 
ATOM   10144 H  HE    . ARG D 1 241 ? 5.179   -17.402 9.156   1.00 61.87 ? 241 ARG B HE    1 
ATOM   10145 H  HH11  . ARG D 1 241 ? 6.420   -20.457 9.460   1.00 61.27 ? 241 ARG B HH11  1 
ATOM   10146 H  HH12  . ARG D 1 241 ? 7.639   -20.220 8.637   1.00 61.27 ? 241 ARG B HH12  1 
ATOM   10147 H  HH21  . ARG D 1 241 ? 7.048   -17.043 7.924   1.00 55.41 ? 241 ARG B HH21  1 
ATOM   10148 H  HH22  . ARG D 1 241 ? 8.020   -18.151 7.706   1.00 55.41 ? 241 ARG B HH22  1 
ATOM   10149 N  N     . VAL D 1 242 ? -0.662  -19.645 11.864  1.00 34.50 ? 242 VAL B N     1 
ATOM   10150 C  CA    . VAL D 1 242 ? -1.743  -20.495 12.346  1.00 36.21 ? 242 VAL B CA    1 
ATOM   10151 C  C     . VAL D 1 242 ? -1.445  -21.916 11.863  1.00 23.77 ? 242 VAL B C     1 
ATOM   10152 O  O     . VAL D 1 242 ? -1.180  -22.127 10.695  1.00 27.54 ? 242 VAL B O     1 
ATOM   10153 C  CB    . VAL D 1 242 ? -3.085  -20.011 11.774  1.00 45.42 ? 242 VAL B CB    1 
ATOM   10154 C  CG1   . VAL D 1 242 ? -4.135  -21.131 11.769  1.00 45.61 ? 242 VAL B CG1   1 
ATOM   10155 C  CG2   . VAL D 1 242 ? -3.585  -18.786 12.557  1.00 43.45 ? 242 VAL B CG2   1 
ATOM   10156 H  H     . VAL D 1 242 ? -0.588  -19.653 11.008  1.00 41.34 ? 242 VAL B H     1 
ATOM   10157 H  HA    . VAL D 1 242 ? -1.780  -20.482 13.326  1.00 43.39 ? 242 VAL B HA    1 
ATOM   10158 H  HB    . VAL D 1 242 ? -2.946  -19.732 10.845  1.00 54.45 ? 242 VAL B HB    1 
ATOM   10159 H  HG11  . VAL D 1 242 ? -3.742  -21.928 12.131  1.00 54.67 ? 242 VAL B HG11  1 
ATOM   10160 H  HG12  . VAL D 1 242 ? -4.882  -20.860 12.308  1.00 54.67 ? 242 VAL B HG12  1 
ATOM   10161 H  HG13  . VAL D 1 242 ? -4.421  -21.286 10.866  1.00 54.67 ? 242 VAL B HG13  1 
ATOM   10162 H  HG21  . VAL D 1 242 ? -4.422  -18.499 12.186  1.00 52.08 ? 242 VAL B HG21  1 
ATOM   10163 H  HG22  . VAL D 1 242 ? -3.701  -19.030 13.478  1.00 52.08 ? 242 VAL B HG22  1 
ATOM   10164 H  HG23  . VAL D 1 242 ? -2.935  -18.083 12.483  1.00 52.08 ? 242 VAL B HG23  1 
ATOM   10165 N  N     . ARG D 1 243 ? -1.450  -22.858 12.792  1.00 25.22 ? 243 ARG B N     1 
ATOM   10166 C  CA    . ARG D 1 243 ? -1.237  -24.260 12.486  1.00 29.46 ? 243 ARG B CA    1 
ATOM   10167 C  C     . ARG D 1 243 ? -2.285  -24.773 11.502  1.00 32.30 ? 243 ARG B C     1 
ATOM   10168 O  O     . ARG D 1 243 ? -3.491  -24.660 11.745  1.00 30.42 ? 243 ARG B O     1 
ATOM   10169 C  CB    . ARG D 1 243 ? -1.315  -25.064 13.781  1.00 37.63 ? 243 ARG B CB    1 
ATOM   10170 C  CG    . ARG D 1 243 ? -0.913  -26.500 13.627  1.00 33.01 ? 243 ARG B CG    1 
ATOM   10171 C  CD    . ARG D 1 243 ? 0.607   -26.618 13.441  1.00 36.16 ? 243 ARG B CD    1 
ATOM   10172 N  NE    . ARG D 1 243 ? 1.169   -27.519 14.444  1.00 53.55 ? 243 ARG B NE    1 
ATOM   10173 C  CZ    . ARG D 1 243 ? 1.272   -28.831 14.276  1.00 44.20 ? 243 ARG B CZ    1 
ATOM   10174 N  NH1   . ARG D 1 243 ? 0.873   -29.359 13.138  1.00 40.66 ? 243 ARG B NH1   1 
ATOM   10175 N  NH2   . ARG D 1 243 ? 1.787   -29.613 15.222  1.00 47.98 ? 243 ARG B NH2   1 
ATOM   10176 H  H     . ARG D 1 243 ? -1.579  -22.705 13.629  1.00 30.20 ? 243 ARG B H     1 
ATOM   10177 H  HA    . ARG D 1 243 ? -0.348  -24.382 12.092  1.00 35.29 ? 243 ARG B HA    1 
ATOM   10178 H  HB2   . ARG D 1 243 ? -0.725  -24.660 14.436  1.00 45.10 ? 243 ARG B HB2   1 
ATOM   10179 H  HB3   . ARG D 1 243 ? -2.229  -25.045 14.106  1.00 45.10 ? 243 ARG B HB3   1 
ATOM   10180 H  HG2   . ARG D 1 243 ? -1.164  -26.994 14.423  1.00 39.55 ? 243 ARG B HG2   1 
ATOM   10181 H  HG3   . ARG D 1 243 ? -1.348  -26.876 12.845  1.00 39.55 ? 243 ARG B HG3   1 
ATOM   10182 H  HD2   . ARG D 1 243 ? 0.799   -26.979 12.561  1.00 43.33 ? 243 ARG B HD2   1 
ATOM   10183 H  HD3   . ARG D 1 243 ? 1.015   -25.745 13.547  1.00 43.33 ? 243 ARG B HD3   1 
ATOM   10184 H  HE    . ARG D 1 243 ? 1.560   -27.169 15.125  1.00 64.20 ? 243 ARG B HE    1 
ATOM   10185 H  HH11  . ARG D 1 243 ? 0.540   -28.857 12.524  1.00 48.73 ? 243 ARG B HH11  1 
ATOM   10186 H  HH12  . ARG D 1 243 ? 0.937   -30.208 13.011  1.00 48.73 ? 243 ARG B HH12  1 
ATOM   10187 H  HH21  . ARG D 1 243 ? 2.053   -29.270 15.965  1.00 57.51 ? 243 ARG B HH21  1 
ATOM   10188 H  HH22  . ARG D 1 243 ? 1.852   -30.460 15.091  1.00 57.51 ? 243 ARG B HH22  1 
ATOM   10189 N  N     . LYS D 1 244 ? -1.817  -25.361 10.409  1.00 22.79 ? 244 LYS B N     1 
ATOM   10190 C  CA    . LYS D 1 244 ? -2.678  -25.770 9.331   1.00 25.11 ? 244 LYS B CA    1 
ATOM   10191 C  C     . LYS D 1 244 ? -2.834  -27.279 9.201   1.00 24.45 ? 244 LYS B C     1 
ATOM   10192 O  O     . LYS D 1 244 ? -3.739  -27.753 8.531   1.00 21.83 ? 244 LYS B O     1 
ATOM   10193 C  CB    . LYS D 1 244 ? -2.177  -25.157 8.031   1.00 26.26 ? 244 LYS B CB    1 
ATOM   10194 C  CG    . LYS D 1 244 ? -2.462  -23.663 7.986   1.00 35.20 ? 244 LYS B CG    1 
ATOM   10195 C  CD    . LYS D 1 244 ? -2.369  -23.096 6.581   1.00 45.63 ? 244 LYS B CD    1 
ATOM   10196 C  CE    . LYS D 1 244 ? -0.993  -23.314 5.995   1.00 52.18 ? 244 LYS B CE    1 
ATOM   10197 N  NZ    . LYS D 1 244 ? -0.532  -22.161 5.174   1.00 55.02 ? 244 LYS B NZ    1 
ATOM   10198 H  H     . LYS D 1 244 ? -0.985  -25.534 10.273  1.00 27.29 ? 244 LYS B H     1 
ATOM   10199 H  HA    . LYS D 1 244 ? -3.570  -25.403 9.499   1.00 30.07 ? 244 LYS B HA    1 
ATOM   10200 H  HB2   . LYS D 1 244 ? -1.218  -25.288 7.962   1.00 31.45 ? 244 LYS B HB2   1 
ATOM   10201 H  HB3   . LYS D 1 244 ? -2.629  -25.577 7.283   1.00 31.45 ? 244 LYS B HB3   1 
ATOM   10202 H  HG2   . LYS D 1 244 ? -3.359  -23.501 8.317   1.00 42.18 ? 244 LYS B HG2   1 
ATOM   10203 H  HG3   . LYS D 1 244 ? -1.814  -23.200 8.540   1.00 42.18 ? 244 LYS B HG3   1 
ATOM   10204 H  HD2   . LYS D 1 244 ? -3.017  -23.540 6.012   1.00 54.70 ? 244 LYS B HD2   1 
ATOM   10205 H  HD3   . LYS D 1 244 ? -2.542  -22.142 6.608   1.00 54.70 ? 244 LYS B HD3   1 
ATOM   10206 H  HE2   . LYS D 1 244 ? -0.357  -23.441 6.717   1.00 62.55 ? 244 LYS B HE2   1 
ATOM   10207 H  HE3   . LYS D 1 244 ? -1.011  -24.100 5.427   1.00 62.55 ? 244 LYS B HE3   1 
ATOM   10208 H  HZ1   . LYS D 1 244 ? -0.499  -21.426 5.674   1.00 65.96 ? 244 LYS B HZ1   1 
ATOM   10209 H  HZ2   . LYS D 1 244 ? 0.279   -22.326 4.847   1.00 65.96 ? 244 LYS B HZ2   1 
ATOM   10210 H  HZ3   . LYS D 1 244 ? -1.095  -22.026 4.497   1.00 65.96 ? 244 LYS B HZ3   1 
ATOM   10211 N  N     . SER D 1 245 ? -1.975  -28.037 9.863   1.00 16.05 ? 245 SER B N     1 
ATOM   10212 C  CA    . SER D 1 245 ? -2.104  -29.486 9.811   1.00 17.17 ? 245 SER B CA    1 
ATOM   10213 C  C     . SER D 1 245 ? -1.472  -30.056 11.028  1.00 18.76 ? 245 SER B C     1 
ATOM   10214 O  O     . SER D 1 245 ? -0.649  -29.398 11.672  1.00 21.20 ? 245 SER B O     1 
ATOM   10215 C  CB    . SER D 1 245 ? -1.462  -30.059 8.543   1.00 19.19 ? 245 SER B CB    1 
ATOM   10216 O  OG    . SER D 1 245 ? -0.040  -29.964 8.569   1.00 17.22 ? 245 SER B OG    1 
ATOM   10217 H  H     . SER D 1 245 ? -1.321  -27.747 10.340  1.00 19.20 ? 245 SER B H     1 
ATOM   10218 H  HA    . SER D 1 245 ? -3.054  -29.728 9.813   1.00 20.54 ? 245 SER B HA    1 
ATOM   10219 H  HB2   . SER D 1 245 ? -1.710  -30.994 8.463   1.00 22.96 ? 245 SER B HB2   1 
ATOM   10220 H  HB3   . SER D 1 245 ? -1.793  -29.566 7.776   1.00 22.96 ? 245 SER B HB3   1 
ATOM   10221 H  HG    . SER D 1 245 ? 0.275   -30.278 7.880   1.00 20.60 ? 245 SER B HG    1 
ATOM   10222 N  N     . ILE D 1 246 ? -1.918  -31.240 11.406  1.00 13.73 ? 246 ILE B N     1 
ATOM   10223 C  CA    . ILE D 1 246 ? -1.397  -31.912 12.570  1.00 15.92 ? 246 ILE B CA    1 
ATOM   10224 C  C     . ILE D 1 246 ? -1.347  -33.373 12.246  1.00 15.67 ? 246 ILE B C     1 
ATOM   10225 O  O     . ILE D 1 246 ? -2.321  -33.948 11.738  1.00 14.11 ? 246 ILE B O     1 
ATOM   10226 C  CB    . ILE D 1 246 ? -2.317  -31.687 13.788  1.00 20.40 ? 246 ILE B CB    1 
ATOM   10227 C  CG1   . ILE D 1 246 ? -2.217  -30.244 14.252  1.00 27.71 ? 246 ILE B CG1   1 
ATOM   10228 C  CG2   . ILE D 1 246 ? -1.988  -32.670 14.913  1.00 25.66 ? 246 ILE B CG2   1 
ATOM   10229 C  CD1   . ILE D 1 246 ? -3.224  -29.892 15.323  1.00 26.79 ? 246 ILE B CD1   1 
ATOM   10230 H  H     . ILE D 1 246 ? -2.532  -31.680 10.995  1.00 16.42 ? 246 ILE B H     1 
ATOM   10231 H  HA    . ILE D 1 246 ? -0.495  -31.591 12.778  1.00 19.04 ? 246 ILE B HA    1 
ATOM   10232 H  HB    . ILE D 1 246 ? -3.231  -31.849 13.507  1.00 24.42 ? 246 ILE B HB    1 
ATOM   10233 H  HG12  . ILE D 1 246 ? -1.330  -30.091 14.614  1.00 33.19 ? 246 ILE B HG12  1 
ATOM   10234 H  HG13  . ILE D 1 246 ? -2.370  -29.658 13.494  1.00 33.19 ? 246 ILE B HG13  1 
ATOM   10235 H  HG21  . ILE D 1 246 ? -1.076  -32.541 15.184  1.00 30.73 ? 246 ILE B HG21  1 
ATOM   10236 H  HG22  . ILE D 1 246 ? -2.576  -32.505 15.654  1.00 30.73 ? 246 ILE B HG22  1 
ATOM   10237 H  HG23  . ILE D 1 246 ? -2.111  -33.566 14.591  1.00 30.73 ? 246 ILE B HG23  1 
ATOM   10238 H  HD11  . ILE D 1 246 ? -4.109  -30.028 14.977  1.00 32.08 ? 246 ILE B HD11  1 
ATOM   10239 H  HD12  . ILE D 1 246 ? -3.079  -30.457 16.086  1.00 32.08 ? 246 ILE B HD12  1 
ATOM   10240 H  HD13  . ILE D 1 246 ? -3.107  -28.971 15.571  1.00 32.08 ? 246 ILE B HD13  1 
ATOM   10241 N  N     . GLY D 1 247 ? -0.221  -34.000 12.521  1.00 13.10 ? 247 GLY B N     1 
ATOM   10242 C  CA    . GLY D 1 247 ? -0.096  -35.403 12.178  1.00 17.49 ? 247 GLY B CA    1 
ATOM   10243 C  C     . GLY D 1 247 ? 0.899   -36.182 13.031  1.00 16.17 ? 247 GLY B C     1 
ATOM   10244 O  O     . GLY D 1 247 ? 1.520   -35.670 13.966  1.00 13.50 ? 247 GLY B O     1 
ATOM   10245 H  H     . GLY D 1 247 ? 0.469   -33.650 12.895  1.00 15.66 ? 247 GLY B H     1 
ATOM   10246 H  HA2   . GLY D 1 247 ? -0.963  -35.828 12.267  1.00 20.92 ? 247 GLY B HA2   1 
ATOM   10247 H  HA3   . GLY D 1 247 ? 0.182   -35.478 11.252  1.00 20.92 ? 247 GLY B HA3   1 
ATOM   10248 N  N     . ARG D 1 248 ? 1.027   -37.455 12.708  1.00 12.78 ? 248 ARG B N     1 
ATOM   10249 C  CA    . ARG D 1 248 ? 1.899   -38.331 13.471  1.00 19.30 ? 248 ARG B CA    1 
ATOM   10250 C  C     . ARG D 1 248 ? 2.291   -39.491 12.576  1.00 18.99 ? 248 ARG B C     1 
ATOM   10251 O  O     . ARG D 1 248 ? 1.472   -40.007 11.839  1.00 18.08 ? 248 ARG B O     1 
ATOM   10252 C  CB    . ARG D 1 248 ? 1.185   -38.781 14.740  1.00 18.93 ? 248 ARG B CB    1 
ATOM   10253 C  CG    . ARG D 1 248 ? 2.001   -39.622 15.652  1.00 30.90 ? 248 ARG B CG    1 
ATOM   10254 C  CD    . ARG D 1 248 ? 2.773   -38.817 16.727  1.00 30.04 ? 248 ARG B CD    1 
ATOM   10255 N  NE    . ARG D 1 248 ? 3.334   -39.798 17.651  1.00 44.20 ? 248 ARG B NE    1 
ATOM   10256 C  CZ    . ARG D 1 248 ? 4.447   -40.501 17.437  1.00 39.82 ? 248 ARG B CZ    1 
ATOM   10257 N  NH1   . ARG D 1 248 ? 5.201   -40.279 16.360  1.00 41.02 ? 248 ARG B NH1   1 
ATOM   10258 N  NH2   . ARG D 1 248 ? 4.835   -41.403 18.331  1.00 44.12 ? 248 ARG B NH2   1 
ATOM   10259 H  H     . ARG D 1 248 ? 0.621   -37.838 12.053  1.00 15.28 ? 248 ARG B H     1 
ATOM   10260 H  HA    . ARG D 1 248 ? 2.711   -37.845 13.726  1.00 23.10 ? 248 ARG B HA    1 
ATOM   10261 H  HB2   . ARG D 1 248 ? 0.910   -37.994 15.235  1.00 22.66 ? 248 ARG B HB2   1 
ATOM   10262 H  HB3   . ARG D 1 248 ? 0.403   -39.296 14.488  1.00 22.66 ? 248 ARG B HB3   1 
ATOM   10263 H  HG2   . ARG D 1 248 ? 1.415   -40.243 16.112  1.00 37.02 ? 248 ARG B HG2   1 
ATOM   10264 H  HG3   . ARG D 1 248 ? 2.651   -40.113 15.126  1.00 37.02 ? 248 ARG B HG3   1 
ATOM   10265 H  HD2   . ARG D 1 248 ? 3.495   -38.315 16.316  1.00 35.98 ? 248 ARG B HD2   1 
ATOM   10266 H  HD3   . ARG D 1 248 ? 2.167   -38.233 17.209  1.00 35.98 ? 248 ARG B HD3   1 
ATOM   10267 H  HE    . ARG D 1 248 ? 2.915   -39.932 18.390  1.00 52.97 ? 248 ARG B HE    1 
ATOM   10268 H  HH11  . ARG D 1 248 ? 4.951   -39.703 15.771  1.00 49.17 ? 248 ARG B HH11  1 
ATOM   10269 H  HH12  . ARG D 1 248 ? 5.924   -40.729 16.240  1.00 49.17 ? 248 ARG B HH12  1 
ATOM   10270 H  HH21  . ARG D 1 248 ? 4.364   -41.538 19.038  1.00 52.88 ? 248 ARG B HH21  1 
ATOM   10271 H  HH22  . ARG D 1 248 ? 5.568   -41.837 18.214  1.00 52.88 ? 248 ARG B HH22  1 
ATOM   10272 N  N     A ILE D 1 249 ? 3.569   -39.858 12.582  0.88 11.69 ? 249 ILE B N     1 
ATOM   10273 C  CA    A ILE D 1 249 ? 4.004   -40.948 11.729  0.88 13.82 ? 249 ILE B CA    1 
ATOM   10274 C  C     . ILE D 1 249 ? 5.072   -41.751 12.474  1.00 19.95 ? 249 ILE B C     1 
ATOM   10275 O  O     . ILE D 1 249 ? 5.930   -41.172 13.111  1.00 17.20 ? 249 ILE B O     1 
ATOM   10276 C  CB    A ILE D 1 249 ? 4.496   -40.444 10.360  0.88 17.20 ? 249 ILE B CB    1 
ATOM   10277 C  CG1   A ILE D 1 249 ? 5.027   -41.605 9.534   0.88 15.38 ? 249 ILE B CG1   1 
ATOM   10278 C  CG2   A ILE D 1 249 ? 5.574   -39.387 10.496  0.88 24.81 ? 249 ILE B CG2   1 
ATOM   10279 C  CD1   A ILE D 1 249 ? 5.108   -41.301 8.057   0.88 23.89 ? 249 ILE B CD1   1 
ATOM   10280 H  H     A ILE D 1 249 ? 4.187   -39.499 13.059  0.88 13.97 ? 249 ILE B H     1 
ATOM   10281 H  HA    A ILE D 1 249 ? 3.242   -41.543 11.568  0.88 16.53 ? 249 ILE B HA    1 
ATOM   10282 H  HB    A ILE D 1 249 ? 3.743   -40.054 9.890   0.88 20.58 ? 249 ILE B HB    1 
ATOM   10283 H  HG12  A ILE D 1 249 ? 5.920   -41.827 9.842   0.88 18.40 ? 249 ILE B HG12  1 
ATOM   10284 H  HG13  A ILE D 1 249 ? 4.439   -42.367 9.649   0.88 18.40 ? 249 ILE B HG13  1 
ATOM   10285 H  HG21  A ILE D 1 249 ? 5.219   -38.641 10.984  0.88 29.71 ? 249 ILE B HG21  1 
ATOM   10286 H  HG22  A ILE D 1 249 ? 6.321   -39.762 10.968  0.88 29.71 ? 249 ILE B HG22  1 
ATOM   10287 H  HG23  A ILE D 1 249 ? 5.847   -39.106 9.620   0.88 29.71 ? 249 ILE B HG23  1 
ATOM   10288 H  HD11  A ILE D 1 249 ? 5.696   -40.554 7.923   0.88 28.60 ? 249 ILE B HD11  1 
ATOM   10289 H  HD12  A ILE D 1 249 ? 5.450   -42.072 7.598   0.88 28.60 ? 249 ILE B HD12  1 
ATOM   10290 H  HD13  A ILE D 1 249 ? 4.230   -41.089 7.733   0.88 28.60 ? 249 ILE B HD13  1 
ATOM   10291 N  N     . VAL D 1 250 ? 4.992   -43.076 12.393  1.00 15.79 ? 250 VAL B N     1 
ATOM   10292 C  CA    . VAL D 1 250 ? 5.794   -43.945 13.258  1.00 17.51 ? 250 VAL B CA    1 
ATOM   10293 C  C     . VAL D 1 250 ? 6.463   -45.051 12.416  1.00 21.82 ? 250 VAL B C     1 
ATOM   10294 O  O     . VAL D 1 250 ? 5.956   -45.456 11.351  1.00 18.71 ? 250 VAL B O     1 
ATOM   10295 C  CB    . VAL D 1 250 ? 4.928   -44.593 14.368  1.00 30.12 ? 250 VAL B CB    1 
ATOM   10296 C  CG1   . VAL D 1 250 ? 4.288   -43.522 15.288  1.00 28.33 ? 250 VAL B CG1   1 
ATOM   10297 C  CG2   . VAL D 1 250 ? 3.862   -45.481 13.761  1.00 28.07 ? 250 VAL B CG2   1 
ATOM   10298 H  H     . VAL D 1 250 ? 4.481   -43.499 11.847  1.00 18.88 ? 250 VAL B H     1 
ATOM   10299 H  HA    . VAL D 1 250 ? 6.499   -43.416 13.687  1.00 20.96 ? 250 VAL B HA    1 
ATOM   10300 H  HB    . VAL D 1 250 ? 5.503   -45.158 14.925  1.00 36.09 ? 250 VAL B HB    1 
ATOM   10301 H  HG11  . VAL D 1 250 ? 3.761   -43.962 15.959  1.00 33.93 ? 250 VAL B HG11  1 
ATOM   10302 H  HG12  . VAL D 1 250 ? 4.985   -43.010 15.702  1.00 33.93 ? 250 VAL B HG12  1 
ATOM   10303 H  HG13  . VAL D 1 250 ? 3.730   -42.948 14.758  1.00 33.93 ? 250 VAL B HG13  1 
ATOM   10304 H  HG21  . VAL D 1 250 ? 3.945   -45.459 12.805  1.00 33.62 ? 250 VAL B HG21  1 
ATOM   10305 H  HG22  . VAL D 1 250 ? 3.985   -46.378 14.080  1.00 33.62 ? 250 VAL B HG22  1 
ATOM   10306 H  HG23  . VAL D 1 250 ? 2.998   -45.155 14.023  1.00 33.62 ? 250 VAL B HG23  1 
ATOM   10307 N  N     . THR D 1 251 ? 7.606   -45.531 12.893  1.00 20.28 ? 251 THR B N     1 
ATOM   10308 C  CA    . THR D 1 251 ? 8.351   -46.581 12.211  1.00 20.84 ? 251 THR B CA    1 
ATOM   10309 C  C     . THR D 1 251 ? 7.864   -47.881 12.829  1.00 25.22 ? 251 THR B C     1 
ATOM   10310 O  O     . THR D 1 251 ? 7.784   -47.998 14.042  1.00 24.67 ? 251 THR B O     1 
ATOM   10311 C  CB    . THR D 1 251 ? 9.898   -46.371 12.358  1.00 22.95 ? 251 THR B CB    1 
ATOM   10312 O  OG1   . THR D 1 251 ? 10.297  -45.171 11.666  1.00 20.32 ? 251 THR B OG1   1 
ATOM   10313 C  CG2   . THR D 1 251 ? 10.693  -47.534 11.760  1.00 29.15 ? 251 THR B CG2   1 
ATOM   10314 H  H     . THR D 1 251 ? 7.976   -45.260 13.621  1.00 24.28 ? 251 THR B H     1 
ATOM   10315 H  HA    . THR D 1 251 ? 8.124   -46.582 11.258  1.00 24.95 ? 251 THR B HA    1 
ATOM   10316 H  HB    . THR D 1 251 ? 10.126  -46.293 13.298  1.00 27.47 ? 251 THR B HB    1 
ATOM   10317 H  HG1   . THR D 1 251 ? 9.908   -44.522 11.982  1.00 24.32 ? 251 THR B HG1   1 
ATOM   10318 H  HG21  . THR D 1 251 ? 11.634  -47.376 11.866  1.00 34.92 ? 251 THR B HG21  1 
ATOM   10319 H  HG22  . THR D 1 251 ? 10.462  -48.352 12.206  1.00 34.92 ? 251 THR B HG22  1 
ATOM   10320 H  HG23  . THR D 1 251 ? 10.494  -47.621 10.825  1.00 34.92 ? 251 THR B HG23  1 
ATOM   10321 N  N     . MET D 1 252 ? 7.473   -48.831 11.989  1.00 22.64 ? 252 MET B N     1 
ATOM   10322 C  CA    . MET D 1 252 ? 6.969   -50.104 12.476  1.00 27.31 ? 252 MET B CA    1 
ATOM   10323 C  C     . MET D 1 252 ? 8.150   -51.025 12.845  1.00 28.75 ? 252 MET B C     1 
ATOM   10324 O  O     . MET D 1 252 ? 9.262   -50.812 12.391  1.00 30.33 ? 252 MET B O     1 
ATOM   10325 C  CB    . MET D 1 252 ? 6.081   -50.755 11.416  1.00 36.98 ? 252 MET B CB    1 
ATOM   10326 C  CG    . MET D 1 252 ? 4.858   -49.902 11.049  1.00 28.02 ? 252 MET B CG    1 
ATOM   10327 S  SD    . MET D 1 252 ? 3.770   -50.751 9.891   1.00 30.42 ? 252 MET B SD    1 
ATOM   10328 C  CE    . MET D 1 252 ? 4.767   -50.726 8.430   1.00 26.69 ? 252 MET B CE    1 
ATOM   10329 H  H     . MET D 1 252 ? 7.491   -48.762 11.132  1.00 27.11 ? 252 MET B H     1 
ATOM   10330 H  HA    . MET D 1 252 ? 6.423   -49.948 13.275  1.00 32.71 ? 252 MET B HA    1 
ATOM   10331 H  HB2   . MET D 1 252 ? 6.602   -50.892 10.609  1.00 44.31 ? 252 MET B HB2   1 
ATOM   10332 H  HB3   . MET D 1 252 ? 5.762   -51.607 11.752  1.00 44.31 ? 252 MET B HB3   1 
ATOM   10333 H  HG2   . MET D 1 252 ? 4.351   -49.709 11.854  1.00 33.57 ? 252 MET B HG2   1 
ATOM   10334 H  HG3   . MET D 1 252 ? 5.156   -49.078 10.636  1.00 33.57 ? 252 MET B HG3   1 
ATOM   10335 H  HE1   . MET D 1 252 ? 4.289   -51.159 7.719   1.00 31.97 ? 252 MET B HE1   1 
ATOM   10336 H  HE2   . MET D 1 252 ? 4.951   -49.814 8.194   1.00 31.97 ? 252 MET B HE2   1 
ATOM   10337 H  HE3   . MET D 1 252 ? 5.588   -51.192 8.605   1.00 31.97 ? 252 MET B HE3   1 
ATOM   10338 N  N     . LYS D 1 253 ? 7.908   -52.014 13.690  1.00 30.45 ? 253 LYS B N     1 
ATOM   10339 C  CA    . LYS D 1 253 ? 9.001   -52.864 14.156  1.00 38.31 ? 253 LYS B CA    1 
ATOM   10340 C  C     . LYS D 1 253 ? 9.593   -53.605 12.953  1.00 39.66 ? 253 LYS B C     1 
ATOM   10341 O  O     . LYS D 1 253 ? 10.783  -53.865 12.890  1.00 38.91 ? 253 LYS B O     1 
ATOM   10342 C  CB    . LYS D 1 253 ? 8.511   -53.822 15.243  1.00 43.27 ? 253 LYS B CB    1 
ATOM   10343 C  CG    . LYS D 1 253 ? 9.559   -54.823 15.725  1.00 47.73 ? 253 LYS B CG    1 
ATOM   10344 C  CD    . LYS D 1 253 ? 8.898   -56.083 16.296  1.00 54.13 ? 253 LYS B CD    1 
ATOM   10345 C  CE    . LYS D 1 253 ? 8.432   -55.894 17.742  1.00 61.25 ? 253 LYS B CE    1 
ATOM   10346 N  NZ    . LYS D 1 253 ? 9.579   -55.912 18.710  1.00 55.35 ? 253 LYS B NZ    1 
ATOM   10347 H  H     . LYS D 1 253 ? 7.135   -52.215 14.006  1.00 36.48 ? 253 LYS B H     1 
ATOM   10348 H  HA    . LYS D 1 253 ? 9.703   -52.301 14.542  1.00 45.91 ? 253 LYS B HA    1 
ATOM   10349 H  HB2   . LYS D 1 253 ? 8.228   -53.301 16.010  1.00 51.86 ? 253 LYS B HB2   1 
ATOM   10350 H  HB3   . LYS D 1 253 ? 7.760   -54.327 14.895  1.00 51.86 ? 253 LYS B HB3   1 
ATOM   10351 H  HG2   . LYS D 1 253 ? 10.120  -55.084 14.979  1.00 57.21 ? 253 LYS B HG2   1 
ATOM   10352 H  HG3   . LYS D 1 253 ? 10.094  -54.416 16.424  1.00 57.21 ? 253 LYS B HG3   1 
ATOM   10353 H  HD2   . LYS D 1 253 ? 8.124   -56.307 15.756  1.00 64.89 ? 253 LYS B HD2   1 
ATOM   10354 H  HD3   . LYS D 1 253 ? 9.538   -56.811 16.278  1.00 64.89 ? 253 LYS B HD3   1 
ATOM   10355 H  HE2   . LYS D 1 253 ? 7.981   -55.039 17.822  1.00 73.44 ? 253 LYS B HE2   1 
ATOM   10356 H  HE3   . LYS D 1 253 ? 7.826   -56.614 17.977  1.00 73.44 ? 253 LYS B HE3   1 
ATOM   10357 H  HZ1   . LYS D 1 253 ? 10.148  -55.255 18.518  1.00 66.35 ? 253 LYS B HZ1   1 
ATOM   10358 H  HZ2   . LYS D 1 253 ? 9.277   -55.801 19.540  1.00 66.35 ? 253 LYS B HZ2   1 
ATOM   10359 H  HZ3   . LYS D 1 253 ? 10.007  -56.690 18.659  1.00 66.35 ? 253 LYS B HZ3   1 
ATOM   10360 N  N     . ARG D 1 254 ? 8.753   -53.916 11.974  1.00 35.24 ? 254 ARG B N     1 
ATOM   10361 C  CA    . ARG D 1 254 ? 9.241   -54.518 10.749  1.00 38.51 ? 254 ARG B CA    1 
ATOM   10362 C  C     . ARG D 1 254 ? 8.397   -54.056 9.577   1.00 35.77 ? 254 ARG B C     1 
ATOM   10363 O  O     . ARG D 1 254 ? 7.257   -53.626 9.754   1.00 37.51 ? 254 ARG B O     1 
ATOM   10364 C  CB    . ARG D 1 254 ? 9.198   -56.041 10.862  1.00 44.51 ? 254 ARG B CB    1 
ATOM   10365 C  CG    . ARG D 1 254 ? 7.873   -56.569 11.372  1.00 48.30 ? 254 ARG B CG    1 
ATOM   10366 C  CD    . ARG D 1 254 ? 7.980   -58.032 11.772  1.00 55.60 ? 254 ARG B CD    1 
ATOM   10367 N  NE    . ARG D 1 254 ? 7.515   -58.938 10.722  1.00 61.13 ? 254 ARG B NE    1 
ATOM   10368 C  CZ    . ARG D 1 254 ? 6.425   -59.699 10.796  1.00 68.69 ? 254 ARG B CZ    1 
ATOM   10369 N  NH1   . ARG D 1 254 ? 5.654   -59.684 11.874  1.00 70.16 ? 254 ARG B NH1   1 
ATOM   10370 N  NH2   . ARG D 1 254 ? 6.098   -60.486 9.782   1.00 67.64 ? 254 ARG B NH2   1 
ATOM   10371 H  H     . ARG D 1 254 ? 7.903   -53.789 11.997  1.00 42.23 ? 254 ARG B H     1 
ATOM   10372 H  HA    . ARG D 1 254 ? 10.168  -54.242 10.593  1.00 46.15 ? 254 ARG B HA    1 
ATOM   10373 H  HB2   . ARG D 1 254 ? 9.355   -56.426 9.986   1.00 53.35 ? 254 ARG B HB2   1 
ATOM   10374 H  HB3   . ARG D 1 254 ? 9.890   -56.329 11.478  1.00 53.35 ? 254 ARG B HB3   1 
ATOM   10375 H  HG2   . ARG D 1 254 ? 7.603   -56.059 12.151  1.00 57.90 ? 254 ARG B HG2   1 
ATOM   10376 H  HG3   . ARG D 1 254 ? 7.207   -56.493 10.671  1.00 57.90 ? 254 ARG B HG3   1 
ATOM   10377 H  HD2   . ARG D 1 254 ? 8.908   -58.242 11.960  1.00 66.65 ? 254 ARG B HD2   1 
ATOM   10378 H  HD3   . ARG D 1 254 ? 7.438   -58.184 12.562  1.00 66.65 ? 254 ARG B HD3   1 
ATOM   10379 H  HE    . ARG D 1 254 ? 7.981   -58.982 10.001  1.00 73.29 ? 254 ARG B HE    1 
ATOM   10380 H  HH11  . ARG D 1 254 ? 5.855   -59.178 12.539  1.00 84.13 ? 254 ARG B HH11  1 
ATOM   10381 H  HH12  . ARG D 1 254 ? 4.953   -60.181 11.908  1.00 84.13 ? 254 ARG B HH12  1 
ATOM   10382 H  HH21  . ARG D 1 254 ? 6.590   -60.504 9.077   1.00 81.11 ? 254 ARG B HH21  1 
ATOM   10383 H  HH22  . ARG D 1 254 ? 5.394   -60.977 9.829   1.00 81.11 ? 254 ARG B HH22  1 
ATOM   10384 N  N     . ASN D 1 255 ? 8.952   -54.155 8.381   1.00 36.47 ? 255 ASN B N     1 
ATOM   10385 C  CA    . ASN D 1 255 ? 8.223   -53.767 7.201   1.00 40.41 ? 255 ASN B CA    1 
ATOM   10386 C  C     . ASN D 1 255 ? 7.063   -54.701 6.934   1.00 49.64 ? 255 ASN B C     1 
ATOM   10387 O  O     . ASN D 1 255 ? 7.012   -55.830 7.435   1.00 39.91 ? 255 ASN B O     1 
ATOM   10388 C  CB    . ASN D 1 255 ? 9.138   -53.709 6.000   1.00 36.29 ? 255 ASN B CB    1 
ATOM   10389 C  CG    . ASN D 1 255 ? 10.206  -52.660 6.150   1.00 46.48 ? 255 ASN B CG    1 
ATOM   10390 O  OD1   . ASN D 1 255 ? 10.202  -51.891 7.111   1.00 42.00 ? 255 ASN B OD1   1 
ATOM   10391 N  ND2   . ASN D 1 255 ? 11.122  -52.606 5.196   1.00 40.75 ? 255 ASN B ND2   1 
ATOM   10392 H  H     . ASN D 1 255 ? 9.748   -54.443 8.231   1.00 43.70 ? 255 ASN B H     1 
ATOM   10393 H  HA    . ASN D 1 255 ? 7.856   -52.869 7.339   1.00 48.43 ? 255 ASN B HA    1 
ATOM   10394 H  HB2   . ASN D 1 255 ? 9.573   -54.569 5.890   1.00 43.49 ? 255 ASN B HB2   1 
ATOM   10395 H  HB3   . ASN D 1 255 ? 8.614   -53.496 5.212   1.00 43.49 ? 255 ASN B HB3   1 
ATOM   10396 H  HD21  . ASN D 1 255 ? 11.753  -52.023 5.237   1.00 48.84 ? 255 ASN B HD21  1 
ATOM   10397 H  HD22  . ASN D 1 255 ? 11.086  -53.155 4.534   1.00 48.84 ? 255 ASN B HD22  1 
ATOM   10398 N  N     . SER D 1 256 ? 6.106   -54.223 6.156   1.00 39.70 ? 256 SER B N     1 
ATOM   10399 C  CA    . SER D 1 256 ? 4.885   -54.969 6.034   1.00 43.11 ? 256 SER B CA    1 
ATOM   10400 C  C     . SER D 1 256 ? 4.008   -54.401 4.957   1.00 44.17 ? 256 SER B C     1 
ATOM   10401 O  O     . SER D 1 256 ? 4.083   -53.211 4.616   1.00 34.82 ? 256 SER B O     1 
ATOM   10402 C  CB    . SER D 1 256 ? 4.144   -54.957 7.364   1.00 36.52 ? 256 SER B CB    1 
ATOM   10403 O  OG    . SER D 1 256 ? 3.168   -55.964 7.396   1.00 48.29 ? 256 SER B OG    1 
ATOM   10404 H  H     . SER D 1 256 ? 6.141   -53.492 5.705   1.00 47.58 ? 256 SER B H     1 
ATOM   10405 H  HA    . SER D 1 256 ? 5.094   -55.898 5.804   1.00 51.68 ? 256 SER B HA    1 
ATOM   10406 H  HB2   . SER D 1 256 ? 4.779   -55.109 8.082   1.00 43.76 ? 256 SER B HB2   1 
ATOM   10407 H  HB3   . SER D 1 256 ? 3.714   -54.095 7.479   1.00 43.76 ? 256 SER B HB3   1 
ATOM   10408 H  HG    . SER D 1 256 ? 2.774   -55.950 8.115   1.00 57.88 ? 256 SER B HG    1 
ATOM   10409 N  N     . ARG D 1 257 ? 3.205   -55.295 4.400   1.00 49.75 ? 257 ARG B N     1 
ATOM   10410 C  CA    . ARG D 1 257 ? 2.117   -54.936 3.518   1.00 44.37 ? 257 ARG B CA    1 
ATOM   10411 C  C     . ARG D 1 257 ? 0.918   -55.673 4.026   1.00 36.51 ? 257 ARG B C     1 
ATOM   10412 O  O     . ARG D 1 257 ? -0.026  -55.886 3.287   1.00 48.48 ? 257 ARG B O     1 
ATOM   10413 C  CB    . ARG D 1 257 ? 2.406   -55.369 2.090   1.00 39.71 ? 257 ARG B CB    1 
ATOM   10414 C  CG    . ARG D 1 257 ? 3.589   -54.673 1.467   1.00 41.63 ? 257 ARG B CG    1 
ATOM   10415 C  CD    . ARG D 1 257 ? 3.737   -55.092 0.039   1.00 42.37 ? 257 ARG B CD    1 
ATOM   10416 N  NE    . ARG D 1 257 ? 2.433   -55.172 -0.632  1.00 52.96 ? 257 ARG B NE    1 
ATOM   10417 C  CZ    . ARG D 1 257 ? 1.863   -54.186 -1.323  1.00 40.99 ? 257 ARG B CZ    1 
ATOM   10418 N  NH1   . ARG D 1 257 ? 2.460   -53.016 -1.463  1.00 40.09 ? 257 ARG B NH1   1 
ATOM   10419 N  NH2   . ARG D 1 257 ? 0.684   -54.387 -1.893  1.00 43.75 ? 257 ARG B NH2   1 
ATOM   10420 H  H     . ARG D 1 257 ? 3.276   -56.142 4.526   1.00 59.63 ? 257 ARG B H     1 
ATOM   10421 H  HA    . ARG D 1 257 ? 1.949   -53.971 3.545   1.00 53.19 ? 257 ARG B HA    1 
ATOM   10422 H  HB2   . ARG D 1 257 ? 2.586   -56.322 2.084   1.00 47.59 ? 257 ARG B HB2   1 
ATOM   10423 H  HB3   . ARG D 1 257 ? 1.628   -55.178 1.543   1.00 47.59 ? 257 ARG B HB3   1 
ATOM   10424 H  HG2   . ARG D 1 257 ? 3.453   -53.713 1.495   1.00 49.89 ? 257 ARG B HG2   1 
ATOM   10425 H  HG3   . ARG D 1 257 ? 4.397   -54.917 1.945   1.00 49.89 ? 257 ARG B HG3   1 
ATOM   10426 H  HD2   . ARG D 1 257 ? 4.281   -54.441 -0.431  1.00 50.79 ? 257 ARG B HD2   1 
ATOM   10427 H  HD3   . ARG D 1 257 ? 4.152   -55.967 0.003   1.00 50.79 ? 257 ARG B HD3   1 
ATOM   10428 H  HE    . ARG D 1 257 ? 2.003   -55.915 -0.575  1.00 63.49 ? 257 ARG B HE    1 
ATOM   10429 H  HH11  . ARG D 1 257 ? 3.228   -52.879 -1.100  1.00 48.04 ? 257 ARG B HH11  1 
ATOM   10430 H  HH12  . ARG D 1 257 ? 2.080   -52.390 -1.913  1.00 48.04 ? 257 ARG B HH12  1 
ATOM   10431 H  HH21  . ARG D 1 257 ? 0.288   -55.146 -1.807  1.00 52.43 ? 257 ARG B HH21  1 
ATOM   10432 H  HH22  . ARG D 1 257 ? 0.309   -53.755 -2.340  1.00 52.43 ? 257 ARG B HH22  1 
ATOM   10433 N  N     . ASN D 1 258 ? 0.967   -56.067 5.297   1.00 46.99 ? 258 ASN B N     1 
ATOM   10434 C  CA    . ASN D 1 258 ? -0.121  -56.790 5.934   1.00 41.62 ? 258 ASN B CA    1 
ATOM   10435 C  C     . ASN D 1 258 ? -1.016  -55.865 6.711   1.00 49.99 ? 258 ASN B C     1 
ATOM   10436 O  O     . ASN D 1 258 ? -0.616  -55.281 7.719   1.00 46.55 ? 258 ASN B O     1 
ATOM   10437 C  CB    . ASN D 1 258 ? 0.401   -57.869 6.892   1.00 49.60 ? 258 ASN B CB    1 
ATOM   10438 C  CG    . ASN D 1 258 ? -0.732  -58.622 7.604   1.00 44.64 ? 258 ASN B CG    1 
ATOM   10439 O  OD1   . ASN D 1 258 ? -1.412  -58.084 8.480   1.00 49.70 ? 258 ASN B OD1   1 
ATOM   10440 N  ND2   . ASN D 1 258 ? -0.929  -59.879 7.225   1.00 56.66 ? 258 ASN B ND2   1 
ATOM   10441 H  H     . ASN D 1 258 ? 1.636   -55.923 5.818   1.00 56.32 ? 258 ASN B H     1 
ATOM   10442 H  HA    . ASN D 1 258 ? -0.661  -57.230 5.244   1.00 49.88 ? 258 ASN B HA    1 
ATOM   10443 H  HB2   . ASN D 1 258 ? 0.921   -58.514 6.389   1.00 59.46 ? 258 ASN B HB2   1 
ATOM   10444 H  HB3   . ASN D 1 258 ? 0.955   -57.450 7.569   1.00 59.46 ? 258 ASN B HB3   1 
ATOM   10445 H  HD21  . ASN D 1 258 ? -0.434  -60.226 6.613   1.00 67.93 ? 258 ASN B HD21  1 
ATOM   10446 H  HD22  . ASN D 1 258 ? -1.550  -60.346 7.592   1.00 67.93 ? 258 ASN B HD22  1 
ATOM   10447 N  N     . LEU D 1 259 ? -2.258  -55.773 6.267   1.00 39.94 ? 259 LEU B N     1 
ATOM   10448 C  CA    . LEU D 1 259 ? -3.185  -54.816 6.826   1.00 40.74 ? 259 LEU B CA    1 
ATOM   10449 C  C     . LEU D 1 259 ? -3.338  -54.919 8.338   1.00 47.95 ? 259 LEU B C     1 
ATOM   10450 O  O     . LEU D 1 259 ? -3.271  -53.903 9.025   1.00 40.96 ? 259 LEU B O     1 
ATOM   10451 C  CB    . LEU D 1 259 ? -4.541  -54.969 6.135   1.00 49.66 ? 259 LEU B CB    1 
ATOM   10452 C  CG    . LEU D 1 259 ? -5.469  -53.773 6.236   1.00 36.89 ? 259 LEU B CG    1 
ATOM   10453 C  CD1   . LEU D 1 259 ? -4.859  -52.572 5.572   1.00 28.52 ? 259 LEU B CD1   1 
ATOM   10454 C  CD2   . LEU D 1 259 ? -6.822  -54.098 5.625   1.00 35.17 ? 259 LEU B CD2   1 
ATOM   10455 H  H     . LEU D 1 259 ? -2.588  -56.258 5.638   1.00 47.87 ? 259 LEU B H     1 
ATOM   10456 H  HA    . LEU D 1 259 ? -2.855  -53.915 6.627   1.00 48.83 ? 259 LEU B HA    1 
ATOM   10457 H  HB2   . LEU D 1 259 ? -4.387  -55.139 5.192   1.00 59.54 ? 259 LEU B HB2   1 
ATOM   10458 H  HB3   . LEU D 1 259 ? -5.001  -55.727 6.528   1.00 59.54 ? 259 LEU B HB3   1 
ATOM   10459 H  HG    . LEU D 1 259 ? -5.607  -53.559 7.172   1.00 44.21 ? 259 LEU B HG    1 
ATOM   10460 H  HD11  . LEU D 1 259 ? -5.465  -51.832 5.650   1.00 34.16 ? 259 LEU B HD11  1 
ATOM   10461 H  HD12  . LEU D 1 259 ? -4.029  -52.364 6.007   1.00 34.16 ? 259 LEU B HD12  1 
ATOM   10462 H  HD13  . LEU D 1 259 ? -4.704  -52.773 4.646   1.00 34.16 ? 259 LEU B HD13  1 
ATOM   10463 H  HD21  . LEU D 1 259 ? -7.208  -54.839 6.099   1.00 42.14 ? 259 LEU B HD21  1 
ATOM   10464 H  HD22  . LEU D 1 259 ? -7.391  -53.328 5.700   1.00 42.14 ? 259 LEU B HD22  1 
ATOM   10465 H  HD23  . LEU D 1 259 ? -6.700  -54.327 4.701   1.00 42.14 ? 259 LEU B HD23  1 
ATOM   10466 N  N     . GLU D 1 260 ? -3.549  -56.121 8.873   1.00 40.23 ? 260 GLU B N     1 
ATOM   10467 C  CA    A GLU D 1 260 ? -3.751  -56.275 10.313  0.70 45.69 ? 260 GLU B CA    1 
ATOM   10468 C  CA    B GLU D 1 260 ? -3.748  -56.281 10.309  0.30 45.75 ? 260 GLU B CA    1 
ATOM   10469 C  C     . GLU D 1 260 ? -2.485  -55.938 11.112  1.00 36.97 ? 260 GLU B C     1 
ATOM   10470 O  O     . GLU D 1 260 ? -2.559  -55.620 12.309  1.00 39.07 ? 260 GLU B O     1 
ATOM   10471 C  CB    A GLU D 1 260 ? -4.214  -57.693 10.669  0.70 51.66 ? 260 GLU B CB    1 
ATOM   10472 C  CB    B GLU D 1 260 ? -4.185  -57.717 10.630  0.30 51.59 ? 260 GLU B CB    1 
ATOM   10473 C  CG    A GLU D 1 260 ? -5.683  -57.982 10.357  0.70 51.07 ? 260 GLU B CG    1 
ATOM   10474 C  CG    B GLU D 1 260 ? -5.521  -58.136 10.013  0.30 51.06 ? 260 GLU B CG    1 
ATOM   10475 C  CD    A GLU D 1 260 ? -6.654  -57.066 11.087  0.70 48.72 ? 260 GLU B CD    1 
ATOM   10476 C  CD    B GLU D 1 260 ? -5.367  -58.863 8.684   0.30 48.87 ? 260 GLU B CD    1 
ATOM   10477 O  OE1   A GLU D 1 260 ? -6.713  -57.092 12.333  0.70 44.85 ? 260 GLU B OE1   1 
ATOM   10478 O  OE1   B GLU D 1 260 ? -5.428  -60.116 8.670   0.30 49.46 ? 260 GLU B OE1   1 
ATOM   10479 O  OE2   A GLU D 1 260 ? -7.371  -56.314 10.401  0.70 45.46 ? 260 GLU B OE2   1 
ATOM   10480 O  OE2   B GLU D 1 260 ? -5.195  -58.183 7.651   0.30 45.95 ? 260 GLU B OE2   1 
ATOM   10481 H  H     . GLU D 1 260 ? -3.580  -56.857 8.430   1.00 48.22 ? 260 GLU B H     1 
ATOM   10482 H  HA    . GLU D 1 260 ? -4.459  -55.665 10.598  0.30 54.84 ? 260 GLU B HA    1 
ATOM   10483 H  HB2   A GLU D 1 260 ? -3.678  -58.328 10.169  0.70 61.92 ? 260 GLU B HB2   1 
ATOM   10484 H  HB2   B GLU D 1 260 ? -3.506  -58.327 10.302  0.30 61.84 ? 260 GLU B HB2   1 
ATOM   10485 H  HB3   A GLU D 1 260 ? -4.083  -57.832 11.620  0.70 61.92 ? 260 GLU B HB3   1 
ATOM   10486 H  HB3   B GLU D 1 260 ? -4.266  -57.807 11.593  0.30 61.84 ? 260 GLU B HB3   1 
ATOM   10487 H  HG2   A GLU D 1 260 ? -5.829  -57.871 9.405   0.70 61.23 ? 260 GLU B HG2   1 
ATOM   10488 H  HG2   B GLU D 1 260 ? -5.978  -58.730 10.628  0.30 61.22 ? 260 GLU B HG2   1 
ATOM   10489 H  HG3   A GLU D 1 260 ? -5.885  -58.895 10.617  0.70 61.23 ? 260 GLU B HG3   1 
ATOM   10490 H  HG3   B GLU D 1 260 ? -6.058  -57.343 9.859   0.30 61.22 ? 260 GLU B HG3   1 
ATOM   10491 N  N     . GLU D 1 261 ? -1.333  -56.013 10.462  1.00 42.81 ? 261 GLU B N     1 
ATOM   10492 C  CA    . GLU D 1 261 ? -0.076  -55.743 11.151  1.00 46.30 ? 261 GLU B CA    1 
ATOM   10493 C  C     . GLU D 1 261 ? 0.131   -54.214 11.233  1.00 41.96 ? 261 GLU B C     1 
ATOM   10494 O  O     . GLU D 1 261 ? 0.641   -53.687 12.225  1.00 39.32 ? 261 GLU B O     1 
ATOM   10495 C  CB    . GLU D 1 261 ? 1.082   -56.433 10.420  1.00 47.99 ? 261 GLU B CB    1 
ATOM   10496 C  CG    . GLU D 1 261 ? 2.399   -56.497 11.191  1.00 54.48 ? 261 GLU B CG    1 
ATOM   10497 C  CD    . GLU D 1 261 ? 3.498   -57.257 10.448  1.00 61.13 ? 261 GLU B CD    1 
ATOM   10498 O  OE1   . GLU D 1 261 ? 3.293   -57.654 9.280   1.00 59.40 ? 261 GLU B OE1   1 
ATOM   10499 O  OE2   . GLU D 1 261 ? 4.581   -57.455 11.037  1.00 60.20 ? 261 GLU B OE2   1 
ATOM   10500 H  H     . GLU D 1 261 ? -1.249  -56.216 9.631   1.00 51.31 ? 261 GLU B H     1 
ATOM   10501 H  HA    . GLU D 1 261 ? -0.121  -56.098 12.063  1.00 55.49 ? 261 GLU B HA    1 
ATOM   10502 H  HB2   . GLU D 1 261 ? 0.818   -57.345 10.219  1.00 57.52 ? 261 GLU B HB2   1 
ATOM   10503 H  HB3   . GLU D 1 261 ? 1.252   -55.955 9.593   1.00 57.52 ? 261 GLU B HB3   1 
ATOM   10504 H  HG2   . GLU D 1 261 ? 2.716   -55.593 11.348  1.00 65.31 ? 261 GLU B HG2   1 
ATOM   10505 H  HG3   . GLU D 1 261 ? 2.247   -56.945 12.038  1.00 65.31 ? 261 GLU B HG3   1 
ATOM   10506 N  N     . ILE D 1 262 ? -0.292  -53.510 10.189  1.00 43.17 ? 262 ILE B N     1 
ATOM   10507 C  CA    . ILE D 1 262 ? -0.093  -52.064 10.105  1.00 43.93 ? 262 ILE B CA    1 
ATOM   10508 C  C     . ILE D 1 262 ? -1.123  -51.288 10.919  1.00 39.87 ? 262 ILE B C     1 
ATOM   10509 O  O     . ILE D 1 262 ? -0.786  -50.288 11.556  1.00 36.25 ? 262 ILE B O     1 
ATOM   10510 C  CB    . ILE D 1 262 ? -0.113  -51.594 8.636   1.00 44.71 ? 262 ILE B CB    1 
ATOM   10511 C  CG1   . ILE D 1 262 ? 1.035   -52.257 7.872   1.00 39.75 ? 262 ILE B CG1   1 
ATOM   10512 C  CG2   . ILE D 1 262 ? -0.011  -50.067 8.553   1.00 36.95 ? 262 ILE B CG2   1 
ATOM   10513 C  CD1   . ILE D 1 262 ? 0.965   -52.113 6.342   1.00 33.02 ? 262 ILE B CD1   1 
ATOM   10514 H  H     . ILE D 1 262 ? -0.699  -53.847 9.510   1.00 51.74 ? 262 ILE B H     1 
ATOM   10515 H  HA    . ILE D 1 262 ? 0.791   -51.850 10.470  1.00 52.65 ? 262 ILE B HA    1 
ATOM   10516 H  HB    . ILE D 1 262 ? -0.952  -51.870 8.234   1.00 53.59 ? 262 ILE B HB    1 
ATOM   10517 H  HG12  . ILE D 1 262 ? 1.870   -51.861 8.166   1.00 47.63 ? 262 ILE B HG12  1 
ATOM   10518 H  HG13  . ILE D 1 262 ? 1.034   -53.205 8.077   1.00 47.63 ? 262 ILE B HG13  1 
ATOM   10519 H  HG21  . ILE D 1 262 ? -0.757  -49.679 9.017   1.00 44.28 ? 262 ILE B HG21  1 
ATOM   10520 H  HG22  . ILE D 1 262 ? 0.811   -49.786 8.961   1.00 44.28 ? 262 ILE B HG22  1 
ATOM   10521 H  HG23  . ILE D 1 262 ? -0.026  -49.803 7.630   1.00 44.28 ? 262 ILE B HG23  1 
ATOM   10522 H  HD11  . ILE D 1 262 ? 0.980   -51.180 6.116   1.00 39.57 ? 262 ILE B HD11  1 
ATOM   10523 H  HD12  . ILE D 1 262 ? 1.721   -52.557 5.952   1.00 39.57 ? 262 ILE B HD12  1 
ATOM   10524 H  HD13  . ILE D 1 262 ? 0.151   -52.513 6.028   1.00 39.57 ? 262 ILE B HD13  1 
ATOM   10525 N  N     . LYS D 1 263 ? -2.375  -51.743 10.921  1.00 31.98 ? 263 LYS B N     1 
ATOM   10526 C  CA    . LYS D 1 263 ? -3.457  -50.989 11.559  1.00 37.21 ? 263 LYS B CA    1 
ATOM   10527 C  C     . LYS D 1 263 ? -3.148  -50.455 12.958  1.00 28.09 ? 263 LYS B C     1 
ATOM   10528 O  O     . LYS D 1 263 ? -3.502  -49.316 13.283  1.00 29.84 ? 263 LYS B O     1 
ATOM   10529 C  CB    . LYS D 1 263 ? -4.752  -51.827 11.618  1.00 42.68 ? 263 LYS B CB    1 
ATOM   10530 C  CG    . LYS D 1 263 ? -5.438  -51.985 10.277  1.00 43.73 ? 263 LYS B CG    1 
ATOM   10531 C  CD    . LYS D 1 263 ? -6.316  -53.256 10.192  1.00 52.47 ? 263 LYS B CD    1 
ATOM   10532 C  CE    . LYS D 1 263 ? -7.541  -53.189 11.092  1.00 46.38 ? 263 LYS B CE    1 
ATOM   10533 N  NZ    . LYS D 1 263 ? -8.652  -54.117 10.651  1.00 31.55 ? 263 LYS B NZ    1 
ATOM   10534 H  H     . LYS D 1 263 ? -2.625  -52.483 10.561  1.00 38.31 ? 263 LYS B H     1 
ATOM   10535 H  HA    . LYS D 1 263 ? -3.648  -50.210 10.996  1.00 44.59 ? 263 LYS B HA    1 
ATOM   10536 H  HB2   . LYS D 1 263 ? -4.537  -52.713 11.947  1.00 51.15 ? 263 LYS B HB2   1 
ATOM   10537 H  HB3   . LYS D 1 263 ? -5.377  -51.395 12.221  1.00 51.15 ? 263 LYS B HB3   1 
ATOM   10538 H  HG2   . LYS D 1 263 ? -6.009  -51.217 10.122  1.00 52.42 ? 263 LYS B HG2   1 
ATOM   10539 H  HG3   . LYS D 1 263 ? -4.763  -52.041 9.582   1.00 52.42 ? 263 LYS B HG3   1 
ATOM   10540 H  HD2   . LYS D 1 263 ? -6.621  -53.369 9.278   1.00 62.91 ? 263 LYS B HD2   1 
ATOM   10541 H  HD3   . LYS D 1 263 ? -5.787  -54.023 10.462  1.00 62.91 ? 263 LYS B HD3   1 
ATOM   10542 H  HE2   . LYS D 1 263 ? -7.283  -53.437 11.994  1.00 55.60 ? 263 LYS B HE2   1 
ATOM   10543 H  HE3   . LYS D 1 263 ? -7.888  -52.283 11.085  1.00 55.60 ? 263 LYS B HE3   1 
ATOM   10544 H