data_4FPR
# 
_entry.id   4FPR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.289 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4FPR         
RCSB  RCSB073201   
WWPDB D_1000073201 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          4FPQ 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4FPR 
_pdbx_database_status.recvd_initial_deposition_date   2012-06-22 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Blondeau, K.'      1  
'Blaise, F.'        2  
'Graille, M.'       3  
'Linglin, J.'       4  
'Ollivier, B.'      5  
'Labarde, A.'       6  
'Doizy, A.'         7  
'Daverdin, G.'      8  
'Balesdent, M.H.'   9  
'Rouxel, T.'        10 
'van Tilbeurgh, H.' 11 
'Fudal, I.'         12 
# 
_citation.id                        primary 
_citation.title                     'Structure of a fungal protein' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Blondeau, K.'      1  
primary 'Blaise, F.'        2  
primary 'Graille, M.'       3  
primary 'Linglin, J.'       4  
primary 'Ollivier, B.'      5  
primary 'Labarde, A.'       6  
primary 'Doizy, A.'         7  
primary 'Daverdin, G.'      8  
primary 'Balesdent, M.H.'   9  
primary 'Rouxel, T.'        10 
primary 'van Tilbeurgh, H.' 11 
primary 'Fudal, I.'         12 
# 
_cell.entry_id           4FPR 
_cell.length_a           61.150 
_cell.length_b           61.150 
_cell.length_c           155.340 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4FPR 
_symmetry.space_group_name_H-M             'P 43' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                78 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Avirulence Effector AvrLm4-7' 14879.876 4   ? 'I80K, G120R' ? ? 
2 water   nat water                          18.015    260 ? ?             ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;AYVCREASISGEIRYPQGTCPTKTEALNDCNKVTKGLIDFSQSHQRAWGIDMTAKVQCAPCKTTDPWDVVLCTCKITAHR
YREFVPKIPYSSFSSAPGVIFRQETGLDHDPEWVVNMKARTRGCDHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;AYVCREASISGEIRYPQGTCPTKTEALNDCNKVTKGLIDFSQSHQRAWGIDMTAKVQCAPCKTTDPWDVVLCTCKITAHR
YREFVPKIPYSSFSSAPGVIFRQETGLDHDPEWVVNMKARTRGCDHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   TYR n 
1 3   VAL n 
1 4   CYS n 
1 5   ARG n 
1 6   GLU n 
1 7   ALA n 
1 8   SER n 
1 9   ILE n 
1 10  SER n 
1 11  GLY n 
1 12  GLU n 
1 13  ILE n 
1 14  ARG n 
1 15  TYR n 
1 16  PRO n 
1 17  GLN n 
1 18  GLY n 
1 19  THR n 
1 20  CYS n 
1 21  PRO n 
1 22  THR n 
1 23  LYS n 
1 24  THR n 
1 25  GLU n 
1 26  ALA n 
1 27  LEU n 
1 28  ASN n 
1 29  ASP n 
1 30  CYS n 
1 31  ASN n 
1 32  LYS n 
1 33  VAL n 
1 34  THR n 
1 35  LYS n 
1 36  GLY n 
1 37  LEU n 
1 38  ILE n 
1 39  ASP n 
1 40  PHE n 
1 41  SER n 
1 42  GLN n 
1 43  SER n 
1 44  HIS n 
1 45  GLN n 
1 46  ARG n 
1 47  ALA n 
1 48  TRP n 
1 49  GLY n 
1 50  ILE n 
1 51  ASP n 
1 52  MET n 
1 53  THR n 
1 54  ALA n 
1 55  LYS n 
1 56  VAL n 
1 57  GLN n 
1 58  CYS n 
1 59  ALA n 
1 60  PRO n 
1 61  CYS n 
1 62  LYS n 
1 63  THR n 
1 64  THR n 
1 65  ASP n 
1 66  PRO n 
1 67  TRP n 
1 68  ASP n 
1 69  VAL n 
1 70  VAL n 
1 71  LEU n 
1 72  CYS n 
1 73  THR n 
1 74  CYS n 
1 75  LYS n 
1 76  ILE n 
1 77  THR n 
1 78  ALA n 
1 79  HIS n 
1 80  ARG n 
1 81  TYR n 
1 82  ARG n 
1 83  GLU n 
1 84  PHE n 
1 85  VAL n 
1 86  PRO n 
1 87  LYS n 
1 88  ILE n 
1 89  PRO n 
1 90  TYR n 
1 91  SER n 
1 92  SER n 
1 93  PHE n 
1 94  SER n 
1 95  SER n 
1 96  ALA n 
1 97  PRO n 
1 98  GLY n 
1 99  VAL n 
1 100 ILE n 
1 101 PHE n 
1 102 ARG n 
1 103 GLN n 
1 104 GLU n 
1 105 THR n 
1 106 GLY n 
1 107 LEU n 
1 108 ASP n 
1 109 HIS n 
1 110 ASP n 
1 111 PRO n 
1 112 GLU n 
1 113 TRP n 
1 114 VAL n 
1 115 VAL n 
1 116 ASN n 
1 117 MET n 
1 118 LYS n 
1 119 ALA n 
1 120 ARG n 
1 121 THR n 
1 122 ARG n 
1 123 GLY n 
1 124 CYS n 
1 125 ASP n 
1 126 HIS n 
1 127 HIS n 
1 128 HIS n 
1 129 HIS n 
1 130 HIS n 
1 131 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Blackleg fungus' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'AvrLm4-7, LEMA_P086290.1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Leptosphaeria maculans' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     985895 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Komagataella pastoris' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     4922 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    E5A6Z5_LEPMJ 
_struct_ref.pdbx_db_accession          E5A6Z5 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;CREASISGEIRYPQGTCPTKTEALNDCNKVTKGLIDFSQSHQRAWGIDMTAKVQCAPCITTDPWDVVLCTCKITAHRYRE
FVPKIPYSSFSSAPGVIFGQETGLDHDPEWVVNMKARTRGCD
;
_struct_ref.pdbx_align_begin           22 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4FPR A 4 ? 125 ? E5A6Z5 22 ? 143 ? 22 143 
2 1 4FPR B 4 ? 125 ? E5A6Z5 22 ? 143 ? 22 143 
3 1 4FPR C 4 ? 125 ? E5A6Z5 22 ? 143 ? 22 143 
4 1 4FPR D 4 ? 125 ? E5A6Z5 22 ? 143 ? 22 143 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4FPR ALA A 1   ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      19  1  
1 4FPR TYR A 2   ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      20  2  
1 4FPR VAL A 3   ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      21  3  
1 4FPR LYS A 62  ? UNP E5A6Z5 ILE 80  'engineered mutation' 80  4  
1 4FPR ARG A 102 ? UNP E5A6Z5 GLY 120 'engineered mutation' 120 5  
1 4FPR HIS A 126 ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      144 6  
1 4FPR HIS A 127 ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      145 7  
1 4FPR HIS A 128 ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      146 8  
1 4FPR HIS A 129 ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      147 9  
1 4FPR HIS A 130 ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      148 10 
1 4FPR HIS A 131 ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      149 11 
2 4FPR ALA B 1   ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      19  12 
2 4FPR TYR B 2   ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      20  13 
2 4FPR VAL B 3   ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      21  14 
2 4FPR LYS B 62  ? UNP E5A6Z5 ILE 80  'engineered mutation' 80  15 
2 4FPR ARG B 102 ? UNP E5A6Z5 GLY 120 'engineered mutation' 120 16 
2 4FPR HIS B 126 ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      144 17 
2 4FPR HIS B 127 ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      145 18 
2 4FPR HIS B 128 ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      146 19 
2 4FPR HIS B 129 ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      147 20 
2 4FPR HIS B 130 ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      148 21 
2 4FPR HIS B 131 ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      149 22 
3 4FPR ALA C 1   ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      19  23 
3 4FPR TYR C 2   ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      20  24 
3 4FPR VAL C 3   ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      21  25 
3 4FPR LYS C 62  ? UNP E5A6Z5 ILE 80  'engineered mutation' 80  26 
3 4FPR ARG C 102 ? UNP E5A6Z5 GLY 120 'engineered mutation' 120 27 
3 4FPR HIS C 126 ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      144 28 
3 4FPR HIS C 127 ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      145 29 
3 4FPR HIS C 128 ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      146 30 
3 4FPR HIS C 129 ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      147 31 
3 4FPR HIS C 130 ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      148 32 
3 4FPR HIS C 131 ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      149 33 
4 4FPR ALA D 1   ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      19  34 
4 4FPR TYR D 2   ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      20  35 
4 4FPR VAL D 3   ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      21  36 
4 4FPR LYS D 62  ? UNP E5A6Z5 ILE 80  'engineered mutation' 80  37 
4 4FPR ARG D 102 ? UNP E5A6Z5 GLY 120 'engineered mutation' 120 38 
4 4FPR HIS D 126 ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      144 39 
4 4FPR HIS D 127 ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      145 40 
4 4FPR HIS D 128 ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      146 41 
4 4FPR HIS D 129 ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      147 42 
4 4FPR HIS D 130 ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      148 43 
4 4FPR HIS D 131 ? UNP E5A6Z5 ?   ?   'EXPRESSION TAG'      149 44 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4FPR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.44 
_exptl_crystal.density_percent_sol   49.59 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pdbx_details    '1.6M ammonium sulfate, 0.1M Hepes pH7, VAPOR DIFFUSION, temperature 292K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2010-02-04 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111 CHANNEL' 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9791 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SOLEIL BEAMLINE PROXIMA 1' 
_diffrn_source.pdbx_synchrotron_site       SOLEIL 
_diffrn_source.pdbx_synchrotron_beamline   'PROXIMA 1' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9791 
# 
_reflns.entry_id                     4FPR 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             45 
_reflns.d_resolution_high            2.4 
_reflns.number_obs                   43302 
_reflns.number_all                   43872 
_reflns.percent_possible_obs         98.7 
_reflns.pdbx_Rmerge_I_obs            0.057 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.4 
_reflns_shell.d_res_low              2.46 
_reflns_shell.percent_possible_all   98.6 
_reflns_shell.Rmerge_I_obs           0.352 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.3 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4FPR 
_refine.ls_number_reflns_obs                     43266 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.24 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             33.189 
_refine.ls_d_res_high                            2.402 
_refine.ls_percent_reflns_obs                    98.64 
_refine.ls_R_factor_obs                          0.2121 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2085 
_refine.ls_R_factor_R_free                       0.2830 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.14 
_refine.ls_number_reflns_R_free                  1130 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            5.6695 
_refine.aniso_B[2][2]                            5.6695 
_refine.aniso_B[3][3]                            -11.3390 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.333 
_refine.solvent_model_param_bsol                 52.918 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.45 
_refine.pdbx_overall_phase_error                 30.91 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4076 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             260 
_refine_hist.number_atoms_total               4336 
_refine_hist.d_res_high                       2.402 
_refine_hist.d_res_low                        33.189 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.008  ? ? 4239 ? 'X-RAY DIFFRACTION' 
f_angle_d          1.132  ? ? 5739 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 17.697 ? ? 1525 ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.084  ? ? 613  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.006  ? ? 742  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 1044 ?     ? POSITIONAL 1 1 'X-RAY DIFFRACTION' ? ? ? 
2 C 1044 0.013 ? POSITIONAL 1 2 'X-RAY DIFFRACTION' ? ? ? 
1 B 1003 ?     ? POSITIONAL 2 3 'X-RAY DIFFRACTION' ? ? ? 
2 D 1003 0.046 ? POSITIONAL 2 4 'X-RAY DIFFRACTION' ? ? ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 2.4023 2.4545  2602 0.3089 98.00  0.3953 . . 118 . . . . 'X-RAY DIFFRACTION' 
. 2.4545 2.5116  2535 0.2712 100.00 0.3528 . . 140 . . . . 'X-RAY DIFFRACTION' 
. 2.5116 2.5744  2624 0.2633 100.00 0.3523 . . 150 . . . . 'X-RAY DIFFRACTION' 
. 2.5744 2.6440  2618 0.2505 99.00  0.3215 . . 122 . . . . 'X-RAY DIFFRACTION' 
. 2.6440 2.7217  2494 0.2338 97.00  0.3117 . . 136 . . . . 'X-RAY DIFFRACTION' 
. 2.7217 2.8095  2564 0.2307 100.00 0.3209 . . 175 . . . . 'X-RAY DIFFRACTION' 
. 2.8095 2.9099  2660 0.2132 100.00 0.3164 . . 128 . . . . 'X-RAY DIFFRACTION' 
. 2.9099 3.0263  2579 0.2031 100.00 0.2838 . . 136 . . . . 'X-RAY DIFFRACTION' 
. 3.0263 3.1640  2523 0.2021 100.00 0.3328 . . 161 . . . . 'X-RAY DIFFRACTION' 
. 3.1640 3.3306  2610 0.2205 100.00 0.2766 . . 170 . . . . 'X-RAY DIFFRACTION' 
. 3.3306 3.5391  2491 0.1843 97.00  0.3152 . . 141 . . . . 'X-RAY DIFFRACTION' 
. 3.5391 3.8120  2544 0.1832 97.00  0.2575 . . 140 . . . . 'X-RAY DIFFRACTION' 
. 3.8120 4.1949  2388 0.1642 93.00  0.2261 . . 137 . . . . 'X-RAY DIFFRACTION' 
. 4.1949 4.8004  2613 0.1439 100.00 0.2197 . . 120 . . . . 'X-RAY DIFFRACTION' 
. 4.8004 6.0420  2593 0.1600 100.00 0.2042 . . 135 . . . . 'X-RAY DIFFRACTION' 
. 6.0420 33.1925 2603 0.1793 99.00  0.1837 . . 116 . . . . 'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 ? 1 
2 ? 1 
1 ? 2 
2 ? 2 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 'chain A and (resseq 5:134 )' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 'chain C and (resseq 5:134 )' 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2 'chain B and (resseq 7:133 )' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2 'chain D and (resseq 7:133 )' 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
# 
_struct.entry_id                  4FPR 
_struct.title                     'Structure of a fungal protein' 
_struct.pdbx_descriptor           'Avirulence Effector AvrLm4-7' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4FPR 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            'Alpha-beta protein, Avirulence protein, PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 22 ? HIS A 44 ? THR A 40  HIS A 62  1 ? 23 
HELX_P HELX_P2 2 PRO A 89 ? PHE A 93 ? PRO A 107 PHE A 111 5 ? 5  
HELX_P HELX_P3 3 THR B 22 ? HIS B 44 ? THR B 40  HIS B 62  1 ? 23 
HELX_P HELX_P4 4 PRO B 89 ? PHE B 93 ? PRO B 107 PHE B 111 5 ? 5  
HELX_P HELX_P5 5 THR C 22 ? HIS C 44 ? THR C 40  HIS C 62  1 ? 23 
HELX_P HELX_P6 6 PRO C 89 ? PHE C 93 ? PRO C 107 PHE C 111 5 ? 5  
HELX_P HELX_P7 7 THR D 22 ? HIS D 44 ? THR D 40  HIS D 62  1 ? 23 
HELX_P HELX_P8 8 PRO D 89 ? PHE D 93 ? PRO D 107 PHE D 111 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 4  SG ? ? ? 1_555 A CYS 124 SG ? ? A CYS 22 A CYS 142 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf2  disulf ? ? A CYS 20 SG ? ? ? 1_555 A CYS 61  SG ? ? A CYS 38 A CYS 79  1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf3  disulf ? ? A CYS 30 SG ? ? ? 1_555 A CYS 74  SG ? ? A CYS 48 A CYS 92  1_555 ? ? ? ? ? ? ? 2.045 ? 
disulf4  disulf ? ? A CYS 58 SG ? ? ? 1_555 A CYS 72  SG ? ? A CYS 76 A CYS 90  1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf5  disulf ? ? B CYS 4  SG ? ? ? 1_555 B CYS 124 SG ? ? B CYS 22 B CYS 142 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf6  disulf ? ? B CYS 20 SG ? ? ? 1_555 B CYS 61  SG ? ? B CYS 38 B CYS 79  1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf7  disulf ? ? B CYS 30 SG ? ? ? 1_555 B CYS 74  SG ? ? B CYS 48 B CYS 92  1_555 ? ? ? ? ? ? ? 2.054 ? 
disulf8  disulf ? ? B CYS 58 SG ? ? ? 1_555 B CYS 72  SG ? ? B CYS 76 B CYS 90  1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf9  disulf ? ? C CYS 4  SG ? ? ? 1_555 C CYS 124 SG ? ? C CYS 22 C CYS 142 1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf10 disulf ? ? C CYS 20 SG ? ? ? 1_555 C CYS 61  SG ? ? C CYS 38 C CYS 79  1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf11 disulf ? ? C CYS 30 SG ? ? ? 1_555 C CYS 74  SG ? ? C CYS 48 C CYS 92  1_555 ? ? ? ? ? ? ? 2.046 ? 
disulf12 disulf ? ? C CYS 58 SG ? ? ? 1_555 C CYS 72  SG ? ? C CYS 76 C CYS 90  1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf13 disulf ? ? D CYS 4  SG ? ? ? 1_555 D CYS 124 SG ? ? D CYS 22 D CYS 142 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf14 disulf ? ? D CYS 20 SG ? ? ? 1_555 D CYS 61  SG ? ? D CYS 38 D CYS 79  1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf15 disulf ? ? D CYS 30 SG ? ? ? 1_555 D CYS 74  SG ? ? D CYS 48 D CYS 92  1_555 ? ? ? ? ? ? ? 2.051 ? 
disulf16 disulf ? ? D CYS 58 SG ? ? ? 1_555 D CYS 72  SG ? ? D CYS 76 D CYS 90  1_555 ? ? ? ? ? ? ? 2.037 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
E ? 4 ? 
F ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 MET A 52  ? CYS A 58  ? MET A 70  CYS A 76  
A 2 LEU A 71  ? TYR A 81  ? LEU A 89  TYR A 99  
A 3 VAL A 3   ? ARG A 14  ? VAL A 21  ARG A 32  
A 4 VAL A 114 ? VAL A 115 ? VAL A 132 VAL A 133 
B 1 MET A 52  ? CYS A 58  ? MET A 70  CYS A 76  
B 2 LEU A 71  ? TYR A 81  ? LEU A 89  TYR A 99  
B 3 VAL A 3   ? ARG A 14  ? VAL A 21  ARG A 32  
B 4 ARG A 122 ? GLY A 123 ? ARG A 140 GLY A 141 
C 1 MET B 52  ? CYS B 58  ? MET B 70  CYS B 76  
C 2 LEU B 71  ? ARG B 82  ? LEU B 89  ARG B 100 
C 3 CYS B 4   ? ARG B 14  ? CYS B 22  ARG B 32  
C 4 VAL B 114 ? ASN B 116 ? VAL B 132 ASN B 134 
D 1 MET C 52  ? CYS C 58  ? MET C 70  CYS C 76  
D 2 LEU C 71  ? TYR C 81  ? LEU C 89  TYR C 99  
D 3 VAL C 3   ? ARG C 14  ? VAL C 21  ARG C 32  
D 4 VAL C 114 ? VAL C 115 ? VAL C 132 VAL C 133 
E 1 MET C 52  ? CYS C 58  ? MET C 70  CYS C 76  
E 2 LEU C 71  ? TYR C 81  ? LEU C 89  TYR C 99  
E 3 VAL C 3   ? ARG C 14  ? VAL C 21  ARG C 32  
E 4 ARG C 122 ? GLY C 123 ? ARG C 140 GLY C 141 
F 1 MET D 52  ? CYS D 58  ? MET D 70  CYS D 76  
F 2 LEU D 71  ? ARG D 82  ? LEU D 89  ARG D 100 
F 3 CYS D 4   ? ARG D 14  ? CYS D 22  ARG D 32  
F 4 VAL D 114 ? ASN D 116 ? VAL D 132 ASN D 134 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLN A 57 ? N GLN A 75 O THR A 73  ? O THR A 91  
A 2 3 O ALA A 78 ? O ALA A 96 N ALA A 7   ? N ALA A 25  
A 3 4 N SER A 8  ? N SER A 26 O VAL A 114 ? O VAL A 132 
B 1 2 N GLN A 57 ? N GLN A 75 O THR A 73  ? O THR A 91  
B 2 3 O ALA A 78 ? O ALA A 96 N ALA A 7   ? N ALA A 25  
B 3 4 N CYS A 4  ? N CYS A 22 O ARG A 122 ? O ARG A 140 
C 1 2 N THR B 53 ? N THR B 71 O THR B 77  ? O THR B 95  
C 2 3 O CYS B 72 ? O CYS B 90 N ILE B 13  ? N ILE B 31  
C 3 4 N GLU B 6  ? N GLU B 24 O ASN B 116 ? O ASN B 134 
D 1 2 N GLN C 57 ? N GLN C 75 O THR C 73  ? O THR C 91  
D 2 3 O ALA C 78 ? O ALA C 96 N ALA C 7   ? N ALA C 25  
D 3 4 N SER C 8  ? N SER C 26 O VAL C 114 ? O VAL C 132 
E 1 2 N GLN C 57 ? N GLN C 75 O THR C 73  ? O THR C 91  
E 2 3 O ALA C 78 ? O ALA C 96 N ALA C 7   ? N ALA C 25  
E 3 4 N CYS C 4  ? N CYS C 22 O ARG C 122 ? O ARG C 140 
F 1 2 N THR D 53 ? N THR D 71 O THR D 77  ? O THR D 95  
F 2 3 O CYS D 72 ? O CYS D 90 N ILE D 13  ? N ILE D 31  
F 3 4 N GLU D 6  ? N GLU D 24 O ASN D 116 ? O ASN D 134 
# 
_database_PDB_matrix.entry_id          4FPR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4FPR 
_atom_sites.fract_transf_matrix[1][1]   0.016353 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016353 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006437 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 1   ? 16.980  2.179  -12.927 1.00 59.89  ? 19  ALA A N   1 
ATOM   2    C CA  . ALA A 1 1   ? 15.609  2.546  -13.294 1.00 69.56  ? 19  ALA A CA  1 
ATOM   3    C C   . ALA A 1 1   ? 15.512  3.997  -13.730 1.00 77.79  ? 19  ALA A C   1 
ATOM   4    O O   . ALA A 1 1   ? 16.506  4.723  -13.719 1.00 97.49  ? 19  ALA A O   1 
ATOM   5    C CB  . ALA A 1 1   ? 14.650  2.291  -12.143 1.00 44.26  ? 19  ALA A CB  1 
ATOM   6    N N   . TYR A 1 2   ? 14.310  4.413  -14.119 1.00 66.73  ? 20  TYR A N   1 
ATOM   7    C CA  . TYR A 1 2   ? 14.055  5.811  -14.447 1.00 66.65  ? 20  TYR A CA  1 
ATOM   8    C C   . TYR A 1 2   ? 13.571  6.599  -13.247 1.00 61.51  ? 20  TYR A C   1 
ATOM   9    O O   . TYR A 1 2   ? 12.879  6.074  -12.383 1.00 58.63  ? 20  TYR A O   1 
ATOM   10   C CB  . TYR A 1 2   ? 13.034  5.933  -15.570 1.00 60.74  ? 20  TYR A CB  1 
ATOM   11   C CG  . TYR A 1 2   ? 13.687  5.844  -16.907 1.00 80.43  ? 20  TYR A CG  1 
ATOM   12   C CD1 . TYR A 1 2   ? 13.315  4.868  -17.818 1.00 77.34  ? 20  TYR A CD1 1 
ATOM   13   C CD2 . TYR A 1 2   ? 14.717  6.718  -17.247 1.00 82.01  ? 20  TYR A CD2 1 
ATOM   14   C CE1 . TYR A 1 2   ? 13.937  4.774  -19.048 1.00 100.90 ? 20  TYR A CE1 1 
ATOM   15   C CE2 . TYR A 1 2   ? 15.349  6.636  -18.473 1.00 71.64  ? 20  TYR A CE2 1 
ATOM   16   C CZ  . TYR A 1 2   ? 14.955  5.659  -19.371 1.00 95.20  ? 20  TYR A CZ  1 
ATOM   17   O OH  . TYR A 1 2   ? 15.575  5.562  -20.597 1.00 77.01  ? 20  TYR A OH  1 
ATOM   18   N N   . VAL A 1 3   ? 13.928  7.871  -13.200 1.00 52.40  ? 21  VAL A N   1 
ATOM   19   C CA  . VAL A 1 3   ? 13.420  8.709  -12.133 1.00 66.57  ? 21  VAL A CA  1 
ATOM   20   C C   . VAL A 1 3   ? 12.350  9.672  -12.629 1.00 53.97  ? 21  VAL A C   1 
ATOM   21   O O   . VAL A 1 3   ? 12.408  10.209 -13.740 1.00 46.87  ? 21  VAL A O   1 
ATOM   22   C CB  . VAL A 1 3   ? 14.540  9.464  -11.359 1.00 77.27  ? 21  VAL A CB  1 
ATOM   23   C CG1 . VAL A 1 3   ? 15.638  8.493  -10.924 1.00 63.79  ? 21  VAL A CG1 1 
ATOM   24   C CG2 . VAL A 1 3   ? 15.105  10.618 -12.180 1.00 42.48  ? 21  VAL A CG2 1 
ATOM   25   N N   . CYS A 1 4   ? 11.351  9.859  -11.783 1.00 43.73  ? 22  CYS A N   1 
ATOM   26   C CA  . CYS A 1 4   ? 10.302  10.816 -12.050 1.00 51.00  ? 22  CYS A CA  1 
ATOM   27   C C   . CYS A 1 4   ? 10.565  12.106 -11.266 1.00 48.89  ? 22  CYS A C   1 
ATOM   28   O O   . CYS A 1 4   ? 11.566  12.228 -10.559 1.00 50.00  ? 22  CYS A O   1 
ATOM   29   C CB  . CYS A 1 4   ? 8.939   10.197 -11.716 1.00 46.09  ? 22  CYS A CB  1 
ATOM   30   S SG  . CYS A 1 4   ? 8.380   9.000  -12.974 1.00 54.06  ? 22  CYS A SG  1 
ATOM   31   N N   . ARG A 1 5   ? 9.677   13.075 -11.421 1.00 39.75  ? 23  ARG A N   1 
ATOM   32   C CA  . ARG A 1 5   ? 9.811   14.351 -10.755 1.00 36.80  ? 23  ARG A CA  1 
ATOM   33   C C   . ARG A 1 5   ? 8.422   14.837 -10.427 1.00 40.45  ? 23  ARG A C   1 
ATOM   34   O O   . ARG A 1 5   ? 7.438   14.247 -10.861 1.00 37.69  ? 23  ARG A O   1 
ATOM   35   C CB  . ARG A 1 5   ? 10.534  15.360 -11.651 1.00 37.70  ? 23  ARG A CB  1 
ATOM   36   C CG  . ARG A 1 5   ? 11.853  14.846 -12.186 1.00 36.52  ? 23  ARG A CG  1 
ATOM   37   C CD  . ARG A 1 5   ? 12.579  15.901 -12.983 1.00 45.16  ? 23  ARG A CD  1 
ATOM   38   N NE  . ARG A 1 5   ? 13.444  16.717 -12.141 1.00 60.21  ? 23  ARG A NE  1 
ATOM   39   C CZ  . ARG A 1 5   ? 14.772  16.652 -12.150 1.00 70.04  ? 23  ARG A CZ  1 
ATOM   40   N NH1 . ARG A 1 5   ? 15.403  15.809 -12.966 1.00 41.22  ? 23  ARG A NH1 1 
ATOM   41   N NH2 . ARG A 1 5   ? 15.471  17.439 -11.342 1.00 66.80  ? 23  ARG A NH2 1 
ATOM   42   N N   . GLU A 1 6   ? 8.344   15.898 -9.639  1.00 38.43  ? 24  GLU A N   1 
ATOM   43   C CA  . GLU A 1 6   ? 7.073   16.553 -9.385  1.00 38.24  ? 24  GLU A CA  1 
ATOM   44   C C   . GLU A 1 6   ? 6.730   17.518 -10.511 1.00 28.42  ? 24  GLU A C   1 
ATOM   45   O O   . GLU A 1 6   ? 7.584   18.264 -11.002 1.00 25.89  ? 24  GLU A O   1 
ATOM   46   C CB  . GLU A 1 6   ? 7.107   17.307 -8.052  1.00 42.29  ? 24  GLU A CB  1 
ATOM   47   C CG  . GLU A 1 6   ? 5.943   18.258 -7.853  1.00 30.73  ? 24  GLU A CG  1 
ATOM   48   C CD  . GLU A 1 6   ? 5.986   18.970 -6.515  1.00 42.26  ? 24  GLU A CD  1 
ATOM   49   O OE1 . GLU A 1 6   ? 6.019   18.286 -5.468  1.00 41.67  ? 24  GLU A OE1 1 
ATOM   50   O OE2 . GLU A 1 6   ? 5.968   20.222 -6.512  1.00 54.72  ? 24  GLU A OE2 1 
ATOM   51   N N   . ALA A 1 7   ? 5.470   17.516 -10.916 1.00 27.69  ? 25  ALA A N   1 
ATOM   52   C CA  . ALA A 1 7   ? 5.034   18.470 -11.927 1.00 27.34  ? 25  ALA A CA  1 
ATOM   53   C C   . ALA A 1 7   ? 3.632   19.009 -11.631 1.00 26.35  ? 25  ALA A C   1 
ATOM   54   O O   . ALA A 1 7   ? 2.807   18.345 -11.002 1.00 28.19  ? 25  ALA A O   1 
ATOM   55   C CB  . ALA A 1 7   ? 5.107   17.836 -13.321 1.00 29.04  ? 25  ALA A CB  1 
ATOM   56   N N   . SER A 1 8   ? 3.376   20.234 -12.064 1.00 25.26  ? 26  SER A N   1 
ATOM   57   C CA  . SER A 1 8   ? 2.054   20.811 -11.896 1.00 37.93  ? 26  SER A CA  1 
ATOM   58   C C   . SER A 1 8   ? 1.521   21.397 -13.172 1.00 34.02  ? 26  SER A C   1 
ATOM   59   O O   . SER A 1 8   ? 2.275   21.772 -14.060 1.00 22.07  ? 26  SER A O   1 
ATOM   60   C CB  . SER A 1 8   ? 2.062   21.886 -10.820 1.00 25.53  ? 26  SER A CB  1 
ATOM   61   O OG  . SER A 1 8   ? 1.978   21.262 -9.551  1.00 50.75  ? 26  SER A OG  1 
ATOM   62   N N   . ILE A 1 9   ? 0.204   21.486 -13.243 1.00 22.66  ? 27  ILE A N   1 
ATOM   63   C CA  . ILE A 1 9   ? -0.428  22.134 -14.360 1.00 27.53  ? 27  ILE A CA  1 
ATOM   64   C C   . ILE A 1 9   ? -1.579  22.967 -13.825 1.00 26.14  ? 27  ILE A C   1 
ATOM   65   O O   . ILE A 1 9   ? -2.317  22.524 -12.950 1.00 29.72  ? 27  ILE A O   1 
ATOM   66   C CB  . ILE A 1 9   ? -0.871  21.096 -15.409 1.00 32.55  ? 27  ILE A CB  1 
ATOM   67   C CG1 . ILE A 1 9   ? -1.454  21.791 -16.645 1.00 32.53  ? 27  ILE A CG1 1 
ATOM   68   C CG2 . ILE A 1 9   ? -1.832  20.080 -14.793 1.00 25.15  ? 27  ILE A CG2 1 
ATOM   69   C CD1 . ILE A 1 9   ? -1.587  20.863 -17.849 1.00 22.10  ? 27  ILE A CD1 1 
ATOM   70   N N   . SER A 1 10  ? -1.701  24.188 -14.329 1.00 22.82  ? 28  SER A N   1 
ATOM   71   C CA  . SER A 1 10  ? -2.698  25.124 -13.837 1.00 30.29  ? 28  SER A CA  1 
ATOM   72   C C   . SER A 1 10  ? -3.679  25.558 -14.901 1.00 35.33  ? 28  SER A C   1 
ATOM   73   O O   . SER A 1 10  ? -3.319  25.726 -16.062 1.00 39.93  ? 28  SER A O   1 
ATOM   74   C CB  . SER A 1 10  ? -2.023  26.357 -13.236 1.00 27.55  ? 28  SER A CB  1 
ATOM   75   O OG  . SER A 1 10  ? -1.353  26.006 -12.036 1.00 37.30  ? 28  SER A OG  1 
ATOM   76   N N   . GLY A 1 11  ? -4.919  25.764 -14.486 1.00 36.97  ? 29  GLY A N   1 
ATOM   77   C CA  . GLY A 1 11  ? -5.974  26.122 -15.407 1.00 40.75  ? 29  GLY A CA  1 
ATOM   78   C C   . GLY A 1 11  ? -7.054  26.907 -14.698 1.00 47.82  ? 29  GLY A C   1 
ATOM   79   O O   . GLY A 1 11  ? -7.073  27.015 -13.477 1.00 39.08  ? 29  GLY A O   1 
ATOM   80   N N   . GLU A 1 12  ? -7.969  27.458 -15.473 1.00 40.84  ? 30  GLU A N   1 
ATOM   81   C CA  . GLU A 1 12  ? -9.007  28.288 -14.918 1.00 33.94  ? 30  GLU A CA  1 
ATOM   82   C C   . GLU A 1 12  ? -10.378 27.645 -15.093 1.00 41.87  ? 30  GLU A C   1 
ATOM   83   O O   . GLU A 1 12  ? -10.664 26.988 -16.097 1.00 42.05  ? 30  GLU A O   1 
ATOM   84   C CB  . GLU A 1 12  ? -8.957  29.656 -15.580 1.00 40.25  ? 30  GLU A CB  1 
ATOM   85   C CG  . GLU A 1 12  ? -9.945  30.657 -15.047 1.00 33.88  ? 30  GLU A CG  1 
ATOM   86   C CD  . GLU A 1 12  ? -9.648  32.046 -15.573 1.00 58.32  ? 30  GLU A CD  1 
ATOM   87   O OE1 . GLU A 1 12  ? -10.399 32.532 -16.450 1.00 54.08  ? 30  GLU A OE1 1 
ATOM   88   O OE2 . GLU A 1 12  ? -8.642  32.637 -15.128 1.00 45.32  ? 30  GLU A OE2 1 
ATOM   89   N N   . ILE A 1 13  ? -11.222 27.818 -14.092 1.00 34.97  ? 31  ILE A N   1 
ATOM   90   C CA  . ILE A 1 13  ? -12.595 27.370 -14.189 1.00 30.94  ? 31  ILE A CA  1 
ATOM   91   C C   . ILE A 1 13  ? -13.485 28.563 -13.863 1.00 44.70  ? 31  ILE A C   1 
ATOM   92   O O   . ILE A 1 13  ? -13.283 29.237 -12.850 1.00 43.11  ? 31  ILE A O   1 
ATOM   93   C CB  . ILE A 1 13  ? -12.855 26.204 -13.236 1.00 39.82  ? 31  ILE A CB  1 
ATOM   94   C CG1 . ILE A 1 13  ? -12.139 24.957 -13.750 1.00 36.10  ? 31  ILE A CG1 1 
ATOM   95   C CG2 . ILE A 1 13  ? -14.333 25.941 -13.103 1.00 34.36  ? 31  ILE A CG2 1 
ATOM   96   C CD1 . ILE A 1 13  ? -12.235 23.782 -12.842 1.00 23.37  ? 31  ILE A CD1 1 
ATOM   97   N N   . ARG A 1 14  ? -14.440 28.852 -14.745 1.00 35.80  ? 32  ARG A N   1 
ATOM   98   C CA  . ARG A 1 14  ? -15.326 29.999 -14.562 1.00 38.11  ? 32  ARG A CA  1 
ATOM   99   C C   . ARG A 1 14  ? -16.731 29.581 -14.192 1.00 40.48  ? 32  ARG A C   1 
ATOM   100  O O   . ARG A 1 14  ? -17.180 28.489 -14.540 1.00 45.86  ? 32  ARG A O   1 
ATOM   101  C CB  . ARG A 1 14  ? -15.367 30.874 -15.812 1.00 47.04  ? 32  ARG A CB  1 
ATOM   102  C CG  . ARG A 1 14  ? -14.131 31.720 -15.989 1.00 74.82  ? 32  ARG A CG  1 
ATOM   103  C CD  . ARG A 1 14  ? -13.206 31.183 -17.065 1.00 91.36  ? 32  ARG A CD  1 
ATOM   104  N NE  . ARG A 1 14  ? -13.225 32.031 -18.254 1.00 102.44 ? 32  ARG A NE  1 
ATOM   105  C CZ  . ARG A 1 14  ? -12.519 31.791 -19.353 1.00 109.88 ? 32  ARG A CZ  1 
ATOM   106  N NH1 . ARG A 1 14  ? -11.738 30.718 -19.420 1.00 86.74  ? 32  ARG A NH1 1 
ATOM   107  N NH2 . ARG A 1 14  ? -12.597 32.622 -20.385 1.00 101.47 ? 32  ARG A NH2 1 
ATOM   108  N N   . TYR A 1 15  ? -17.426 30.462 -13.482 1.00 50.72  ? 33  TYR A N   1 
ATOM   109  C CA  . TYR A 1 15  ? -18.789 30.183 -13.045 1.00 44.84  ? 33  TYR A CA  1 
ATOM   110  C C   . TYR A 1 15  ? -19.832 31.112 -13.683 1.00 51.45  ? 33  TYR A C   1 
ATOM   111  O O   . TYR A 1 15  ? -19.509 32.234 -14.087 1.00 40.23  ? 33  TYR A O   1 
ATOM   112  C CB  . TYR A 1 15  ? -18.845 30.148 -11.512 1.00 55.94  ? 33  TYR A CB  1 
ATOM   113  C CG  . TYR A 1 15  ? -18.068 28.957 -11.001 1.00 47.27  ? 33  TYR A CG  1 
ATOM   114  C CD1 . TYR A 1 15  ? -18.698 27.738 -10.782 1.00 29.42  ? 33  TYR A CD1 1 
ATOM   115  C CD2 . TYR A 1 15  ? -16.692 29.030 -10.812 1.00 41.20  ? 33  TYR A CD2 1 
ATOM   116  C CE1 . TYR A 1 15  ? -17.987 26.634 -10.363 1.00 45.64  ? 33  TYR A CE1 1 
ATOM   117  C CE2 . TYR A 1 15  ? -15.976 27.936 -10.397 1.00 32.91  ? 33  TYR A CE2 1 
ATOM   118  C CZ  . TYR A 1 15  ? -16.625 26.736 -10.175 1.00 49.15  ? 33  TYR A CZ  1 
ATOM   119  O OH  . TYR A 1 15  ? -15.920 25.629 -9.754  1.00 41.23  ? 33  TYR A OH  1 
ATOM   120  N N   . PRO A 1 16  ? -21.079 30.626 -13.812 1.00 45.77  ? 34  PRO A N   1 
ATOM   121  C CA  . PRO A 1 16  ? -22.117 31.384 -14.518 1.00 39.69  ? 34  PRO A CA  1 
ATOM   122  C C   . PRO A 1 16  ? -22.324 32.722 -13.853 1.00 41.87  ? 34  PRO A C   1 
ATOM   123  O O   . PRO A 1 16  ? -22.292 32.799 -12.626 1.00 54.34  ? 34  PRO A O   1 
ATOM   124  C CB  . PRO A 1 16  ? -23.360 30.507 -14.356 1.00 47.32  ? 34  PRO A CB  1 
ATOM   125  C CG  . PRO A 1 16  ? -22.818 29.115 -14.168 1.00 40.92  ? 34  PRO A CG  1 
ATOM   126  C CD  . PRO A 1 16  ? -21.576 29.322 -13.341 1.00 48.20  ? 34  PRO A CD  1 
ATOM   127  N N   . GLN A 1 17  ? -22.512 33.771 -14.640 1.00 43.63  ? 35  GLN A N   1 
ATOM   128  C CA  . GLN A 1 17  ? -22.683 35.105 -14.064 1.00 65.93  ? 35  GLN A CA  1 
ATOM   129  C C   . GLN A 1 17  ? -23.706 35.133 -12.924 1.00 51.90  ? 35  GLN A C   1 
ATOM   130  O O   . GLN A 1 17  ? -24.671 34.368 -12.915 1.00 34.88  ? 35  GLN A O   1 
ATOM   131  C CB  . GLN A 1 17  ? -23.049 36.120 -15.144 1.00 43.21  ? 35  GLN A CB  1 
ATOM   132  C CG  . GLN A 1 17  ? -23.516 35.482 -16.432 1.00 74.56  ? 35  GLN A CG  1 
ATOM   133  C CD  . GLN A 1 17  ? -24.140 36.489 -17.371 1.00 100.22 ? 35  GLN A CD  1 
ATOM   134  O OE1 . GLN A 1 17  ? -24.902 37.360 -16.941 1.00 77.70  ? 35  GLN A OE1 1 
ATOM   135  N NE2 . GLN A 1 17  ? -23.827 36.376 -18.663 1.00 82.33  ? 35  GLN A NE2 1 
ATOM   136  N N   . GLY A 1 18  ? -23.475 36.012 -11.956 1.00 40.65  ? 36  GLY A N   1 
ATOM   137  C CA  . GLY A 1 18  ? -24.372 36.155 -10.827 1.00 48.84  ? 36  GLY A CA  1 
ATOM   138  C C   . GLY A 1 18  ? -24.496 34.918 -9.957  1.00 54.70  ? 36  GLY A C   1 
ATOM   139  O O   . GLY A 1 18  ? -25.474 34.768 -9.222  1.00 64.85  ? 36  GLY A O   1 
ATOM   140  N N   . THR A 1 19  ? -23.518 34.022 -10.039 1.00 46.80  ? 37  THR A N   1 
ATOM   141  C CA  . THR A 1 19  ? -23.509 32.861 -9.158  1.00 62.49  ? 37  THR A CA  1 
ATOM   142  C C   . THR A 1 19  ? -22.264 32.818 -8.275  1.00 47.89  ? 37  THR A C   1 
ATOM   143  O O   . THR A 1 19  ? -21.342 33.628 -8.418  1.00 38.56  ? 37  THR A O   1 
ATOM   144  C CB  . THR A 1 19  ? -23.702 31.531 -9.921  1.00 49.23  ? 37  THR A CB  1 
ATOM   145  O OG1 . THR A 1 19  ? -22.548 31.247 -10.716 1.00 60.67  ? 37  THR A OG1 1 
ATOM   146  C CG2 . THR A 1 19  ? -24.923 31.611 -10.817 1.00 57.89  ? 37  THR A CG2 1 
ATOM   147  N N   . CYS A 1 20  ? -22.252 31.871 -7.352  1.00 41.11  ? 38  CYS A N   1 
ATOM   148  C CA  . CYS A 1 20  ? -21.211 31.835 -6.344  1.00 40.74  ? 38  CYS A CA  1 
ATOM   149  C C   . CYS A 1 20  ? -21.060 30.424 -5.817  1.00 41.52  ? 38  CYS A C   1 
ATOM   150  O O   . CYS A 1 20  ? -21.934 29.911 -5.117  1.00 43.20  ? 38  CYS A O   1 
ATOM   151  C CB  . CYS A 1 20  ? -21.536 32.809 -5.203  1.00 44.49  ? 38  CYS A CB  1 
ATOM   152  S SG  . CYS A 1 20  ? -20.223 33.011 -3.980  1.00 50.35  ? 38  CYS A SG  1 
ATOM   153  N N   . PRO A 1 21  ? -19.943 29.786 -6.169  1.00 42.38  ? 39  PRO A N   1 
ATOM   154  C CA  . PRO A 1 21  ? -19.652 28.425 -5.739  1.00 31.79  ? 39  PRO A CA  1 
ATOM   155  C C   . PRO A 1 21  ? -19.117 28.513 -4.325  1.00 41.60  ? 39  PRO A C   1 
ATOM   156  O O   . PRO A 1 21  ? -18.487 29.507 -3.985  1.00 35.17  ? 39  PRO A O   1 
ATOM   157  C CB  . PRO A 1 21  ? -18.515 27.992 -6.677  1.00 31.29  ? 39  PRO A CB  1 
ATOM   158  C CG  . PRO A 1 21  ? -18.121 29.197 -7.445  1.00 31.11  ? 39  PRO A CG  1 
ATOM   159  C CD  . PRO A 1 21  ? -18.816 30.387 -6.891  1.00 33.05  ? 39  PRO A CD  1 
ATOM   160  N N   . THR A 1 22  ? -19.393 27.508 -3.510  1.00 41.14  ? 40  THR A N   1 
ATOM   161  C CA  . THR A 1 22  ? -18.708 27.349 -2.245  1.00 39.29  ? 40  THR A CA  1 
ATOM   162  C C   . THR A 1 22  ? -17.288 26.901 -2.571  1.00 40.22  ? 40  THR A C   1 
ATOM   163  O O   . THR A 1 22  ? -17.031 26.365 -3.659  1.00 42.50  ? 40  THR A O   1 
ATOM   164  C CB  . THR A 1 22  ? -19.398 26.275 -1.405  1.00 46.15  ? 40  THR A CB  1 
ATOM   165  O OG1 . THR A 1 22  ? -19.426 25.042 -2.144  1.00 32.57  ? 40  THR A OG1 1 
ATOM   166  C CG2 . THR A 1 22  ? -20.833 26.709 -1.069  1.00 32.72  ? 40  THR A CG2 1 
ATOM   167  N N   . LYS A 1 23  ? -16.361 27.125 -1.651  1.00 31.52  ? 41  LYS A N   1 
ATOM   168  C CA  . LYS A 1 23  ? -14.984 26.714 -1.883  1.00 36.10  ? 41  LYS A CA  1 
ATOM   169  C C   . LYS A 1 23  ? -14.966 25.210 -2.089  1.00 35.11  ? 41  LYS A C   1 
ATOM   170  O O   . LYS A 1 23  ? -14.176 24.683 -2.870  1.00 36.06  ? 41  LYS A O   1 
ATOM   171  C CB  . LYS A 1 23  ? -14.076 27.107 -0.714  1.00 34.31  ? 41  LYS A CB  1 
ATOM   172  C CG  . LYS A 1 23  ? -14.151 28.581 -0.312  1.00 26.13  ? 41  LYS A CG  1 
ATOM   173  C CD  . LYS A 1 23  ? -13.346 29.479 -1.226  1.00 43.46  ? 41  LYS A CD  1 
ATOM   174  C CE  . LYS A 1 23  ? -13.531 30.951 -0.879  1.00 24.14  ? 41  LYS A CE  1 
ATOM   175  N NZ  . LYS A 1 23  ? -13.065 31.831 -1.989  1.00 29.87  ? 41  LYS A NZ  1 
ATOM   176  N N   . THR A 1 24  ? -15.863 24.525 -1.396  1.00 29.15  ? 42  THR A N   1 
ATOM   177  C CA  . THR A 1 24  ? -15.965 23.077 -1.491  1.00 33.83  ? 42  THR A CA  1 
ATOM   178  C C   . THR A 1 24  ? -16.314 22.618 -2.889  1.00 36.66  ? 42  THR A C   1 
ATOM   179  O O   . THR A 1 24  ? -15.659 21.731 -3.416  1.00 36.54  ? 42  THR A O   1 
ATOM   180  C CB  . THR A 1 24  ? -17.006 22.510 -0.525  1.00 32.01  ? 42  THR A CB  1 
ATOM   181  O OG1 . THR A 1 24  ? -16.585 22.782 0.809   1.00 52.67  ? 42  THR A OG1 1 
ATOM   182  C CG2 . THR A 1 24  ? -17.161 20.980 -0.708  1.00 21.55  ? 42  THR A CG2 1 
ATOM   183  N N   . GLU A 1 25  ? -17.342 23.201 -3.497  1.00 34.94  ? 43  GLU A N   1 
ATOM   184  C CA  . GLU A 1 25  ? -17.700 22.752 -4.838  1.00 41.53  ? 43  GLU A CA  1 
ATOM   185  C C   . GLU A 1 25  ? -16.614 23.091 -5.861  1.00 45.49  ? 43  GLU A C   1 
ATOM   186  O O   . GLU A 1 25  ? -16.349 22.308 -6.795  1.00 37.40  ? 43  GLU A O   1 
ATOM   187  C CB  . GLU A 1 25  ? -19.077 23.264 -5.275  1.00 49.12  ? 43  GLU A CB  1 
ATOM   188  C CG  . GLU A 1 25  ? -19.249 24.768 -5.278  1.00 65.93  ? 43  GLU A CG  1 
ATOM   189  C CD  . GLU A 1 25  ? -20.652 25.193 -5.708  1.00 80.82  ? 43  GLU A CD  1 
ATOM   190  O OE1 . GLU A 1 25  ? -21.341 25.871 -4.904  1.00 51.22  ? 43  GLU A OE1 1 
ATOM   191  O OE2 . GLU A 1 25  ? -21.056 24.842 -6.849  1.00 66.03  ? 43  GLU A OE2 1 
ATOM   192  N N   . ALA A 1 26  ? -15.973 24.242 -5.678  1.00 26.48  ? 44  ALA A N   1 
ATOM   193  C CA  . ALA A 1 26  ? -14.893 24.632 -6.589  1.00 33.58  ? 44  ALA A CA  1 
ATOM   194  C C   . ALA A 1 26  ? -13.750 23.615 -6.561  1.00 38.91  ? 44  ALA A C   1 
ATOM   195  O O   . ALA A 1 26  ? -13.257 23.189 -7.606  1.00 39.01  ? 44  ALA A O   1 
ATOM   196  C CB  . ALA A 1 26  ? -14.381 26.039 -6.286  1.00 24.22  ? 44  ALA A CB  1 
ATOM   197  N N   . LEU A 1 27  ? -13.335 23.223 -5.364  1.00 27.29  ? 45  LEU A N   1 
ATOM   198  C CA  . LEU A 1 27  ? -12.328 22.201 -5.240  1.00 24.92  ? 45  LEU A CA  1 
ATOM   199  C C   . LEU A 1 27  ? -12.843 20.889 -5.833  1.00 30.37  ? 45  LEU A C   1 
ATOM   200  O O   . LEU A 1 27  ? -12.083 20.104 -6.383  1.00 31.76  ? 45  LEU A O   1 
ATOM   201  C CB  . LEU A 1 27  ? -11.924 22.020 -3.775  1.00 28.57  ? 45  LEU A CB  1 
ATOM   202  C CG  . LEU A 1 27  ? -10.862 20.954 -3.513  1.00 32.88  ? 45  LEU A CG  1 
ATOM   203  C CD1 . LEU A 1 27  ? -9.576  21.278 -4.273  1.00 35.06  ? 45  LEU A CD1 1 
ATOM   204  C CD2 . LEU A 1 27  ? -10.580 20.804 -2.026  1.00 34.62  ? 45  LEU A CD2 1 
ATOM   205  N N   . ASN A 1 28  ? -14.140 20.654 -5.723  1.00 31.91  ? 46  ASN A N   1 
ATOM   206  C CA  . ASN A 1 28  ? -14.701 19.427 -6.248  1.00 41.13  ? 46  ASN A CA  1 
ATOM   207  C C   . ASN A 1 28  ? -14.626 19.411 -7.784  1.00 39.45  ? 46  ASN A C   1 
ATOM   208  O O   . ASN A 1 28  ? -14.259 18.409 -8.397  1.00 25.87  ? 46  ASN A O   1 
ATOM   209  C CB  . ASN A 1 28  ? -16.131 19.215 -5.738  1.00 27.83  ? 46  ASN A CB  1 
ATOM   210  C CG  . ASN A 1 28  ? -16.793 17.981 -6.364  1.00 47.46  ? 46  ASN A CG  1 
ATOM   211  O OD1 . ASN A 1 28  ? -16.928 16.936 -5.729  1.00 41.96  ? 46  ASN A OD1 1 
ATOM   212  N ND2 . ASN A 1 28  ? -17.179 18.099 -7.627  1.00 50.15  ? 46  ASN A ND2 1 
ATOM   213  N N   . ASP A 1 29  ? -14.962 20.542 -8.387  1.00 32.27  ? 47  ASP A N   1 
ATOM   214  C CA  . ASP A 1 29  ? -14.841 20.718 -9.828  1.00 45.98  ? 47  ASP A CA  1 
ATOM   215  C C   . ASP A 1 29  ? -13.418 20.482 -10.257 1.00 45.81  ? 47  ASP A C   1 
ATOM   216  O O   . ASP A 1 29  ? -13.133 19.742 -11.205 1.00 33.92  ? 47  ASP A O   1 
ATOM   217  C CB  . ASP A 1 29  ? -15.249 22.136 -10.221 1.00 26.90  ? 47  ASP A CB  1 
ATOM   218  C CG  . ASP A 1 29  ? -16.743 22.290 -10.315 1.00 47.50  ? 47  ASP A CG  1 
ATOM   219  O OD1 . ASP A 1 29  ? -17.415 21.253 -10.545 1.00 37.00  ? 47  ASP A OD1 1 
ATOM   220  O OD2 . ASP A 1 29  ? -17.237 23.429 -10.158 1.00 35.76  ? 47  ASP A OD2 1 
ATOM   221  N N   . CYS A 1 30  ? -12.525 21.139 -9.539  1.00 36.01  ? 48  CYS A N   1 
ATOM   222  C CA  . CYS A 1 30  ? -11.122 21.033 -9.813  1.00 30.81  ? 48  CYS A CA  1 
ATOM   223  C C   . CYS A 1 30  ? -10.687 19.571 -9.746  1.00 31.65  ? 48  CYS A C   1 
ATOM   224  O O   . CYS A 1 30  ? -9.918  19.119 -10.591 1.00 39.86  ? 48  CYS A O   1 
ATOM   225  C CB  . CYS A 1 30  ? -10.340 21.903 -8.832  1.00 34.86  ? 48  CYS A CB  1 
ATOM   226  S SG  . CYS A 1 30  ? -8.575  21.851 -9.104  1.00 48.64  ? 48  CYS A SG  1 
ATOM   227  N N   . ASN A 1 31  ? -11.187 18.832 -8.757  1.00 24.95  ? 49  ASN A N   1 
ATOM   228  C CA  . ASN A 1 31  ? -10.911 17.400 -8.682  1.00 23.16  ? 49  ASN A CA  1 
ATOM   229  C C   . ASN A 1 31  ? -11.544 16.552 -9.794  1.00 40.07  ? 49  ASN A C   1 
ATOM   230  O O   . ASN A 1 31  ? -11.202 15.380 -9.951  1.00 29.92  ? 49  ASN A O   1 
ATOM   231  C CB  . ASN A 1 31  ? -11.267 16.835 -7.316  1.00 31.91  ? 49  ASN A CB  1 
ATOM   232  C CG  . ASN A 1 31  ? -10.140 17.016 -6.316  1.00 34.39  ? 49  ASN A CG  1 
ATOM   233  O OD1 . ASN A 1 31  ? -9.003  16.619 -6.557  1.00 35.53  ? 49  ASN A OD1 1 
ATOM   234  N ND2 . ASN A 1 31  ? -10.445 17.646 -5.210  1.00 22.72  ? 49  ASN A ND2 1 
ATOM   235  N N   . LYS A 1 32  ? -12.458 17.136 -10.565 1.00 23.02  ? 50  LYS A N   1 
ATOM   236  C CA  . LYS A 1 32  ? -12.941 16.456 -11.756 1.00 40.30  ? 50  LYS A CA  1 
ATOM   237  C C   . LYS A 1 32  ? -11.828 16.419 -12.813 1.00 30.71  ? 50  LYS A C   1 
ATOM   238  O O   . LYS A 1 32  ? -11.600 15.399 -13.462 1.00 29.38  ? 50  LYS A O   1 
ATOM   239  C CB  . LYS A 1 32  ? -14.215 17.105 -12.288 1.00 37.70  ? 50  LYS A CB  1 
ATOM   240  C CG  . LYS A 1 32  ? -15.480 16.774 -11.485 1.00 22.87  ? 50  LYS A CG  1 
ATOM   241  C CD  . LYS A 1 32  ? -16.704 17.390 -12.176 1.00 42.05  ? 50  LYS A CD  1 
ATOM   242  C CE  . LYS A 1 32  ? -17.999 17.193 -11.402 1.00 41.63  ? 50  LYS A CE  1 
ATOM   243  N NZ  . LYS A 1 32  ? -18.314 18.398 -10.610 1.00 42.82  ? 50  LYS A NZ  1 
ATOM   244  N N   . VAL A 1 33  ? -11.094 17.514 -12.936 1.00 20.29  ? 51  VAL A N   1 
ATOM   245  C CA  . VAL A 1 33  ? -9.962  17.525 -13.834 1.00 35.86  ? 51  VAL A CA  1 
ATOM   246  C C   . VAL A 1 33  ? -8.816  16.667 -13.319 1.00 36.72  ? 51  VAL A C   1 
ATOM   247  O O   . VAL A 1 33  ? -8.081  16.084 -14.105 1.00 40.76  ? 51  VAL A O   1 
ATOM   248  C CB  . VAL A 1 33  ? -9.537  18.956 -14.263 1.00 36.06  ? 51  VAL A CB  1 
ATOM   249  C CG1 . VAL A 1 33  ? -10.437 20.013 -13.646 1.00 21.93  ? 51  VAL A CG1 1 
ATOM   250  C CG2 . VAL A 1 33  ? -8.066  19.207 -14.020 1.00 31.93  ? 51  VAL A CG2 1 
ATOM   251  N N   . THR A 1 34  ? -8.694  16.544 -12.007 1.00 31.88  ? 52  THR A N   1 
ATOM   252  C CA  . THR A 1 34  ? -7.718  15.622 -11.452 1.00 23.67  ? 52  THR A CA  1 
ATOM   253  C C   . THR A 1 34  ? -7.983  14.212 -11.964 1.00 37.87  ? 52  THR A C   1 
ATOM   254  O O   . THR A 1 34  ? -7.085  13.530 -12.475 1.00 27.77  ? 52  THR A O   1 
ATOM   255  C CB  . THR A 1 34  ? -7.785  15.590 -9.922  1.00 28.46  ? 52  THR A CB  1 
ATOM   256  O OG1 . THR A 1 34  ? -7.554  16.907 -9.407  1.00 39.38  ? 52  THR A OG1 1 
ATOM   257  C CG2 . THR A 1 34  ? -6.731  14.644 -9.352  1.00 24.91  ? 52  THR A CG2 1 
ATOM   258  N N   . LYS A 1 35  ? -9.219  13.768 -11.787 1.00 30.55  ? 53  LYS A N   1 
ATOM   259  C CA  . LYS A 1 35  ? -9.612  12.438 -12.215 1.00 42.06  ? 53  LYS A CA  1 
ATOM   260  C C   . LYS A 1 35  ? -9.415  12.307 -13.731 1.00 44.82  ? 53  LYS A C   1 
ATOM   261  O O   . LYS A 1 35  ? -8.861  11.320 -14.216 1.00 35.96  ? 53  LYS A O   1 
ATOM   262  C CB  . LYS A 1 35  ? -11.068 12.175 -11.822 1.00 43.14  ? 53  LYS A CB  1 
ATOM   263  C CG  . LYS A 1 35  ? -11.475 10.708 -11.834 1.00 36.75  ? 53  LYS A CG  1 
ATOM   264  C CD  . LYS A 1 35  ? -11.852 10.241 -13.236 1.00 64.09  ? 53  LYS A CD  1 
ATOM   265  C CE  . LYS A 1 35  ? -12.092 8.735  -13.266 1.00 80.19  ? 53  LYS A CE  1 
ATOM   266  N NZ  . LYS A 1 35  ? -10.863 7.961  -12.911 1.00 69.09  ? 53  LYS A NZ  1 
ATOM   267  N N   . GLY A 1 36  ? -9.861  13.320 -14.469 1.00 32.44  ? 54  GLY A N   1 
ATOM   268  C CA  . GLY A 1 36  ? -9.649  13.368 -15.901 1.00 45.89  ? 54  GLY A CA  1 
ATOM   269  C C   . GLY A 1 36  ? -8.199  13.147 -16.309 1.00 50.43  ? 54  GLY A C   1 
ATOM   270  O O   . GLY A 1 36  ? -7.917  12.346 -17.206 1.00 33.23  ? 54  GLY A O   1 
ATOM   271  N N   . LEU A 1 37  ? -7.278  13.850 -15.653 1.00 39.66  ? 55  LEU A N   1 
ATOM   272  C CA  . LEU A 1 37  ? -5.867  13.742 -15.997 1.00 30.35  ? 55  LEU A CA  1 
ATOM   273  C C   . LEU A 1 37  ? -5.295  12.376 -15.655 1.00 30.62  ? 55  LEU A C   1 
ATOM   274  O O   . LEU A 1 37  ? -4.454  11.846 -16.377 1.00 38.73  ? 55  LEU A O   1 
ATOM   275  C CB  . LEU A 1 37  ? -5.056  14.824 -15.308 1.00 22.07  ? 55  LEU A CB  1 
ATOM   276  C CG  . LEU A 1 37  ? -5.425  16.255 -15.649 1.00 38.43  ? 55  LEU A CG  1 
ATOM   277  C CD1 . LEU A 1 37  ? -4.342  17.172 -15.118 1.00 48.79  ? 55  LEU A CD1 1 
ATOM   278  C CD2 . LEU A 1 37  ? -5.612  16.445 -17.147 1.00 26.54  ? 55  LEU A CD2 1 
ATOM   279  N N   . ILE A 1 38  ? -5.751  11.803 -14.554 1.00 35.40  ? 56  ILE A N   1 
ATOM   280  C CA  . ILE A 1 38  ? -5.283  10.490 -14.155 1.00 26.61  ? 56  ILE A CA  1 
ATOM   281  C C   . ILE A 1 38  ? -5.708  9.473  -15.206 1.00 41.59  ? 56  ILE A C   1 
ATOM   282  O O   . ILE A 1 38  ? -4.946  8.594  -15.576 1.00 31.35  ? 56  ILE A O   1 
ATOM   283  C CB  . ILE A 1 38  ? -5.844  10.119 -12.776 1.00 41.70  ? 56  ILE A CB  1 
ATOM   284  C CG1 . ILE A 1 38  ? -5.309  11.098 -11.733 1.00 37.78  ? 56  ILE A CG1 1 
ATOM   285  C CG2 . ILE A 1 38  ? -5.503  8.668  -12.391 1.00 27.45  ? 56  ILE A CG2 1 
ATOM   286  C CD1 . ILE A 1 38  ? -5.859  10.859 -10.357 1.00 37.46  ? 56  ILE A CD1 1 
ATOM   287  N N   . ASP A 1 39  ? -6.929  9.616  -15.705 1.00 35.16  ? 57  ASP A N   1 
ATOM   288  C CA  . ASP A 1 39  ? -7.425  8.718  -16.739 1.00 43.90  ? 57  ASP A CA  1 
ATOM   289  C C   . ASP A 1 39  ? -6.647  8.824  -18.051 1.00 39.03  ? 57  ASP A C   1 
ATOM   290  O O   . ASP A 1 39  ? -6.250  7.814  -18.632 1.00 36.02  ? 57  ASP A O   1 
ATOM   291  C CB  . ASP A 1 39  ? -8.907  8.958  -16.972 1.00 34.73  ? 57  ASP A CB  1 
ATOM   292  C CG  . ASP A 1 39  ? -9.749  8.407  -15.855 1.00 62.42  ? 57  ASP A CG  1 
ATOM   293  O OD1 . ASP A 1 39  ? -9.171  7.738  -14.961 1.00 54.82  ? 57  ASP A OD1 1 
ATOM   294  O OD2 . ASP A 1 39  ? -10.977 8.644  -15.877 1.00 50.16  ? 57  ASP A OD2 1 
ATOM   295  N N   . PHE A 1 40  ? -6.436  10.049 -18.510 1.00 29.16  ? 58  PHE A N   1 
ATOM   296  C CA  . PHE A 1 40  ? -5.609  10.294 -19.687 1.00 35.53  ? 58  PHE A CA  1 
ATOM   297  C C   . PHE A 1 40  ? -4.188  9.753  -19.478 1.00 35.45  ? 58  PHE A C   1 
ATOM   298  O O   . PHE A 1 40  ? -3.686  8.985  -20.290 1.00 46.40  ? 58  PHE A O   1 
ATOM   299  C CB  . PHE A 1 40  ? -5.593  11.791 -19.998 1.00 28.14  ? 58  PHE A CB  1 
ATOM   300  C CG  . PHE A 1 40  ? -5.079  12.137 -21.368 1.00 41.00  ? 58  PHE A CG  1 
ATOM   301  C CD1 . PHE A 1 40  ? -5.954  12.286 -22.433 1.00 38.27  ? 58  PHE A CD1 1 
ATOM   302  C CD2 . PHE A 1 40  ? -3.729  12.347 -21.581 1.00 36.80  ? 58  PHE A CD2 1 
ATOM   303  C CE1 . PHE A 1 40  ? -5.491  12.618 -23.690 1.00 32.43  ? 58  PHE A CE1 1 
ATOM   304  C CE2 . PHE A 1 40  ? -3.258  12.680 -22.826 1.00 43.25  ? 58  PHE A CE2 1 
ATOM   305  C CZ  . PHE A 1 40  ? -4.140  12.821 -23.886 1.00 56.85  ? 58  PHE A CZ  1 
ATOM   306  N N   . SER A 1 41  ? -3.549  10.134 -18.379 1.00 40.62  ? 59  SER A N   1 
ATOM   307  C CA  . SER A 1 41  ? -2.205  9.642  -18.099 1.00 49.69  ? 59  SER A CA  1 
ATOM   308  C C   . SER A 1 41  ? -2.190  8.127  -18.246 1.00 43.11  ? 59  SER A C   1 
ATOM   309  O O   . SER A 1 41  ? -1.302  7.546  -18.881 1.00 30.84  ? 59  SER A O   1 
ATOM   310  C CB  . SER A 1 41  ? -1.755  10.042 -16.685 1.00 25.72  ? 59  SER A CB  1 
ATOM   311  O OG  . SER A 1 41  ? -0.470  9.510  -16.358 1.00 23.54  ? 59  SER A OG  1 
ATOM   312  N N   . GLN A 1 42  ? -3.201  7.512  -17.648 1.00 36.64  ? 60  GLN A N   1 
ATOM   313  C CA  . GLN A 1 42  ? -3.343  6.070  -17.584 1.00 46.64  ? 60  GLN A CA  1 
ATOM   314  C C   . GLN A 1 42  ? -3.360  5.450  -18.977 1.00 55.24  ? 60  GLN A C   1 
ATOM   315  O O   . GLN A 1 42  ? -2.656  4.473  -19.264 1.00 45.94  ? 60  GLN A O   1 
ATOM   316  C CB  . GLN A 1 42  ? -4.655  5.746  -16.876 1.00 30.84  ? 60  GLN A CB  1 
ATOM   317  C CG  . GLN A 1 42  ? -4.856  4.301  -16.562 1.00 56.92  ? 60  GLN A CG  1 
ATOM   318  C CD  . GLN A 1 42  ? -3.947  3.848  -15.454 1.00 75.76  ? 60  GLN A CD  1 
ATOM   319  O OE1 . GLN A 1 42  ? -2.825  3.419  -15.701 1.00 65.87  ? 60  GLN A OE1 1 
ATOM   320  N NE2 . GLN A 1 42  ? -4.425  3.945  -14.218 1.00 81.02  ? 60  GLN A NE2 1 
ATOM   321  N N   . SER A 1 43  ? -4.181  6.024  -19.841 1.00 31.83  ? 61  SER A N   1 
ATOM   322  C CA  . SER A 1 43  ? -4.323  5.515  -21.186 1.00 46.44  ? 61  SER A CA  1 
ATOM   323  C C   . SER A 1 43  ? -3.214  6.058  -22.085 1.00 52.61  ? 61  SER A C   1 
ATOM   324  O O   . SER A 1 43  ? -3.221  5.836  -23.288 1.00 51.16  ? 61  SER A O   1 
ATOM   325  C CB  . SER A 1 43  ? -5.691  5.897  -21.735 1.00 49.04  ? 61  SER A CB  1 
ATOM   326  O OG  . SER A 1 43  ? -5.855  7.302  -21.706 1.00 52.91  ? 61  SER A OG  1 
ATOM   327  N N   . HIS A 1 44  ? -2.264  6.776  -21.499 1.00 48.81  ? 62  HIS A N   1 
ATOM   328  C CA  . HIS A 1 44  ? -1.106  7.252  -22.254 1.00 28.77  ? 62  HIS A CA  1 
ATOM   329  C C   . HIS A 1 44  ? 0.225   6.852  -21.642 1.00 41.63  ? 62  HIS A C   1 
ATOM   330  O O   . HIS A 1 44  ? 1.148   7.670  -21.566 1.00 38.20  ? 62  HIS A O   1 
ATOM   331  C CB  . HIS A 1 44  ? -1.157  8.754  -22.436 1.00 37.87  ? 62  HIS A CB  1 
ATOM   332  C CG  . HIS A 1 44  ? -2.229  9.192  -23.369 1.00 52.85  ? 62  HIS A CG  1 
ATOM   333  N ND1 . HIS A 1 44  ? -3.550  9.272  -22.991 1.00 46.30  ? 62  HIS A ND1 1 
ATOM   334  C CD2 . HIS A 1 44  ? -2.184  9.548  -24.674 1.00 53.91  ? 62  HIS A CD2 1 
ATOM   335  C CE1 . HIS A 1 44  ? -4.273  9.676  -24.020 1.00 58.08  ? 62  HIS A CE1 1 
ATOM   336  N NE2 . HIS A 1 44  ? -3.468  9.850  -25.054 1.00 59.55  ? 62  HIS A NE2 1 
ATOM   337  N N   . GLN A 1 45  ? 0.311   5.593  -21.212 1.00 33.42  ? 63  GLN A N   1 
ATOM   338  C CA  . GLN A 1 45  ? 1.544   5.032  -20.690 1.00 45.42  ? 63  GLN A CA  1 
ATOM   339  C C   . GLN A 1 45  ? 1.986   5.776  -19.444 1.00 49.94  ? 63  GLN A C   1 
ATOM   340  O O   . GLN A 1 45  ? 3.178   6.060  -19.286 1.00 46.40  ? 63  GLN A O   1 
ATOM   341  C CB  . GLN A 1 45  ? 2.661   5.119  -21.735 1.00 47.62  ? 63  GLN A CB  1 
ATOM   342  C CG  . GLN A 1 45  ? 2.252   4.758  -23.149 1.00 61.66  ? 63  GLN A CG  1 
ATOM   343  C CD  . GLN A 1 45  ? 3.304   5.163  -24.177 1.00 94.79  ? 63  GLN A CD  1 
ATOM   344  O OE1 . GLN A 1 45  ? 3.264   4.721  -25.329 1.00 99.11  ? 63  GLN A OE1 1 
ATOM   345  N NE2 . GLN A 1 45  ? 4.254   6.008  -23.761 1.00 62.25  ? 63  GLN A NE2 1 
ATOM   346  N N   . ARG A 1 46  ? 1.026   6.107  -18.583 1.00 40.52  ? 64  ARG A N   1 
ATOM   347  C CA  . ARG A 1 46  ? 1.317   6.768  -17.320 1.00 40.96  ? 64  ARG A CA  1 
ATOM   348  C C   . ARG A 1 46  ? 2.378   7.861  -17.465 1.00 45.03  ? 64  ARG A C   1 
ATOM   349  O O   . ARG A 1 46  ? 3.265   7.981  -16.627 1.00 46.64  ? 64  ARG A O   1 
ATOM   350  C CB  . ARG A 1 46  ? 1.795   5.744  -16.294 1.00 39.76  ? 64  ARG A CB  1 
ATOM   351  C CG  . ARG A 1 46  ? 1.382   4.318  -16.614 1.00 62.57  ? 64  ARG A CG  1 
ATOM   352  C CD  . ARG A 1 46  ? 0.169   3.878  -15.823 1.00 50.15  ? 64  ARG A CD  1 
ATOM   353  N NE  . ARG A 1 46  ? 0.535   3.412  -14.491 1.00 56.86  ? 64  ARG A NE  1 
ATOM   354  C CZ  . ARG A 1 46  ? -0.201  2.580  -13.750 1.00 96.06  ? 64  ARG A CZ  1 
ATOM   355  N NH1 . ARG A 1 46  ? -1.348  2.109  -14.218 1.00 94.12  ? 64  ARG A NH1 1 
ATOM   356  N NH2 . ARG A 1 46  ? 0.209   2.209  -12.538 1.00 78.06  ? 64  ARG A NH2 1 
ATOM   357  N N   . ALA A 1 47  ? 2.295   8.642  -18.534 1.00 35.28  ? 65  ALA A N   1 
ATOM   358  C CA  . ALA A 1 47  ? 3.197   9.772  -18.741 1.00 29.87  ? 65  ALA A CA  1 
ATOM   359  C C   . ALA A 1 47  ? 3.225   10.706 -17.532 1.00 51.51  ? 65  ALA A C   1 
ATOM   360  O O   . ALA A 1 47  ? 4.272   11.243 -17.177 1.00 36.08  ? 65  ALA A O   1 
ATOM   361  C CB  . ALA A 1 47  ? 2.788   10.553 -19.976 1.00 34.22  ? 65  ALA A CB  1 
ATOM   362  N N   . TRP A 1 48  ? 2.069   10.917 -16.911 1.00 36.82  ? 66  TRP A N   1 
ATOM   363  C CA  . TRP A 1 48  ? 2.009   11.801 -15.759 1.00 37.60  ? 66  TRP A CA  1 
ATOM   364  C C   . TRP A 1 48  ? 1.864   11.034 -14.452 1.00 32.83  ? 66  TRP A C   1 
ATOM   365  O O   . TRP A 1 48  ? 1.639   11.623 -13.414 1.00 41.13  ? 66  TRP A O   1 
ATOM   366  C CB  . TRP A 1 48  ? 0.853   12.783 -15.898 1.00 38.76  ? 66  TRP A CB  1 
ATOM   367  C CG  . TRP A 1 48  ? 0.777   13.445 -17.233 1.00 39.41  ? 66  TRP A CG  1 
ATOM   368  C CD1 . TRP A 1 48  ? 1.816   13.776 -18.040 1.00 25.39  ? 66  TRP A CD1 1 
ATOM   369  C CD2 . TRP A 1 48  ? -0.413  13.889 -17.899 1.00 36.97  ? 66  TRP A CD2 1 
ATOM   370  N NE1 . TRP A 1 48  ? 1.354   14.393 -19.178 1.00 34.35  ? 66  TRP A NE1 1 
ATOM   371  C CE2 . TRP A 1 48  ? -0.013  14.469 -19.120 1.00 36.27  ? 66  TRP A CE2 1 
ATOM   372  C CE3 . TRP A 1 48  ? -1.778  13.844 -17.581 1.00 32.21  ? 66  TRP A CE3 1 
ATOM   373  C CZ2 . TRP A 1 48  ? -0.932  15.008 -20.035 1.00 35.62  ? 66  TRP A CZ2 1 
ATOM   374  C CZ3 . TRP A 1 48  ? -2.687  14.378 -18.476 1.00 28.86  ? 66  TRP A CZ3 1 
ATOM   375  C CH2 . TRP A 1 48  ? -2.258  14.950 -19.699 1.00 37.97  ? 66  TRP A CH2 1 
ATOM   376  N N   . GLY A 1 49  ? 1.985   9.718  -14.514 1.00 36.87  ? 67  GLY A N   1 
ATOM   377  C CA  . GLY A 1 49  ? 1.718   8.874  -13.368 1.00 24.06  ? 67  GLY A CA  1 
ATOM   378  C C   . GLY A 1 49  ? 0.293   8.951  -12.858 1.00 40.53  ? 67  GLY A C   1 
ATOM   379  O O   . GLY A 1 49  ? -0.555  9.660  -13.416 1.00 26.28  ? 67  GLY A O   1 
ATOM   380  N N   . ILE A 1 50  ? 0.029   8.238  -11.766 1.00 38.65  ? 68  ILE A N   1 
ATOM   381  C CA  . ILE A 1 50  ? -1.328  8.170  -11.241 1.00 34.97  ? 68  ILE A CA  1 
ATOM   382  C C   . ILE A 1 50  ? -1.512  8.811  -9.871  1.00 36.51  ? 68  ILE A C   1 
ATOM   383  O O   . ILE A 1 50  ? -2.606  8.753  -9.306  1.00 44.38  ? 68  ILE A O   1 
ATOM   384  C CB  . ILE A 1 50  ? -1.850  6.721  -11.220 1.00 34.76  ? 68  ILE A CB  1 
ATOM   385  C CG1 . ILE A 1 50  ? -1.021  5.872  -10.267 1.00 35.27  ? 68  ILE A CG1 1 
ATOM   386  C CG2 . ILE A 1 50  ? -1.802  6.124  -12.632 1.00 42.26  ? 68  ILE A CG2 1 
ATOM   387  C CD1 . ILE A 1 50  ? -1.588  4.480  -10.062 1.00 42.05  ? 68  ILE A CD1 1 
ATOM   388  N N   . ASP A 1 51  ? -0.462  9.431  -9.340  1.00 39.74  ? 69  ASP A N   1 
ATOM   389  C CA  . ASP A 1 51  ? -0.571  10.119 -8.043  1.00 24.06  ? 69  ASP A CA  1 
ATOM   390  C C   . ASP A 1 51  ? -0.686  11.643 -8.207  1.00 34.96  ? 69  ASP A C   1 
ATOM   391  O O   . ASP A 1 51  ? 0.316   12.356 -8.357  1.00 27.73  ? 69  ASP A O   1 
ATOM   392  C CB  . ASP A 1 51  ? 0.568   9.726  -7.101  1.00 28.45  ? 69  ASP A CB  1 
ATOM   393  C CG  . ASP A 1 51  ? 0.316   10.159 -5.650  1.00 46.94  ? 69  ASP A CG  1 
ATOM   394  O OD1 . ASP A 1 51  ? -0.792  10.638 -5.341  1.00 37.47  ? 69  ASP A OD1 1 
ATOM   395  O OD2 . ASP A 1 51  ? 1.231   10.025 -4.810  1.00 38.93  ? 69  ASP A OD2 1 
ATOM   396  N N   . MET A 1 52  ? -1.926  12.130 -8.184  1.00 23.83  ? 70  MET A N   1 
ATOM   397  C CA  . MET A 1 52  ? -2.203  13.542 -8.434  1.00 35.46  ? 70  MET A CA  1 
ATOM   398  C C   . MET A 1 52  ? -3.086  14.154 -7.340  1.00 36.44  ? 70  MET A C   1 
ATOM   399  O O   . MET A 1 52  ? -4.006  13.514 -6.832  1.00 37.90  ? 70  MET A O   1 
ATOM   400  C CB  . MET A 1 52  ? -2.863  13.736 -9.810  1.00 21.09  ? 70  MET A CB  1 
ATOM   401  C CG  . MET A 1 52  ? -2.048  13.241 -11.007 1.00 29.28  ? 70  MET A CG  1 
ATOM   402  S SD  . MET A 1 52  ? -2.742  13.749 -12.634 1.00 32.63  ? 70  MET A SD  1 
ATOM   403  C CE  . MET A 1 52  ? -1.788  12.675 -13.694 1.00 30.76  ? 70  MET A CE  1 
ATOM   404  N N   . THR A 1 53  ? -2.817  15.405 -6.996  1.00 25.86  ? 71  THR A N   1 
ATOM   405  C CA  . THR A 1 53  ? -3.587  16.078 -5.951  1.00 30.18  ? 71  THR A CA  1 
ATOM   406  C C   . THR A 1 53  ? -3.892  17.519 -6.350  1.00 25.27  ? 71  THR A C   1 
ATOM   407  O O   . THR A 1 53  ? -3.110  18.157 -7.059  1.00 32.36  ? 71  THR A O   1 
ATOM   408  C CB  . THR A 1 53  ? -2.864  16.030 -4.576  1.00 36.37  ? 71  THR A CB  1 
ATOM   409  O OG1 . THR A 1 53  ? -1.522  16.513 -4.719  1.00 36.27  ? 71  THR A OG1 1 
ATOM   410  C CG2 . THR A 1 53  ? -2.814  14.609 -4.053  1.00 22.12  ? 71  THR A CG2 1 
ATOM   411  N N   . ALA A 1 54  ? -5.032  18.024 -5.892  1.00 28.83  ? 72  ALA A N   1 
ATOM   412  C CA  . ALA A 1 54  ? -5.527  19.323 -6.339  1.00 32.64  ? 72  ALA A CA  1 
ATOM   413  C C   . ALA A 1 54  ? -5.623  20.378 -5.232  1.00 41.90  ? 72  ALA A C   1 
ATOM   414  O O   . ALA A 1 54  ? -5.990  20.080 -4.102  1.00 32.14  ? 72  ALA A O   1 
ATOM   415  C CB  . ALA A 1 54  ? -6.889  19.156 -7.002  1.00 28.06  ? 72  ALA A CB  1 
ATOM   416  N N   . LYS A 1 55  ? -5.308  21.616 -5.592  1.00 35.78  ? 73  LYS A N   1 
ATOM   417  C CA  . LYS A 1 55  ? -5.572  22.775 -4.751  1.00 44.39  ? 73  LYS A CA  1 
ATOM   418  C C   . LYS A 1 55  ? -6.301  23.770 -5.640  1.00 45.14  ? 73  LYS A C   1 
ATOM   419  O O   . LYS A 1 55  ? -6.188  23.710 -6.869  1.00 30.40  ? 73  LYS A O   1 
ATOM   420  C CB  . LYS A 1 55  ? -4.267  23.409 -4.259  1.00 39.78  ? 73  LYS A CB  1 
ATOM   421  C CG  . LYS A 1 55  ? -3.318  22.464 -3.547  1.00 58.24  ? 73  LYS A CG  1 
ATOM   422  C CD  . LYS A 1 55  ? -2.052  23.205 -3.134  1.00 75.55  ? 73  LYS A CD  1 
ATOM   423  C CE  . LYS A 1 55  ? -1.214  22.406 -2.149  1.00 63.84  ? 73  LYS A CE  1 
ATOM   424  N NZ  . LYS A 1 55  ? 0.100   23.071 -1.920  1.00 80.52  ? 73  LYS A NZ  1 
ATOM   425  N N   . VAL A 1 56  ? -7.039  24.686 -5.027  1.00 37.16  ? 74  VAL A N   1 
ATOM   426  C CA  . VAL A 1 56  ? -7.767  25.694 -5.777  1.00 25.55  ? 74  VAL A CA  1 
ATOM   427  C C   . VAL A 1 56  ? -7.892  27.007 -5.007  1.00 33.17  ? 74  VAL A C   1 
ATOM   428  O O   . VAL A 1 56  ? -8.025  27.013 -3.779  1.00 30.75  ? 74  VAL A O   1 
ATOM   429  C CB  . VAL A 1 56  ? -9.177  25.187 -6.214  1.00 37.02  ? 74  VAL A CB  1 
ATOM   430  C CG1 . VAL A 1 56  ? -10.027 24.872 -5.018  1.00 45.12  ? 74  VAL A CG1 1 
ATOM   431  C CG2 . VAL A 1 56  ? -9.875  26.215 -7.085  1.00 37.58  ? 74  VAL A CG2 1 
ATOM   432  N N   . GLN A 1 57  ? -7.825  28.109 -5.750  1.00 29.96  ? 75  GLN A N   1 
ATOM   433  C CA  . GLN A 1 57  ? -8.071  29.447 -5.240  1.00 40.30  ? 75  GLN A CA  1 
ATOM   434  C C   . GLN A 1 57  ? -9.149  30.088 -6.099  1.00 43.60  ? 75  GLN A C   1 
ATOM   435  O O   . GLN A 1 57  ? -9.133  29.952 -7.325  1.00 38.68  ? 75  GLN A O   1 
ATOM   436  C CB  . GLN A 1 57  ? -6.823  30.320 -5.344  1.00 34.59  ? 75  GLN A CB  1 
ATOM   437  C CG  . GLN A 1 57  ? -5.597  29.834 -4.634  1.00 60.58  ? 75  GLN A CG  1 
ATOM   438  C CD  . GLN A 1 57  ? -4.437  30.789 -4.819  1.00 75.01  ? 75  GLN A CD  1 
ATOM   439  O OE1 . GLN A 1 57  ? -3.276  30.426 -4.613  1.00 65.57  ? 75  GLN A OE1 1 
ATOM   440  N NE2 . GLN A 1 57  ? -4.746  32.022 -5.220  1.00 57.22  ? 75  GLN A NE2 1 
ATOM   441  N N   . CYS A 1 58  ? -10.072 30.799 -5.459  1.00 44.82  ? 76  CYS A N   1 
ATOM   442  C CA  . CYS A 1 58  ? -11.098 31.550 -6.179  1.00 41.77  ? 76  CYS A CA  1 
ATOM   443  C C   . CYS A 1 58  ? -11.075 33.011 -5.806  1.00 40.36  ? 76  CYS A C   1 
ATOM   444  O O   . CYS A 1 58  ? -10.597 33.393 -4.739  1.00 53.01  ? 76  CYS A O   1 
ATOM   445  C CB  . CYS A 1 58  ? -12.492 31.004 -5.884  1.00 31.40  ? 76  CYS A CB  1 
ATOM   446  S SG  . CYS A 1 58  ? -12.741 29.342 -6.487  1.00 46.68  ? 76  CYS A SG  1 
ATOM   447  N N   . ALA A 1 59  ? -11.589 33.830 -6.705  1.00 44.20  ? 77  ALA A N   1 
ATOM   448  C CA  . ALA A 1 59  ? -11.875 35.203 -6.377  1.00 52.02  ? 77  ALA A CA  1 
ATOM   449  C C   . ALA A 1 59  ? -13.097 35.218 -5.464  1.00 38.43  ? 77  ALA A C   1 
ATOM   450  O O   . ALA A 1 59  ? -13.939 34.325 -5.526  1.00 44.88  ? 77  ALA A O   1 
ATOM   451  C CB  . ALA A 1 59  ? -12.142 35.983 -7.634  1.00 26.68  ? 77  ALA A CB  1 
ATOM   452  N N   . PRO A 1 60  ? -13.197 36.232 -4.602  1.00 47.95  ? 78  PRO A N   1 
ATOM   453  C CA  . PRO A 1 60  ? -14.417 36.406 -3.812  1.00 42.91  ? 78  PRO A CA  1 
ATOM   454  C C   . PRO A 1 60  ? -15.566 36.750 -4.741  1.00 40.52  ? 78  PRO A C   1 
ATOM   455  O O   . PRO A 1 60  ? -15.361 37.547 -5.655  1.00 49.20  ? 78  PRO A O   1 
ATOM   456  C CB  . PRO A 1 60  ? -14.091 37.621 -2.940  1.00 45.80  ? 78  PRO A CB  1 
ATOM   457  C CG  . PRO A 1 60  ? -12.604 37.702 -2.920  1.00 63.25  ? 78  PRO A CG  1 
ATOM   458  C CD  . PRO A 1 60  ? -12.178 37.239 -4.274  1.00 49.73  ? 78  PRO A CD  1 
ATOM   459  N N   . CYS A 1 61  ? -16.743 36.169 -4.535  1.00 48.23  ? 79  CYS A N   1 
ATOM   460  C CA  . CYS A 1 61  ? -17.901 36.556 -5.336  1.00 48.62  ? 79  CYS A CA  1 
ATOM   461  C C   . CYS A 1 61  ? -18.354 37.938 -4.905  1.00 43.78  ? 79  CYS A C   1 
ATOM   462  O O   . CYS A 1 61  ? -18.188 38.309 -3.747  1.00 40.77  ? 79  CYS A O   1 
ATOM   463  C CB  . CYS A 1 61  ? -19.051 35.577 -5.141  1.00 46.33  ? 79  CYS A CB  1 
ATOM   464  S SG  . CYS A 1 61  ? -18.546 33.935 -4.651  1.00 59.56  ? 79  CYS A SG  1 
ATOM   465  N N   . LYS A 1 62  ? -18.914 38.709 -5.828  1.00 62.49  ? 80  LYS A N   1 
ATOM   466  C CA  . LYS A 1 62  ? -19.564 39.953 -5.441  1.00 64.66  ? 80  LYS A CA  1 
ATOM   467  C C   . LYS A 1 62  ? -21.054 39.692 -5.268  1.00 77.01  ? 80  LYS A C   1 
ATOM   468  O O   . LYS A 1 62  ? -21.755 39.415 -6.241  1.00 53.18  ? 80  LYS A O   1 
ATOM   469  C CB  . LYS A 1 62  ? -19.311 41.052 -6.467  1.00 54.88  ? 80  LYS A CB  1 
ATOM   470  C CG  . LYS A 1 62  ? -17.852 41.385 -6.626  1.00 61.45  ? 80  LYS A CG  1 
ATOM   471  C CD  . LYS A 1 62  ? -17.162 40.394 -7.549  1.00 77.12  ? 80  LYS A CD  1 
ATOM   472  C CE  . LYS A 1 62  ? -15.634 40.422 -7.396  1.00 90.32  ? 80  LYS A CE  1 
ATOM   473  N NZ  . LYS A 1 62  ? -14.990 41.676 -7.888  1.00 86.32  ? 80  LYS A NZ  1 
ATOM   474  N N   . THR A 1 63  ? -21.517 39.742 -4.017  1.00 96.63  ? 81  THR A N   1 
ATOM   475  C CA  . THR A 1 63  ? -22.929 39.539 -3.686  1.00 90.16  ? 81  THR A CA  1 
ATOM   476  C C   . THR A 1 63  ? -23.759 40.431 -4.612  1.00 88.89  ? 81  THR A C   1 
ATOM   477  O O   . THR A 1 63  ? -24.754 39.994 -5.210  1.00 60.43  ? 81  THR A O   1 
ATOM   478  C CB  . THR A 1 63  ? -23.212 39.813 -2.151  1.00 92.88  ? 81  THR A CB  1 
ATOM   479  O OG1 . THR A 1 63  ? -24.597 39.594 -1.829  1.00 72.28  ? 81  THR A OG1 1 
ATOM   480  C CG2 . THR A 1 63  ? -22.805 41.230 -1.743  1.00 97.45  ? 81  THR A CG2 1 
ATOM   481  N N   . THR A 1 64  ? -23.278 41.663 -4.766  1.00 75.88  ? 82  THR A N   1 
ATOM   482  C CA  . THR A 1 64  ? -23.924 42.704 -5.554  1.00 79.10  ? 82  THR A CA  1 
ATOM   483  C C   . THR A 1 64  ? -23.914 42.428 -7.065  1.00 94.29  ? 82  THR A C   1 
ATOM   484  O O   . THR A 1 64  ? -24.819 41.774 -7.600  1.00 90.39  ? 82  THR A O   1 
ATOM   485  C CB  . THR A 1 64  ? -23.238 44.059 -5.277  1.00 92.23  ? 82  THR A CB  1 
ATOM   486  O OG1 . THR A 1 64  ? -21.974 44.117 -5.955  1.00 84.21  ? 82  THR A OG1 1 
ATOM   487  C CG2 . THR A 1 64  ? -23.004 44.232 -3.775  1.00 68.71  ? 82  THR A CG2 1 
ATOM   488  N N   . ASP A 1 65  ? -22.884 42.943 -7.735  1.00 89.86  ? 83  ASP A N   1 
ATOM   489  C CA  . ASP A 1 65  ? -22.711 42.824 -9.181  1.00 80.27  ? 83  ASP A CA  1 
ATOM   490  C C   . ASP A 1 65  ? -23.319 41.544 -9.774  1.00 78.41  ? 83  ASP A C   1 
ATOM   491  O O   . ASP A 1 65  ? -22.881 40.433 -9.478  1.00 73.54  ? 83  ASP A O   1 
ATOM   492  C CB  . ASP A 1 65  ? -21.229 42.949 -9.530  1.00 67.72  ? 83  ASP A CB  1 
ATOM   493  C CG  . ASP A 1 65  ? -20.951 42.678 -10.983 1.00 81.07  ? 83  ASP A CG  1 
ATOM   494  O OD1 . ASP A 1 65  ? -21.917 42.464 -11.745 1.00 72.58  ? 83  ASP A OD1 1 
ATOM   495  O OD2 . ASP A 1 65  ? -19.760 42.675 -11.361 1.00 83.37  ? 83  ASP A OD2 1 
ATOM   496  N N   . PRO A 1 66  ? -24.341 41.715 -10.622 1.00 84.95  ? 84  PRO A N   1 
ATOM   497  C CA  . PRO A 1 66  ? -25.165 40.658 -11.222 1.00 74.12  ? 84  PRO A CA  1 
ATOM   498  C C   . PRO A 1 66  ? -24.524 39.980 -12.436 1.00 63.85  ? 84  PRO A C   1 
ATOM   499  O O   . PRO A 1 66  ? -24.894 38.856 -12.777 1.00 58.67  ? 84  PRO A O   1 
ATOM   500  C CB  . PRO A 1 66  ? -26.438 41.405 -11.656 1.00 67.18  ? 84  PRO A CB  1 
ATOM   501  C CG  . PRO A 1 66  ? -26.318 42.806 -11.077 1.00 67.20  ? 84  PRO A CG  1 
ATOM   502  C CD  . PRO A 1 66  ? -24.855 43.053 -10.950 1.00 85.92  ? 84  PRO A CD  1 
ATOM   503  N N   A TRP A 1 67  ? -23.573 40.657 -13.072 0.48 62.84  ? 85  TRP A N   1 
ATOM   504  N N   B TRP A 1 67  ? -23.601 40.665 -13.102 0.52 62.80  ? 85  TRP A N   1 
ATOM   505  C CA  A TRP A 1 67  ? -22.858 40.084 -14.209 0.48 67.52  ? 85  TRP A CA  1 
ATOM   506  C CA  B TRP A 1 67  ? -22.877 40.055 -14.215 0.52 67.61  ? 85  TRP A CA  1 
ATOM   507  C C   A TRP A 1 67  ? -21.552 39.464 -13.736 0.48 68.04  ? 85  TRP A C   1 
ATOM   508  C C   B TRP A 1 67  ? -21.511 39.575 -13.730 0.52 68.07  ? 85  TRP A C   1 
ATOM   509  O O   A TRP A 1 67  ? -20.711 39.062 -14.539 0.48 66.29  ? 85  TRP A O   1 
ATOM   510  O O   B TRP A 1 67  ? -20.587 39.384 -14.520 0.52 66.39  ? 85  TRP A O   1 
ATOM   511  C CB  A TRP A 1 67  ? -22.599 41.151 -15.278 0.48 62.31  ? 85  TRP A CB  1 
ATOM   512  C CB  B TRP A 1 67  ? -22.743 41.022 -15.406 0.52 62.04  ? 85  TRP A CB  1 
ATOM   513  C CG  A TRP A 1 67  ? -23.844 41.884 -15.664 0.48 54.91  ? 85  TRP A CG  1 
ATOM   514  C CG  B TRP A 1 67  ? -24.051 41.309 -16.121 0.52 49.12  ? 85  TRP A CG  1 
ATOM   515  C CD1 A TRP A 1 67  ? -24.749 41.516 -16.615 0.48 46.60  ? 85  TRP A CD1 1 
ATOM   516  C CD1 B TRP A 1 67  ? -24.970 42.263 -15.791 0.52 54.98  ? 85  TRP A CD1 1 
ATOM   517  C CD2 A TRP A 1 67  ? -24.340 43.096 -15.081 0.48 58.32  ? 85  TRP A CD2 1 
ATOM   518  C CD2 B TRP A 1 67  ? -24.574 40.635 -17.275 0.52 47.88  ? 85  TRP A CD2 1 
ATOM   519  N NE1 A TRP A 1 67  ? -25.774 42.430 -16.668 0.48 57.30  ? 85  TRP A NE1 1 
ATOM   520  N NE1 B TRP A 1 67  ? -26.030 42.223 -16.664 0.52 57.25  ? 85  TRP A NE1 1 
ATOM   521  C CE2 A TRP A 1 67  ? -25.546 43.410 -15.736 0.48 55.09  ? 85  TRP A CE2 1 
ATOM   522  C CE2 B TRP A 1 67  ? -25.809 41.235 -17.586 0.52 47.56  ? 85  TRP A CE2 1 
ATOM   523  C CE3 A TRP A 1 67  ? -23.879 43.947 -14.072 0.48 58.44  ? 85  TRP A CE3 1 
ATOM   524  C CE3 B TRP A 1 67  ? -24.112 39.592 -18.082 0.52 61.44  ? 85  TRP A CE3 1 
ATOM   525  C CZ2 A TRP A 1 67  ? -26.297 44.538 -15.416 0.48 53.69  ? 85  TRP A CZ2 1 
ATOM   526  C CZ2 B TRP A 1 67  ? -26.591 40.822 -18.664 0.52 48.33  ? 85  TRP A CZ2 1 
ATOM   527  C CZ3 A TRP A 1 67  ? -24.627 45.067 -13.755 0.48 51.90  ? 85  TRP A CZ3 1 
ATOM   528  C CZ3 B TRP A 1 67  ? -24.896 39.179 -19.150 0.52 48.15  ? 85  TRP A CZ3 1 
ATOM   529  C CH2 A TRP A 1 67  ? -25.821 45.351 -14.423 0.48 47.58  ? 85  TRP A CH2 1 
ATOM   530  C CH2 B TRP A 1 67  ? -26.118 39.793 -19.429 0.52 47.92  ? 85  TRP A CH2 1 
ATOM   531  N N   . ASP A 1 68  ? -21.399 39.384 -12.418 1.00 63.91  ? 86  ASP A N   1 
ATOM   532  C CA  . ASP A 1 68  ? -20.186 38.872 -11.819 1.00 55.95  ? 86  ASP A CA  1 
ATOM   533  C C   . ASP A 1 68  ? -19.912 37.442 -12.246 1.00 55.22  ? 86  ASP A C   1 
ATOM   534  O O   . ASP A 1 68  ? -20.726 36.552 -12.019 1.00 53.91  ? 86  ASP A O   1 
ATOM   535  C CB  . ASP A 1 68  ? -20.282 38.919 -10.297 1.00 62.66  ? 86  ASP A CB  1 
ATOM   536  C CG  . ASP A 1 68  ? -18.988 38.517 -9.631  1.00 67.91  ? 86  ASP A CG  1 
ATOM   537  O OD1 . ASP A 1 68  ? -17.935 38.992 -10.110 1.00 51.05  ? 86  ASP A OD1 1 
ATOM   538  O OD2 . ASP A 1 68  ? -19.019 37.731 -8.652  1.00 52.35  ? 86  ASP A OD2 1 
ATOM   539  N N   . VAL A 1 69  ? -18.756 37.230 -12.863 1.00 37.78  ? 87  VAL A N   1 
ATOM   540  C CA  . VAL A 1 69  ? -18.272 35.884 -13.140 1.00 48.59  ? 87  VAL A CA  1 
ATOM   541  C C   . VAL A 1 69  ? -17.076 35.513 -12.248 1.00 51.45  ? 87  VAL A C   1 
ATOM   542  O O   . VAL A 1 69  ? -15.988 36.074 -12.372 1.00 66.62  ? 87  VAL A O   1 
ATOM   543  C CB  . VAL A 1 69  ? -17.889 35.719 -14.619 1.00 48.07  ? 87  VAL A CB  1 
ATOM   544  C CG1 . VAL A 1 69  ? -17.271 34.349 -14.861 1.00 45.77  ? 87  VAL A CG1 1 
ATOM   545  C CG2 . VAL A 1 69  ? -19.110 35.922 -15.492 1.00 58.23  ? 87  VAL A CG2 1 
ATOM   546  N N   . VAL A 1 70  ? -17.293 34.561 -11.350 1.00 46.80  ? 88  VAL A N   1 
ATOM   547  C CA  . VAL A 1 70  ? -16.249 34.072 -10.451 1.00 46.08  ? 88  VAL A CA  1 
ATOM   548  C C   . VAL A 1 70  ? -15.203 33.157 -11.137 1.00 56.23  ? 88  VAL A C   1 
ATOM   549  O O   . VAL A 1 70  ? -15.553 32.141 -11.748 1.00 53.28  ? 88  VAL A O   1 
ATOM   550  C CB  . VAL A 1 70  ? -16.885 33.343 -9.257  1.00 38.93  ? 88  VAL A CB  1 
ATOM   551  C CG1 . VAL A 1 70  ? -15.866 32.477 -8.565  1.00 49.05  ? 88  VAL A CG1 1 
ATOM   552  C CG2 . VAL A 1 70  ? -17.508 34.353 -8.293  1.00 40.79  ? 88  VAL A CG2 1 
ATOM   553  N N   . LEU A 1 71  ? -13.927 33.536 -11.024 1.00 43.65  ? 89  LEU A N   1 
ATOM   554  C CA  . LEU A 1 71  ? -12.801 32.811 -11.619 1.00 38.42  ? 89  LEU A CA  1 
ATOM   555  C C   . LEU A 1 71  ? -12.049 31.964 -10.599 1.00 36.15  ? 89  LEU A C   1 
ATOM   556  O O   . LEU A 1 71  ? -11.558 32.468 -9.601  1.00 36.60  ? 89  LEU A O   1 
ATOM   557  C CB  . LEU A 1 71  ? -11.800 33.808 -12.212 1.00 30.51  ? 89  LEU A CB  1 
ATOM   558  C CG  . LEU A 1 71  ? -11.726 34.106 -13.713 1.00 69.46  ? 89  LEU A CG  1 
ATOM   559  C CD1 . LEU A 1 71  ? -13.100 34.173 -14.384 1.00 45.92  ? 89  LEU A CD1 1 
ATOM   560  C CD2 . LEU A 1 71  ? -10.947 35.405 -13.930 1.00 45.11  ? 89  LEU A CD2 1 
ATOM   561  N N   . CYS A 1 72  ? -11.904 30.681 -10.858 1.00 39.99  ? 90  CYS A N   1 
ATOM   562  C CA  . CYS A 1 72  ? -11.052 29.881 -9.988  1.00 34.07  ? 90  CYS A CA  1 
ATOM   563  C C   . CYS A 1 72  ? -9.803  29.382 -10.706 1.00 44.59  ? 90  CYS A C   1 
ATOM   564  O O   . CYS A 1 72  ? -9.867  28.951 -11.871 1.00 34.65  ? 90  CYS A O   1 
ATOM   565  C CB  . CYS A 1 72  ? -11.834 28.707 -9.394  1.00 38.88  ? 90  CYS A CB  1 
ATOM   566  S SG  . CYS A 1 72  ? -13.273 29.209 -8.436  1.00 44.99  ? 90  CYS A SG  1 
ATOM   567  N N   . THR A 1 73  ? -8.667  29.467 -10.011 1.00 41.80  ? 91  THR A N   1 
ATOM   568  C CA  . THR A 1 73  ? -7.445  28.814 -10.465 1.00 23.19  ? 91  THR A CA  1 
ATOM   569  C C   . THR A 1 73  ? -7.342  27.434 -9.849  1.00 26.76  ? 91  THR A C   1 
ATOM   570  O O   . THR A 1 73  ? -7.323  27.271 -8.625  1.00 36.37  ? 91  THR A O   1 
ATOM   571  C CB  . THR A 1 73  ? -6.173  29.571 -10.106 1.00 29.67  ? 91  THR A CB  1 
ATOM   572  O OG1 . THR A 1 73  ? -6.194  30.878 -10.686 1.00 37.63  ? 91  THR A OG1 1 
ATOM   573  C CG2 . THR A 1 73  ? -4.970  28.801 -10.618 1.00 32.96  ? 91  THR A CG2 1 
ATOM   574  N N   . CYS A 1 74  ? -7.269  26.444 -10.720 1.00 26.98  ? 92  CYS A N   1 
ATOM   575  C CA  . CYS A 1 74  ? -7.157  25.057 -10.337 1.00 24.18  ? 92  CYS A CA  1 
ATOM   576  C C   . CYS A 1 74  ? -5.720  24.618 -10.641 1.00 21.07  ? 92  CYS A C   1 
ATOM   577  O O   . CYS A 1 74  ? -5.168  24.964 -11.677 1.00 48.86  ? 92  CYS A O   1 
ATOM   578  C CB  . CYS A 1 74  ? -8.214  24.268 -11.113 1.00 23.17  ? 92  CYS A CB  1 
ATOM   579  S SG  . CYS A 1 74  ? -8.181  22.490 -11.006 1.00 46.20  ? 92  CYS A SG  1 
ATOM   580  N N   . LYS A 1 75  ? -5.100  23.891 -9.722  1.00 32.37  ? 93  LYS A N   1 
ATOM   581  C CA  . LYS A 1 75  ? -3.697  23.513 -9.870  1.00 37.85  ? 93  LYS A CA  1 
ATOM   582  C C   . LYS A 1 75  ? -3.516  22.066 -9.467  1.00 43.12  ? 93  LYS A C   1 
ATOM   583  O O   . LYS A 1 75  ? -3.695  21.699 -8.298  1.00 46.81  ? 93  LYS A O   1 
ATOM   584  C CB  . LYS A 1 75  ? -2.771  24.413 -9.030  1.00 30.36  ? 93  LYS A CB  1 
ATOM   585  C CG  . LYS A 1 75  ? -1.302  24.004 -9.108  1.00 31.56  ? 93  LYS A CG  1 
ATOM   586  C CD  . LYS A 1 75  ? -0.340  25.110 -8.679  1.00 26.16  ? 93  LYS A CD  1 
ATOM   587  C CE  . LYS A 1 75  ? 1.035   24.525 -8.385  1.00 40.08  ? 93  LYS A CE  1 
ATOM   588  N NZ  . LYS A 1 75  ? 2.015   25.514 -7.869  1.00 58.34  ? 93  LYS A NZ  1 
ATOM   589  N N   . ILE A 1 76  ? -3.168  21.235 -10.436 1.00 27.32  ? 94  ILE A N   1 
ATOM   590  C CA  . ILE A 1 76  ? -3.014  19.834 -10.146 1.00 25.23  ? 94  ILE A CA  1 
ATOM   591  C C   . ILE A 1 76  ? -1.531  19.558 -10.083 1.00 36.15  ? 94  ILE A C   1 
ATOM   592  O O   . ILE A 1 76  ? -0.769  20.047 -10.912 1.00 43.19  ? 94  ILE A O   1 
ATOM   593  C CB  . ILE A 1 76  ? -3.697  18.921 -11.208 1.00 42.01  ? 94  ILE A CB  1 
ATOM   594  C CG1 . ILE A 1 76  ? -5.225  18.933 -11.074 1.00 41.52  ? 94  ILE A CG1 1 
ATOM   595  C CG2 . ILE A 1 76  ? -3.251  17.478 -11.040 1.00 25.37  ? 94  ILE A CG2 1 
ATOM   596  C CD1 . ILE A 1 76  ? -5.902  20.191 -11.507 1.00 35.30  ? 94  ILE A CD1 1 
ATOM   597  N N   . THR A 1 77  ? -1.119  18.787 -9.086  1.00 30.30  ? 95  THR A N   1 
ATOM   598  C CA  . THR A 1 77  ? 0.277   18.428 -8.955  1.00 36.08  ? 95  THR A CA  1 
ATOM   599  C C   . THR A 1 77  ? 0.436   16.930 -9.143  1.00 37.34  ? 95  THR A C   1 
ATOM   600  O O   . THR A 1 77  ? -0.148  16.132 -8.402  1.00 37.58  ? 95  THR A O   1 
ATOM   601  C CB  . THR A 1 77  ? 0.842   18.835 -7.573  1.00 37.14  ? 95  THR A CB  1 
ATOM   602  O OG1 . THR A 1 77  ? 0.836   20.267 -7.439  1.00 32.38  ? 95  THR A OG1 1 
ATOM   603  C CG2 . THR A 1 77  ? 2.254   18.312 -7.416  1.00 25.46  ? 95  THR A CG2 1 
ATOM   604  N N   . ALA A 1 78  ? 1.226   16.553 -10.140 1.00 29.23  ? 96  ALA A N   1 
ATOM   605  C CA  . ALA A 1 78  ? 1.523   15.148 -10.393 1.00 39.84  ? 96  ALA A CA  1 
ATOM   606  C C   . ALA A 1 78  ? 2.818   14.794 -9.690  1.00 36.69  ? 96  ALA A C   1 
ATOM   607  O O   . ALA A 1 78  ? 3.844   15.441 -9.913  1.00 33.99  ? 96  ALA A O   1 
ATOM   608  C CB  . ALA A 1 78  ? 1.633   14.868 -11.898 1.00 31.99  ? 96  ALA A CB  1 
ATOM   609  N N   . HIS A 1 79  ? 2.760   13.760 -8.855  1.00 29.72  ? 97  HIS A N   1 
ATOM   610  C CA  . HIS A 1 79  ? 3.861   13.430 -7.955  1.00 32.52  ? 97  HIS A CA  1 
ATOM   611  C C   . HIS A 1 79  ? 4.912   12.459 -8.541  1.00 39.72  ? 97  HIS A C   1 
ATOM   612  O O   . HIS A 1 79  ? 6.074   12.499 -8.146  1.00 34.36  ? 97  HIS A O   1 
ATOM   613  C CB  . HIS A 1 79  ? 3.318   12.979 -6.582  1.00 35.80  ? 97  HIS A CB  1 
ATOM   614  C CG  . HIS A 1 79  ? 2.443   14.005 -5.916  1.00 28.22  ? 97  HIS A CG  1 
ATOM   615  N ND1 . HIS A 1 79  ? 2.953   15.086 -5.227  1.00 28.80  ? 97  HIS A ND1 1 
ATOM   616  C CD2 . HIS A 1 79  ? 1.094   14.128 -5.852  1.00 27.74  ? 97  HIS A CD2 1 
ATOM   617  C CE1 . HIS A 1 79  ? 1.960   15.834 -4.775  1.00 21.22  ? 97  HIS A CE1 1 
ATOM   618  N NE2 . HIS A 1 79  ? 0.821   15.277 -5.143  1.00 25.23  ? 97  HIS A NE2 1 
ATOM   619  N N   . ARG A 1 80  ? 4.519   11.613 -9.491  1.00 34.32  ? 98  ARG A N   1 
ATOM   620  C CA  . ARG A 1 80  ? 5.481   10.726 -10.160 1.00 33.03  ? 98  ARG A CA  1 
ATOM   621  C C   . ARG A 1 80  ? 5.375   10.891 -11.683 1.00 32.47  ? 98  ARG A C   1 
ATOM   622  O O   . ARG A 1 80  ? 5.027   9.975  -12.425 1.00 36.35  ? 98  ARG A O   1 
ATOM   623  C CB  . ARG A 1 80  ? 5.347   9.264  -9.692  1.00 30.21  ? 98  ARG A CB  1 
ATOM   624  C CG  . ARG A 1 80  ? 5.150   9.104  -8.176  1.00 42.03  ? 98  ARG A CG  1 
ATOM   625  C CD  . ARG A 1 80  ? 5.187   7.645  -7.694  1.00 34.31  ? 98  ARG A CD  1 
ATOM   626  N NE  . ARG A 1 80  ? 6.532   7.262  -7.287  1.00 61.36  ? 98  ARG A NE  1 
ATOM   627  C CZ  . ARG A 1 80  ? 6.956   7.190  -6.026  1.00 59.88  ? 98  ARG A CZ  1 
ATOM   628  N NH1 . ARG A 1 80  ? 6.137   7.449  -5.006  1.00 29.99  ? 98  ARG A NH1 1 
ATOM   629  N NH2 . ARG A 1 80  ? 8.212   6.836  -5.786  1.00 61.11  ? 98  ARG A NH2 1 
ATOM   630  N N   . TYR A 1 81  ? 5.675   12.111 -12.108 1.00 32.52  ? 99  TYR A N   1 
ATOM   631  C CA  . TYR A 1 81  ? 5.650   12.547 -13.492 1.00 30.46  ? 99  TYR A CA  1 
ATOM   632  C C   . TYR A 1 81  ? 6.895   12.079 -14.230 1.00 38.64  ? 99  TYR A C   1 
ATOM   633  O O   . TYR A 1 81  ? 8.002   12.117 -13.696 1.00 31.79  ? 99  TYR A O   1 
ATOM   634  C CB  . TYR A 1 81  ? 5.610   14.065 -13.476 1.00 34.44  ? 99  TYR A CB  1 
ATOM   635  C CG  . TYR A 1 81  ? 5.511   14.716 -14.813 1.00 36.61  ? 99  TYR A CG  1 
ATOM   636  C CD1 . TYR A 1 81  ? 4.277   15.093 -15.329 1.00 36.24  ? 99  TYR A CD1 1 
ATOM   637  C CD2 . TYR A 1 81  ? 6.647   14.991 -15.552 1.00 25.33  ? 99  TYR A CD2 1 
ATOM   638  C CE1 . TYR A 1 81  ? 4.181   15.700 -16.556 1.00 37.35  ? 99  TYR A CE1 1 
ATOM   639  C CE2 . TYR A 1 81  ? 6.562   15.607 -16.770 1.00 36.65  ? 99  TYR A CE2 1 
ATOM   640  C CZ  . TYR A 1 81  ? 5.328   15.947 -17.273 1.00 32.01  ? 99  TYR A CZ  1 
ATOM   641  O OH  . TYR A 1 81  ? 5.249   16.558 -18.488 1.00 29.42  ? 99  TYR A OH  1 
ATOM   642  N N   . ARG A 1 82  ? 6.725   11.629 -15.465 1.00 42.80  ? 100 ARG A N   1 
ATOM   643  C CA  . ARG A 1 82  ? 7.868   11.159 -16.251 1.00 41.39  ? 100 ARG A CA  1 
ATOM   644  C C   . ARG A 1 82  ? 8.346   12.256 -17.166 1.00 39.88  ? 100 ARG A C   1 
ATOM   645  O O   . ARG A 1 82  ? 7.834   12.412 -18.278 1.00 45.64  ? 100 ARG A O   1 
ATOM   646  C CB  . ARG A 1 82  ? 7.496   9.922  -17.067 1.00 43.34  ? 100 ARG A CB  1 
ATOM   647  C CG  . ARG A 1 82  ? 7.140   8.738  -16.194 1.00 44.82  ? 100 ARG A CG  1 
ATOM   648  C CD  . ARG A 1 82  ? 6.187   7.778  -16.866 1.00 50.00  ? 100 ARG A CD  1 
ATOM   649  N NE  . ARG A 1 82  ? 5.472   6.978  -15.873 1.00 54.20  ? 100 ARG A NE  1 
ATOM   650  C CZ  . ARG A 1 82  ? 5.543   5.656  -15.774 1.00 49.61  ? 100 ARG A CZ  1 
ATOM   651  N NH1 . ARG A 1 82  ? 6.286   4.963  -16.621 1.00 54.68  ? 100 ARG A NH1 1 
ATOM   652  N NH2 . ARG A 1 82  ? 4.858   5.025  -14.833 1.00 40.34  ? 100 ARG A NH2 1 
ATOM   653  N N   . GLU A 1 83  ? 9.319   13.029 -16.701 1.00 34.55  ? 101 GLU A N   1 
ATOM   654  C CA  . GLU A 1 83  ? 9.877   14.089 -17.528 1.00 52.62  ? 101 GLU A CA  1 
ATOM   655  C C   . GLU A 1 83  ? 10.696  13.495 -18.680 1.00 46.60  ? 101 GLU A C   1 
ATOM   656  O O   . GLU A 1 83  ? 10.986  14.180 -19.651 1.00 46.03  ? 101 GLU A O   1 
ATOM   657  C CB  . GLU A 1 83  ? 10.714  15.068 -16.692 1.00 50.80  ? 101 GLU A CB  1 
ATOM   658  C CG  . GLU A 1 83  ? 12.227  14.906 -16.821 1.00 70.33  ? 101 GLU A CG  1 
ATOM   659  C CD  . GLU A 1 83  ? 12.797  15.620 -18.042 1.00 77.75  ? 101 GLU A CD  1 
ATOM   660  O OE1 . GLU A 1 83  ? 12.635  16.857 -18.167 1.00 68.92  ? 101 GLU A OE1 1 
ATOM   661  O OE2 . GLU A 1 83  ? 13.417  14.938 -18.879 1.00 76.17  ? 101 GLU A OE2 1 
ATOM   662  N N   . PHE A 1 84  ? 11.053  12.218 -18.567 1.00 43.99  ? 102 PHE A N   1 
ATOM   663  C CA  . PHE A 1 84  ? 11.812  11.542 -19.617 1.00 47.18  ? 102 PHE A CA  1 
ATOM   664  C C   . PHE A 1 84  ? 10.916  11.095 -20.771 1.00 61.12  ? 102 PHE A C   1 
ATOM   665  O O   . PHE A 1 84  ? 11.404  10.676 -21.821 1.00 53.26  ? 102 PHE A O   1 
ATOM   666  C CB  . PHE A 1 84  ? 12.628  10.366 -19.065 1.00 45.97  ? 102 PHE A CB  1 
ATOM   667  C CG  . PHE A 1 84  ? 11.805  9.305  -18.373 1.00 62.36  ? 102 PHE A CG  1 
ATOM   668  C CD1 . PHE A 1 84  ? 11.517  9.405  -17.017 1.00 63.49  ? 102 PHE A CD1 1 
ATOM   669  C CD2 . PHE A 1 84  ? 11.346  8.195  -19.071 1.00 58.35  ? 102 PHE A CD2 1 
ATOM   670  C CE1 . PHE A 1 84  ? 10.773  8.427  -16.373 1.00 61.09  ? 102 PHE A CE1 1 
ATOM   671  C CE2 . PHE A 1 84  ? 10.601  7.211  -18.438 1.00 44.16  ? 102 PHE A CE2 1 
ATOM   672  C CZ  . PHE A 1 84  ? 10.316  7.325  -17.085 1.00 69.31  ? 102 PHE A CZ  1 
ATOM   673  N N   . VAL A 1 85  ? 9.606   11.188 -20.570 1.00 58.63  ? 103 VAL A N   1 
ATOM   674  C CA  . VAL A 1 85  ? 8.655   10.962 -21.652 1.00 35.76  ? 103 VAL A CA  1 
ATOM   675  C C   . VAL A 1 85  ? 8.348   12.311 -22.306 1.00 56.45  ? 103 VAL A C   1 
ATOM   676  O O   . VAL A 1 85  ? 8.355   13.352 -21.636 1.00 44.30  ? 103 VAL A O   1 
ATOM   677  C CB  . VAL A 1 85  ? 7.378   10.254 -21.147 1.00 46.17  ? 103 VAL A CB  1 
ATOM   678  C CG1 . VAL A 1 85  ? 6.184   10.580 -22.017 1.00 38.21  ? 103 VAL A CG1 1 
ATOM   679  C CG2 . VAL A 1 85  ? 7.608   8.745  -21.044 1.00 30.06  ? 103 VAL A CG2 1 
ATOM   680  N N   . PRO A 1 86  ? 8.149   12.306 -23.634 1.00 65.20  ? 104 PRO A N   1 
ATOM   681  C CA  . PRO A 1 86  ? 7.877   13.562 -24.342 1.00 39.86  ? 104 PRO A CA  1 
ATOM   682  C C   . PRO A 1 86  ? 6.720   14.324 -23.704 1.00 43.02  ? 104 PRO A C   1 
ATOM   683  O O   . PRO A 1 86  ? 5.728   13.719 -23.282 1.00 44.52  ? 104 PRO A O   1 
ATOM   684  C CB  . PRO A 1 86  ? 7.497   13.089 -25.750 1.00 36.57  ? 104 PRO A CB  1 
ATOM   685  C CG  . PRO A 1 86  ? 8.232   11.772 -25.918 1.00 31.13  ? 104 PRO A CG  1 
ATOM   686  C CD  . PRO A 1 86  ? 8.288   11.149 -24.548 1.00 37.07  ? 104 PRO A CD  1 
ATOM   687  N N   . LYS A 1 87  ? 6.849   15.644 -23.658 1.00 46.62  ? 105 LYS A N   1 
ATOM   688  C CA  . LYS A 1 87  ? 5.859   16.521 -23.033 1.00 54.31  ? 105 LYS A CA  1 
ATOM   689  C C   . LYS A 1 87  ? 4.539   16.552 -23.797 1.00 53.71  ? 105 LYS A C   1 
ATOM   690  O O   . LYS A 1 87  ? 4.491   16.965 -24.953 1.00 54.53  ? 105 LYS A O   1 
ATOM   691  C CB  . LYS A 1 87  ? 6.438   17.934 -22.925 1.00 41.04  ? 105 LYS A CB  1 
ATOM   692  C CG  . LYS A 1 87  ? 5.546   18.983 -22.281 1.00 44.96  ? 105 LYS A CG  1 
ATOM   693  C CD  . LYS A 1 87  ? 6.404   19.869 -21.375 1.00 55.44  ? 105 LYS A CD  1 
ATOM   694  C CE  . LYS A 1 87  ? 5.963   21.332 -21.340 1.00 63.44  ? 105 LYS A CE  1 
ATOM   695  N NZ  . LYS A 1 87  ? 6.803   22.134 -20.373 1.00 57.29  ? 105 LYS A NZ  1 
ATOM   696  N N   . ILE A 1 88  ? 3.465   16.122 -23.145 1.00 41.73  ? 106 ILE A N   1 
ATOM   697  C CA  . ILE A 1 88  ? 2.145   16.129 -23.770 1.00 44.11  ? 106 ILE A CA  1 
ATOM   698  C C   . ILE A 1 88  ? 1.458   17.491 -23.596 1.00 41.17  ? 106 ILE A C   1 
ATOM   699  O O   . ILE A 1 88  ? 1.356   18.001 -22.484 1.00 52.50  ? 106 ILE A O   1 
ATOM   700  C CB  . ILE A 1 88  ? 1.265   14.995 -23.207 1.00 38.77  ? 106 ILE A CB  1 
ATOM   701  C CG1 . ILE A 1 88  ? 2.106   13.731 -23.028 1.00 38.54  ? 106 ILE A CG1 1 
ATOM   702  C CG2 . ILE A 1 88  ? 0.068   14.740 -24.101 1.00 32.75  ? 106 ILE A CG2 1 
ATOM   703  C CD1 . ILE A 1 88  ? 1.338   12.525 -22.552 1.00 27.36  ? 106 ILE A CD1 1 
ATOM   704  N N   . PRO A 1 89  ? 0.995   18.085 -24.705 1.00 40.06  ? 107 PRO A N   1 
ATOM   705  C CA  . PRO A 1 89  ? 0.386   19.424 -24.737 1.00 32.42  ? 107 PRO A CA  1 
ATOM   706  C C   . PRO A 1 89  ? -1.104  19.431 -24.409 1.00 41.43  ? 107 PRO A C   1 
ATOM   707  O O   . PRO A 1 89  ? -1.793  18.448 -24.672 1.00 41.12  ? 107 PRO A O   1 
ATOM   708  C CB  . PRO A 1 89  ? 0.522   19.844 -26.211 1.00 39.21  ? 107 PRO A CB  1 
ATOM   709  C CG  . PRO A 1 89  ? 0.958   18.602 -26.973 1.00 30.25  ? 107 PRO A CG  1 
ATOM   710  C CD  . PRO A 1 89  ? 1.022   17.443 -26.033 1.00 33.99  ? 107 PRO A CD  1 
ATOM   711  N N   . TYR A 1 90  ? -1.578  20.562 -23.887 1.00 41.14  ? 108 TYR A N   1 
ATOM   712  C CA  . TYR A 1 90  ? -2.995  20.818 -23.597 1.00 34.87  ? 108 TYR A CA  1 
ATOM   713  C C   . TYR A 1 90  ? -3.918  20.460 -24.766 1.00 43.68  ? 108 TYR A C   1 
ATOM   714  O O   . TYR A 1 90  ? -4.962  19.838 -24.570 1.00 33.97  ? 108 TYR A O   1 
ATOM   715  C CB  . TYR A 1 90  ? -3.178  22.299 -23.233 1.00 40.91  ? 108 TYR A CB  1 
ATOM   716  C CG  . TYR A 1 90  ? -4.593  22.705 -22.879 1.00 48.88  ? 108 TYR A CG  1 
ATOM   717  C CD1 . TYR A 1 90  ? -5.190  22.249 -21.711 1.00 42.36  ? 108 TYR A CD1 1 
ATOM   718  C CD2 . TYR A 1 90  ? -5.327  23.557 -23.703 1.00 36.95  ? 108 TYR A CD2 1 
ATOM   719  C CE1 . TYR A 1 90  ? -6.491  22.613 -21.371 1.00 38.94  ? 108 TYR A CE1 1 
ATOM   720  C CE2 . TYR A 1 90  ? -6.628  23.934 -23.376 1.00 28.84  ? 108 TYR A CE2 1 
ATOM   721  C CZ  . TYR A 1 90  ? -7.205  23.456 -22.199 1.00 52.82  ? 108 TYR A CZ  1 
ATOM   722  O OH  . TYR A 1 90  ? -8.494  23.803 -21.836 1.00 43.64  ? 108 TYR A OH  1 
ATOM   723  N N   . SER A 1 91  ? -3.527  20.870 -25.973 1.00 32.91  ? 109 SER A N   1 
ATOM   724  C CA  . SER A 1 91  ? -4.268  20.537 -27.188 1.00 44.94  ? 109 SER A CA  1 
ATOM   725  C C   . SER A 1 91  ? -4.586  19.040 -27.295 1.00 33.13  ? 109 SER A C   1 
ATOM   726  O O   . SER A 1 91  ? -5.611  18.658 -27.829 1.00 36.77  ? 109 SER A O   1 
ATOM   727  C CB  . SER A 1 91  ? -3.502  20.997 -28.424 1.00 35.14  ? 109 SER A CB  1 
ATOM   728  O OG  . SER A 1 91  ? -2.312  20.245 -28.572 1.00 43.82  ? 109 SER A OG  1 
ATOM   729  N N   . SER A 1 92  ? -3.732  18.191 -26.749 1.00 42.04  ? 110 SER A N   1 
ATOM   730  C CA  . SER A 1 92  ? -4.003  16.759 -26.790 1.00 34.82  ? 110 SER A CA  1 
ATOM   731  C C   . SER A 1 92  ? -5.041  16.275 -25.764 1.00 47.31  ? 110 SER A C   1 
ATOM   732  O O   . SER A 1 92  ? -5.566  15.166 -25.906 1.00 30.67  ? 110 SER A O   1 
ATOM   733  C CB  . SER A 1 92  ? -2.704  15.961 -26.641 1.00 42.82  ? 110 SER A CB  1 
ATOM   734  O OG  . SER A 1 92  ? -1.917  16.054 -27.817 1.00 39.74  ? 110 SER A OG  1 
ATOM   735  N N   . PHE A 1 93  ? -5.344  17.079 -24.738 1.00 32.59  ? 111 PHE A N   1 
ATOM   736  C CA  . PHE A 1 93  ? -6.263  16.592 -23.692 1.00 28.83  ? 111 PHE A CA  1 
ATOM   737  C C   . PHE A 1 93  ? -7.353  17.563 -23.213 1.00 27.89  ? 111 PHE A C   1 
ATOM   738  O O   . PHE A 1 93  ? -8.123  17.231 -22.309 1.00 47.82  ? 111 PHE A O   1 
ATOM   739  C CB  . PHE A 1 93  ? -5.489  15.997 -22.497 1.00 36.43  ? 111 PHE A CB  1 
ATOM   740  C CG  . PHE A 1 93  ? -4.497  16.952 -21.876 1.00 35.20  ? 111 PHE A CG  1 
ATOM   741  C CD1 . PHE A 1 93  ? -4.876  17.788 -20.831 1.00 33.37  ? 111 PHE A CD1 1 
ATOM   742  C CD2 . PHE A 1 93  ? -3.193  17.023 -22.349 1.00 38.81  ? 111 PHE A CD2 1 
ATOM   743  C CE1 . PHE A 1 93  ? -3.960  18.675 -20.256 1.00 34.83  ? 111 PHE A CE1 1 
ATOM   744  C CE2 . PHE A 1 93  ? -2.276  17.900 -21.793 1.00 37.24  ? 111 PHE A CE2 1 
ATOM   745  C CZ  . PHE A 1 93  ? -2.656  18.731 -20.740 1.00 35.39  ? 111 PHE A CZ  1 
ATOM   746  N N   . SER A 1 94  ? -7.444  18.736 -23.830 1.00 36.10  ? 112 SER A N   1 
ATOM   747  C CA  . SER A 1 94  ? -8.432  19.735 -23.420 1.00 37.87  ? 112 SER A CA  1 
ATOM   748  C C   . SER A 1 94  ? -9.877  19.331 -23.697 1.00 39.37  ? 112 SER A C   1 
ATOM   749  O O   . SER A 1 94  ? -10.801 20.000 -23.248 1.00 50.15  ? 112 SER A O   1 
ATOM   750  C CB  . SER A 1 94  ? -8.156  21.076 -24.091 1.00 42.48  ? 112 SER A CB  1 
ATOM   751  O OG  . SER A 1 94  ? -8.059  20.917 -25.491 1.00 57.71  ? 112 SER A OG  1 
ATOM   752  N N   . SER A 1 95  ? -10.063 18.242 -24.433 1.00 34.87  ? 113 SER A N   1 
ATOM   753  C CA  . SER A 1 95  ? -11.399 17.755 -24.796 1.00 62.86  ? 113 SER A CA  1 
ATOM   754  C C   . SER A 1 95  ? -11.742 16.549 -23.952 1.00 29.11  ? 113 SER A C   1 
ATOM   755  O O   . SER A 1 95  ? -12.905 16.197 -23.798 1.00 37.08  ? 113 SER A O   1 
ATOM   756  C CB  . SER A 1 95  ? -11.475 17.365 -26.287 1.00 38.71  ? 113 SER A CB  1 
ATOM   757  O OG  . SER A 1 95  ? -11.648 18.517 -27.094 1.00 70.26  ? 113 SER A OG  1 
ATOM   758  N N   . ALA A 1 96  ? -10.698 15.910 -23.443 1.00 28.71  ? 114 ALA A N   1 
ATOM   759  C CA  . ALA A 1 96  ? -10.824 14.733 -22.611 1.00 30.54  ? 114 ALA A CA  1 
ATOM   760  C C   . ALA A 1 96  ? -11.843 14.979 -21.501 1.00 43.49  ? 114 ALA A C   1 
ATOM   761  O O   . ALA A 1 96  ? -12.009 16.110 -21.027 1.00 37.50  ? 114 ALA A O   1 
ATOM   762  C CB  . ALA A 1 96  ? -9.465  14.375 -22.030 1.00 30.21  ? 114 ALA A CB  1 
ATOM   763  N N   . PRO A 1 97  ? -12.537 13.918 -21.087 1.00 30.33  ? 115 PRO A N   1 
ATOM   764  C CA  . PRO A 1 97  ? -13.582 14.012 -20.056 1.00 36.29  ? 115 PRO A CA  1 
ATOM   765  C C   . PRO A 1 97  ? -12.992 14.499 -18.742 1.00 43.27  ? 115 PRO A C   1 
ATOM   766  O O   . PRO A 1 97  ? -11.871 14.124 -18.402 1.00 37.71  ? 115 PRO A O   1 
ATOM   767  C CB  . PRO A 1 97  ? -14.063 12.559 -19.887 1.00 30.54  ? 115 PRO A CB  1 
ATOM   768  C CG  . PRO A 1 97  ? -13.461 11.787 -21.027 1.00 39.78  ? 115 PRO A CG  1 
ATOM   769  C CD  . PRO A 1 97  ? -12.237 12.531 -21.469 1.00 34.38  ? 115 PRO A CD  1 
ATOM   770  N N   . GLY A 1 98  ? -13.732 15.322 -18.010 1.00 42.20  ? 116 GLY A N   1 
ATOM   771  C CA  . GLY A 1 98  ? -13.248 15.821 -16.737 1.00 22.07  ? 116 GLY A CA  1 
ATOM   772  C C   . GLY A 1 98  ? -12.335 17.022 -16.905 1.00 38.30  ? 116 GLY A C   1 
ATOM   773  O O   . GLY A 1 98  ? -12.157 17.796 -15.976 1.00 35.23  ? 116 GLY A O   1 
ATOM   774  N N   . VAL A 1 99  ? -11.759 17.200 -18.090 1.00 31.20  ? 117 VAL A N   1 
ATOM   775  C CA  . VAL A 1 99  ? -10.801 18.279 -18.264 1.00 25.06  ? 117 VAL A CA  1 
ATOM   776  C C   . VAL A 1 99  ? -11.486 19.610 -18.535 1.00 30.26  ? 117 VAL A C   1 
ATOM   777  O O   . VAL A 1 99  ? -11.525 20.109 -19.656 1.00 37.49  ? 117 VAL A O   1 
ATOM   778  C CB  . VAL A 1 99  ? -9.714  17.934 -19.294 1.00 34.28  ? 117 VAL A CB  1 
ATOM   779  C CG1 . VAL A 1 99  ? -8.711  19.076 -19.431 1.00 25.80  ? 117 VAL A CG1 1 
ATOM   780  C CG2 . VAL A 1 99  ? -9.003  16.674 -18.869 1.00 22.81  ? 117 VAL A CG2 1 
ATOM   781  N N   . ILE A 1 100 ? -11.993 20.209 -17.469 1.00 37.42  ? 118 ILE A N   1 
ATOM   782  C CA  . ILE A 1 100 ? -12.874 21.355 -17.605 1.00 24.41  ? 118 ILE A CA  1 
ATOM   783  C C   . ILE A 1 100 ? -12.201 22.698 -17.384 1.00 35.69  ? 118 ILE A C   1 
ATOM   784  O O   . ILE A 1 100 ? -12.799 23.736 -17.637 1.00 52.56  ? 118 ILE A O   1 
ATOM   785  C CB  . ILE A 1 100 ? -14.099 21.210 -16.695 1.00 36.94  ? 118 ILE A CB  1 
ATOM   786  C CG1 . ILE A 1 100 ? -13.656 20.902 -15.261 1.00 34.39  ? 118 ILE A CG1 1 
ATOM   787  C CG2 . ILE A 1 100 ? -15.003 20.088 -17.222 1.00 33.96  ? 118 ILE A CG2 1 
ATOM   788  C CD1 . ILE A 1 100 ? -14.756 21.007 -14.238 1.00 36.30  ? 118 ILE A CD1 1 
ATOM   789  N N   . PHE A 1 101 ? -10.958 22.699 -16.919 1.00 34.46  ? 119 PHE A N   1 
ATOM   790  C CA  . PHE A 1 101 ? -10.271 23.978 -16.759 1.00 32.60  ? 119 PHE A CA  1 
ATOM   791  C C   . PHE A 1 101 ? -9.767  24.456 -18.111 1.00 43.19  ? 119 PHE A C   1 
ATOM   792  O O   . PHE A 1 101 ? -9.733  23.678 -19.066 1.00 34.08  ? 119 PHE A O   1 
ATOM   793  C CB  . PHE A 1 101 ? -9.187  23.951 -15.654 1.00 37.25  ? 119 PHE A CB  1 
ATOM   794  C CG  . PHE A 1 101 ? -7.990  23.077 -15.944 1.00 34.21  ? 119 PHE A CG  1 
ATOM   795  C CD1 . PHE A 1 101 ? -7.901  22.311 -17.103 1.00 38.78  ? 119 PHE A CD1 1 
ATOM   796  C CD2 . PHE A 1 101 ? -6.962  22.991 -15.015 1.00 33.44  ? 119 PHE A CD2 1 
ATOM   797  C CE1 . PHE A 1 101 ? -6.784  21.504 -17.341 1.00 29.15  ? 119 PHE A CE1 1 
ATOM   798  C CE2 . PHE A 1 101 ? -5.847  22.189 -15.246 1.00 41.39  ? 119 PHE A CE2 1 
ATOM   799  C CZ  . PHE A 1 101 ? -5.758  21.442 -16.407 1.00 35.13  ? 119 PHE A CZ  1 
ATOM   800  N N   . ARG A 1 102 ? -9.407  25.730 -18.206 1.00 27.28  ? 120 ARG A N   1 
ATOM   801  C CA  . ARG A 1 102 ? -9.110  26.305 -19.509 1.00 32.06  ? 120 ARG A CA  1 
ATOM   802  C C   . ARG A 1 102 ? -7.986  27.291 -19.403 1.00 39.98  ? 120 ARG A C   1 
ATOM   803  O O   . ARG A 1 102 ? -7.510  27.582 -18.315 1.00 40.38  ? 120 ARG A O   1 
ATOM   804  C CB  . ARG A 1 102 ? -10.345 27.006 -20.072 1.00 27.82  ? 120 ARG A CB  1 
ATOM   805  C CG  . ARG A 1 102 ? -11.469 26.042 -20.426 1.00 47.89  ? 120 ARG A CG  1 
ATOM   806  C CD  . ARG A 1 102 ? -12.465 26.688 -21.368 1.00 69.00  ? 120 ARG A CD  1 
ATOM   807  N NE  . ARG A 1 102 ? -13.340 27.627 -20.674 1.00 80.95  ? 120 ARG A NE  1 
ATOM   808  C CZ  . ARG A 1 102 ? -14.312 28.314 -21.263 1.00 86.20  ? 120 ARG A CZ  1 
ATOM   809  N NH1 . ARG A 1 102 ? -14.530 28.170 -22.565 1.00 75.45  ? 120 ARG A NH1 1 
ATOM   810  N NH2 . ARG A 1 102 ? -15.064 29.145 -20.552 1.00 65.35  ? 120 ARG A NH2 1 
ATOM   811  N N   . GLN A 1 103 ? -7.559  27.819 -20.536 1.00 37.44  ? 121 GLN A N   1 
ATOM   812  C CA  . GLN A 1 103 ? -6.522  28.817 -20.495 1.00 32.40  ? 121 GLN A CA  1 
ATOM   813  C C   . GLN A 1 103 ? -6.917  29.837 -19.432 1.00 37.11  ? 121 GLN A C   1 
ATOM   814  O O   . GLN A 1 103 ? -8.101  30.119 -19.251 1.00 47.18  ? 121 GLN A O   1 
ATOM   815  C CB  . GLN A 1 103 ? -6.386  29.473 -21.848 1.00 20.56  ? 121 GLN A CB  1 
ATOM   816  C CG  . GLN A 1 103 ? -5.301  30.516 -21.931 1.00 38.67  ? 121 GLN A CG  1 
ATOM   817  C CD  . GLN A 1 103 ? -4.957  30.869 -23.373 1.00 53.16  ? 121 GLN A CD  1 
ATOM   818  O OE1 . GLN A 1 103 ? -5.088  30.043 -24.275 1.00 43.87  ? 121 GLN A OE1 1 
ATOM   819  N NE2 . GLN A 1 103 ? -4.508  32.094 -23.593 1.00 39.65  ? 121 GLN A NE2 1 
ATOM   820  N N   . GLU A 1 104 ? -5.936  30.377 -18.715 1.00 37.47  ? 122 GLU A N   1 
ATOM   821  C CA  . GLU A 1 104 ? -6.246  31.305 -17.626 1.00 47.80  ? 122 GLU A CA  1 
ATOM   822  C C   . GLU A 1 104 ? -6.402  32.726 -18.117 1.00 39.33  ? 122 GLU A C   1 
ATOM   823  O O   . GLU A 1 104 ? -5.695  33.175 -19.028 1.00 40.99  ? 122 GLU A O   1 
ATOM   824  C CB  . GLU A 1 104 ? -5.172  31.290 -16.539 1.00 54.44  ? 122 GLU A CB  1 
ATOM   825  C CG  . GLU A 1 104 ? -4.962  29.969 -15.834 1.00 49.89  ? 122 GLU A CG  1 
ATOM   826  C CD  . GLU A 1 104 ? -3.993  30.119 -14.676 1.00 57.99  ? 122 GLU A CD  1 
ATOM   827  O OE1 . GLU A 1 104 ? -4.115  31.111 -13.921 1.00 56.57  ? 122 GLU A OE1 1 
ATOM   828  O OE2 . GLU A 1 104 ? -3.107  29.259 -14.520 1.00 60.63  ? 122 GLU A OE2 1 
ATOM   829  N N   . THR A 1 105 ? -7.333  33.436 -17.500 1.00 35.75  ? 123 THR A N   1 
ATOM   830  C CA  . THR A 1 105 ? -7.484  34.860 -17.750 1.00 53.02  ? 123 THR A CA  1 
ATOM   831  C C   . THR A 1 105 ? -6.155  35.579 -17.515 1.00 52.70  ? 123 THR A C   1 
ATOM   832  O O   . THR A 1 105 ? -5.482  35.354 -16.507 1.00 36.99  ? 123 THR A O   1 
ATOM   833  C CB  . THR A 1 105 ? -8.573  35.453 -16.848 1.00 53.23  ? 123 THR A CB  1 
ATOM   834  O OG1 . THR A 1 105 ? -9.834  34.850 -17.170 1.00 56.27  ? 123 THR A OG1 1 
ATOM   835  C CG2 . THR A 1 105 ? -8.671  36.952 -17.037 1.00 43.14  ? 123 THR A CG2 1 
ATOM   836  N N   . GLY A 1 106 ? -5.770  36.427 -18.463 1.00 51.25  ? 124 GLY A N   1 
ATOM   837  C CA  . GLY A 1 106 ? -4.528  37.173 -18.355 1.00 34.51  ? 124 GLY A CA  1 
ATOM   838  C C   . GLY A 1 106 ? -3.302  36.433 -18.874 1.00 52.60  ? 124 GLY A C   1 
ATOM   839  O O   . GLY A 1 106 ? -2.224  37.014 -19.000 1.00 73.81  ? 124 GLY A O   1 
ATOM   840  N N   . LEU A 1 107 ? -3.459  35.149 -19.177 1.00 49.96  ? 125 LEU A N   1 
ATOM   841  C CA  . LEU A 1 107 ? -2.364  34.360 -19.737 1.00 50.21  ? 125 LEU A CA  1 
ATOM   842  C C   . LEU A 1 107 ? -2.467  34.194 -21.253 1.00 48.06  ? 125 LEU A C   1 
ATOM   843  O O   . LEU A 1 107 ? -3.510  33.812 -21.776 1.00 55.35  ? 125 LEU A O   1 
ATOM   844  C CB  . LEU A 1 107 ? -2.281  32.995 -19.059 1.00 45.35  ? 125 LEU A CB  1 
ATOM   845  C CG  . LEU A 1 107 ? -1.049  32.796 -18.177 1.00 53.47  ? 125 LEU A CG  1 
ATOM   846  C CD1 . LEU A 1 107 ? -0.811  33.994 -17.263 1.00 37.03  ? 125 LEU A CD1 1 
ATOM   847  C CD2 . LEU A 1 107 ? -1.202  31.518 -17.387 1.00 44.95  ? 125 LEU A CD2 1 
ATOM   848  N N   . ASP A 1 108 ? -1.373  34.473 -21.954 1.00 54.36  ? 126 ASP A N   1 
ATOM   849  C CA  . ASP A 1 108 ? -1.367  34.390 -23.407 1.00 58.39  ? 126 ASP A CA  1 
ATOM   850  C C   . ASP A 1 108 ? -1.036  32.979 -23.890 1.00 63.67  ? 126 ASP A C   1 
ATOM   851  O O   . ASP A 1 108 ? -0.770  32.773 -25.072 1.00 60.22  ? 126 ASP A O   1 
ATOM   852  C CB  . ASP A 1 108 ? -0.357  35.369 -23.991 1.00 67.30  ? 126 ASP A CB  1 
ATOM   853  C CG  . ASP A 1 108 ? 1.063   34.859 -23.883 1.00 89.29  ? 126 ASP A CG  1 
ATOM   854  O OD1 . ASP A 1 108 ? 1.338   34.067 -22.953 1.00 95.38  ? 126 ASP A OD1 1 
ATOM   855  O OD2 . ASP A 1 108 ? 1.902   35.241 -24.728 1.00 67.99  ? 126 ASP A OD2 1 
ATOM   856  N N   . HIS A 1 109 ? -1.041  32.006 -22.984 1.00 47.58  ? 127 HIS A N   1 
ATOM   857  C CA  . HIS A 1 109 ? -0.802  30.638 -23.403 1.00 40.69  ? 127 HIS A CA  1 
ATOM   858  C C   . HIS A 1 109 ? -1.635  29.614 -22.644 1.00 39.19  ? 127 HIS A C   1 
ATOM   859  O O   . HIS A 1 109 ? -2.207  29.911 -21.605 1.00 41.94  ? 127 HIS A O   1 
ATOM   860  C CB  . HIS A 1 109 ? 0.680   30.300 -23.310 1.00 39.05  ? 127 HIS A CB  1 
ATOM   861  C CG  . HIS A 1 109 ? 1.182   30.217 -21.909 1.00 69.14  ? 127 HIS A CG  1 
ATOM   862  N ND1 . HIS A 1 109 ? 1.622   31.321 -21.212 1.00 65.98  ? 127 HIS A ND1 1 
ATOM   863  C CD2 . HIS A 1 109 ? 1.303   29.164 -21.068 1.00 60.26  ? 127 HIS A CD2 1 
ATOM   864  C CE1 . HIS A 1 109 ? 2.001   30.949 -20.002 1.00 77.24  ? 127 HIS A CE1 1 
ATOM   865  N NE2 . HIS A 1 109 ? 1.816   29.646 -19.889 1.00 62.40  ? 127 HIS A NE2 1 
ATOM   866  N N   . ASP A 1 110 ? -1.690  28.405 -23.193 1.00 35.49  ? 128 ASP A N   1 
ATOM   867  C CA  . ASP A 1 110 ? -2.480  27.310 -22.650 1.00 34.65  ? 128 ASP A CA  1 
ATOM   868  C C   . ASP A 1 110 ? -1.908  26.764 -21.359 1.00 44.41  ? 128 ASP A C   1 
ATOM   869  O O   . ASP A 1 110 ? -0.710  26.902 -21.089 1.00 38.11  ? 128 ASP A O   1 
ATOM   870  C CB  . ASP A 1 110 ? -2.571  26.158 -23.660 1.00 43.85  ? 128 ASP A CB  1 
ATOM   871  C CG  . ASP A 1 110 ? -3.571  26.428 -24.770 1.00 51.54  ? 128 ASP A CG  1 
ATOM   872  O OD1 . ASP A 1 110 ? -4.231  27.484 -24.722 1.00 49.49  ? 128 ASP A OD1 1 
ATOM   873  O OD2 . ASP A 1 110 ? -3.695  25.584 -25.685 1.00 55.28  ? 128 ASP A OD2 1 
ATOM   874  N N   . PRO A 1 111 ? -2.775  26.125 -20.561 1.00 43.27  ? 129 PRO A N   1 
ATOM   875  C CA  . PRO A 1 111 ? -2.336  25.366 -19.391 1.00 42.83  ? 129 PRO A CA  1 
ATOM   876  C C   . PRO A 1 111 ? -1.237  24.426 -19.828 1.00 40.66  ? 129 PRO A C   1 
ATOM   877  O O   . PRO A 1 111 ? -1.342  23.826 -20.902 1.00 40.75  ? 129 PRO A O   1 
ATOM   878  C CB  . PRO A 1 111 ? -3.584  24.567 -19.002 1.00 34.51  ? 129 PRO A CB  1 
ATOM   879  C CG  . PRO A 1 111 ? -4.721  25.402 -19.493 1.00 37.05  ? 129 PRO A CG  1 
ATOM   880  C CD  . PRO A 1 111 ? -4.230  26.035 -20.770 1.00 35.74  ? 129 PRO A CD  1 
ATOM   881  N N   . GLU A 1 112 ? -0.189  24.316 -19.021 1.00 35.28  ? 130 GLU A N   1 
ATOM   882  C CA  . GLU A 1 112 ? 0.940   23.472 -19.365 1.00 30.56  ? 130 GLU A CA  1 
ATOM   883  C C   . GLU A 1 112 ? 1.513   22.754 -18.152 1.00 33.07  ? 130 GLU A C   1 
ATOM   884  O O   . GLU A 1 112 ? 1.624   23.307 -17.061 1.00 34.88  ? 130 GLU A O   1 
ATOM   885  C CB  . GLU A 1 112 ? 2.030   24.306 -20.035 1.00 36.39  ? 130 GLU A CB  1 
ATOM   886  C CG  . GLU A 1 112 ? 2.470   25.483 -19.177 1.00 41.32  ? 130 GLU A CG  1 
ATOM   887  C CD  . GLU A 1 112 ? 3.794   26.071 -19.609 1.00 71.59  ? 130 GLU A CD  1 
ATOM   888  O OE1 . GLU A 1 112 ? 4.313   25.671 -20.679 1.00 57.89  ? 130 GLU A OE1 1 
ATOM   889  O OE2 . GLU A 1 112 ? 4.312   26.940 -18.869 1.00 86.13  ? 130 GLU A OE2 1 
ATOM   890  N N   . TRP A 1 113 ? 1.882   21.505 -18.356 1.00 37.90  ? 131 TRP A N   1 
ATOM   891  C CA  . TRP A 1 113 ? 2.670   20.818 -17.371 1.00 32.35  ? 131 TRP A CA  1 
ATOM   892  C C   . TRP A 1 113 ? 3.994   21.552 -17.142 1.00 39.97  ? 131 TRP A C   1 
ATOM   893  O O   . TRP A 1 113 ? 4.737   21.840 -18.077 1.00 34.00  ? 131 TRP A O   1 
ATOM   894  C CB  . TRP A 1 113 ? 2.902   19.384 -17.807 1.00 23.51  ? 131 TRP A CB  1 
ATOM   895  C CG  . TRP A 1 113 ? 1.690   18.532 -17.631 1.00 39.92  ? 131 TRP A CG  1 
ATOM   896  C CD1 . TRP A 1 113 ? 0.896   18.027 -18.612 1.00 26.14  ? 131 TRP A CD1 1 
ATOM   897  C CD2 . TRP A 1 113 ? 1.121   18.097 -16.390 1.00 40.94  ? 131 TRP A CD2 1 
ATOM   898  N NE1 . TRP A 1 113 ? -0.121  17.288 -18.067 1.00 34.41  ? 131 TRP A NE1 1 
ATOM   899  C CE2 . TRP A 1 113 ? -0.002  17.306 -16.703 1.00 33.53  ? 131 TRP A CE2 1 
ATOM   900  C CE3 . TRP A 1 113 ? 1.453   18.298 -15.046 1.00 36.80  ? 131 TRP A CE3 1 
ATOM   901  C CZ2 . TRP A 1 113 ? -0.800  16.718 -15.723 1.00 39.91  ? 131 TRP A CZ2 1 
ATOM   902  C CZ3 . TRP A 1 113 ? 0.667   17.711 -14.072 1.00 35.63  ? 131 TRP A CZ3 1 
ATOM   903  C CH2 . TRP A 1 113 ? -0.451  16.929 -14.415 1.00 46.10  ? 131 TRP A CH2 1 
ATOM   904  N N   . VAL A 1 114 ? 4.264   21.862 -15.882 1.00 37.56  ? 132 VAL A N   1 
ATOM   905  C CA  . VAL A 1 114 ? 5.506   22.488 -15.474 1.00 28.27  ? 132 VAL A CA  1 
ATOM   906  C C   . VAL A 1 114 ? 6.233   21.586 -14.468 1.00 37.42  ? 132 VAL A C   1 
ATOM   907  O O   . VAL A 1 114 ? 5.702   21.271 -13.391 1.00 29.92  ? 132 VAL A O   1 
ATOM   908  C CB  . VAL A 1 114 ? 5.220   23.845 -14.835 1.00 51.82  ? 132 VAL A CB  1 
ATOM   909  C CG1 . VAL A 1 114 ? 6.441   24.358 -14.044 1.00 35.31  ? 132 VAL A CG1 1 
ATOM   910  C CG2 . VAL A 1 114 ? 4.779   24.819 -15.907 1.00 44.04  ? 132 VAL A CG2 1 
ATOM   911  N N   . VAL A 1 115 ? 7.437   21.150 -14.831 1.00 31.96  ? 133 VAL A N   1 
ATOM   912  C CA  . VAL A 1 115 ? 8.223   20.311 -13.931 1.00 47.68  ? 133 VAL A CA  1 
ATOM   913  C C   . VAL A 1 115 ? 8.897   21.124 -12.828 1.00 36.08  ? 133 VAL A C   1 
ATOM   914  O O   . VAL A 1 115 ? 9.499   22.163 -13.082 1.00 46.37  ? 133 VAL A O   1 
ATOM   915  C CB  . VAL A 1 115 ? 9.305   19.516 -14.674 1.00 33.16  ? 133 VAL A CB  1 
ATOM   916  C CG1 . VAL A 1 115 ? 10.252  18.884 -13.671 1.00 31.53  ? 133 VAL A CG1 1 
ATOM   917  C CG2 . VAL A 1 115 ? 8.674   18.450 -15.540 1.00 34.05  ? 133 VAL A CG2 1 
ATOM   918  N N   . ASN A 1 116 ? 8.790   20.643 -11.597 1.00 40.89  ? 134 ASN A N   1 
ATOM   919  C CA  . ASN A 1 116 ? 9.469   21.296 -10.491 1.00 47.23  ? 134 ASN A CA  1 
ATOM   920  C C   . ASN A 1 116 ? 10.926  20.834 -10.372 1.00 35.35  ? 134 ASN A C   1 
ATOM   921  O O   . ASN A 1 116 ? 11.215  19.776 -9.814  1.00 34.91  ? 134 ASN A O   1 
ATOM   922  C CB  . ASN A 1 116 ? 8.702   21.072 -9.191  1.00 37.83  ? 134 ASN A CB  1 
ATOM   923  C CG  . ASN A 1 116 ? 9.388   21.707 -7.998  1.00 61.00  ? 134 ASN A CG  1 
ATOM   924  O OD1 . ASN A 1 116 ? 9.044   21.422 -6.853  1.00 61.06  ? 134 ASN A OD1 1 
ATOM   925  N ND2 . ASN A 1 116 ? 10.371  22.568 -8.260  1.00 44.47  ? 134 ASN A ND2 1 
ATOM   926  N N   . MET A 1 117 ? 11.831  21.639 -10.920 1.00 34.62  ? 135 MET A N   1 
ATOM   927  C CA  . MET A 1 117 ? 13.252  21.300 -10.954 1.00 43.76  ? 135 MET A CA  1 
ATOM   928  C C   . MET A 1 117 ? 13.952  21.457 -9.597  1.00 58.45  ? 135 MET A C   1 
ATOM   929  O O   . MET A 1 117 ? 15.117  21.079 -9.461  1.00 60.47  ? 135 MET A O   1 
ATOM   930  C CB  . MET A 1 117 ? 13.981  22.113 -12.035 1.00 40.74  ? 135 MET A CB  1 
ATOM   931  C CG  . MET A 1 117 ? 13.640  21.694 -13.487 1.00 38.09  ? 135 MET A CG  1 
ATOM   932  S SD  . MET A 1 117 ? 13.931  19.923 -13.791 1.00 41.09  ? 135 MET A SD  1 
ATOM   933  C CE  . MET A 1 117 ? 15.679  19.804 -13.416 1.00 46.91  ? 135 MET A CE  1 
ATOM   934  N N   . LYS A 1 118 ? 13.249  22.007 -8.602  1.00 37.48  ? 136 LYS A N   1 
ATOM   935  C CA  . LYS A 1 118 ? 13.801  22.152 -7.245  1.00 41.60  ? 136 LYS A CA  1 
ATOM   936  C C   . LYS A 1 118 ? 13.522  20.928 -6.384  1.00 49.27  ? 136 LYS A C   1 
ATOM   937  O O   . LYS A 1 118 ? 14.322  20.583 -5.520  1.00 37.26  ? 136 LYS A O   1 
ATOM   938  C CB  . LYS A 1 118 ? 13.240  23.379 -6.526  1.00 37.44  ? 136 LYS A CB  1 
ATOM   939  C CG  . LYS A 1 118 ? 13.818  24.710 -6.955  1.00 41.97  ? 136 LYS A CG  1 
ATOM   940  C CD  . LYS A 1 118 ? 12.735  25.778 -6.951  1.00 58.00  ? 136 LYS A CD  1 
ATOM   941  C CE  . LYS A 1 118 ? 11.467  25.248 -7.631  1.00 57.11  ? 136 LYS A CE  1 
ATOM   942  N NZ  . LYS A 1 118 ? 10.831  26.232 -8.551  1.00 44.06  ? 136 LYS A NZ  1 
ATOM   943  N N   . ALA A 1 119 ? 12.381  20.281 -6.608  1.00 41.82  ? 137 ALA A N   1 
ATOM   944  C CA  . ALA A 1 119 ? 12.034  19.083 -5.851  1.00 28.02  ? 137 ALA A CA  1 
ATOM   945  C C   . ALA A 1 119 ? 12.975  17.938 -6.182  1.00 23.85  ? 137 ALA A C   1 
ATOM   946  O O   . ALA A 1 119 ? 13.556  17.881 -7.264  1.00 45.98  ? 137 ALA A O   1 
ATOM   947  C CB  . ALA A 1 119 ? 10.583  18.675 -6.127  1.00 35.46  ? 137 ALA A CB  1 
ATOM   948  N N   . ARG A 1 120 ? 13.103  17.008 -5.252  1.00 52.84  ? 138 ARG A N   1 
ATOM   949  C CA  . ARG A 1 120 ? 13.969  15.856 -5.456  1.00 62.58  ? 138 ARG A CA  1 
ATOM   950  C C   . ARG A 1 120 ? 13.310  14.826 -6.366  1.00 50.77  ? 138 ARG A C   1 
ATOM   951  O O   . ARG A 1 120 ? 12.113  14.572 -6.262  1.00 57.07  ? 138 ARG A O   1 
ATOM   952  C CB  . ARG A 1 120 ? 14.325  15.225 -4.108  1.00 53.34  ? 138 ARG A CB  1 
ATOM   953  C CG  . ARG A 1 120 ? 15.047  16.180 -3.178  1.00 75.06  ? 138 ARG A CG  1 
ATOM   954  C CD  . ARG A 1 120 ? 15.161  15.623 -1.777  1.00 93.89  ? 138 ARG A CD  1 
ATOM   955  N NE  . ARG A 1 120 ? 16.259  16.245 -1.044  1.00 77.74  ? 138 ARG A NE  1 
ATOM   956  C CZ  . ARG A 1 120 ? 17.533  15.895 -1.187  1.00 92.38  ? 138 ARG A CZ  1 
ATOM   957  N NH1 . ARG A 1 120 ? 17.870  14.933 -2.046  1.00 53.71  ? 138 ARG A NH1 1 
ATOM   958  N NH2 . ARG A 1 120 ? 18.470  16.511 -0.474  1.00 94.20  ? 138 ARG A NH2 1 
ATOM   959  N N   . THR A 1 121 ? 14.094  14.246 -7.266  1.00 45.35  ? 139 THR A N   1 
ATOM   960  C CA  . THR A 1 121 ? 13.633  13.119 -8.063  1.00 45.23  ? 139 THR A CA  1 
ATOM   961  C C   . THR A 1 121 ? 13.071  12.036 -7.149  1.00 46.84  ? 139 THR A C   1 
ATOM   962  O O   . THR A 1 121 ? 13.454  11.927 -5.986  1.00 47.21  ? 139 THR A O   1 
ATOM   963  C CB  . THR A 1 121 ? 14.781  12.507 -8.893  1.00 44.04  ? 139 THR A CB  1 
ATOM   964  O OG1 . THR A 1 121 ? 15.809  12.032 -8.010  1.00 56.69  ? 139 THR A OG1 1 
ATOM   965  C CG2 . THR A 1 121 ? 15.366  13.537 -9.857  1.00 35.96  ? 139 THR A CG2 1 
ATOM   966  N N   . ARG A 1 122 ? 12.159  11.234 -7.675  1.00 41.23  ? 140 ARG A N   1 
ATOM   967  C CA  . ARG A 1 122 ? 11.645  10.110 -6.912  1.00 46.73  ? 140 ARG A CA  1 
ATOM   968  C C   . ARG A 1 122 ? 11.373  8.931  -7.840  1.00 55.75  ? 140 ARG A C   1 
ATOM   969  O O   . ARG A 1 122 ? 11.491  9.051  -9.062  1.00 38.42  ? 140 ARG A O   1 
ATOM   970  C CB  . ARG A 1 122 ? 10.394  10.506 -6.126  1.00 39.59  ? 140 ARG A CB  1 
ATOM   971  C CG  . ARG A 1 122 ? 9.189   10.903 -6.979  1.00 43.22  ? 140 ARG A CG  1 
ATOM   972  C CD  . ARG A 1 122 ? 9.416   12.177 -7.783  1.00 31.05  ? 140 ARG A CD  1 
ATOM   973  N NE  . ARG A 1 122 ? 9.772   13.337 -6.968  1.00 42.12  ? 140 ARG A NE  1 
ATOM   974  C CZ  . ARG A 1 122 ? 8.922   14.025 -6.206  1.00 35.91  ? 140 ARG A CZ  1 
ATOM   975  N NH1 . ARG A 1 122 ? 7.655   13.667 -6.125  1.00 31.51  ? 140 ARG A NH1 1 
ATOM   976  N NH2 . ARG A 1 122 ? 9.341   15.081 -5.521  1.00 33.93  ? 140 ARG A NH2 1 
ATOM   977  N N   . GLY A 1 123 ? 11.039  7.784  -7.259  1.00 55.19  ? 141 GLY A N   1 
ATOM   978  C CA  . GLY A 1 123 ? 10.757  6.606  -8.058  1.00 57.79  ? 141 GLY A CA  1 
ATOM   979  C C   . GLY A 1 123 ? 9.640   6.888  -9.038  1.00 43.31  ? 141 GLY A C   1 
ATOM   980  O O   . GLY A 1 123 ? 8.880   7.827  -8.848  1.00 48.17  ? 141 GLY A O   1 
ATOM   981  N N   . CYS A 1 124 ? 9.538   6.088  -10.092 1.00 55.33  ? 142 CYS A N   1 
ATOM   982  C CA  . CYS A 1 124 ? 8.417   6.229  -11.010 1.00 49.95  ? 142 CYS A CA  1 
ATOM   983  C C   . CYS A 1 124 ? 7.273   5.328  -10.591 1.00 50.11  ? 142 CYS A C   1 
ATOM   984  O O   . CYS A 1 124 ? 6.116   5.585  -10.921 1.00 61.74  ? 142 CYS A O   1 
ATOM   985  C CB  . CYS A 1 124 ? 8.837   5.956  -12.447 1.00 46.25  ? 142 CYS A CB  1 
ATOM   986  S SG  . CYS A 1 124 ? 9.592   7.383  -13.209 1.00 59.70  ? 142 CYS A SG  1 
ATOM   987  N N   . ASP A 1 125 ? 7.608   4.281  -9.844  1.00 43.50  ? 143 ASP A N   1 
ATOM   988  C CA  . ASP A 1 125 ? 6.611   3.411  -9.231  1.00 61.21  ? 143 ASP A CA  1 
ATOM   989  C C   . ASP A 1 125 ? 6.506   3.695  -7.745  1.00 57.14  ? 143 ASP A C   1 
ATOM   990  O O   . ASP A 1 125 ? 7.514   3.855  -7.057  1.00 52.33  ? 143 ASP A O   1 
ATOM   991  C CB  . ASP A 1 125 ? 6.988   1.937  -9.407  1.00 79.39  ? 143 ASP A CB  1 
ATOM   992  C CG  . ASP A 1 125 ? 7.019   1.508  -10.855 1.00 86.38  ? 143 ASP A CG  1 
ATOM   993  O OD1 . ASP A 1 125 ? 8.020   0.880  -11.266 1.00 105.23 ? 143 ASP A OD1 1 
ATOM   994  O OD2 . ASP A 1 125 ? 6.045   1.802  -11.580 1.00 82.30  ? 143 ASP A OD2 1 
ATOM   995  N N   . HIS A 1 126 ? 5.282   3.736  -7.242  1.00 57.02  ? 144 HIS A N   1 
ATOM   996  C CA  . HIS A 1 126 ? 5.080   3.835  -5.812  1.00 44.43  ? 144 HIS A CA  1 
ATOM   997  C C   . HIS A 1 126 ? 5.206   2.459  -5.174  1.00 55.22  ? 144 HIS A C   1 
ATOM   998  O O   . HIS A 1 126 ? 4.698   1.469  -5.700  1.00 54.35  ? 144 HIS A O   1 
ATOM   999  C CB  . HIS A 1 126 ? 3.711   4.420  -5.503  1.00 26.22  ? 144 HIS A CB  1 
ATOM   1000 C CG  . HIS A 1 126 ? 3.514   4.744  -4.057  1.00 52.32  ? 144 HIS A CG  1 
ATOM   1001 N ND1 . HIS A 1 126 ? 3.808   5.983  -3.525  1.00 48.64  ? 144 HIS A ND1 1 
ATOM   1002 C CD2 . HIS A 1 126 ? 3.069   3.986  -3.027  1.00 54.72  ? 144 HIS A CD2 1 
ATOM   1003 C CE1 . HIS A 1 126 ? 3.540   5.976  -2.231  1.00 50.36  ? 144 HIS A CE1 1 
ATOM   1004 N NE2 . HIS A 1 126 ? 3.093   4.776  -1.904  1.00 63.57  ? 144 HIS A NE2 1 
ATOM   1005 N N   . HIS A 1 127 ? 5.894   2.398  -4.042  1.00 61.10  ? 145 HIS A N   1 
ATOM   1006 C CA  . HIS A 1 127 ? 5.959   1.166  -3.270  1.00 67.77  ? 145 HIS A CA  1 
ATOM   1007 C C   . HIS A 1 127 ? 5.334   1.350  -1.896  1.00 61.83  ? 145 HIS A C   1 
ATOM   1008 O O   . HIS A 1 127 ? 5.768   2.195  -1.107  1.00 55.68  ? 145 HIS A O   1 
ATOM   1009 C CB  . HIS A 1 127 ? 7.396   0.647  -3.173  1.00 63.50  ? 145 HIS A CB  1 
ATOM   1010 C CG  . HIS A 1 127 ? 7.858   -0.045 -4.415  1.00 80.92  ? 145 HIS A CG  1 
ATOM   1011 N ND1 . HIS A 1 127 ? 9.006   0.314  -5.087  1.00 71.43  ? 145 HIS A ND1 1 
ATOM   1012 C CD2 . HIS A 1 127 ? 7.306   -1.056 -5.126  1.00 85.05  ? 145 HIS A CD2 1 
ATOM   1013 C CE1 . HIS A 1 127 ? 9.149   -0.456 -6.151  1.00 87.45  ? 145 HIS A CE1 1 
ATOM   1014 N NE2 . HIS A 1 127 ? 8.131   -1.296 -6.198  1.00 89.77  ? 145 HIS A NE2 1 
ATOM   1015 N N   . HIS A 1 128 ? 4.303   0.558  -1.622  1.00 54.61  ? 146 HIS A N   1 
ATOM   1016 C CA  . HIS A 1 128 ? 3.543   0.701  -0.387  1.00 59.14  ? 146 HIS A CA  1 
ATOM   1017 C C   . HIS A 1 128 ? 4.259   0.162  0.846   1.00 50.11  ? 146 HIS A C   1 
ATOM   1018 O O   . HIS A 1 128 ? 4.004   0.611  1.958   1.00 50.01  ? 146 HIS A O   1 
ATOM   1019 C CB  . HIS A 1 128 ? 2.176   0.040  -0.526  1.00 51.21  ? 146 HIS A CB  1 
ATOM   1020 C CG  . HIS A 1 128 ? 1.140   0.928  -1.139  1.00 69.00  ? 146 HIS A CG  1 
ATOM   1021 N ND1 . HIS A 1 128 ? 0.885   0.952  -2.494  1.00 67.77  ? 146 HIS A ND1 1 
ATOM   1022 C CD2 . HIS A 1 128 ? 0.296   1.827  -0.581  1.00 65.28  ? 146 HIS A CD2 1 
ATOM   1023 C CE1 . HIS A 1 128 ? -0.075  1.824  -2.743  1.00 71.39  ? 146 HIS A CE1 1 
ATOM   1024 N NE2 . HIS A 1 128 ? -0.451  2.367  -1.599  1.00 93.48  ? 146 HIS A NE2 1 
ATOM   1025 N N   . HIS A 1 129 ? 5.152   -0.798 0.651   1.00 47.23  ? 147 HIS A N   1 
ATOM   1026 C CA  . HIS A 1 129 ? 5.822   -1.424 1.776   1.00 54.40  ? 147 HIS A CA  1 
ATOM   1027 C C   . HIS A 1 129 ? 7.313   -1.644 1.545   1.00 63.08  ? 147 HIS A C   1 
ATOM   1028 O O   . HIS A 1 129 ? 7.810   -1.507 0.422   1.00 62.75  ? 147 HIS A O   1 
ATOM   1029 C CB  . HIS A 1 129 ? 5.143   -2.749 2.132   1.00 67.96  ? 147 HIS A CB  1 
ATOM   1030 C CG  . HIS A 1 129 ? 5.325   -3.153 3.564   1.00 83.99  ? 147 HIS A CG  1 
ATOM   1031 N ND1 . HIS A 1 129 ? 4.447   -2.780 4.560   1.00 98.65  ? 147 HIS A ND1 1 
ATOM   1032 C CD2 . HIS A 1 129 ? 6.286   -3.893 4.168   1.00 74.25  ? 147 HIS A CD2 1 
ATOM   1033 C CE1 . HIS A 1 129 ? 4.856   -3.276 5.716   1.00 89.99  ? 147 HIS A CE1 1 
ATOM   1034 N NE2 . HIS A 1 129 ? 5.970   -3.955 5.505   1.00 96.19  ? 147 HIS A NE2 1 
ATOM   1035 N N   . HIS A 1 130 ? 8.010   -1.952 2.637   1.00 66.83  ? 148 HIS A N   1 
ATOM   1036 C CA  . HIS A 1 130 ? 9.399   -2.397 2.621   1.00 78.33  ? 148 HIS A CA  1 
ATOM   1037 C C   . HIS A 1 130 ? 10.046  -2.216 3.989   1.00 68.49  ? 148 HIS A C   1 
ATOM   1038 O O   . HIS A 1 130 ? 10.170  -3.172 4.759   1.00 76.36  ? 148 HIS A O   1 
ATOM   1039 C CB  . HIS A 1 130 ? 10.226  -1.675 1.562   1.00 80.11  ? 148 HIS A CB  1 
ATOM   1040 C CG  . HIS A 1 130 ? 11.434  -2.445 1.134   1.00 113.01 ? 148 HIS A CG  1 
ATOM   1041 N ND1 . HIS A 1 130 ? 11.650  -2.830 -0.171  1.00 118.11 ? 148 HIS A ND1 1 
ATOM   1042 C CD2 . HIS A 1 130 ? 12.476  -2.933 1.848   1.00 127.43 ? 148 HIS A CD2 1 
ATOM   1043 C CE1 . HIS A 1 130 ? 12.783  -3.505 -0.247  1.00 136.41 ? 148 HIS A CE1 1 
ATOM   1044 N NE2 . HIS A 1 130 ? 13.303  -3.583 0.965   1.00 143.33 ? 148 HIS A NE2 1 
ATOM   1045 N N   . VAL B 1 3   ? -20.975 38.038 11.696  1.00 57.36  ? 21  VAL B N   1 
ATOM   1046 C CA  . VAL B 1 3   ? -20.010 37.744 10.638  1.00 67.87  ? 21  VAL B CA  1 
ATOM   1047 C C   . VAL B 1 3   ? -18.971 36.663 10.989  1.00 68.30  ? 21  VAL B C   1 
ATOM   1048 O O   . VAL B 1 3   ? -18.780 36.283 12.156  1.00 54.69  ? 21  VAL B O   1 
ATOM   1049 C CB  . VAL B 1 3   ? -19.292 39.022 10.134  1.00 67.96  ? 21  VAL B CB  1 
ATOM   1050 C CG1 . VAL B 1 3   ? -20.108 39.702 9.030   1.00 77.93  ? 21  VAL B CG1 1 
ATOM   1051 C CG2 . VAL B 1 3   ? -19.026 39.976 11.278  1.00 44.71  ? 21  VAL B CG2 1 
ATOM   1052 N N   . CYS B 1 4   ? -18.309 36.166 9.949   1.00 56.93  ? 22  CYS B N   1 
ATOM   1053 C CA  . CYS B 1 4   ? -17.358 35.077 10.084  1.00 53.04  ? 22  CYS B CA  1 
ATOM   1054 C C   . CYS B 1 4   ? -16.003 35.442 9.517   1.00 52.30  ? 22  CYS B C   1 
ATOM   1055 O O   . CYS B 1 4   ? -15.823 36.472 8.864   1.00 39.86  ? 22  CYS B O   1 
ATOM   1056 C CB  . CYS B 1 4   ? -17.854 33.831 9.345   1.00 51.50  ? 22  CYS B CB  1 
ATOM   1057 S SG  . CYS B 1 4   ? -19.142 32.882 10.168  1.00 57.52  ? 22  CYS B SG  1 
ATOM   1058 N N   . ARG B 1 5   ? -15.043 34.568 9.756   1.00 45.86  ? 23  ARG B N   1 
ATOM   1059 C CA  . ARG B 1 5   ? -13.784 34.675 9.072   1.00 64.07  ? 23  ARG B CA  1 
ATOM   1060 C C   . ARG B 1 5   ? -13.393 33.317 8.534   1.00 55.60  ? 23  ARG B C   1 
ATOM   1061 O O   . ARG B 1 5   ? -14.178 32.366 8.523   1.00 31.15  ? 23  ARG B O   1 
ATOM   1062 C CB  . ARG B 1 5   ? -12.710 35.178 10.027  1.00 50.50  ? 23  ARG B CB  1 
ATOM   1063 C CG  . ARG B 1 5   ? -13.074 36.455 10.717  1.00 57.25  ? 23  ARG B CG  1 
ATOM   1064 C CD  . ARG B 1 5   ? -11.946 36.891 11.610  1.00 74.81  ? 23  ARG B CD  1 
ATOM   1065 N NE  . ARG B 1 5   ? -10.999 37.737 10.905  1.00 80.35  ? 23  ARG B NE  1 
ATOM   1066 C CZ  . ARG B 1 5   ? -11.043 39.059 10.939  1.00 69.04  ? 23  ARG B CZ  1 
ATOM   1067 N NH1 . ARG B 1 5   ? -11.987 39.660 11.649  1.00 78.25  ? 23  ARG B NH1 1 
ATOM   1068 N NH2 . ARG B 1 5   ? -10.150 39.773 10.273  1.00 80.79  ? 23  ARG B NH2 1 
ATOM   1069 N N   . GLU B 1 6   ? -12.154 33.237 8.091   1.00 34.16  ? 24  GLU B N   1 
ATOM   1070 C CA  . GLU B 1 6   ? -11.600 31.966 7.735   1.00 44.42  ? 24  GLU B CA  1 
ATOM   1071 C C   . GLU B 1 6   ? -10.739 31.510 8.888   1.00 39.29  ? 24  GLU B C   1 
ATOM   1072 O O   . GLU B 1 6   ? -10.087 32.315 9.542   1.00 39.71  ? 24  GLU B O   1 
ATOM   1073 C CB  . GLU B 1 6   ? -10.788 32.097 6.449   1.00 50.51  ? 24  GLU B CB  1 
ATOM   1074 C CG  . GLU B 1 6   ? -9.775  31.010 6.223   1.00 32.48  ? 24  GLU B CG  1 
ATOM   1075 C CD  . GLU B 1 6   ? -8.750  31.438 5.213   1.00 47.23  ? 24  GLU B CD  1 
ATOM   1076 O OE1 . GLU B 1 6   ? -9.143  31.663 4.047   1.00 39.32  ? 24  GLU B OE1 1 
ATOM   1077 O OE2 . GLU B 1 6   ? -7.563  31.567 5.588   1.00 40.86  ? 24  GLU B OE2 1 
ATOM   1078 N N   . ALA B 1 7   ? -10.749 30.210 9.132   1.00 33.36  ? 25  ALA B N   1 
ATOM   1079 C CA  . ALA B 1 7   ? -10.008 29.637 10.226  1.00 39.26  ? 25  ALA B CA  1 
ATOM   1080 C C   . ALA B 1 7   ? -9.450  28.318 9.749   1.00 38.00  ? 25  ALA B C   1 
ATOM   1081 O O   . ALA B 1 7   ? -9.981  27.724 8.817   1.00 35.75  ? 25  ALA B O   1 
ATOM   1082 C CB  . ALA B 1 7   ? -10.925 29.429 11.443  1.00 37.35  ? 25  ALA B CB  1 
ATOM   1083 N N   . SER B 1 8   ? -8.393  27.859 10.409  1.00 27.33  ? 26  SER B N   1 
ATOM   1084 C CA  . SER B 1 8   ? -7.712  26.648 10.009  1.00 42.19  ? 26  SER B CA  1 
ATOM   1085 C C   . SER B 1 8   ? -7.313  25.841 11.206  1.00 46.55  ? 26  SER B C   1 
ATOM   1086 O O   . SER B 1 8   ? -6.928  26.389 12.241  1.00 57.07  ? 26  SER B O   1 
ATOM   1087 C CB  . SER B 1 8   ? -6.464  26.982 9.200   1.00 32.53  ? 26  SER B CB  1 
ATOM   1088 O OG  . SER B 1 8   ? -6.844  27.449 7.918   1.00 48.95  ? 26  SER B OG  1 
ATOM   1089 N N   . ILE B 1 9   ? -7.387  24.527 11.066  1.00 32.08  ? 27  ILE B N   1 
ATOM   1090 C CA  . ILE B 1 9   ? -6.888  23.675 12.123  1.00 48.97  ? 27  ILE B CA  1 
ATOM   1091 C C   . ILE B 1 9   ? -5.999  22.591 11.542  1.00 47.46  ? 27  ILE B C   1 
ATOM   1092 O O   . ILE B 1 9   ? -6.352  21.964 10.547  1.00 47.11  ? 27  ILE B O   1 
ATOM   1093 C CB  . ILE B 1 9   ? -8.029  23.074 12.953  1.00 40.15  ? 27  ILE B CB  1 
ATOM   1094 C CG1 . ILE B 1 9   ? -7.455  22.225 14.084  1.00 35.42  ? 27  ILE B CG1 1 
ATOM   1095 C CG2 . ILE B 1 9   ? -8.961  22.259 12.064  1.00 34.17  ? 27  ILE B CG2 1 
ATOM   1096 C CD1 . ILE B 1 9   ? -8.518  21.689 15.008  1.00 35.75  ? 27  ILE B CD1 1 
ATOM   1097 N N   . SER B 1 10  ? -4.838  22.392 12.161  1.00 37.42  ? 28  SER B N   1 
ATOM   1098 C CA  . SER B 1 10  ? -3.905  21.357 11.737  1.00 34.79  ? 28  SER B CA  1 
ATOM   1099 C C   . SER B 1 10  ? -3.807  20.193 12.732  1.00 39.61  ? 28  SER B C   1 
ATOM   1100 O O   . SER B 1 10  ? -3.944  20.384 13.929  1.00 41.90  ? 28  SER B O   1 
ATOM   1101 C CB  . SER B 1 10  ? -2.522  21.962 11.485  1.00 26.23  ? 28  SER B CB  1 
ATOM   1102 O OG  . SER B 1 10  ? -2.592  22.957 10.473  1.00 40.08  ? 28  SER B OG  1 
ATOM   1103 N N   . GLY B 1 11  ? -3.559  18.994 12.215  1.00 42.08  ? 29  GLY B N   1 
ATOM   1104 C CA  . GLY B 1 11  ? -3.387  17.806 13.027  1.00 42.98  ? 29  GLY B CA  1 
ATOM   1105 C C   . GLY B 1 11  ? -2.465  16.820 12.336  1.00 48.41  ? 29  GLY B C   1 
ATOM   1106 O O   . GLY B 1 11  ? -2.256  16.897 11.130  1.00 49.02  ? 29  GLY B O   1 
ATOM   1107 N N   . GLU B 1 12  ? -1.902  15.893 13.100  1.00 50.67  ? 30  GLU B N   1 
ATOM   1108 C CA  . GLU B 1 12  ? -0.915  14.967 12.559  1.00 40.62  ? 30  GLU B CA  1 
ATOM   1109 C C   . GLU B 1 12  ? -1.505  13.584 12.320  1.00 39.55  ? 30  GLU B C   1 
ATOM   1110 O O   . GLU B 1 12  ? -2.425  13.141 13.010  1.00 43.10  ? 30  GLU B O   1 
ATOM   1111 C CB  . GLU B 1 12  ? 0.307   14.875 13.482  1.00 45.77  ? 30  GLU B CB  1 
ATOM   1112 C CG  . GLU B 1 12  ? 1.455   14.044 12.936  1.00 40.70  ? 30  GLU B CG  1 
ATOM   1113 C CD  . GLU B 1 12  ? 2.717   14.205 13.758  1.00 50.77  ? 30  GLU B CD  1 
ATOM   1114 O OE1 . GLU B 1 12  ? 2.991   13.329 14.603  1.00 66.24  ? 30  GLU B OE1 1 
ATOM   1115 O OE2 . GLU B 1 12  ? 3.429   15.214 13.576  1.00 41.22  ? 30  GLU B OE2 1 
ATOM   1116 N N   . ILE B 1 13  ? -0.963  12.911 11.319  1.00 40.54  ? 31  ILE B N   1 
ATOM   1117 C CA  . ILE B 1 13  ? -1.372  11.564 10.978  1.00 37.63  ? 31  ILE B CA  1 
ATOM   1118 C C   . ILE B 1 13  ? -0.137  10.788 10.580  1.00 42.33  ? 31  ILE B C   1 
ATOM   1119 O O   . ILE B 1 13  ? 0.666   11.246 9.753   1.00 41.29  ? 31  ILE B O   1 
ATOM   1120 C CB  . ILE B 1 13  ? -2.368  11.545 9.807   1.00 34.99  ? 31  ILE B CB  1 
ATOM   1121 C CG1 . ILE B 1 13  ? -3.739  12.057 10.261  1.00 41.95  ? 31  ILE B CG1 1 
ATOM   1122 C CG2 . ILE B 1 13  ? -2.474  10.151 9.255   1.00 33.07  ? 31  ILE B CG2 1 
ATOM   1123 C CD1 . ILE B 1 13  ? -4.773  12.146 9.155   1.00 43.41  ? 31  ILE B CD1 1 
ATOM   1124 N N   . ARG B 1 14  ? 0.025   9.613  11.174  1.00 52.36  ? 32  ARG B N   1 
ATOM   1125 C CA  . ARG B 1 14  ? 1.189   8.794  10.886  1.00 46.35  ? 32  ARG B CA  1 
ATOM   1126 C C   . ARG B 1 14  ? 0.808   7.468  10.246  1.00 48.79  ? 32  ARG B C   1 
ATOM   1127 O O   . ARG B 1 14  ? -0.373  7.125  10.171  1.00 51.38  ? 32  ARG B O   1 
ATOM   1128 C CB  . ARG B 1 14  ? 2.040   8.621  12.136  1.00 53.14  ? 32  ARG B CB  1 
ATOM   1129 C CG  . ARG B 1 14  ? 3.079   9.731  12.273  1.00 64.99  ? 32  ARG B CG  1 
ATOM   1130 C CD  . ARG B 1 14  ? 2.989   10.438 13.617  1.00 74.64  ? 32  ARG B CD  1 
ATOM   1131 N NE  . ARG B 1 14  ? 3.017   9.505  14.739  1.00 80.62  ? 32  ARG B NE  1 
ATOM   1132 C CZ  . ARG B 1 14  ? 2.628   9.809  15.972  1.00 77.42  ? 32  ARG B CZ  1 
ATOM   1133 N NH1 . ARG B 1 14  ? 2.174   11.028 16.244  1.00 61.23  ? 32  ARG B NH1 1 
ATOM   1134 N NH2 . ARG B 1 14  ? 2.689   8.893  16.929  1.00 73.65  ? 32  ARG B NH2 1 
ATOM   1135 N N   . TYR B 1 15  ? 1.805   6.753  9.737   1.00 40.63  ? 33  TYR B N   1 
ATOM   1136 C CA  . TYR B 1 15  ? 1.547   5.484  9.082   1.00 49.81  ? 33  TYR B CA  1 
ATOM   1137 C C   . TYR B 1 15  ? 2.422   4.378  9.660   1.00 49.90  ? 33  TYR B C   1 
ATOM   1138 O O   . TYR B 1 15  ? 3.485   4.655  10.210  1.00 50.52  ? 33  TYR B O   1 
ATOM   1139 C CB  . TYR B 1 15  ? 1.676   5.624  7.556   1.00 31.11  ? 33  TYR B CB  1 
ATOM   1140 C CG  . TYR B 1 15  ? 0.596   6.527  7.014   1.00 47.29  ? 33  TYR B CG  1 
ATOM   1141 C CD1 . TYR B 1 15  ? -0.603  6.011  6.534   1.00 39.52  ? 33  TYR B CD1 1 
ATOM   1142 C CD2 . TYR B 1 15  ? 0.750   7.906  7.036   1.00 54.69  ? 33  TYR B CD2 1 
ATOM   1143 C CE1 . TYR B 1 15  ? -1.614  6.853  6.064   1.00 32.45  ? 33  TYR B CE1 1 
ATOM   1144 C CE2 . TYR B 1 15  ? -0.254  8.755  6.571   1.00 30.63  ? 33  TYR B CE2 1 
ATOM   1145 C CZ  . TYR B 1 15  ? -1.430  8.228  6.095   1.00 45.30  ? 33  TYR B CZ  1 
ATOM   1146 O OH  . TYR B 1 15  ? -2.411  9.091  5.653   1.00 41.38  ? 33  TYR B OH  1 
ATOM   1147 N N   . PRO B 1 16  ? 1.945   3.126  9.570   1.00 45.39  ? 34  PRO B N   1 
ATOM   1148 C CA  . PRO B 1 16  ? 2.667   1.955  10.066  1.00 37.61  ? 34  PRO B CA  1 
ATOM   1149 C C   . PRO B 1 16  ? 4.090   1.945  9.562   1.00 47.62  ? 34  PRO B C   1 
ATOM   1150 O O   . PRO B 1 16  ? 4.343   2.270  8.401   1.00 43.73  ? 34  PRO B O   1 
ATOM   1151 C CB  . PRO B 1 16  ? 1.902   0.788  9.438   1.00 56.61  ? 34  PRO B CB  1 
ATOM   1152 C CG  . PRO B 1 16  ? 0.526   1.297  9.261   1.00 42.41  ? 34  PRO B CG  1 
ATOM   1153 C CD  . PRO B 1 16  ? 0.647   2.763  8.971   1.00 38.28  ? 34  PRO B CD  1 
ATOM   1154 N N   . GLN B 1 17  ? 5.018   1.570  10.430  1.00 36.92  ? 35  GLN B N   1 
ATOM   1155 C CA  . GLN B 1 17  ? 6.405   1.478  10.015  1.00 53.37  ? 35  GLN B CA  1 
ATOM   1156 C C   . GLN B 1 17  ? 6.521   0.671  8.710   1.00 50.12  ? 35  GLN B C   1 
ATOM   1157 O O   . GLN B 1 17  ? 5.779   -0.286 8.484   1.00 41.45  ? 35  GLN B O   1 
ATOM   1158 C CB  . GLN B 1 17  ? 7.239   0.850  11.132  1.00 36.94  ? 35  GLN B CB  1 
ATOM   1159 C CG  . GLN B 1 17  ? 6.707   -0.492 11.598  1.00 35.84  ? 35  GLN B CG  1 
ATOM   1160 C CD  . GLN B 1 17  ? 7.124   -0.846 13.024  1.00 64.54  ? 35  GLN B CD  1 
ATOM   1161 O OE1 . GLN B 1 17  ? 7.909   -1.770 13.240  1.00 42.50  ? 35  GLN B OE1 1 
ATOM   1162 N NE2 . GLN B 1 17  ? 6.590   -0.116 14.003  1.00 50.07  ? 35  GLN B NE2 1 
ATOM   1163 N N   . GLY B 1 18  ? 7.449   1.070  7.849   1.00 47.52  ? 36  GLY B N   1 
ATOM   1164 C CA  . GLY B 1 18  ? 7.727   0.327  6.629   1.00 49.29  ? 36  GLY B CA  1 
ATOM   1165 C C   . GLY B 1 18  ? 6.798   0.659  5.477   1.00 52.02  ? 36  GLY B C   1 
ATOM   1166 O O   . GLY B 1 18  ? 7.125   0.414  4.310   1.00 63.32  ? 36  GLY B O   1 
ATOM   1167 N N   . THR B 1 19  ? 5.643   1.227  5.810   1.00 34.27  ? 37  THR B N   1 
ATOM   1168 C CA  . THR B 1 19  ? 4.645   1.588  4.822   1.00 38.54  ? 37  THR B CA  1 
ATOM   1169 C C   . THR B 1 19  ? 4.927   2.960  4.237   1.00 48.09  ? 37  THR B C   1 
ATOM   1170 O O   . THR B 1 19  ? 5.663   3.749  4.818   1.00 44.07  ? 37  THR B O   1 
ATOM   1171 C CB  . THR B 1 19  ? 3.222   1.564  5.409   1.00 41.51  ? 37  THR B CB  1 
ATOM   1172 O OG1 . THR B 1 19  ? 3.061   2.645  6.333   1.00 60.24  ? 37  THR B OG1 1 
ATOM   1173 C CG2 . THR B 1 19  ? 2.957   0.235  6.117   1.00 56.23  ? 37  THR B CG2 1 
ATOM   1174 N N   . CYS B 1 20  ? 4.338   3.224  3.074   1.00 56.73  ? 38  CYS B N   1 
ATOM   1175 C CA  . CYS B 1 20  ? 4.479   4.503  2.387   1.00 43.90  ? 38  CYS B CA  1 
ATOM   1176 C C   . CYS B 1 20  ? 3.202   4.830  1.635   1.00 38.43  ? 38  CYS B C   1 
ATOM   1177 O O   . CYS B 1 20  ? 2.919   4.233  0.601   1.00 59.74  ? 38  CYS B O   1 
ATOM   1178 C CB  . CYS B 1 20  ? 5.646   4.457  1.410   1.00 30.13  ? 38  CYS B CB  1 
ATOM   1179 S SG  . CYS B 1 20  ? 5.784   5.926  0.364   1.00 48.14  ? 38  CYS B SG  1 
ATOM   1180 N N   . PRO B 1 21  ? 2.431   5.791  2.147   1.00 34.99  ? 39  PRO B N   1 
ATOM   1181 C CA  . PRO B 1 21  ? 1.147   6.135  1.545   1.00 37.51  ? 39  PRO B CA  1 
ATOM   1182 C C   . PRO B 1 21  ? 1.434   6.939  0.299   1.00 45.13  ? 39  PRO B C   1 
ATOM   1183 O O   . PRO B 1 21  ? 2.511   7.531  0.219   1.00 36.26  ? 39  PRO B O   1 
ATOM   1184 C CB  . PRO B 1 21  ? 0.514   7.067  2.580   1.00 29.62  ? 39  PRO B CB  1 
ATOM   1185 C CG  . PRO B 1 21  ? 1.637   7.502  3.484   1.00 34.93  ? 39  PRO B CG  1 
ATOM   1186 C CD  . PRO B 1 21  ? 2.913   6.858  3.029   1.00 36.23  ? 39  PRO B CD  1 
ATOM   1187 N N   . THR B 1 22  ? 0.514   6.967  -0.657  1.00 38.89  ? 40  THR B N   1 
ATOM   1188 C CA  . THR B 1 22  ? 0.660   7.899  -1.771  1.00 43.88  ? 40  THR B CA  1 
ATOM   1189 C C   . THR B 1 22  ? 0.131   9.244  -1.293  1.00 38.57  ? 40  THR B C   1 
ATOM   1190 O O   . THR B 1 22  ? -0.591  9.320  -0.285  1.00 29.52  ? 40  THR B O   1 
ATOM   1191 C CB  . THR B 1 22  ? -0.142  7.461  -3.005  1.00 39.15  ? 40  THR B CB  1 
ATOM   1192 O OG1 . THR B 1 22  ? -1.529  7.382  -2.653  1.00 34.87  ? 40  THR B OG1 1 
ATOM   1193 C CG2 . THR B 1 22  ? 0.361   6.086  -3.560  1.00 23.89  ? 40  THR B CG2 1 
ATOM   1194 N N   . LYS B 1 23  ? 0.475   10.306 -2.006  1.00 28.66  ? 41  LYS B N   1 
ATOM   1195 C CA  . LYS B 1 23  ? -0.048  11.614 -1.648  1.00 31.25  ? 41  LYS B CA  1 
ATOM   1196 C C   . LYS B 1 23  ? -1.559  11.541 -1.631  1.00 36.58  ? 41  LYS B C   1 
ATOM   1197 O O   . LYS B 1 23  ? -2.216  12.176 -0.807  1.00 44.09  ? 41  LYS B O   1 
ATOM   1198 C CB  . LYS B 1 23  ? 0.428   12.680 -2.631  1.00 23.10  ? 41  LYS B CB  1 
ATOM   1199 C CG  . LYS B 1 23  ? 1.941   12.738 -2.770  1.00 25.33  ? 41  LYS B CG  1 
ATOM   1200 C CD  . LYS B 1 23  ? 2.594   13.027 -1.440  1.00 43.37  ? 41  LYS B CD  1 
ATOM   1201 C CE  . LYS B 1 23  ? 4.108   12.851 -1.501  1.00 34.37  ? 41  LYS B CE  1 
ATOM   1202 N NZ  . LYS B 1 23  ? 4.763   13.270 -0.222  1.00 37.05  ? 41  LYS B NZ  1 
ATOM   1203 N N   . THR B 1 24  ? -2.104  10.727 -2.529  1.00 30.28  ? 42  THR B N   1 
ATOM   1204 C CA  . THR B 1 24  ? -3.543  10.643 -2.723  1.00 29.77  ? 42  THR B CA  1 
ATOM   1205 C C   . THR B 1 24  ? -4.225  10.006 -1.535  1.00 18.91  ? 42  THR B C   1 
ATOM   1206 O O   . THR B 1 24  ? -5.233  10.498 -1.052  1.00 35.84  ? 42  THR B O   1 
ATOM   1207 C CB  . THR B 1 24  ? -3.889  9.851  -4.007  1.00 40.86  ? 42  THR B CB  1 
ATOM   1208 O OG1 . THR B 1 24  ? -3.461  10.599 -5.142  1.00 39.06  ? 42  THR B OG1 1 
ATOM   1209 C CG2 . THR B 1 24  ? -5.384  9.589  -4.124  1.00 24.63  ? 42  THR B CG2 1 
ATOM   1210 N N   . GLU B 1 25  ? -3.687  8.901  -1.056  1.00 31.50  ? 43  GLU B N   1 
ATOM   1211 C CA  . GLU B 1 25  ? -4.312  8.280  0.099   1.00 48.30  ? 43  GLU B CA  1 
ATOM   1212 C C   . GLU B 1 25  ? -4.093  9.126  1.363   1.00 44.15  ? 43  GLU B C   1 
ATOM   1213 O O   . GLU B 1 25  ? -4.918  9.113  2.281   1.00 31.79  ? 43  GLU B O   1 
ATOM   1214 C CB  . GLU B 1 25  ? -3.857  6.827  0.273   1.00 37.18  ? 43  GLU B CB  1 
ATOM   1215 C CG  . GLU B 1 25  ? -2.413  6.584  -0.082  1.00 56.35  ? 43  GLU B CG  1 
ATOM   1216 C CD  . GLU B 1 25  ? -1.876  5.324  0.557   1.00 66.29  ? 43  GLU B CD  1 
ATOM   1217 O OE1 . GLU B 1 25  ? -1.250  4.514  -0.161  1.00 58.03  ? 43  GLU B OE1 1 
ATOM   1218 O OE2 . GLU B 1 25  ? -2.086  5.144  1.780   1.00 54.45  ? 43  GLU B OE2 1 
ATOM   1219 N N   . ALA B 1 26  ? -3.002  9.887  1.401   1.00 28.74  ? 44  ALA B N   1 
ATOM   1220 C CA  . ALA B 1 26  ? -2.795  10.767 2.548   1.00 33.09  ? 44  ALA B CA  1 
ATOM   1221 C C   . ALA B 1 26  ? -3.827  11.883 2.542   1.00 38.60  ? 44  ALA B C   1 
ATOM   1222 O O   . ALA B 1 26  ? -4.405  12.208 3.581   1.00 29.63  ? 44  ALA B O   1 
ATOM   1223 C CB  . ALA B 1 26  ? -1.365  11.325 2.595   1.00 26.32  ? 44  ALA B CB  1 
ATOM   1224 N N   . LEU B 1 27  ? -4.085  12.453 1.367   1.00 36.66  ? 45  LEU B N   1 
ATOM   1225 C CA  . LEU B 1 27  ? -5.100  13.494 1.282   1.00 34.36  ? 45  LEU B CA  1 
ATOM   1226 C C   . LEU B 1 27  ? -6.496  12.930 1.549   1.00 40.85  ? 45  LEU B C   1 
ATOM   1227 O O   . LEU B 1 27  ? -7.335  13.557 2.199   1.00 41.35  ? 45  LEU B O   1 
ATOM   1228 C CB  . LEU B 1 27  ? -5.063  14.177 -0.070  1.00 39.92  ? 45  LEU B CB  1 
ATOM   1229 C CG  . LEU B 1 27  ? -5.943  15.415 -0.201  1.00 40.41  ? 45  LEU B CG  1 
ATOM   1230 C CD1 . LEU B 1 27  ? -5.414  16.495 0.712   1.00 34.90  ? 45  LEU B CD1 1 
ATOM   1231 C CD2 . LEU B 1 27  ? -5.966  15.901 -1.646  1.00 29.37  ? 45  LEU B CD2 1 
ATOM   1232 N N   . ASN B 1 28  ? -6.743  11.730 1.057   1.00 30.96  ? 46  ASN B N   1 
ATOM   1233 C CA  . ASN B 1 28  ? -8.016  11.095 1.312   1.00 35.19  ? 46  ASN B CA  1 
ATOM   1234 C C   . ASN B 1 28  ? -8.273  10.922 2.825   1.00 37.73  ? 46  ASN B C   1 
ATOM   1235 O O   . ASN B 1 28  ? -9.384  11.121 3.323   1.00 30.41  ? 46  ASN B O   1 
ATOM   1236 C CB  . ASN B 1 28  ? -8.063  9.749  0.596   1.00 34.50  ? 46  ASN B CB  1 
ATOM   1237 C CG  . ASN B 1 28  ? -9.409  9.107  0.687   1.00 45.78  ? 46  ASN B CG  1 
ATOM   1238 O OD1 . ASN B 1 28  ? -10.395 9.635  0.167   1.00 50.17  ? 46  ASN B OD1 1 
ATOM   1239 N ND2 . ASN B 1 28  ? -9.476  7.972  1.369   1.00 48.20  ? 46  ASN B ND2 1 
ATOM   1240 N N   . ASP B 1 29  ? -7.232  10.538 3.551   1.00 36.46  ? 47  ASP B N   1 
ATOM   1241 C CA  . ASP B 1 29  ? -7.329  10.403 4.998   1.00 42.55  ? 47  ASP B CA  1 
ATOM   1242 C C   . ASP B 1 29  ? -7.574  11.755 5.655   1.00 51.04  ? 47  ASP B C   1 
ATOM   1243 O O   . ASP B 1 29  ? -8.438  11.901 6.524   1.00 40.10  ? 47  ASP B O   1 
ATOM   1244 C CB  . ASP B 1 29  ? -6.048  9.795  5.550   1.00 47.00  ? 47  ASP B CB  1 
ATOM   1245 C CG  . ASP B 1 29  ? -5.911  8.342  5.199   1.00 50.96  ? 47  ASP B CG  1 
ATOM   1246 O OD1 . ASP B 1 29  ? -6.957  7.688  4.997   1.00 51.01  ? 47  ASP B OD1 1 
ATOM   1247 O OD2 . ASP B 1 29  ? -4.762  7.858  5.123   1.00 47.83  ? 47  ASP B OD2 1 
ATOM   1248 N N   . CYS B 1 30  ? -6.795  12.742 5.237   1.00 38.69  ? 48  CYS B N   1 
ATOM   1249 C CA  . CYS B 1 30  ? -6.978  14.079 5.738   1.00 26.06  ? 48  CYS B CA  1 
ATOM   1250 C C   . CYS B 1 30  ? -8.408  14.548 5.482   1.00 30.91  ? 48  CYS B C   1 
ATOM   1251 O O   . CYS B 1 30  ? -8.987  15.269 6.293   1.00 35.02  ? 48  CYS B O   1 
ATOM   1252 C CB  . CYS B 1 30  ? -5.943  15.025 5.131   1.00 21.86  ? 48  CYS B CB  1 
ATOM   1253 S SG  . CYS B 1 30  ? -6.158  16.728 5.674   1.00 57.28  ? 48  CYS B SG  1 
ATOM   1254 N N   . ASN B 1 31  ? -8.998  14.111 4.371   1.00 37.26  ? 49  ASN B N   1 
ATOM   1255 C CA  . ASN B 1 31  ? -10.390 14.468 4.072   1.00 37.10  ? 49  ASN B CA  1 
ATOM   1256 C C   . ASN B 1 31  ? -11.389 13.659 4.900   1.00 42.96  ? 49  ASN B C   1 
ATOM   1257 O O   . ASN B 1 31  ? -12.549 14.034 5.020   1.00 34.01  ? 49  ASN B O   1 
ATOM   1258 C CB  . ASN B 1 31  ? -10.697 14.339 2.577   1.00 27.43  ? 49  ASN B CB  1 
ATOM   1259 C CG  . ASN B 1 31  ? -10.198 15.530 1.774   1.00 40.72  ? 49  ASN B CG  1 
ATOM   1260 O OD1 . ASN B 1 31  ? -10.734 16.627 1.880   1.00 53.23  ? 49  ASN B OD1 1 
ATOM   1261 N ND2 . ASN B 1 31  ? -9.178  15.315 0.957   1.00 36.12  ? 49  ASN B ND2 1 
ATOM   1262 N N   . LYS B 1 32  ? -10.933 12.543 5.461   1.00 33.55  ? 50  LYS B N   1 
ATOM   1263 C CA  . LYS B 1 32  ? -11.718 11.836 6.466   1.00 36.20  ? 50  LYS B CA  1 
ATOM   1264 C C   . LYS B 1 32  ? -11.984 12.730 7.691   1.00 51.32  ? 50  LYS B C   1 
ATOM   1265 O O   . LYS B 1 32  ? -13.091 12.714 8.247   1.00 40.33  ? 50  LYS B O   1 
ATOM   1266 C CB  . LYS B 1 32  ? -11.016 10.551 6.896   1.00 47.21  ? 50  LYS B CB  1 
ATOM   1267 C CG  . LYS B 1 32  ? -11.168 9.398  5.920   1.00 56.75  ? 50  LYS B CG  1 
ATOM   1268 C CD  . LYS B 1 32  ? -10.296 8.224  6.326   1.00 49.13  ? 50  LYS B CD  1 
ATOM   1269 C CE  . LYS B 1 32  ? -10.543 7.031  5.430   1.00 63.09  ? 50  LYS B CE  1 
ATOM   1270 N NZ  . LYS B 1 32  ? -9.507  5.990  5.641   1.00 88.34  ? 50  LYS B NZ  1 
ATOM   1271 N N   . VAL B 1 33  ? -10.984 13.516 8.105   1.00 33.70  ? 51  VAL B N   1 
ATOM   1272 C CA  . VAL B 1 33  ? -11.205 14.456 9.208   1.00 51.52  ? 51  VAL B CA  1 
ATOM   1273 C C   . VAL B 1 33  ? -12.010 15.677 8.756   1.00 39.35  ? 51  VAL B C   1 
ATOM   1274 O O   . VAL B 1 33  ? -12.775 16.235 9.535   1.00 46.47  ? 51  VAL B O   1 
ATOM   1275 C CB  . VAL B 1 33  ? -9.901  14.889 9.969   1.00 53.67  ? 51  VAL B CB  1 
ATOM   1276 C CG1 . VAL B 1 33  ? -8.754  13.939 9.697   1.00 23.61  ? 51  VAL B CG1 1 
ATOM   1277 C CG2 . VAL B 1 33  ? -9.518  16.316 9.639   1.00 40.44  ? 51  VAL B CG2 1 
ATOM   1278 N N   . THR B 1 34  ? -11.851 16.076 7.495   1.00 48.97  ? 52  THR B N   1 
ATOM   1279 C CA  . THR B 1 34  ? -12.692 17.127 6.914   1.00 37.77  ? 52  THR B CA  1 
ATOM   1280 C C   . THR B 1 34  ? -14.175 16.835 7.153   1.00 48.94  ? 52  THR B C   1 
ATOM   1281 O O   . THR B 1 34  ? -14.932 17.694 7.620   1.00 41.12  ? 52  THR B O   1 
ATOM   1282 C CB  . THR B 1 34  ? -12.439 17.301 5.387   1.00 40.42  ? 52  THR B CB  1 
ATOM   1283 O OG1 . THR B 1 34  ? -11.076 17.676 5.163   1.00 48.08  ? 52  THR B OG1 1 
ATOM   1284 C CG2 . THR B 1 34  ? -13.350 18.380 4.790   1.00 34.71  ? 52  THR B CG2 1 
ATOM   1285 N N   . LYS B 1 35  ? -14.590 15.617 6.826   1.00 45.82  ? 53  LYS B N   1 
ATOM   1286 C CA  . LYS B 1 35  ? -15.973 15.225 7.023   1.00 51.66  ? 53  LYS B CA  1 
ATOM   1287 C C   . LYS B 1 35  ? -16.379 15.320 8.502   1.00 54.68  ? 53  LYS B C   1 
ATOM   1288 O O   . LYS B 1 35  ? -17.415 15.899 8.845   1.00 50.81  ? 53  LYS B O   1 
ATOM   1289 C CB  . LYS B 1 35  ? -16.201 13.816 6.481   1.00 53.53  ? 53  LYS B CB  1 
ATOM   1290 C CG  . LYS B 1 35  ? -17.534 13.246 6.881   1.00 66.90  ? 53  LYS B CG  1 
ATOM   1291 C CD  . LYS B 1 35  ? -18.083 12.298 5.841   1.00 70.72  ? 53  LYS B CD  1 
ATOM   1292 C CE  . LYS B 1 35  ? -19.555 12.049 6.120   1.00 86.66  ? 53  LYS B CE  1 
ATOM   1293 N NZ  . LYS B 1 35  ? -20.242 13.330 6.475   1.00 48.92  ? 53  LYS B NZ  1 
ATOM   1294 N N   . GLY B 1 36  ? -15.551 14.757 9.373   1.00 47.90  ? 54  GLY B N   1 
ATOM   1295 C CA  . GLY B 1 36  ? -15.777 14.831 10.807  1.00 53.58  ? 54  GLY B CA  1 
ATOM   1296 C C   . GLY B 1 36  ? -16.015 16.236 11.340  1.00 53.09  ? 54  GLY B C   1 
ATOM   1297 O O   . GLY B 1 36  ? -17.020 16.494 12.005  1.00 63.22  ? 54  GLY B O   1 
ATOM   1298 N N   . LEU B 1 37  ? -15.091 17.146 11.052  1.00 42.28  ? 55  LEU B N   1 
ATOM   1299 C CA  . LEU B 1 37  ? -15.219 18.523 11.510  1.00 39.90  ? 55  LEU B CA  1 
ATOM   1300 C C   . LEU B 1 37  ? -16.537 19.147 11.069  1.00 41.98  ? 55  LEU B C   1 
ATOM   1301 O O   . LEU B 1 37  ? -17.147 19.912 11.808  1.00 58.55  ? 55  LEU B O   1 
ATOM   1302 C CB  . LEU B 1 37  ? -14.029 19.361 11.044  1.00 27.25  ? 55  LEU B CB  1 
ATOM   1303 C CG  . LEU B 1 37  ? -12.727 18.881 11.692  1.00 46.15  ? 55  LEU B CG  1 
ATOM   1304 C CD1 . LEU B 1 37  ? -11.539 19.744 11.289  1.00 27.94  ? 55  LEU B CD1 1 
ATOM   1305 C CD2 . LEU B 1 37  ? -12.857 18.827 13.224  1.00 41.47  ? 55  LEU B CD2 1 
ATOM   1306 N N   . ILE B 1 38  ? -16.984 18.807 9.868   1.00 46.83  ? 56  ILE B N   1 
ATOM   1307 C CA  . ILE B 1 38  ? -18.227 19.353 9.345   1.00 45.27  ? 56  ILE B CA  1 
ATOM   1308 C C   . ILE B 1 38  ? -19.435 18.763 10.058  1.00 53.45  ? 56  ILE B C   1 
ATOM   1309 O O   . ILE B 1 38  ? -20.392 19.471 10.371  1.00 49.96  ? 56  ILE B O   1 
ATOM   1310 C CB  . ILE B 1 38  ? -18.378 19.047 7.858   1.00 55.18  ? 56  ILE B CB  1 
ATOM   1311 C CG1 . ILE B 1 38  ? -17.512 19.989 7.025   1.00 47.83  ? 56  ILE B CG1 1 
ATOM   1312 C CG2 . ILE B 1 38  ? -19.836 19.143 7.444   1.00 29.27  ? 56  ILE B CG2 1 
ATOM   1313 C CD1 . ILE B 1 38  ? -17.456 19.587 5.587   1.00 37.01  ? 56  ILE B CD1 1 
ATOM   1314 N N   . ASP B 1 39  ? -19.397 17.456 10.287  1.00 41.72  ? 57  ASP B N   1 
ATOM   1315 C CA  . ASP B 1 39  ? -20.485 16.792 10.982  1.00 43.79  ? 57  ASP B CA  1 
ATOM   1316 C C   . ASP B 1 39  ? -20.549 17.354 12.393  1.00 64.67  ? 57  ASP B C   1 
ATOM   1317 O O   . ASP B 1 39  ? -21.626 17.657 12.914  1.00 57.21  ? 57  ASP B O   1 
ATOM   1318 C CB  . ASP B 1 39  ? -20.281 15.273 11.000  1.00 44.80  ? 57  ASP B CB  1 
ATOM   1319 C CG  . ASP B 1 39  ? -20.655 14.609 9.666   1.00 69.30  ? 57  ASP B CG  1 
ATOM   1320 O OD1 . ASP B 1 39  ? -21.375 15.230 8.840   1.00 43.49  ? 57  ASP B OD1 1 
ATOM   1321 O OD2 . ASP B 1 39  ? -20.236 13.450 9.448   1.00 46.07  ? 57  ASP B OD2 1 
ATOM   1322 N N   . PHE B 1 40  ? -19.380 17.514 13.000  1.00 51.99  ? 58  PHE B N   1 
ATOM   1323 C CA  . PHE B 1 40  ? -19.292 18.093 14.327  1.00 49.98  ? 58  PHE B CA  1 
ATOM   1324 C C   . PHE B 1 40  ? -19.736 19.555 14.346  1.00 55.25  ? 58  PHE B C   1 
ATOM   1325 O O   . PHE B 1 40  ? -20.473 19.964 15.236  1.00 50.43  ? 58  PHE B O   1 
ATOM   1326 C CB  . PHE B 1 40  ? -17.877 17.965 14.873  1.00 57.35  ? 58  PHE B CB  1 
ATOM   1327 C CG  . PHE B 1 40  ? -17.751 18.373 16.306  1.00 56.84  ? 58  PHE B CG  1 
ATOM   1328 C CD1 . PHE B 1 40  ? -17.824 17.432 17.310  1.00 53.74  ? 58  PHE B CD1 1 
ATOM   1329 C CD2 . PHE B 1 40  ? -17.576 19.701 16.650  1.00 55.08  ? 58  PHE B CD2 1 
ATOM   1330 C CE1 . PHE B 1 40  ? -17.713 17.810 18.635  1.00 52.50  ? 58  PHE B CE1 1 
ATOM   1331 C CE2 . PHE B 1 40  ? -17.465 20.079 17.966  1.00 55.36  ? 58  PHE B CE2 1 
ATOM   1332 C CZ  . PHE B 1 40  ? -17.532 19.130 18.959  1.00 53.70  ? 58  PHE B CZ  1 
ATOM   1333 N N   . SER B 1 41  ? -19.283 20.342 13.373  1.00 60.04  ? 59  SER B N   1 
ATOM   1334 C CA  . SER B 1 41  ? -19.738 21.722 13.263  1.00 58.06  ? 59  SER B CA  1 
ATOM   1335 C C   . SER B 1 41  ? -21.236 21.708 13.149  1.00 49.56  ? 59  SER B C   1 
ATOM   1336 O O   . SER B 1 41  ? -21.923 22.572 13.688  1.00 55.24  ? 59  SER B O   1 
ATOM   1337 C CB  . SER B 1 41  ? -19.168 22.414 12.024  1.00 46.05  ? 59  SER B CB  1 
ATOM   1338 O OG  . SER B 1 41  ? -19.692 23.731 11.906  1.00 33.08  ? 59  SER B OG  1 
ATOM   1339 N N   . GLN B 1 42  ? -21.738 20.713 12.433  1.00 41.60  ? 60  GLN B N   1 
ATOM   1340 C CA  . GLN B 1 42  ? -23.167 20.606 12.186  1.00 69.44  ? 60  GLN B CA  1 
ATOM   1341 C C   . GLN B 1 42  ? -23.959 20.409 13.478  1.00 63.50  ? 60  GLN B C   1 
ATOM   1342 O O   . GLN B 1 42  ? -25.010 21.022 13.676  1.00 47.98  ? 60  GLN B O   1 
ATOM   1343 C CB  . GLN B 1 42  ? -23.454 19.456 11.229  1.00 41.89  ? 60  GLN B CB  1 
ATOM   1344 C CG  . GLN B 1 42  ? -24.903 19.390 10.837  1.00 55.09  ? 60  GLN B CG  1 
ATOM   1345 C CD  . GLN B 1 42  ? -25.387 20.686 10.215  1.00 66.84  ? 60  GLN B CD  1 
ATOM   1346 O OE1 . GLN B 1 42  ? -24.792 21.200 9.261   1.00 62.37  ? 60  GLN B OE1 1 
ATOM   1347 N NE2 . GLN B 1 42  ? -26.479 21.217 10.746  1.00 64.42  ? 60  GLN B NE2 1 
ATOM   1348 N N   . SER B 1 43  ? -23.440 19.544 14.346  1.00 70.34  ? 61  SER B N   1 
ATOM   1349 C CA  . SER B 1 43  ? -24.077 19.204 15.611  1.00 49.15  ? 61  SER B CA  1 
ATOM   1350 C C   . SER B 1 43  ? -24.010 20.373 16.562  1.00 55.98  ? 61  SER B C   1 
ATOM   1351 O O   . SER B 1 43  ? -24.740 20.427 17.545  1.00 76.56  ? 61  SER B O   1 
ATOM   1352 C CB  . SER B 1 43  ? -23.364 18.017 16.252  1.00 34.74  ? 61  SER B CB  1 
ATOM   1353 O OG  . SER B 1 43  ? -23.118 17.006 15.292  1.00 85.23  ? 61  SER B OG  1 
ATOM   1354 N N   . HIS B 1 44  ? -23.125 21.313 16.268  1.00 54.11  ? 62  HIS B N   1 
ATOM   1355 C CA  . HIS B 1 44  ? -22.856 22.394 17.197  1.00 50.15  ? 62  HIS B CA  1 
ATOM   1356 C C   . HIS B 1 44  ? -23.130 23.755 16.603  1.00 50.53  ? 62  HIS B C   1 
ATOM   1357 O O   . HIS B 1 44  ? -22.325 24.683 16.753  1.00 44.98  ? 62  HIS B O   1 
ATOM   1358 C CB  . HIS B 1 44  ? -21.429 22.292 17.715  1.00 59.62  ? 62  HIS B CB  1 
ATOM   1359 C CG  . HIS B 1 44  ? -21.166 21.024 18.460  1.00 59.61  ? 62  HIS B CG  1 
ATOM   1360 N ND1 . HIS B 1 44  ? -20.952 19.820 17.825  1.00 53.41  ? 62  HIS B ND1 1 
ATOM   1361 C CD2 . HIS B 1 44  ? -21.114 20.763 19.786  1.00 63.70  ? 62  HIS B CD2 1 
ATOM   1362 C CE1 . HIS B 1 44  ? -20.762 18.876 18.727  1.00 57.63  ? 62  HIS B CE1 1 
ATOM   1363 N NE2 . HIS B 1 44  ? -20.856 19.422 19.926  1.00 58.66  ? 62  HIS B NE2 1 
ATOM   1364 N N   . GLN B 1 45  ? -24.281 23.854 15.939  1.00 43.95  ? 63  GLN B N   1 
ATOM   1365 C CA  . GLN B 1 45  ? -24.777 25.108 15.376  1.00 53.25  ? 63  GLN B CA  1 
ATOM   1366 C C   . GLN B 1 45  ? -23.842 25.726 14.345  1.00 64.53  ? 63  GLN B C   1 
ATOM   1367 O O   . GLN B 1 45  ? -23.730 26.946 14.261  1.00 76.56  ? 63  GLN B O   1 
ATOM   1368 C CB  . GLN B 1 45  ? -25.050 26.122 16.488  1.00 65.42  ? 63  GLN B CB  1 
ATOM   1369 C CG  . GLN B 1 45  ? -25.839 25.561 17.654  1.00 82.90  ? 63  GLN B CG  1 
ATOM   1370 C CD  . GLN B 1 45  ? -25.815 26.477 18.857  1.00 100.54 ? 63  GLN B CD  1 
ATOM   1371 O OE1 . GLN B 1 45  ? -25.092 27.476 18.875  1.00 98.33  ? 63  GLN B OE1 1 
ATOM   1372 N NE2 . GLN B 1 45  ? -26.604 26.143 19.873  1.00 98.81  ? 63  GLN B NE2 1 
ATOM   1373 N N   . ARG B 1 46  ? -23.174 24.890 13.559  1.00 61.97  ? 64  ARG B N   1 
ATOM   1374 C CA  . ARG B 1 46  ? -22.301 25.384 12.504  1.00 64.27  ? 64  ARG B CA  1 
ATOM   1375 C C   . ARG B 1 46  ? -21.383 26.499 13.020  1.00 62.26  ? 64  ARG B C   1 
ATOM   1376 O O   . ARG B 1 46  ? -21.194 27.537 12.376  1.00 44.04  ? 64  ARG B O   1 
ATOM   1377 C CB  . ARG B 1 46  ? -23.144 25.855 11.318  1.00 57.90  ? 64  ARG B CB  1 
ATOM   1378 C CG  . ARG B 1 46  ? -24.481 25.148 11.242  1.00 60.32  ? 64  ARG B CG  1 
ATOM   1379 C CD  . ARG B 1 46  ? -24.776 24.578 9.861   1.00 65.72  ? 64  ARG B CD  1 
ATOM   1380 N NE  . ARG B 1 46  ? -25.259 25.579 8.915   1.00 68.42  ? 64  ARG B NE  1 
ATOM   1381 C CZ  . ARG B 1 46  ? -25.793 25.295 7.726   1.00 95.60  ? 64  ARG B CZ  1 
ATOM   1382 N NH1 . ARG B 1 46  ? -25.929 24.029 7.328   1.00 59.37  ? 64  ARG B NH1 1 
ATOM   1383 N NH2 . ARG B 1 46  ? -26.197 26.280 6.931   1.00 77.17  ? 64  ARG B NH2 1 
ATOM   1384 N N   . ALA B 1 47  ? -20.823 26.280 14.203  1.00 50.45  ? 65  ALA B N   1 
ATOM   1385 C CA  . ALA B 1 47  ? -19.848 27.213 14.740  1.00 53.50  ? 65  ALA B CA  1 
ATOM   1386 C C   . ALA B 1 47  ? -18.739 27.369 13.717  1.00 49.02  ? 65  ALA B C   1 
ATOM   1387 O O   . ALA B 1 47  ? -18.250 28.465 13.482  1.00 48.86  ? 65  ALA B O   1 
ATOM   1388 C CB  . ALA B 1 47  ? -19.288 26.706 16.051  1.00 52.88  ? 65  ALA B CB  1 
ATOM   1389 N N   . TRP B 1 48  ? -18.357 26.262 13.097  1.00 46.61  ? 66  TRP B N   1 
ATOM   1390 C CA  . TRP B 1 48  ? -17.287 26.296 12.123  1.00 43.62  ? 66  TRP B CA  1 
ATOM   1391 C C   . TRP B 1 48  ? -17.809 26.357 10.700  1.00 47.72  ? 66  TRP B C   1 
ATOM   1392 O O   . TRP B 1 48  ? -17.055 26.161 9.759   1.00 51.03  ? 66  TRP B O   1 
ATOM   1393 C CB  . TRP B 1 48  ? -16.423 25.055 12.255  1.00 49.82  ? 66  TRP B CB  1 
ATOM   1394 C CG  . TRP B 1 48  ? -15.963 24.760 13.628  1.00 53.13  ? 66  TRP B CG  1 
ATOM   1395 C CD1 . TRP B 1 48  ? -15.698 25.654 14.623  1.00 42.44  ? 66  TRP B CD1 1 
ATOM   1396 C CD2 . TRP B 1 48  ? -15.668 23.468 14.158  1.00 51.62  ? 66  TRP B CD2 1 
ATOM   1397 N NE1 . TRP B 1 48  ? -15.270 24.995 15.747  1.00 47.53  ? 66  TRP B NE1 1 
ATOM   1398 C CE2 . TRP B 1 48  ? -15.243 23.650 15.488  1.00 45.01  ? 66  TRP B CE2 1 
ATOM   1399 C CE3 . TRP B 1 48  ? -15.730 22.171 13.637  1.00 42.39  ? 66  TRP B CE3 1 
ATOM   1400 C CZ2 . TRP B 1 48  ? -14.879 22.587 16.303  1.00 39.98  ? 66  TRP B CZ2 1 
ATOM   1401 C CZ3 . TRP B 1 48  ? -15.369 21.114 14.449  1.00 41.64  ? 66  TRP B CZ3 1 
ATOM   1402 C CH2 . TRP B 1 48  ? -14.948 21.329 15.767  1.00 49.18  ? 66  TRP B CH2 1 
ATOM   1403 N N   . GLY B 1 49  ? -19.098 26.601 10.534  1.00 36.63  ? 67  GLY B N   1 
ATOM   1404 C CA  . GLY B 1 49  ? -19.669 26.593 9.205   1.00 34.61  ? 67  GLY B CA  1 
ATOM   1405 C C   . GLY B 1 49  ? -19.622 25.190 8.634   1.00 49.98  ? 67  GLY B C   1 
ATOM   1406 O O   . GLY B 1 49  ? -19.413 24.226 9.370   1.00 41.23  ? 67  GLY B O   1 
ATOM   1407 N N   . ILE B 1 50  ? -19.817 25.063 7.323   1.00 39.96  ? 68  ILE B N   1 
ATOM   1408 C CA  . ILE B 1 50  ? -19.769 23.747 6.685   1.00 40.16  ? 68  ILE B CA  1 
ATOM   1409 C C   . ILE B 1 50  ? -18.932 23.722 5.424   1.00 42.30  ? 68  ILE B C   1 
ATOM   1410 O O   . ILE B 1 50  ? -18.752 22.674 4.820   1.00 60.71  ? 68  ILE B O   1 
ATOM   1411 C CB  . ILE B 1 50  ? -21.161 23.241 6.350   1.00 49.61  ? 68  ILE B CB  1 
ATOM   1412 C CG1 . ILE B 1 50  ? -21.968 24.378 5.734   1.00 41.68  ? 68  ILE B CG1 1 
ATOM   1413 C CG2 . ILE B 1 50  ? -21.840 22.696 7.607   1.00 47.90  ? 68  ILE B CG2 1 
ATOM   1414 C CD1 . ILE B 1 50  ? -23.258 23.926 5.136   1.00 57.25  ? 68  ILE B CD1 1 
ATOM   1415 N N   . ASP B 1 51  ? -18.423 24.881 5.027   1.00 44.87  ? 69  ASP B N   1 
ATOM   1416 C CA  . ASP B 1 51  ? -17.516 24.969 3.895   1.00 27.13  ? 69  ASP B CA  1 
ATOM   1417 C C   . ASP B 1 51  ? -16.065 24.782 4.359   1.00 26.66  ? 69  ASP B C   1 
ATOM   1418 O O   . ASP B 1 51  ? -15.399 25.735 4.765   1.00 30.00  ? 69  ASP B O   1 
ATOM   1419 C CB  . ASP B 1 51  ? -17.698 26.318 3.179   1.00 29.22  ? 69  ASP B CB  1 
ATOM   1420 C CG  . ASP B 1 51  ? -17.124 26.317 1.766   1.00 42.75  ? 69  ASP B CG  1 
ATOM   1421 O OD1 . ASP B 1 51  ? -16.461 25.332 1.401   1.00 51.10  ? 69  ASP B OD1 1 
ATOM   1422 O OD2 . ASP B 1 51  ? -17.330 27.294 1.010   1.00 42.40  ? 69  ASP B OD2 1 
ATOM   1423 N N   . MET B 1 52  ? -15.580 23.548 4.300   1.00 28.57  ? 70  MET B N   1 
ATOM   1424 C CA  . MET B 1 52  ? -14.197 23.260 4.669   1.00 39.58  ? 70  MET B CA  1 
ATOM   1425 C C   . MET B 1 52  ? -13.382 22.617 3.545   1.00 34.61  ? 70  MET B C   1 
ATOM   1426 O O   . MET B 1 52  ? -13.903 21.829 2.774   1.00 33.40  ? 70  MET B O   1 
ATOM   1427 C CB  . MET B 1 52  ? -14.162 22.366 5.907   1.00 33.09  ? 70  MET B CB  1 
ATOM   1428 C CG  . MET B 1 52  ? -14.882 22.962 7.102   1.00 36.76  ? 70  MET B CG  1 
ATOM   1429 S SD  . MET B 1 52  ? -14.667 21.993 8.609   1.00 42.42  ? 70  MET B SD  1 
ATOM   1430 C CE  . MET B 1 52  ? -16.044 22.634 9.575   1.00 44.97  ? 70  MET B CE  1 
ATOM   1431 N N   . THR B 1 53  ? -12.091 22.930 3.487   1.00 34.84  ? 71  THR B N   1 
ATOM   1432 C CA  . THR B 1 53  ? -11.200 22.359 2.473   1.00 34.24  ? 71  THR B CA  1 
ATOM   1433 C C   . THR B 1 53  ? -9.866  21.895 3.078   1.00 39.28  ? 71  THR B C   1 
ATOM   1434 O O   . THR B 1 53  ? -9.349  22.512 4.013   1.00 34.09  ? 71  THR B O   1 
ATOM   1435 C CB  . THR B 1 53  ? -10.969 23.348 1.285   1.00 33.31  ? 71  THR B CB  1 
ATOM   1436 O OG1 . THR B 1 53  ? -10.492 24.615 1.775   1.00 34.80  ? 71  THR B OG1 1 
ATOM   1437 C CG2 . THR B 1 53  ? -12.265 23.569 0.516   1.00 25.63  ? 71  THR B CG2 1 
ATOM   1438 N N   . ALA B 1 54  ? -9.322  20.806 2.534   1.00 32.70  ? 72  ALA B N   1 
ATOM   1439 C CA  . ALA B 1 54  ? -8.166  20.126 3.115   1.00 34.72  ? 72  ALA B CA  1 
ATOM   1440 C C   . ALA B 1 54  ? -6.915  20.210 2.259   1.00 37.57  ? 72  ALA B C   1 
ATOM   1441 O O   . ALA B 1 54  ? -6.994  20.175 1.042   1.00 32.92  ? 72  ALA B O   1 
ATOM   1442 C CB  . ALA B 1 54  ? -8.499  18.655 3.386   1.00 27.62  ? 72  ALA B CB  1 
ATOM   1443 N N   . LYS B 1 55  ? -5.767  20.322 2.921   1.00 32.39  ? 73  LYS B N   1 
ATOM   1444 C CA  . LYS B 1 55  ? -4.466  20.200 2.285   1.00 40.35  ? 73  LYS B CA  1 
ATOM   1445 C C   . LYS B 1 55  ? -3.638  19.272 3.167   1.00 31.79  ? 73  LYS B C   1 
ATOM   1446 O O   . LYS B 1 55  ? -3.908  19.138 4.347   1.00 26.93  ? 73  LYS B O   1 
ATOM   1447 C CB  . LYS B 1 55  ? -3.790  21.566 2.129   1.00 31.84  ? 73  LYS B CB  1 
ATOM   1448 C CG  . LYS B 1 55  ? -4.061  22.245 0.802   1.00 53.22  ? 73  LYS B CG  1 
ATOM   1449 C CD  . LYS B 1 55  ? -4.485  23.706 0.962   1.00 61.69  ? 73  LYS B CD  1 
ATOM   1450 C CE  . LYS B 1 55  ? -3.309  24.645 1.213   1.00 72.53  ? 73  LYS B CE  1 
ATOM   1451 N NZ  . LYS B 1 55  ? -3.760  26.072 1.285   1.00 55.10  ? 73  LYS B NZ  1 
ATOM   1452 N N   . VAL B 1 56  ? -2.639  18.622 2.588   1.00 33.01  ? 74  VAL B N   1 
ATOM   1453 C CA  . VAL B 1 56  ? -1.812  17.686 3.326   1.00 28.32  ? 74  VAL B CA  1 
ATOM   1454 C C   . VAL B 1 56  ? -0.389  17.786 2.831   1.00 35.59  ? 74  VAL B C   1 
ATOM   1455 O O   . VAL B 1 56  ? -0.149  18.060 1.651   1.00 37.03  ? 74  VAL B O   1 
ATOM   1456 C CB  . VAL B 1 56  ? -2.292  16.223 3.164   1.00 41.32  ? 74  VAL B CB  1 
ATOM   1457 C CG1 . VAL B 1 56  ? -2.035  15.732 1.753   1.00 28.03  ? 74  VAL B CG1 1 
ATOM   1458 C CG2 . VAL B 1 56  ? -1.578  15.316 4.150   1.00 27.55  ? 74  VAL B CG2 1 
ATOM   1459 N N   . GLN B 1 57  ? 0.550   17.573 3.746   1.00 30.62  ? 75  GLN B N   1 
ATOM   1460 C CA  . GLN B 1 57  ? 1.959   17.516 3.406   1.00 34.62  ? 75  GLN B CA  1 
ATOM   1461 C C   . GLN B 1 57  ? 2.546   16.384 4.203   1.00 32.27  ? 75  GLN B C   1 
ATOM   1462 O O   . GLN B 1 57  ? 2.250   16.221 5.383   1.00 42.68  ? 75  GLN B O   1 
ATOM   1463 C CB  . GLN B 1 57  ? 2.672   18.825 3.751   1.00 29.80  ? 75  GLN B CB  1 
ATOM   1464 C CG  . GLN B 1 57  ? 2.151   20.031 3.008   1.00 57.64  ? 75  GLN B CG  1 
ATOM   1465 C CD  . GLN B 1 57  ? 2.969   21.278 3.293   1.00 92.70  ? 75  GLN B CD  1 
ATOM   1466 O OE1 . GLN B 1 57  ? 3.029   22.203 2.477   1.00 84.36  ? 75  GLN B OE1 1 
ATOM   1467 N NE2 . GLN B 1 57  ? 3.611   21.306 4.458   1.00 85.56  ? 75  GLN B NE2 1 
ATOM   1468 N N   . CYS B 1 58  ? 3.398   15.606 3.567   1.00 30.38  ? 76  CYS B N   1 
ATOM   1469 C CA  . CYS B 1 58  ? 3.926   14.419 4.203   1.00 28.89  ? 76  CYS B CA  1 
ATOM   1470 C C   . CYS B 1 58  ? 5.422   14.485 4.172   1.00 37.16  ? 76  CYS B C   1 
ATOM   1471 O O   . CYS B 1 58  ? 6.009   15.075 3.265   1.00 30.96  ? 76  CYS B O   1 
ATOM   1472 C CB  . CYS B 1 58  ? 3.455   13.156 3.463   1.00 21.86  ? 76  CYS B CB  1 
ATOM   1473 S SG  . CYS B 1 58  ? 1.728   12.811 3.680   1.00 40.99  ? 76  CYS B SG  1 
ATOM   1474 N N   . ALA B 1 59  ? 6.044   13.877 5.171   1.00 34.48  ? 77  ALA B N   1 
ATOM   1475 C CA  . ALA B 1 59  ? 7.467   13.645 5.101   1.00 32.85  ? 77  ALA B CA  1 
ATOM   1476 C C   . ALA B 1 59  ? 7.667   12.691 3.936   1.00 36.55  ? 77  ALA B C   1 
ATOM   1477 O O   . ALA B 1 59  ? 6.796   11.875 3.654   1.00 36.47  ? 77  ALA B O   1 
ATOM   1478 C CB  . ALA B 1 59  ? 7.969   13.024 6.400   1.00 28.75  ? 77  ALA B CB  1 
ATOM   1479 N N   . PRO B 1 60  ? 8.806   12.803 3.241   1.00 44.48  ? 78  PRO B N   1 
ATOM   1480 C CA  . PRO B 1 60  ? 9.108   11.842 2.175   1.00 32.68  ? 78  PRO B CA  1 
ATOM   1481 C C   . PRO B 1 60  ? 9.348   10.472 2.784   1.00 48.06  ? 78  PRO B C   1 
ATOM   1482 O O   . PRO B 1 60  ? 9.780   10.388 3.942   1.00 46.23  ? 78  PRO B O   1 
ATOM   1483 C CB  . PRO B 1 60  ? 10.408  12.384 1.564   1.00 31.22  ? 78  PRO B CB  1 
ATOM   1484 C CG  . PRO B 1 60  ? 10.488  13.809 2.012   1.00 57.30  ? 78  PRO B CG  1 
ATOM   1485 C CD  . PRO B 1 60  ? 9.834   13.849 3.354   1.00 34.38  ? 78  PRO B CD  1 
ATOM   1486 N N   . CYS B 1 61  ? 9.067   9.417  2.026   1.00 27.11  ? 79  CYS B N   1 
ATOM   1487 C CA  . CYS B 1 61  ? 9.289   8.058  2.506   1.00 49.03  ? 79  CYS B CA  1 
ATOM   1488 C C   . CYS B 1 61  ? 10.785  7.742  2.494   1.00 46.97  ? 79  CYS B C   1 
ATOM   1489 O O   . CYS B 1 61  ? 11.522  8.235  1.639   1.00 36.22  ? 79  CYS B O   1 
ATOM   1490 C CB  . CYS B 1 61  ? 8.525   7.045  1.638   1.00 40.45  ? 79  CYS B CB  1 
ATOM   1491 S SG  . CYS B 1 61  ? 6.732   7.333  1.495   1.00 54.30  ? 79  CYS B SG  1 
ATOM   1492 N N   . LYS B 1 62  ? 11.241  6.948  3.458   1.00 33.76  ? 80  LYS B N   1 
ATOM   1493 C CA  . LYS B 1 62  ? 12.562  6.343  3.336   1.00 44.04  ? 80  LYS B CA  1 
ATOM   1494 C C   . LYS B 1 62  ? 12.397  4.922  2.863   1.00 44.43  ? 80  LYS B C   1 
ATOM   1495 O O   . LYS B 1 62  ? 11.934  4.071  3.614   1.00 57.10  ? 80  LYS B O   1 
ATOM   1496 C CB  . LYS B 1 62  ? 13.299  6.339  4.664   1.00 56.50  ? 80  LYS B CB  1 
ATOM   1497 C CG  . LYS B 1 62  ? 14.032  7.616  4.938   1.00 27.83  ? 80  LYS B CG  1 
ATOM   1498 C CD  . LYS B 1 62  ? 13.058  8.759  5.095   1.00 43.96  ? 80  LYS B CD  1 
ATOM   1499 C CE  . LYS B 1 62  ? 13.704  9.901  5.884   1.00 100.50 ? 80  LYS B CE  1 
ATOM   1500 N NZ  . LYS B 1 62  ? 14.395  9.434  7.133   1.00 61.25  ? 80  LYS B NZ  1 
ATOM   1501 N N   . THR B 1 63  ? 12.762  4.672  1.613   1.00 53.63  ? 81  THR B N   1 
ATOM   1502 C CA  . THR B 1 63  ? 12.602  3.349  1.019   1.00 68.22  ? 81  THR B CA  1 
ATOM   1503 C C   . THR B 1 63  ? 13.629  2.375  1.606   1.00 50.14  ? 81  THR B C   1 
ATOM   1504 O O   . THR B 1 63  ? 13.338  1.196  1.815   1.00 55.22  ? 81  THR B O   1 
ATOM   1505 C CB  . THR B 1 63  ? 12.673  3.405  -0.546  1.00 89.79  ? 81  THR B CB  1 
ATOM   1506 O OG1 . THR B 1 63  ? 14.032  3.539  -0.992  1.00 66.28  ? 81  THR B OG1 1 
ATOM   1507 C CG2 . THR B 1 63  ? 11.849  4.580  -1.080  1.00 59.02  ? 81  THR B CG2 1 
ATOM   1508 N N   . THR B 1 64  ? 14.816  2.896  1.902   1.00 52.76  ? 82  THR B N   1 
ATOM   1509 C CA  . THR B 1 64  ? 15.896  2.109  2.489   1.00 52.77  ? 82  THR B CA  1 
ATOM   1510 C C   . THR B 1 64  ? 15.640  1.696  3.960   1.00 54.48  ? 82  THR B C   1 
ATOM   1511 O O   . THR B 1 64  ? 16.158  0.682  4.421   1.00 72.08  ? 82  THR B O   1 
ATOM   1512 C CB  . THR B 1 64  ? 17.282  2.827  2.341   1.00 64.42  ? 82  THR B CB  1 
ATOM   1513 O OG1 . THR B 1 64  ? 17.339  3.990  3.176   1.00 52.04  ? 82  THR B OG1 1 
ATOM   1514 C CG2 . THR B 1 64  ? 17.528  3.246  0.900   1.00 45.52  ? 82  THR B CG2 1 
ATOM   1515 N N   . ASP B 1 65  ? 14.834  2.463  4.687   1.00 48.82  ? 83  ASP B N   1 
ATOM   1516 C CA  . ASP B 1 65  ? 14.605  2.204  6.114   1.00 46.92  ? 83  ASP B CA  1 
ATOM   1517 C C   . ASP B 1 65  ? 13.344  1.373  6.353   1.00 40.39  ? 83  ASP B C   1 
ATOM   1518 O O   . ASP B 1 65  ? 12.233  1.836  6.165   1.00 43.49  ? 83  ASP B O   1 
ATOM   1519 C CB  . ASP B 1 65  ? 14.570  3.532  6.891   1.00 38.62  ? 83  ASP B CB  1 
ATOM   1520 C CG  . ASP B 1 65  ? 14.343  3.359  8.403   1.00 50.30  ? 83  ASP B CG  1 
ATOM   1521 O OD1 . ASP B 1 65  ? 13.994  2.253  8.882   1.00 35.59  ? 83  ASP B OD1 1 
ATOM   1522 O OD2 . ASP B 1 65  ? 14.504  4.377  9.118   1.00 50.05  ? 83  ASP B OD2 1 
ATOM   1523 N N   . PRO B 1 66  ? 13.522  0.129  6.778   1.00 39.03  ? 84  PRO B N   1 
ATOM   1524 C CA  . PRO B 1 66  ? 12.377  -0.768 6.990   1.00 37.29  ? 84  PRO B CA  1 
ATOM   1525 C C   . PRO B 1 66  ? 11.490  -0.387 8.164   1.00 49.92  ? 84  PRO B C   1 
ATOM   1526 O O   . PRO B 1 66  ? 10.422  -0.982 8.300   1.00 53.42  ? 84  PRO B O   1 
ATOM   1527 C CB  . PRO B 1 66  ? 13.031  -2.129 7.258   1.00 37.88  ? 84  PRO B CB  1 
ATOM   1528 C CG  . PRO B 1 66  ? 14.436  -1.999 6.685   1.00 53.64  ? 84  PRO B CG  1 
ATOM   1529 C CD  . PRO B 1 66  ? 14.817  -0.561 6.878   1.00 42.15  ? 84  PRO B CD  1 
ATOM   1530 N N   . TRP B 1 67  ? 11.911  0.557  9.005   1.00 54.90  ? 85  TRP B N   1 
ATOM   1531 C CA  . TRP B 1 67  ? 11.080  0.951  10.152  1.00 58.49  ? 85  TRP B CA  1 
ATOM   1532 C C   . TRP B 1 67  ? 10.557  2.361  10.012  1.00 45.88  ? 85  TRP B C   1 
ATOM   1533 O O   . TRP B 1 67  ? 9.862   2.855  10.898  1.00 45.35  ? 85  TRP B O   1 
ATOM   1534 C CB  . TRP B 1 67  ? 11.826  0.829  11.484  1.00 50.74  ? 85  TRP B CB  1 
ATOM   1535 C CG  . TRP B 1 67  ? 12.213  -0.564 11.840  1.00 51.90  ? 85  TRP B CG  1 
ATOM   1536 C CD1 . TRP B 1 67  ? 11.531  -1.435 12.654  1.00 37.48  ? 85  TRP B CD1 1 
ATOM   1537 C CD2 . TRP B 1 67  ? 13.384  -1.259 11.395  1.00 40.64  ? 85  TRP B CD2 1 
ATOM   1538 N NE1 . TRP B 1 67  ? 12.213  -2.625 12.737  1.00 36.91  ? 85  TRP B NE1 1 
ATOM   1539 C CE2 . TRP B 1 67  ? 13.354  -2.541 11.977  1.00 49.14  ? 85  TRP B CE2 1 
ATOM   1540 C CE3 . TRP B 1 67  ? 14.456  -0.918 10.565  1.00 29.08  ? 85  TRP B CE3 1 
ATOM   1541 C CZ2 . TRP B 1 67  ? 14.353  -3.483 11.748  1.00 42.22  ? 85  TRP B CZ2 1 
ATOM   1542 C CZ3 . TRP B 1 67  ? 15.442  -1.849 10.339  1.00 48.51  ? 85  TRP B CZ3 1 
ATOM   1543 C CH2 . TRP B 1 67  ? 15.386  -3.120 10.927  1.00 43.96  ? 85  TRP B CH2 1 
ATOM   1544 N N   . ASP B 1 68  ? 10.893  3.006  8.901   1.00 42.96  ? 86  ASP B N   1 
ATOM   1545 C CA  . ASP B 1 68  ? 10.401  4.345  8.637   1.00 38.71  ? 86  ASP B CA  1 
ATOM   1546 C C   . ASP B 1 68  ? 8.906   4.501  8.938   1.00 37.98  ? 86  ASP B C   1 
ATOM   1547 O O   . ASP B 1 68  ? 8.083   3.677  8.534   1.00 40.24  ? 86  ASP B O   1 
ATOM   1548 C CB  . ASP B 1 68  ? 10.687  4.737  7.192   1.00 61.69  ? 86  ASP B CB  1 
ATOM   1549 C CG  . ASP B 1 68  ? 10.297  6.168  6.891   1.00 56.93  ? 86  ASP B CG  1 
ATOM   1550 O OD1 . ASP B 1 68  ? 10.698  7.072  7.659   1.00 51.26  ? 86  ASP B OD1 1 
ATOM   1551 O OD2 . ASP B 1 68  ? 9.586   6.385  5.889   1.00 47.86  ? 86  ASP B OD2 1 
ATOM   1552 N N   . VAL B 1 69  ? 8.568   5.569  9.652   1.00 31.66  ? 87  VAL B N   1 
ATOM   1553 C CA  . VAL B 1 69  ? 7.180   5.928  9.902   1.00 41.41  ? 87  VAL B CA  1 
ATOM   1554 C C   . VAL B 1 69  ? 6.946   7.298  9.297   1.00 39.57  ? 87  VAL B C   1 
ATOM   1555 O O   . VAL B 1 69  ? 7.675   8.235  9.585   1.00 39.99  ? 87  VAL B O   1 
ATOM   1556 C CB  . VAL B 1 69  ? 6.842   5.954  11.413  1.00 46.21  ? 87  VAL B CB  1 
ATOM   1557 C CG1 . VAL B 1 69  ? 5.636   6.849  11.689  1.00 50.17  ? 87  VAL B CG1 1 
ATOM   1558 C CG2 . VAL B 1 69  ? 6.579   4.546  11.926  1.00 56.05  ? 87  VAL B CG2 1 
ATOM   1559 N N   . VAL B 1 70  ? 5.932   7.404  8.445   1.00 50.57  ? 88  VAL B N   1 
ATOM   1560 C CA  . VAL B 1 70  ? 5.661   8.641  7.728   1.00 40.38  ? 88  VAL B CA  1 
ATOM   1561 C C   . VAL B 1 70  ? 4.706   9.533  8.508   1.00 41.38  ? 88  VAL B C   1 
ATOM   1562 O O   . VAL B 1 70  ? 3.662   9.074  8.970   1.00 35.26  ? 88  VAL B O   1 
ATOM   1563 C CB  . VAL B 1 70  ? 5.079   8.356  6.327   1.00 44.26  ? 88  VAL B CB  1 
ATOM   1564 C CG1 . VAL B 1 70  ? 4.600   9.658  5.660   1.00 40.10  ? 88  VAL B CG1 1 
ATOM   1565 C CG2 . VAL B 1 70  ? 6.117   7.651  5.469   1.00 30.52  ? 88  VAL B CG2 1 
ATOM   1566 N N   . LEU B 1 71  ? 5.085   10.805 8.646   1.00 31.37  ? 89  LEU B N   1 
ATOM   1567 C CA  . LEU B 1 71  ? 4.274   11.801 9.325   1.00 37.63  ? 89  LEU B CA  1 
ATOM   1568 C C   . LEU B 1 71  ? 3.636   12.705 8.310   1.00 28.17  ? 89  LEU B C   1 
ATOM   1569 O O   . LEU B 1 71  ? 4.315   13.262 7.455   1.00 31.85  ? 89  LEU B O   1 
ATOM   1570 C CB  . LEU B 1 71  ? 5.146   12.679 10.225  1.00 51.86  ? 89  LEU B CB  1 
ATOM   1571 C CG  . LEU B 1 71  ? 5.542   12.193 11.614  1.00 64.36  ? 89  LEU B CG  1 
ATOM   1572 C CD1 . LEU B 1 71  ? 6.226   10.837 11.533  1.00 53.97  ? 89  LEU B CD1 1 
ATOM   1573 C CD2 . LEU B 1 71  ? 6.444   13.226 12.272  1.00 54.88  ? 89  LEU B CD2 1 
ATOM   1574 N N   . CYS B 1 72  ? 2.334   12.896 8.428   1.00 32.86  ? 90  CYS B N   1 
ATOM   1575 C CA  . CYS B 1 72  ? 1.643   13.843 7.563   1.00 32.08  ? 90  CYS B CA  1 
ATOM   1576 C C   . CYS B 1 72  ? 0.902   14.895 8.362   1.00 47.56  ? 90  CYS B C   1 
ATOM   1577 O O   . CYS B 1 72  ? 0.238   14.595 9.362   1.00 40.41  ? 90  CYS B O   1 
ATOM   1578 C CB  . CYS B 1 72  ? 0.675   13.119 6.622   1.00 36.26  ? 90  CYS B CB  1 
ATOM   1579 S SG  . CYS B 1 72  ? 1.524   11.965 5.515   1.00 34.81  ? 90  CYS B SG  1 
ATOM   1580 N N   . THR B 1 73  ? 1.032   16.139 7.926   1.00 37.65  ? 91  THR B N   1 
ATOM   1581 C CA  . THR B 1 73  ? 0.215   17.198 8.486   1.00 27.50  ? 91  THR B CA  1 
ATOM   1582 C C   . THR B 1 73  ? -1.057  17.419 7.664   1.00 35.40  ? 91  THR B C   1 
ATOM   1583 O O   . THR B 1 73  ? -1.016  17.715 6.469   1.00 36.30  ? 91  THR B O   1 
ATOM   1584 C CB  . THR B 1 73  ? 0.969   18.508 8.603   1.00 31.92  ? 91  THR B CB  1 
ATOM   1585 O OG1 . THR B 1 73  ? 2.247   18.268 9.199   1.00 29.55  ? 91  THR B OG1 1 
ATOM   1586 C CG2 . THR B 1 73  ? 0.164   19.488 9.451   1.00 30.82  ? 91  THR B CG2 1 
ATOM   1587 N N   . CYS B 1 74  ? -2.185  17.280 8.342   1.00 32.72  ? 92  CYS B N   1 
ATOM   1588 C CA  . CYS B 1 74  ? -3.487  17.497 7.762   1.00 29.76  ? 92  CYS B CA  1 
ATOM   1589 C C   . CYS B 1 74  ? -4.003  18.892 8.162   1.00 35.54  ? 92  CYS B C   1 
ATOM   1590 O O   . CYS B 1 74  ? -4.326  19.122 9.318   1.00 44.10  ? 92  CYS B O   1 
ATOM   1591 C CB  . CYS B 1 74  ? -4.417  16.378 8.255   1.00 26.15  ? 92  CYS B CB  1 
ATOM   1592 S SG  . CYS B 1 74  ? -6.112  16.484 7.713   1.00 52.69  ? 92  CYS B SG  1 
ATOM   1593 N N   . LYS B 1 75  ? -4.059  19.822 7.211   1.00 37.47  ? 93  LYS B N   1 
ATOM   1594 C CA  . LYS B 1 75  ? -4.574  21.168 7.469   1.00 35.80  ? 93  LYS B CA  1 
ATOM   1595 C C   . LYS B 1 75  ? -5.934  21.428 6.820   1.00 34.90  ? 93  LYS B C   1 
ATOM   1596 O O   . LYS B 1 75  ? -6.056  21.424 5.601   1.00 54.09  ? 93  LYS B O   1 
ATOM   1597 C CB  . LYS B 1 75  ? -3.578  22.238 7.027   1.00 27.78  ? 93  LYS B CB  1 
ATOM   1598 C CG  . LYS B 1 75  ? -4.113  23.671 7.177   1.00 42.73  ? 93  LYS B CG  1 
ATOM   1599 C CD  . LYS B 1 75  ? -3.007  24.705 6.974   1.00 39.41  ? 93  LYS B CD  1 
ATOM   1600 C CE  . LYS B 1 75  ? -3.550  26.134 7.025   1.00 52.45  ? 93  LYS B CE  1 
ATOM   1601 N NZ  . LYS B 1 75  ? -2.508  27.155 6.708   1.00 48.49  ? 93  LYS B NZ  1 
ATOM   1602 N N   . ILE B 1 76  ? -6.940  21.678 7.649   1.00 37.18  ? 94  ILE B N   1 
ATOM   1603 C CA  . ILE B 1 76  ? -8.316  21.870 7.212   1.00 23.25  ? 94  ILE B CA  1 
ATOM   1604 C C   . ILE B 1 76  ? -8.702  23.318 7.423   1.00 32.37  ? 94  ILE B C   1 
ATOM   1605 O O   . ILE B 1 76  ? -8.463  23.885 8.476   1.00 43.62  ? 94  ILE B O   1 
ATOM   1606 C CB  . ILE B 1 76  ? -9.296  20.980 8.011   1.00 32.81  ? 94  ILE B CB  1 
ATOM   1607 C CG1 . ILE B 1 76  ? -9.091  19.512 7.669   1.00 44.75  ? 94  ILE B CG1 1 
ATOM   1608 C CG2 . ILE B 1 76  ? -10.728 21.356 7.743   1.00 31.19  ? 94  ILE B CG2 1 
ATOM   1609 C CD1 . ILE B 1 76  ? -7.894  18.931 8.315   1.00 42.28  ? 94  ILE B CD1 1 
ATOM   1610 N N   . THR B 1 77  ? -9.309  23.909 6.407   1.00 45.14  ? 95  THR B N   1 
ATOM   1611 C CA  . THR B 1 77  ? -9.643  25.311 6.432   1.00 28.64  ? 95  THR B CA  1 
ATOM   1612 C C   . THR B 1 77  ? -11.147 25.476 6.386   1.00 32.18  ? 95  THR B C   1 
ATOM   1613 O O   . THR B 1 77  ? -11.782 25.107 5.399   1.00 34.53  ? 95  THR B O   1 
ATOM   1614 C CB  . THR B 1 77  ? -9.051  26.014 5.205   1.00 29.02  ? 95  THR B CB  1 
ATOM   1615 O OG1 . THR B 1 77  ? -7.624  25.971 5.270   1.00 30.05  ? 95  THR B OG1 1 
ATOM   1616 C CG2 . THR B 1 77  ? -9.498  27.453 5.160   1.00 22.74  ? 95  THR B CG2 1 
ATOM   1617 N N   . ALA B 1 78  ? -11.716 26.036 7.450   1.00 41.71  ? 96  ALA B N   1 
ATOM   1618 C CA  . ALA B 1 78  ? -13.142 26.366 7.486   1.00 34.77  ? 96  ALA B CA  1 
ATOM   1619 C C   . ALA B 1 78  ? -13.328 27.785 6.952   1.00 39.82  ? 96  ALA B C   1 
ATOM   1620 O O   . ALA B 1 78  ? -12.688 28.719 7.440   1.00 29.12  ? 96  ALA B O   1 
ATOM   1621 C CB  . ALA B 1 78  ? -13.678 26.253 8.909   1.00 41.46  ? 96  ALA B CB  1 
ATOM   1622 N N   . HIS B 1 79  ? -14.198 27.943 5.955   1.00 30.73  ? 97  HIS B N   1 
ATOM   1623 C CA  . HIS B 1 79  ? -14.321 29.221 5.240   1.00 26.07  ? 97  HIS B CA  1 
ATOM   1624 C C   . HIS B 1 79  ? -15.404 30.181 5.756   1.00 43.72  ? 97  HIS B C   1 
ATOM   1625 O O   . HIS B 1 79  ? -15.354 31.387 5.482   1.00 33.03  ? 97  HIS B O   1 
ATOM   1626 C CB  . HIS B 1 79  ? -14.500 28.971 3.738   1.00 33.58  ? 97  HIS B CB  1 
ATOM   1627 C CG  . HIS B 1 79  ? -13.356 28.229 3.125   1.00 40.80  ? 97  HIS B CG  1 
ATOM   1628 N ND1 . HIS B 1 79  ? -12.164 28.842 2.801   1.00 32.89  ? 97  HIS B ND1 1 
ATOM   1629 C CD2 . HIS B 1 79  ? -13.207 26.921 2.807   1.00 28.60  ? 97  HIS B CD2 1 
ATOM   1630 C CE1 . HIS B 1 79  ? -11.332 27.944 2.303   1.00 27.78  ? 97  HIS B CE1 1 
ATOM   1631 N NE2 . HIS B 1 79  ? -11.940 26.771 2.297   1.00 39.48  ? 97  HIS B NE2 1 
ATOM   1632 N N   . ARG B 1 80  ? -16.383 29.655 6.490   1.00 34.38  ? 98  ARG B N   1 
ATOM   1633 C CA  . ARG B 1 80  ? -17.396 30.511 7.110   1.00 54.30  ? 98  ARG B CA  1 
ATOM   1634 C C   . ARG B 1 80  ? -17.513 30.181 8.599   1.00 41.54  ? 98  ARG B C   1 
ATOM   1635 O O   . ARG B 1 80  ? -18.475 29.564 9.057   1.00 48.93  ? 98  ARG B O   1 
ATOM   1636 C CB  . ARG B 1 80  ? -18.737 30.449 6.354   1.00 43.94  ? 98  ARG B CB  1 
ATOM   1637 C CG  . ARG B 1 80  ? -18.564 30.605 4.832   1.00 45.07  ? 98  ARG B CG  1 
ATOM   1638 C CD  . ARG B 1 80  ? -19.861 30.912 4.077   1.00 44.90  ? 98  ARG B CD  1 
ATOM   1639 N NE  . ARG B 1 80  ? -20.017 32.347 3.862   1.00 66.74  ? 98  ARG B NE  1 
ATOM   1640 C CZ  . ARG B 1 80  ? -20.020 32.951 2.678   1.00 48.69  ? 98  ARG B CZ  1 
ATOM   1641 N NH1 . ARG B 1 80  ? -19.900 32.257 1.551   1.00 36.74  ? 98  ARG B NH1 1 
ATOM   1642 N NH2 . ARG B 1 80  ? -20.164 34.269 2.630   1.00 54.49  ? 98  ARG B NH2 1 
ATOM   1643 N N   . TYR B 1 81  ? -16.499 30.633 9.329   1.00 38.07  ? 99  TYR B N   1 
ATOM   1644 C CA  . TYR B 1 81  ? -16.284 30.323 10.731  1.00 47.03  ? 99  TYR B CA  1 
ATOM   1645 C C   . TYR B 1 81  ? -16.677 31.508 11.615  1.00 51.70  ? 99  TYR B C   1 
ATOM   1646 O O   . TYR B 1 81  ? -16.134 32.605 11.473  1.00 37.59  ? 99  TYR B O   1 
ATOM   1647 C CB  . TYR B 1 81  ? -14.801 30.014 10.902  1.00 47.45  ? 99  TYR B CB  1 
ATOM   1648 C CG  . TYR B 1 81  ? -14.328 29.592 12.280  1.00 52.85  ? 99  TYR B CG  1 
ATOM   1649 C CD1 . TYR B 1 81  ? -14.052 28.257 12.554  1.00 42.12  ? 99  TYR B CD1 1 
ATOM   1650 C CD2 . TYR B 1 81  ? -14.096 30.531 13.285  1.00 47.56  ? 99  TYR B CD2 1 
ATOM   1651 C CE1 . TYR B 1 81  ? -13.582 27.864 13.786  1.00 41.61  ? 99  TYR B CE1 1 
ATOM   1652 C CE2 . TYR B 1 81  ? -13.629 30.147 14.526  1.00 40.69  ? 99  TYR B CE2 1 
ATOM   1653 C CZ  . TYR B 1 81  ? -13.373 28.810 14.767  1.00 45.81  ? 99  TYR B CZ  1 
ATOM   1654 O OH  . TYR B 1 81  ? -12.910 28.403 15.991  1.00 53.95  ? 99  TYR B OH  1 
ATOM   1655 N N   . ARG B 1 82  ? -17.628 31.287 12.520  1.00 47.76  ? 100 ARG B N   1 
ATOM   1656 C CA  . ARG B 1 82  ? -18.073 32.340 13.422  1.00 53.29  ? 100 ARG B CA  1 
ATOM   1657 C C   . ARG B 1 82  ? -17.017 32.527 14.485  1.00 52.41  ? 100 ARG B C   1 
ATOM   1658 O O   . ARG B 1 82  ? -16.745 31.614 15.262  1.00 57.11  ? 100 ARG B O   1 
ATOM   1659 C CB  . ARG B 1 82  ? -19.362 31.945 14.121  1.00 59.26  ? 100 ARG B CB  1 
ATOM   1660 C CG  . ARG B 1 82  ? -20.139 30.846 13.450  1.00 52.96  ? 100 ARG B CG  1 
ATOM   1661 C CD  . ARG B 1 82  ? -21.266 31.386 12.611  1.00 73.27  ? 100 ARG B CD  1 
ATOM   1662 N NE  . ARG B 1 82  ? -22.468 30.632 12.815  1.00 84.63  ? 100 ARG B NE  1 
ATOM   1663 C CZ  . ARG B 1 82  ? -23.127 29.781 12.037  1.00 83.15  ? 100 ARG B CZ  1 
ATOM   1664 N NH1 . ARG B 1 82  ? -24.202 29.260 12.593  1.00 92.81  ? 100 ARG B NH1 1 
ATOM   1665 N NH2 . ARG B 1 82  ? -22.800 29.448 10.791  1.00 77.17  ? 100 ARG B NH2 1 
ATOM   1666 N N   . GLU B 1 83  ? -16.419 33.706 14.528  1.00 40.01  ? 101 GLU B N   1 
ATOM   1667 C CA  . GLU B 1 83  ? -15.421 33.982 15.550  1.00 66.86  ? 101 GLU B CA  1 
ATOM   1668 C C   . GLU B 1 83  ? -16.109 34.366 16.853  1.00 70.27  ? 101 GLU B C   1 
ATOM   1669 O O   . GLU B 1 83  ? -15.618 34.067 17.943  1.00 67.37  ? 101 GLU B O   1 
ATOM   1670 C CB  . GLU B 1 83  ? -14.472 35.086 15.087  1.00 76.04  ? 101 GLU B CB  1 
ATOM   1671 C CG  . GLU B 1 83  ? -15.103 36.090 14.131  1.00 65.05  ? 101 GLU B CG  1 
ATOM   1672 C CD  . GLU B 1 83  ? -14.170 37.244 13.819  1.00 76.23  ? 101 GLU B CD  1 
ATOM   1673 O OE1 . GLU B 1 83  ? -14.564 38.154 13.056  1.00 89.76  ? 101 GLU B OE1 1 
ATOM   1674 O OE2 . GLU B 1 83  ? -13.036 37.239 14.343  1.00 80.98  ? 101 GLU B OE2 1 
ATOM   1675 N N   . PHE B 1 84  ? -17.272 34.997 16.718  1.00 60.44  ? 102 PHE B N   1 
ATOM   1676 C CA  . PHE B 1 84  ? -18.042 35.507 17.847  1.00 64.18  ? 102 PHE B CA  1 
ATOM   1677 C C   . PHE B 1 84  ? -18.557 34.417 18.788  1.00 71.85  ? 102 PHE B C   1 
ATOM   1678 O O   . PHE B 1 84  ? -19.157 34.713 19.819  1.00 71.42  ? 102 PHE B O   1 
ATOM   1679 C CB  . PHE B 1 84  ? -19.222 36.341 17.339  1.00 66.51  ? 102 PHE B CB  1 
ATOM   1680 C CG  . PHE B 1 84  ? -20.221 35.555 16.525  1.00 80.77  ? 102 PHE B CG  1 
ATOM   1681 C CD1 . PHE B 1 84  ? -20.050 35.403 15.149  1.00 76.46  ? 102 PHE B CD1 1 
ATOM   1682 C CD2 . PHE B 1 84  ? -21.333 34.974 17.131  1.00 64.11  ? 102 PHE B CD2 1 
ATOM   1683 C CE1 . PHE B 1 84  ? -20.966 34.688 14.391  1.00 76.09  ? 102 PHE B CE1 1 
ATOM   1684 C CE2 . PHE B 1 84  ? -22.255 34.252 16.379  1.00 79.67  ? 102 PHE B CE2 1 
ATOM   1685 C CZ  . PHE B 1 84  ? -22.071 34.108 15.008  1.00 91.27  ? 102 PHE B CZ  1 
ATOM   1686 N N   . VAL B 1 85  ? -18.318 33.159 18.445  1.00 60.51  ? 103 VAL B N   1 
ATOM   1687 C CA  . VAL B 1 85  ? -18.818 32.054 19.253  1.00 66.03  ? 103 VAL B CA  1 
ATOM   1688 C C   . VAL B 1 85  ? -17.685 31.413 20.073  1.00 56.95  ? 103 VAL B C   1 
ATOM   1689 O O   . VAL B 1 85  ? -16.525 31.422 19.651  1.00 57.20  ? 103 VAL B O   1 
ATOM   1690 C CB  . VAL B 1 85  ? -19.510 31.041 18.309  1.00 51.31  ? 103 VAL B CB  1 
ATOM   1691 C CG1 . VAL B 1 85  ? -19.540 29.613 18.832  1.00 51.12  ? 103 VAL B CG1 1 
ATOM   1692 C CG2 . VAL B 1 85  ? -20.831 31.581 17.758  1.00 45.52  ? 103 VAL B CG2 1 
ATOM   1693 N N   . PRO B 1 86  ? -18.014 30.888 21.267  1.00 80.80  ? 104 PRO B N   1 
ATOM   1694 C CA  . PRO B 1 86  ? -17.046 30.193 22.124  1.00 77.42  ? 104 PRO B CA  1 
ATOM   1695 C C   . PRO B 1 86  ? -16.207 29.187 21.342  1.00 68.11  ? 104 PRO B C   1 
ATOM   1696 O O   . PRO B 1 86  ? -16.750 28.315 20.664  1.00 51.50  ? 104 PRO B O   1 
ATOM   1697 C CB  . PRO B 1 86  ? -17.938 29.461 23.128  1.00 67.84  ? 104 PRO B CB  1 
ATOM   1698 C CG  . PRO B 1 86  ? -19.132 30.336 23.254  1.00 62.55  ? 104 PRO B CG  1 
ATOM   1699 C CD  . PRO B 1 86  ? -19.340 30.984 21.905  1.00 80.19  ? 104 PRO B CD  1 
ATOM   1700 N N   . LYS B 1 87  ? -14.890 29.319 21.449  1.00 52.98  ? 105 LYS B N   1 
ATOM   1701 C CA  . LYS B 1 87  ? -13.961 28.458 20.738  1.00 62.76  ? 105 LYS B CA  1 
ATOM   1702 C C   . LYS B 1 87  ? -14.007 27.037 21.283  1.00 64.95  ? 105 LYS B C   1 
ATOM   1703 O O   . LYS B 1 87  ? -13.609 26.787 22.420  1.00 59.76  ? 105 LYS B O   1 
ATOM   1704 C CB  . LYS B 1 87  ? -12.544 29.018 20.857  1.00 58.26  ? 105 LYS B CB  1 
ATOM   1705 C CG  . LYS B 1 87  ? -11.546 28.442 19.871  1.00 50.72  ? 105 LYS B CG  1 
ATOM   1706 C CD  . LYS B 1 87  ? -10.203 29.126 20.034  1.00 43.54  ? 105 LYS B CD  1 
ATOM   1707 C CE  . LYS B 1 87  ? -9.382  29.062 18.751  1.00 76.58  ? 105 LYS B CE  1 
ATOM   1708 N NZ  . LYS B 1 87  ? -8.123  29.876 18.802  1.00 46.90  ? 105 LYS B NZ  1 
ATOM   1709 N N   . ILE B 1 88  ? -14.491 26.108 20.464  1.00 56.86  ? 106 ILE B N   1 
ATOM   1710 C CA  . ILE B 1 88  ? -14.556 24.703 20.843  1.00 45.20  ? 106 ILE B CA  1 
ATOM   1711 C C   . ILE B 1 88  ? -13.160 24.089 20.775  1.00 46.03  ? 106 ILE B C   1 
ATOM   1712 O O   . ILE B 1 88  ? -12.451 24.265 19.785  1.00 68.27  ? 106 ILE B O   1 
ATOM   1713 C CB  . ILE B 1 88  ? -15.525 23.954 19.934  1.00 45.13  ? 106 ILE B CB  1 
ATOM   1714 C CG1 . ILE B 1 88  ? -16.836 24.744 19.835  1.00 37.86  ? 106 ILE B CG1 1 
ATOM   1715 C CG2 . ILE B 1 88  ? -15.725 22.526 20.427  1.00 54.83  ? 106 ILE B CG2 1 
ATOM   1716 C CD1 . ILE B 1 88  ? -17.985 23.986 19.277  1.00 35.84  ? 106 ILE B CD1 1 
ATOM   1717 N N   . PRO B 1 89  ? -12.745 23.393 21.843  1.00 52.47  ? 107 PRO B N   1 
ATOM   1718 C CA  . PRO B 1 89  ? -11.373 22.878 21.965  1.00 58.44  ? 107 PRO B CA  1 
ATOM   1719 C C   . PRO B 1 89  ? -11.224 21.470 21.404  1.00 51.09  ? 107 PRO B C   1 
ATOM   1720 O O   . PRO B 1 89  ? -12.175 20.692 21.426  1.00 44.09  ? 107 PRO B O   1 
ATOM   1721 C CB  . PRO B 1 89  ? -11.147 22.817 23.488  1.00 45.58  ? 107 PRO B CB  1 
ATOM   1722 C CG  . PRO B 1 89  ? -12.522 23.049 24.129  1.00 40.08  ? 107 PRO B CG  1 
ATOM   1723 C CD  . PRO B 1 89  ? -13.552 23.077 23.032  1.00 62.31  ? 107 PRO B CD  1 
ATOM   1724 N N   . TYR B 1 90  ? -10.029 21.150 20.925  1.00 47.19  ? 108 TYR B N   1 
ATOM   1725 C CA  . TYR B 1 90  ? -9.701  19.786 20.529  1.00 44.81  ? 108 TYR B CA  1 
ATOM   1726 C C   . TYR B 1 90  ? -10.333 18.772 21.483  1.00 65.38  ? 108 TYR B C   1 
ATOM   1727 O O   . TYR B 1 90  ? -11.068 17.882 21.046  1.00 53.33  ? 108 TYR B O   1 
ATOM   1728 C CB  . TYR B 1 90  ? -8.185  19.604 20.506  1.00 38.72  ? 108 TYR B CB  1 
ATOM   1729 C CG  . TYR B 1 90  ? -7.708  18.254 20.008  1.00 58.31  ? 108 TYR B CG  1 
ATOM   1730 C CD1 . TYR B 1 90  ? -8.136  17.740 18.789  1.00 60.00  ? 108 TYR B CD1 1 
ATOM   1731 C CD2 . TYR B 1 90  ? -6.798  17.512 20.743  1.00 58.99  ? 108 TYR B CD2 1 
ATOM   1732 C CE1 . TYR B 1 90  ? -7.682  16.509 18.328  1.00 48.87  ? 108 TYR B CE1 1 
ATOM   1733 C CE2 . TYR B 1 90  ? -6.340  16.286 20.294  1.00 51.42  ? 108 TYR B CE2 1 
ATOM   1734 C CZ  . TYR B 1 90  ? -6.782  15.791 19.088  1.00 61.10  ? 108 TYR B CZ  1 
ATOM   1735 O OH  . TYR B 1 90  ? -6.313  14.575 18.654  1.00 48.67  ? 108 TYR B OH  1 
ATOM   1736 N N   . SER B 1 91  ? -10.058 18.920 22.782  1.00 50.89  ? 109 SER B N   1 
ATOM   1737 C CA  . SER B 1 91  ? -10.590 17.999 23.793  1.00 59.45  ? 109 SER B CA  1 
ATOM   1738 C C   . SER B 1 91  ? -12.055 17.634 23.528  1.00 50.13  ? 109 SER B C   1 
ATOM   1739 O O   . SER B 1 91  ? -12.445 16.479 23.680  1.00 44.83  ? 109 SER B O   1 
ATOM   1740 C CB  . SER B 1 91  ? -10.423 18.569 25.211  1.00 43.68  ? 109 SER B CB  1 
ATOM   1741 O OG  . SER B 1 91  ? -11.469 19.475 25.537  1.00 53.56  ? 109 SER B OG  1 
ATOM   1742 N N   . SER B 1 92  ? -12.845 18.620 23.105  1.00 49.08  ? 110 SER B N   1 
ATOM   1743 C CA  . SER B 1 92  ? -14.276 18.437 22.852  1.00 50.54  ? 110 SER B CA  1 
ATOM   1744 C C   . SER B 1 92  ? -14.640 17.629 21.613  1.00 48.99  ? 110 SER B C   1 
ATOM   1745 O O   . SER B 1 92  ? -15.820 17.355 21.397  1.00 58.09  ? 110 SER B O   1 
ATOM   1746 C CB  . SER B 1 92  ? -14.985 19.792 22.734  1.00 48.43  ? 110 SER B CB  1 
ATOM   1747 O OG  . SER B 1 92  ? -15.449 20.252 23.985  1.00 77.57  ? 110 SER B OG  1 
ATOM   1748 N N   . PHE B 1 93  ? -13.669 17.275 20.776  1.00 53.71  ? 111 PHE B N   1 
ATOM   1749 C CA  . PHE B 1 93  ? -14.017 16.559 19.545  1.00 46.95  ? 111 PHE B CA  1 
ATOM   1750 C C   . PHE B 1 93  ? -12.980 15.562 19.034  1.00 58.80  ? 111 PHE B C   1 
ATOM   1751 O O   . PHE B 1 93  ? -13.192 14.913 18.002  1.00 57.46  ? 111 PHE B O   1 
ATOM   1752 C CB  . PHE B 1 93  ? -14.436 17.532 18.430  1.00 45.99  ? 111 PHE B CB  1 
ATOM   1753 C CG  . PHE B 1 93  ? -13.407 18.593 18.101  1.00 57.17  ? 111 PHE B CG  1 
ATOM   1754 C CD1 . PHE B 1 93  ? -12.410 18.352 17.154  1.00 51.06  ? 111 PHE B CD1 1 
ATOM   1755 C CD2 . PHE B 1 93  ? -13.458 19.844 18.707  1.00 51.29  ? 111 PHE B CD2 1 
ATOM   1756 C CE1 . PHE B 1 93  ? -11.460 19.337 16.833  1.00 42.36  ? 111 PHE B CE1 1 
ATOM   1757 C CE2 . PHE B 1 93  ? -12.517 20.834 18.392  1.00 52.66  ? 111 PHE B CE2 1 
ATOM   1758 C CZ  . PHE B 1 93  ? -11.518 20.581 17.450  1.00 50.44  ? 111 PHE B CZ  1 
ATOM   1759 N N   . SER B 1 94  ? -11.876 15.423 19.764  1.00 54.53  ? 112 SER B N   1 
ATOM   1760 C CA  . SER B 1 94  ? -10.792 14.535 19.346  1.00 49.83  ? 112 SER B CA  1 
ATOM   1761 C C   . SER B 1 94  ? -11.283 13.100 19.184  1.00 60.85  ? 112 SER B C   1 
ATOM   1762 O O   . SER B 1 94  ? -10.560 12.234 18.699  1.00 55.34  ? 112 SER B O   1 
ATOM   1763 C CB  . SER B 1 94  ? -9.637  14.573 20.349  1.00 53.14  ? 112 SER B CB  1 
ATOM   1764 O OG  . SER B 1 94  ? -9.991  13.921 21.562  1.00 68.32  ? 112 SER B OG  1 
ATOM   1765 N N   . SER B 1 95  ? -12.519 12.850 19.591  1.00 52.61  ? 113 SER B N   1 
ATOM   1766 C CA  . SER B 1 95  ? -13.045 11.497 19.579  1.00 64.28  ? 113 SER B CA  1 
ATOM   1767 C C   . SER B 1 95  ? -14.184 11.385 18.593  1.00 55.00  ? 113 SER B C   1 
ATOM   1768 O O   . SER B 1 95  ? -14.582 10.286 18.213  1.00 61.35  ? 113 SER B O   1 
ATOM   1769 C CB  . SER B 1 95  ? -13.518 11.102 20.976  1.00 67.45  ? 113 SER B CB  1 
ATOM   1770 O OG  . SER B 1 95  ? -12.479 11.294 21.925  1.00 94.52  ? 113 SER B OG  1 
ATOM   1771 N N   . ALA B 1 96  ? -14.709 12.526 18.172  1.00 40.58  ? 114 ALA B N   1 
ATOM   1772 C CA  . ALA B 1 96  ? -15.801 12.511 17.215  1.00 45.17  ? 114 ALA B CA  1 
ATOM   1773 C C   . ALA B 1 96  ? -15.368 11.723 15.981  1.00 51.87  ? 114 ALA B C   1 
ATOM   1774 O O   . ALA B 1 96  ? -14.170 11.595 15.707  1.00 51.82  ? 114 ALA B O   1 
ATOM   1775 C CB  . ALA B 1 96  ? -16.218 13.928 16.855  1.00 38.05  ? 114 ALA B CB  1 
ATOM   1776 N N   . PRO B 1 97  ? -16.341 11.170 15.246  1.00 55.10  ? 115 PRO B N   1 
ATOM   1777 C CA  . PRO B 1 97  ? -16.106 10.313 14.076  1.00 58.38  ? 115 PRO B CA  1 
ATOM   1778 C C   . PRO B 1 97  ? -15.309 10.974 12.946  1.00 65.98  ? 115 PRO B C   1 
ATOM   1779 O O   . PRO B 1 97  ? -15.662 12.051 12.463  1.00 51.17  ? 115 PRO B O   1 
ATOM   1780 C CB  . PRO B 1 97  ? -17.521 9.995  13.590  1.00 57.27  ? 115 PRO B CB  1 
ATOM   1781 C CG  . PRO B 1 97  ? -18.373 10.153 14.786  1.00 53.38  ? 115 PRO B CG  1 
ATOM   1782 C CD  . PRO B 1 97  ? -17.770 11.257 15.586  1.00 56.44  ? 115 PRO B CD  1 
ATOM   1783 N N   . GLY B 1 98  ? -14.242 10.307 12.517  1.00 78.13  ? 116 GLY B N   1 
ATOM   1784 C CA  . GLY B 1 98  ? -13.458 10.771 11.387  1.00 60.83  ? 116 GLY B CA  1 
ATOM   1785 C C   . GLY B 1 98  ? -12.359 11.728 11.803  1.00 71.35  ? 116 GLY B C   1 
ATOM   1786 O O   . GLY B 1 98  ? -11.463 12.044 11.019  1.00 45.35  ? 116 GLY B O   1 
ATOM   1787 N N   . VAL B 1 99  ? -12.420 12.198 13.044  1.00 59.05  ? 117 VAL B N   1 
ATOM   1788 C CA  . VAL B 1 99  ? -11.417 13.139 13.512  1.00 52.10  ? 117 VAL B CA  1 
ATOM   1789 C C   . VAL B 1 99  ? -10.169 12.359 13.882  1.00 57.01  ? 117 VAL B C   1 
ATOM   1790 O O   . VAL B 1 99  ? -9.902  12.090 15.049  1.00 56.09  ? 117 VAL B O   1 
ATOM   1791 C CB  . VAL B 1 99  ? -11.928 14.000 14.680  1.00 49.96  ? 117 VAL B CB  1 
ATOM   1792 C CG1 . VAL B 1 99  ? -10.842 14.958 15.161  1.00 34.40  ? 117 VAL B CG1 1 
ATOM   1793 C CG2 . VAL B 1 99  ? -13.169 14.773 14.247  1.00 34.48  ? 117 VAL B CG2 1 
ATOM   1794 N N   . ILE B 1 100 ? -9.397  11.995 12.869  1.00 38.77  ? 118 ILE B N   1 
ATOM   1795 C CA  . ILE B 1 100 ? -8.321  11.057 13.092  1.00 45.57  ? 118 ILE B CA  1 
ATOM   1796 C C   . ILE B 1 100 ? -6.953  11.691 13.264  1.00 32.22  ? 118 ILE B C   1 
ATOM   1797 O O   . ILE B 1 100 ? -6.010  11.002 13.629  1.00 42.87  ? 118 ILE B O   1 
ATOM   1798 C CB  . ILE B 1 100 ? -8.259  9.998  11.972  1.00 60.54  ? 118 ILE B CB  1 
ATOM   1799 C CG1 . ILE B 1 100 ? -8.041  10.676 10.616  1.00 43.89  ? 118 ILE B CG1 1 
ATOM   1800 C CG2 . ILE B 1 100 ? -9.523  9.153  11.984  1.00 43.08  ? 118 ILE B CG2 1 
ATOM   1801 C CD1 . ILE B 1 100 ? -7.846  9.729  9.466   1.00 54.47  ? 118 ILE B CD1 1 
ATOM   1802 N N   . PHE B 1 101 ? -6.822  12.985 12.998  1.00 35.47  ? 119 PHE B N   1 
ATOM   1803 C CA  . PHE B 1 101 ? -5.520  13.617 13.220  1.00 51.94  ? 119 PHE B CA  1 
ATOM   1804 C C   . PHE B 1 101 ? -5.241  13.793 14.717  1.00 40.96  ? 119 PHE B C   1 
ATOM   1805 O O   . PHE B 1 101 ? -6.158  13.698 15.529  1.00 45.76  ? 119 PHE B O   1 
ATOM   1806 C CB  . PHE B 1 101 ? -5.322  14.917 12.416  1.00 44.57  ? 119 PHE B CB  1 
ATOM   1807 C CG  . PHE B 1 101 ? -6.276  16.030 12.769  1.00 43.75  ? 119 PHE B CG  1 
ATOM   1808 C CD1 . PHE B 1 101 ? -7.146  15.925 13.842  1.00 43.56  ? 119 PHE B CD1 1 
ATOM   1809 C CD2 . PHE B 1 101 ? -6.275  17.208 12.029  1.00 48.02  ? 119 PHE B CD2 1 
ATOM   1810 C CE1 . PHE B 1 101 ? -8.017  16.969 14.162  1.00 38.45  ? 119 PHE B CE1 1 
ATOM   1811 C CE2 . PHE B 1 101 ? -7.128  18.257 12.346  1.00 50.25  ? 119 PHE B CE2 1 
ATOM   1812 C CZ  . PHE B 1 101 ? -8.006  18.137 13.416  1.00 41.21  ? 119 PHE B CZ  1 
ATOM   1813 N N   . ARG B 1 102 ? -3.975  14.017 15.064  1.00 39.66  ? 120 ARG B N   1 
ATOM   1814 C CA  . ARG B 1 102 ? -3.533  14.068 16.456  1.00 42.42  ? 120 ARG B CA  1 
ATOM   1815 C C   . ARG B 1 102 ? -2.516  15.167 16.687  1.00 42.02  ? 120 ARG B C   1 
ATOM   1816 O O   . ARG B 1 102 ? -1.938  15.696 15.747  1.00 54.09  ? 120 ARG B O   1 
ATOM   1817 C CB  . ARG B 1 102 ? -2.936  12.722 16.876  1.00 39.44  ? 120 ARG B CB  1 
ATOM   1818 C CG  . ARG B 1 102 ? -3.999  11.652 17.081  1.00 61.21  ? 120 ARG B CG  1 
ATOM   1819 C CD  . ARG B 1 102 ? -3.591  10.318 16.495  1.00 68.78  ? 120 ARG B CD  1 
ATOM   1820 N NE  . ARG B 1 102 ? -2.790  9.522  17.415  1.00 101.71 ? 120 ARG B NE  1 
ATOM   1821 C CZ  . ARG B 1 102 ? -2.456  8.256  17.192  1.00 125.73 ? 120 ARG B CZ  1 
ATOM   1822 N NH1 . ARG B 1 102 ? -2.858  7.652  16.080  1.00 129.36 ? 120 ARG B NH1 1 
ATOM   1823 N NH2 . ARG B 1 102 ? -1.725  7.594  18.079  1.00 133.16 ? 120 ARG B NH2 1 
ATOM   1824 N N   . GLN B 1 103 ? -2.312  15.517 17.948  1.00 38.44  ? 121 GLN B N   1 
ATOM   1825 C CA  . GLN B 1 103 ? -1.271  16.467 18.313  1.00 47.41  ? 121 GLN B CA  1 
ATOM   1826 C C   . GLN B 1 103 ? -0.011  16.266 17.484  1.00 35.92  ? 121 GLN B C   1 
ATOM   1827 O O   . GLN B 1 103 ? 0.499   15.155 17.355  1.00 41.34  ? 121 GLN B O   1 
ATOM   1828 C CB  . GLN B 1 103 ? -0.924  16.329 19.793  1.00 33.71  ? 121 GLN B CB  1 
ATOM   1829 C CG  . GLN B 1 103 ? 0.324   17.081 20.222  1.00 50.78  ? 121 GLN B CG  1 
ATOM   1830 C CD  . GLN B 1 103 ? 0.540   17.026 21.738  1.00 63.79  ? 121 GLN B CD  1 
ATOM   1831 O OE1 . GLN B 1 103 ? -0.398  16.788 22.498  1.00 47.21  ? 121 GLN B OE1 1 
ATOM   1832 N NE2 . GLN B 1 103 ? 1.773   17.243 22.174  1.00 35.12  ? 121 GLN B NE2 1 
ATOM   1833 N N   . GLU B 1 104 ? 0.507   17.361 16.951  1.00 33.44  ? 122 GLU B N   1 
ATOM   1834 C CA  . GLU B 1 104 ? 1.691   17.312 16.112  1.00 38.78  ? 122 GLU B CA  1 
ATOM   1835 C C   . GLU B 1 104 ? 2.988   17.113 16.872  1.00 39.06  ? 122 GLU B C   1 
ATOM   1836 O O   . GLU B 1 104 ? 3.232   17.748 17.899  1.00 47.17  ? 122 GLU B O   1 
ATOM   1837 C CB  . GLU B 1 104 ? 1.807   18.591 15.294  1.00 43.27  ? 122 GLU B CB  1 
ATOM   1838 C CG  . GLU B 1 104 ? 0.668   18.814 14.334  1.00 41.62  ? 122 GLU B CG  1 
ATOM   1839 C CD  . GLU B 1 104 ? 0.968   19.947 13.394  1.00 48.15  ? 122 GLU B CD  1 
ATOM   1840 O OE1 . GLU B 1 104 ? 2.053   19.910 12.773  1.00 53.55  ? 122 GLU B OE1 1 
ATOM   1841 O OE2 . GLU B 1 104 ? 0.134   20.871 13.283  1.00 56.48  ? 122 GLU B OE2 1 
ATOM   1842 N N   . THR B 1 105 ? 3.828   16.243 16.327  1.00 33.76  ? 123 THR B N   1 
ATOM   1843 C CA  . THR B 1 105 ? 5.167   16.034 16.829  1.00 36.61  ? 123 THR B CA  1 
ATOM   1844 C C   . THR B 1 105 ? 5.923   17.354 16.874  1.00 36.94  ? 123 THR B C   1 
ATOM   1845 O O   . THR B 1 105 ? 5.929   18.101 15.909  1.00 54.51  ? 123 THR B O   1 
ATOM   1846 C CB  . THR B 1 105 ? 5.905   15.007 15.953  1.00 47.50  ? 123 THR B CB  1 
ATOM   1847 O OG1 . THR B 1 105 ? 5.319   13.716 16.158  1.00 60.49  ? 123 THR B OG1 1 
ATOM   1848 C CG2 . THR B 1 105 ? 7.398   14.947 16.281  1.00 31.70  ? 123 THR B CG2 1 
ATOM   1849 N N   . GLY B 1 106 ? 6.539   17.641 18.017  1.00 51.95  ? 124 GLY B N   1 
ATOM   1850 C CA  . GLY B 1 106 ? 7.315   18.857 18.185  1.00 40.85  ? 124 GLY B CA  1 
ATOM   1851 C C   . GLY B 1 106 ? 6.456   19.995 18.692  1.00 54.06  ? 124 GLY B C   1 
ATOM   1852 O O   . GLY B 1 106 ? 6.927   21.122 18.879  1.00 68.45  ? 124 GLY B O   1 
ATOM   1853 N N   . LEU B 1 107 ? 5.184   19.692 18.913  1.00 35.08  ? 125 LEU B N   1 
ATOM   1854 C CA  . LEU B 1 107 ? 4.236   20.675 19.402  1.00 55.64  ? 125 LEU B CA  1 
ATOM   1855 C C   . LEU B 1 107 ? 3.805   20.245 20.800  1.00 61.88  ? 125 LEU B C   1 
ATOM   1856 O O   . LEU B 1 107 ? 3.564   19.064 21.048  1.00 56.58  ? 125 LEU B O   1 
ATOM   1857 C CB  . LEU B 1 107 ? 3.033   20.762 18.452  1.00 43.26  ? 125 LEU B CB  1 
ATOM   1858 C CG  . LEU B 1 107 ? 2.697   22.160 17.922  1.00 51.15  ? 125 LEU B CG  1 
ATOM   1859 C CD1 . LEU B 1 107 ? 3.970   22.933 17.607  1.00 48.40  ? 125 LEU B CD1 1 
ATOM   1860 C CD2 . LEU B 1 107 ? 1.806   22.089 16.693  1.00 44.16  ? 125 LEU B CD2 1 
ATOM   1861 N N   . ASP B 1 108 ? 3.722   21.191 21.725  1.00 55.73  ? 126 ASP B N   1 
ATOM   1862 C CA  . ASP B 1 108 ? 3.354   20.835 23.095  1.00 78.47  ? 126 ASP B CA  1 
ATOM   1863 C C   . ASP B 1 108 ? 1.908   21.176 23.440  1.00 54.26  ? 126 ASP B C   1 
ATOM   1864 O O   . ASP B 1 108 ? 1.496   21.060 24.582  1.00 69.27  ? 126 ASP B O   1 
ATOM   1865 C CB  . ASP B 1 108 ? 4.307   21.471 24.105  1.00 88.38  ? 126 ASP B CB  1 
ATOM   1866 C CG  . ASP B 1 108 ? 4.320   22.977 24.017  1.00 106.10 ? 126 ASP B CG  1 
ATOM   1867 O OD1 . ASP B 1 108 ? 3.302   23.555 23.576  1.00 103.63 ? 126 ASP B OD1 1 
ATOM   1868 O OD2 . ASP B 1 108 ? 5.349   23.581 24.386  1.00 119.43 ? 126 ASP B OD2 1 
ATOM   1869 N N   . HIS B 1 109 ? 1.140   21.597 22.449  1.00 63.50  ? 127 HIS B N   1 
ATOM   1870 C CA  . HIS B 1 109 ? -0.287  21.780 22.649  1.00 60.03  ? 127 HIS B CA  1 
ATOM   1871 C C   . HIS B 1 109 ? -1.049  21.013 21.575  1.00 59.61  ? 127 HIS B C   1 
ATOM   1872 O O   . HIS B 1 109 ? -0.484  20.601 20.564  1.00 69.60  ? 127 HIS B O   1 
ATOM   1873 C CB  . HIS B 1 109 ? -0.664  23.266 22.630  1.00 51.08  ? 127 HIS B CB  1 
ATOM   1874 C CG  . HIS B 1 109 ? -0.423  23.934 21.313  1.00 69.99  ? 127 HIS B CG  1 
ATOM   1875 N ND1 . HIS B 1 109 ? 0.731   24.634 21.032  1.00 72.34  ? 127 HIS B ND1 1 
ATOM   1876 C CD2 . HIS B 1 109 ? -1.188  24.006 20.197  1.00 77.13  ? 127 HIS B CD2 1 
ATOM   1877 C CE1 . HIS B 1 109 ? 0.666   25.109 19.800  1.00 81.29  ? 127 HIS B CE1 1 
ATOM   1878 N NE2 . HIS B 1 109 ? -0.489  24.744 19.271  1.00 68.89  ? 127 HIS B NE2 1 
ATOM   1879 N N   . ASP B 1 110 ? -2.337  20.820 21.810  1.00 35.85  ? 128 ASP B N   1 
ATOM   1880 C CA  . ASP B 1 110 ? -3.202  20.126 20.880  1.00 45.84  ? 128 ASP B CA  1 
ATOM   1881 C C   . ASP B 1 110 ? -3.548  20.970 19.648  1.00 54.06  ? 128 ASP B C   1 
ATOM   1882 O O   . ASP B 1 110 ? -3.267  22.166 19.596  1.00 49.39  ? 128 ASP B O   1 
ATOM   1883 C CB  . ASP B 1 110 ? -4.491  19.727 21.596  1.00 55.94  ? 128 ASP B CB  1 
ATOM   1884 C CG  . ASP B 1 110 ? -4.254  18.723 22.712  1.00 79.67  ? 128 ASP B CG  1 
ATOM   1885 O OD1 . ASP B 1 110 ? -3.293  17.921 22.599  1.00 51.15  ? 128 ASP B OD1 1 
ATOM   1886 O OD2 . ASP B 1 110 ? -5.032  18.737 23.696  1.00 77.94  ? 128 ASP B OD2 1 
ATOM   1887 N N   . PRO B 1 111 ? -4.150  20.330 18.641  1.00 43.30  ? 129 PRO B N   1 
ATOM   1888 C CA  . PRO B 1 111 ? -4.742  21.016 17.487  1.00 53.21  ? 129 PRO B CA  1 
ATOM   1889 C C   . PRO B 1 111 ? -5.813  22.021 17.901  1.00 41.49  ? 129 PRO B C   1 
ATOM   1890 O O   . PRO B 1 111 ? -6.726  21.690 18.649  1.00 44.85  ? 129 PRO B O   1 
ATOM   1891 C CB  . PRO B 1 111 ? -5.372  19.868 16.692  1.00 44.28  ? 129 PRO B CB  1 
ATOM   1892 C CG  . PRO B 1 111 ? -4.493  18.691 17.017  1.00 47.80  ? 129 PRO B CG  1 
ATOM   1893 C CD  . PRO B 1 111 ? -4.121  18.867 18.462  1.00 44.57  ? 129 PRO B CD  1 
ATOM   1894 N N   . GLU B 1 112 ? -5.708  23.242 17.397  1.00 33.67  ? 130 GLU B N   1 
ATOM   1895 C CA  . GLU B 1 112 ? -6.629  24.291 17.786  1.00 44.48  ? 130 GLU B CA  1 
ATOM   1896 C C   . GLU B 1 112 ? -7.091  25.043 16.544  1.00 41.21  ? 130 GLU B C   1 
ATOM   1897 O O   . GLU B 1 112 ? -6.290  25.321 15.647  1.00 36.20  ? 130 GLU B O   1 
ATOM   1898 C CB  . GLU B 1 112 ? -5.914  25.250 18.744  1.00 30.22  ? 130 GLU B CB  1 
ATOM   1899 C CG  . GLU B 1 112 ? -4.854  26.091 18.037  1.00 56.82  ? 130 GLU B CG  1 
ATOM   1900 C CD  . GLU B 1 112 ? -3.803  26.662 18.970  1.00 78.64  ? 130 GLU B CD  1 
ATOM   1901 O OE1 . GLU B 1 112 ? -4.103  26.845 20.171  1.00 74.63  ? 130 GLU B OE1 1 
ATOM   1902 O OE2 . GLU B 1 112 ? -2.672  26.929 18.494  1.00 77.79  ? 130 GLU B OE2 1 
ATOM   1903 N N   . TRP B 1 113 ? -8.374  25.378 16.477  1.00 38.57  ? 131 TRP B N   1 
ATOM   1904 C CA  . TRP B 1 113 ? -8.822  26.289 15.427  1.00 35.45  ? 131 TRP B CA  1 
ATOM   1905 C C   . TRP B 1 113 ? -8.060  27.605 15.518  1.00 43.13  ? 131 TRP B C   1 
ATOM   1906 O O   . TRP B 1 113 ? -7.781  28.096 16.600  1.00 39.51  ? 131 TRP B O   1 
ATOM   1907 C CB  . TRP B 1 113 ? -10.319 26.533 15.502  1.00 37.67  ? 131 TRP B CB  1 
ATOM   1908 C CG  . TRP B 1 113 ? -11.118 25.420 14.920  1.00 40.78  ? 131 TRP B CG  1 
ATOM   1909 C CD1 . TRP B 1 113 ? -11.864 24.513 15.601  1.00 45.59  ? 131 TRP B CD1 1 
ATOM   1910 C CD2 . TRP B 1 113 ? -11.241 25.083 13.534  1.00 39.10  ? 131 TRP B CD2 1 
ATOM   1911 N NE1 . TRP B 1 113 ? -12.453 23.634 14.732  1.00 41.45  ? 131 TRP B NE1 1 
ATOM   1912 C CE2 . TRP B 1 113 ? -12.087 23.960 13.453  1.00 49.53  ? 131 TRP B CE2 1 
ATOM   1913 C CE3 . TRP B 1 113 ? -10.726 25.626 12.354  1.00 50.78  ? 131 TRP B CE3 1 
ATOM   1914 C CZ2 . TRP B 1 113 ? -12.431 23.362 12.234  1.00 53.24  ? 131 TRP B CZ2 1 
ATOM   1915 C CZ3 . TRP B 1 113 ? -11.066 25.033 11.142  1.00 63.48  ? 131 TRP B CZ3 1 
ATOM   1916 C CH2 . TRP B 1 113 ? -11.911 23.910 11.094  1.00 47.33  ? 131 TRP B CH2 1 
ATOM   1917 N N   . VAL B 1 114 ? -7.690  28.156 14.371  1.00 52.96  ? 132 VAL B N   1 
ATOM   1918 C CA  . VAL B 1 114 ? -6.920  29.396 14.332  1.00 42.39  ? 132 VAL B CA  1 
ATOM   1919 C C   . VAL B 1 114 ? -7.505  30.317 13.277  1.00 44.44  ? 132 VAL B C   1 
ATOM   1920 O O   . VAL B 1 114 ? -7.495  29.992 12.093  1.00 48.48  ? 132 VAL B O   1 
ATOM   1921 C CB  . VAL B 1 114 ? -5.428  29.135 14.029  1.00 41.53  ? 132 VAL B CB  1 
ATOM   1922 C CG1 . VAL B 1 114 ? -4.743  30.411 13.496  1.00 26.94  ? 132 VAL B CG1 1 
ATOM   1923 C CG2 . VAL B 1 114 ? -4.731  28.605 15.265  1.00 42.12  ? 132 VAL B CG2 1 
ATOM   1924 N N   . VAL B 1 115 ? -8.019  31.461 13.714  1.00 39.86  ? 133 VAL B N   1 
ATOM   1925 C CA  . VAL B 1 115 ? -8.685  32.398 12.821  1.00 45.47  ? 133 VAL B CA  1 
ATOM   1926 C C   . VAL B 1 115 ? -7.711  33.236 11.987  1.00 43.61  ? 133 VAL B C   1 
ATOM   1927 O O   . VAL B 1 115 ? -6.804  33.871 12.524  1.00 41.26  ? 133 VAL B O   1 
ATOM   1928 C CB  . VAL B 1 115 ? -9.609  33.343 13.612  1.00 46.89  ? 133 VAL B CB  1 
ATOM   1929 C CG1 . VAL B 1 115 ? -10.188 34.427 12.699  1.00 35.47  ? 133 VAL B CG1 1 
ATOM   1930 C CG2 . VAL B 1 115 ? -10.704 32.552 14.286  1.00 38.28  ? 133 VAL B CG2 1 
ATOM   1931 N N   . ASN B 1 116 ? -7.911  33.232 10.673  1.00 36.64  ? 134 ASN B N   1 
ATOM   1932 C CA  . ASN B 1 116 ? -7.122  34.068 9.774   1.00 41.72  ? 134 ASN B CA  1 
ATOM   1933 C C   . ASN B 1 116 ? -7.552  35.524 9.871   1.00 42.40  ? 134 ASN B C   1 
ATOM   1934 O O   . ASN B 1 116 ? -8.573  35.920 9.295   1.00 39.71  ? 134 ASN B O   1 
ATOM   1935 C CB  . ASN B 1 116 ? -7.266  33.586 8.335   1.00 42.05  ? 134 ASN B CB  1 
ATOM   1936 C CG  . ASN B 1 116 ? -6.344  34.315 7.378   1.00 44.90  ? 134 ASN B CG  1 
ATOM   1937 O OD1 . ASN B 1 116 ? -5.672  35.285 7.740   1.00 38.61  ? 134 ASN B OD1 1 
ATOM   1938 N ND2 . ASN B 1 116 ? -6.312  33.847 6.137   1.00 45.40  ? 134 ASN B ND2 1 
ATOM   1939 N N   . MET B 1 117 ? -6.767  36.315 10.596  1.00 36.02  ? 135 MET B N   1 
ATOM   1940 C CA  . MET B 1 117 ? -7.086  37.721 10.799  1.00 49.79  ? 135 MET B CA  1 
ATOM   1941 C C   . MET B 1 117 ? -6.720  38.569 9.585   1.00 57.82  ? 135 MET B C   1 
ATOM   1942 O O   . MET B 1 117 ? -7.321  39.610 9.350   1.00 59.15  ? 135 MET B O   1 
ATOM   1943 C CB  . MET B 1 117 ? -6.409  38.260 12.062  1.00 37.78  ? 135 MET B CB  1 
ATOM   1944 C CG  . MET B 1 117 ? -6.964  37.671 13.373  1.00 49.49  ? 135 MET B CG  1 
ATOM   1945 S SD  . MET B 1 117 ? -8.778  37.733 13.525  1.00 48.33  ? 135 MET B SD  1 
ATOM   1946 C CE  . MET B 1 117 ? -9.058  39.485 13.734  1.00 41.07  ? 135 MET B CE  1 
ATOM   1947 N N   . LYS B 1 118 ? -5.739  38.123 8.809   1.00 34.86  ? 136 LYS B N   1 
ATOM   1948 C CA  . LYS B 1 118 ? -5.333  38.876 7.636   1.00 57.35  ? 136 LYS B CA  1 
ATOM   1949 C C   . LYS B 1 118 ? -6.357  38.816 6.495   1.00 64.29  ? 136 LYS B C   1 
ATOM   1950 O O   . LYS B 1 118 ? -6.183  39.484 5.478   1.00 61.23  ? 136 LYS B O   1 
ATOM   1951 C CB  . LYS B 1 118 ? -3.959  38.416 7.136   1.00 44.26  ? 136 LYS B CB  1 
ATOM   1952 C CG  . LYS B 1 118 ? -2.828  38.650 8.125   1.00 61.87  ? 136 LYS B CG  1 
ATOM   1953 C CD  . LYS B 1 118 ? -2.732  37.524 9.137   1.00 57.44  ? 136 LYS B CD  1 
ATOM   1954 C CE  . LYS B 1 118 ? -2.385  36.210 8.456   1.00 51.57  ? 136 LYS B CE  1 
ATOM   1955 N NZ  . LYS B 1 118 ? -2.224  35.132 9.457   1.00 36.97  ? 136 LYS B NZ  1 
ATOM   1956 N N   . ALA B 1 119 ? -7.419  38.031 6.650   1.00 44.44  ? 137 ALA B N   1 
ATOM   1957 C CA  . ALA B 1 119 ? -8.381  37.874 5.555   1.00 44.45  ? 137 ALA B CA  1 
ATOM   1958 C C   . ALA B 1 119 ? -9.734  38.501 5.835   1.00 40.37  ? 137 ALA B C   1 
ATOM   1959 O O   . ALA B 1 119 ? -10.249 38.430 6.955   1.00 61.48  ? 137 ALA B O   1 
ATOM   1960 C CB  . ALA B 1 119 ? -8.553  36.408 5.173   1.00 37.28  ? 137 ALA B CB  1 
ATOM   1961 N N   . ARG B 1 120 ? -10.296 39.104 4.789   1.00 48.84  ? 138 ARG B N   1 
ATOM   1962 C CA  . ARG B 1 120 ? -11.623 39.709 4.816   1.00 51.31  ? 138 ARG B CA  1 
ATOM   1963 C C   . ARG B 1 120 ? -12.578 38.938 5.711   1.00 55.03  ? 138 ARG B C   1 
ATOM   1964 O O   . ARG B 1 120 ? -12.610 37.701 5.700   1.00 51.61  ? 138 ARG B O   1 
ATOM   1965 C CB  . ARG B 1 120 ? -12.220 39.769 3.399   1.00 56.98  ? 138 ARG B CB  1 
ATOM   1966 C CG  . ARG B 1 120 ? -11.957 41.056 2.625   1.00 54.13  ? 138 ARG B CG  1 
ATOM   1967 C CD  . ARG B 1 120 ? -10.472 41.351 2.525   1.00 94.40  ? 138 ARG B CD  1 
ATOM   1968 N NE  . ARG B 1 120 ? -10.108 42.195 1.384   1.00 75.94  ? 138 ARG B NE  1 
ATOM   1969 C CZ  . ARG B 1 120 ? -10.374 43.495 1.298   1.00 80.86  ? 138 ARG B CZ  1 
ATOM   1970 N NH1 . ARG B 1 120 ? -11.032 44.108 2.274   1.00 75.94  ? 138 ARG B NH1 1 
ATOM   1971 N NH2 . ARG B 1 120 ? -9.987  44.181 0.231   1.00 70.78  ? 138 ARG B NH2 1 
ATOM   1972 N N   . THR B 1 121 ? -13.359 39.673 6.488   1.00 39.59  ? 139 THR B N   1 
ATOM   1973 C CA  . THR B 1 121 ? -14.487 39.069 7.166   1.00 62.07  ? 139 THR B CA  1 
ATOM   1974 C C   . THR B 1 121 ? -15.475 38.722 6.070   1.00 52.68  ? 139 THR B C   1 
ATOM   1975 O O   . THR B 1 121 ? -15.472 39.353 5.013   1.00 58.38  ? 139 THR B O   1 
ATOM   1976 C CB  . THR B 1 121 ? -15.131 40.035 8.172   1.00 61.58  ? 139 THR B CB  1 
ATOM   1977 O OG1 . THR B 1 121 ? -15.541 41.228 7.494   1.00 36.01  ? 139 THR B OG1 1 
ATOM   1978 C CG2 . THR B 1 121 ? -14.135 40.388 9.288   1.00 32.01  ? 139 THR B CG2 1 
ATOM   1979 N N   . ARG B 1 122 ? -16.300 37.709 6.297   1.00 43.95  ? 140 ARG B N   1 
ATOM   1980 C CA  . ARG B 1 122 ? -17.288 37.330 5.301   1.00 38.19  ? 140 ARG B CA  1 
ATOM   1981 C C   . ARG B 1 122 ? -18.539 36.837 5.982   1.00 44.37  ? 140 ARG B C   1 
ATOM   1982 O O   . ARG B 1 122 ? -18.550 36.641 7.196   1.00 46.97  ? 140 ARG B O   1 
ATOM   1983 C CB  . ARG B 1 122 ? -16.735 36.253 4.363   1.00 42.83  ? 140 ARG B CB  1 
ATOM   1984 C CG  . ARG B 1 122 ? -16.633 34.858 4.969   1.00 37.71  ? 140 ARG B CG  1 
ATOM   1985 C CD  . ARG B 1 122 ? -15.496 34.786 5.977   1.00 43.21  ? 140 ARG B CD  1 
ATOM   1986 N NE  . ARG B 1 122 ? -14.241 35.263 5.409   1.00 40.14  ? 140 ARG B NE  1 
ATOM   1987 C CZ  . ARG B 1 122 ? -13.437 34.506 4.668   1.00 42.57  ? 140 ARG B CZ  1 
ATOM   1988 N NH1 . ARG B 1 122 ? -13.776 33.248 4.419   1.00 29.58  ? 140 ARG B NH1 1 
ATOM   1989 N NH2 . ARG B 1 122 ? -12.303 34.995 4.175   1.00 20.37  ? 140 ARG B NH2 1 
ATOM   1990 N N   . GLY B 1 123 ? -19.591 36.628 5.197   1.00 40.82  ? 141 GLY B N   1 
ATOM   1991 C CA  . GLY B 1 123 ? -20.842 36.124 5.732   1.00 40.90  ? 141 GLY B CA  1 
ATOM   1992 C C   . GLY B 1 123 ? -20.647 34.810 6.469   1.00 56.55  ? 141 GLY B C   1 
ATOM   1993 O O   . GLY B 1 123 ? -19.562 34.224 6.432   1.00 59.30  ? 141 GLY B O   1 
ATOM   1994 N N   . CYS B 1 124 ? -21.691 34.351 7.152   1.00 36.33  ? 142 CYS B N   1 
ATOM   1995 C CA  . CYS B 1 124 ? -21.656 33.041 7.788   1.00 60.17  ? 142 CYS B CA  1 
ATOM   1996 C C   . CYS B 1 124 ? -22.581 32.105 7.048   1.00 54.06  ? 142 CYS B C   1 
ATOM   1997 O O   . CYS B 1 124 ? -22.573 30.892 7.273   1.00 52.85  ? 142 CYS B O   1 
ATOM   1998 C CB  . CYS B 1 124 ? -22.057 33.126 9.259   1.00 57.34  ? 142 CYS B CB  1 
ATOM   1999 S SG  . CYS B 1 124 ? -20.844 33.989 10.253  1.00 75.82  ? 142 CYS B SG  1 
ATOM   2000 N N   . ASP B 1 125 ? -23.394 32.694 6.178   1.00 55.74  ? 143 ASP B N   1 
ATOM   2001 C CA  . ASP B 1 125 ? -24.221 31.936 5.248   1.00 78.26  ? 143 ASP B CA  1 
ATOM   2002 C C   . ASP B 1 125 ? -23.761 32.179 3.810   1.00 71.18  ? 143 ASP B C   1 
ATOM   2003 O O   . ASP B 1 125 ? -23.323 33.277 3.448   1.00 47.67  ? 143 ASP B O   1 
ATOM   2004 C CB  . ASP B 1 125 ? -25.700 32.298 5.408   1.00 69.66  ? 143 ASP B CB  1 
ATOM   2005 C CG  . ASP B 1 125 ? -26.286 31.797 6.718   1.00 93.36  ? 143 ASP B CG  1 
ATOM   2006 O OD1 . ASP B 1 125 ? -27.137 32.506 7.307   1.00 82.31  ? 143 ASP B OD1 1 
ATOM   2007 O OD2 . ASP B 1 125 ? -25.890 30.695 7.159   1.00 85.72  ? 143 ASP B OD2 1 
ATOM   2008 N N   . HIS B 1 126 ? -23.849 31.140 2.995   1.00 66.08  ? 144 HIS B N   1 
ATOM   2009 C CA  . HIS B 1 126 ? -23.467 31.247 1.601   1.00 61.72  ? 144 HIS B CA  1 
ATOM   2010 C C   . HIS B 1 126 ? -24.708 31.386 0.728   1.00 60.00  ? 144 HIS B C   1 
ATOM   2011 O O   . HIS B 1 126 ? -25.652 30.603 0.858   1.00 63.30  ? 144 HIS B O   1 
ATOM   2012 C CB  . HIS B 1 126 ? -22.668 30.012 1.185   1.00 45.67  ? 144 HIS B CB  1 
ATOM   2013 C CG  . HIS B 1 126 ? -22.250 30.021 -0.251  1.00 43.21  ? 144 HIS B CG  1 
ATOM   2014 N ND1 . HIS B 1 126 ? -20.988 30.400 -0.655  1.00 37.32  ? 144 HIS B ND1 1 
ATOM   2015 C CD2 . HIS B 1 126 ? -22.927 29.694 -1.378  1.00 37.69  ? 144 HIS B CD2 1 
ATOM   2016 C CE1 . HIS B 1 126 ? -20.904 30.301 -1.971  1.00 42.70  ? 144 HIS B CE1 1 
ATOM   2017 N NE2 . HIS B 1 126 ? -22.067 29.878 -2.434  1.00 51.12  ? 144 HIS B NE2 1 
ATOM   2018 N N   . HIS B 1 127 ? -24.708 32.387 -0.149  1.00 48.40  ? 145 HIS B N   1 
ATOM   2019 C CA  . HIS B 1 127 ? -25.710 32.479 -1.216  1.00 70.43  ? 145 HIS B CA  1 
ATOM   2020 C C   . HIS B 1 127 ? -25.140 32.124 -2.600  1.00 51.77  ? 145 HIS B C   1 
ATOM   2021 O O   . HIS B 1 127 ? -24.155 32.711 -3.053  1.00 45.44  ? 145 HIS B O   1 
ATOM   2022 C CB  . HIS B 1 127 ? -26.354 33.866 -1.234  1.00 68.63  ? 145 HIS B CB  1 
ATOM   2023 C CG  . HIS B 1 127 ? -26.903 34.280 0.093   1.00 73.55  ? 145 HIS B CG  1 
ATOM   2024 N ND1 . HIS B 1 127 ? -26.443 35.384 0.778   1.00 99.57  ? 145 HIS B ND1 1 
ATOM   2025 C CD2 . HIS B 1 127 ? -27.856 33.720 0.876   1.00 64.14  ? 145 HIS B CD2 1 
ATOM   2026 C CE1 . HIS B 1 127 ? -27.097 35.494 1.921   1.00 84.77  ? 145 HIS B CE1 1 
ATOM   2027 N NE2 . HIS B 1 127 ? -27.959 34.496 2.005   1.00 90.95  ? 145 HIS B NE2 1 
ATOM   2028 N N   . HIS B 1 128 ? -25.768 31.161 -3.268  1.00 56.88  ? 146 HIS B N   1 
ATOM   2029 C CA  . HIS B 1 128 ? -25.286 30.696 -4.565  1.00 49.58  ? 146 HIS B CA  1 
ATOM   2030 C C   . HIS B 1 128 ? -25.688 31.598 -5.734  1.00 58.71  ? 146 HIS B C   1 
ATOM   2031 O O   . HIS B 1 128 ? -25.138 31.475 -6.832  1.00 62.13  ? 146 HIS B O   1 
ATOM   2032 C CB  . HIS B 1 128 ? -25.759 29.267 -4.819  1.00 41.67  ? 146 HIS B CB  1 
ATOM   2033 C CG  . HIS B 1 128 ? -25.171 28.260 -3.877  1.00 70.81  ? 146 HIS B CG  1 
ATOM   2034 N ND1 . HIS B 1 128 ? -25.582 28.136 -2.566  1.00 83.56  ? 146 HIS B ND1 1 
ATOM   2035 C CD2 . HIS B 1 128 ? -24.207 27.325 -4.058  1.00 56.52  ? 146 HIS B CD2 1 
ATOM   2036 C CE1 . HIS B 1 128 ? -24.899 27.169 -1.980  1.00 49.90  ? 146 HIS B CE1 1 
ATOM   2037 N NE2 . HIS B 1 128 ? -24.059 26.660 -2.863  1.00 64.23  ? 146 HIS B NE2 1 
ATOM   2038 N N   . HIS B 1 129 ? -26.639 32.502 -5.494  1.00 61.16  ? 147 HIS B N   1 
ATOM   2039 C CA  . HIS B 1 129 ? -27.217 33.322 -6.561  1.00 63.38  ? 147 HIS B CA  1 
ATOM   2040 C C   . HIS B 1 129 ? -27.398 34.800 -6.187  1.00 82.20  ? 147 HIS B C   1 
ATOM   2041 O O   . HIS B 1 129 ? -27.275 35.167 -5.016  1.00 63.96  ? 147 HIS B O   1 
ATOM   2042 C CB  . HIS B 1 129 ? -28.554 32.729 -7.013  1.00 53.57  ? 147 HIS B CB  1 
ATOM   2043 C CG  . HIS B 1 129 ? -28.416 31.471 -7.814  1.00 60.26  ? 147 HIS B CG  1 
ATOM   2044 N ND1 . HIS B 1 129 ? -28.476 30.216 -7.247  1.00 75.68  ? 147 HIS B ND1 1 
ATOM   2045 C CD2 . HIS B 1 129 ? -28.219 31.276 -9.139  1.00 71.06  ? 147 HIS B CD2 1 
ATOM   2046 C CE1 . HIS B 1 129 ? -28.321 29.301 -8.189  1.00 68.89  ? 147 HIS B CE1 1 
ATOM   2047 N NE2 . HIS B 1 129 ? -28.169 29.918 -9.347  1.00 60.66  ? 147 HIS B NE2 1 
ATOM   2048 N N   . HIS B 1 130 ? -27.672 35.628 -7.203  1.00 80.33  ? 148 HIS B N   1 
ATOM   2049 C CA  . HIS B 1 130 ? -27.946 37.068 -7.057  1.00 82.90  ? 148 HIS B CA  1 
ATOM   2050 C C   . HIS B 1 130 ? -27.547 37.880 -8.296  1.00 93.64  ? 148 HIS B C   1 
ATOM   2051 O O   . HIS B 1 130 ? -27.664 39.116 -8.320  1.00 77.51  ? 148 HIS B O   1 
ATOM   2052 C CB  . HIS B 1 130 ? -27.276 37.666 -5.816  1.00 86.48  ? 148 HIS B CB  1 
ATOM   2053 C CG  . HIS B 1 130 ? -28.235 38.005 -4.713  1.00 119.33 ? 148 HIS B CG  1 
ATOM   2054 N ND1 . HIS B 1 130 ? -29.428 38.660 -4.937  1.00 105.69 ? 148 HIS B ND1 1 
ATOM   2055 C CD2 . HIS B 1 130 ? -28.164 37.803 -3.374  1.00 116.30 ? 148 HIS B CD2 1 
ATOM   2056 C CE1 . HIS B 1 130 ? -30.057 38.833 -3.788  1.00 104.30 ? 148 HIS B CE1 1 
ATOM   2057 N NE2 . HIS B 1 130 ? -29.311 38.324 -2.824  1.00 102.68 ? 148 HIS B NE2 1 
ATOM   2058 N N   . ALA C 1 1   ? 28.427  13.611 12.898  1.00 58.74  ? 19  ALA C N   1 
ATOM   2059 C CA  . ALA C 1 1   ? 28.056  14.976 13.271  1.00 69.91  ? 19  ALA C CA  1 
ATOM   2060 C C   . ALA C 1 1   ? 26.604  15.066 13.705  1.00 77.54  ? 19  ALA C C   1 
ATOM   2061 O O   . ALA C 1 1   ? 25.881  14.072 13.688  1.00 96.49  ? 19  ALA C O   1 
ATOM   2062 C CB  . ALA C 1 1   ? 28.310  15.938 12.125  1.00 39.64  ? 19  ALA C CB  1 
ATOM   2063 N N   . TYR C 1 2   ? 26.185  16.263 14.101  1.00 66.10  ? 20  TYR C N   1 
ATOM   2064 C CA  . TYR C 1 2   ? 24.789  16.513 14.430  1.00 64.55  ? 20  TYR C CA  1 
ATOM   2065 C C   . TYR C 1 2   ? 24.005  16.995 13.228  1.00 64.05  ? 20  TYR C C   1 
ATOM   2066 O O   . TYR C 1 2   ? 24.534  17.684 12.359  1.00 60.27  ? 20  TYR C O   1 
ATOM   2067 C CB  . TYR C 1 2   ? 24.667  17.538 15.549  1.00 62.23  ? 20  TYR C CB  1 
ATOM   2068 C CG  . TYR C 1 2   ? 24.755  16.889 16.887  1.00 78.96  ? 20  TYR C CG  1 
ATOM   2069 C CD1 . TYR C 1 2   ? 25.729  17.263 17.799  1.00 78.17  ? 20  TYR C CD1 1 
ATOM   2070 C CD2 . TYR C 1 2   ? 23.885  15.857 17.225  1.00 78.14  ? 20  TYR C CD2 1 
ATOM   2071 C CE1 . TYR C 1 2   ? 25.825  16.642 19.029  1.00 101.84 ? 20  TYR C CE1 1 
ATOM   2072 C CE2 . TYR C 1 2   ? 23.967  15.226 18.449  1.00 69.01  ? 20  TYR C CE2 1 
ATOM   2073 C CZ  . TYR C 1 2   ? 24.942  15.624 19.351  1.00 95.37  ? 20  TYR C CZ  1 
ATOM   2074 O OH  . TYR C 1 2   ? 25.040  15.008 20.579  1.00 74.62  ? 20  TYR C OH  1 
ATOM   2075 N N   . VAL C 1 3   ? 22.732  16.644 13.181  1.00 52.30  ? 21  VAL C N   1 
ATOM   2076 C CA  . VAL C 1 3   ? 21.895  17.160 12.116  1.00 69.13  ? 21  VAL C CA  1 
ATOM   2077 C C   . VAL C 1 3   ? 20.940  18.234 12.616  1.00 56.12  ? 21  VAL C C   1 
ATOM   2078 O O   . VAL C 1 3   ? 20.412  18.179 13.734  1.00 45.95  ? 21  VAL C O   1 
ATOM   2079 C CB  . VAL C 1 3   ? 21.136  16.045 11.341  1.00 77.88  ? 21  VAL C CB  1 
ATOM   2080 C CG1 . VAL C 1 3   ? 22.105  14.946 10.907  1.00 65.48  ? 21  VAL C CG1 1 
ATOM   2081 C CG2 . VAL C 1 3   ? 19.983  15.481 12.168  1.00 44.04  ? 21  VAL C CG2 1 
ATOM   2082 N N   . CYS C 1 4   ? 20.751  19.233 11.770  1.00 42.43  ? 22  CYS C N   1 
ATOM   2083 C CA  . CYS C 1 4   ? 19.789  20.279 12.031  1.00 50.64  ? 22  CYS C CA  1 
ATOM   2084 C C   . CYS C 1 4   ? 18.495  20.016 11.250  1.00 49.39  ? 22  CYS C C   1 
ATOM   2085 O O   . CYS C 1 4   ? 18.372  19.018 10.541  1.00 53.23  ? 22  CYS C O   1 
ATOM   2086 C CB  . CYS C 1 4   ? 20.405  21.637 11.688  1.00 45.04  ? 22  CYS C CB  1 
ATOM   2087 S SG  . CYS C 1 4   ? 21.616  22.188 12.917  1.00 54.84  ? 22  CYS C SG  1 
ATOM   2088 N N   . ARG C 1 5   ? 17.523  20.902 11.407  1.00 40.94  ? 23  ARG C N   1 
ATOM   2089 C CA  . ARG C 1 5   ? 16.247  20.767 10.741  1.00 34.25  ? 23  ARG C CA  1 
ATOM   2090 C C   . ARG C 1 5   ? 15.762  22.153 10.417  1.00 39.68  ? 23  ARG C C   1 
ATOM   2091 O O   . ARG C 1 5   ? 16.349  23.135 10.863  1.00 36.50  ? 23  ARG C O   1 
ATOM   2092 C CB  . ARG C 1 5   ? 15.236  20.041 11.632  1.00 34.52  ? 23  ARG C CB  1 
ATOM   2093 C CG  . ARG C 1 5   ? 15.751  18.727 12.166  1.00 35.86  ? 23  ARG C CG  1 
ATOM   2094 C CD  . ARG C 1 5   ? 14.696  17.998 12.962  1.00 48.03  ? 23  ARG C CD  1 
ATOM   2095 N NE  . ARG C 1 5   ? 13.884  17.128 12.119  1.00 61.67  ? 23  ARG C NE  1 
ATOM   2096 C CZ  . ARG C 1 5   ? 13.950  15.800 12.127  1.00 68.50  ? 23  ARG C CZ  1 
ATOM   2097 N NH1 . ARG C 1 5   ? 14.788  15.165 12.948  1.00 43.11  ? 23  ARG C NH1 1 
ATOM   2098 N NH2 . ARG C 1 5   ? 13.166  15.104 11.315  1.00 65.01  ? 23  ARG C NH2 1 
ATOM   2099 N N   . GLU C 1 6   ? 14.706  22.232 9.619   1.00 38.49  ? 24  GLU C N   1 
ATOM   2100 C CA  . GLU C 1 6   ? 14.044  23.505 9.373   1.00 37.39  ? 24  GLU C CA  1 
ATOM   2101 C C   . GLU C 1 6   ? 13.074  23.852 10.504  1.00 32.21  ? 24  GLU C C   1 
ATOM   2102 O O   . GLU C 1 6   ? 12.316  22.996 10.994  1.00 23.09  ? 24  GLU C O   1 
ATOM   2103 C CB  . GLU C 1 6   ? 13.296  23.477 8.040   1.00 41.83  ? 24  GLU C CB  1 
ATOM   2104 C CG  . GLU C 1 6   ? 12.338  24.633 7.849   1.00 28.95  ? 24  GLU C CG  1 
ATOM   2105 C CD  . GLU C 1 6   ? 11.628  24.591 6.513   1.00 41.50  ? 24  GLU C CD  1 
ATOM   2106 O OE1 . GLU C 1 6   ? 12.311  24.552 5.463   1.00 40.89  ? 24  GLU C OE1 1 
ATOM   2107 O OE2 . GLU C 1 6   ? 10.379  24.609 6.517   1.00 52.99  ? 24  GLU C OE2 1 
ATOM   2108 N N   . ALA C 1 7   ? 13.088  25.113 10.916  1.00 27.14  ? 25  ALA C N   1 
ATOM   2109 C CA  . ALA C 1 7   ? 12.130  25.548 11.923  1.00 28.81  ? 25  ALA C CA  1 
ATOM   2110 C C   . ALA C 1 7   ? 11.587  26.942 11.620  1.00 27.94  ? 25  ALA C C   1 
ATOM   2111 O O   . ALA C 1 7   ? 12.249  27.761 10.983  1.00 27.54  ? 25  ALA C O   1 
ATOM   2112 C CB  . ALA C 1 7   ? 12.752  25.482 13.329  1.00 29.29  ? 25  ALA C CB  1 
ATOM   2113 N N   . SER C 1 8   ? 10.365  27.199 12.064  1.00 24.81  ? 26  SER C N   1 
ATOM   2114 C CA  . SER C 1 8   ? 9.792   28.523 11.900  1.00 38.84  ? 26  SER C CA  1 
ATOM   2115 C C   . SER C 1 8   ? 9.212   29.064 13.179  1.00 33.90  ? 26  SER C C   1 
ATOM   2116 O O   . SER C 1 8   ? 8.844   28.316 14.072  1.00 21.87  ? 26  SER C O   1 
ATOM   2117 C CB  . SER C 1 8   ? 8.720   28.530 10.822  1.00 24.65  ? 26  SER C CB  1 
ATOM   2118 O OG  . SER C 1 8   ? 9.350   28.631 9.558   1.00 49.58  ? 26  SER C OG  1 
ATOM   2119 N N   . ILE C 1 9   ? 9.131   30.382 13.250  1.00 21.23  ? 27  ILE C N   1 
ATOM   2120 C CA  . ILE C 1 9   ? 8.475   31.014 14.359  1.00 28.62  ? 27  ILE C CA  1 
ATOM   2121 C C   . ILE C 1 9   ? 7.639   32.166 13.825  1.00 27.59  ? 27  ILE C C   1 
ATOM   2122 O O   . ILE C 1 9   ? 8.080   32.904 12.947  1.00 30.74  ? 27  ILE C O   1 
ATOM   2123 C CB  . ILE C 1 9   ? 9.506   31.460 15.409  1.00 32.60  ? 27  ILE C CB  1 
ATOM   2124 C CG1 . ILE C 1 9   ? 8.805   32.014 16.654  1.00 30.69  ? 27  ILE C CG1 1 
ATOM   2125 C CG2 . ILE C 1 9   ? 10.501  32.439 14.801  1.00 25.54  ? 27  ILE C CG2 1 
ATOM   2126 C CD1 . ILE C 1 9   ? 9.737   32.143 17.847  1.00 20.66  ? 27  ILE C CD1 1 
ATOM   2127 N N   . SER C 1 10  ? 6.414   32.286 14.328  1.00 24.14  ? 28  SER C N   1 
ATOM   2128 C CA  . SER C 1 10  ? 5.470   33.278 13.830  1.00 30.94  ? 28  SER C CA  1 
ATOM   2129 C C   . SER C 1 10  ? 5.041   34.255 14.897  1.00 37.09  ? 28  SER C C   1 
ATOM   2130 O O   . SER C 1 10  ? 4.877   33.892 16.058  1.00 41.39  ? 28  SER C O   1 
ATOM   2131 C CB  . SER C 1 10  ? 4.236   32.601 13.239  1.00 26.73  ? 28  SER C CB  1 
ATOM   2132 O OG  . SER C 1 10  ? 4.580   31.914 12.052  1.00 37.35  ? 28  SER C OG  1 
ATOM   2133 N N   . GLY C 1 11  ? 4.839   35.497 14.486  1.00 38.84  ? 29  GLY C N   1 
ATOM   2134 C CA  . GLY C 1 11  ? 4.484   36.550 15.414  1.00 42.99  ? 29  GLY C CA  1 
ATOM   2135 C C   . GLY C 1 11  ? 3.689   37.626 14.710  1.00 47.90  ? 29  GLY C C   1 
ATOM   2136 O O   . GLY C 1 11  ? 3.564   37.632 13.490  1.00 43.73  ? 29  GLY C O   1 
ATOM   2137 N N   . GLU C 1 12  ? 3.144   38.546 15.484  1.00 39.55  ? 30  GLU C N   1 
ATOM   2138 C CA  . GLU C 1 12  ? 2.305   39.580 14.924  1.00 33.96  ? 30  GLU C CA  1 
ATOM   2139 C C   . GLU C 1 12  ? 2.949   40.946 15.101  1.00 42.08  ? 30  GLU C C   1 
ATOM   2140 O O   . GLU C 1 12  ? 3.608   41.226 16.105  1.00 40.27  ? 30  GLU C O   1 
ATOM   2141 C CB  . GLU C 1 12  ? 0.940   39.535 15.589  1.00 41.92  ? 30  GLU C CB  1 
ATOM   2142 C CG  . GLU C 1 12  ? -0.062  40.522 15.055  1.00 33.83  ? 30  GLU C CG  1 
ATOM   2143 C CD  . GLU C 1 12  ? -1.445  40.223 15.580  1.00 58.44  ? 30  GLU C CD  1 
ATOM   2144 O OE1 . GLU C 1 12  ? -1.925  40.980 16.456  1.00 53.62  ? 30  GLU C OE1 1 
ATOM   2145 O OE2 . GLU C 1 12  ? -2.035  39.209 15.140  1.00 47.12  ? 30  GLU C OE2 1 
ATOM   2146 N N   . ILE C 1 13  ? 2.777   41.792 14.101  1.00 34.04  ? 31  ILE C N   1 
ATOM   2147 C CA  . ILE C 1 13  ? 3.225   43.166 14.206  1.00 31.10  ? 31  ILE C CA  1 
ATOM   2148 C C   . ILE C 1 13  ? 2.034   44.053 13.884  1.00 43.90  ? 31  ILE C C   1 
ATOM   2149 O O   . ILE C 1 13  ? 1.364   43.852 12.870  1.00 45.02  ? 31  ILE C O   1 
ATOM   2150 C CB  . ILE C 1 13  ? 4.386   43.431 13.250  1.00 39.06  ? 31  ILE C CB  1 
ATOM   2151 C CG1 . ILE C 1 13  ? 5.636   42.718 13.757  1.00 36.33  ? 31  ILE C CG1 1 
ATOM   2152 C CG2 . ILE C 1 13  ? 4.644   44.912 13.125  1.00 32.97  ? 31  ILE C CG2 1 
ATOM   2153 C CD1 . ILE C 1 13  ? 6.802   42.810 12.845  1.00 22.73  ? 31  ILE C CD1 1 
ATOM   2154 N N   . ARG C 1 14  ? 1.746   45.007 14.764  1.00 37.29  ? 32  ARG C N   1 
ATOM   2155 C CA  . ARG C 1 14  ? 0.598   45.891 14.580  1.00 36.77  ? 32  ARG C CA  1 
ATOM   2156 C C   . ARG C 1 14  ? 1.018   47.293 14.205  1.00 38.92  ? 32  ARG C C   1 
ATOM   2157 O O   . ARG C 1 14  ? 2.115   47.733 14.543  1.00 46.59  ? 32  ARG C O   1 
ATOM   2158 C CB  . ARG C 1 14  ? -0.276  45.934 15.833  1.00 48.00  ? 32  ARG C CB  1 
ATOM   2159 C CG  . ARG C 1 14  ? -1.123  44.700 16.011  1.00 75.63  ? 32  ARG C CG  1 
ATOM   2160 C CD  . ARG C 1 14  ? -0.584  43.771 17.081  1.00 89.44  ? 32  ARG C CD  1 
ATOM   2161 N NE  . ARG C 1 14  ? -1.430  43.790 18.272  1.00 103.52 ? 32  ARG C NE  1 
ATOM   2162 C CZ  . ARG C 1 14  ? -1.191  43.081 19.370  1.00 112.42 ? 32  ARG C CZ  1 
ATOM   2163 N NH1 . ARG C 1 14  ? -0.120  42.295 19.433  1.00 87.81  ? 32  ARG C NH1 1 
ATOM   2164 N NH2 . ARG C 1 14  ? -2.020  43.160 20.405  1.00 102.69 ? 32  ARG C NH2 1 
ATOM   2165 N N   . TYR C 1 15  ? 0.134   47.994 13.502  1.00 51.86  ? 33  TYR C N   1 
ATOM   2166 C CA  . TYR C 1 15  ? 0.410   49.361 13.073  1.00 43.89  ? 33  TYR C CA  1 
ATOM   2167 C C   . TYR C 1 15  ? -0.523  50.405 13.712  1.00 52.97  ? 33  TYR C C   1 
ATOM   2168 O O   . TYR C 1 15  ? -1.647  50.085 14.121  1.00 41.69  ? 33  TYR C O   1 
ATOM   2169 C CB  . TYR C 1 15  ? 0.452   49.424 11.543  1.00 57.07  ? 33  TYR C CB  1 
ATOM   2170 C CG  . TYR C 1 15  ? 1.642   48.646 11.034  1.00 47.56  ? 33  TYR C CG  1 
ATOM   2171 C CD1 . TYR C 1 15  ? 2.862   49.274 10.818  1.00 29.52  ? 33  TYR C CD1 1 
ATOM   2172 C CD2 . TYR C 1 15  ? 1.566   47.273 10.840  1.00 42.13  ? 33  TYR C CD2 1 
ATOM   2173 C CE1 . TYR C 1 15  ? 3.967   48.559 10.392  1.00 45.21  ? 33  TYR C CE1 1 
ATOM   2174 C CE2 . TYR C 1 15  ? 2.659   46.552 10.423  1.00 35.72  ? 33  TYR C CE2 1 
ATOM   2175 C CZ  . TYR C 1 15  ? 3.862   47.196 10.199  1.00 49.12  ? 33  TYR C CZ  1 
ATOM   2176 O OH  . TYR C 1 15  ? 4.958   46.475 9.776   1.00 40.00  ? 33  TYR C OH  1 
ATOM   2177 N N   . PRO C 1 16  ? -0.037  51.652 13.838  1.00 47.14  ? 34  PRO C N   1 
ATOM   2178 C CA  . PRO C 1 16  ? -0.795  52.692 14.542  1.00 40.04  ? 34  PRO C CA  1 
ATOM   2179 C C   . PRO C 1 16  ? -2.130  52.905 13.877  1.00 44.31  ? 34  PRO C C   1 
ATOM   2180 O O   . PRO C 1 16  ? -2.208  52.876 12.651  1.00 54.42  ? 34  PRO C O   1 
ATOM   2181 C CB  . PRO C 1 16  ? 0.083   53.932 14.380  1.00 49.29  ? 34  PRO C CB  1 
ATOM   2182 C CG  . PRO C 1 16  ? 1.471   53.386 14.196  1.00 40.93  ? 34  PRO C CG  1 
ATOM   2183 C CD  . PRO C 1 16  ? 1.267   52.148 13.368  1.00 48.68  ? 34  PRO C CD  1 
ATOM   2184 N N   . GLN C 1 17  ? -3.178  53.098 14.666  1.00 42.50  ? 35  GLN C N   1 
ATOM   2185 C CA  . GLN C 1 17  ? -4.510  53.262 14.089  1.00 67.53  ? 35  GLN C CA  1 
ATOM   2186 C C   . GLN C 1 17  ? -4.545  54.280 12.938  1.00 54.23  ? 35  GLN C C   1 
ATOM   2187 O O   . GLN C 1 17  ? -3.786  55.247 12.915  1.00 35.80  ? 35  GLN C O   1 
ATOM   2188 C CB  . GLN C 1 17  ? -5.528  53.621 15.169  1.00 43.43  ? 35  GLN C CB  1 
ATOM   2189 C CG  . GLN C 1 17  ? -4.893  54.078 16.459  1.00 75.38  ? 35  GLN C CG  1 
ATOM   2190 C CD  . GLN C 1 17  ? -5.899  54.702 17.395  1.00 98.42  ? 35  GLN C CD  1 
ATOM   2191 O OE1 . GLN C 1 17  ? -6.770  55.461 16.962  1.00 74.86  ? 35  GLN C OE1 1 
ATOM   2192 N NE2 . GLN C 1 17  ? -5.788  54.392 18.688  1.00 83.40  ? 35  GLN C NE2 1 
ATOM   2193 N N   . GLY C 1 18  ? -5.424  54.042 11.975  1.00 42.40  ? 36  GLY C N   1 
ATOM   2194 C CA  . GLY C 1 18  ? -5.569  54.942 10.850  1.00 50.09  ? 36  GLY C CA  1 
ATOM   2195 C C   . GLY C 1 18  ? -4.328  55.063 9.985   1.00 54.34  ? 36  GLY C C   1 
ATOM   2196 O O   . GLY C 1 18  ? -4.177  56.037 9.249   1.00 67.33  ? 36  GLY C O   1 
ATOM   2197 N N   . THR C 1 19  ? -3.431  54.086 10.071  1.00 48.81  ? 37  THR C N   1 
ATOM   2198 C CA  . THR C 1 19  ? -2.271  54.075 9.189   1.00 61.05  ? 37  THR C CA  1 
ATOM   2199 C C   . THR C 1 19  ? -2.220  52.832 8.306   1.00 46.15  ? 37  THR C C   1 
ATOM   2200 O O   . THR C 1 19  ? -3.026  51.906 8.441   1.00 37.75  ? 37  THR C O   1 
ATOM   2201 C CB  . THR C 1 19  ? -0.940  54.273 9.949   1.00 51.27  ? 37  THR C CB  1 
ATOM   2202 O OG1 . THR C 1 19  ? -0.649  53.120 10.743  1.00 61.00  ? 37  THR C OG1 1 
ATOM   2203 C CG2 . THR C 1 19  ? -1.021  55.496 10.840  1.00 55.30  ? 37  THR C CG2 1 
ATOM   2204 N N   . CYS C 1 20  ? -1.274  52.827 7.383   1.00 42.50  ? 38  CYS C N   1 
ATOM   2205 C CA  . CYS C 1 20  ? -1.244  51.788 6.364   1.00 41.71  ? 38  CYS C CA  1 
ATOM   2206 C C   . CYS C 1 20  ? 0.164   51.632 5.833   1.00 41.18  ? 38  CYS C C   1 
ATOM   2207 O O   . CYS C 1 20  ? 0.677   52.501 5.121   1.00 44.97  ? 38  CYS C O   1 
ATOM   2208 C CB  . CYS C 1 20  ? -2.217  52.119 5.220   1.00 45.24  ? 38  CYS C CB  1 
ATOM   2209 S SG  . CYS C 1 20  ? -2.442  50.800 3.989   1.00 48.56  ? 38  CYS C SG  1 
ATOM   2210 N N   . PRO C 1 21  ? 0.801   50.517 6.190   1.00 42.91  ? 39  PRO C N   1 
ATOM   2211 C CA  . PRO C 1 21  ? 2.161   50.225 5.753   1.00 31.87  ? 39  PRO C CA  1 
ATOM   2212 C C   . PRO C 1 21  ? 2.068   49.691 4.344   1.00 42.62  ? 39  PRO C C   1 
ATOM   2213 O O   . PRO C 1 21  ? 1.070   49.058 4.009   1.00 33.76  ? 39  PRO C O   1 
ATOM   2214 C CB  . PRO C 1 21  ? 2.597   49.087 6.690   1.00 32.11  ? 39  PRO C CB  1 
ATOM   2215 C CG  . PRO C 1 21  ? 1.390   48.702 7.484   1.00 29.38  ? 39  PRO C CG  1 
ATOM   2216 C CD  . PRO C 1 21  ? 0.202   49.391 6.919   1.00 34.38  ? 39  PRO C CD  1 
ATOM   2217 N N   . THR C 1 22  ? 3.070   49.974 3.525   1.00 42.66  ? 40  THR C N   1 
ATOM   2218 C CA  . THR C 1 22  ? 3.235   49.293 2.258   1.00 39.79  ? 40  THR C CA  1 
ATOM   2219 C C   . THR C 1 22  ? 3.673   47.870 2.584   1.00 40.18  ? 40  THR C C   1 
ATOM   2220 O O   . THR C 1 22  ? 4.193   47.612 3.681   1.00 42.77  ? 40  THR C O   1 
ATOM   2221 C CB  . THR C 1 22  ? 4.318   49.983 1.415   1.00 46.67  ? 40  THR C CB  1 
ATOM   2222 O OG1 . THR C 1 22  ? 5.551   50.014 2.155   1.00 32.47  ? 40  THR C OG1 1 
ATOM   2223 C CG2 . THR C 1 22  ? 3.892   51.414 1.072   1.00 31.96  ? 40  THR C CG2 1 
ATOM   2224 N N   . LYS C 1 23  ? 3.460   46.943 1.658   1.00 30.44  ? 41  LYS C N   1 
ATOM   2225 C CA  . LYS C 1 23  ? 3.875   45.565 1.890   1.00 36.06  ? 41  LYS C CA  1 
ATOM   2226 C C   . LYS C 1 23  ? 5.382   45.543 2.092   1.00 36.65  ? 41  LYS C C   1 
ATOM   2227 O O   . LYS C 1 23  ? 5.914   44.749 2.872   1.00 37.69  ? 41  LYS C O   1 
ATOM   2228 C CB  . LYS C 1 23  ? 3.482   44.650 0.726   1.00 31.60  ? 41  LYS C CB  1 
ATOM   2229 C CG  . LYS C 1 23  ? 2.010   44.726 0.319   1.00 25.68  ? 41  LYS C CG  1 
ATOM   2230 C CD  . LYS C 1 23  ? 1.111   43.920 1.224   1.00 42.19  ? 41  LYS C CD  1 
ATOM   2231 C CE  . LYS C 1 23  ? -0.357  44.121 0.882   1.00 23.31  ? 41  LYS C CE  1 
ATOM   2232 N NZ  . LYS C 1 23  ? -1.241  43.665 2.004   1.00 29.56  ? 41  LYS C NZ  1 
ATOM   2233 N N   . THR C 1 24  ? 6.063   46.443 1.399   1.00 26.44  ? 42  THR C N   1 
ATOM   2234 C CA  . THR C 1 24  ? 7.511   46.545 1.499   1.00 34.81  ? 42  THR C CA  1 
ATOM   2235 C C   . THR C 1 24  ? 7.974   46.887 2.900   1.00 36.64  ? 42  THR C C   1 
ATOM   2236 O O   . THR C 1 24  ? 8.855   46.219 3.419   1.00 36.16  ? 42  THR C O   1 
ATOM   2237 C CB  . THR C 1 24  ? 8.082   47.589 0.534   1.00 31.88  ? 42  THR C CB  1 
ATOM   2238 O OG1 . THR C 1 24  ? 7.828   47.164 -0.803  1.00 51.97  ? 42  THR C OG1 1 
ATOM   2239 C CG2 . THR C 1 24  ? 9.600   47.748 0.733   1.00 21.32  ? 42  THR C CG2 1 
ATOM   2240 N N   . GLU C 1 25  ? 7.405   47.924 3.513   1.00 34.58  ? 43  GLU C N   1 
ATOM   2241 C CA  . GLU C 1 25  ? 7.846   48.279 4.861   1.00 42.72  ? 43  GLU C CA  1 
ATOM   2242 C C   . GLU C 1 25  ? 7.503   47.192 5.889   1.00 46.42  ? 43  GLU C C   1 
ATOM   2243 O O   . GLU C 1 25  ? 8.284   46.922 6.824   1.00 34.94  ? 43  GLU C O   1 
ATOM   2244 C CB  . GLU C 1 25  ? 7.332   49.657 5.297   1.00 49.48  ? 43  GLU C CB  1 
ATOM   2245 C CG  . GLU C 1 25  ? 5.823   49.830 5.307   1.00 65.35  ? 43  GLU C CG  1 
ATOM   2246 C CD  . GLU C 1 25  ? 5.400   51.235 5.743   1.00 81.63  ? 43  GLU C CD  1 
ATOM   2247 O OE1 . GLU C 1 25  ? 4.729   51.934 4.937   1.00 48.50  ? 43  GLU C OE1 1 
ATOM   2248 O OE2 . GLU C 1 25  ? 5.750   51.631 6.889   1.00 61.31  ? 43  GLU C OE2 1 
ATOM   2249 N N   . ALA C 1 26  ? 6.352   46.551 5.703   1.00 28.79  ? 44  ALA C N   1 
ATOM   2250 C CA  . ALA C 1 26  ? 5.957   45.470 6.611   1.00 33.72  ? 44  ALA C CA  1 
ATOM   2251 C C   . ALA C 1 26  ? 6.970   44.327 6.586   1.00 37.90  ? 44  ALA C C   1 
ATOM   2252 O O   . ALA C 1 26  ? 7.394   43.838 7.632   1.00 38.48  ? 44  ALA C O   1 
ATOM   2253 C CB  . ALA C 1 26  ? 4.551   44.961 6.299   1.00 22.53  ? 44  ALA C CB  1 
ATOM   2254 N N   . LEU C 1 27  ? 7.360   43.906 5.390   1.00 28.62  ? 45  LEU C N   1 
ATOM   2255 C CA  . LEU C 1 27  ? 8.399   42.908 5.257   1.00 25.17  ? 45  LEU C CA  1 
ATOM   2256 C C   . LEU C 1 27  ? 9.721   43.427 5.836   1.00 29.96  ? 45  LEU C C   1 
ATOM   2257 O O   . LEU C 1 27  ? 10.519  42.675 6.383   1.00 29.31  ? 45  LEU C O   1 
ATOM   2258 C CB  . LEU C 1 27  ? 8.571   42.506 3.788   1.00 29.39  ? 45  LEU C CB  1 
ATOM   2259 C CG  . LEU C 1 27  ? 9.651   41.454 3.525   1.00 33.12  ? 45  LEU C CG  1 
ATOM   2260 C CD1 . LEU C 1 27  ? 9.343   40.162 4.281   1.00 35.20  ? 45  LEU C CD1 1 
ATOM   2261 C CD2 . LEU C 1 27  ? 9.805   41.185 2.038   1.00 34.38  ? 45  LEU C CD2 1 
ATOM   2262 N N   . ASN C 1 28  ? 9.952   44.722 5.720   1.00 34.40  ? 46  ASN C N   1 
ATOM   2263 C CA  . ASN C 1 28  ? 11.172  45.288 6.256   1.00 41.74  ? 46  ASN C CA  1 
ATOM   2264 C C   . ASN C 1 28  ? 11.179  45.202 7.791   1.00 39.51  ? 46  ASN C C   1 
ATOM   2265 O O   . ASN C 1 28  ? 12.177  44.823 8.400   1.00 27.61  ? 46  ASN C O   1 
ATOM   2266 C CB  . ASN C 1 28  ? 11.376  46.720 5.757   1.00 26.56  ? 46  ASN C CB  1 
ATOM   2267 C CG  . ASN C 1 28  ? 12.605  47.379 6.376   1.00 44.82  ? 46  ASN C CG  1 
ATOM   2268 O OD1 . ASN C 1 28  ? 13.646  47.508 5.738   1.00 45.26  ? 46  ASN C OD1 1 
ATOM   2269 N ND2 . ASN C 1 28  ? 12.491  47.773 7.635   1.00 46.71  ? 46  ASN C ND2 1 
ATOM   2270 N N   . ASP C 1 29  ? 10.049  45.539 8.398   1.00 30.46  ? 47  ASP C N   1 
ATOM   2271 C CA  . ASP C 1 29  ? 9.879   45.418 9.843   1.00 44.22  ? 47  ASP C CA  1 
ATOM   2272 C C   . ASP C 1 29  ? 10.111  43.997 10.267  1.00 45.73  ? 47  ASP C C   1 
ATOM   2273 O O   . ASP C 1 29  ? 10.842  43.714 11.224  1.00 31.45  ? 47  ASP C O   1 
ATOM   2274 C CB  . ASP C 1 29  ? 8.465   45.823 10.253  1.00 26.29  ? 47  ASP C CB  1 
ATOM   2275 C CG  . ASP C 1 29  ? 8.310   47.315 10.350  1.00 47.07  ? 47  ASP C CG  1 
ATOM   2276 O OD1 . ASP C 1 29  ? 9.348   47.979 10.578  1.00 34.33  ? 47  ASP C OD1 1 
ATOM   2277 O OD2 . ASP C 1 29  ? 7.171   47.815 10.200  1.00 37.58  ? 47  ASP C OD2 1 
ATOM   2278 N N   . CYS C 1 30  ? 9.463   43.104 9.537   1.00 37.03  ? 48  CYS C N   1 
ATOM   2279 C CA  . CYS C 1 30  ? 9.562   41.697 9.813   1.00 29.99  ? 48  CYS C CA  1 
ATOM   2280 C C   . CYS C 1 30  ? 11.021  41.260 9.744   1.00 31.85  ? 48  CYS C C   1 
ATOM   2281 O O   . CYS C 1 30  ? 11.473  40.484 10.580  1.00 42.11  ? 48  CYS C O   1 
ATOM   2282 C CB  . CYS C 1 30  ? 8.698   40.918 8.831   1.00 36.43  ? 48  CYS C CB  1 
ATOM   2283 S SG  . CYS C 1 30  ? 8.728   39.156 9.114   1.00 47.98  ? 48  CYS C SG  1 
ATOM   2284 N N   . ASN C 1 31  ? 11.765  41.777 8.768   1.00 26.50  ? 49  ASN C N   1 
ATOM   2285 C CA  . ASN C 1 31  ? 13.193  41.491 8.692   1.00 23.86  ? 49  ASN C CA  1 
ATOM   2286 C C   . ASN C 1 31  ? 14.032  42.114 9.815   1.00 40.51  ? 49  ASN C C   1 
ATOM   2287 O O   . ASN C 1 31  ? 15.201  41.769 9.983   1.00 28.73  ? 49  ASN C O   1 
ATOM   2288 C CB  . ASN C 1 31  ? 13.762  41.855 7.326   1.00 31.51  ? 49  ASN C CB  1 
ATOM   2289 C CG  . ASN C 1 31  ? 13.584  40.733 6.316   1.00 35.90  ? 49  ASN C CG  1 
ATOM   2290 O OD1 . ASN C 1 31  ? 13.979  39.597 6.556   1.00 38.83  ? 49  ASN C OD1 1 
ATOM   2291 N ND2 . ASN C 1 31  ? 12.967  41.043 5.197   1.00 26.56  ? 49  ASN C ND2 1 
ATOM   2292 N N   . LYS C 1 32  ? 13.443  43.021 10.590  1.00 22.80  ? 50  LYS C N   1 
ATOM   2293 C CA  . LYS C 1 32  ? 14.135  43.517 11.769  1.00 38.99  ? 50  LYS C CA  1 
ATOM   2294 C C   . LYS C 1 32  ? 14.170  42.409 12.831  1.00 30.75  ? 50  LYS C C   1 
ATOM   2295 O O   . LYS C 1 32  ? 15.181  42.193 13.500  1.00 29.72  ? 50  LYS C O   1 
ATOM   2296 C CB  . LYS C 1 32  ? 13.484  44.789 12.300  1.00 37.34  ? 50  LYS C CB  1 
ATOM   2297 C CG  . LYS C 1 32  ? 13.816  46.051 11.507  1.00 24.37  ? 50  LYS C CG  1 
ATOM   2298 C CD  . LYS C 1 32  ? 13.194  47.275 12.204  1.00 43.08  ? 50  LYS C CD  1 
ATOM   2299 C CE  . LYS C 1 32  ? 13.388  48.579 11.433  1.00 46.40  ? 50  LYS C CE  1 
ATOM   2300 N NZ  . LYS C 1 32  ? 12.194  48.894 10.620  1.00 42.36  ? 50  LYS C NZ  1 
ATOM   2301 N N   . VAL C 1 33  ? 13.078  41.672 12.940  1.00 20.90  ? 51  VAL C N   1 
ATOM   2302 C CA  . VAL C 1 33  ? 13.069  40.540 13.838  1.00 36.12  ? 51  VAL C CA  1 
ATOM   2303 C C   . VAL C 1 33  ? 13.929  39.399 13.321  1.00 34.58  ? 51  VAL C C   1 
ATOM   2304 O O   . VAL C 1 33  ? 14.507  38.661 14.106  1.00 40.00  ? 51  VAL C O   1 
ATOM   2305 C CB  . VAL C 1 33  ? 11.642  40.105 14.266  1.00 34.88  ? 51  VAL C CB  1 
ATOM   2306 C CG1 . VAL C 1 33  ? 10.580  40.986 13.646  1.00 23.04  ? 51  VAL C CG1 1 
ATOM   2307 C CG2 . VAL C 1 33  ? 11.405  38.639 14.011  1.00 36.46  ? 51  VAL C CG2 1 
ATOM   2308 N N   . THR C 1 34  ? 14.058  39.280 12.008  1.00 30.93  ? 52  THR C N   1 
ATOM   2309 C CA  . THR C 1 34  ? 14.975  38.296 11.453  1.00 24.66  ? 52  THR C CA  1 
ATOM   2310 C C   . THR C 1 34  ? 16.388  38.560 11.971  1.00 39.96  ? 52  THR C C   1 
ATOM   2311 O O   . THR C 1 34  ? 17.069  37.670 12.502  1.00 28.11  ? 52  THR C O   1 
ATOM   2312 C CB  . THR C 1 34  ? 15.008  38.364 9.921   1.00 28.10  ? 52  THR C CB  1 
ATOM   2313 O OG1 . THR C 1 34  ? 13.692  38.144 9.401   1.00 39.76  ? 52  THR C OG1 1 
ATOM   2314 C CG2 . THR C 1 34  ? 15.945  37.307 9.357   1.00 26.28  ? 52  THR C CG2 1 
ATOM   2315 N N   . LYS C 1 35  ? 16.830  39.796 11.790  1.00 29.20  ? 53  LYS C N   1 
ATOM   2316 C CA  . LYS C 1 35  ? 18.157  40.190 12.218  1.00 43.25  ? 53  LYS C CA  1 
ATOM   2317 C C   . LYS C 1 35  ? 18.299  39.984 13.731  1.00 43.08  ? 53  LYS C C   1 
ATOM   2318 O O   . LYS C 1 35  ? 19.287  39.434 14.203  1.00 36.04  ? 53  LYS C O   1 
ATOM   2319 C CB  . LYS C 1 35  ? 18.415  41.647 11.829  1.00 42.52  ? 53  LYS C CB  1 
ATOM   2320 C CG  . LYS C 1 35  ? 19.885  42.056 11.838  1.00 41.69  ? 53  LYS C CG  1 
ATOM   2321 C CD  . LYS C 1 35  ? 20.357  42.429 13.242  1.00 64.82  ? 53  LYS C CD  1 
ATOM   2322 C CE  . LYS C 1 35  ? 21.861  42.664 13.271  1.00 78.49  ? 53  LYS C CE  1 
ATOM   2323 N NZ  . LYS C 1 35  ? 22.625  41.425 12.931  1.00 67.64  ? 53  LYS C NZ  1 
ATOM   2324 N N   . GLY C 1 36  ? 17.295  40.425 14.478  1.00 31.30  ? 54  GLY C N   1 
ATOM   2325 C CA  . GLY C 1 36  ? 17.257  40.218 15.910  1.00 43.38  ? 54  GLY C CA  1 
ATOM   2326 C C   . GLY C 1 36  ? 17.457  38.766 16.320  1.00 50.43  ? 54  GLY C C   1 
ATOM   2327 O O   . GLY C 1 36  ? 18.245  38.477 17.225  1.00 33.82  ? 54  GLY C O   1 
ATOM   2328 N N   . LEU C 1 37  ? 16.752  37.849 15.660  1.00 36.99  ? 55  LEU C N   1 
ATOM   2329 C CA  . LEU C 1 37  ? 16.859  36.444 16.007  1.00 25.92  ? 55  LEU C CA  1 
ATOM   2330 C C   . LEU C 1 37  ? 18.225  35.872 15.665  1.00 30.37  ? 55  LEU C C   1 
ATOM   2331 O O   . LEU C 1 37  ? 18.762  35.039 16.393  1.00 40.47  ? 55  LEU C O   1 
ATOM   2332 C CB  . LEU C 1 37  ? 15.774  35.630 15.326  1.00 21.27  ? 55  LEU C CB  1 
ATOM   2333 C CG  . LEU C 1 37  ? 14.339  36.003 15.653  1.00 37.85  ? 55  LEU C CG  1 
ATOM   2334 C CD1 . LEU C 1 37  ? 13.427  34.921 15.116  1.00 48.97  ? 55  LEU C CD1 1 
ATOM   2335 C CD2 . LEU C 1 37  ? 14.141  36.180 17.145  1.00 27.30  ? 55  LEU C CD2 1 
ATOM   2336 N N   . ILE C 1 38  ? 18.789  36.313 14.553  1.00 35.34  ? 56  ILE C N   1 
ATOM   2337 C CA  . ILE C 1 38  ? 20.103  35.849 14.157  1.00 26.82  ? 56  ILE C CA  1 
ATOM   2338 C C   . ILE C 1 38  ? 21.116  36.273 15.214  1.00 40.32  ? 56  ILE C C   1 
ATOM   2339 O O   . ILE C 1 38  ? 21.989  35.507 15.590  1.00 30.71  ? 56  ILE C O   1 
ATOM   2340 C CB  . ILE C 1 38  ? 20.472  36.421 12.784  1.00 41.03  ? 56  ILE C CB  1 
ATOM   2341 C CG1 . ILE C 1 38  ? 19.495  35.887 11.739  1.00 37.38  ? 56  ILE C CG1 1 
ATOM   2342 C CG2 . ILE C 1 38  ? 21.917  36.091 12.403  1.00 27.06  ? 56  ILE C CG2 1 
ATOM   2343 C CD1 . ILE C 1 38  ? 19.729  36.426 10.361  1.00 37.45  ? 56  ILE C CD1 1 
ATOM   2344 N N   . ASP C 1 39  ? 20.977  37.495 15.711  1.00 35.28  ? 57  ASP C N   1 
ATOM   2345 C CA  . ASP C 1 39  ? 21.878  37.994 16.742  1.00 44.59  ? 57  ASP C CA  1 
ATOM   2346 C C   . ASP C 1 39  ? 21.772  37.215 18.055  1.00 40.92  ? 57  ASP C C   1 
ATOM   2347 O O   . ASP C 1 39  ? 22.783  36.810 18.634  1.00 36.06  ? 57  ASP C O   1 
ATOM   2348 C CB  . ASP C 1 39  ? 21.638  39.478 16.977  1.00 34.96  ? 57  ASP C CB  1 
ATOM   2349 C CG  . ASP C 1 39  ? 22.181  40.323 15.861  1.00 61.79  ? 57  ASP C CG  1 
ATOM   2350 O OD1 . ASP C 1 39  ? 22.834  39.746 14.957  1.00 57.92  ? 57  ASP C OD1 1 
ATOM   2351 O OD2 . ASP C 1 39  ? 21.954  41.552 15.891  1.00 50.64  ? 57  ASP C OD2 1 
ATOM   2352 N N   . PHE C 1 40  ? 20.547  37.016 18.523  1.00 29.32  ? 58  PHE C N   1 
ATOM   2353 C CA  . PHE C 1 40  ? 20.301  36.186 19.699  1.00 34.93  ? 58  PHE C CA  1 
ATOM   2354 C C   . PHE C 1 40  ? 20.842  34.765 19.488  1.00 36.44  ? 58  PHE C C   1 
ATOM   2355 O O   . PHE C 1 40  ? 21.608  34.261 20.303  1.00 47.27  ? 58  PHE C O   1 
ATOM   2356 C CB  . PHE C 1 40  ? 18.804  36.165 20.006  1.00 28.95  ? 58  PHE C CB  1 
ATOM   2357 C CG  . PHE C 1 40  ? 18.456  35.649 21.372  1.00 39.76  ? 58  PHE C CG  1 
ATOM   2358 C CD1 . PHE C 1 40  ? 18.300  36.521 22.436  1.00 40.14  ? 58  PHE C CD1 1 
ATOM   2359 C CD2 . PHE C 1 40  ? 18.252  34.299 21.584  1.00 39.20  ? 58  PHE C CD2 1 
ATOM   2360 C CE1 . PHE C 1 40  ? 17.963  36.054 23.694  1.00 34.21  ? 58  PHE C CE1 1 
ATOM   2361 C CE2 . PHE C 1 40  ? 17.918  33.823 22.828  1.00 41.72  ? 58  PHE C CE2 1 
ATOM   2362 C CZ  . PHE C 1 40  ? 17.769  34.704 23.888  1.00 55.00  ? 58  PHE C CZ  1 
ATOM   2363 N N   . SER C 1 41  ? 20.462  34.129 18.384  1.00 41.79  ? 59  SER C N   1 
ATOM   2364 C CA  . SER C 1 41  ? 20.950  32.785 18.096  1.00 49.11  ? 59  SER C CA  1 
ATOM   2365 C C   . SER C 1 41  ? 22.466  32.771 18.249  1.00 41.03  ? 59  SER C C   1 
ATOM   2366 O O   . SER C 1 41  ? 23.044  31.886 18.882  1.00 31.76  ? 59  SER C O   1 
ATOM   2367 C CB  . SER C 1 41  ? 20.537  32.342 16.679  1.00 24.54  ? 59  SER C CB  1 
ATOM   2368 O OG  . SER C 1 41  ? 21.060  31.060 16.335  1.00 23.93  ? 59  SER C OG  1 
ATOM   2369 N N   . GLN C 1 42  ? 23.085  33.782 17.659  1.00 38.08  ? 60  GLN C N   1 
ATOM   2370 C CA  . GLN C 1 42  ? 24.529  33.918 17.585  1.00 49.23  ? 60  GLN C CA  1 
ATOM   2371 C C   . GLN C 1 42  ? 25.153  33.926 18.975  1.00 53.13  ? 60  GLN C C   1 
ATOM   2372 O O   . GLN C 1 42  ? 26.118  33.211 19.259  1.00 43.75  ? 60  GLN C O   1 
ATOM   2373 C CB  . GLN C 1 42  ? 24.851  35.232 16.880  1.00 32.58  ? 60  GLN C CB  1 
ATOM   2374 C CG  . GLN C 1 42  ? 26.300  35.433 16.567  1.00 60.42  ? 60  GLN C CG  1 
ATOM   2375 C CD  . GLN C 1 42  ? 26.765  34.525 15.460  1.00 75.55  ? 60  GLN C CD  1 
ATOM   2376 O OE1 . GLN C 1 42  ? 27.195  33.403 15.707  1.00 61.55  ? 60  GLN C OE1 1 
ATOM   2377 N NE2 . GLN C 1 42  ? 26.690  35.009 14.225  1.00 86.12  ? 60  GLN C NE2 1 
ATOM   2378 N N   . SER C 1 43  ? 24.592  34.758 19.835  1.00 34.00  ? 61  SER C N   1 
ATOM   2379 C CA  . SER C 1 43  ? 25.094  34.897 21.181  1.00 48.52  ? 61  SER C CA  1 
ATOM   2380 C C   . SER C 1 43  ? 24.548  33.788 22.079  1.00 52.32  ? 61  SER C C   1 
ATOM   2381 O O   . SER C 1 43  ? 24.773  33.794 23.277  1.00 48.51  ? 61  SER C O   1 
ATOM   2382 C CB  . SER C 1 43  ? 24.708  36.265 21.726  1.00 46.33  ? 61  SER C CB  1 
ATOM   2383 O OG  . SER C 1 43  ? 23.303  36.418 21.701  1.00 51.46  ? 61  SER C OG  1 
ATOM   2384 N N   . HIS C 1 44  ? 23.824  32.838 21.496  1.00 51.42  ? 62  HIS C N   1 
ATOM   2385 C CA  . HIS C 1 44  ? 23.345  31.679 22.249  1.00 28.87  ? 62  HIS C CA  1 
ATOM   2386 C C   . HIS C 1 44  ? 23.742  30.353 21.636  1.00 40.76  ? 62  HIS C C   1 
ATOM   2387 O O   . HIS C 1 44  ? 22.918  29.438 21.546  1.00 37.08  ? 62  HIS C O   1 
ATOM   2388 C CB  . HIS C 1 44  ? 21.845  31.733 22.425  1.00 37.39  ? 62  HIS C CB  1 
ATOM   2389 C CG  . HIS C 1 44  ? 21.408  32.803 23.362  1.00 54.71  ? 62  HIS C CG  1 
ATOM   2390 N ND1 . HIS C 1 44  ? 21.326  34.125 22.987  1.00 45.32  ? 62  HIS C ND1 1 
ATOM   2391 C CD2 . HIS C 1 44  ? 21.057  32.756 24.668  1.00 55.16  ? 62  HIS C CD2 1 
ATOM   2392 C CE1 . HIS C 1 44  ? 20.923  34.845 24.017  1.00 56.03  ? 62  HIS C CE1 1 
ATOM   2393 N NE2 . HIS C 1 44  ? 20.753  34.040 25.050  1.00 59.15  ? 62  HIS C NE2 1 
ATOM   2394 N N   . GLN C 1 45  ? 25.005  30.262 21.219  1.00 32.88  ? 63  GLN C N   1 
ATOM   2395 C CA  . GLN C 1 45  ? 25.562  29.027 20.688  1.00 47.77  ? 63  GLN C CA  1 
ATOM   2396 C C   . GLN C 1 45  ? 24.822  28.587 19.436  1.00 49.54  ? 63  GLN C C   1 
ATOM   2397 O O   . GLN C 1 45  ? 24.534  27.396 19.275  1.00 45.82  ? 63  GLN C O   1 
ATOM   2398 C CB  . GLN C 1 45  ? 25.475  27.907 21.729  1.00 45.96  ? 63  GLN C CB  1 
ATOM   2399 C CG  . GLN C 1 45  ? 25.831  28.319 23.144  1.00 62.27  ? 63  GLN C CG  1 
ATOM   2400 C CD  . GLN C 1 45  ? 25.434  27.265 24.171  1.00 95.77  ? 63  GLN C CD  1 
ATOM   2401 O OE1 . GLN C 1 45  ? 25.875  27.308 25.323  1.00 103.25 ? 63  GLN C OE1 1 
ATOM   2402 N NE2 . GLN C 1 45  ? 24.596  26.312 23.756  1.00 61.23  ? 63  GLN C NE2 1 
ATOM   2403 N N   . ARG C 1 46  ? 24.497  29.549 18.573  1.00 42.68  ? 64  ARG C N   1 
ATOM   2404 C CA  . ARG C 1 46  ? 23.830  29.261 17.310  1.00 40.19  ? 64  ARG C CA  1 
ATOM   2405 C C   . ARG C 1 46  ? 22.733  28.202 17.457  1.00 45.11  ? 64  ARG C C   1 
ATOM   2406 O O   . ARG C 1 46  ? 22.611  27.319 16.618  1.00 44.24  ? 64  ARG C O   1 
ATOM   2407 C CB  . ARG C 1 46  ? 24.850  28.783 16.278  1.00 37.40  ? 64  ARG C CB  1 
ATOM   2408 C CG  . ARG C 1 46  ? 26.273  29.194 16.600  1.00 59.83  ? 64  ARG C CG  1 
ATOM   2409 C CD  . ARG C 1 46  ? 26.704  30.408 15.813  1.00 51.47  ? 64  ARG C CD  1 
ATOM   2410 N NE  . ARG C 1 46  ? 27.178  30.046 14.480  1.00 55.74  ? 64  ARG C NE  1 
ATOM   2411 C CZ  . ARG C 1 46  ? 28.015  30.780 13.745  1.00 91.95  ? 64  ARG C CZ  1 
ATOM   2412 N NH1 . ARG C 1 46  ? 28.489  31.925 14.214  1.00 93.98  ? 64  ARG C NH1 1 
ATOM   2413 N NH2 . ARG C 1 46  ? 28.386  30.368 12.536  1.00 77.39  ? 64  ARG C NH2 1 
ATOM   2414 N N   . ALA C 1 47  ? 21.946  28.288 18.524  1.00 32.88  ? 65  ALA C N   1 
ATOM   2415 C CA  . ALA C 1 47  ? 20.828  27.382 18.730  1.00 26.21  ? 65  ALA C CA  1 
ATOM   2416 C C   . ALA C 1 47  ? 19.891  27.353 17.529  1.00 50.12  ? 65  ALA C C   1 
ATOM   2417 O O   . ALA C 1 47  ? 19.347  26.309 17.184  1.00 37.68  ? 65  ALA C O   1 
ATOM   2418 C CB  . ALA C 1 47  ? 20.050  27.779 19.962  1.00 34.24  ? 65  ALA C CB  1 
ATOM   2419 N N   . TRP C 1 48  ? 19.682  28.505 16.904  1.00 38.07  ? 66  TRP C N   1 
ATOM   2420 C CA  . TRP C 1 48  ? 18.795  28.569 15.753  1.00 37.07  ? 66  TRP C CA  1 
ATOM   2421 C C   . TRP C 1 48  ? 19.558  28.723 14.452  1.00 31.80  ? 66  TRP C C   1 
ATOM   2422 O O   . TRP C 1 48  ? 18.964  28.954 13.422  1.00 41.12  ? 66  TRP C O   1 
ATOM   2423 C CB  . TRP C 1 48  ? 17.819  29.728 15.894  1.00 39.38  ? 66  TRP C CB  1 
ATOM   2424 C CG  . TRP C 1 48  ? 17.158  29.802 17.227  1.00 38.07  ? 66  TRP C CG  1 
ATOM   2425 C CD1 . TRP C 1 48  ? 16.828  28.761 18.035  1.00 26.51  ? 66  TRP C CD1 1 
ATOM   2426 C CD2 . TRP C 1 48  ? 16.717  30.988 17.894  1.00 38.65  ? 66  TRP C CD2 1 
ATOM   2427 N NE1 . TRP C 1 48  ? 16.213  29.221 19.174  1.00 32.97  ? 66  TRP C NE1 1 
ATOM   2428 C CE2 . TRP C 1 48  ? 16.135  30.587 19.116  1.00 38.86  ? 66  TRP C CE2 1 
ATOM   2429 C CE3 . TRP C 1 48  ? 16.768  32.352 17.580  1.00 31.61  ? 66  TRP C CE3 1 
ATOM   2430 C CZ2 . TRP C 1 48  ? 15.597  31.505 20.032  1.00 36.63  ? 66  TRP C CZ2 1 
ATOM   2431 C CZ3 . TRP C 1 48  ? 16.232  33.262 18.484  1.00 30.41  ? 66  TRP C CZ3 1 
ATOM   2432 C CH2 . TRP C 1 48  ? 15.655  32.831 19.699  1.00 38.11  ? 66  TRP C CH2 1 
ATOM   2433 N N   . GLY C 1 49  ? 20.875  28.601 14.509  1.00 36.40  ? 67  GLY C N   1 
ATOM   2434 C CA  . GLY C 1 49  ? 21.712  28.858 13.355  1.00 23.74  ? 67  GLY C CA  1 
ATOM   2435 C C   . GLY C 1 49  ? 21.637  30.289 12.856  1.00 40.77  ? 67  GLY C C   1 
ATOM   2436 O O   . GLY C 1 49  ? 20.905  31.128 13.409  1.00 27.74  ? 67  GLY C O   1 
ATOM   2437 N N   . ILE C 1 50  ? 22.369  30.566 11.780  1.00 37.80  ? 68  ILE C N   1 
ATOM   2438 C CA  . ILE C 1 50  ? 22.429  31.920 11.251  1.00 32.85  ? 68  ILE C CA  1 
ATOM   2439 C C   . ILE C 1 50  ? 21.786  32.098 9.877   1.00 38.08  ? 68  ILE C C   1 
ATOM   2440 O O   . ILE C 1 50  ? 21.853  33.186 9.303   1.00 44.64  ? 68  ILE C O   1 
ATOM   2441 C CB  . ILE C 1 50  ? 23.875  32.439 11.226  1.00 37.32  ? 68  ILE C CB  1 
ATOM   2442 C CG1 . ILE C 1 50  ? 24.726  31.607 10.275  1.00 37.67  ? 68  ILE C CG1 1 
ATOM   2443 C CG2 . ILE C 1 50  ? 24.477  32.385 12.632  1.00 40.58  ? 68  ILE C CG2 1 
ATOM   2444 C CD1 . ILE C 1 50  ? 26.115  32.181 10.061  1.00 42.60  ? 68  ILE C CD1 1 
ATOM   2445 N N   . ASP C 1 51  ? 21.164  31.046 9.350   1.00 39.80  ? 69  ASP C N   1 
ATOM   2446 C CA  . ASP C 1 51  ? 20.475  31.151 8.053   1.00 27.08  ? 69  ASP C CA  1 
ATOM   2447 C C   . ASP C 1 51  ? 18.948  31.266 8.209   1.00 33.01  ? 69  ASP C C   1 
ATOM   2448 O O   . ASP C 1 51  ? 18.234  30.264 8.344   1.00 25.97  ? 69  ASP C O   1 
ATOM   2449 C CB  . ASP C 1 51  ? 20.868  30.007 7.103   1.00 29.21  ? 69  ASP C CB  1 
ATOM   2450 C CG  . ASP C 1 51  ? 20.434  30.269 5.655   1.00 45.07  ? 69  ASP C CG  1 
ATOM   2451 O OD1 . ASP C 1 51  ? 19.966  31.381 5.360   1.00 38.44  ? 69  ASP C OD1 1 
ATOM   2452 O OD2 . ASP C 1 51  ? 20.552  29.367 4.804   1.00 41.20  ? 69  ASP C OD2 1 
ATOM   2453 N N   . MET C 1 52  ? 18.461  32.507 8.193   1.00 23.94  ? 70  MET C N   1 
ATOM   2454 C CA  . MET C 1 52  ? 17.047  32.786 8.436   1.00 34.10  ? 70  MET C CA  1 
ATOM   2455 C C   . MET C 1 52  ? 16.435  33.679 7.348   1.00 37.45  ? 70  MET C C   1 
ATOM   2456 O O   . MET C 1 52  ? 17.066  34.615 6.855   1.00 38.39  ? 70  MET C O   1 
ATOM   2457 C CB  . MET C 1 52  ? 16.854  33.441 9.811   1.00 20.73  ? 70  MET C CB  1 
ATOM   2458 C CG  . MET C 1 52  ? 17.364  32.632 11.008  1.00 28.18  ? 70  MET C CG  1 
ATOM   2459 S SD  . MET C 1 52  ? 16.857  33.343 12.633  1.00 31.27  ? 70  MET C SD  1 
ATOM   2460 C CE  . MET C 1 52  ? 17.934  32.386 13.698  1.00 29.98  ? 70  MET C CE  1 
ATOM   2461 N N   . THR C 1 53  ? 15.191  33.399 6.991   1.00 25.28  ? 71  THR C N   1 
ATOM   2462 C CA  . THR C 1 53  ? 14.517  34.170 5.949   1.00 29.66  ? 71  THR C CA  1 
ATOM   2463 C C   . THR C 1 53  ? 13.083  34.478 6.357   1.00 23.01  ? 71  THR C C   1 
ATOM   2464 O O   . THR C 1 53  ? 12.454  33.701 7.074   1.00 29.03  ? 71  THR C O   1 
ATOM   2465 C CB  . THR C 1 53  ? 14.559  33.443 4.573   1.00 36.26  ? 71  THR C CB  1 
ATOM   2466 O OG1 . THR C 1 53  ? 14.068  32.101 4.719   1.00 33.17  ? 71  THR C OG1 1 
ATOM   2467 C CG2 . THR C 1 53  ? 15.982  33.383 4.047   1.00 20.72  ? 71  THR C CG2 1 
ATOM   2468 N N   . ALA C 1 54  ? 12.573  35.618 5.898   1.00 29.47  ? 72  ALA C N   1 
ATOM   2469 C CA  . ALA C 1 54  ? 11.270  36.117 6.343   1.00 34.14  ? 72  ALA C CA  1 
ATOM   2470 C C   . ALA C 1 54  ? 10.214  36.204 5.239   1.00 42.48  ? 72  ALA C C   1 
ATOM   2471 O O   . ALA C 1 54  ? 10.511  36.559 4.103   1.00 34.37  ? 72  ALA C O   1 
ATOM   2472 C CB  . ALA C 1 54  ? 11.433  37.487 6.995   1.00 26.79  ? 72  ALA C CB  1 
ATOM   2473 N N   . LYS C 1 55  ? 8.978   35.896 5.605   1.00 35.59  ? 73  LYS C N   1 
ATOM   2474 C CA  . LYS C 1 55  ? 7.819   36.161 4.764   1.00 42.69  ? 73  LYS C CA  1 
ATOM   2475 C C   . LYS C 1 55  ? 6.823   36.894 5.652   1.00 44.87  ? 73  LYS C C   1 
ATOM   2476 O O   . LYS C 1 55  ? 6.883   36.791 6.885   1.00 28.02  ? 73  LYS C O   1 
ATOM   2477 C CB  . LYS C 1 55  ? 7.184   34.858 4.263   1.00 40.55  ? 73  LYS C CB  1 
ATOM   2478 C CG  . LYS C 1 55  ? 8.127   33.903 3.554   1.00 56.72  ? 73  LYS C CG  1 
ATOM   2479 C CD  . LYS C 1 55  ? 7.385   32.642 3.128   1.00 73.38  ? 73  LYS C CD  1 
ATOM   2480 C CE  . LYS C 1 55  ? 8.191   31.801 2.146   1.00 66.62  ? 73  LYS C CE  1 
ATOM   2481 N NZ  . LYS C 1 55  ? 7.532   30.482 1.922   1.00 80.88  ? 73  LYS C NZ  1 
ATOM   2482 N N   . VAL C 1 56  ? 5.905   37.626 5.036   1.00 39.22  ? 74  VAL C N   1 
ATOM   2483 C CA  . VAL C 1 56  ? 4.897   38.347 5.792   1.00 25.21  ? 74  VAL C CA  1 
ATOM   2484 C C   . VAL C 1 56  ? 3.585   38.476 5.026   1.00 33.03  ? 74  VAL C C   1 
ATOM   2485 O O   . VAL C 1 56  ? 3.580   38.622 3.802   1.00 29.21  ? 74  VAL C O   1 
ATOM   2486 C CB  . VAL C 1 56  ? 5.403   39.759 6.226   1.00 40.00  ? 74  VAL C CB  1 
ATOM   2487 C CG1 . VAL C 1 56  ? 5.723   40.609 5.026   1.00 44.54  ? 74  VAL C CG1 1 
ATOM   2488 C CG2 . VAL C 1 56  ? 4.376   40.460 7.105   1.00 39.32  ? 74  VAL C CG2 1 
ATOM   2489 N N   . GLN C 1 57  ? 2.484   38.408 5.767   1.00 29.64  ? 75  GLN C N   1 
ATOM   2490 C CA  . GLN C 1 57  ? 1.149   38.656 5.252   1.00 39.07  ? 75  GLN C CA  1 
ATOM   2491 C C   . GLN C 1 57  ? 0.508   39.732 6.108   1.00 39.89  ? 75  GLN C C   1 
ATOM   2492 O O   . GLN C 1 57  ? 0.640   39.715 7.331   1.00 40.05  ? 75  GLN C O   1 
ATOM   2493 C CB  . GLN C 1 57  ? 0.270   37.408 5.348   1.00 33.81  ? 75  GLN C CB  1 
ATOM   2494 C CG  . GLN C 1 57  ? 0.754   36.179 4.642   1.00 59.68  ? 75  GLN C CG  1 
ATOM   2495 C CD  . GLN C 1 57  ? -0.207  35.018 4.826   1.00 74.80  ? 75  GLN C CD  1 
ATOM   2496 O OE1 . GLN C 1 57  ? 0.149   33.858 4.614   1.00 66.08  ? 75  GLN C OE1 1 
ATOM   2497 N NE2 . GLN C 1 57  ? -1.436  35.329 5.237   1.00 57.72  ? 75  GLN C NE2 1 
ATOM   2498 N N   . CYS C 1 58  ? -0.204  40.653 5.471   1.00 46.70  ? 76  CYS C N   1 
ATOM   2499 C CA  . CYS C 1 58  ? -0.953  41.676 6.197   1.00 40.03  ? 76  CYS C CA  1 
ATOM   2500 C C   . CYS C 1 58  ? -2.411  41.652 5.824   1.00 40.02  ? 76  CYS C C   1 
ATOM   2501 O O   . CYS C 1 58  ? -2.791  41.172 4.755   1.00 50.15  ? 76  CYS C O   1 
ATOM   2502 C CB  . CYS C 1 58  ? -0.407  43.069 5.906   1.00 28.72  ? 76  CYS C CB  1 
ATOM   2503 S SG  . CYS C 1 58  ? 1.264   43.312 6.514   1.00 44.60  ? 76  CYS C SG  1 
ATOM   2504 N N   . ALA C 1 59  ? -3.231  42.167 6.723   1.00 45.07  ? 77  ALA C N   1 
ATOM   2505 C CA  . ALA C 1 59  ? -4.607  42.450 6.391   1.00 53.79  ? 77  ALA C CA  1 
ATOM   2506 C C   . ALA C 1 59  ? -4.630  43.676 5.479   1.00 38.48  ? 77  ALA C C   1 
ATOM   2507 O O   . ALA C 1 59  ? -3.737  44.520 5.536   1.00 46.34  ? 77  ALA C O   1 
ATOM   2508 C CB  . ALA C 1 59  ? -5.402  42.697 7.649   1.00 26.87  ? 77  ALA C CB  1 
ATOM   2509 N N   . PRO C 1 60  ? -5.645  43.773 4.617   1.00 50.16  ? 78  PRO C N   1 
ATOM   2510 C CA  . PRO C 1 60  ? -5.815  44.993 3.827   1.00 42.16  ? 78  PRO C CA  1 
ATOM   2511 C C   . PRO C 1 60  ? -6.150  46.139 4.760   1.00 44.30  ? 78  PRO C C   1 
ATOM   2512 O O   . PRO C 1 60  ? -6.932  45.926 5.690   1.00 48.35  ? 78  PRO C O   1 
ATOM   2513 C CB  . PRO C 1 60  ? -7.036  44.673 2.962   1.00 44.16  ? 78  PRO C CB  1 
ATOM   2514 C CG  . PRO C 1 60  ? -7.117  43.182 2.937   1.00 63.45  ? 78  PRO C CG  1 
ATOM   2515 C CD  . PRO C 1 60  ? -6.654  42.755 4.289   1.00 47.95  ? 78  PRO C CD  1 
ATOM   2516 N N   . CYS C 1 61  ? -5.578  47.319 4.542   1.00 45.89  ? 79  CYS C N   1 
ATOM   2517 C CA  . CYS C 1 61  ? -5.964  48.478 5.345   1.00 50.14  ? 79  CYS C CA  1 
ATOM   2518 C C   . CYS C 1 61  ? -7.356  48.927 4.927   1.00 44.67  ? 79  CYS C C   1 
ATOM   2519 O O   . CYS C 1 61  ? -7.736  48.765 3.770   1.00 41.80  ? 79  CYS C O   1 
ATOM   2520 C CB  . CYS C 1 61  ? -4.987  49.633 5.145   1.00 45.57  ? 79  CYS C CB  1 
ATOM   2521 S SG  . CYS C 1 61  ? -3.341  49.120 4.670   1.00 56.22  ? 79  CYS C SG  1 
ATOM   2522 N N   . LYS C 1 62  ? -8.126  49.478 5.857   1.00 61.00  ? 80  LYS C N   1 
ATOM   2523 C CA  . LYS C 1 62  ? -9.366  50.135 5.464   1.00 65.96  ? 80  LYS C CA  1 
ATOM   2524 C C   . LYS C 1 62  ? -9.102  51.626 5.296   1.00 78.75  ? 80  LYS C C   1 
ATOM   2525 O O   . LYS C 1 62  ? -8.823  52.324 6.273   1.00 56.17  ? 80  LYS C O   1 
ATOM   2526 C CB  . LYS C 1 62  ? -10.474 49.883 6.476   1.00 55.30  ? 80  LYS C CB  1 
ATOM   2527 C CG  . LYS C 1 62  ? -10.801 48.423 6.636   1.00 62.37  ? 80  LYS C CG  1 
ATOM   2528 C CD  . LYS C 1 62  ? -9.809  47.737 7.566   1.00 79.78  ? 80  LYS C CD  1 
ATOM   2529 C CE  . LYS C 1 62  ? -9.829  46.208 7.413   1.00 92.03  ? 80  LYS C CE  1 
ATOM   2530 N NZ  . LYS C 1 62  ? -11.081 45.557 7.901   1.00 85.55  ? 80  LYS C NZ  1 
ATOM   2531 N N   . THR C 1 63  ? -9.153  52.092 4.046   1.00 94.33  ? 81  THR C N   1 
ATOM   2532 C CA  . THR C 1 63  ? -8.955  53.505 3.716   1.00 89.58  ? 81  THR C CA  1 
ATOM   2533 C C   . THR C 1 63  ? -9.850  54.330 4.643   1.00 90.48  ? 81  THR C C   1 
ATOM   2534 O O   . THR C 1 63  ? -9.419  55.326 5.243   1.00 59.72  ? 81  THR C O   1 
ATOM   2535 C CB  . THR C 1 63  ? -9.233  53.788 2.179   1.00 93.11  ? 81  THR C CB  1 
ATOM   2536 O OG1 . THR C 1 63  ? -9.021  55.173 1.854   1.00 69.34  ? 81  THR C OG1 1 
ATOM   2537 C CG2 . THR C 1 63  ? -10.648 53.381 1.775   1.00 97.60  ? 81  THR C CG2 1 
ATOM   2538 N N   . THR C 1 64  ? -11.081 53.849 4.796   1.00 75.56  ? 82  THR C N   1 
ATOM   2539 C CA  . THR C 1 64  ? -12.121 54.494 5.584   1.00 76.73  ? 82  THR C CA  1 
ATOM   2540 C C   . THR C 1 64  ? -11.845 54.482 7.095   1.00 95.23  ? 82  THR C C   1 
ATOM   2541 O O   . THR C 1 64  ? -11.192 55.386 7.631   1.00 92.48  ? 82  THR C O   1 
ATOM   2542 C CB  . THR C 1 64  ? -13.472 53.807 5.303   1.00 94.19  ? 82  THR C CB  1 
ATOM   2543 O OG1 . THR C 1 64  ? -13.528 52.542 5.978   1.00 89.79  ? 82  THR C OG1 1 
ATOM   2544 C CG2 . THR C 1 64  ? -13.636 53.571 3.801   1.00 68.03  ? 82  THR C CG2 1 
ATOM   2545 N N   . ASP C 1 65  ? -12.355 53.452 7.766   1.00 90.62  ? 83  ASP C N   1 
ATOM   2546 C CA  . ASP C 1 65  ? -12.230 53.279 9.213   1.00 79.52  ? 83  ASP C CA  1 
ATOM   2547 C C   . ASP C 1 65  ? -10.951 53.887 9.803   1.00 78.03  ? 83  ASP C C   1 
ATOM   2548 O O   . ASP C 1 65  ? -9.842  53.448 9.505   1.00 72.40  ? 83  ASP C O   1 
ATOM   2549 C CB  . ASP C 1 65  ? -12.351 51.798 9.561   1.00 70.20  ? 83  ASP C CB  1 
ATOM   2550 C CG  . ASP C 1 65  ? -12.082 51.519 11.016  1.00 82.16  ? 83  ASP C CG  1 
ATOM   2551 O OD1 . ASP C 1 65  ? -11.869 52.482 11.782  1.00 73.55  ? 83  ASP C OD1 1 
ATOM   2552 O OD2 . ASP C 1 65  ? -12.083 50.328 11.395  1.00 83.10  ? 83  ASP C OD2 1 
ATOM   2553 N N   . PRO C 1 66  ? -11.120 54.909 10.654  1.00 84.52  ? 84  PRO C N   1 
ATOM   2554 C CA  . PRO C 1 66  ? -10.064 55.734 11.254  1.00 72.58  ? 84  PRO C CA  1 
ATOM   2555 C C   . PRO C 1 66  ? -9.391  55.100 12.473  1.00 62.98  ? 84  PRO C C   1 
ATOM   2556 O O   . PRO C 1 66  ? -8.275  55.481 12.828  1.00 58.76  ? 84  PRO C O   1 
ATOM   2557 C CB  . PRO C 1 66  ? -10.814 57.008 11.684  1.00 68.23  ? 84  PRO C CB  1 
ATOM   2558 C CG  . PRO C 1 66  ? -12.212 56.884 11.105  1.00 66.54  ? 84  PRO C CG  1 
ATOM   2559 C CD  . PRO C 1 66  ? -12.458 55.421 10.983  1.00 84.76  ? 84  PRO C CD  1 
ATOM   2560 N N   A TRP C 1 67  ? -10.065 54.142 13.100  0.51 62.73  ? 85  TRP C N   1 
ATOM   2561 N N   B TRP C 1 67  ? -10.074 54.169 13.131  0.49 62.70  ? 85  TRP C N   1 
ATOM   2562 C CA  A TRP C 1 67  ? -9.494  53.427 14.237  0.51 68.00  ? 85  TRP C CA  1 
ATOM   2563 C CA  B TRP C 1 67  ? -9.466  53.445 14.244  0.49 67.91  ? 85  TRP C CA  1 
ATOM   2564 C C   A TRP C 1 67  ? -8.871  52.122 13.764  0.51 69.42  ? 85  TRP C C   1 
ATOM   2565 C C   B TRP C 1 67  ? -8.984  52.081 13.757  0.49 69.40  ? 85  TRP C C   1 
ATOM   2566 O O   A TRP C 1 67  ? -8.471  51.280 14.567  0.51 67.48  ? 85  TRP C O   1 
ATOM   2567 O O   B TRP C 1 67  ? -8.795  51.156 14.546  0.49 67.52  ? 85  TRP C O   1 
ATOM   2568 C CB  A TRP C 1 67  ? -10.563 53.165 15.305  0.51 61.88  ? 85  TRP C CB  1 
ATOM   2569 C CB  B TRP C 1 67  ? -10.433 53.310 15.433  0.49 61.72  ? 85  TRP C CB  1 
ATOM   2570 C CG  A TRP C 1 67  ? -11.293 54.409 15.692  0.51 54.37  ? 85  TRP C CG  1 
ATOM   2571 C CG  B TRP C 1 67  ? -10.719 54.617 16.149  0.49 48.72  ? 85  TRP C CG  1 
ATOM   2572 C CD1 A TRP C 1 67  ? -10.923 55.315 16.642  0.51 45.60  ? 85  TRP C CD1 1 
ATOM   2573 C CD1 B TRP C 1 67  ? -11.670 55.537 15.820  0.49 53.18  ? 85  TRP C CD1 1 
ATOM   2574 C CD2 A TRP C 1 67  ? -12.504 54.906 15.111  0.51 58.35  ? 85  TRP C CD2 1 
ATOM   2575 C CD2 B TRP C 1 67  ? -10.045 55.136 17.304  0.49 47.27  ? 85  TRP C CD2 1 
ATOM   2576 N NE1 A TRP C 1 67  ? -11.836 56.340 16.696  0.51 54.19  ? 85  TRP C NE1 1 
ATOM   2577 N NE1 B TRP C 1 67  ? -11.630 56.595 16.693  0.49 54.13  ? 85  TRP C NE1 1 
ATOM   2578 C CE2 A TRP C 1 67  ? -12.817 56.112 15.766  0.51 54.86  ? 85  TRP C CE2 1 
ATOM   2579 C CE2 B TRP C 1 67  ? -10.643 56.372 17.616  0.49 48.19  ? 85  TRP C CE2 1 
ATOM   2580 C CE3 A TRP C 1 67  ? -13.357 54.446 14.102  0.51 57.91  ? 85  TRP C CE3 1 
ATOM   2581 C CE3 B TRP C 1 67  ? -9.004  54.672 18.111  0.49 59.01  ? 85  TRP C CE3 1 
ATOM   2582 C CZ2 A TRP C 1 67  ? -13.946 56.862 15.446  0.51 55.11  ? 85  TRP C CZ2 1 
ATOM   2583 C CZ2 B TRP C 1 67  ? -10.230 57.152 18.696  0.49 48.25  ? 85  TRP C CZ2 1 
ATOM   2584 C CZ3 A TRP C 1 67  ? -14.475 55.194 13.785  0.51 50.33  ? 85  TRP C CZ3 1 
ATOM   2585 C CZ3 B TRP C 1 67  ? -8.590  55.454 19.180  0.49 47.78  ? 85  TRP C CZ3 1 
ATOM   2586 C CH2 A TRP C 1 67  ? -14.759 56.387 14.454  0.51 48.24  ? 85  TRP C CH2 1 
ATOM   2587 C CH2 B TRP C 1 67  ? -9.203  56.677 19.462  0.49 47.62  ? 85  TRP C CH2 1 
ATOM   2588 N N   . ASP C 1 68  ? -8.786  51.972 12.446  1.00 66.00  ? 86  ASP C N   1 
ATOM   2589 C CA  . ASP C 1 68  ? -8.277  50.758 11.845  1.00 55.63  ? 86  ASP C CA  1 
ATOM   2590 C C   . ASP C 1 68  ? -6.851  50.485 12.275  1.00 53.38  ? 86  ASP C C   1 
ATOM   2591 O O   . ASP C 1 68  ? -5.965  51.308 12.054  1.00 49.77  ? 86  ASP C O   1 
ATOM   2592 C CB  . ASP C 1 68  ? -8.323  50.852 10.322  1.00 63.63  ? 86  ASP C CB  1 
ATOM   2593 C CG  . ASP C 1 68  ? -7.914  49.556 9.655   1.00 67.75  ? 86  ASP C CG  1 
ATOM   2594 O OD1 . ASP C 1 68  ? -8.388  48.500 10.131  1.00 47.98  ? 86  ASP C OD1 1 
ATOM   2595 O OD2 . ASP C 1 68  ? -7.121  49.591 8.679   1.00 48.89  ? 86  ASP C OD2 1 
ATOM   2596 N N   . VAL C 1 69  ? -6.640  49.325 12.889  1.00 36.22  ? 87  VAL C N   1 
ATOM   2597 C CA  . VAL C 1 69  ? -5.293  48.840 13.168  1.00 47.15  ? 87  VAL C CA  1 
ATOM   2598 C C   . VAL C 1 69  ? -4.921  47.647 12.277  1.00 52.33  ? 87  VAL C C   1 
ATOM   2599 O O   . VAL C 1 69  ? -5.488  46.560 12.398  1.00 67.64  ? 87  VAL C O   1 
ATOM   2600 C CB  . VAL C 1 69  ? -5.129  48.451 14.644  1.00 47.34  ? 87  VAL C CB  1 
ATOM   2601 C CG1 . VAL C 1 69  ? -3.757  47.835 14.884  1.00 50.06  ? 87  VAL C CG1 1 
ATOM   2602 C CG2 . VAL C 1 69  ? -5.327  49.667 15.523  1.00 57.53  ? 87  VAL C CG2 1 
ATOM   2603 N N   . VAL C 1 70  ? -3.964  47.861 11.383  1.00 48.44  ? 88  VAL C N   1 
ATOM   2604 C CA  . VAL C 1 70  ? -3.487  46.819 10.476  1.00 45.07  ? 88  VAL C CA  1 
ATOM   2605 C C   . VAL C 1 70  ? -2.572  45.773 11.164  1.00 56.10  ? 88  VAL C C   1 
ATOM   2606 O O   . VAL C 1 70  ? -1.556  46.120 11.779  1.00 52.94  ? 88  VAL C O   1 
ATOM   2607 C CB  . VAL C 1 70  ? -2.762  47.458 9.280   1.00 40.31  ? 88  VAL C CB  1 
ATOM   2608 C CG1 . VAL C 1 70  ? -1.889  46.443 8.573   1.00 49.60  ? 88  VAL C CG1 1 
ATOM   2609 C CG2 . VAL C 1 70  ? -3.773  48.086 8.331   1.00 39.71  ? 88  VAL C CG2 1 
ATOM   2610 N N   . LEU C 1 71  ? -2.950  44.498 11.052  1.00 42.87  ? 89  LEU C N   1 
ATOM   2611 C CA  . LEU C 1 71  ? -2.220  43.376 11.646  1.00 39.22  ? 89  LEU C CA  1 
ATOM   2612 C C   . LEU C 1 71  ? -1.376  42.621 10.626  1.00 36.30  ? 89  LEU C C   1 
ATOM   2613 O O   . LEU C 1 71  ? -1.888  42.122 9.636   1.00 38.89  ? 89  LEU C O   1 
ATOM   2614 C CB  . LEU C 1 71  ? -3.213  42.372 12.239  1.00 31.35  ? 89  LEU C CB  1 
ATOM   2615 C CG  . LEU C 1 71  ? -3.513  42.302 13.738  1.00 70.61  ? 89  LEU C CG  1 
ATOM   2616 C CD1 . LEU C 1 71  ? -3.574  43.678 14.390  1.00 47.93  ? 89  LEU C CD1 1 
ATOM   2617 C CD2 . LEU C 1 71  ? -4.817  41.530 13.968  1.00 47.42  ? 89  LEU C CD2 1 
ATOM   2618 N N   . CYS C 1 72  ? -0.089  42.479 10.881  1.00 42.29  ? 90  CYS C N   1 
ATOM   2619 C CA  . CYS C 1 72  ? 0.714   41.632 10.006  1.00 37.71  ? 90  CYS C CA  1 
ATOM   2620 C C   . CYS C 1 72  ? 1.217   40.378 10.717  1.00 46.63  ? 90  CYS C C   1 
ATOM   2621 O O   . CYS C 1 72  ? 1.660   40.442 11.871  1.00 38.43  ? 90  CYS C O   1 
ATOM   2622 C CB  . CYS C 1 72  ? 1.883   42.418 9.415   1.00 39.41  ? 90  CYS C CB  1 
ATOM   2623 S SG  . CYS C 1 72  ? 1.375   43.864 8.469   1.00 46.48  ? 90  CYS C SG  1 
ATOM   2624 N N   . THR C 1 73  ? 1.123   39.239 10.028  1.00 42.78  ? 91  THR C N   1 
ATOM   2625 C CA  . THR C 1 73  ? 1.778   38.019 10.479  1.00 23.37  ? 91  THR C CA  1 
ATOM   2626 C C   . THR C 1 73  ? 3.158   37.913 9.859   1.00 27.51  ? 91  THR C C   1 
ATOM   2627 O O   . THR C 1 73  ? 3.321   37.897 8.637   1.00 35.94  ? 91  THR C O   1 
ATOM   2628 C CB  . THR C 1 73  ? 1.022   36.743 10.121  1.00 31.51  ? 91  THR C CB  1 
ATOM   2629 O OG1 . THR C 1 73  ? -0.287  36.761 10.695  1.00 35.20  ? 91  THR C OG1 1 
ATOM   2630 C CG2 . THR C 1 73  ? 1.792   35.537 10.643  1.00 32.59  ? 91  THR C CG2 1 
ATOM   2631 N N   . CYS C 1 74  ? 4.148   37.833 10.727  1.00 27.17  ? 92  CYS C N   1 
ATOM   2632 C CA  . CYS C 1 74  ? 5.534   37.723 10.342  1.00 22.67  ? 92  CYS C CA  1 
ATOM   2633 C C   . CYS C 1 74  ? 5.977   36.290 10.647  1.00 19.68  ? 92  CYS C C   1 
ATOM   2634 O O   . CYS C 1 74  ? 5.643   35.736 11.684  1.00 47.97  ? 92  CYS C O   1 
ATOM   2635 C CB  . CYS C 1 74  ? 6.326   38.792 11.108  1.00 23.47  ? 92  CYS C CB  1 
ATOM   2636 S SG  . CYS C 1 74  ? 8.104   38.753 11.020  1.00 43.41  ? 92  CYS C SG  1 
ATOM   2637 N N   . LYS C 1 75  ? 6.693   35.672 9.723   1.00 35.87  ? 93  LYS C N   1 
ATOM   2638 C CA  . LYS C 1 75  ? 7.077   34.273 9.870   1.00 38.96  ? 93  LYS C CA  1 
ATOM   2639 C C   . LYS C 1 75  ? 8.529   34.098 9.467   1.00 43.85  ? 93  LYS C C   1 
ATOM   2640 O O   . LYS C 1 75  ? 8.894   34.275 8.299   1.00 46.42  ? 93  LYS C O   1 
ATOM   2641 C CB  . LYS C 1 75  ? 6.177   33.350 9.034   1.00 29.82  ? 93  LYS C CB  1 
ATOM   2642 C CG  . LYS C 1 75  ? 6.584   31.879 9.126   1.00 32.83  ? 93  LYS C CG  1 
ATOM   2643 C CD  . LYS C 1 75  ? 5.490   30.921 8.677   1.00 29.36  ? 93  LYS C CD  1 
ATOM   2644 C CE  . LYS C 1 75  ? 6.076   29.549 8.371   1.00 38.34  ? 93  LYS C CE  1 
ATOM   2645 N NZ  . LYS C 1 75  ? 5.072   28.575 7.870   1.00 54.43  ? 93  LYS C NZ  1 
ATOM   2646 N N   . ILE C 1 76  ? 9.363   33.762 10.439  1.00 29.14  ? 94  ILE C N   1 
ATOM   2647 C CA  . ILE C 1 76  ? 10.766  33.600 10.152  1.00 26.69  ? 94  ILE C CA  1 
ATOM   2648 C C   . ILE C 1 76  ? 11.041  32.116 10.087  1.00 36.01  ? 94  ILE C C   1 
ATOM   2649 O O   . ILE C 1 76  ? 10.554  31.356 10.918  1.00 45.91  ? 94  ILE C O   1 
ATOM   2650 C CB  . ILE C 1 76  ? 11.671  34.280 11.218  1.00 40.02  ? 94  ILE C CB  1 
ATOM   2651 C CG1 . ILE C 1 76  ? 11.667  35.808 11.073  1.00 39.39  ? 94  ILE C CG1 1 
ATOM   2652 C CG2 . ILE C 1 76  ? 13.113  33.825 11.066  1.00 23.96  ? 94  ILE C CG2 1 
ATOM   2653 C CD1 . ILE C 1 76  ? 10.409  36.490 11.489  1.00 36.43  ? 94  ILE C CD1 1 
ATOM   2654 N N   . THR C 1 77  ? 11.808  31.699 9.089   1.00 29.30  ? 95  THR C N   1 
ATOM   2655 C CA  . THR C 1 77  ? 12.167  30.303 8.959   1.00 33.55  ? 95  THR C CA  1 
ATOM   2656 C C   . THR C 1 77  ? 13.663  30.146 9.144   1.00 34.79  ? 95  THR C C   1 
ATOM   2657 O O   . THR C 1 77  ? 14.458  30.737 8.410   1.00 33.43  ? 95  THR C O   1 
ATOM   2658 C CB  . THR C 1 77  ? 11.760  29.736 7.579   1.00 38.51  ? 95  THR C CB  1 
ATOM   2659 O OG1 . THR C 1 77  ? 10.329  29.752 7.443   1.00 34.43  ? 95  THR C OG1 1 
ATOM   2660 C CG2 . THR C 1 77  ? 12.276  28.321 7.422   1.00 23.19  ? 95  THR C CG2 1 
ATOM   2661 N N   . ALA C 1 78  ? 14.042  29.354 10.141  1.00 31.21  ? 96  ALA C N   1 
ATOM   2662 C CA  . ALA C 1 78  ? 15.447  29.053 10.387  1.00 40.10  ? 96  ALA C CA  1 
ATOM   2663 C C   . ALA C 1 78  ? 15.797  27.760 9.674   1.00 36.50  ? 96  ALA C C   1 
ATOM   2664 O O   . ALA C 1 78  ? 15.150  26.734 9.891   1.00 34.88  ? 96  ALA C O   1 
ATOM   2665 C CB  . ALA C 1 78  ? 15.733  28.939 11.885  1.00 30.91  ? 96  ALA C CB  1 
ATOM   2666 N N   . HIS C 1 79  ? 16.833  27.820 8.842   1.00 28.25  ? 97  HIS C N   1 
ATOM   2667 C CA  . HIS C 1 79  ? 17.170  26.721 7.942   1.00 33.86  ? 97  HIS C CA  1 
ATOM   2668 C C   . HIS C 1 79  ? 18.147  25.677 8.527   1.00 41.28  ? 97  HIS C C   1 
ATOM   2669 O O   . HIS C 1 79  ? 18.120  24.516 8.119   1.00 34.21  ? 97  HIS C O   1 
ATOM   2670 C CB  . HIS C 1 79  ? 17.629  27.267 6.568   1.00 35.52  ? 97  HIS C CB  1 
ATOM   2671 C CG  . HIS C 1 79  ? 16.604  28.143 5.899   1.00 28.30  ? 97  HIS C CG  1 
ATOM   2672 N ND1 . HIS C 1 79  ? 15.522  27.634 5.215   1.00 26.43  ? 97  HIS C ND1 1 
ATOM   2673 C CD2 . HIS C 1 79  ? 16.480  29.492 5.838   1.00 26.46  ? 97  HIS C CD2 1 
ATOM   2674 C CE1 . HIS C 1 79  ? 14.777  28.626 4.759   1.00 21.50  ? 97  HIS C CE1 1 
ATOM   2675 N NE2 . HIS C 1 79  ? 15.336  29.764 5.123   1.00 24.02  ? 97  HIS C NE2 1 
ATOM   2676 N N   . ARG C 1 80  ? 18.983  26.071 9.488   1.00 30.97  ? 98  ARG C N   1 
ATOM   2677 C CA  . ARG C 1 80  ? 19.872  25.106 10.152  1.00 33.58  ? 98  ARG C CA  1 
ATOM   2678 C C   . ARG C 1 80  ? 19.708  25.189 11.679  1.00 32.55  ? 98  ARG C C   1 
ATOM   2679 O O   . ARG C 1 80  ? 20.621  25.530 12.426  1.00 36.12  ? 98  ARG C O   1 
ATOM   2680 C CB  . ARG C 1 80  ? 21.336  25.245 9.685   1.00 31.92  ? 98  ARG C CB  1 
ATOM   2681 C CG  . ARG C 1 80  ? 21.497  25.446 8.170   1.00 43.14  ? 98  ARG C CG  1 
ATOM   2682 C CD  . ARG C 1 80  ? 22.955  25.406 7.684   1.00 35.64  ? 98  ARG C CD  1 
ATOM   2683 N NE  . ARG C 1 80  ? 23.343  24.060 7.280   1.00 62.27  ? 98  ARG C NE  1 
ATOM   2684 C CZ  . ARG C 1 80  ? 23.407  23.627 6.021   1.00 59.30  ? 98  ARG C CZ  1 
ATOM   2685 N NH1 . ARG C 1 80  ? 23.133  24.437 5.006   1.00 30.76  ? 98  ARG C NH1 1 
ATOM   2686 N NH2 . ARG C 1 80  ? 23.765  22.372 5.779   1.00 61.27  ? 98  ARG C NH2 1 
ATOM   2687 N N   . TYR C 1 81  ? 18.491  24.889 12.101  1.00 31.92  ? 99  TYR C N   1 
ATOM   2688 C CA  . TYR C 1 81  ? 18.059  24.925 13.483  1.00 30.65  ? 99  TYR C CA  1 
ATOM   2689 C C   . TYR C 1 81  ? 18.518  23.682 14.225  1.00 39.64  ? 99  TYR C C   1 
ATOM   2690 O O   . TYR C 1 81  ? 18.447  22.571 13.701  1.00 30.00  ? 99  TYR C O   1 
ATOM   2691 C CB  . TYR C 1 81  ? 16.540  24.963 13.471  1.00 37.42  ? 99  TYR C CB  1 
ATOM   2692 C CG  . TYR C 1 81  ? 15.891  25.065 14.813  1.00 36.05  ? 99  TYR C CG  1 
ATOM   2693 C CD1 . TYR C 1 81  ? 15.503  26.296 15.323  1.00 35.78  ? 99  TYR C CD1 1 
ATOM   2694 C CD2 . TYR C 1 81  ? 15.627  23.932 15.557  1.00 26.19  ? 99  TYR C CD2 1 
ATOM   2695 C CE1 . TYR C 1 81  ? 14.894  26.393 16.553  1.00 38.20  ? 99  TYR C CE1 1 
ATOM   2696 C CE2 . TYR C 1 81  ? 15.008  24.014 16.776  1.00 35.82  ? 99  TYR C CE2 1 
ATOM   2697 C CZ  . TYR C 1 81  ? 14.656  25.245 17.276  1.00 32.81  ? 99  TYR C CZ  1 
ATOM   2698 O OH  . TYR C 1 81  ? 14.043  25.323 18.495  1.00 30.22  ? 99  TYR C OH  1 
ATOM   2699 N N   . ARG C 1 82  ? 18.990  23.860 15.450  1.00 41.76  ? 100 ARG C N   1 
ATOM   2700 C CA  . ARG C 1 82  ? 19.446  22.720 16.250  1.00 42.67  ? 100 ARG C CA  1 
ATOM   2701 C C   . ARG C 1 82  ? 18.343  22.235 17.163  1.00 37.95  ? 100 ARG C C   1 
ATOM   2702 O O   . ARG C 1 82  ? 18.171  22.752 18.270  1.00 44.82  ? 100 ARG C O   1 
ATOM   2703 C CB  . ARG C 1 82  ? 20.683  23.090 17.067  1.00 43.70  ? 100 ARG C CB  1 
ATOM   2704 C CG  . ARG C 1 82  ? 21.868  23.428 16.187  1.00 45.70  ? 100 ARG C CG  1 
ATOM   2705 C CD  . ARG C 1 82  ? 22.834  24.375 16.852  1.00 51.03  ? 100 ARG C CD  1 
ATOM   2706 N NE  . ARG C 1 82  ? 23.628  25.094 15.856  1.00 57.06  ? 100 ARG C NE  1 
ATOM   2707 C CZ  . ARG C 1 82  ? 24.950  25.035 15.760  1.00 51.22  ? 100 ARG C CZ  1 
ATOM   2708 N NH1 . ARG C 1 82  ? 25.648  24.299 16.609  1.00 56.13  ? 100 ARG C NH1 1 
ATOM   2709 N NH2 . ARG C 1 82  ? 25.576  25.727 14.823  1.00 36.86  ? 100 ARG C NH2 1 
ATOM   2710 N N   . GLU C 1 83  ? 17.584  21.249 16.698  1.00 36.04  ? 101 GLU C N   1 
ATOM   2711 C CA  . GLU C 1 83  ? 16.516  20.695 17.521  1.00 54.84  ? 101 GLU C CA  1 
ATOM   2712 C C   . GLU C 1 83  ? 17.108  19.878 18.674  1.00 44.99  ? 101 GLU C C   1 
ATOM   2713 O O   . GLU C 1 83  ? 16.425  19.597 19.649  1.00 50.37  ? 101 GLU C O   1 
ATOM   2714 C CB  . GLU C 1 83  ? 15.534  19.860 16.683  1.00 53.34  ? 101 GLU C CB  1 
ATOM   2715 C CG  . GLU C 1 83  ? 15.697  18.346 16.808  1.00 71.97  ? 101 GLU C CG  1 
ATOM   2716 C CD  . GLU C 1 83  ? 14.980  17.770 18.023  1.00 76.09  ? 101 GLU C CD  1 
ATOM   2717 O OE1 . GLU C 1 83  ? 13.744  17.935 18.140  1.00 70.55  ? 101 GLU C OE1 1 
ATOM   2718 O OE2 . GLU C 1 83  ? 15.658  17.142 18.861  1.00 76.77  ? 101 GLU C OE2 1 
ATOM   2719 N N   . PHE C 1 84  ? 18.383  19.517 18.560  1.00 44.48  ? 102 PHE C N   1 
ATOM   2720 C CA  . PHE C 1 84  ? 19.061  18.760 19.609  1.00 45.20  ? 102 PHE C CA  1 
ATOM   2721 C C   . PHE C 1 84  ? 19.507  19.657 20.762  1.00 59.36  ? 102 PHE C C   1 
ATOM   2722 O O   . PHE C 1 84  ? 19.925  19.177 21.812  1.00 54.52  ? 102 PHE C O   1 
ATOM   2723 C CB  . PHE C 1 84  ? 20.238  17.943 19.054  1.00 48.55  ? 102 PHE C CB  1 
ATOM   2724 C CG  . PHE C 1 84  ? 21.301  18.766 18.359  1.00 62.31  ? 102 PHE C CG  1 
ATOM   2725 C CD1 . PHE C 1 84  ? 21.200  19.056 17.003  1.00 65.19  ? 102 PHE C CD1 1 
ATOM   2726 C CD2 . PHE C 1 84  ? 22.415  19.222 19.055  1.00 59.69  ? 102 PHE C CD2 1 
ATOM   2727 C CE1 . PHE C 1 84  ? 22.181  19.803 16.356  1.00 62.44  ? 102 PHE C CE1 1 
ATOM   2728 C CE2 . PHE C 1 84  ? 23.403  19.966 18.417  1.00 45.57  ? 102 PHE C CE2 1 
ATOM   2729 C CZ  . PHE C 1 84  ? 23.286  20.255 17.065  1.00 70.75  ? 102 PHE C CZ  1 
ATOM   2730 N N   . VAL C 1 85  ? 19.412  20.964 20.560  1.00 56.72  ? 103 VAL C N   1 
ATOM   2731 C CA  . VAL C 1 85  ? 19.642  21.914 21.639  1.00 38.35  ? 103 VAL C CA  1 
ATOM   2732 C C   . VAL C 1 85  ? 18.293  22.219 22.298  1.00 55.66  ? 103 VAL C C   1 
ATOM   2733 O O   . VAL C 1 85  ? 17.248  22.210 21.635  1.00 46.27  ? 103 VAL C O   1 
ATOM   2734 C CB  . VAL C 1 85  ? 20.356  23.193 21.129  1.00 45.46  ? 103 VAL C CB  1 
ATOM   2735 C CG1 . VAL C 1 85  ? 20.037  24.392 21.990  1.00 39.52  ? 103 VAL C CG1 1 
ATOM   2736 C CG2 . VAL C 1 85  ? 21.865  22.963 21.034  1.00 28.70  ? 103 VAL C CG2 1 
ATOM   2737 N N   . PRO C 1 86  ? 18.304  22.427 23.623  1.00 61.80  ? 104 PRO C N   1 
ATOM   2738 C CA  . PRO C 1 86  ? 17.047  22.694 24.331  1.00 44.18  ? 104 PRO C CA  1 
ATOM   2739 C C   . PRO C 1 86  ? 16.287  23.852 23.693  1.00 43.69  ? 104 PRO C C   1 
ATOM   2740 O O   . PRO C 1 86  ? 16.896  24.839 23.275  1.00 41.93  ? 104 PRO C O   1 
ATOM   2741 C CB  . PRO C 1 86  ? 17.514  23.063 25.746  1.00 36.61  ? 104 PRO C CB  1 
ATOM   2742 C CG  . PRO C 1 86  ? 18.831  22.335 25.915  1.00 29.24  ? 104 PRO C CG  1 
ATOM   2743 C CD  . PRO C 1 86  ? 19.460  22.300 24.535  1.00 34.70  ? 104 PRO C CD  1 
ATOM   2744 N N   . LYS C 1 87  ? 14.966  23.725 23.639  1.00 43.12  ? 105 LYS C N   1 
ATOM   2745 C CA  . LYS C 1 87  ? 14.091  24.713 23.012  1.00 50.22  ? 105 LYS C CA  1 
ATOM   2746 C C   . LYS C 1 87  ? 14.058  26.025 23.784  1.00 53.73  ? 105 LYS C C   1 
ATOM   2747 O O   . LYS C 1 87  ? 13.653  26.058 24.944  1.00 55.72  ? 105 LYS C O   1 
ATOM   2748 C CB  . LYS C 1 87  ? 12.678  24.136 22.902  1.00 41.48  ? 105 LYS C CB  1 
ATOM   2749 C CG  . LYS C 1 87  ? 11.628  25.031 22.270  1.00 45.65  ? 105 LYS C CG  1 
ATOM   2750 C CD  . LYS C 1 87  ? 10.740  24.171 21.360  1.00 59.26  ? 105 LYS C CD  1 
ATOM   2751 C CE  . LYS C 1 87  ? 9.276   24.609 21.326  1.00 63.73  ? 105 LYS C CE  1 
ATOM   2752 N NZ  . LYS C 1 87  ? 8.478   23.771 20.361  1.00 54.63  ? 105 LYS C NZ  1 
ATOM   2753 N N   . ILE C 1 88  ? 14.476  27.105 23.135  1.00 38.75  ? 106 ILE C N   1 
ATOM   2754 C CA  . ILE C 1 88  ? 14.473  28.420 23.764  1.00 43.23  ? 106 ILE C CA  1 
ATOM   2755 C C   . ILE C 1 88  ? 13.109  29.098 23.592  1.00 40.74  ? 106 ILE C C   1 
ATOM   2756 O O   . ILE C 1 88  ? 12.597  29.187 22.483  1.00 53.42  ? 106 ILE C O   1 
ATOM   2757 C CB  . ILE C 1 88  ? 15.598  29.299 23.197  1.00 36.38  ? 106 ILE C CB  1 
ATOM   2758 C CG1 . ILE C 1 88  ? 16.861  28.454 23.013  1.00 36.42  ? 106 ILE C CG1 1 
ATOM   2759 C CG2 . ILE C 1 88  ? 15.860  30.498 24.099  1.00 32.28  ? 106 ILE C CG2 1 
ATOM   2760 C CD1 . ILE C 1 88  ? 18.074  29.218 22.553  1.00 26.16  ? 106 ILE C CD1 1 
ATOM   2761 N N   . PRO C 1 89  ? 12.513  29.562 24.701  1.00 41.22  ? 107 PRO C N   1 
ATOM   2762 C CA  . PRO C 1 89  ? 11.175  30.179 24.735  1.00 32.65  ? 107 PRO C CA  1 
ATOM   2763 C C   . PRO C 1 89  ? 11.173  31.668 24.402  1.00 41.81  ? 107 PRO C C   1 
ATOM   2764 O O   . PRO C 1 89  ? 12.165  32.356 24.654  1.00 40.00  ? 107 PRO C O   1 
ATOM   2765 C CB  . PRO C 1 89  ? 10.753  30.044 26.208  1.00 40.24  ? 107 PRO C CB  1 
ATOM   2766 C CG  . PRO C 1 89  ? 11.994  29.597 26.971  1.00 29.72  ? 107 PRO C CG  1 
ATOM   2767 C CD  . PRO C 1 89  ? 13.154  29.523 26.029  1.00 33.06  ? 107 PRO C CD  1 
ATOM   2768 N N   . TYR C 1 90  ? 10.040  32.145 23.886  1.00 40.30  ? 108 TYR C N   1 
ATOM   2769 C CA  . TYR C 1 90  ? 9.783   33.564 23.601  1.00 32.70  ? 108 TYR C CA  1 
ATOM   2770 C C   . TYR C 1 90  ? 10.138  34.488 24.769  1.00 43.88  ? 108 TYR C C   1 
ATOM   2771 O O   . TYR C 1 90  ? 10.770  35.532 24.575  1.00 35.55  ? 108 TYR C O   1 
ATOM   2772 C CB  . TYR C 1 90  ? 8.305   33.751 23.245  1.00 39.33  ? 108 TYR C CB  1 
ATOM   2773 C CG  . TYR C 1 90  ? 7.900   35.164 22.891  1.00 48.64  ? 108 TYR C CG  1 
ATOM   2774 C CD1 . TYR C 1 90  ? 8.364   35.764 21.727  1.00 44.82  ? 108 TYR C CD1 1 
ATOM   2775 C CD2 . TYR C 1 90  ? 7.036   35.892 23.707  1.00 39.94  ? 108 TYR C CD2 1 
ATOM   2776 C CE1 . TYR C 1 90  ? 7.997   37.063 21.383  1.00 41.56  ? 108 TYR C CE1 1 
ATOM   2777 C CE2 . TYR C 1 90  ? 6.656   37.196 23.374  1.00 30.94  ? 108 TYR C CE2 1 
ATOM   2778 C CZ  . TYR C 1 90  ? 7.144   37.776 22.202  1.00 52.96  ? 108 TYR C CZ  1 
ATOM   2779 O OH  . TYR C 1 90  ? 6.800   39.064 21.831  1.00 42.25  ? 108 TYR C OH  1 
ATOM   2780 N N   . SER C 1 91  ? 9.711   34.105 25.973  1.00 31.91  ? 109 SER C N   1 
ATOM   2781 C CA  . SER C 1 91  ? 10.057  34.831 27.194  1.00 47.39  ? 109 SER C CA  1 
ATOM   2782 C C   . SER C 1 91  ? 11.561  35.141 27.304  1.00 34.92  ? 109 SER C C   1 
ATOM   2783 O O   . SER C 1 91  ? 11.945  36.157 27.859  1.00 40.52  ? 109 SER C O   1 
ATOM   2784 C CB  . SER C 1 91  ? 9.583   34.068 28.433  1.00 33.87  ? 109 SER C CB  1 
ATOM   2785 O OG  . SER C 1 91  ? 10.330  32.879 28.606  1.00 43.96  ? 109 SER C OG  1 
ATOM   2786 N N   . SER C 1 92  ? 12.410  34.294 26.744  1.00 39.69  ? 110 SER C N   1 
ATOM   2787 C CA  . SER C 1 92  ? 13.843  34.570 26.784  1.00 33.22  ? 110 SER C CA  1 
ATOM   2788 C C   . SER C 1 92  ? 14.324  35.602 25.755  1.00 45.10  ? 110 SER C C   1 
ATOM   2789 O O   . SER C 1 92  ? 15.427  36.132 25.895  1.00 32.69  ? 110 SER C O   1 
ATOM   2790 C CB  . SER C 1 92  ? 14.649  33.276 26.642  1.00 44.15  ? 110 SER C CB  1 
ATOM   2791 O OG  . SER C 1 92  ? 14.551  32.492 27.816  1.00 38.80  ? 110 SER C OG  1 
ATOM   2792 N N   . PHE C 1 93  ? 13.524  35.901 24.727  1.00 35.47  ? 111 PHE C N   1 
ATOM   2793 C CA  . PHE C 1 93  ? 14.010  36.828 23.690  1.00 26.59  ? 111 PHE C CA  1 
ATOM   2794 C C   . PHE C 1 93  ? 13.045  37.915 23.221  1.00 26.85  ? 111 PHE C C   1 
ATOM   2795 O O   . PHE C 1 93  ? 13.379  38.688 22.324  1.00 47.37  ? 111 PHE C O   1 
ATOM   2796 C CB  . PHE C 1 93  ? 14.605  36.062 22.492  1.00 37.61  ? 111 PHE C CB  1 
ATOM   2797 C CG  . PHE C 1 93  ? 13.656  35.071 21.872  1.00 33.16  ? 111 PHE C CG  1 
ATOM   2798 C CD1 . PHE C 1 93  ? 12.816  35.451 20.833  1.00 33.35  ? 111 PHE C CD1 1 
ATOM   2799 C CD2 . PHE C 1 93  ? 13.590  33.763 22.343  1.00 42.11  ? 111 PHE C CD2 1 
ATOM   2800 C CE1 . PHE C 1 93  ? 11.933  34.529 20.252  1.00 38.92  ? 111 PHE C CE1 1 
ATOM   2801 C CE2 . PHE C 1 93  ? 12.711  32.841 21.789  1.00 37.76  ? 111 PHE C CE2 1 
ATOM   2802 C CZ  . PHE C 1 93  ? 11.880  33.221 20.738  1.00 38.25  ? 111 PHE C CZ  1 
ATOM   2803 N N   . SER C 1 94  ? 11.870  37.999 23.834  1.00 34.99  ? 112 SER C N   1 
ATOM   2804 C CA  . SER C 1 94  ? 10.870  38.989 23.429  1.00 36.62  ? 112 SER C CA  1 
ATOM   2805 C C   . SER C 1 94  ? 11.276  40.434 23.707  1.00 38.88  ? 112 SER C C   1 
ATOM   2806 O O   . SER C 1 94  ? 10.608  41.363 23.258  1.00 47.56  ? 112 SER C O   1 
ATOM   2807 C CB  . SER C 1 94  ? 9.528   38.708 24.101  1.00 43.38  ? 112 SER C CB  1 
ATOM   2808 O OG  . SER C 1 94  ? 9.676   38.623 25.505  1.00 58.48  ? 112 SER C OG  1 
ATOM   2809 N N   . SER C 1 95  ? 12.368  40.616 24.440  1.00 33.15  ? 113 SER C N   1 
ATOM   2810 C CA  . SER C 1 95  ? 12.844  41.951 24.805  1.00 61.07  ? 113 SER C CA  1 
ATOM   2811 C C   . SER C 1 95  ? 14.047  42.292 23.963  1.00 25.76  ? 113 SER C C   1 
ATOM   2812 O O   . SER C 1 95  ? 14.397  43.456 23.799  1.00 38.42  ? 113 SER C O   1 
ATOM   2813 C CB  . SER C 1 95  ? 13.226  42.030 26.296  1.00 38.90  ? 113 SER C CB  1 
ATOM   2814 O OG  . SER C 1 95  ? 12.073  42.205 27.098  1.00 66.30  ? 113 SER C OG  1 
ATOM   2815 N N   . ALA C 1 96  ? 14.693  41.249 23.467  1.00 27.12  ? 114 ALA C N   1 
ATOM   2816 C CA  . ALA C 1 96  ? 15.867  41.386 22.619  1.00 32.05  ? 114 ALA C CA  1 
ATOM   2817 C C   . ALA C 1 96  ? 15.620  42.412 21.518  1.00 43.14  ? 114 ALA C C   1 
ATOM   2818 O O   . ALA C 1 96  ? 14.489  42.573 21.042  1.00 36.86  ? 114 ALA C O   1 
ATOM   2819 C CB  . ALA C 1 96  ? 16.227  40.036 22.022  1.00 29.21  ? 114 ALA C CB  1 
ATOM   2820 N N   . PRO C 1 97  ? 16.680  43.116 21.112  1.00 31.44  ? 115 PRO C N   1 
ATOM   2821 C CA  . PRO C 1 97  ? 16.582  44.159 20.077  1.00 34.89  ? 115 PRO C CA  1 
ATOM   2822 C C   . PRO C 1 97  ? 16.091  43.561 18.753  1.00 47.37  ? 115 PRO C C   1 
ATOM   2823 O O   . PRO C 1 97  ? 16.469  42.438 18.400  1.00 34.01  ? 115 PRO C O   1 
ATOM   2824 C CB  . PRO C 1 97  ? 18.034  44.650 19.909  1.00 27.38  ? 115 PRO C CB  1 
ATOM   2825 C CG  . PRO C 1 97  ? 18.816  44.034 21.042  1.00 38.96  ? 115 PRO C CG  1 
ATOM   2826 C CD  . PRO C 1 97  ? 18.069  42.814 21.489  1.00 33.61  ? 115 PRO C CD  1 
ATOM   2827 N N   . GLY C 1 98  ? 15.264  44.305 18.027  1.00 42.04  ? 116 GLY C N   1 
ATOM   2828 C CA  . GLY C 1 98  ? 14.766  43.836 16.747  1.00 24.64  ? 116 GLY C CA  1 
ATOM   2829 C C   . GLY C 1 98  ? 13.575  42.908 16.913  1.00 39.67  ? 116 GLY C C   1 
ATOM   2830 O O   . GLY C 1 98  ? 12.802  42.720 15.984  1.00 36.00  ? 116 GLY C O   1 
ATOM   2831 N N   . VAL C 1 99  ? 13.404  42.328 18.096  1.00 32.46  ? 117 VAL C N   1 
ATOM   2832 C CA  . VAL C 1 99  ? 12.322  41.370 18.269  1.00 25.05  ? 117 VAL C CA  1 
ATOM   2833 C C   . VAL C 1 99  ? 11.001  42.061 18.544  1.00 29.85  ? 117 VAL C C   1 
ATOM   2834 O O   . VAL C 1 99  ? 10.517  42.105 19.675  1.00 38.56  ? 117 VAL C O   1 
ATOM   2835 C CB  . VAL C 1 99  ? 12.660  40.280 19.307  1.00 36.02  ? 117 VAL C CB  1 
ATOM   2836 C CG1 . VAL C 1 99  ? 11.505  39.288 19.457  1.00 27.96  ? 117 VAL C CG1 1 
ATOM   2837 C CG2 . VAL C 1 99  ? 13.912  39.557 18.887  1.00 22.74  ? 117 VAL C CG2 1 
ATOM   2838 N N   . ILE C 1 100 ? 10.393  42.565 17.476  1.00 35.11  ? 118 ILE C N   1 
ATOM   2839 C CA  . ILE C 1 100 ? 9.242   43.441 17.614  1.00 23.76  ? 118 ILE C CA  1 
ATOM   2840 C C   . ILE C 1 100 ? 7.897   42.768 17.406  1.00 35.28  ? 118 ILE C C   1 
ATOM   2841 O O   . ILE C 1 100 ? 6.858   43.367 17.661  1.00 51.68  ? 118 ILE C O   1 
ATOM   2842 C CB  . ILE C 1 100 ? 9.380   44.661 16.708  1.00 37.14  ? 118 ILE C CB  1 
ATOM   2843 C CG1 . ILE C 1 100 ? 9.669   44.220 15.270  1.00 36.44  ? 118 ILE C CG1 1 
ATOM   2844 C CG2 . ILE C 1 100 ? 10.512  45.560 17.233  1.00 36.70  ? 118 ILE C CG2 1 
ATOM   2845 C CD1 . ILE C 1 100 ? 9.571   45.332 14.246  1.00 36.74  ? 118 ILE C CD1 1 
ATOM   2846 N N   . PHE C 1 101 ? 7.897   41.523 16.948  1.00 35.29  ? 119 PHE C N   1 
ATOM   2847 C CA  . PHE C 1 101 ? 6.621   40.838 16.783  1.00 32.28  ? 119 PHE C CA  1 
ATOM   2848 C C   . PHE C 1 101 ? 6.139   40.328 18.131  1.00 40.63  ? 119 PHE C C   1 
ATOM   2849 O O   . PHE C 1 101 ? 6.907   40.283 19.086  1.00 33.50  ? 119 PHE C O   1 
ATOM   2850 C CB  . PHE C 1 101 ? 6.647   39.763 15.670  1.00 36.15  ? 119 PHE C CB  1 
ATOM   2851 C CG  . PHE C 1 101 ? 7.519   38.559 15.953  1.00 36.94  ? 119 PHE C CG  1 
ATOM   2852 C CD1 . PHE C 1 101 ? 8.282   38.462 17.114  1.00 38.76  ? 119 PHE C CD1 1 
ATOM   2853 C CD2 . PHE C 1 101 ? 7.601   37.530 15.018  1.00 33.71  ? 119 PHE C CD2 1 
ATOM   2854 C CE1 . PHE C 1 101 ? 9.084   37.339 17.352  1.00 28.51  ? 119 PHE C CE1 1 
ATOM   2855 C CE2 . PHE C 1 101 ? 8.400   36.409 15.250  1.00 43.56  ? 119 PHE C CE2 1 
ATOM   2856 C CZ  . PHE C 1 101 ? 9.145   36.315 16.416  1.00 33.37  ? 119 PHE C CZ  1 
ATOM   2857 N N   . ARG C 1 102 ? 4.867   39.976 18.223  1.00 26.65  ? 120 ARG C N   1 
ATOM   2858 C CA  . ARG C 1 102 ? 4.289   39.680 19.521  1.00 32.34  ? 120 ARG C CA  1 
ATOM   2859 C C   . ARG C 1 102 ? 3.305   38.552 19.418  1.00 41.31  ? 120 ARG C C   1 
ATOM   2860 O O   . ARG C 1 102 ? 3.010   38.073 18.330  1.00 40.47  ? 120 ARG C O   1 
ATOM   2861 C CB  . ARG C 1 102 ? 3.580   40.917 20.072  1.00 30.20  ? 120 ARG C CB  1 
ATOM   2862 C CG  . ARG C 1 102 ? 4.548   42.038 20.443  1.00 52.08  ? 120 ARG C CG  1 
ATOM   2863 C CD  . ARG C 1 102 ? 3.903   43.031 21.382  1.00 69.25  ? 120 ARG C CD  1 
ATOM   2864 N NE  . ARG C 1 102 ? 2.964   43.906 20.689  1.00 82.15  ? 120 ARG C NE  1 
ATOM   2865 C CZ  . ARG C 1 102 ? 2.276   44.876 21.282  1.00 87.65  ? 120 ARG C CZ  1 
ATOM   2866 N NH1 . ARG C 1 102 ? 2.421   45.087 22.585  1.00 73.94  ? 120 ARG C NH1 1 
ATOM   2867 N NH2 . ARG C 1 102 ? 1.442   45.630 20.575  1.00 65.11  ? 120 ARG C NH2 1 
ATOM   2868 N N   . GLN C 1 103 ? 2.778   38.124 20.553  1.00 35.85  ? 121 GLN C N   1 
ATOM   2869 C CA  . GLN C 1 103 ? 1.776   37.091 20.508  1.00 32.13  ? 121 GLN C CA  1 
ATOM   2870 C C   . GLN C 1 103 ? 0.756   37.484 19.443  1.00 39.44  ? 121 GLN C C   1 
ATOM   2871 O O   . GLN C 1 103 ? 0.462   38.668 19.265  1.00 50.68  ? 121 GLN C O   1 
ATOM   2872 C CB  . GLN C 1 103 ? 1.115   36.959 21.854  1.00 19.64  ? 121 GLN C CB  1 
ATOM   2873 C CG  . GLN C 1 103 ? 0.078   35.870 21.935  1.00 36.33  ? 121 GLN C CG  1 
ATOM   2874 C CD  . GLN C 1 103 ? -0.261  35.523 23.376  1.00 54.80  ? 121 GLN C CD  1 
ATOM   2875 O OE1 . GLN C 1 103 ? 0.575   35.660 24.270  1.00 43.24  ? 121 GLN C OE1 1 
ATOM   2876 N NE2 . GLN C 1 103 ? -1.484  35.067 23.607  1.00 42.29  ? 121 GLN C NE2 1 
ATOM   2877 N N   . GLU C 1 104 ? 0.228   36.502 18.719  1.00 36.78  ? 122 GLU C N   1 
ATOM   2878 C CA  . GLU C 1 104 ? -0.704  36.813 17.639  1.00 48.56  ? 122 GLU C CA  1 
ATOM   2879 C C   . GLU C 1 104 ? -2.128  36.967 18.138  1.00 40.00  ? 122 GLU C C   1 
ATOM   2880 O O   . GLU C 1 104 ? -2.576  36.247 19.043  1.00 40.30  ? 122 GLU C O   1 
ATOM   2881 C CB  . GLU C 1 104 ? -0.684  35.741 16.553  1.00 56.39  ? 122 GLU C CB  1 
ATOM   2882 C CG  . GLU C 1 104 ? 0.637   35.543 15.840  1.00 51.37  ? 122 GLU C CG  1 
ATOM   2883 C CD  . GLU C 1 104 ? 0.486   34.574 14.678  1.00 58.38  ? 122 GLU C CD  1 
ATOM   2884 O OE1 . GLU C 1 104 ? -0.498  34.710 13.916  1.00 55.56  ? 122 GLU C OE1 1 
ATOM   2885 O OE2 . GLU C 1 104 ? 1.337   33.676 14.528  1.00 57.20  ? 122 GLU C OE2 1 
ATOM   2886 N N   . THR C 1 105 ? -2.839  37.907 17.529  1.00 33.78  ? 123 THR C N   1 
ATOM   2887 C CA  . THR C 1 105 ? -4.266  38.053 17.766  1.00 51.86  ? 123 THR C CA  1 
ATOM   2888 C C   . THR C 1 105 ? -4.986  36.727 17.526  1.00 53.00  ? 123 THR C C   1 
ATOM   2889 O O   . THR C 1 105 ? -4.768  36.062 16.507  1.00 38.43  ? 123 THR C O   1 
ATOM   2890 C CB  . THR C 1 105 ? -4.857  39.139 16.860  1.00 55.09  ? 123 THR C CB  1 
ATOM   2891 O OG1 . THR C 1 105 ? -4.260  40.400 17.186  1.00 56.61  ? 123 THR C OG1 1 
ATOM   2892 C CG2 . THR C 1 105 ? -6.358  39.231 17.044  1.00 42.57  ? 123 THR C CG2 1 
ATOM   2893 N N   . GLY C 1 106 ? -5.829  36.337 18.477  1.00 48.52  ? 124 GLY C N   1 
ATOM   2894 C CA  . GLY C 1 106 ? -6.576  35.097 18.370  1.00 32.85  ? 124 GLY C CA  1 
ATOM   2895 C C   . GLY C 1 106 ? -5.834  33.871 18.881  1.00 50.60  ? 124 GLY C C   1 
ATOM   2896 O O   . GLY C 1 106 ? -6.413  32.792 19.005  1.00 72.85  ? 124 GLY C O   1 
ATOM   2897 N N   . LEU C 1 107 ? -4.551  34.030 19.180  1.00 50.12  ? 125 LEU C N   1 
ATOM   2898 C CA  . LEU C 1 107 ? -3.764  32.934 19.740  1.00 54.48  ? 125 LEU C CA  1 
ATOM   2899 C C   . LEU C 1 107 ? -3.600  33.035 21.253  1.00 47.03  ? 125 LEU C C   1 
ATOM   2900 O O   . LEU C 1 107 ? -3.210  34.076 21.770  1.00 56.89  ? 125 LEU C O   1 
ATOM   2901 C CB  . LEU C 1 107 ? -2.396  32.857 19.065  1.00 49.55  ? 125 LEU C CB  1 
ATOM   2902 C CG  . LEU C 1 107 ? -2.193  31.620 18.197  1.00 51.67  ? 125 LEU C CG  1 
ATOM   2903 C CD1 . LEU C 1 107 ? -3.389  31.390 17.288  1.00 38.14  ? 125 LEU C CD1 1 
ATOM   2904 C CD2 . LEU C 1 107 ? -0.911  31.764 17.419  1.00 44.17  ? 125 LEU C CD2 1 
ATOM   2905 N N   . ASP C 1 108 ? -3.882  31.943 21.957  1.00 56.08  ? 126 ASP C N   1 
ATOM   2906 C CA  . ASP C 1 108 ? -3.793  31.936 23.412  1.00 58.11  ? 126 ASP C CA  1 
ATOM   2907 C C   . ASP C 1 108 ? -2.381  31.604 23.895  1.00 62.17  ? 126 ASP C C   1 
ATOM   2908 O O   . ASP C 1 108 ? -2.178  31.328 25.072  1.00 59.34  ? 126 ASP C O   1 
ATOM   2909 C CB  . ASP C 1 108 ? -4.768  30.923 23.995  1.00 68.44  ? 126 ASP C CB  1 
ATOM   2910 C CG  . ASP C 1 108 ? -4.253  29.502 23.884  1.00 89.81  ? 126 ASP C CG  1 
ATOM   2911 O OD1 . ASP C 1 108 ? -3.459  29.230 22.956  1.00 96.91  ? 126 ASP C OD1 1 
ATOM   2912 O OD2 . ASP C 1 108 ? -4.635  28.660 24.724  1.00 67.64  ? 126 ASP C OD2 1 
ATOM   2913 N N   . HIS C 1 109 ? -1.407  31.615 22.992  1.00 45.88  ? 127 HIS C N   1 
ATOM   2914 C CA  . HIS C 1 109 ? -0.038  31.370 23.408  1.00 41.87  ? 127 HIS C CA  1 
ATOM   2915 C C   . HIS C 1 109 ? 0.990   32.204 22.646  1.00 39.18  ? 127 HIS C C   1 
ATOM   2916 O O   . HIS C 1 109 ? 0.696   32.777 21.611  1.00 41.58  ? 127 HIS C O   1 
ATOM   2917 C CB  . HIS C 1 109 ? 0.296   29.887 23.316  1.00 38.45  ? 127 HIS C CB  1 
ATOM   2918 C CG  . HIS C 1 109 ? 0.381   29.383 21.913  1.00 67.92  ? 127 HIS C CG  1 
ATOM   2919 N ND1 . HIS C 1 109 ? -0.722  28.938 21.215  1.00 60.45  ? 127 HIS C ND1 1 
ATOM   2920 C CD2 . HIS C 1 109 ? 1.435   29.265 21.072  1.00 58.80  ? 127 HIS C CD2 1 
ATOM   2921 C CE1 . HIS C 1 109 ? -0.348  28.561 20.005  1.00 76.83  ? 127 HIS C CE1 1 
ATOM   2922 N NE2 . HIS C 1 109 ? 0.955   28.750 19.893  1.00 62.37  ? 127 HIS C NE2 1 
ATOM   2923 N N   . ASP C 1 110 ? 2.199   32.256 23.190  1.00 32.68  ? 128 ASP C N   1 
ATOM   2924 C CA  . ASP C 1 110 ? 3.288   33.051 22.652  1.00 33.39  ? 128 ASP C CA  1 
ATOM   2925 C C   . ASP C 1 110 ? 3.834   32.477 21.369  1.00 44.22  ? 128 ASP C C   1 
ATOM   2926 O O   . ASP C 1 110 ? 3.693   31.279 21.109  1.00 39.53  ? 128 ASP C O   1 
ATOM   2927 C CB  . ASP C 1 110 ? 4.439   33.144 23.662  1.00 44.85  ? 128 ASP C CB  1 
ATOM   2928 C CG  . ASP C 1 110 ? 4.167   34.140 24.775  1.00 51.19  ? 128 ASP C CG  1 
ATOM   2929 O OD1 . ASP C 1 110 ? 3.108   34.796 24.726  1.00 48.82  ? 128 ASP C OD1 1 
ATOM   2930 O OD2 . ASP C 1 110 ? 5.012   34.267 25.692  1.00 54.22  ? 128 ASP C OD2 1 
ATOM   2931 N N   . PRO C 1 111 ? 4.471   33.341 20.563  1.00 43.30  ? 129 PRO C N   1 
ATOM   2932 C CA  . PRO C 1 111 ? 5.230   32.903 19.390  1.00 40.81  ? 129 PRO C CA  1 
ATOM   2933 C C   . PRO C 1 111 ? 6.176   31.804 19.828  1.00 40.29  ? 129 PRO C C   1 
ATOM   2934 O O   . PRO C 1 111 ? 6.778   31.905 20.897  1.00 40.95  ? 129 PRO C O   1 
ATOM   2935 C CB  . PRO C 1 111 ? 6.024   34.154 18.992  1.00 31.75  ? 129 PRO C CB  1 
ATOM   2936 C CG  . PRO C 1 111 ? 5.185   35.291 19.482  1.00 38.45  ? 129 PRO C CG  1 
ATOM   2937 C CD  . PRO C 1 111 ? 4.556   34.799 20.768  1.00 38.18  ? 129 PRO C CD  1 
ATOM   2938 N N   . GLU C 1 112 ? 6.290   30.757 19.023  1.00 33.82  ? 130 GLU C N   1 
ATOM   2939 C CA  . GLU C 1 112 ? 7.134   29.629 19.369  1.00 28.07  ? 130 GLU C CA  1 
ATOM   2940 C C   . GLU C 1 112 ? 7.851   29.055 18.149  1.00 33.31  ? 130 GLU C C   1 
ATOM   2941 O O   . GLU C 1 112 ? 7.296   28.937 17.060  1.00 35.30  ? 130 GLU C O   1 
ATOM   2942 C CB  . GLU C 1 112 ? 6.295   28.544 20.038  1.00 33.79  ? 130 GLU C CB  1 
ATOM   2943 C CG  . GLU C 1 112 ? 5.128   28.096 19.170  1.00 43.52  ? 130 GLU C CG  1 
ATOM   2944 C CD  . GLU C 1 112 ? 4.534   26.772 19.604  1.00 72.10  ? 130 GLU C CD  1 
ATOM   2945 O OE1 . GLU C 1 112 ? 4.936   26.250 20.669  1.00 60.65  ? 130 GLU C OE1 1 
ATOM   2946 O OE2 . GLU C 1 112 ? 3.660   26.254 18.870  1.00 87.09  ? 130 GLU C OE2 1 
ATOM   2947 N N   . TRP C 1 113 ? 9.103   28.699 18.343  1.00 35.63  ? 131 TRP C N   1 
ATOM   2948 C CA  . TRP C 1 113 ? 9.784   27.904 17.362  1.00 31.71  ? 131 TRP C CA  1 
ATOM   2949 C C   . TRP C 1 113 ? 9.051   26.578 17.137  1.00 40.38  ? 131 TRP C C   1 
ATOM   2950 O O   . TRP C 1 113 ? 8.752   25.845 18.073  1.00 31.32  ? 131 TRP C O   1 
ATOM   2951 C CB  . TRP C 1 113 ? 11.213  27.670 17.796  1.00 24.15  ? 131 TRP C CB  1 
ATOM   2952 C CG  . TRP C 1 113 ? 12.063  28.879 17.628  1.00 39.98  ? 131 TRP C CG  1 
ATOM   2953 C CD1 . TRP C 1 113 ? 12.570  29.671 18.615  1.00 25.32  ? 131 TRP C CD1 1 
ATOM   2954 C CD2 . TRP C 1 113 ? 12.499  29.451 16.391  1.00 39.27  ? 131 TRP C CD2 1 
ATOM   2955 N NE1 . TRP C 1 113 ? 13.310  30.685 18.072  1.00 36.06  ? 131 TRP C NE1 1 
ATOM   2956 C CE2 . TRP C 1 113 ? 13.289  30.573 16.707  1.00 34.17  ? 131 TRP C CE2 1 
ATOM   2957 C CE3 . TRP C 1 113 ? 12.298  29.124 15.048  1.00 37.45  ? 131 TRP C CE3 1 
ATOM   2958 C CZ2 . TRP C 1 113 ? 13.880  31.372 15.729  1.00 38.27  ? 131 TRP C CZ2 1 
ATOM   2959 C CZ3 . TRP C 1 113 ? 12.889  29.911 14.078  1.00 36.44  ? 131 TRP C CZ3 1 
ATOM   2960 C CH2 . TRP C 1 113 ? 13.670  31.027 14.423  1.00 44.91  ? 131 TRP C CH2 1 
ATOM   2961 N N   . VAL C 1 114 ? 8.754   26.300 15.875  1.00 38.35  ? 132 VAL C N   1 
ATOM   2962 C CA  . VAL C 1 114 ? 8.118   25.062 15.469  1.00 27.23  ? 132 VAL C CA  1 
ATOM   2963 C C   . VAL C 1 114 ? 9.005   24.335 14.454  1.00 34.02  ? 132 VAL C C   1 
ATOM   2964 O O   . VAL C 1 114 ? 9.312   24.863 13.375  1.00 30.68  ? 132 VAL C O   1 
ATOM   2965 C CB  . VAL C 1 114 ? 6.762   25.352 14.839  1.00 52.59  ? 132 VAL C CB  1 
ATOM   2966 C CG1 . VAL C 1 114 ? 6.252   24.132 14.037  1.00 35.52  ? 132 VAL C CG1 1 
ATOM   2967 C CG2 . VAL C 1 114 ? 5.793   25.784 15.920  1.00 41.67  ? 132 VAL C CG2 1 
ATOM   2968 N N   . VAL C 1 115 ? 9.436   23.131 14.810  1.00 33.45  ? 133 VAL C N   1 
ATOM   2969 C CA  . VAL C 1 115 ? 10.289  22.354 13.918  1.00 47.80  ? 133 VAL C CA  1 
ATOM   2970 C C   . VAL C 1 115 ? 9.473   21.683 12.823  1.00 35.33  ? 133 VAL C C   1 
ATOM   2971 O O   . VAL C 1 115 ? 8.430   21.092 13.087  1.00 50.62  ? 133 VAL C O   1 
ATOM   2972 C CB  . VAL C 1 115 ? 11.088  21.274 14.664  1.00 33.02  ? 133 VAL C CB  1 
ATOM   2973 C CG1 . VAL C 1 115 ? 11.738  20.325 13.662  1.00 32.71  ? 133 VAL C CG1 1 
ATOM   2974 C CG2 . VAL C 1 115 ? 12.138  21.908 15.543  1.00 32.91  ? 133 VAL C CG2 1 
ATOM   2975 N N   . ASN C 1 116 ? 9.955   21.779 11.593  1.00 38.24  ? 134 ASN C N   1 
ATOM   2976 C CA  . ASN C 1 116 ? 9.301   21.107 10.484  1.00 47.15  ? 134 ASN C CA  1 
ATOM   2977 C C   . ASN C 1 116 ? 9.769   19.655 10.366  1.00 35.86  ? 134 ASN C C   1 
ATOM   2978 O O   . ASN C 1 116 ? 10.821  19.370 9.793   1.00 36.58  ? 134 ASN C O   1 
ATOM   2979 C CB  . ASN C 1 116 ? 9.528   21.874 9.182   1.00 36.96  ? 134 ASN C CB  1 
ATOM   2980 C CG  . ASN C 1 116 ? 8.898   21.191 7.994   1.00 59.33  ? 134 ASN C CG  1 
ATOM   2981 O OD1 . ASN C 1 116 ? 9.180   21.535 6.850   1.00 60.48  ? 134 ASN C OD1 1 
ATOM   2982 N ND2 . ASN C 1 116 ? 8.042   20.209 8.258   1.00 46.94  ? 134 ASN C ND2 1 
ATOM   2983 N N   . MET C 1 117 ? 8.977   18.748 10.928  1.00 35.02  ? 135 MET C N   1 
ATOM   2984 C CA  . MET C 1 117 ? 9.312   17.329 10.950  1.00 42.13  ? 135 MET C CA  1 
ATOM   2985 C C   . MET C 1 117 ? 9.151   16.633 9.586   1.00 58.91  ? 135 MET C C   1 
ATOM   2986 O O   . MET C 1 117 ? 9.530   15.468 9.447   1.00 58.24  ? 135 MET C O   1 
ATOM   2987 C CB  . MET C 1 117 ? 8.494   16.601 12.026  1.00 41.12  ? 135 MET C CB  1 
ATOM   2988 C CG  . MET C 1 117 ? 8.899   16.935 13.478  1.00 37.45  ? 135 MET C CG  1 
ATOM   2989 S SD  . MET C 1 117 ? 10.668  16.650 13.818  1.00 44.83  ? 135 MET C SD  1 
ATOM   2990 C CE  . MET C 1 117 ? 10.806  14.908 13.398  1.00 46.99  ? 135 MET C CE  1 
ATOM   2991 N N   . LYS C 1 118 ? 8.597   17.338 8.592   1.00 34.84  ? 136 LYS C N   1 
ATOM   2992 C CA  . LYS C 1 118 ? 8.445   16.785 7.236   1.00 44.02  ? 136 LYS C CA  1 
ATOM   2993 C C   . LYS C 1 118 ? 9.668   17.060 6.372   1.00 50.80  ? 136 LYS C C   1 
ATOM   2994 O O   . LYS C 1 118 ? 10.001  16.261 5.503   1.00 39.44  ? 136 LYS C O   1 
ATOM   2995 C CB  . LYS C 1 118 ? 7.216   17.349 6.516   1.00 39.05  ? 136 LYS C CB  1 
ATOM   2996 C CG  . LYS C 1 118 ? 5.885   16.770 6.961   1.00 45.06  ? 136 LYS C CG  1 
ATOM   2997 C CD  . LYS C 1 118 ? 4.817   17.842 6.951   1.00 56.62  ? 136 LYS C CD  1 
ATOM   2998 C CE  . LYS C 1 118 ? 5.350   19.112 7.617   1.00 55.21  ? 136 LYS C CE  1 
ATOM   2999 N NZ  . LYS C 1 118 ? 4.364   19.759 8.516   1.00 43.83  ? 136 LYS C NZ  1 
ATOM   3000 N N   . ALA C 1 119 ? 10.324  18.196 6.603   1.00 42.10  ? 137 ALA C N   1 
ATOM   3001 C CA  . ALA C 1 119 ? 11.514  18.553 5.840   1.00 28.80  ? 137 ALA C CA  1 
ATOM   3002 C C   . ALA C 1 119 ? 12.660  17.619 6.174   1.00 26.48  ? 137 ALA C C   1 
ATOM   3003 O O   . ALA C 1 119 ? 12.706  17.032 7.256   1.00 46.11  ? 137 ALA C O   1 
ATOM   3004 C CB  . ALA C 1 119 ? 11.912  20.004 6.112   1.00 35.30  ? 137 ALA C CB  1 
ATOM   3005 N N   . ARG C 1 120 ? 13.598  17.495 5.247   1.00 52.79  ? 138 ARG C N   1 
ATOM   3006 C CA  . ARG C 1 120 ? 14.742  16.618 5.445   1.00 60.71  ? 138 ARG C CA  1 
ATOM   3007 C C   . ARG C 1 120 ? 15.771  17.271 6.356   1.00 50.81  ? 138 ARG C C   1 
ATOM   3008 O O   . ARG C 1 120 ? 16.024  18.466 6.254   1.00 57.12  ? 138 ARG C O   1 
ATOM   3009 C CB  . ARG C 1 120 ? 15.373  16.266 4.096   1.00 53.83  ? 138 ARG C CB  1 
ATOM   3010 C CG  . ARG C 1 120 ? 14.419  15.540 3.165   1.00 74.23  ? 138 ARG C CG  1 
ATOM   3011 C CD  . ARG C 1 120 ? 14.974  15.428 1.762   1.00 91.38  ? 138 ARG C CD  1 
ATOM   3012 N NE  . ARG C 1 120 ? 14.355  14.330 1.026   1.00 77.80  ? 138 ARG C NE  1 
ATOM   3013 C CZ  . ARG C 1 120 ? 14.701  13.054 1.168   1.00 92.60  ? 138 ARG C CZ  1 
ATOM   3014 N NH1 . ARG C 1 120 ? 15.660  12.711 2.030   1.00 52.61  ? 138 ARG C NH1 1 
ATOM   3015 N NH2 . ARG C 1 120 ? 14.086  12.120 0.451   1.00 94.43  ? 138 ARG C NH2 1 
ATOM   3016 N N   . THR C 1 121 ? 16.351  16.484 7.254   1.00 43.75  ? 139 THR C N   1 
ATOM   3017 C CA  . THR C 1 121 ? 17.476  16.945 8.050   1.00 42.06  ? 139 THR C CA  1 
ATOM   3018 C C   . THR C 1 121 ? 18.556  17.510 7.136   1.00 48.39  ? 139 THR C C   1 
ATOM   3019 O O   . THR C 1 121 ? 18.664  17.126 5.973   1.00 46.93  ? 139 THR C O   1 
ATOM   3020 C CB  . THR C 1 121 ? 18.090  15.800 8.871   1.00 40.79  ? 139 THR C CB  1 
ATOM   3021 O OG1 . THR C 1 121 ? 18.561  14.779 7.982   1.00 54.89  ? 139 THR C OG1 1 
ATOM   3022 C CG2 . THR C 1 121 ? 17.065  15.205 9.835   1.00 35.27  ? 139 THR C CG2 1 
ATOM   3023 N N   . ARG C 1 122 ? 19.356  18.427 7.661   1.00 43.49  ? 140 ARG C N   1 
ATOM   3024 C CA  . ARG C 1 122 ? 20.481  18.939 6.901   1.00 46.50  ? 140 ARG C CA  1 
ATOM   3025 C C   . ARG C 1 122 ? 21.663  19.211 7.828   1.00 56.85  ? 140 ARG C C   1 
ATOM   3026 O O   . ARG C 1 122 ? 21.545  19.094 9.053   1.00 38.28  ? 140 ARG C O   1 
ATOM   3027 C CB  . ARG C 1 122 ? 20.080  20.188 6.118   1.00 38.49  ? 140 ARG C CB  1 
ATOM   3028 C CG  . ARG C 1 122 ? 19.689  21.392 6.974   1.00 43.84  ? 140 ARG C CG  1 
ATOM   3029 C CD  . ARG C 1 122 ? 18.412  21.178 7.782   1.00 30.33  ? 140 ARG C CD  1 
ATOM   3030 N NE  . ARG C 1 122 ? 17.254  20.821 6.967   1.00 43.28  ? 140 ARG C NE  1 
ATOM   3031 C CZ  . ARG C 1 122 ? 16.574  21.666 6.192   1.00 35.94  ? 140 ARG C CZ  1 
ATOM   3032 N NH1 . ARG C 1 122 ? 16.937  22.928 6.100   1.00 33.69  ? 140 ARG C NH1 1 
ATOM   3033 N NH2 . ARG C 1 122 ? 15.520  21.252 5.501   1.00 34.74  ? 140 ARG C NH2 1 
ATOM   3034 N N   . GLY C 1 123 ? 22.810  19.543 7.245   1.00 54.04  ? 141 GLY C N   1 
ATOM   3035 C CA  . GLY C 1 123 ? 23.989  19.828 8.043   1.00 59.38  ? 141 GLY C CA  1 
ATOM   3036 C C   . GLY C 1 123 ? 23.705  20.940 9.028   1.00 45.59  ? 141 GLY C C   1 
ATOM   3037 O O   . GLY C 1 123 ? 22.763  21.700 8.845   1.00 49.43  ? 141 GLY C O   1 
ATOM   3038 N N   . CYS C 1 124 ? 24.507  21.042 10.079  1.00 56.85  ? 142 CYS C N   1 
ATOM   3039 C CA  . CYS C 1 124 ? 24.363  22.163 10.997  1.00 47.88  ? 142 CYS C CA  1 
ATOM   3040 C C   . CYS C 1 124 ? 25.269  23.307 10.582  1.00 53.18  ? 142 CYS C C   1 
ATOM   3041 O O   . CYS C 1 124 ? 25.013  24.466 10.921  1.00 62.91  ? 142 CYS C O   1 
ATOM   3042 C CB  . CYS C 1 124 ? 24.630  21.738 12.433  1.00 47.07  ? 142 CYS C CB  1 
ATOM   3043 S SG  . CYS C 1 124 ? 23.211  20.946 13.171  1.00 59.45  ? 142 CYS C SG  1 
ATOM   3044 N N   . ASP C 1 125 ? 26.315  22.971 9.831   1.00 46.31  ? 143 ASP C N   1 
ATOM   3045 C CA  . ASP C 1 125 ? 27.190  23.967 9.215   1.00 64.09  ? 143 ASP C CA  1 
ATOM   3046 C C   . ASP C 1 125 ? 26.906  24.079 7.729   1.00 55.10  ? 143 ASP C C   1 
ATOM   3047 O O   . ASP C 1 125 ? 26.744  23.074 7.038   1.00 50.85  ? 143 ASP C O   1 
ATOM   3048 C CB  . ASP C 1 125 ? 28.665  23.589 9.391   1.00 75.88  ? 143 ASP C CB  1 
ATOM   3049 C CG  . ASP C 1 125 ? 29.093  23.560 10.838  1.00 88.27  ? 143 ASP C CG  1 
ATOM   3050 O OD1 . ASP C 1 125 ? 29.722  22.557 11.251  1.00 105.14 ? 143 ASP C OD1 1 
ATOM   3051 O OD2 . ASP C 1 125 ? 28.799  24.538 11.561  1.00 86.86  ? 143 ASP C OD2 1 
ATOM   3052 N N   . HIS C 1 126 ? 26.868  25.304 7.232   1.00 55.39  ? 144 HIS C N   1 
ATOM   3053 C CA  . HIS C 1 126 ? 26.766  25.509 5.802   1.00 44.99  ? 144 HIS C CA  1 
ATOM   3054 C C   . HIS C 1 126 ? 28.141  25.380 5.158   1.00 55.36  ? 144 HIS C C   1 
ATOM   3055 O O   . HIS C 1 126 ? 29.135  25.891 5.675   1.00 53.13  ? 144 HIS C O   1 
ATOM   3056 C CB  . HIS C 1 126 ? 26.181  26.882 5.493   1.00 25.86  ? 144 HIS C CB  1 
ATOM   3057 C CG  . HIS C 1 126 ? 25.854  27.078 4.047   1.00 51.94  ? 144 HIS C CG  1 
ATOM   3058 N ND1 . HIS C 1 126 ? 24.617  26.778 3.513   1.00 48.25  ? 144 HIS C ND1 1 
ATOM   3059 C CD2 . HIS C 1 126 ? 26.610  27.524 3.016   1.00 53.72  ? 144 HIS C CD2 1 
ATOM   3060 C CE1 . HIS C 1 126 ? 24.622  27.045 2.220   1.00 50.43  ? 144 HIS C CE1 1 
ATOM   3061 N NE2 . HIS C 1 126 ? 25.821  27.496 1.893   1.00 59.78  ? 144 HIS C NE2 1 
ATOM   3062 N N   . HIS C 1 127 ? 28.198  24.687 4.029   1.00 60.13  ? 145 HIS C N   1 
ATOM   3063 C CA  . HIS C 1 127 ? 29.428  24.627 3.256   1.00 67.10  ? 145 HIS C CA  1 
ATOM   3064 C C   . HIS C 1 127 ? 29.245  25.254 1.882   1.00 61.98  ? 145 HIS C C   1 
ATOM   3065 O O   . HIS C 1 127 ? 28.405  24.817 1.091   1.00 54.42  ? 145 HIS C O   1 
ATOM   3066 C CB  . HIS C 1 127 ? 29.950  23.192 3.158   1.00 65.06  ? 145 HIS C CB  1 
ATOM   3067 C CG  . HIS C 1 127 ? 30.646  22.733 4.400   1.00 82.24  ? 145 HIS C CG  1 
ATOM   3068 N ND1 . HIS C 1 127 ? 30.295  21.582 5.069   1.00 69.08  ? 145 HIS C ND1 1 
ATOM   3069 C CD2 . HIS C 1 127 ? 31.656  23.289 5.111   1.00 84.25  ? 145 HIS C CD2 1 
ATOM   3070 C CE1 . HIS C 1 127 ? 31.066  21.441 6.132   1.00 88.24  ? 145 HIS C CE1 1 
ATOM   3071 N NE2 . HIS C 1 127 ? 31.901  22.464 6.181   1.00 88.64  ? 145 HIS C NE2 1 
ATOM   3072 N N   . HIS C 1 128 ? 30.034  26.290 1.614   1.00 54.40  ? 146 HIS C N   1 
ATOM   3073 C CA  . HIS C 1 128 ? 29.895  27.055 0.380   1.00 61.18  ? 146 HIS C CA  1 
ATOM   3074 C C   . HIS C 1 128 ? 30.431  26.341 -0.852  1.00 51.83  ? 146 HIS C C   1 
ATOM   3075 O O   . HIS C 1 128 ? 29.964  26.586 -1.961  1.00 48.25  ? 146 HIS C O   1 
ATOM   3076 C CB  . HIS C 1 128 ? 30.558  28.422 0.521   1.00 51.23  ? 146 HIS C CB  1 
ATOM   3077 C CG  . HIS C 1 128 ? 29.672  29.459 1.134   1.00 67.19  ? 146 HIS C CG  1 
ATOM   3078 N ND1 . HIS C 1 128 ? 29.645  29.711 2.489   1.00 69.36  ? 146 HIS C ND1 1 
ATOM   3079 C CD2 . HIS C 1 128 ? 28.774  30.305 0.576   1.00 64.33  ? 146 HIS C CD2 1 
ATOM   3080 C CE1 . HIS C 1 128 ? 28.774  30.672 2.739   1.00 70.42  ? 146 HIS C CE1 1 
ATOM   3081 N NE2 . HIS C 1 128 ? 28.233  31.051 1.595   1.00 96.05  ? 146 HIS C NE2 1 
ATOM   3082 N N   . HIS C 1 129 ? 31.407  25.459 -0.659  1.00 48.77  ? 147 HIS C N   1 
ATOM   3083 C CA  . HIS C 1 129 ? 32.028  24.782 -1.785  1.00 54.64  ? 147 HIS C CA  1 
ATOM   3084 C C   . HIS C 1 129 ? 32.242  23.288 -1.558  1.00 64.44  ? 147 HIS C C   1 
ATOM   3085 O O   . HIS C 1 129 ? 32.099  22.788 -0.435  1.00 61.09  ? 147 HIS C O   1 
ATOM   3086 C CB  . HIS C 1 129 ? 33.353  25.456 -2.144  1.00 69.66  ? 147 HIS C CB  1 
ATOM   3087 C CG  . HIS C 1 129 ? 33.753  25.278 -3.578  1.00 85.54  ? 147 HIS C CG  1 
ATOM   3088 N ND1 . HIS C 1 129 ? 33.378  26.159 -4.571  1.00 96.05  ? 147 HIS C ND1 1 
ATOM   3089 C CD2 . HIS C 1 129 ? 34.491  24.319 -4.186  1.00 77.39  ? 147 HIS C CD2 1 
ATOM   3090 C CE1 . HIS C 1 129 ? 33.871  25.753 -5.729  1.00 88.14  ? 147 HIS C CE1 1 
ATOM   3091 N NE2 . HIS C 1 129 ? 34.551  24.639 -5.522  1.00 94.92  ? 147 HIS C NE2 1 
ATOM   3092 N N   . HIS C 1 130 ? 32.548  22.592 -2.653  1.00 64.61  ? 148 HIS C N   1 
ATOM   3093 C CA  . HIS C 1 130 ? 32.994  21.202 -2.637  1.00 79.55  ? 148 HIS C CA  1 
ATOM   3094 C C   . HIS C 1 130 ? 32.814  20.552 -4.004  1.00 69.69  ? 148 HIS C C   1 
ATOM   3095 O O   . HIS C 1 130 ? 33.770  20.433 -4.774  1.00 76.62  ? 148 HIS C O   1 
ATOM   3096 C CB  . HIS C 1 130 ? 32.275  20.374 -1.576  1.00 80.39  ? 148 HIS C CB  1 
ATOM   3097 C CG  . HIS C 1 130 ? 33.046  19.164 -1.153  1.00 115.13 ? 148 HIS C CG  1 
ATOM   3098 N ND1 . HIS C 1 130 ? 33.433  18.947 0.152   1.00 119.20 ? 148 HIS C ND1 1 
ATOM   3099 C CD2 . HIS C 1 130 ? 33.531  18.122 -1.869  1.00 125.91 ? 148 HIS C CD2 1 
ATOM   3100 C CE1 . HIS C 1 130 ? 34.106  17.812 0.225   1.00 137.15 ? 148 HIS C CE1 1 
ATOM   3101 N NE2 . HIS C 1 130 ? 34.181  17.293 -0.988  1.00 143.01 ? 148 HIS C NE2 1 
ATOM   3102 N N   . VAL D 1 3   ? -7.442  51.569 -11.677 1.00 61.46  ? 21  VAL D N   1 
ATOM   3103 C CA  . VAL D 1 3   ? -7.151  50.603 -10.617 1.00 69.63  ? 21  VAL D CA  1 
ATOM   3104 C C   . VAL D 1 3   ? -6.070  49.564 -10.970 1.00 68.72  ? 21  VAL D C   1 
ATOM   3105 O O   . VAL D 1 3   ? -5.686  49.372 -12.137 1.00 50.69  ? 21  VAL D O   1 
ATOM   3106 C CB  . VAL D 1 3   ? -8.432  49.887 -10.109 1.00 68.25  ? 21  VAL D CB  1 
ATOM   3107 C CG1 . VAL D 1 3   ? -9.111  50.700 -8.994  1.00 74.68  ? 21  VAL D CG1 1 
ATOM   3108 C CG2 . VAL D 1 3   ? -9.383  49.630 -11.253 1.00 44.70  ? 21  VAL D CG2 1 
ATOM   3109 N N   . CYS D 1 4   ? -5.574  48.904 -9.929  1.00 62.33  ? 22  CYS D N   1 
ATOM   3110 C CA  . CYS D 1 4   ? -4.482  47.955 -10.063 1.00 55.11  ? 22  CYS D CA  1 
ATOM   3111 C C   . CYS D 1 4   ? -4.848  46.601 -9.496  1.00 51.08  ? 22  CYS D C   1 
ATOM   3112 O O   . CYS D 1 4   ? -5.878  46.418 -8.848  1.00 42.47  ? 22  CYS D O   1 
ATOM   3113 C CB  . CYS D 1 4   ? -3.241  48.451 -9.316  1.00 50.82  ? 22  CYS D CB  1 
ATOM   3114 S SG  . CYS D 1 4   ? -2.286  49.740 -10.128 1.00 57.30  ? 22  CYS D SG  1 
ATOM   3115 N N   . ARG D 1 5   ? -3.970  45.646 -9.728  1.00 48.70  ? 23  ARG D N   1 
ATOM   3116 C CA  . ARG D 1 5   ? -4.085  44.384 -9.044  1.00 65.84  ? 23  ARG D CA  1 
ATOM   3117 C C   . ARG D 1 5   ? -2.728  43.996 -8.511  1.00 53.96  ? 23  ARG D C   1 
ATOM   3118 O O   . ARG D 1 5   ? -1.784  44.784 -8.497  1.00 31.29  ? 23  ARG D O   1 
ATOM   3119 C CB  . ARG D 1 5   ? -4.594  43.307 -9.997  1.00 50.01  ? 23  ARG D CB  1 
ATOM   3120 C CG  . ARG D 1 5   ? -5.872  43.677 -10.689 1.00 59.59  ? 23  ARG D CG  1 
ATOM   3121 C CD  . ARG D 1 5   ? -6.307  42.554 -11.592 1.00 77.43  ? 23  ARG D CD  1 
ATOM   3122 N NE  . ARG D 1 5   ? -7.151  41.604 -10.891 1.00 82.18  ? 23  ARG D NE  1 
ATOM   3123 C CZ  . ARG D 1 5   ? -8.473  41.648 -10.925 1.00 69.78  ? 23  ARG D CZ  1 
ATOM   3124 N NH1 . ARG D 1 5   ? -9.073  42.594 -11.633 1.00 79.74  ? 23  ARG D NH1 1 
ATOM   3125 N NH2 . ARG D 1 5   ? -9.186  40.752 -10.261 1.00 82.18  ? 23  ARG D NH2 1 
ATOM   3126 N N   . GLU D 1 6   ? -2.642  42.758 -8.070  1.00 37.17  ? 24  GLU D N   1 
ATOM   3127 C CA  . GLU D 1 6   ? -1.371  42.199 -7.718  1.00 44.92  ? 24  GLU D CA  1 
ATOM   3128 C C   . GLU D 1 6   ? -0.924  41.337 -8.873  1.00 38.27  ? 24  GLU D C   1 
ATOM   3129 O O   . GLU D 1 6   ? -1.732  40.685 -9.522  1.00 36.39  ? 24  GLU D O   1 
ATOM   3130 C CB  . GLU D 1 6   ? -1.502  41.386 -6.436  1.00 49.81  ? 24  GLU D CB  1 
ATOM   3131 C CG  . GLU D 1 6   ? -0.415  40.376 -6.212  1.00 32.78  ? 24  GLU D CG  1 
ATOM   3132 C CD  . GLU D 1 6   ? -0.845  39.344 -5.205  1.00 49.45  ? 24  GLU D CD  1 
ATOM   3133 O OE1 . GLU D 1 6   ? -1.067  39.737 -4.037  1.00 39.71  ? 24  GLU D OE1 1 
ATOM   3134 O OE2 . GLU D 1 6   ? -0.984  38.157 -5.587  1.00 40.18  ? 24  GLU D OE2 1 
ATOM   3135 N N   . ALA D 1 7   ? 0.375   41.349 -9.126  1.00 34.03  ? 25  ALA D N   1 
ATOM   3136 C CA  . ALA D 1 7   ? 0.950   40.602 -10.219 1.00 40.48  ? 25  ALA D CA  1 
ATOM   3137 C C   . ALA D 1 7   ? 2.271   40.050 -9.741  1.00 37.75  ? 25  ALA D C   1 
ATOM   3138 O O   . ALA D 1 7   ? 2.862   40.589 -8.809  1.00 33.80  ? 25  ALA D O   1 
ATOM   3139 C CB  . ALA D 1 7   ? 1.160   41.511 -11.441 1.00 36.93  ? 25  ALA D CB  1 
ATOM   3140 N N   . SER D 1 8   ? 2.736   38.996 -10.402 1.00 25.69  ? 26  SER D N   1 
ATOM   3141 C CA  . SER D 1 8   ? 3.940   38.312 -9.998  1.00 41.41  ? 26  SER D CA  1 
ATOM   3142 C C   . SER D 1 8   ? 4.748   37.919 -11.194 1.00 44.87  ? 26  SER D C   1 
ATOM   3143 O O   . SER D 1 8   ? 4.201   37.543 -12.229 1.00 56.41  ? 26  SER D O   1 
ATOM   3144 C CB  . SER D 1 8   ? 3.596   37.059 -9.194  1.00 33.45  ? 26  SER D CB  1 
ATOM   3145 O OG  . SER D 1 8   ? 3.145   37.432 -7.906  1.00 46.59  ? 26  SER D OG  1 
ATOM   3146 N N   . ILE D 1 9   ? 6.062   37.990 -11.053 1.00 31.75  ? 27  ILE D N   1 
ATOM   3147 C CA  . ILE D 1 9   ? 6.914   37.492 -12.109 1.00 46.24  ? 27  ILE D CA  1 
ATOM   3148 C C   . ILE D 1 9   ? 8.004   36.601 -11.538 1.00 47.08  ? 27  ILE D C   1 
ATOM   3149 O O   . ILE D 1 9   ? 8.632   36.942 -10.538 1.00 46.46  ? 27  ILE D O   1 
ATOM   3150 C CB  . ILE D 1 9   ? 7.505   38.633 -12.946 1.00 40.10  ? 27  ILE D CB  1 
ATOM   3151 C CG1 . ILE D 1 9   ? 8.355   38.058 -14.078 1.00 35.71  ? 27  ILE D CG1 1 
ATOM   3152 C CG2 . ILE D 1 9   ? 8.311   39.571 -12.074 1.00 33.55  ? 27  ILE D CG2 1 
ATOM   3153 C CD1 . ILE D 1 9   ? 8.880   39.110 -14.998 1.00 35.74  ? 27  ILE D CD1 1 
ATOM   3154 N N   . SER D 1 10  ? 8.206   35.447 -12.168 1.00 37.88  ? 28  SER D N   1 
ATOM   3155 C CA  . SER D 1 10  ? 9.233   34.507 -11.736 1.00 35.08  ? 28  SER D CA  1 
ATOM   3156 C C   . SER D 1 10  ? 10.395  34.407 -12.728 1.00 38.92  ? 28  SER D C   1 
ATOM   3157 O O   . SER D 1 10  ? 10.209  34.559 -13.922 1.00 40.10  ? 28  SER D O   1 
ATOM   3158 C CB  . SER D 1 10  ? 8.627   33.123 -11.483 1.00 24.87  ? 28  SER D CB  1 
ATOM   3159 O OG  . SER D 1 10  ? 7.640   33.203 -10.468 1.00 36.66  ? 28  SER D OG  1 
ATOM   3160 N N   . GLY D 1 11  ? 11.590  34.144 -12.212 1.00 42.55  ? 29  GLY D N   1 
ATOM   3161 C CA  . GLY D 1 11  ? 12.772  33.970 -13.031 1.00 46.13  ? 29  GLY D CA  1 
ATOM   3162 C C   . GLY D 1 11  ? 13.766  33.058 -12.340 1.00 49.99  ? 29  GLY D C   1 
ATOM   3163 O O   . GLY D 1 11  ? 13.704  32.866 -11.133 1.00 44.06  ? 29  GLY D O   1 
ATOM   3164 N N   . GLU D 1 12  ? 14.684  32.488 -13.109 1.00 53.67  ? 30  GLU D N   1 
ATOM   3165 C CA  . GLU D 1 12  ? 15.614  31.505 -12.569 1.00 41.34  ? 30  GLU D CA  1 
ATOM   3166 C C   . GLU D 1 12  ? 16.997  32.092 -12.325 1.00 41.24  ? 30  GLU D C   1 
ATOM   3167 O O   . GLU D 1 12  ? 17.446  33.010 -13.014 1.00 43.05  ? 30  GLU D O   1 
ATOM   3168 C CB  . GLU D 1 12  ? 15.707  30.289 -13.495 1.00 43.18  ? 30  GLU D CB  1 
ATOM   3169 C CG  . GLU D 1 12  ? 16.536  29.138 -12.949 1.00 40.54  ? 30  GLU D CG  1 
ATOM   3170 C CD  . GLU D 1 12  ? 16.372  27.875 -13.771 1.00 49.43  ? 30  GLU D CD  1 
ATOM   3171 O OE1 . GLU D 1 12  ? 17.245  27.597 -14.615 1.00 67.96  ? 30  GLU D OE1 1 
ATOM   3172 O OE2 . GLU D 1 12  ? 15.365  27.162 -13.593 1.00 40.94  ? 30  GLU D OE2 1 
ATOM   3173 N N   . ILE D 1 13  ? 17.662  31.554 -11.316 1.00 41.18  ? 31  ILE D N   1 
ATOM   3174 C CA  . ILE D 1 13  ? 19.011  31.963 -10.976 1.00 35.42  ? 31  ILE D CA  1 
ATOM   3175 C C   . ILE D 1 13  ? 19.789  30.727 -10.589 1.00 40.09  ? 31  ILE D C   1 
ATOM   3176 O O   . ILE D 1 13  ? 19.331  29.917 -9.773  1.00 42.44  ? 31  ILE D O   1 
ATOM   3177 C CB  . ILE D 1 13  ? 19.031  32.960 -9.807  1.00 32.72  ? 31  ILE D CB  1 
ATOM   3178 C CG1 . ILE D 1 13  ? 18.502  34.323 -10.257 1.00 40.04  ? 31  ILE D CG1 1 
ATOM   3179 C CG2 . ILE D 1 13  ? 20.431  33.078 -9.248  1.00 34.26  ? 31  ILE D CG2 1 
ATOM   3180 C CD1 . ILE D 1 13  ? 18.416  35.353 -9.146  1.00 43.18  ? 31  ILE D CD1 1 
ATOM   3181 N N   . ARG D 1 14  ? 20.965  30.570 -11.182 1.00 49.16  ? 32  ARG D N   1 
ATOM   3182 C CA  . ARG D 1 14  ? 21.782  29.405 -10.895 1.00 45.80  ? 32  ARG D CA  1 
ATOM   3183 C C   . ARG D 1 14  ? 23.110  29.781 -10.254 1.00 50.65  ? 32  ARG D C   1 
ATOM   3184 O O   . ARG D 1 14  ? 23.454  30.964 -10.173 1.00 53.21  ? 32  ARG D O   1 
ATOM   3185 C CB  . ARG D 1 14  ? 21.949  28.551 -12.144 1.00 52.69  ? 32  ARG D CB  1 
ATOM   3186 C CG  . ARG D 1 14  ? 20.840  27.516 -12.276 1.00 60.38  ? 32  ARG D CG  1 
ATOM   3187 C CD  . ARG D 1 14  ? 20.138  27.602 -13.620 1.00 72.72  ? 32  ARG D CD  1 
ATOM   3188 N NE  . ARG D 1 14  ? 21.072  27.577 -14.741 1.00 79.59  ? 32  ARG D NE  1 
ATOM   3189 C CZ  . ARG D 1 14  ? 20.767  27.973 -15.972 1.00 79.40  ? 32  ARG D CZ  1 
ATOM   3190 N NH1 . ARG D 1 14  ? 19.549  28.433 -16.239 1.00 58.99  ? 32  ARG D NH1 1 
ATOM   3191 N NH2 . ARG D 1 14  ? 21.682  27.915 -16.934 1.00 75.18  ? 32  ARG D NH2 1 
ATOM   3192 N N   . TYR D 1 15  ? 23.824  28.782 -9.745  1.00 40.13  ? 33  TYR D N   1 
ATOM   3193 C CA  . TYR D 1 15  ? 25.096  29.045 -9.096  1.00 49.81  ? 33  TYR D CA  1 
ATOM   3194 C C   . TYR D 1 15  ? 26.202  28.171 -9.675  1.00 49.68  ? 33  TYR D C   1 
ATOM   3195 O O   . TYR D 1 15  ? 25.925  27.113 -10.231 1.00 52.54  ? 33  TYR D O   1 
ATOM   3196 C CB  . TYR D 1 15  ? 24.965  28.926 -7.570  1.00 30.54  ? 33  TYR D CB  1 
ATOM   3197 C CG  . TYR D 1 15  ? 24.059  30.002 -7.027  1.00 47.13  ? 33  TYR D CG  1 
ATOM   3198 C CD1 . TYR D 1 15  ? 24.574  31.194 -6.527  1.00 38.79  ? 33  TYR D CD1 1 
ATOM   3199 C CD2 . TYR D 1 15  ? 22.677  29.851 -7.062  1.00 54.79  ? 33  TYR D CD2 1 
ATOM   3200 C CE1 . TYR D 1 15  ? 23.732  32.201 -6.046  1.00 28.10  ? 33  TYR D CE1 1 
ATOM   3201 C CE2 . TYR D 1 15  ? 21.828  30.849 -6.596  1.00 31.37  ? 33  TYR D CE2 1 
ATOM   3202 C CZ  . TYR D 1 15  ? 22.355  32.022 -6.092  1.00 46.60  ? 33  TYR D CZ  1 
ATOM   3203 O OH  . TYR D 1 15  ? 21.490  33.003 -5.644  1.00 38.16  ? 33  TYR D OH  1 
ATOM   3204 N N   . PRO D 1 16  ? 27.453  28.642 -9.578  1.00 47.66  ? 34  PRO D N   1 
ATOM   3205 C CA  . PRO D 1 16  ? 28.620  27.919 -10.078 1.00 37.34  ? 34  PRO D CA  1 
ATOM   3206 C C   . PRO D 1 16  ? 28.623  26.494 -9.580  1.00 47.03  ? 34  PRO D C   1 
ATOM   3207 O O   . PRO D 1 16  ? 28.291  26.236 -8.421  1.00 46.36  ? 34  PRO D O   1 
ATOM   3208 C CB  . PRO D 1 16  ? 29.788  28.676 -9.448  1.00 55.01  ? 34  PRO D CB  1 
ATOM   3209 C CG  . PRO D 1 16  ? 29.282  30.053 -9.256  1.00 42.61  ? 34  PRO D CG  1 
ATOM   3210 C CD  . PRO D 1 16  ? 27.822  29.934 -8.967  1.00 40.48  ? 34  PRO D CD  1 
ATOM   3211 N N   . GLN D 1 17  ? 28.999  25.568 -10.446 1.00 35.51  ? 35  GLN D N   1 
ATOM   3212 C CA  . GLN D 1 17  ? 29.095  24.185 -10.029 1.00 53.08  ? 35  GLN D CA  1 
ATOM   3213 C C   . GLN D 1 17  ? 29.901  24.073 -8.725  1.00 50.04  ? 35  GLN D C   1 
ATOM   3214 O O   . GLN D 1 17  ? 30.848  24.827 -8.499  1.00 45.78  ? 35  GLN D O   1 
ATOM   3215 C CB  . GLN D 1 17  ? 29.728  23.354 -11.142 1.00 36.19  ? 35  GLN D CB  1 
ATOM   3216 C CG  . GLN D 1 17  ? 31.068  23.890 -11.607 1.00 38.01  ? 35  GLN D CG  1 
ATOM   3217 C CD  . GLN D 1 17  ? 31.419  23.471 -13.030 1.00 63.07  ? 35  GLN D CD  1 
ATOM   3218 O OE1 . GLN D 1 17  ? 32.329  22.671 -13.242 1.00 42.45  ? 35  GLN D OE1 1 
ATOM   3219 N NE2 . GLN D 1 17  ? 30.697  24.016 -14.011 1.00 49.97  ? 35  GLN D NE2 1 
ATOM   3220 N N   . GLY D 1 18  ? 29.507  23.142 -7.864  1.00 45.71  ? 36  GLY D N   1 
ATOM   3221 C CA  . GLY D 1 18  ? 30.249  22.859 -6.642  1.00 50.58  ? 36  GLY D CA  1 
ATOM   3222 C C   . GLY D 1 18  ? 29.923  23.787 -5.485  1.00 52.36  ? 36  GLY D C   1 
ATOM   3223 O O   . GLY D 1 18  ? 30.177  23.464 -4.321  1.00 59.92  ? 36  GLY D O   1 
ATOM   3224 N N   . THR D 1 19  ? 29.356  24.943 -5.815  1.00 35.50  ? 37  THR D N   1 
ATOM   3225 C CA  . THR D 1 19  ? 28.999  25.940 -4.827  1.00 38.93  ? 37  THR D CA  1 
ATOM   3226 C C   . THR D 1 19  ? 27.624  25.659 -4.251  1.00 50.46  ? 37  THR D C   1 
ATOM   3227 O O   . THR D 1 19  ? 26.836  24.922 -4.840  1.00 46.04  ? 37  THR D O   1 
ATOM   3228 C CB  . THR D 1 19  ? 29.017  27.364 -5.413  1.00 39.78  ? 37  THR D CB  1 
ATOM   3229 O OG1 . THR D 1 19  ? 27.936  27.519 -6.338  1.00 56.08  ? 37  THR D OG1 1 
ATOM   3230 C CG2 . THR D 1 19  ? 30.350  27.636 -6.113  1.00 58.12  ? 37  THR D CG2 1 
ATOM   3231 N N   . CYS D 1 20  ? 27.359  26.246 -3.088  1.00 54.31  ? 38  CYS D N   1 
ATOM   3232 C CA  . CYS D 1 20  ? 26.085  26.102 -2.402  1.00 43.62  ? 38  CYS D CA  1 
ATOM   3233 C C   . CYS D 1 20  ? 25.765  27.385 -1.650  1.00 39.02  ? 38  CYS D C   1 
ATOM   3234 O O   . CYS D 1 20  ? 26.365  27.665 -0.616  1.00 57.05  ? 38  CYS D O   1 
ATOM   3235 C CB  . CYS D 1 20  ? 26.137  24.926 -1.429  1.00 31.75  ? 38  CYS D CB  1 
ATOM   3236 S SG  . CYS D 1 20  ? 24.676  24.770 -0.365  1.00 49.83  ? 38  CYS D SG  1 
ATOM   3237 N N   . PRO D 1 21  ? 24.805  28.159 -2.160  1.00 34.84  ? 39  PRO D N   1 
ATOM   3238 C CA  . PRO D 1 21  ? 24.455  29.438 -1.553  1.00 40.48  ? 39  PRO D CA  1 
ATOM   3239 C C   . PRO D 1 21  ? 23.646  29.151 -0.306  1.00 46.03  ? 39  PRO D C   1 
ATOM   3240 O O   . PRO D 1 21  ? 23.037  28.080 -0.233  1.00 34.58  ? 39  PRO D O   1 
ATOM   3241 C CB  . PRO D 1 21  ? 23.519  30.069 -2.585  1.00 31.16  ? 39  PRO D CB  1 
ATOM   3242 C CG  . PRO D 1 21  ? 23.081  28.947 -3.478  1.00 35.13  ? 39  PRO D CG  1 
ATOM   3243 C CD  . PRO D 1 21  ? 23.730  27.675 -3.030  1.00 37.09  ? 39  PRO D CD  1 
ATOM   3244 N N   . THR D 1 22  ? 23.627  30.068 0.654   1.00 35.55  ? 40  THR D N   1 
ATOM   3245 C CA  . THR D 1 22  ? 22.692  29.924 1.767   1.00 43.87  ? 40  THR D CA  1 
ATOM   3246 C C   . THR D 1 22  ? 21.343  30.449 1.290   1.00 38.32  ? 40  THR D C   1 
ATOM   3247 O O   . THR D 1 22  ? 21.268  31.179 0.291   1.00 29.80  ? 40  THR D O   1 
ATOM   3248 C CB  . THR D 1 22  ? 23.128  30.724 3.007   1.00 38.20  ? 40  THR D CB  1 
ATOM   3249 O OG1 . THR D 1 22  ? 23.210  32.112 2.661   1.00 32.79  ? 40  THR D OG1 1 
ATOM   3250 C CG2 . THR D 1 22  ? 24.501  30.221 3.567   1.00 21.34  ? 40  THR D CG2 1 
ATOM   3251 N N   . LYS D 1 23  ? 20.278  30.093 1.994   1.00 27.88  ? 41  LYS D N   1 
ATOM   3252 C CA  . LYS D 1 23  ? 18.974  30.631 1.646   1.00 30.27  ? 41  LYS D CA  1 
ATOM   3253 C C   . LYS D 1 23  ? 19.043  32.145 1.634   1.00 37.69  ? 41  LYS D C   1 
ATOM   3254 O O   . LYS D 1 23  ? 18.403  32.806 0.812   1.00 44.03  ? 41  LYS D O   1 
ATOM   3255 C CB  . LYS D 1 23  ? 17.913  30.150 2.630   1.00 25.31  ? 41  LYS D CB  1 
ATOM   3256 C CG  . LYS D 1 23  ? 17.863  28.639 2.757   1.00 27.85  ? 41  LYS D CG  1 
ATOM   3257 C CD  . LYS D 1 23  ? 17.549  27.987 1.427   1.00 41.16  ? 41  LYS D CD  1 
ATOM   3258 C CE  . LYS D 1 23  ? 17.723  26.475 1.493   1.00 34.57  ? 41  LYS D CE  1 
ATOM   3259 N NZ  . LYS D 1 23  ? 17.313  25.820 0.217   1.00 37.36  ? 41  LYS D NZ  1 
ATOM   3260 N N   . THR D 1 24  ? 19.852  32.689 2.537   1.00 28.53  ? 42  THR D N   1 
ATOM   3261 C CA  . THR D 1 24  ? 19.942  34.130 2.726   1.00 29.38  ? 42  THR D CA  1 
ATOM   3262 C C   . THR D 1 24  ? 20.591  34.817 1.539   1.00 20.32  ? 42  THR D C   1 
ATOM   3263 O O   . THR D 1 24  ? 20.101  35.827 1.056   1.00 34.73  ? 42  THR D O   1 
ATOM   3264 C CB  . THR D 1 24  ? 20.724  34.475 4.011   1.00 39.04  ? 42  THR D CB  1 
ATOM   3265 O OG1 . THR D 1 24  ? 19.977  34.037 5.141   1.00 39.44  ? 42  THR D OG1 1 
ATOM   3266 C CG2 . THR D 1 24  ? 20.969  35.963 4.135   1.00 24.36  ? 42  THR D CG2 1 
ATOM   3267 N N   . GLU D 1 25  ? 21.696  34.279 1.059   1.00 29.97  ? 43  GLU D N   1 
ATOM   3268 C CA  . GLU D 1 25  ? 22.313  34.901 -0.099  1.00 45.07  ? 43  GLU D CA  1 
ATOM   3269 C C   . GLU D 1 25  ? 21.464  34.679 -1.367  1.00 44.38  ? 43  GLU D C   1 
ATOM   3270 O O   . GLU D 1 25  ? 21.470  35.508 -2.281  1.00 31.84  ? 43  GLU D O   1 
ATOM   3271 C CB  . GLU D 1 25  ? 23.765  34.449 -0.268  1.00 33.04  ? 43  GLU D CB  1 
ATOM   3272 C CG  . GLU D 1 25  ? 24.005  33.000 0.075   1.00 57.95  ? 43  GLU D CG  1 
ATOM   3273 C CD  . GLU D 1 25  ? 25.272  32.469 -0.555  1.00 68.56  ? 43  GLU D CD  1 
ATOM   3274 O OE1 . GLU D 1 25  ? 26.081  31.848 0.169   1.00 59.20  ? 43  GLU D OE1 1 
ATOM   3275 O OE2 . GLU D 1 25  ? 25.457  32.682 -1.778  1.00 57.79  ? 43  GLU D OE2 1 
ATOM   3276 N N   . ALA D 1 26  ? 20.706  33.585 -1.407  1.00 28.96  ? 44  ALA D N   1 
ATOM   3277 C CA  . ALA D 1 26  ? 19.815  33.376 -2.546  1.00 30.81  ? 44  ALA D CA  1 
ATOM   3278 C C   . ALA D 1 26  ? 18.701  34.413 -2.535  1.00 37.54  ? 44  ALA D C   1 
ATOM   3279 O O   . ALA D 1 26  ? 18.371  34.991 -3.570  1.00 31.43  ? 44  ALA D O   1 
ATOM   3280 C CB  . ALA D 1 26  ? 19.253  31.952 -2.580  1.00 25.78  ? 44  ALA D CB  1 
ATOM   3281 N N   . LEU D 1 27  ? 18.138  34.679 -1.360  1.00 37.84  ? 45  LEU D N   1 
ATOM   3282 C CA  . LEU D 1 27  ? 17.092  35.686 -1.280  1.00 34.86  ? 45  LEU D CA  1 
ATOM   3283 C C   . LEU D 1 27  ? 17.658  37.078 -1.547  1.00 41.54  ? 45  LEU D C   1 
ATOM   3284 O O   . LEU D 1 27  ? 17.029  37.918 -2.187  1.00 40.28  ? 45  LEU D O   1 
ATOM   3285 C CB  . LEU D 1 27  ? 16.410  35.648 0.073   1.00 37.95  ? 45  LEU D CB  1 
ATOM   3286 C CG  . LEU D 1 27  ? 15.164  36.515 0.204   1.00 40.12  ? 45  LEU D CG  1 
ATOM   3287 C CD1 . LEU D 1 27  ? 14.082  35.975 -0.712  1.00 32.85  ? 45  LEU D CD1 1 
ATOM   3288 C CD2 . LEU D 1 27  ? 14.679  36.550 1.650   1.00 29.78  ? 45  LEU D CD2 1 
ATOM   3289 N N   . ASN D 1 28  ? 18.859  37.321 -1.061  1.00 31.43  ? 46  ASN D N   1 
ATOM   3290 C CA  . ASN D 1 28  ? 19.484  38.595 -1.305  1.00 34.60  ? 46  ASN D CA  1 
ATOM   3291 C C   . ASN D 1 28  ? 19.662  38.853 -2.815  1.00 39.93  ? 46  ASN D C   1 
ATOM   3292 O O   . ASN D 1 28  ? 19.471  39.970 -3.306  1.00 33.14  ? 46  ASN D O   1 
ATOM   3293 C CB  . ASN D 1 28  ? 20.823  38.651 -0.579  1.00 35.02  ? 46  ASN D CB  1 
ATOM   3294 C CG  . ASN D 1 28  ? 21.468  39.998 -0.687  1.00 49.06  ? 46  ASN D CG  1 
ATOM   3295 O OD1 . ASN D 1 28  ? 20.943  40.990 -0.174  1.00 49.30  ? 46  ASN D OD1 1 
ATOM   3296 N ND2 . ASN D 1 28  ? 22.600  40.056 -1.377  1.00 49.47  ? 46  ASN D ND2 1 
ATOM   3297 N N   . ASP D 1 29  ? 20.038  37.810 -3.546  1.00 36.14  ? 47  ASP D N   1 
ATOM   3298 C CA  . ASP D 1 29  ? 20.184  37.912 -4.992  1.00 42.29  ? 47  ASP D CA  1 
ATOM   3299 C C   . ASP D 1 29  ? 18.836  38.156 -5.648  1.00 50.27  ? 47  ASP D C   1 
ATOM   3300 O O   . ASP D 1 29  ? 18.692  39.011 -6.528  1.00 38.83  ? 47  ASP D O   1 
ATOM   3301 C CB  . ASP D 1 29  ? 20.785  36.631 -5.542  1.00 44.81  ? 47  ASP D CB  1 
ATOM   3302 C CG  . ASP D 1 29  ? 22.232  36.496 -5.205  1.00 47.65  ? 47  ASP D CG  1 
ATOM   3303 O OD1 . ASP D 1 29  ? 22.884  37.543 -5.022  1.00 50.76  ? 47  ASP D OD1 1 
ATOM   3304 O OD2 . ASP D 1 29  ? 22.712  35.350 -5.119  1.00 46.63  ? 47  ASP D OD2 1 
ATOM   3305 N N   . CYS D 1 30  ? 17.847  37.384 -5.219  1.00 37.75  ? 48  CYS D N   1 
ATOM   3306 C CA  . CYS D 1 30  ? 16.508  37.564 -5.723  1.00 27.53  ? 48  CYS D CA  1 
ATOM   3307 C C   . CYS D 1 30  ? 16.039  38.993 -5.475  1.00 33.12  ? 48  CYS D C   1 
ATOM   3308 O O   . CYS D 1 30  ? 15.320  39.570 -6.295  1.00 36.65  ? 48  CYS D O   1 
ATOM   3309 C CB  . CYS D 1 30  ? 15.560  36.530 -5.112  1.00 24.45  ? 48  CYS D CB  1 
ATOM   3310 S SG  . CYS D 1 30  ? 13.861  36.732 -5.668  1.00 58.36  ? 48  CYS D SG  1 
ATOM   3311 N N   . ASN D 1 31  ? 16.475  39.584 -4.364  1.00 33.94  ? 49  ASN D N   1 
ATOM   3312 C CA  . ASN D 1 31  ? 16.123  40.975 -4.069  1.00 36.13  ? 49  ASN D CA  1 
ATOM   3313 C C   . ASN D 1 31  ? 16.925  41.970 -4.907  1.00 42.94  ? 49  ASN D C   1 
ATOM   3314 O O   . ASN D 1 31  ? 16.543  43.126 -5.037  1.00 36.08  ? 49  ASN D O   1 
ATOM   3315 C CB  . ASN D 1 31  ? 16.248  41.291 -2.574  1.00 28.22  ? 49  ASN D CB  1 
ATOM   3316 C CG  . ASN D 1 31  ? 15.056  40.789 -1.767  1.00 40.38  ? 49  ASN D CG  1 
ATOM   3317 O OD1 . ASN D 1 31  ? 13.961  41.330 -1.866  1.00 50.86  ? 49  ASN D OD1 1 
ATOM   3318 N ND2 . ASN D 1 31  ? 15.269  39.757 -0.961  1.00 36.03  ? 49  ASN D ND2 1 
ATOM   3319 N N   . LYS D 1 32  ? 18.042  41.517 -5.469  1.00 32.07  ? 50  LYS D N   1 
ATOM   3320 C CA  . LYS D 1 32  ? 18.748  42.308 -6.467  1.00 36.69  ? 50  LYS D CA  1 
ATOM   3321 C C   . LYS D 1 32  ? 17.851  42.578 -7.692  1.00 53.27  ? 50  LYS D C   1 
ATOM   3322 O O   . LYS D 1 32  ? 17.857  43.689 -8.246  1.00 39.73  ? 50  LYS D O   1 
ATOM   3323 C CB  . LYS D 1 32  ? 20.037  41.613 -6.900  1.00 47.33  ? 50  LYS D CB  1 
ATOM   3324 C CG  . LYS D 1 32  ? 21.187  41.754 -5.914  1.00 59.63  ? 50  LYS D CG  1 
ATOM   3325 C CD  . LYS D 1 32  ? 22.364  40.879 -6.321  1.00 50.31  ? 50  LYS D CD  1 
ATOM   3326 C CE  . LYS D 1 32  ? 23.557  41.131 -5.427  1.00 61.58  ? 50  LYS D CE  1 
ATOM   3327 N NZ  . LYS D 1 32  ? 24.600  40.097 -5.634  1.00 90.10  ? 50  LYS D NZ  1 
ATOM   3328 N N   . VAL D 1 33  ? 17.078  41.575 -8.114  1.00 33.17  ? 51  VAL D N   1 
ATOM   3329 C CA  . VAL D 1 33  ? 16.133  41.796 -9.207  1.00 50.91  ? 51  VAL D CA  1 
ATOM   3330 C C   . VAL D 1 33  ? 14.908  42.595 -8.746  1.00 38.12  ? 51  VAL D C   1 
ATOM   3331 O O   . VAL D 1 33  ? 14.350  43.367 -9.520  1.00 46.72  ? 51  VAL D O   1 
ATOM   3332 C CB  . VAL D 1 33  ? 15.705  40.489 -9.959  1.00 54.83  ? 51  VAL D CB  1 
ATOM   3333 C CG1 . VAL D 1 33  ? 16.655  39.339 -9.667  1.00 21.52  ? 51  VAL D CG1 1 
ATOM   3334 C CG2 . VAL D 1 33  ? 14.275  40.113 -9.637  1.00 41.11  ? 51  VAL D CG2 1 
ATOM   3335 N N   . THR D 1 34  ? 14.511  42.431 -7.484  1.00 50.47  ? 52  THR D N   1 
ATOM   3336 C CA  . THR D 1 34  ? 13.466  43.280 -6.899  1.00 42.87  ? 52  THR D CA  1 
ATOM   3337 C C   . THR D 1 34  ? 13.759  44.764 -7.147  1.00 51.56  ? 52  THR D C   1 
ATOM   3338 O O   . THR D 1 34  ? 12.904  45.518 -7.630  1.00 40.42  ? 52  THR D O   1 
ATOM   3339 C CB  . THR D 1 34  ? 13.295  43.029 -5.376  1.00 37.60  ? 52  THR D CB  1 
ATOM   3340 O OG1 . THR D 1 34  ? 12.911  41.667 -5.160  1.00 48.72  ? 52  THR D OG1 1 
ATOM   3341 C CG2 . THR D 1 34  ? 12.224  43.940 -4.774  1.00 29.61  ? 52  THR D CG2 1 
ATOM   3342 N N   . LYS D 1 35  ? 14.975  45.179 -6.813  1.00 44.76  ? 53  LYS D N   1 
ATOM   3343 C CA  . LYS D 1 35  ? 15.363  46.562 -7.005  1.00 51.68  ? 53  LYS D CA  1 
ATOM   3344 C C   . LYS D 1 35  ? 15.261  46.972 -8.482  1.00 53.88  ? 53  LYS D C   1 
ATOM   3345 O O   . LYS D 1 35  ? 14.681  48.007 -8.816  1.00 50.57  ? 53  LYS D O   1 
ATOM   3346 C CB  . LYS D 1 35  ? 16.771  46.791 -6.461  1.00 52.89  ? 53  LYS D CB  1 
ATOM   3347 C CG  . LYS D 1 35  ? 17.338  48.129 -6.863  1.00 69.08  ? 53  LYS D CG  1 
ATOM   3348 C CD  . LYS D 1 35  ? 18.292  48.677 -5.828  1.00 72.96  ? 53  LYS D CD  1 
ATOM   3349 C CE  . LYS D 1 35  ? 18.535  50.147 -6.105  1.00 87.00  ? 53  LYS D CE  1 
ATOM   3350 N NZ  . LYS D 1 35  ? 17.251  50.823 -6.469  1.00 48.70  ? 53  LYS D NZ  1 
ATOM   3351 N N   . GLY D 1 36  ? 15.821  46.148 -9.361  1.00 45.34  ? 54  GLY D N   1 
ATOM   3352 C CA  . GLY D 1 36  ? 15.749  46.382 -10.793 1.00 52.31  ? 54  GLY D CA  1 
ATOM   3353 C C   . GLY D 1 36  ? 14.344  46.618 -11.327 1.00 51.11  ? 54  GLY D C   1 
ATOM   3354 O O   . GLY D 1 36  ? 14.082  47.626 -11.983 1.00 61.06  ? 54  GLY D O   1 
ATOM   3355 N N   . LEU D 1 37  ? 13.438  45.689 -11.047 1.00 43.08  ? 55  LEU D N   1 
ATOM   3356 C CA  . LEU D 1 37  ? 12.061  45.819 -11.498 1.00 39.87  ? 55  LEU D CA  1 
ATOM   3357 C C   . LEU D 1 37  ? 11.439  47.133 -11.051 1.00 38.96  ? 55  LEU D C   1 
ATOM   3358 O O   . LEU D 1 37  ? 10.671  47.744 -11.789 1.00 53.78  ? 55  LEU D O   1 
ATOM   3359 C CB  . LEU D 1 37  ? 11.226  44.623 -11.037 1.00 27.19  ? 55  LEU D CB  1 
ATOM   3360 C CG  . LEU D 1 37  ? 11.705  43.323 -11.691 1.00 44.84  ? 55  LEU D CG  1 
ATOM   3361 C CD1 . LEU D 1 37  ? 10.846  42.145 -11.289 1.00 27.52  ? 55  LEU D CD1 1 
ATOM   3362 C CD2 . LEU D 1 37  ? 11.746  43.455 -13.222 1.00 42.07  ? 55  LEU D CD2 1 
ATOM   3363 N N   . ILE D 1 38  ? 11.778  47.574 -9.848  1.00 44.64  ? 56  ILE D N   1 
ATOM   3364 C CA  . ILE D 1 38  ? 11.233  48.819 -9.321  1.00 44.15  ? 56  ILE D CA  1 
ATOM   3365 C C   . ILE D 1 38  ? 11.825  50.028 -10.029 1.00 54.28  ? 56  ILE D C   1 
ATOM   3366 O O   . ILE D 1 38  ? 11.118  50.986 -10.336 1.00 53.07  ? 56  ILE D O   1 
ATOM   3367 C CB  . ILE D 1 38  ? 11.538  48.972 -7.842  1.00 57.12  ? 56  ILE D CB  1 
ATOM   3368 C CG1 . ILE D 1 38  ? 10.603  48.097 -7.010  1.00 51.96  ? 56  ILE D CG1 1 
ATOM   3369 C CG2 . ILE D 1 38  ? 11.435  50.435 -7.438  1.00 29.31  ? 56  ILE D CG2 1 
ATOM   3370 C CD1 . ILE D 1 38  ? 10.993  48.062 -5.564  1.00 36.46  ? 56  ILE D CD1 1 
ATOM   3371 N N   . ASP D 1 39  ? 13.131  49.989 -10.268 1.00 43.10  ? 57  ASP D N   1 
ATOM   3372 C CA  . ASP D 1 39  ? 13.792  51.079 -10.962 1.00 44.29  ? 57  ASP D CA  1 
ATOM   3373 C C   . ASP D 1 39  ? 13.231  51.146 -12.369 1.00 65.25  ? 57  ASP D C   1 
ATOM   3374 O O   . ASP D 1 39  ? 12.923  52.227 -12.883 1.00 57.79  ? 57  ASP D O   1 
ATOM   3375 C CB  . ASP D 1 39  ? 15.312  50.878 -10.976 1.00 49.88  ? 57  ASP D CB  1 
ATOM   3376 C CG  . ASP D 1 39  ? 15.974  51.256 -9.632  1.00 72.79  ? 57  ASP D CG  1 
ATOM   3377 O OD1 . ASP D 1 39  ? 15.339  51.953 -8.789  1.00 41.98  ? 57  ASP D OD1 1 
ATOM   3378 O OD2 . ASP D 1 39  ? 17.142  50.861 -9.425  1.00 44.62  ? 57  ASP D OD2 1 
ATOM   3379 N N   . PHE D 1 40  ? 13.068  49.976 -12.977 1.00 55.88  ? 58  PHE D N   1 
ATOM   3380 C CA  . PHE D 1 40  ? 12.489  49.886 -14.306 1.00 48.90  ? 58  PHE D CA  1 
ATOM   3381 C C   . PHE D 1 40  ? 11.029  50.330 -14.328 1.00 56.11  ? 58  PHE D C   1 
ATOM   3382 O O   . PHE D 1 40  ? 10.621  51.069 -15.217 1.00 55.34  ? 58  PHE D O   1 
ATOM   3383 C CB  . PHE D 1 40  ? 12.613  48.472 -14.852 1.00 55.81  ? 58  PHE D CB  1 
ATOM   3384 C CG  . PHE D 1 40  ? 12.207  48.352 -16.287 1.00 57.95  ? 58  PHE D CG  1 
ATOM   3385 C CD1 . PHE D 1 40  ? 13.148  48.428 -17.292 1.00 51.57  ? 58  PHE D CD1 1 
ATOM   3386 C CD2 . PHE D 1 40  ? 10.880  48.178 -16.632 1.00 56.19  ? 58  PHE D CD2 1 
ATOM   3387 C CE1 . PHE D 1 40  ? 12.771  48.320 -18.618 1.00 54.44  ? 58  PHE D CE1 1 
ATOM   3388 C CE2 . PHE D 1 40  ? 10.501  48.071 -17.954 1.00 56.55  ? 58  PHE D CE2 1 
ATOM   3389 C CZ  . PHE D 1 40  ? 11.449  48.142 -18.945 1.00 53.34  ? 58  PHE D CZ  1 
ATOM   3390 N N   . SER D 1 41  ? 10.240  49.875 -13.359 1.00 61.96  ? 59  SER D N   1 
ATOM   3391 C CA  . SER D 1 41  ? 8.863   50.339 -13.243 1.00 59.28  ? 59  SER D CA  1 
ATOM   3392 C C   . SER D 1 41  ? 8.884   51.839 -13.135 1.00 47.84  ? 59  SER D C   1 
ATOM   3393 O O   . SER D 1 41  ? 8.026   52.529 -13.681 1.00 54.86  ? 59  SER D O   1 
ATOM   3394 C CB  . SER D 1 41  ? 8.175   49.776 -11.998 1.00 44.09  ? 59  SER D CB  1 
ATOM   3395 O OG  . SER D 1 41  ? 6.858   50.302 -11.881 1.00 32.72  ? 59  SER D OG  1 
ATOM   3396 N N   . GLN D 1 42  ? 9.879   52.339 -12.419 1.00 41.08  ? 60  GLN D N   1 
ATOM   3397 C CA  . GLN D 1 42  ? 9.983   53.766 -12.164 1.00 69.10  ? 60  GLN D CA  1 
ATOM   3398 C C   . GLN D 1 42  ? 10.181  54.560 -13.451 1.00 64.91  ? 60  GLN D C   1 
ATOM   3399 O O   . GLN D 1 42  ? 9.575   55.615 -13.642 1.00 47.08  ? 60  GLN D O   1 
ATOM   3400 C CB  . GLN D 1 42  ? 11.136  54.052 -11.213 1.00 44.27  ? 60  GLN D CB  1 
ATOM   3401 C CG  . GLN D 1 42  ? 11.202  55.501 -10.803 1.00 54.73  ? 60  GLN D CG  1 
ATOM   3402 C CD  . GLN D 1 42  ? 9.903   55.979 -10.183 1.00 65.72  ? 60  GLN D CD  1 
ATOM   3403 O OE1 . GLN D 1 42  ? 9.389   55.377 -9.236  1.00 62.52  ? 60  GLN D OE1 1 
ATOM   3404 N NE2 . GLN D 1 42  ? 9.371   57.072 -10.708 1.00 64.70  ? 60  GLN D NE2 1 
ATOM   3405 N N   . SER D 1 43  ? 11.041  54.039 -14.321 1.00 70.13  ? 61  SER D N   1 
ATOM   3406 C CA  . SER D 1 43  ? 11.383  54.679 -15.582 1.00 50.23  ? 61  SER D CA  1 
ATOM   3407 C C   . SER D 1 43  ? 10.215  54.615 -16.536 1.00 56.85  ? 61  SER D C   1 
ATOM   3408 O O   . SER D 1 43  ? 10.167  55.342 -17.522 1.00 73.97  ? 61  SER D O   1 
ATOM   3409 C CB  . SER D 1 43  ? 12.572  53.967 -16.221 1.00 39.32  ? 61  SER D CB  1 
ATOM   3410 O OG  . SER D 1 43  ? 13.584  53.717 -15.263 1.00 84.06  ? 61  SER D OG  1 
ATOM   3411 N N   . HIS D 1 44  ? 9.271   53.734 -16.238 1.00 58.49  ? 62  HIS D N   1 
ATOM   3412 C CA  . HIS D 1 44  ? 8.190   53.457 -17.170 1.00 52.58  ? 62  HIS D CA  1 
ATOM   3413 C C   . HIS D 1 44  ? 6.828   53.731 -16.575 1.00 51.69  ? 62  HIS D C   1 
ATOM   3414 O O   . HIS D 1 44  ? 5.900   52.928 -16.721 1.00 47.69  ? 62  HIS D O   1 
ATOM   3415 C CB  . HIS D 1 44  ? 8.298   52.025 -17.687 1.00 58.64  ? 62  HIS D CB  1 
ATOM   3416 C CG  . HIS D 1 44  ? 9.567   51.765 -18.435 1.00 64.93  ? 62  HIS D CG  1 
ATOM   3417 N ND1 . HIS D 1 44  ? 10.773  51.558 -17.802 1.00 53.50  ? 62  HIS D ND1 1 
ATOM   3418 C CD2 . HIS D 1 44  ? 9.825   51.717 -19.763 1.00 63.71  ? 62  HIS D CD2 1 
ATOM   3419 C CE1 . HIS D 1 44  ? 11.716  51.371 -18.708 1.00 55.05  ? 62  HIS D CE1 1 
ATOM   3420 N NE2 . HIS D 1 44  ? 11.167  51.465 -19.905 1.00 54.18  ? 62  HIS D NE2 1 
ATOM   3421 N N   . GLN D 1 45  ? 6.729   54.880 -15.912 1.00 44.91  ? 63  GLN D N   1 
ATOM   3422 C CA  . GLN D 1 45  ? 5.473   55.372 -15.351 1.00 54.85  ? 63  GLN D CA  1 
ATOM   3423 C C   . GLN D 1 45  ? 4.858   54.437 -14.319 1.00 64.65  ? 63  GLN D C   1 
ATOM   3424 O O   . GLN D 1 45  ? 3.639   54.329 -14.228 1.00 74.95  ? 63  GLN D O   1 
ATOM   3425 C CB  . GLN D 1 45  ? 4.458   55.645 -16.463 1.00 61.40  ? 63  GLN D CB  1 
ATOM   3426 C CG  . GLN D 1 45  ? 5.017   56.439 -17.623 1.00 83.07  ? 63  GLN D CG  1 
ATOM   3427 C CD  . GLN D 1 45  ? 4.104   56.414 -18.829 1.00 102.44 ? 63  GLN D CD  1 
ATOM   3428 O OE1 . GLN D 1 45  ? 3.105   55.692 -18.849 1.00 97.80  ? 63  GLN D OE1 1 
ATOM   3429 N NE2 . GLN D 1 45  ? 4.442   57.202 -19.846 1.00 99.56  ? 63  GLN D NE2 1 
ATOM   3430 N N   . ARG D 1 46  ? 5.698   53.767 -13.538 1.00 62.45  ? 64  ARG D N   1 
ATOM   3431 C CA  . ARG D 1 46  ? 5.204   52.897 -12.480 1.00 64.94  ? 64  ARG D CA  1 
ATOM   3432 C C   . ARG D 1 46  ? 4.089   51.981 -12.996 1.00 63.22  ? 64  ARG D C   1 
ATOM   3433 O O   . ARG D 1 46  ? 3.049   51.795 -12.351 1.00 46.05  ? 64  ARG D O   1 
ATOM   3434 C CB  . ARG D 1 46  ? 4.730   53.741 -11.295 1.00 59.23  ? 64  ARG D CB  1 
ATOM   3435 C CG  . ARG D 1 46  ? 5.443   55.075 -11.214 1.00 59.32  ? 64  ARG D CG  1 
ATOM   3436 C CD  . ARG D 1 46  ? 6.011   55.364 -9.829  1.00 65.87  ? 64  ARG D CD  1 
ATOM   3437 N NE  . ARG D 1 46  ? 5.009   55.847 -8.887  1.00 66.29  ? 64  ARG D NE  1 
ATOM   3438 C CZ  . ARG D 1 46  ? 5.292   56.384 -7.701  1.00 96.05  ? 64  ARG D CZ  1 
ATOM   3439 N NH1 . ARG D 1 46  ? 6.558   56.519 -7.308  1.00 63.57  ? 64  ARG D NH1 1 
ATOM   3440 N NH2 . ARG D 1 46  ? 4.308   56.793 -6.906  1.00 77.57  ? 64  ARG D NH2 1 
ATOM   3441 N N   . ALA D 1 47  ? 4.308   51.423 -14.180 1.00 51.90  ? 65  ALA D N   1 
ATOM   3442 C CA  . ALA D 1 47  ? 3.374   50.453 -14.719 1.00 50.92  ? 65  ALA D CA  1 
ATOM   3443 C C   . ALA D 1 47  ? 3.216   49.345 -13.698 1.00 49.10  ? 65  ALA D C   1 
ATOM   3444 O O   . ALA D 1 47  ? 2.118   48.854 -13.468 1.00 47.07  ? 65  ALA D O   1 
ATOM   3445 C CB  . ALA D 1 47  ? 3.880   49.895 -16.024 1.00 53.57  ? 65  ALA D CB  1 
ATOM   3446 N N   . TRP D 1 48  ? 4.323   48.964 -13.075 1.00 46.45  ? 66  TRP D N   1 
ATOM   3447 C CA  . TRP D 1 48  ? 4.290   47.890 -12.105 1.00 44.69  ? 66  TRP D CA  1 
ATOM   3448 C C   . TRP D 1 48  ? 4.222   48.404 -10.681 1.00 46.69  ? 66  TRP D C   1 
ATOM   3449 O O   . TRP D 1 48  ? 4.410   47.644 -9.744  1.00 52.24  ? 66  TRP D O   1 
ATOM   3450 C CB  . TRP D 1 48  ? 5.535   47.031 -12.236 1.00 49.18  ? 66  TRP D CB  1 
ATOM   3451 C CG  . TRP D 1 48  ? 5.823   46.569 -13.608 1.00 51.89  ? 66  TRP D CG  1 
ATOM   3452 C CD1 . TRP D 1 48  ? 4.923   46.302 -14.603 1.00 42.02  ? 66  TRP D CD1 1 
ATOM   3453 C CD2 . TRP D 1 48  ? 7.112   46.273 -14.139 1.00 49.03  ? 66  TRP D CD2 1 
ATOM   3454 N NE1 . TRP D 1 48  ? 5.580   45.870 -15.726 1.00 48.25  ? 66  TRP D NE1 1 
ATOM   3455 C CE2 . TRP D 1 48  ? 6.927   45.843 -15.467 1.00 46.65  ? 66  TRP D CE2 1 
ATOM   3456 C CE3 . TRP D 1 48  ? 8.410   46.338 -13.622 1.00 43.00  ? 66  TRP D CE3 1 
ATOM   3457 C CZ2 . TRP D 1 48  ? 7.993   45.477 -16.284 1.00 42.07  ? 66  TRP D CZ2 1 
ATOM   3458 C CZ3 . TRP D 1 48  ? 9.466   45.974 -14.432 1.00 43.38  ? 66  TRP D CZ3 1 
ATOM   3459 C CH2 . TRP D 1 48  ? 9.251   45.548 -15.749 1.00 51.28  ? 66  TRP D CH2 1 
ATOM   3460 N N   . GLY D 1 49  ? 3.981   49.692 -10.510 1.00 36.98  ? 67  GLY D N   1 
ATOM   3461 C CA  . GLY D 1 49  ? 3.994   50.260 -9.180  1.00 36.52  ? 67  GLY D CA  1 
ATOM   3462 C C   . GLY D 1 49  ? 5.396   50.213 -8.604  1.00 52.96  ? 67  GLY D C   1 
ATOM   3463 O O   . GLY D 1 49  ? 6.366   49.997 -9.340  1.00 41.96  ? 67  GLY D O   1 
ATOM   3464 N N   . ILE D 1 50  ? 5.519   50.415 -7.292  1.00 38.53  ? 68  ILE D N   1 
ATOM   3465 C CA  . ILE D 1 50  ? 6.835   50.366 -6.662  1.00 38.90  ? 68  ILE D CA  1 
ATOM   3466 C C   . ILE D 1 50  ? 6.865   49.519 -5.405  1.00 42.65  ? 68  ILE D C   1 
ATOM   3467 O O   . ILE D 1 50  ? 7.917   49.331 -4.807  1.00 62.24  ? 68  ILE D O   1 
ATOM   3468 C CB  . ILE D 1 50  ? 7.345   51.754 -6.333  1.00 48.22  ? 68  ILE D CB  1 
ATOM   3469 C CG1 . ILE D 1 50  ? 6.213   52.563 -5.717  1.00 38.22  ? 68  ILE D CG1 1 
ATOM   3470 C CG2 . ILE D 1 50  ? 7.889   52.425 -7.594  1.00 44.59  ? 68  ILE D CG2 1 
ATOM   3471 C CD1 . ILE D 1 50  ? 6.669   53.856 -5.136  1.00 55.04  ? 68  ILE D CD1 1 
ATOM   3472 N N   . ASP D 1 51  ? 5.708   49.010 -5.008  1.00 44.79  ? 69  ASP D N   1 
ATOM   3473 C CA  . ASP D 1 51  ? 5.623   48.102 -3.875  1.00 25.21  ? 69  ASP D CA  1 
ATOM   3474 C C   . ASP D 1 51  ? 5.816   46.649 -4.340  1.00 27.19  ? 69  ASP D C   1 
ATOM   3475 O O   . ASP D 1 51  ? 4.872   45.979 -4.761  1.00 31.60  ? 69  ASP D O   1 
ATOM   3476 C CB  . ASP D 1 51  ? 4.276   48.285 -3.161  1.00 29.72  ? 69  ASP D CB  1 
ATOM   3477 C CG  . ASP D 1 51  ? 4.278   47.711 -1.752  1.00 40.78  ? 69  ASP D CG  1 
ATOM   3478 O OD1 . ASP D 1 51  ? 5.267   47.050 -1.399  1.00 48.58  ? 69  ASP D OD1 1 
ATOM   3479 O OD2 . ASP D 1 51  ? 3.301   47.912 -0.994  1.00 42.41  ? 69  ASP D OD2 1 
ATOM   3480 N N   . MET D 1 52  ? 7.047   46.164 -4.276  1.00 27.37  ? 70  MET D N   1 
ATOM   3481 C CA  . MET D 1 52  ? 7.326   44.780 -4.648  1.00 38.27  ? 70  MET D CA  1 
ATOM   3482 C C   . MET D 1 52  ? 7.973   43.963 -3.524  1.00 37.31  ? 70  MET D C   1 
ATOM   3483 O O   . MET D 1 52  ? 8.756   44.481 -2.741  1.00 33.81  ? 70  MET D O   1 
ATOM   3484 C CB  . MET D 1 52  ? 8.213   44.740 -5.891  1.00 35.42  ? 70  MET D CB  1 
ATOM   3485 C CG  . MET D 1 52  ? 7.618   45.475 -7.085  1.00 36.09  ? 70  MET D CG  1 
ATOM   3486 S SD  . MET D 1 52  ? 8.597   45.274 -8.591  1.00 45.44  ? 70  MET D SD  1 
ATOM   3487 C CE  . MET D 1 52  ? 7.944   46.646 -9.559  1.00 47.68  ? 70  MET D CE  1 
ATOM   3488 N N   . THR D 1 53  ? 7.664   42.673 -3.472  1.00 35.98  ? 71  THR D N   1 
ATOM   3489 C CA  . THR D 1 53  ? 8.237   41.793 -2.458  1.00 34.54  ? 71  THR D CA  1 
ATOM   3490 C C   . THR D 1 53  ? 8.695   40.461 -3.068  1.00 39.33  ? 71  THR D C   1 
ATOM   3491 O O   . THR D 1 53  ? 8.070   39.946 -3.998  1.00 31.74  ? 71  THR D O   1 
ATOM   3492 C CB  . THR D 1 53  ? 7.247   41.556 -1.275  1.00 33.01  ? 71  THR D CB  1 
ATOM   3493 O OG1 . THR D 1 53  ? 5.980   41.079 -1.771  1.00 37.39  ? 71  THR D OG1 1 
ATOM   3494 C CG2 . THR D 1 53  ? 7.026   42.844 -0.501  1.00 25.57  ? 71  THR D CG2 1 
ATOM   3495 N N   . ALA D 1 54  ? 9.784   39.918 -2.525  1.00 33.59  ? 72  ALA D N   1 
ATOM   3496 C CA  . ALA D 1 54  ? 10.467  38.756 -3.093  1.00 32.79  ? 72  ALA D CA  1 
ATOM   3497 C C   . ALA D 1 54  ? 10.381  37.499 -2.239  1.00 39.02  ? 72  ALA D C   1 
ATOM   3498 O O   . ALA D 1 54  ? 10.422  37.565 -1.015  1.00 31.69  ? 72  ALA D O   1 
ATOM   3499 C CB  . ALA D 1 54  ? 11.933  39.088 -3.353  1.00 28.52  ? 72  ALA D CB  1 
ATOM   3500 N N   . LYS D 1 55  ? 10.270  36.357 -2.910  1.00 34.20  ? 73  LYS D N   1 
ATOM   3501 C CA  . LYS D 1 55  ? 10.387  35.045 -2.284  1.00 39.69  ? 73  LYS D CA  1 
ATOM   3502 C C   . LYS D 1 55  ? 11.311  34.213 -3.173  1.00 33.33  ? 73  LYS D C   1 
ATOM   3503 O O   . LYS D 1 55  ? 11.436  34.471 -4.362  1.00 29.24  ? 73  LYS D O   1 
ATOM   3504 C CB  . LYS D 1 55  ? 9.015   34.375 -2.132  1.00 30.77  ? 73  LYS D CB  1 
ATOM   3505 C CG  . LYS D 1 55  ? 8.336   34.639 -0.802  1.00 55.49  ? 73  LYS D CG  1 
ATOM   3506 C CD  . LYS D 1 55  ? 6.877   35.071 -0.957  1.00 61.47  ? 73  LYS D CD  1 
ATOM   3507 C CE  . LYS D 1 55  ? 5.935   33.898 -1.207  1.00 72.27  ? 73  LYS D CE  1 
ATOM   3508 N NZ  . LYS D 1 55  ? 4.509   34.354 -1.279  1.00 58.21  ? 73  LYS D NZ  1 
ATOM   3509 N N   . VAL D 1 56  ? 11.966  33.222 -2.594  1.00 36.20  ? 74  VAL D N   1 
ATOM   3510 C CA  . VAL D 1 56  ? 12.907  32.400 -3.333  1.00 29.98  ? 74  VAL D CA  1 
ATOM   3511 C C   . VAL D 1 56  ? 12.812  30.977 -2.831  1.00 31.91  ? 74  VAL D C   1 
ATOM   3512 O O   . VAL D 1 56  ? 12.548  30.739 -1.654  1.00 33.57  ? 74  VAL D O   1 
ATOM   3513 C CB  . VAL D 1 56  ? 14.369  32.881 -3.163  1.00 40.05  ? 74  VAL D CB  1 
ATOM   3514 C CG1 . VAL D 1 56  ? 14.840  32.616 -1.763  1.00 27.85  ? 74  VAL D CG1 1 
ATOM   3515 C CG2 . VAL D 1 56  ? 15.295  32.164 -4.140  1.00 27.11  ? 74  VAL D CG2 1 
ATOM   3516 N N   . GLN D 1 57  ? 13.024  30.037 -3.740  1.00 28.53  ? 75  GLN D N   1 
ATOM   3517 C CA  . GLN D 1 57  ? 13.066  28.628 -3.403  1.00 37.33  ? 75  GLN D CA  1 
ATOM   3518 C C   . GLN D 1 57  ? 14.193  28.034 -4.203  1.00 31.72  ? 75  GLN D C   1 
ATOM   3519 O O   . GLN D 1 57  ? 14.359  28.338 -5.378  1.00 43.38  ? 75  GLN D O   1 
ATOM   3520 C CB  . GLN D 1 57  ? 11.754  27.927 -3.755  1.00 30.76  ? 75  GLN D CB  1 
ATOM   3521 C CG  . GLN D 1 57  ? 10.551  28.442 -3.010  1.00 58.15  ? 75  GLN D CG  1 
ATOM   3522 C CD  . GLN D 1 57  ? 9.304   27.622 -3.299  1.00 92.64  ? 75  GLN D CD  1 
ATOM   3523 O OE1 . GLN D 1 57  ? 8.382   27.556 -2.481  1.00 84.23  ? 75  GLN D OE1 1 
ATOM   3524 N NE2 . GLN D 1 57  ? 9.274   26.985 -4.468  1.00 82.38  ? 75  GLN D NE2 1 
ATOM   3525 N N   . CYS D 1 58  ? 14.967  27.174 -3.570  1.00 30.13  ? 76  CYS D N   1 
ATOM   3526 C CA  . CYS D 1 58  ? 16.160  26.655 -4.198  1.00 28.92  ? 76  CYS D CA  1 
ATOM   3527 C C   . CYS D 1 58  ? 16.093  25.163 -4.175  1.00 37.16  ? 76  CYS D C   1 
ATOM   3528 O O   . CYS D 1 58  ? 15.487  24.577 -3.281  1.00 32.06  ? 76  CYS D O   1 
ATOM   3529 C CB  . CYS D 1 58  ? 17.422  27.121 -3.449  1.00 22.36  ? 76  CYS D CB  1 
ATOM   3530 S SG  . CYS D 1 58  ? 17.789  28.843 -3.692  1.00 39.59  ? 76  CYS D SG  1 
ATOM   3531 N N   . ALA D 1 59  ? 16.710  24.543 -5.171  1.00 35.97  ? 77  ALA D N   1 
ATOM   3532 C CA  . ALA D 1 59  ? 16.933  23.120 -5.106  1.00 31.99  ? 77  ALA D CA  1 
ATOM   3533 C C   . ALA D 1 59  ? 17.879  22.924 -3.939  1.00 36.98  ? 77  ALA D C   1 
ATOM   3534 O O   . ALA D 1 59  ? 18.680  23.805 -3.647  1.00 38.10  ? 77  ALA D O   1 
ATOM   3535 C CB  . ALA D 1 59  ? 17.556  22.622 -6.400  1.00 28.53  ? 77  ALA D CB  1 
ATOM   3536 N N   . PRO D 1 60  ? 17.772  21.784 -3.245  1.00 43.60  ? 78  PRO D N   1 
ATOM   3537 C CA  . PRO D 1 60  ? 18.743  21.470 -2.189  1.00 33.40  ? 78  PRO D CA  1 
ATOM   3538 C C   . PRO D 1 60  ? 20.116  21.228 -2.801  1.00 47.12  ? 78  PRO D C   1 
ATOM   3539 O O   . PRO D 1 60  ? 20.209  20.792 -3.956  1.00 43.71  ? 78  PRO D O   1 
ATOM   3540 C CB  . PRO D 1 60  ? 18.205  20.165 -1.582  1.00 29.03  ? 78  PRO D CB  1 
ATOM   3541 C CG  . PRO D 1 60  ? 16.776  20.092 -2.027  1.00 60.81  ? 78  PRO D CG  1 
ATOM   3542 C CD  . PRO D 1 60  ? 16.728  20.756 -3.366  1.00 34.15  ? 78  PRO D CD  1 
ATOM   3543 N N   . CYS D 1 61  ? 21.167  21.508 -2.041  1.00 30.14  ? 79  CYS D N   1 
ATOM   3544 C CA  . CYS D 1 61  ? 22.529  21.288 -2.517  1.00 49.84  ? 79  CYS D CA  1 
ATOM   3545 C C   . CYS D 1 61  ? 22.853  19.796 -2.499  1.00 46.45  ? 79  CYS D C   1 
ATOM   3546 O O   . CYS D 1 61  ? 22.382  19.061 -1.630  1.00 35.42  ? 79  CYS D O   1 
ATOM   3547 C CB  . CYS D 1 61  ? 23.539  22.053 -1.645  1.00 37.06  ? 79  CYS D CB  1 
ATOM   3548 S SG  . CYS D 1 61  ? 23.258  23.848 -1.511  1.00 48.65  ? 79  CYS D SG  1 
ATOM   3549 N N   . LYS D 1 62  ? 23.637  19.339 -3.467  1.00 34.35  ? 80  LYS D N   1 
ATOM   3550 C CA  . LYS D 1 62  ? 24.237  18.019 -3.346  1.00 40.42  ? 80  LYS D CA  1 
ATOM   3551 C C   . LYS D 1 62  ? 25.658  18.190 -2.881  1.00 42.46  ? 80  LYS D C   1 
ATOM   3552 O O   . LYS D 1 62  ? 26.506  18.660 -3.635  1.00 54.84  ? 80  LYS D O   1 
ATOM   3553 C CB  . LYS D 1 62  ? 24.232  17.280 -4.672  1.00 58.11  ? 80  LYS D CB  1 
ATOM   3554 C CG  . LYS D 1 62  ? 22.951  16.547 -4.936  1.00 28.87  ? 80  LYS D CG  1 
ATOM   3555 C CD  . LYS D 1 62  ? 21.814  17.525 -5.112  1.00 45.45  ? 80  LYS D CD  1 
ATOM   3556 C CE  . LYS D 1 62  ? 20.674  16.883 -5.902  1.00 100.31 ? 80  LYS D CE  1 
ATOM   3557 N NZ  . LYS D 1 62  ? 21.152  16.214 -7.160  1.00 56.57  ? 80  LYS D NZ  1 
ATOM   3558 N N   . THR D 1 63  ? 25.912  17.823 -1.632  1.00 53.62  ? 81  THR D N   1 
ATOM   3559 C CA  . THR D 1 63  ? 27.233  17.979 -1.037  1.00 68.65  ? 81  THR D CA  1 
ATOM   3560 C C   . THR D 1 63  ? 28.204  16.950 -1.628  1.00 48.12  ? 81  THR D C   1 
ATOM   3561 O O   . THR D 1 63  ? 29.382  17.237 -1.841  1.00 55.55  ? 81  THR D O   1 
ATOM   3562 C CB  . THR D 1 63  ? 27.175  17.903 0.529   1.00 88.43  ? 81  THR D CB  1 
ATOM   3563 O OG1 . THR D 1 63  ? 27.022  16.546 0.971   1.00 65.21  ? 81  THR D OG1 1 
ATOM   3564 C CG2 . THR D 1 63  ? 26.011  18.732 1.064   1.00 59.88  ? 81  THR D CG2 1 
ATOM   3565 N N   . THR D 1 64  ? 27.682  15.763 -1.922  1.00 49.81  ? 82  THR D N   1 
ATOM   3566 C CA  . THR D 1 64  ? 28.468  14.685 -2.511  1.00 51.64  ? 82  THR D CA  1 
ATOM   3567 C C   . THR D 1 64  ? 28.882  14.939 -3.982  1.00 55.76  ? 82  THR D C   1 
ATOM   3568 O O   . THR D 1 64  ? 29.893  14.417 -4.441  1.00 73.35  ? 82  THR D O   1 
ATOM   3569 C CB  . THR D 1 64  ? 27.747  13.306 -2.370  1.00 62.48  ? 82  THR D CB  1 
ATOM   3570 O OG1 . THR D 1 64  ? 26.587  13.261 -3.213  1.00 50.50  ? 82  THR D OG1 1 
ATOM   3571 C CG2 . THR D 1 64  ? 27.324  13.053 -0.924  1.00 47.65  ? 82  THR D CG2 1 
ATOM   3572 N N   . ASP D 1 65  ? 28.119  15.748 -4.709  1.00 48.95  ? 83  ASP D N   1 
ATOM   3573 C CA  . ASP D 1 65  ? 28.381  15.974 -6.131  1.00 42.51  ? 83  ASP D CA  1 
ATOM   3574 C C   . ASP D 1 65  ? 29.206  17.240 -6.370  1.00 41.48  ? 83  ASP D C   1 
ATOM   3575 O O   . ASP D 1 65  ? 28.743  18.350 -6.164  1.00 42.61  ? 83  ASP D O   1 
ATOM   3576 C CB  . ASP D 1 65  ? 27.056  15.996 -6.909  1.00 38.73  ? 83  ASP D CB  1 
ATOM   3577 C CG  . ASP D 1 65  ? 27.228  16.253 -8.421  1.00 51.72  ? 83  ASP D CG  1 
ATOM   3578 O OD1 . ASP D 1 65  ? 28.339  16.600 -8.897  1.00 33.21  ? 83  ASP D OD1 1 
ATOM   3579 O OD2 . ASP D 1 65  ? 26.206  16.113 -9.137  1.00 51.44  ? 83  ASP D OD2 1 
ATOM   3580 N N   . PRO D 1 66  ? 30.449  17.067 -6.815  1.00 38.48  ? 84  PRO D N   1 
ATOM   3581 C CA  . PRO D 1 66  ? 31.347  18.210 -7.026  1.00 35.90  ? 84  PRO D CA  1 
ATOM   3582 C C   . PRO D 1 66  ? 30.966  19.097 -8.200  1.00 47.62  ? 84  PRO D C   1 
ATOM   3583 O O   . PRO D 1 66  ? 31.558  20.164 -8.343  1.00 51.73  ? 84  PRO D O   1 
ATOM   3584 C CB  . PRO D 1 66  ? 32.706  17.553 -7.289  1.00 38.24  ? 84  PRO D CB  1 
ATOM   3585 C CG  . PRO D 1 66  ? 32.578  16.158 -6.703  1.00 51.06  ? 84  PRO D CG  1 
ATOM   3586 C CD  . PRO D 1 66  ? 31.142  15.774 -6.906  1.00 40.92  ? 84  PRO D CD  1 
ATOM   3587 N N   . TRP D 1 67  ? 30.017  18.677 -9.032  1.00 51.25  ? 85  TRP D N   1 
ATOM   3588 C CA  . TRP D 1 67  ? 29.621  19.508 -10.174 1.00 58.45  ? 85  TRP D CA  1 
ATOM   3589 C C   . TRP D 1 67  ? 28.213  20.033 -10.028 1.00 42.96  ? 85  TRP D C   1 
ATOM   3590 O O   . TRP D 1 67  ? 27.721  20.731 -10.908 1.00 42.43  ? 85  TRP D O   1 
ATOM   3591 C CB  . TRP D 1 67  ? 29.742  18.761 -11.508 1.00 47.33  ? 85  TRP D CB  1 
ATOM   3592 C CG  . TRP D 1 67  ? 31.137  18.377 -11.860 1.00 50.12  ? 85  TRP D CG  1 
ATOM   3593 C CD1 . TRP D 1 67  ? 32.008  19.063 -12.669 1.00 36.06  ? 85  TRP D CD1 1 
ATOM   3594 C CD2 . TRP D 1 67  ? 31.834  17.207 -11.416 1.00 39.56  ? 85  TRP D CD2 1 
ATOM   3595 N NE1 . TRP D 1 67  ? 33.199  18.385 -12.751 1.00 35.99  ? 85  TRP D NE1 1 
ATOM   3596 C CE2 . TRP D 1 67  ? 33.119  17.243 -11.994 1.00 48.14  ? 85  TRP D CE2 1 
ATOM   3597 C CE3 . TRP D 1 67  ? 31.495  16.132 -10.587 1.00 30.77  ? 85  TRP D CE3 1 
ATOM   3598 C CZ2 . TRP D 1 67  ? 34.067  16.245 -11.765 1.00 39.79  ? 85  TRP D CZ2 1 
ATOM   3599 C CZ3 . TRP D 1 67  ? 32.432  15.147 -10.358 1.00 46.69  ? 85  TRP D CZ3 1 
ATOM   3600 C CH2 . TRP D 1 67  ? 33.706  15.209 -10.945 1.00 42.15  ? 85  TRP D CH2 1 
ATOM   3601 N N   . ASP D 1 68  ? 27.567  19.690 -8.920  1.00 41.31  ? 86  ASP D N   1 
ATOM   3602 C CA  . ASP D 1 68  ? 26.230  20.190 -8.647  1.00 41.65  ? 86  ASP D CA  1 
ATOM   3603 C C   . ASP D 1 68  ? 26.074  21.691 -8.941  1.00 42.83  ? 86  ASP D C   1 
ATOM   3604 O O   . ASP D 1 68  ? 26.894  22.519 -8.529  1.00 38.45  ? 86  ASP D O   1 
ATOM   3605 C CB  . ASP D 1 68  ? 25.840  19.898 -7.202  1.00 63.71  ? 86  ASP D CB  1 
ATOM   3606 C CG  . ASP D 1 68  ? 24.407  20.290 -6.894  1.00 58.89  ? 86  ASP D CG  1 
ATOM   3607 O OD1 . ASP D 1 68  ? 23.501  19.899 -7.664  1.00 52.15  ? 86  ASP D OD1 1 
ATOM   3608 O OD2 . ASP D 1 68  ? 24.190  20.985 -5.880  1.00 46.52  ? 86  ASP D OD2 1 
ATOM   3609 N N   . VAL D 1 69  ? 25.015  22.028 -9.670  1.00 37.72  ? 87  VAL D N   1 
ATOM   3610 C CA  . VAL D 1 69  ? 24.650  23.413 -9.915  1.00 42.53  ? 87  VAL D CA  1 
ATOM   3611 C C   . VAL D 1 69  ? 23.279  23.644 -9.298  1.00 39.92  ? 87  VAL D C   1 
ATOM   3612 O O   . VAL D 1 69  ? 22.339  22.916 -9.582  1.00 38.93  ? 87  VAL D O   1 
ATOM   3613 C CB  . VAL D 1 69  ? 24.625  23.756 -11.422 1.00 45.83  ? 87  VAL D CB  1 
ATOM   3614 C CG1 . VAL D 1 69  ? 23.725  24.960 -11.699 1.00 47.35  ? 87  VAL D CG1 1 
ATOM   3615 C CG2 . VAL D 1 69  ? 26.034  24.025 -11.929 1.00 53.97  ? 87  VAL D CG2 1 
ATOM   3616 N N   . VAL D 1 70  ? 23.179  24.653 -8.440  1.00 49.61  ? 88  VAL D N   1 
ATOM   3617 C CA  . VAL D 1 70  ? 21.941  24.929 -7.731  1.00 38.83  ? 88  VAL D CA  1 
ATOM   3618 C C   . VAL D 1 70  ? 21.053  25.880 -8.521  1.00 40.67  ? 88  VAL D C   1 
ATOM   3619 O O   . VAL D 1 70  ? 21.518  26.918 -8.994  1.00 35.30  ? 88  VAL D O   1 
ATOM   3620 C CB  . VAL D 1 70  ? 22.225  25.516 -6.341  1.00 41.10  ? 88  VAL D CB  1 
ATOM   3621 C CG1 . VAL D 1 70  ? 20.926  25.993 -5.678  1.00 41.57  ? 88  VAL D CG1 1 
ATOM   3622 C CG2 . VAL D 1 70  ? 22.930  24.478 -5.482  1.00 30.87  ? 88  VAL D CG2 1 
ATOM   3623 N N   . LEU D 1 71  ? 19.782  25.497 -8.665  1.00 32.12  ? 89  LEU D N   1 
ATOM   3624 C CA  . LEU D 1 71  ? 18.774  26.308 -9.336  1.00 38.97  ? 89  LEU D CA  1 
ATOM   3625 C C   . LEU D 1 71  ? 17.867  26.953 -8.313  1.00 30.54  ? 89  LEU D C   1 
ATOM   3626 O O   . LEU D 1 71  ? 17.324  26.278 -7.443  1.00 29.58  ? 89  LEU D O   1 
ATOM   3627 C CB  . LEU D 1 71  ? 17.897  25.440 -10.235 1.00 48.83  ? 89  LEU D CB  1 
ATOM   3628 C CG  . LEU D 1 71  ? 18.383  25.048 -11.623 1.00 65.61  ? 89  LEU D CG  1 
ATOM   3629 C CD1 . LEU D 1 71  ? 19.739  24.367 -11.546 1.00 53.98  ? 89  LEU D CD1 1 
ATOM   3630 C CD2 . LEU D 1 71  ? 17.352  24.142 -12.280 1.00 54.81  ? 89  LEU D CD2 1 
ATOM   3631 N N   . CYS D 1 72  ? 17.672  28.254 -8.437  1.00 33.29  ? 90  CYS D N   1 
ATOM   3632 C CA  . CYS D 1 72  ? 16.739  28.946 -7.562  1.00 32.79  ? 90  CYS D CA  1 
ATOM   3633 C C   . CYS D 1 72  ? 15.691  29.695 -8.358  1.00 46.45  ? 90  CYS D C   1 
ATOM   3634 O O   . CYS D 1 72  ? 16.001  30.376 -9.346  1.00 39.98  ? 90  CYS D O   1 
ATOM   3635 C CB  . CYS D 1 72  ? 17.480  29.914 -6.639  1.00 37.47  ? 90  CYS D CB  1 
ATOM   3636 S SG  . CYS D 1 72  ? 18.631  29.081 -5.532  1.00 38.44  ? 90  CYS D SG  1 
ATOM   3637 N N   . THR D 1 73  ? 14.443  29.556 -7.936  1.00 35.26  ? 91  THR D N   1 
ATOM   3638 C CA  . THR D 1 73  ? 13.389  30.382 -8.494  1.00 24.96  ? 91  THR D CA  1 
ATOM   3639 C C   . THR D 1 73  ? 13.168  31.648 -7.662  1.00 35.23  ? 91  THR D C   1 
ATOM   3640 O O   . THR D 1 73  ? 12.868  31.596 -6.464  1.00 36.58  ? 91  THR D O   1 
ATOM   3641 C CB  . THR D 1 73  ? 12.077  29.636 -8.617  1.00 34.61  ? 91  THR D CB  1 
ATOM   3642 O OG1 . THR D 1 73  ? 12.303  28.362 -9.230  1.00 29.72  ? 91  THR D OG1 1 
ATOM   3643 C CG2 . THR D 1 73  ? 11.097  30.462 -9.440  1.00 27.99  ? 91  THR D CG2 1 
ATOM   3644 N N   . CYS D 1 74  ? 13.320  32.781 -8.328  1.00 29.48  ? 92  CYS D N   1 
ATOM   3645 C CA  . CYS D 1 74  ? 13.092  34.082 -7.753  1.00 27.36  ? 92  CYS D CA  1 
ATOM   3646 C C   . CYS D 1 74  ? 11.691  34.596 -8.153  1.00 35.97  ? 92  CYS D C   1 
ATOM   3647 O O   . CYS D 1 74  ? 11.453  34.917 -9.308  1.00 47.20  ? 92  CYS D O   1 
ATOM   3648 C CB  . CYS D 1 74  ? 14.206  35.013 -8.255  1.00 25.28  ? 92  CYS D CB  1 
ATOM   3649 S SG  . CYS D 1 74  ? 14.109  36.728 -7.704  1.00 51.94  ? 92  CYS D SG  1 
ATOM   3650 N N   . LYS D 1 75  ? 10.763  34.653 -7.203  1.00 38.21  ? 93  LYS D N   1 
ATOM   3651 C CA  . LYS D 1 75  ? 9.419   35.172 -7.470  1.00 38.45  ? 93  LYS D CA  1 
ATOM   3652 C C   . LYS D 1 75  ? 9.154   36.530 -6.815  1.00 38.16  ? 93  LYS D C   1 
ATOM   3653 O O   . LYS D 1 75  ? 9.155   36.648 -5.597  1.00 51.35  ? 93  LYS D O   1 
ATOM   3654 C CB  . LYS D 1 75  ? 8.346   34.174 -7.045  1.00 26.86  ? 93  LYS D CB  1 
ATOM   3655 C CG  . LYS D 1 75  ? 6.912   34.716 -7.166  1.00 43.95  ? 93  LYS D CG  1 
ATOM   3656 C CD  . LYS D 1 75  ? 5.873   33.605 -6.972  1.00 43.03  ? 93  LYS D CD  1 
ATOM   3657 C CE  . LYS D 1 75  ? 4.449   34.152 -7.018  1.00 52.11  ? 93  LYS D CE  1 
ATOM   3658 N NZ  . LYS D 1 75  ? 3.428   33.105 -6.723  1.00 48.67  ? 93  LYS D NZ  1 
ATOM   3659 N N   . ILE D 1 76  ? 8.909   37.540 -7.643  1.00 38.31  ? 94  ILE D N   1 
ATOM   3660 C CA  . ILE D 1 76  ? 8.711   38.911 -7.201  1.00 23.10  ? 94  ILE D CA  1 
ATOM   3661 C C   . ILE D 1 76  ? 7.263   39.299 -7.411  1.00 32.36  ? 94  ILE D C   1 
ATOM   3662 O O   . ILE D 1 76  ? 6.692   39.067 -8.465  1.00 42.43  ? 94  ILE D O   1 
ATOM   3663 C CB  . ILE D 1 76  ? 9.594   39.893 -7.999  1.00 34.70  ? 94  ILE D CB  1 
ATOM   3664 C CG1 . ILE D 1 76  ? 11.066  39.684 -7.666  1.00 48.04  ? 94  ILE D CG1 1 
ATOM   3665 C CG2 . ILE D 1 76  ? 9.218   41.322 -7.715  1.00 29.88  ? 94  ILE D CG2 1 
ATOM   3666 C CD1 . ILE D 1 76  ? 11.650  38.484 -8.313  1.00 43.67  ? 94  ILE D CD1 1 
ATOM   3667 N N   . THR D 1 77  ? 6.672   39.898 -6.392  1.00 46.65  ? 95  THR D N   1 
ATOM   3668 C CA  . THR D 1 77  ? 5.270   40.236 -6.419  1.00 29.55  ? 95  THR D CA  1 
ATOM   3669 C C   . THR D 1 77  ? 5.107   41.740 -6.361  1.00 34.18  ? 95  THR D C   1 
ATOM   3670 O O   . THR D 1 77  ? 5.472   42.367 -5.366  1.00 34.84  ? 95  THR D O   1 
ATOM   3671 C CB  . THR D 1 77  ? 4.570   39.647 -5.197  1.00 27.83  ? 95  THR D CB  1 
ATOM   3672 O OG1 . THR D 1 77  ? 4.623   38.219 -5.259  1.00 30.86  ? 95  THR D OG1 1 
ATOM   3673 C CG2 . THR D 1 77  ? 3.132   40.088 -5.162  1.00 21.68  ? 95  THR D CG2 1 
ATOM   3674 N N   . ALA D 1 78  ? 4.553   42.314 -7.427  1.00 42.22  ? 96  ALA D N   1 
ATOM   3675 C CA  . ALA D 1 78  ? 4.222   43.737 -7.464  1.00 33.17  ? 96  ALA D CA  1 
ATOM   3676 C C   . ALA D 1 78  ? 2.803   43.925 -6.928  1.00 36.90  ? 96  ALA D C   1 
ATOM   3677 O O   . ALA D 1 78  ? 1.866   43.290 -7.409  1.00 31.79  ? 96  ALA D O   1 
ATOM   3678 C CB  . ALA D 1 78  ? 4.338   44.269 -8.890  1.00 39.21  ? 96  ALA D CB  1 
ATOM   3679 N N   . HIS D 1 79  ? 2.645   44.794 -5.936  1.00 30.09  ? 97  HIS D N   1 
ATOM   3680 C CA  . HIS D 1 79  ? 1.370   44.917 -5.223  1.00 24.94  ? 97  HIS D CA  1 
ATOM   3681 C C   . HIS D 1 79  ? 0.412   45.997 -5.738  1.00 41.39  ? 97  HIS D C   1 
ATOM   3682 O O   . HIS D 1 79  ? -0.795  45.939 -5.478  1.00 33.82  ? 97  HIS D O   1 
ATOM   3683 C CB  . HIS D 1 79  ? 1.624   45.092 -3.718  1.00 33.86  ? 97  HIS D CB  1 
ATOM   3684 C CG  . HIS D 1 79  ? 2.364   43.943 -3.105  1.00 44.49  ? 97  HIS D CG  1 
ATOM   3685 N ND1 . HIS D 1 79  ? 1.748   42.754 -2.774  1.00 35.24  ? 97  HIS D ND1 1 
ATOM   3686 C CD2 . HIS D 1 79  ? 3.674   43.789 -2.792  1.00 30.24  ? 97  HIS D CD2 1 
ATOM   3687 C CE1 . HIS D 1 79  ? 2.644   41.920 -2.275  1.00 28.88  ? 97  HIS D CE1 1 
ATOM   3688 N NE2 . HIS D 1 79  ? 3.820   42.521 -2.278  1.00 38.29  ? 97  HIS D NE2 1 
ATOM   3689 N N   . ARG D 1 80  ? 0.940   46.984 -6.458  1.00 35.88  ? 98  ARG D N   1 
ATOM   3690 C CA  . ARG D 1 80  ? 0.081   47.991 -7.089  1.00 52.98  ? 98  ARG D CA  1 
ATOM   3691 C C   . ARG D 1 80  ? 0.405   48.108 -8.585  1.00 41.63  ? 98  ARG D C   1 
ATOM   3692 O O   . ARG D 1 80  ? 1.020   49.067 -9.053  1.00 49.28  ? 98  ARG D O   1 
ATOM   3693 C CB  . ARG D 1 80  ? 0.130   49.333 -6.335  1.00 45.02  ? 98  ARG D CB  1 
ATOM   3694 C CG  . ARG D 1 80  ? -0.015  49.162 -4.813  1.00 45.92  ? 98  ARG D CG  1 
ATOM   3695 C CD  . ARG D 1 80  ? -0.321  50.459 -4.061  1.00 43.50  ? 98  ARG D CD  1 
ATOM   3696 N NE  . ARG D 1 80  ? -1.754  50.608 -3.837  1.00 67.69  ? 98  ARG D NE  1 
ATOM   3697 C CZ  . ARG D 1 80  ? -2.355  50.601 -2.650  1.00 49.97  ? 98  ARG D CZ  1 
ATOM   3698 N NH1 . ARG D 1 80  ? -1.656  50.478 -1.524  1.00 35.91  ? 98  ARG D NH1 1 
ATOM   3699 N NH2 . ARG D 1 80  ? -3.674  50.739 -2.600  1.00 54.77  ? 98  ARG D NH2 1 
ATOM   3700 N N   . TYR D 1 81  ? -0.054  47.099 -9.313  1.00 40.17  ? 99  TYR D N   1 
ATOM   3701 C CA  . TYR D 1 81  ? 0.262   46.885 -10.713 1.00 45.53  ? 99  TYR D CA  1 
ATOM   3702 C C   . TYR D 1 81  ? -0.925  47.280 -11.590 1.00 52.69  ? 99  TYR D C   1 
ATOM   3703 O O   . TYR D 1 81  ? -2.022  46.739 -11.435 1.00 40.26  ? 99  TYR D O   1 
ATOM   3704 C CB  . TYR D 1 81  ? 0.566   45.401 -10.884 1.00 45.63  ? 99  TYR D CB  1 
ATOM   3705 C CG  . TYR D 1 81  ? 0.989   44.925 -12.259 1.00 54.15  ? 99  TYR D CG  1 
ATOM   3706 C CD1 . TYR D 1 81  ? 2.323   44.647 -12.531 1.00 42.71  ? 99  TYR D CD1 1 
ATOM   3707 C CD2 . TYR D 1 81  ? 0.053   44.693 -13.265 1.00 47.44  ? 99  TYR D CD2 1 
ATOM   3708 C CE1 . TYR D 1 81  ? 2.718   44.179 -13.764 1.00 43.73  ? 99  TYR D CE1 1 
ATOM   3709 C CE2 . TYR D 1 81  ? 0.440   44.223 -14.504 1.00 38.64  ? 99  TYR D CE2 1 
ATOM   3710 C CZ  . TYR D 1 81  ? 1.777   43.967 -14.744 1.00 43.79  ? 99  TYR D CZ  1 
ATOM   3711 O OH  . TYR D 1 81  ? 2.198   43.502 -15.964 1.00 53.51  ? 99  TYR D OH  1 
ATOM   3712 N N   . ARG D 1 82  ? -0.707  48.231 -12.500 1.00 46.89  ? 100 ARG D N   1 
ATOM   3713 C CA  . ARG D 1 82  ? -1.761  48.672 -13.405 1.00 53.25  ? 100 ARG D CA  1 
ATOM   3714 C C   . ARG D 1 82  ? -1.946  47.620 -14.468 1.00 50.10  ? 100 ARG D C   1 
ATOM   3715 O O   . ARG D 1 82  ? -1.039  47.358 -15.251 1.00 58.80  ? 100 ARG D O   1 
ATOM   3716 C CB  . ARG D 1 82  ? -1.390  49.974 -14.099 1.00 57.52  ? 100 ARG D CB  1 
ATOM   3717 C CG  . ARG D 1 82  ? -0.316  50.751 -13.423 1.00 50.56  ? 100 ARG D CG  1 
ATOM   3718 C CD  . ARG D 1 82  ? -0.734  52.188 -13.205 1.00 68.52  ? 100 ARG D CD  1 
ATOM   3719 N NE  . ARG D 1 82  ? -0.016  52.666 -12.068 1.00 84.00  ? 100 ARG D NE  1 
ATOM   3720 C CZ  . ARG D 1 82  ? 0.826   53.674 -11.900 1.00 85.02  ? 100 ARG D CZ  1 
ATOM   3721 N NH1 . ARG D 1 82  ? 1.137   54.595 -12.806 1.00 90.65  ? 100 ARG D NH1 1 
ATOM   3722 N NH2 . ARG D 1 82  ? 1.334   53.747 -10.689 1.00 78.89  ? 100 ARG D NH2 1 
ATOM   3723 N N   . GLU D 1 83  ? -3.118  47.012 -14.502 1.00 38.87  ? 101 GLU D N   1 
ATOM   3724 C CA  . GLU D 1 83  ? -3.396  46.019 -15.525 1.00 65.71  ? 101 GLU D CA  1 
ATOM   3725 C C   . GLU D 1 83  ? -3.780  46.714 -16.825 1.00 70.34  ? 101 GLU D C   1 
ATOM   3726 O O   . GLU D 1 83  ? -3.488  46.225 -17.918 1.00 66.76  ? 101 GLU D O   1 
ATOM   3727 C CB  . GLU D 1 83  ? -4.502  45.075 -15.062 1.00 75.77  ? 101 GLU D CB  1 
ATOM   3728 C CG  . GLU D 1 83  ? -5.507  45.707 -14.108 1.00 61.99  ? 101 GLU D CG  1 
ATOM   3729 C CD  . GLU D 1 83  ? -6.660  44.774 -13.795 1.00 76.46  ? 101 GLU D CD  1 
ATOM   3730 O OE1 . GLU D 1 83  ? -7.569  45.165 -13.031 1.00 89.99  ? 101 GLU D OE1 1 
ATOM   3731 O OE2 . GLU D 1 83  ? -6.655  43.639 -14.317 1.00 81.69  ? 101 GLU D OE2 1 
ATOM   3732 N N   . PHE D 1 84  ? -4.401  47.880 -16.684 1.00 62.78  ? 102 PHE D N   1 
ATOM   3733 C CA  . PHE D 1 84  ? -4.911  48.647 -17.809 1.00 62.65  ? 102 PHE D CA  1 
ATOM   3734 C C   . PHE D 1 84  ? -3.818  49.154 -18.742 1.00 73.22  ? 102 PHE D C   1 
ATOM   3735 O O   . PHE D 1 84  ? -4.120  49.719 -19.799 1.00 71.70  ? 102 PHE D O   1 
ATOM   3736 C CB  . PHE D 1 84  ? -5.747  49.827 -17.306 1.00 64.49  ? 102 PHE D CB  1 
ATOM   3737 C CG  . PHE D 1 84  ? -4.964  50.825 -16.494 1.00 79.99  ? 102 PHE D CG  1 
ATOM   3738 C CD1 . PHE D 1 84  ? -4.809  50.654 -15.121 1.00 77.81  ? 102 PHE D CD1 1 
ATOM   3739 C CD2 . PHE D 1 84  ? -4.383  51.936 -17.100 1.00 63.76  ? 102 PHE D CD2 1 
ATOM   3740 C CE1 . PHE D 1 84  ? -4.095  51.570 -14.364 1.00 73.15  ? 102 PHE D CE1 1 
ATOM   3741 C CE2 . PHE D 1 84  ? -3.662  52.858 -16.350 1.00 79.44  ? 102 PHE D CE2 1 
ATOM   3742 C CZ  . PHE D 1 84  ? -3.517  52.673 -14.981 1.00 89.82  ? 102 PHE D CZ  1 
ATOM   3743 N N   . VAL D 1 85  ? -2.550  48.978 -18.371 1.00 62.00  ? 103 VAL D N   1 
ATOM   3744 C CA  . VAL D 1 85  ? -1.502  49.413 -19.295 1.00 65.02  ? 103 VAL D CA  1 
ATOM   3745 C C   . VAL D 1 85  ? -0.825  48.281 -20.064 1.00 59.74  ? 103 VAL D C   1 
ATOM   3746 O O   . VAL D 1 85  ? -0.816  47.134 -19.617 1.00 61.37  ? 103 VAL D O   1 
ATOM   3747 C CB  . VAL D 1 85  ? -0.483  50.469 -18.713 1.00 50.76  ? 103 VAL D CB  1 
ATOM   3748 C CG1 . VAL D 1 85  ? -1.041  51.291 -17.555 1.00 49.82  ? 103 VAL D CG1 1 
ATOM   3749 C CG2 . VAL D 1 85  ? 0.957   49.965 -18.585 1.00 52.17  ? 103 VAL D CG2 1 
ATOM   3750 N N   . PRO D 1 86  ? -0.302  48.605 -21.256 1.00 80.67  ? 104 PRO D N   1 
ATOM   3751 C CA  . PRO D 1 86  ? 0.396   47.642 -22.111 1.00 75.86  ? 104 PRO D CA  1 
ATOM   3752 C C   . PRO D 1 86  ? 1.397   46.813 -21.319 1.00 65.57  ? 104 PRO D C   1 
ATOM   3753 O O   . PRO D 1 86  ? 2.260   47.355 -20.631 1.00 47.24  ? 104 PRO D O   1 
ATOM   3754 C CB  . PRO D 1 86  ? 1.128   48.538 -23.111 1.00 69.69  ? 104 PRO D CB  1 
ATOM   3755 C CG  . PRO D 1 86  ? 0.246   49.739 -23.233 1.00 66.64  ? 104 PRO D CG  1 
ATOM   3756 C CD  . PRO D 1 86  ? -0.396  49.937 -21.885 1.00 79.95  ? 104 PRO D CD  1 
ATOM   3757 N N   . LYS D 1 87  ? 1.267   45.499 -21.426 1.00 52.93  ? 105 LYS D N   1 
ATOM   3758 C CA  . LYS D 1 87  ? 2.127   44.572 -20.715 1.00 62.00  ? 105 LYS D CA  1 
ATOM   3759 C C   . LYS D 1 87  ? 3.544   44.623 -21.268 1.00 65.98  ? 105 LYS D C   1 
ATOM   3760 O O   . LYS D 1 87  ? 3.790   44.236 -22.408 1.00 58.24  ? 105 LYS D O   1 
ATOM   3761 C CB  . LYS D 1 87  ? 1.571   43.154 -20.836 1.00 59.44  ? 105 LYS D CB  1 
ATOM   3762 C CG  . LYS D 1 87  ? 2.151   42.153 -19.854 1.00 51.73  ? 105 LYS D CG  1 
ATOM   3763 C CD  . LYS D 1 87  ? 1.455   40.811 -20.011 1.00 46.26  ? 105 LYS D CD  1 
ATOM   3764 C CE  . LYS D 1 87  ? 1.514   39.987 -18.732 1.00 74.95  ? 105 LYS D CE  1 
ATOM   3765 N NZ  . LYS D 1 87  ? 0.696   38.731 -18.792 1.00 44.07  ? 105 LYS D NZ  1 
ATOM   3766 N N   . ILE D 1 88  ? 4.474   45.105 -20.453 1.00 59.48  ? 106 ILE D N   1 
ATOM   3767 C CA  . ILE D 1 88  ? 5.878   45.164 -20.832 1.00 43.71  ? 106 ILE D CA  1 
ATOM   3768 C C   . ILE D 1 88  ? 6.490   43.766 -20.763 1.00 42.63  ? 106 ILE D C   1 
ATOM   3769 O O   . ILE D 1 88  ? 6.315   43.056 -19.777 1.00 66.30  ? 106 ILE D O   1 
ATOM   3770 C CB  . ILE D 1 88  ? 6.627   46.135 -19.920 1.00 43.67  ? 106 ILE D CB  1 
ATOM   3771 C CG1 . ILE D 1 88  ? 5.834   47.445 -19.819 1.00 37.82  ? 106 ILE D CG1 1 
ATOM   3772 C CG2 . ILE D 1 88  ? 8.048   46.338 -20.410 1.00 51.87  ? 106 ILE D CG2 1 
ATOM   3773 C CD1 . ILE D 1 88  ? 6.592   48.598 -19.272 1.00 34.99  ? 106 ILE D CD1 1 
ATOM   3774 N N   . PRO D 1 89  ? 7.191   43.355 -21.825 1.00 51.48  ? 107 PRO D N   1 
ATOM   3775 C CA  . PRO D 1 89  ? 7.703   41.984 -21.947 1.00 58.62  ? 107 PRO D CA  1 
ATOM   3776 C C   . PRO D 1 89  ? 9.111   41.832 -21.384 1.00 52.94  ? 107 PRO D C   1 
ATOM   3777 O O   . PRO D 1 89  ? 9.891   42.783 -21.393 1.00 44.60  ? 107 PRO D O   1 
ATOM   3778 C CB  . PRO D 1 89  ? 7.758   41.759 -23.471 1.00 46.81  ? 107 PRO D CB  1 
ATOM   3779 C CG  . PRO D 1 89  ? 7.510   43.129 -24.108 1.00 36.09  ? 107 PRO D CG  1 
ATOM   3780 C CD  . PRO D 1 89  ? 7.499   44.158 -23.018 1.00 60.65  ? 107 PRO D CD  1 
ATOM   3781 N N   . TYR D 1 90  ? 9.432   40.632 -20.916 1.00 47.01  ? 108 TYR D N   1 
ATOM   3782 C CA  . TYR D 1 90  ? 10.793  40.304 -20.518 1.00 42.58  ? 108 TYR D CA  1 
ATOM   3783 C C   . TYR D 1 90  ? 11.812  40.938 -21.471 1.00 63.87  ? 108 TYR D C   1 
ATOM   3784 O O   . TYR D 1 90  ? 12.696  41.679 -21.033 1.00 49.15  ? 108 TYR D O   1 
ATOM   3785 C CB  . TYR D 1 90  ? 10.971  38.786 -20.487 1.00 36.17  ? 108 TYR D CB  1 
ATOM   3786 C CG  . TYR D 1 90  ? 12.321  38.311 -19.996 1.00 55.16  ? 108 TYR D CG  1 
ATOM   3787 C CD1 . TYR D 1 90  ? 12.840  38.741 -18.780 1.00 56.50  ? 108 TYR D CD1 1 
ATOM   3788 C CD2 . TYR D 1 90  ? 13.062  37.403 -20.734 1.00 55.47  ? 108 TYR D CD2 1 
ATOM   3789 C CE1 . TYR D 1 90  ? 14.074  38.291 -18.325 1.00 47.10  ? 108 TYR D CE1 1 
ATOM   3790 C CE2 . TYR D 1 90  ? 14.291  36.949 -20.291 1.00 50.36  ? 108 TYR D CE2 1 
ATOM   3791 C CZ  . TYR D 1 90  ? 14.791  37.393 -19.087 1.00 59.57  ? 108 TYR D CZ  1 
ATOM   3792 O OH  . TYR D 1 90  ? 16.007  36.925 -18.655 1.00 46.80  ? 108 TYR D OH  1 
ATOM   3793 N N   . SER D 1 91  ? 11.672  40.658 -22.770 1.00 50.51  ? 109 SER D N   1 
ATOM   3794 C CA  . SER D 1 91  ? 12.588  41.195 -23.781 1.00 57.28  ? 109 SER D CA  1 
ATOM   3795 C C   . SER D 1 91  ? 12.945  42.660 -23.514 1.00 52.07  ? 109 SER D C   1 
ATOM   3796 O O   . SER D 1 91  ? 14.099  43.056 -23.669 1.00 45.01  ? 109 SER D O   1 
ATOM   3797 C CB  . SER D 1 91  ? 12.016  41.030 -25.198 1.00 41.74  ? 109 SER D CB  1 
ATOM   3798 O OG  . SER D 1 91  ? 11.112  42.078 -25.516 1.00 52.44  ? 109 SER D OG  1 
ATOM   3799 N N   . SER D 1 92  ? 11.958  43.446 -23.085 1.00 49.53  ? 110 SER D N   1 
ATOM   3800 C CA  . SER D 1 92  ? 12.141  44.879 -22.835 1.00 51.47  ? 110 SER D CA  1 
ATOM   3801 C C   . SER D 1 92  ? 12.954  45.244 -21.597 1.00 48.35  ? 110 SER D C   1 
ATOM   3802 O O   . SER D 1 92  ? 13.230  46.423 -21.382 1.00 52.66  ? 110 SER D O   1 
ATOM   3803 C CB  . SER D 1 92  ? 10.785  45.590 -22.719 1.00 47.49  ? 110 SER D CB  1 
ATOM   3804 O OG  . SER D 1 92  ? 10.321  46.055 -23.969 1.00 73.67  ? 110 SER D OG  1 
ATOM   3805 N N   . PHE D 1 93  ? 13.307  44.272 -20.761 1.00 52.34  ? 111 PHE D N   1 
ATOM   3806 C CA  . PHE D 1 93  ? 14.022  44.618 -19.530 1.00 47.32  ? 111 PHE D CA  1 
ATOM   3807 C C   . PHE D 1 93  ? 15.023  43.582 -19.023 1.00 56.92  ? 111 PHE D C   1 
ATOM   3808 O O   . PHE D 1 93  ? 15.676  43.793 -17.994 1.00 56.58  ? 111 PHE D O   1 
ATOM   3809 C CB  . PHE D 1 93  ? 13.048  45.038 -18.415 1.00 45.58  ? 111 PHE D CB  1 
ATOM   3810 C CG  . PHE D 1 93  ? 11.986  44.012 -18.089 1.00 56.68  ? 111 PHE D CG  1 
ATOM   3811 C CD1 . PHE D 1 93  ? 12.224  43.014 -17.141 1.00 53.96  ? 111 PHE D CD1 1 
ATOM   3812 C CD2 . PHE D 1 93  ? 10.739  44.063 -18.699 1.00 50.22  ? 111 PHE D CD2 1 
ATOM   3813 C CE1 . PHE D 1 93  ? 11.237  42.062 -16.822 1.00 42.28  ? 111 PHE D CE1 1 
ATOM   3814 C CE2 . PHE D 1 93  ? 9.748   43.120 -18.387 1.00 50.78  ? 111 PHE D CE2 1 
ATOM   3815 C CZ  . PHE D 1 93  ? 10.000  42.119 -17.441 1.00 50.31  ? 111 PHE D CZ  1 
ATOM   3816 N N   . SER D 1 94  ? 15.161  42.479 -19.752 1.00 52.43  ? 112 SER D N   1 
ATOM   3817 C CA  . SER D 1 94  ? 16.041  41.392 -19.331 1.00 47.36  ? 112 SER D CA  1 
ATOM   3818 C C   . SER D 1 94  ? 17.472  41.881 -19.170 1.00 59.72  ? 112 SER D C   1 
ATOM   3819 O O   . SER D 1 94  ? 18.337  41.154 -18.688 1.00 58.04  ? 112 SER D O   1 
ATOM   3820 C CB  . SER D 1 94  ? 16.004  40.234 -20.334 1.00 53.30  ? 112 SER D CB  1 
ATOM   3821 O OG  . SER D 1 94  ? 16.648  40.585 -21.551 1.00 66.55  ? 112 SER D OG  1 
ATOM   3822 N N   . SER D 1 95  ? 17.723  43.119 -19.573 1.00 51.99  ? 113 SER D N   1 
ATOM   3823 C CA  . SER D 1 95  ? 19.079  43.641 -19.568 1.00 63.53  ? 113 SER D CA  1 
ATOM   3824 C C   . SER D 1 95  ? 19.197  44.776 -18.581 1.00 53.56  ? 113 SER D C   1 
ATOM   3825 O O   . SER D 1 95  ? 20.296  45.162 -18.199 1.00 63.25  ? 113 SER D O   1 
ATOM   3826 C CB  . SER D 1 95  ? 19.472  44.115 -20.966 1.00 66.80  ? 113 SER D CB  1 
ATOM   3827 O OG  . SER D 1 95  ? 19.283  43.075 -21.914 1.00 92.89  ? 113 SER D OG  1 
ATOM   3828 N N   . ALA D 1 96  ? 18.058  45.307 -18.162 1.00 40.97  ? 114 ALA D N   1 
ATOM   3829 C CA  . ALA D 1 96  ? 18.069  46.401 -17.206 1.00 45.93  ? 114 ALA D CA  1 
ATOM   3830 C C   . ALA D 1 96  ? 18.854  45.967 -15.966 1.00 52.43  ? 114 ALA D C   1 
ATOM   3831 O O   . ALA D 1 96  ? 18.977  44.770 -15.692 1.00 51.98  ? 114 ALA D O   1 
ATOM   3832 C CB  . ALA D 1 96  ? 16.649  46.819 -16.855 1.00 37.66  ? 114 ALA D CB  1 
ATOM   3833 N N   . PRO D 1 97  ? 19.414  46.939 -15.232 1.00 57.80  ? 115 PRO D N   1 
ATOM   3834 C CA  . PRO D 1 97  ? 20.273  46.701 -14.063 1.00 59.31  ? 115 PRO D CA  1 
ATOM   3835 C C   . PRO D 1 97  ? 19.611  45.906 -12.934 1.00 65.62  ? 115 PRO D C   1 
ATOM   3836 O O   . PRO D 1 97  ? 18.535  46.265 -12.452 1.00 49.97  ? 115 PRO D O   1 
ATOM   3837 C CB  . PRO D 1 97  ? 20.593  48.115 -13.576 1.00 55.66  ? 115 PRO D CB  1 
ATOM   3838 C CG  . PRO D 1 97  ? 20.435  48.968 -14.774 1.00 51.55  ? 115 PRO D CG  1 
ATOM   3839 C CD  . PRO D 1 97  ? 19.331  48.369 -15.571 1.00 54.70  ? 115 PRO D CD  1 
ATOM   3840 N N   . GLY D 1 98  ? 20.275  44.837 -12.508 1.00 78.31  ? 116 GLY D N   1 
ATOM   3841 C CA  . GLY D 1 98  ? 19.816  44.049 -11.379 1.00 58.46  ? 116 GLY D CA  1 
ATOM   3842 C C   . GLY D 1 98  ? 18.864  42.949 -11.801 1.00 72.33  ? 116 GLY D C   1 
ATOM   3843 O O   . GLY D 1 98  ? 18.546  42.049 -11.018 1.00 44.29  ? 116 GLY D O   1 
ATOM   3844 N N   . VAL D 1 99  ? 18.399  43.013 -13.046 1.00 55.50  ? 117 VAL D N   1 
ATOM   3845 C CA  . VAL D 1 99  ? 17.450  42.015 -13.512 1.00 53.55  ? 117 VAL D CA  1 
ATOM   3846 C C   . VAL D 1 99  ? 18.217  40.761 -13.881 1.00 56.48  ? 117 VAL D C   1 
ATOM   3847 O O   . VAL D 1 99  ? 18.480  40.495 -15.047 1.00 51.92  ? 117 VAL D O   1 
ATOM   3848 C CB  . VAL D 1 99  ? 16.592  42.525 -14.682 1.00 47.03  ? 117 VAL D CB  1 
ATOM   3849 C CG1 . VAL D 1 99  ? 15.639  41.443 -15.158 1.00 33.25  ? 117 VAL D CG1 1 
ATOM   3850 C CG2 . VAL D 1 99  ? 15.813  43.765 -14.252 1.00 35.86  ? 117 VAL D CG2 1 
ATOM   3851 N N   . ILE D 1 100 ? 18.570  39.982 -12.870 1.00 39.04  ? 118 ILE D N   1 
ATOM   3852 C CA  . ILE D 1 100 ? 19.519  38.914 -13.089 1.00 44.81  ? 118 ILE D CA  1 
ATOM   3853 C C   . ILE D 1 100 ? 18.890  37.547 -13.256 1.00 33.34  ? 118 ILE D C   1 
ATOM   3854 O O   . ILE D 1 100 ? 19.585  36.600 -13.603 1.00 39.55  ? 118 ILE D O   1 
ATOM   3855 C CB  . ILE D 1 100 ? 20.581  38.857 -11.968 1.00 59.17  ? 118 ILE D CB  1 
ATOM   3856 C CG1 . ILE D 1 100 ? 19.907  38.628 -10.611 1.00 45.10  ? 118 ILE D CG1 1 
ATOM   3857 C CG2 . ILE D 1 100 ? 21.426  40.125 -11.978 1.00 41.16  ? 118 ILE D CG2 1 
ATOM   3858 C CD1 . ILE D 1 100 ? 20.854  38.437 -9.459  1.00 51.46  ? 118 ILE D CD1 1 
ATOM   3859 N N   . PHE D 1 101 ? 17.592  37.420 -13.004 1.00 37.56  ? 119 PHE D N   1 
ATOM   3860 C CA  . PHE D 1 101 ? 16.966  36.111 -13.218 1.00 52.10  ? 119 PHE D CA  1 
ATOM   3861 C C   . PHE D 1 101 ? 16.793  35.836 -14.711 1.00 40.17  ? 119 PHE D C   1 
ATOM   3862 O O   . PHE D 1 101 ? 16.884  36.754 -15.522 1.00 47.10  ? 119 PHE D O   1 
ATOM   3863 C CB  . PHE D 1 101 ? 15.661  35.905 -12.422 1.00 43.57  ? 119 PHE D CB  1 
ATOM   3864 C CG  . PHE D 1 101 ? 14.546  36.861 -12.770 1.00 42.79  ? 119 PHE D CG  1 
ATOM   3865 C CD1 . PHE D 1 101 ? 14.654  37.744 -13.833 1.00 45.52  ? 119 PHE D CD1 1 
ATOM   3866 C CD2 . PHE D 1 101 ? 13.365  36.849 -12.038 1.00 47.97  ? 119 PHE D CD2 1 
ATOM   3867 C CE1 . PHE D 1 101 ? 13.612  38.613 -14.151 1.00 36.22  ? 119 PHE D CE1 1 
ATOM   3868 C CE2 . PHE D 1 101 ? 12.319  37.706 -12.352 1.00 49.91  ? 119 PHE D CE2 1 
ATOM   3869 C CZ  . PHE D 1 101 ? 12.444  38.594 -13.413 1.00 40.71  ? 119 PHE D CZ  1 
ATOM   3870 N N   . ARG D 1 102 ? 16.572  34.570 -15.057 1.00 39.04  ? 120 ARG D N   1 
ATOM   3871 C CA  . ARG D 1 102 ? 16.516  34.130 -16.448 1.00 39.69  ? 120 ARG D CA  1 
ATOM   3872 C C   . ARG D 1 102 ? 15.413  33.118 -16.684 1.00 41.46  ? 120 ARG D C   1 
ATOM   3873 O O   . ARG D 1 102 ? 14.873  32.542 -15.746 1.00 53.98  ? 120 ARG D O   1 
ATOM   3874 C CB  . ARG D 1 102 ? 17.859  33.534 -16.868 1.00 37.57  ? 120 ARG D CB  1 
ATOM   3875 C CG  . ARG D 1 102 ? 18.926  34.594 -17.074 1.00 62.24  ? 120 ARG D CG  1 
ATOM   3876 C CD  . ARG D 1 102 ? 20.259  34.183 -16.487 1.00 69.99  ? 120 ARG D CD  1 
ATOM   3877 N NE  . ARG D 1 102 ? 21.056  33.385 -17.410 1.00 103.59 ? 120 ARG D NE  1 
ATOM   3878 C CZ  . ARG D 1 102 ? 22.322  33.051 -17.189 1.00 125.99 ? 120 ARG D CZ  1 
ATOM   3879 N NH1 . ARG D 1 102 ? 22.926  33.450 -16.076 1.00 129.67 ? 120 ARG D NH1 1 
ATOM   3880 N NH2 . ARG D 1 102 ? 22.984  32.324 -18.079 1.00 133.79 ? 120 ARG D NH2 1 
ATOM   3881 N N   . GLN D 1 103 ? 15.071  32.916 -17.947 1.00 37.80  ? 121 GLN D N   1 
ATOM   3882 C CA  . GLN D 1 103 ? 14.122  31.879 -18.316 1.00 50.61  ? 121 GLN D CA  1 
ATOM   3883 C C   . GLN D 1 103 ? 14.319  30.620 -17.486 1.00 34.71  ? 121 GLN D C   1 
ATOM   3884 O O   . GLN D 1 103 ? 15.432  30.117 -17.349 1.00 44.79  ? 121 GLN D O   1 
ATOM   3885 C CB  . GLN D 1 103 ? 14.260  31.535 -19.796 1.00 34.64  ? 121 GLN D CB  1 
ATOM   3886 C CG  . GLN D 1 103 ? 13.503  30.288 -20.222 1.00 51.83  ? 121 GLN D CG  1 
ATOM   3887 C CD  . GLN D 1 103 ? 13.562  30.065 -21.726 1.00 60.40  ? 121 GLN D CD  1 
ATOM   3888 O OE1 . GLN D 1 103 ? 13.811  30.996 -22.493 1.00 48.00  ? 121 GLN D OE1 1 
ATOM   3889 N NE2 . GLN D 1 103 ? 13.335  28.832 -22.152 1.00 36.64  ? 121 GLN D NE2 1 
ATOM   3890 N N   . GLU D 1 104 ? 13.222  30.098 -16.962 1.00 31.95  ? 122 GLU D N   1 
ATOM   3891 C CA  . GLU D 1 104 ? 13.268  28.913 -16.122 1.00 39.90  ? 122 GLU D CA  1 
ATOM   3892 C C   . GLU D 1 104 ? 13.471  27.613 -16.886 1.00 39.30  ? 122 GLU D C   1 
ATOM   3893 O O   . GLU D 1 104 ? 12.834  27.363 -17.910 1.00 43.53  ? 122 GLU D O   1 
ATOM   3894 C CB  . GLU D 1 104 ? 11.985  28.801 -15.304 1.00 41.54  ? 122 GLU D CB  1 
ATOM   3895 C CG  . GLU D 1 104 ? 11.758  29.941 -14.343 1.00 39.69  ? 122 GLU D CG  1 
ATOM   3896 C CD  . GLU D 1 104 ? 10.634  29.633 -13.392 1.00 47.93  ? 122 GLU D CD  1 
ATOM   3897 O OE1 . GLU D 1 104 ? 10.685  28.551 -12.766 1.00 52.96  ? 122 GLU D OE1 1 
ATOM   3898 O OE2 . GLU D 1 104 ? 9.700   30.457 -13.280 1.00 58.14  ? 122 GLU D OE2 1 
ATOM   3899 N N   . THR D 1 105 ? 14.347  26.777 -16.347 1.00 34.76  ? 123 THR D N   1 
ATOM   3900 C CA  . THR D 1 105 ? 14.545  25.435 -16.842 1.00 37.99  ? 123 THR D CA  1 
ATOM   3901 C C   . THR D 1 105 ? 13.220  24.682 -16.883 1.00 39.06  ? 123 THR D C   1 
ATOM   3902 O O   . THR D 1 105 ? 12.473  24.679 -15.916 1.00 53.53  ? 123 THR D O   1 
ATOM   3903 C CB  . THR D 1 105 ? 15.572  24.698 -15.965 1.00 50.96  ? 123 THR D CB  1 
ATOM   3904 O OG1 . THR D 1 105 ? 16.859  25.296 -16.160 1.00 61.13  ? 123 THR D OG1 1 
ATOM   3905 C CG2 . THR D 1 105 ? 15.646  23.198 -16.302 1.00 32.49  ? 123 THR D CG2 1 
ATOM   3906 N N   . GLY D 1 106 ? 12.930  24.058 -18.020 1.00 54.81  ? 124 GLY D N   1 
ATOM   3907 C CA  . GLY D 1 106 ? 11.710  23.288 -18.181 1.00 39.91  ? 124 GLY D CA  1 
ATOM   3908 C C   . GLY D 1 106 ? 10.573  24.146 -18.695 1.00 50.92  ? 124 GLY D C   1 
ATOM   3909 O O   . GLY D 1 106 ? 9.451   23.673 -18.904 1.00 64.21  ? 124 GLY D O   1 
ATOM   3910 N N   . LEU D 1 107 ? 10.872  25.422 -18.892 1.00 36.90  ? 125 LEU D N   1 
ATOM   3911 C CA  . LEU D 1 107 ? 9.896   26.370 -19.394 1.00 56.22  ? 125 LEU D CA  1 
ATOM   3912 C C   . LEU D 1 107 ? 10.325  26.809 -20.795 1.00 64.91  ? 125 LEU D C   1 
ATOM   3913 O O   . LEU D 1 107 ? 11.505  27.057 -21.038 1.00 60.41  ? 125 LEU D O   1 
ATOM   3914 C CB  . LEU D 1 107 ? 9.809   27.569 -18.446 1.00 45.03  ? 125 LEU D CB  1 
ATOM   3915 C CG  . LEU D 1 107 ? 8.411   27.906 -17.922 1.00 50.69  ? 125 LEU D CG  1 
ATOM   3916 C CD1 . LEU D 1 107 ? 7.645   26.633 -17.607 1.00 47.18  ? 125 LEU D CD1 1 
ATOM   3917 C CD2 . LEU D 1 107 ? 8.478   28.801 -16.698 1.00 41.78  ? 125 LEU D CD2 1 
ATOM   3918 N N   . ASP D 1 108 ? 9.382   26.890 -21.724 1.00 59.45  ? 126 ASP D N   1 
ATOM   3919 C CA  . ASP D 1 108 ? 9.737   27.257 -23.095 1.00 77.94  ? 126 ASP D CA  1 
ATOM   3920 C C   . ASP D 1 108 ? 9.392   28.700 -23.439 1.00 55.83  ? 126 ASP D C   1 
ATOM   3921 O O   . ASP D 1 108 ? 9.504   29.114 -24.582 1.00 73.05  ? 126 ASP D O   1 
ATOM   3922 C CB  . ASP D 1 108 ? 9.099   26.302 -24.103 1.00 89.22  ? 126 ASP D CB  1 
ATOM   3923 C CG  . ASP D 1 108 ? 7.593   26.286 -24.011 1.00 104.30 ? 126 ASP D CG  1 
ATOM   3924 O OD1 . ASP D 1 108 ? 7.012   27.302 -23.566 1.00 102.37 ? 126 ASP D OD1 1 
ATOM   3925 O OD2 . ASP D 1 108 ? 6.991   25.257 -24.382 1.00 114.76 ? 126 ASP D OD2 1 
ATOM   3926 N N   . HIS D 1 109 ? 8.966   29.465 -22.448 1.00 61.68  ? 127 HIS D N   1 
ATOM   3927 C CA  . HIS D 1 109 ? 8.788   30.892 -22.646 1.00 60.05  ? 127 HIS D CA  1 
ATOM   3928 C C   . HIS D 1 109 ? 9.557   31.653 -21.571 1.00 58.37  ? 127 HIS D C   1 
ATOM   3929 O O   . HIS D 1 109 ? 9.973   31.082 -20.562 1.00 65.82  ? 127 HIS D O   1 
ATOM   3930 C CB  . HIS D 1 109 ? 7.305   31.271 -22.629 1.00 51.87  ? 127 HIS D CB  1 
ATOM   3931 C CG  . HIS D 1 109 ? 6.637   31.034 -21.314 1.00 67.11  ? 127 HIS D CG  1 
ATOM   3932 N ND1 . HIS D 1 109 ? 5.939   29.879 -21.032 1.00 74.51  ? 127 HIS D ND1 1 
ATOM   3933 C CD2 . HIS D 1 109 ? 6.565   31.799 -20.198 1.00 75.35  ? 127 HIS D CD2 1 
ATOM   3934 C CE1 . HIS D 1 109 ? 5.464   29.944 -19.799 1.00 81.01  ? 127 HIS D CE1 1 
ATOM   3935 N NE2 . HIS D 1 109 ? 5.828   31.099 -19.271 1.00 66.17  ? 127 HIS D NE2 1 
ATOM   3936 N N   . ASP D 1 110 ? 9.755   32.941 -21.804 1.00 34.45  ? 128 ASP D N   1 
ATOM   3937 C CA  . ASP D 1 110 ? 10.452  33.806 -20.872 1.00 47.11  ? 128 ASP D CA  1 
ATOM   3938 C C   . ASP D 1 110 ? 9.605   34.154 -19.645 1.00 52.46  ? 128 ASP D C   1 
ATOM   3939 O O   . ASP D 1 110 ? 8.406   33.890 -19.605 1.00 46.63  ? 128 ASP D O   1 
ATOM   3940 C CB  . ASP D 1 110 ? 10.850  35.097 -21.585 1.00 55.65  ? 128 ASP D CB  1 
ATOM   3941 C CG  . ASP D 1 110 ? 11.853  34.863 -22.698 1.00 79.87  ? 128 ASP D CG  1 
ATOM   3942 O OD1 . ASP D 1 110 ? 12.646  33.897 -22.583 1.00 50.05  ? 128 ASP D OD1 1 
ATOM   3943 O OD2 . ASP D 1 110 ? 11.845  35.647 -23.678 1.00 79.62  ? 128 ASP D OD2 1 
ATOM   3944 N N   . PRO D 1 111 ? 10.244  34.748 -18.633 1.00 44.54  ? 129 PRO D N   1 
ATOM   3945 C CA  . PRO D 1 111 ? 9.564   35.348 -17.480 1.00 51.54  ? 129 PRO D CA  1 
ATOM   3946 C C   . PRO D 1 111 ? 8.560   36.421 -17.890 1.00 38.90  ? 129 PRO D C   1 
ATOM   3947 O O   . PRO D 1 111 ? 8.894   37.337 -18.631 1.00 39.84  ? 129 PRO D O   1 
ATOM   3948 C CB  . PRO D 1 111 ? 10.716  35.981 -16.696 1.00 43.31  ? 129 PRO D CB  1 
ATOM   3949 C CG  . PRO D 1 111 ? 11.886  35.102 -17.017 1.00 47.90  ? 129 PRO D CG  1 
ATOM   3950 C CD  . PRO D 1 111 ? 11.707  34.715 -18.458 1.00 47.00  ? 129 PRO D CD  1 
ATOM   3951 N N   . GLU D 1 112 ? 7.338   36.315 -17.387 1.00 31.86  ? 130 GLU D N   1 
ATOM   3952 C CA  . GLU D 1 112 ? 6.284   37.230 -17.774 1.00 44.93  ? 130 GLU D CA  1 
ATOM   3953 C C   . GLU D 1 112 ? 5.536   37.687 -16.530 1.00 43.02  ? 130 GLU D C   1 
ATOM   3954 O O   . GLU D 1 112 ? 5.268   36.881 -15.629 1.00 35.22  ? 130 GLU D O   1 
ATOM   3955 C CB  . GLU D 1 112 ? 5.324   36.517 -18.731 1.00 28.83  ? 130 GLU D CB  1 
ATOM   3956 C CG  . GLU D 1 112 ? 4.490   35.456 -18.026 1.00 56.21  ? 130 GLU D CG  1 
ATOM   3957 C CD  . GLU D 1 112 ? 3.911   34.412 -18.962 1.00 77.77  ? 130 GLU D CD  1 
ATOM   3958 O OE1 . GLU D 1 112 ? 3.723   34.722 -20.158 1.00 71.33  ? 130 GLU D OE1 1 
ATOM   3959 O OE2 . GLU D 1 112 ? 3.645   33.279 -18.492 1.00 76.58  ? 130 GLU D OE2 1 
ATOM   3960 N N   . TRP D 1 113 ? 5.196   38.970 -16.466 1.00 37.07  ? 131 TRP D N   1 
ATOM   3961 C CA  . TRP D 1 113 ? 4.295   39.420 -15.411 1.00 34.82  ? 131 TRP D CA  1 
ATOM   3962 C C   . TRP D 1 113 ? 2.981   38.655 -15.504 1.00 45.25  ? 131 TRP D C   1 
ATOM   3963 O O   . TRP D 1 113 ? 2.492   38.371 -16.593 1.00 38.68  ? 131 TRP D O   1 
ATOM   3964 C CB  . TRP D 1 113 ? 4.054   40.918 -15.484 1.00 35.85  ? 131 TRP D CB  1 
ATOM   3965 C CG  . TRP D 1 113 ? 5.169   41.715 -14.902 1.00 41.23  ? 131 TRP D CG  1 
ATOM   3966 C CD1 . TRP D 1 113 ? 6.078   42.463 -15.584 1.00 44.57  ? 131 TRP D CD1 1 
ATOM   3967 C CD2 . TRP D 1 113 ? 5.507   41.837 -13.517 1.00 38.95  ? 131 TRP D CD2 1 
ATOM   3968 N NE1 . TRP D 1 113 ? 6.960   43.048 -14.714 1.00 42.22  ? 131 TRP D NE1 1 
ATOM   3969 C CE2 . TRP D 1 113 ? 6.631   42.685 -13.436 1.00 47.27  ? 131 TRP D CE2 1 
ATOM   3970 C CE3 . TRP D 1 113 ? 4.963   41.323 -12.336 1.00 51.81  ? 131 TRP D CE3 1 
ATOM   3971 C CZ2 . TRP D 1 113 ? 7.228   43.029 -12.216 1.00 53.85  ? 131 TRP D CZ2 1 
ATOM   3972 C CZ3 . TRP D 1 113 ? 5.557   41.662 -11.122 1.00 63.44  ? 131 TRP D CZ3 1 
ATOM   3973 C CH2 . TRP D 1 113 ? 6.681   42.506 -11.073 1.00 47.98  ? 131 TRP D CH2 1 
ATOM   3974 N N   . VAL D 1 114 ? 2.429   38.287 -14.353 1.00 50.02  ? 132 VAL D N   1 
ATOM   3975 C CA  . VAL D 1 114 ? 1.187   37.517 -14.310 1.00 42.27  ? 132 VAL D CA  1 
ATOM   3976 C C   . VAL D 1 114 ? 0.259   38.101 -13.257 1.00 45.32  ? 132 VAL D C   1 
ATOM   3977 O O   . VAL D 1 114 ? 0.579   38.100 -12.074 1.00 43.46  ? 132 VAL D O   1 
ATOM   3978 C CB  . VAL D 1 114 ? 1.448   36.027 -14.006 1.00 40.54  ? 132 VAL D CB  1 
ATOM   3979 C CG1 . VAL D 1 114 ? 0.177   35.345 -13.480 1.00 26.65  ? 132 VAL D CG1 1 
ATOM   3980 C CG2 . VAL D 1 114 ? 1.980   35.327 -15.245 1.00 45.71  ? 132 VAL D CG2 1 
ATOM   3981 N N   . VAL D 1 115 ? -0.887  38.607 -13.696 1.00 40.86  ? 133 VAL D N   1 
ATOM   3982 C CA  . VAL D 1 115 ? -1.816  39.282 -12.802 1.00 47.98  ? 133 VAL D CA  1 
ATOM   3983 C C   . VAL D 1 115 ? -2.653  38.310 -11.966 1.00 43.52  ? 133 VAL D C   1 
ATOM   3984 O O   . VAL D 1 115 ? -3.295  37.404 -12.500 1.00 40.00  ? 133 VAL D O   1 
ATOM   3985 C CB  . VAL D 1 115 ? -2.759  40.214 -13.589 1.00 49.82  ? 133 VAL D CB  1 
ATOM   3986 C CG1 . VAL D 1 115 ? -3.844  40.798 -12.675 1.00 33.95  ? 133 VAL D CG1 1 
ATOM   3987 C CG2 . VAL D 1 115 ? -1.959  41.309 -14.255 1.00 38.39  ? 133 VAL D CG2 1 
ATOM   3988 N N   . ASN D 1 116 ? -2.642  38.509 -10.651 1.00 38.84  ? 134 ASN D N   1 
ATOM   3989 C CA  . ASN D 1 116 ? -3.481  37.721 -9.754  1.00 42.84  ? 134 ASN D CA  1 
ATOM   3990 C C   . ASN D 1 116 ? -4.936  38.148 -9.853  1.00 39.12  ? 134 ASN D C   1 
ATOM   3991 O O   . ASN D 1 116 ? -5.331  39.163 -9.279  1.00 39.83  ? 134 ASN D O   1 
ATOM   3992 C CB  . ASN D 1 116 ? -2.999  37.865 -8.315  1.00 41.90  ? 134 ASN D CB  1 
ATOM   3993 C CG  . ASN D 1 116 ? -3.722  36.942 -7.362  1.00 42.84  ? 134 ASN D CG  1 
ATOM   3994 O OD1 . ASN D 1 116 ? -4.685  36.267 -7.725  1.00 43.10  ? 134 ASN D OD1 1 
ATOM   3995 N ND2 . ASN D 1 116 ? -3.256  36.910 -6.125  1.00 47.56  ? 134 ASN D ND2 1 
ATOM   3996 N N   . MET D 1 117 ? -5.727  37.368 -10.581 1.00 36.41  ? 135 MET D N   1 
ATOM   3997 C CA  . MET D 1 117 ? -7.133  37.692 -10.778 1.00 48.66  ? 135 MET D CA  1 
ATOM   3998 C C   . MET D 1 117 ? -7.984  37.323 -9.566  1.00 58.42  ? 135 MET D C   1 
ATOM   3999 O O   . MET D 1 117 ? -9.023  37.929 -9.332  1.00 57.09  ? 135 MET D O   1 
ATOM   4000 C CB  . MET D 1 117 ? -7.675  37.021 -12.042 1.00 37.39  ? 135 MET D CB  1 
ATOM   4001 C CG  . MET D 1 117 ? -7.090  37.582 -13.362 1.00 46.02  ? 135 MET D CG  1 
ATOM   4002 S SD  . MET D 1 117 ? -7.162  39.398 -13.510 1.00 46.22  ? 135 MET D SD  1 
ATOM   4003 C CE  . MET D 1 117 ? -8.911  39.659 -13.730 1.00 39.63  ? 135 MET D CE  1 
ATOM   4004 N N   . LYS D 1 118 ? -7.545  36.336 -8.794  1.00 33.47  ? 136 LYS D N   1 
ATOM   4005 C CA  . LYS D 1 118 ? -8.296  35.932 -7.619  1.00 56.45  ? 136 LYS D CA  1 
ATOM   4006 C C   . LYS D 1 118 ? -8.238  36.957 -6.475  1.00 60.55  ? 136 LYS D C   1 
ATOM   4007 O O   . LYS D 1 118 ? -8.907  36.787 -5.466  1.00 60.40  ? 136 LYS D O   1 
ATOM   4008 C CB  . LYS D 1 118 ? -7.834  34.557 -7.125  1.00 44.32  ? 136 LYS D CB  1 
ATOM   4009 C CG  . LYS D 1 118 ? -8.064  33.432 -8.119  1.00 60.85  ? 136 LYS D CG  1 
ATOM   4010 C CD  . LYS D 1 118 ? -6.935  33.338 -9.125  1.00 55.49  ? 136 LYS D CD  1 
ATOM   4011 C CE  . LYS D 1 118 ? -5.625  32.997 -8.436  1.00 50.94  ? 136 LYS D CE  1 
ATOM   4012 N NZ  . LYS D 1 118 ? -4.545  32.813 -9.425  1.00 37.17  ? 136 LYS D NZ  1 
ATOM   4013 N N   . ALA D 1 119 ? -7.449  38.014 -6.621  1.00 47.25  ? 137 ALA D N   1 
ATOM   4014 C CA  . ALA D 1 119 ? -7.287  38.973 -5.524  1.00 44.00  ? 137 ALA D CA  1 
ATOM   4015 C C   . ALA D 1 119 ? -7.911  40.331 -5.803  1.00 41.64  ? 137 ALA D C   1 
ATOM   4016 O O   . ALA D 1 119 ? -7.840  40.846 -6.924  1.00 63.16  ? 137 ALA D O   1 
ATOM   4017 C CB  . ALA D 1 119 ? -5.817  39.142 -5.154  1.00 36.28  ? 137 ALA D CB  1 
ATOM   4018 N N   . ARG D 1 120 ? -8.512  40.896 -4.759  1.00 48.09  ? 138 ARG D N   1 
ATOM   4019 C CA  . ARG D 1 120 ? -9.120  42.219 -4.792  1.00 48.46  ? 138 ARG D CA  1 
ATOM   4020 C C   . ARG D 1 120 ? -8.348  43.168 -5.691  1.00 55.04  ? 138 ARG D C   1 
ATOM   4021 O O   . ARG D 1 120 ? -7.112  43.187 -5.687  1.00 50.49  ? 138 ARG D O   1 
ATOM   4022 C CB  . ARG D 1 120 ? -9.182  42.822 -3.379  1.00 57.58  ? 138 ARG D CB  1 
ATOM   4023 C CG  . ARG D 1 120 ? -10.468 42.557 -2.605  1.00 55.55  ? 138 ARG D CG  1 
ATOM   4024 C CD  . ARG D 1 120 ? -10.760 41.071 -2.500  1.00 92.05  ? 138 ARG D CD  1 
ATOM   4025 N NE  . ARG D 1 120 ? -11.607 40.708 -1.360  1.00 75.81  ? 138 ARG D NE  1 
ATOM   4026 C CZ  . ARG D 1 120 ? -12.908 40.970 -1.275  1.00 78.44  ? 138 ARG D CZ  1 
ATOM   4027 N NH1 . ARG D 1 120 ? -13.521 41.626 -2.252  1.00 78.54  ? 138 ARG D NH1 1 
ATOM   4028 N NH2 . ARG D 1 120 ? -13.597 40.581 -0.210  1.00 66.44  ? 138 ARG D NH2 1 
ATOM   4029 N N   . THR D 1 121 ? -9.082  43.953 -6.466  1.00 40.85  ? 139 THR D N   1 
ATOM   4030 C CA  . THR D 1 121 ? -8.478  45.084 -7.141  1.00 61.76  ? 139 THR D CA  1 
ATOM   4031 C C   . THR D 1 121 ? -8.126  46.065 -6.043  1.00 52.83  ? 139 THR D C   1 
ATOM   4032 O O   . THR D 1 121 ? -8.750  46.054 -4.978  1.00 54.86  ? 139 THR D O   1 
ATOM   4033 C CB  . THR D 1 121 ? -9.443  45.733 -8.143  1.00 59.47  ? 139 THR D CB  1 
ATOM   4034 O OG1 . THR D 1 121 ? -10.645 46.122 -7.466  1.00 34.32  ? 139 THR D OG1 1 
ATOM   4035 C CG2 . THR D 1 121 ? -9.772  44.747 -9.274  1.00 33.38  ? 139 THR D CG2 1 
ATOM   4036 N N   . ARG D 1 122 ? -7.119  46.895 -6.278  1.00 42.46  ? 140 ARG D N   1 
ATOM   4037 C CA  . ARG D 1 122 ? -6.740  47.881 -5.279  1.00 41.74  ? 140 ARG D CA  1 
ATOM   4038 C C   . ARG D 1 122 ? -6.253  49.135 -5.957  1.00 46.79  ? 140 ARG D C   1 
ATOM   4039 O O   . ARG D 1 122 ? -6.075  49.151 -7.177  1.00 44.52  ? 140 ARG D O   1 
ATOM   4040 C CB  . ARG D 1 122 ? -5.661  47.331 -4.339  1.00 45.42  ? 140 ARG D CB  1 
ATOM   4041 C CG  . ARG D 1 122 ? -4.269  47.221 -4.946  1.00 37.81  ? 140 ARG D CG  1 
ATOM   4042 C CD  . ARG D 1 122 ? -4.203  46.091 -5.957  1.00 42.62  ? 140 ARG D CD  1 
ATOM   4043 N NE  . ARG D 1 122 ? -4.673  44.835 -5.388  1.00 39.90  ? 140 ARG D NE  1 
ATOM   4044 C CZ  . ARG D 1 122 ? -3.912  44.037 -4.647  1.00 42.14  ? 140 ARG D CZ  1 
ATOM   4045 N NH1 . ARG D 1 122 ? -2.660  44.385 -4.398  1.00 30.46  ? 140 ARG D NH1 1 
ATOM   4046 N NH2 . ARG D 1 122 ? -4.391  42.901 -4.155  1.00 20.56  ? 140 ARG D NH2 1 
ATOM   4047 N N   . GLY D 1 123 ? -6.035  50.181 -5.165  1.00 36.48  ? 141 GLY D N   1 
ATOM   4048 C CA  . GLY D 1 123 ? -5.531  51.433 -5.696  1.00 41.89  ? 141 GLY D CA  1 
ATOM   4049 C C   . GLY D 1 123 ? -4.223  51.244 -6.438  1.00 54.30  ? 141 GLY D C   1 
ATOM   4050 O O   . GLY D 1 123 ? -3.631  50.164 -6.396  1.00 59.82  ? 141 GLY D O   1 
ATOM   4051 N N   . CYS D 1 124 ? -3.775  52.284 -7.134  1.00 38.61  ? 142 CYS D N   1 
ATOM   4052 C CA  . CYS D 1 124 ? -2.458  52.259 -7.765  1.00 61.36  ? 142 CYS D CA  1 
ATOM   4053 C C   . CYS D 1 124 ? -1.516  53.182 -7.025  1.00 52.81  ? 142 CYS D C   1 
ATOM   4054 O O   . CYS D 1 124 ? -0.304  53.179 -7.259  1.00 51.04  ? 142 CYS D O   1 
ATOM   4055 C CB  . CYS D 1 124 ? -2.543  52.658 -9.234  1.00 58.13  ? 142 CYS D CB  1 
ATOM   4056 S SG  . CYS D 1 124 ? -3.398  51.435 -10.225 1.00 74.45  ? 142 CYS D SG  1 
ATOM   4057 N N   . ASP D 1 125 ? -2.099  53.986 -6.144  1.00 57.29  ? 143 ASP D N   1 
ATOM   4058 C CA  . ASP D 1 125 ? -1.338  54.815 -5.220  1.00 79.02  ? 143 ASP D CA  1 
ATOM   4059 C C   . ASP D 1 125 ? -1.587  54.354 -3.784  1.00 73.14  ? 143 ASP D C   1 
ATOM   4060 O O   . ASP D 1 125 ? -2.686  53.916 -3.430  1.00 50.84  ? 143 ASP D O   1 
ATOM   4061 C CB  . ASP D 1 125 ? -1.700  56.295 -5.380  1.00 70.25  ? 143 ASP D CB  1 
ATOM   4062 C CG  . ASP D 1 125 ? -1.199  56.881 -6.689  1.00 91.75  ? 143 ASP D CG  1 
ATOM   4063 O OD1 . ASP D 1 125 ? -1.908  57.732 -7.275  1.00 84.47  ? 143 ASP D OD1 1 
ATOM   4064 O OD2 . ASP D 1 125 ? -0.098  56.489 -7.135  1.00 86.45  ? 143 ASP D OD2 1 
ATOM   4065 N N   . HIS D 1 126 ? -0.551  54.442 -2.964  1.00 65.66  ? 144 HIS D N   1 
ATOM   4066 C CA  . HIS D 1 126 ? -0.661  54.054 -1.575  1.00 59.10  ? 144 HIS D CA  1 
ATOM   4067 C C   . HIS D 1 126 ? -0.792  55.293 -0.699  1.00 59.03  ? 144 HIS D C   1 
ATOM   4068 O O   . HIS D 1 126 ? -0.004  56.235 -0.830  1.00 55.86  ? 144 HIS D O   1 
ATOM   4069 C CB  . HIS D 1 126 ? 0.572   53.248 -1.166  1.00 45.02  ? 144 HIS D CB  1 
ATOM   4070 C CG  . HIS D 1 126 ? 0.574   52.838 0.271   1.00 39.65  ? 144 HIS D CG  1 
ATOM   4071 N ND1 . HIS D 1 126 ? 0.183   51.583 0.684   1.00 36.93  ? 144 HIS D ND1 1 
ATOM   4072 C CD2 . HIS D 1 126 ? 0.916   53.515 1.392   1.00 34.16  ? 144 HIS D CD2 1 
ATOM   4073 C CE1 . HIS D 1 126 ? 0.293   51.500 1.998   1.00 40.88  ? 144 HIS D CE1 1 
ATOM   4074 N NE2 . HIS D 1 126 ? 0.733   52.660 2.452   1.00 53.24  ? 144 HIS D NE2 1 
ATOM   4075 N N   . HIS D 1 127 ? -1.791  55.292 0.182   1.00 50.46  ? 145 HIS D N   1 
ATOM   4076 C CA  . HIS D 1 127 ? -1.882  56.296 1.250   1.00 70.84  ? 145 HIS D CA  1 
ATOM   4077 C C   . HIS D 1 127 ? -1.525  55.725 2.632   1.00 49.40  ? 145 HIS D C   1 
ATOM   4078 O O   . HIS D 1 127 ? -2.102  54.732 3.075   1.00 44.97  ? 145 HIS D O   1 
ATOM   4079 C CB  . HIS D 1 127 ? -3.266  56.949 1.270   1.00 66.42  ? 145 HIS D CB  1 
ATOM   4080 C CG  . HIS D 1 127 ? -3.683  57.495 -0.058  1.00 72.53  ? 145 HIS D CG  1 
ATOM   4081 N ND1 . HIS D 1 127 ? -4.782  57.027 -0.746  1.00 96.70  ? 145 HIS D ND1 1 
ATOM   4082 C CD2 . HIS D 1 127 ? -3.128  58.450 -0.839  1.00 60.25  ? 145 HIS D CD2 1 
ATOM   4083 C CE1 . HIS D 1 127 ? -4.894  57.679 -1.889  1.00 82.14  ? 145 HIS D CE1 1 
ATOM   4084 N NE2 . HIS D 1 127 ? -3.901  58.547 -1.971  1.00 89.78  ? 145 HIS D NE2 1 
ATOM   4085 N N   . HIS D 1 128 ? -0.571  56.360 3.307   1.00 58.63  ? 146 HIS D N   1 
ATOM   4086 C CA  . HIS D 1 128 ? -0.100  55.876 4.602   1.00 47.70  ? 146 HIS D CA  1 
ATOM   4087 C C   . HIS D 1 128 ? -1.000  56.275 5.769   1.00 57.41  ? 146 HIS D C   1 
ATOM   4088 O O   . HIS D 1 128 ? -0.881  55.721 6.867   1.00 57.12  ? 146 HIS D O   1 
ATOM   4089 C CB  . HIS D 1 128 ? 1.328   56.350 4.853   1.00 40.40  ? 146 HIS D CB  1 
ATOM   4090 C CG  . HIS D 1 128 ? 2.335   55.758 3.912   1.00 70.23  ? 146 HIS D CG  1 
ATOM   4091 N ND1 . HIS D 1 128 ? 2.453   56.162 2.598   1.00 84.40  ? 146 HIS D ND1 1 
ATOM   4092 C CD2 . HIS D 1 128 ? 3.273   54.796 4.094   1.00 56.31  ? 146 HIS D CD2 1 
ATOM   4093 C CE1 . HIS D 1 128 ? 3.419   55.476 2.011   1.00 53.99  ? 146 HIS D CE1 1 
ATOM   4094 N NE2 . HIS D 1 128 ? 3.935   54.643 2.899   1.00 66.95  ? 146 HIS D NE2 1 
ATOM   4095 N N   . HIS D 1 129 ? -1.901  57.227 5.527   1.00 62.15  ? 147 HIS D N   1 
ATOM   4096 C CA  . HIS D 1 129 ? -2.722  57.803 6.593   1.00 60.13  ? 147 HIS D CA  1 
ATOM   4097 C C   . HIS D 1 129 ? -4.195  57.989 6.214   1.00 78.48  ? 147 HIS D C   1 
ATOM   4098 O O   . HIS D 1 129 ? -4.579  57.846 5.053   1.00 61.75  ? 147 HIS D O   1 
ATOM   4099 C CB  . HIS D 1 129 ? -2.131  59.138 7.048   1.00 51.45  ? 147 HIS D CB  1 
ATOM   4100 C CG  . HIS D 1 129 ? -0.874  59.002 7.851   1.00 62.04  ? 147 HIS D CG  1 
ATOM   4101 N ND1 . HIS D 1 129 ? 0.382   59.064 7.286   1.00 78.91  ? 147 HIS D ND1 1 
ATOM   4102 C CD2 . HIS D 1 129 ? -0.679  58.806 9.177   1.00 71.30  ? 147 HIS D CD2 1 
ATOM   4103 C CE1 . HIS D 1 129 ? 1.296   58.913 8.229   1.00 68.54  ? 147 HIS D CE1 1 
ATOM   4104 N NE2 . HIS D 1 129 ? 0.678   58.760 9.386   1.00 61.13  ? 147 HIS D NE2 1 
HETATM 4105 O O   . HOH E 2 .   ? 0.556   25.209 -15.866 1.00 36.04  ? 201 HOH A O   1 
HETATM 4106 O O   . HOH E 2 .   ? -13.322 17.520 -3.849  1.00 34.03  ? 202 HOH A O   1 
HETATM 4107 O O   . HOH E 2 .   ? 7.793   16.887 -20.035 1.00 41.41  ? 203 HOH A O   1 
HETATM 4108 O O   . HOH E 2 .   ? 2.041   7.471  -9.951  1.00 31.44  ? 204 HOH A O   1 
HETATM 4109 O O   . HOH E 2 .   ? -3.529  28.990 -19.277 1.00 31.95  ? 205 HOH A O   1 
HETATM 4110 O O   . HOH E 2 .   ? 2.846   7.630  -5.629  1.00 34.91  ? 206 HOH A O   1 
HETATM 4111 O O   . HOH E 2 .   ? -20.081 33.758 -10.802 1.00 41.05  ? 207 HOH A O   1 
HETATM 4112 O O   . HOH E 2 .   ? 2.725   9.198  -23.317 1.00 42.89  ? 208 HOH A O   1 
HETATM 4113 O O   . HOH E 2 .   ? -1.829  21.175 -6.477  1.00 27.71  ? 209 HOH A O   1 
HETATM 4114 O O   . HOH E 2 .   ? 5.045   21.359 -9.202  1.00 31.56  ? 210 HOH A O   1 
HETATM 4115 O O   . HOH E 2 .   ? 0.491   22.748 -23.248 1.00 34.39  ? 211 HOH A O   1 
HETATM 4116 O O   . HOH E 2 .   ? 1.883   20.518 -20.984 1.00 33.05  ? 212 HOH A O   1 
HETATM 4117 O O   . HOH E 2 .   ? 11.567  4.348  -10.747 1.00 57.62  ? 213 HOH A O   1 
HETATM 4118 O O   . HOH E 2 .   ? 1.229   24.931 -12.588 1.00 45.33  ? 214 HOH A O   1 
HETATM 4119 O O   . HOH E 2 .   ? -13.887 15.152 -5.487  1.00 37.31  ? 215 HOH A O   1 
HETATM 4120 O O   . HOH E 2 .   ? -6.648  34.535 -21.581 1.00 55.17  ? 216 HOH A O   1 
HETATM 4121 O O   . HOH E 2 .   ? -11.292 16.943 -2.056  1.00 39.64  ? 217 HOH A O   1 
HETATM 4122 O O   . HOH E 2 .   ? 11.084  16.182 -8.516  1.00 46.97  ? 218 HOH A O   1 
HETATM 4123 O O   . HOH E 2 .   ? -6.011  34.254 -14.113 1.00 44.32  ? 219 HOH A O   1 
HETATM 4124 O O   . HOH E 2 .   ? -19.405 31.906 -16.700 1.00 40.05  ? 220 HOH A O   1 
HETATM 4125 O O   . HOH E 2 .   ? -7.154  22.587 -27.197 1.00 44.69  ? 221 HOH A O   1 
HETATM 4126 O O   . HOH E 2 .   ? -7.643  24.452 -1.845  1.00 41.90  ? 222 HOH A O   1 
HETATM 4127 O O   . HOH E 2 .   ? 2.949   22.322 -23.712 1.00 42.91  ? 223 HOH A O   1 
HETATM 4128 O O   . HOH E 2 .   ? 0.574   19.636 -3.013  1.00 36.89  ? 224 HOH A O   1 
HETATM 4129 O O   . HOH E 2 .   ? -19.918 23.156 -9.746  1.00 42.44  ? 225 HOH A O   1 
HETATM 4130 O O   . HOH E 2 .   ? 1.663   11.151 -10.531 1.00 34.21  ? 226 HOH A O   1 
HETATM 4131 O O   . HOH E 2 .   ? -1.931  19.043 -4.243  1.00 27.23  ? 227 HOH A O   1 
HETATM 4132 O O   . HOH E 2 .   ? 12.838  11.360 -3.351  1.00 40.33  ? 228 HOH A O   1 
HETATM 4133 O O   . HOH E 2 .   ? -9.176  10.268 -21.566 1.00 47.45  ? 229 HOH A O   1 
HETATM 4134 O O   . HOH E 2 .   ? -1.036  28.433 -10.781 1.00 26.19  ? 230 HOH A O   1 
HETATM 4135 O O   . HOH E 2 .   ? -17.058 38.160 -0.846  1.00 48.88  ? 231 HOH A O   1 
HETATM 4136 O O   . HOH E 2 .   ? -6.982  16.160 -4.836  1.00 31.89  ? 232 HOH A O   1 
HETATM 4137 O O   . HOH E 2 .   ? 5.785   22.869 -11.382 1.00 36.80  ? 233 HOH A O   1 
HETATM 4138 O O   . HOH E 2 .   ? -2.503  28.156 -16.897 1.00 33.31  ? 234 HOH A O   1 
HETATM 4139 O O   . HOH E 2 .   ? -14.832 15.451 -8.229  1.00 40.02  ? 235 HOH A O   1 
HETATM 4140 O O   . HOH E 2 .   ? -10.003 11.929 -19.250 1.00 35.20  ? 236 HOH A O   1 
HETATM 4141 O O   . HOH E 2 .   ? -14.526 19.835 -2.326  1.00 36.32  ? 237 HOH A O   1 
HETATM 4142 O O   . HOH E 2 .   ? -11.865 11.082 -17.757 1.00 37.58  ? 238 HOH A O   1 
HETATM 4143 O O   . HOH E 2 .   ? 15.366  3.073  -21.584 1.00 54.39  ? 239 HOH A O   1 
HETATM 4144 O O   . HOH E 2 .   ? -13.190 25.822 -9.568  1.00 40.88  ? 240 HOH A O   1 
HETATM 4145 O O   . HOH E 2 .   ? -13.674 12.222 -16.098 1.00 42.34  ? 241 HOH A O   1 
HETATM 4146 O O   . HOH E 2 .   ? 4.007   19.630 -25.026 1.00 57.11  ? 242 HOH A O   1 
HETATM 4147 O O   . HOH E 2 .   ? 11.070  24.455 -11.334 1.00 39.57  ? 243 HOH A O   1 
HETATM 4148 O O   . HOH E 2 .   ? -13.449 18.720 -21.236 1.00 41.00  ? 244 HOH A O   1 
HETATM 4149 O O   . HOH E 2 .   ? -8.011  18.106 -3.220  1.00 32.05  ? 245 HOH A O   1 
HETATM 4150 O O   . HOH E 2 .   ? 5.839   15.722 -4.811  1.00 27.21  ? 246 HOH A O   1 
HETATM 4151 O O   . HOH E 2 .   ? -21.037 18.375 -9.602  1.00 30.74  ? 247 HOH A O   1 
HETATM 4152 O O   . HOH E 2 .   ? 2.062   21.168 -4.845  1.00 40.97  ? 248 HOH A O   1 
HETATM 4153 O O   . HOH E 2 .   ? -1.360  3.351  -21.826 1.00 41.75  ? 249 HOH A O   1 
HETATM 4154 O O   . HOH E 2 .   ? -7.021  32.701 -3.435  1.00 42.82  ? 250 HOH A O   1 
HETATM 4155 O O   . HOH E 2 .   ? -9.466  28.591 -1.271  1.00 38.58  ? 251 HOH A O   1 
HETATM 4156 O O   . HOH E 2 .   ? -18.929 20.804 -12.722 1.00 39.31  ? 252 HOH A O   1 
HETATM 4157 O O   . HOH E 2 .   ? -10.493 30.314 -2.691  1.00 34.14  ? 253 HOH A O   1 
HETATM 4158 O O   . HOH E 2 .   ? -0.435  16.873 -1.928  1.00 39.27  ? 254 HOH A O   1 
HETATM 4159 O O   . HOH E 2 .   ? -6.622  31.161 -13.144 1.00 48.48  ? 255 HOH A O   1 
HETATM 4160 O O   . HOH E 2 .   ? -11.034 22.694 -21.374 1.00 48.68  ? 256 HOH A O   1 
HETATM 4161 O O   . HOH E 2 .   ? -13.745 13.904 -14.088 1.00 40.78  ? 257 HOH A O   1 
HETATM 4162 O O   . HOH E 2 .   ? 17.484  14.478 -6.352  1.00 45.15  ? 258 HOH A O   1 
HETATM 4163 O O   . HOH E 2 .   ? 4.830   23.925 -22.890 1.00 50.54  ? 259 HOH A O   1 
HETATM 4164 O O   . HOH E 2 .   ? -12.134 23.872 -23.539 1.00 51.20  ? 260 HOH A O   1 
HETATM 4165 O O   . HOH E 2 .   ? 18.789  13.453 -8.853  1.00 49.16  ? 261 HOH A O   1 
HETATM 4166 O O   . HOH E 2 .   ? -8.473  15.980 -25.718 1.00 36.45  ? 262 HOH A O   1 
HETATM 4167 O O   . HOH E 2 .   ? 11.282  7.085  -4.124  1.00 40.04  ? 263 HOH A O   1 
HETATM 4168 O O   . HOH E 2 .   ? 10.525  3.554  -8.375  1.00 57.76  ? 264 HOH A O   1 
HETATM 4169 O O   . HOH E 2 .   ? 3.657   1.802  -25.506 1.00 55.64  ? 265 HOH A O   1 
HETATM 4170 O O   . HOH E 2 .   ? -9.335  31.447 -0.966  1.00 51.65  ? 266 HOH A O   1 
HETATM 4171 O O   . HOH E 2 .   ? 11.732  8.982  -1.919  1.00 45.10  ? 267 HOH A O   1 
HETATM 4172 O O   . HOH E 2 .   ? 3.922   14.871 -20.382 1.00 36.20  ? 268 HOH A O   1 
HETATM 4173 O O   . HOH E 2 .   ? -11.925 20.823 -25.970 1.00 56.48  ? 269 HOH A O   1 
HETATM 4174 O O   . HOH E 2 .   ? -7.316  4.988  -18.743 1.00 43.04  ? 270 HOH A O   1 
HETATM 4175 O O   . HOH F 2 .   ? -19.733 36.989 2.023   1.00 36.35  ? 201 HOH B O   1 
HETATM 4176 O O   . HOH F 2 .   ? -19.691 28.723 1.580   1.00 40.68  ? 202 HOH B O   1 
HETATM 4177 O O   . HOH F 2 .   ? 7.956   4.261  4.517   1.00 49.23  ? 203 HOH B O   1 
HETATM 4178 O O   . HOH F 2 .   ? -17.231 13.621 13.136  1.00 45.21  ? 204 HOH B O   1 
HETATM 4179 O O   . HOH F 2 .   ? 2.158   17.536 11.864  1.00 35.28  ? 205 HOH B O   1 
HETATM 4180 O O   . HOH F 2 .   ? -5.558  20.636 -1.238  1.00 35.27  ? 206 HOH B O   1 
HETATM 4181 O O   . HOH F 2 .   ? -6.957  11.820 -2.084  1.00 33.59  ? 207 HOH B O   1 
HETATM 4182 O O   . HOH F 2 .   ? -9.071  10.055 -2.315  1.00 45.39  ? 208 HOH B O   1 
HETATM 4183 O O   . HOH F 2 .   ? -16.962 27.135 7.149   1.00 29.91  ? 209 HOH B O   1 
HETATM 4184 O O   . HOH F 2 .   ? -3.687  25.356 11.255  1.00 35.88  ? 210 HOH B O   1 
HETATM 4185 O O   . HOH F 2 .   ? -8.637  13.396 -1.062  1.00 39.42  ? 211 HOH B O   1 
HETATM 4186 O O   . HOH F 2 .   ? 15.794  4.761  -2.412  1.00 50.98  ? 212 HOH B O   1 
HETATM 4187 O O   . HOH F 2 .   ? -12.188 11.226 2.514   1.00 40.70  ? 213 HOH B O   1 
HETATM 4188 O O   . HOH F 2 .   ? -20.339 27.264 6.072   1.00 46.05  ? 214 HOH B O   1 
HETATM 4189 O O   . HOH F 2 .   ? -6.643  29.887 7.579   1.00 29.11  ? 215 HOH B O   1 
HETATM 4190 O O   . HOH F 2 .   ? -8.524  18.220 -0.365  1.00 40.18  ? 216 HOH B O   1 
HETATM 4191 O O   . HOH F 2 .   ? -9.765  25.156 19.185  1.00 45.18  ? 217 HOH B O   1 
HETATM 4192 O O   . HOH F 2 .   ? -1.118  19.879 17.295  1.00 36.07  ? 218 HOH B O   1 
HETATM 4193 O O   . HOH F 2 .   ? -15.941 38.927 2.319   1.00 63.11  ? 219 HOH B O   1 
HETATM 4194 O O   . HOH F 2 .   ? -5.546  30.670 10.104  1.00 43.92  ? 220 HOH B O   1 
HETATM 4195 O O   . HOH F 2 .   ? 12.886  4.446  -3.794  1.00 44.56  ? 221 HOH B O   1 
HETATM 4196 O O   . HOH F 2 .   ? -3.732  32.803 10.501  1.00 41.47  ? 222 HOH B O   1 
HETATM 4197 O O   . HOH F 2 .   ? -4.334  35.566 11.562  1.00 47.84  ? 223 HOH B O   1 
HETATM 4198 O O   . HOH F 2 .   ? 4.913   5.099  7.397   1.00 37.66  ? 224 HOH B O   1 
HETATM 4199 O O   . HOH F 2 .   ? -7.790  20.378 23.705  1.00 45.40  ? 225 HOH B O   1 
HETATM 4200 O O   . HOH F 2 .   ? 3.540   16.141 20.255  1.00 41.77  ? 226 HOH B O   1 
HETATM 4201 O O   . HOH F 2 .   ? -6.449  23.660 4.355   1.00 33.41  ? 227 HOH B O   1 
HETATM 4202 O O   . HOH F 2 .   ? -10.581 4.584  3.287   1.00 51.57  ? 228 HOH B O   1 
HETATM 4203 O O   . HOH F 2 .   ? -2.603  18.683 -0.352  1.00 30.99  ? 229 HOH B O   1 
HETATM 4204 O O   . HOH F 2 .   ? 4.267   21.300 13.237  1.00 50.54  ? 230 HOH B O   1 
HETATM 4205 O O   . HOH F 2 .   ? -11.010 18.979 0.971   1.00 28.01  ? 231 HOH B O   1 
HETATM 4206 O O   . HOH F 2 .   ? -7.820  24.262 1.994   1.00 22.88  ? 232 HOH B O   1 
HETATM 4207 O O   . HOH F 2 .   ? -11.333 31.826 2.876   1.00 29.76  ? 233 HOH B O   1 
HETATM 4208 O O   . HOH F 2 .   ? 10.013  9.553  6.800   1.00 43.58  ? 234 HOH B O   1 
HETATM 4209 O O   . HOH F 2 .   ? -9.851  26.073 -0.939  1.00 29.28  ? 235 HOH B O   1 
HETATM 4210 O O   . HOH F 2 .   ? -4.278  6.379  -3.464  1.00 35.87  ? 236 HOH B O   1 
HETATM 4211 O O   . HOH F 2 .   ? 3.845   16.061 0.633   1.00 32.05  ? 237 HOH B O   1 
HETATM 4212 O O   . HOH F 2 .   ? 14.579  2.709  -3.613  1.00 58.08  ? 238 HOH B O   1 
HETATM 4213 O O   . HOH F 2 .   ? -16.988 29.300 16.289  1.00 50.24  ? 239 HOH B O   1 
HETATM 4214 O O   . HOH F 2 .   ? 1.347   16.684 -0.089  1.00 47.40  ? 240 HOH B O   1 
HETATM 4215 O O   . HOH F 2 .   ? -0.715  20.065 -0.332  1.00 48.37  ? 241 HOH B O   1 
HETATM 4216 O O   . HOH F 2 .   ? 18.337  1.484  5.837   1.00 51.81  ? 242 HOH B O   1 
HETATM 4217 O O   . HOH F 2 .   ? -13.708 19.879 0.392   1.00 40.59  ? 243 HOH B O   1 
HETATM 4218 O O   . HOH F 2 .   ? -14.884 27.000 17.522  1.00 48.88  ? 244 HOH B O   1 
HETATM 4219 O O   . HOH F 2 .   ? -1.050  26.164 2.929   1.00 52.62  ? 245 HOH B O   1 
HETATM 4220 O O   . HOH F 2 .   ? 9.983   1.635  3.438   1.00 40.01  ? 246 HOH B O   1 
HETATM 4221 O O   . HOH F 2 .   ? -2.789  15.506 22.328  1.00 45.96  ? 247 HOH B O   1 
HETATM 4222 O O   . HOH F 2 .   ? -8.668  41.516 8.000   1.00 52.22  ? 248 HOH B O   1 
HETATM 4223 O O   . HOH F 2 .   ? -20.958 26.775 3.267   1.00 45.05  ? 249 HOH B O   1 
HETATM 4224 O O   . HOH F 2 .   ? -4.287  23.994 21.310  1.00 53.75  ? 250 HOH B O   1 
HETATM 4225 O O   . HOH F 2 .   ? -11.534 10.416 16.705  1.00 43.77  ? 251 HOH B O   1 
HETATM 4226 O O   . HOH F 2 .   ? 7.781   11.052 8.842   1.00 34.11  ? 252 HOH B O   1 
HETATM 4227 O O   . HOH F 2 .   ? -10.562 34.563 1.715   1.00 47.98  ? 253 HOH B O   1 
HETATM 4228 O O   . HOH F 2 .   ? -2.757  4.238  -2.246  1.00 56.91  ? 254 HOH B O   1 
HETATM 4229 O O   . HOH F 2 .   ? 4.073   -2.790 9.614   1.00 52.81  ? 255 HOH B O   1 
HETATM 4230 O O   . HOH F 2 .   ? 4.347   1.252  13.512  1.00 46.64  ? 256 HOH B O   1 
HETATM 4231 O O   . HOH F 2 .   ? -7.017  39.760 2.863   1.00 46.10  ? 257 HOH B O   1 
HETATM 4232 O O   . HOH F 2 .   ? -4.171  13.052 20.147  1.00 50.61  ? 258 HOH B O   1 
HETATM 4233 O O   . HOH F 2 .   ? -26.763 21.985 16.282  1.00 57.66  ? 259 HOH B O   1 
HETATM 4234 O O   . HOH F 2 .   ? 0.449   27.421 5.526   1.00 47.79  ? 260 HOH B O   1 
HETATM 4235 O O   . HOH F 2 .   ? 0.101   23.024 1.454   1.00 56.74  ? 261 HOH B O   1 
HETATM 4236 O O   . HOH G 2 .   ? 13.692  22.889 19.650  1.00 41.15  ? 201 HOH C O   1 
HETATM 4237 O O   . HOH G 2 .   ? 21.714  27.621 22.995  1.00 35.37  ? 202 HOH C O   1 
HETATM 4238 O O   . HOH G 2 .   ? 5.345   30.024 15.903  1.00 32.50  ? 203 HOH C O   1 
HETATM 4239 O O   . HOH G 2 .   ? 23.112  28.509 9.907   1.00 35.38  ? 204 HOH C O   1 
HETATM 4240 O O   . HOH G 2 .   ? 1.676   34.051 19.326  1.00 31.45  ? 205 HOH C O   1 
HETATM 4241 O O   . HOH G 2 .   ? -2.993  50.686 11.025  1.00 41.02  ? 206 HOH C O   1 
HETATM 4242 O O   . HOH G 2 .   ? 23.048  27.656 5.689   1.00 32.91  ? 207 HOH C O   1 
HETATM 4243 O O   . HOH G 2 .   ? 26.463  19.223 11.239  1.00 58.57  ? 208 HOH C O   1 
HETATM 4244 O O   . HOH G 2 .   ? 15.430  44.367 5.462   1.00 34.20  ? 209 HOH C O   1 
HETATM 4245 O O   . HOH G 2 .   ? 9.182   25.550 9.134   1.00 34.79  ? 210 HOH C O   1 
HETATM 4246 O O   . HOH G 2 .   ? 14.273  19.476 8.551   1.00 43.23  ? 211 HOH C O   1 
HETATM 4247 O O   . HOH G 2 .   ? -0.702  37.300 13.270  1.00 45.90  ? 212 HOH C O   1 
HETATM 4248 O O   . HOH G 2 .   ? 14.560  39.152 25.735  1.00 36.77  ? 213 HOH C O   1 
HETATM 4249 O O   . HOH G 2 .   ? -1.177  49.956 16.826  1.00 45.45  ? 214 HOH C O   1 
HETATM 4250 O O   . HOH G 2 .   ? 8.101   37.647 27.093  1.00 50.00  ? 215 HOH C O   1 
HETATM 4251 O O   . HOH G 2 .   ? 23.441  19.275 3.951   1.00 42.01  ? 216 HOH C O   1 
HETATM 4252 O O   . HOH G 2 .   ? 18.530  40.552 19.210  1.00 31.35  ? 217 HOH C O   1 
HETATM 4253 O O   . HOH G 2 .   ? 15.042  45.108 8.242   1.00 38.60  ? 218 HOH C O   1 
HETATM 4254 O O   . HOH G 2 .   ? 5.887   29.414 12.566  1.00 48.61  ? 219 HOH C O   1 
HETATM 4255 O O   . HOH G 2 .   ? 6.268   19.314 11.333  1.00 39.66  ? 220 HOH C O   1 
HETATM 4256 O O   . HOH G 2 .   ? 19.294  17.633 3.373   1.00 36.62  ? 221 HOH C O   1 
HETATM 4257 O O   . HOH G 2 .   ? 14.810  24.871 4.925   1.00 29.69  ? 222 HOH C O   1 
HETATM 4258 O O   . HOH G 2 .   ? 9.418   28.525 5.052   1.00 47.91  ? 223 HOH C O   1 
HETATM 4259 O O   . HOH G 2 .   ? 14.403  37.527 4.872   1.00 32.52  ? 224 HOH C O   1 
HETATM 4260 O O   . HOH G 2 .   ? 10.898  29.972 3.130   1.00 37.00  ? 225 HOH C O   1 
HETATM 4261 O O   . HOH G 2 .   ? 2.476   33.080 16.907  1.00 33.90  ? 226 HOH C O   1 
HETATM 4262 O O   . HOH G 2 .   ? 19.287  42.239 17.621  1.00 47.10  ? 227 HOH C O   1 
HETATM 4263 O O   . HOH G 2 .   ? 7.727   24.854 11.333  1.00 39.90  ? 228 HOH C O   1 
HETATM 4264 O O   . HOH G 2 .   ? 27.033  31.959 21.808  1.00 40.01  ? 229 HOH C O   1 
HETATM 4265 O O   . HOH G 2 .   ? 10.931  45.355 2.289   1.00 42.06  ? 230 HOH C O   1 
HETATM 4266 O O   . HOH G 2 .   ? -7.700  32.236 16.600  1.00 46.24  ? 231 HOH C O   1 
HETATM 4267 O O   . HOH G 2 .   ? 27.513  15.296 21.608  1.00 55.14  ? 232 HOH C O   1 
HETATM 4268 O O   . HOH G 2 .   ? 6.269   26.109 7.799   1.00 56.11  ? 233 HOH C O   1 
HETATM 4269 O O   . HOH G 2 .   ? 3.493   36.630 1.889   1.00 49.47  ? 234 HOH C O   1 
HETATM 4270 O O   . HOH G 2 .   ? 1.224   31.529 4.935   1.00 55.20  ? 235 HOH C O   1 
HETATM 4271 O O   . HOH G 2 .   ? 13.459  41.845 1.871   1.00 41.51  ? 236 HOH C O   1 
HETATM 4272 O O   . HOH G 2 .   ? 11.818  44.291 21.054  1.00 38.88  ? 237 HOH C O   1 
HETATM 4273 O O   . HOH G 2 .   ? 13.130  43.850 3.874   1.00 32.24  ? 238 HOH C O   1 
HETATM 4274 O O   . HOH G 2 .   ? 12.188  51.575 9.600   1.00 32.36  ? 239 HOH C O   1 
HETATM 4275 O O   . HOH G 2 .   ? 11.437  32.443 4.345   1.00 31.61  ? 240 HOH C O   1 
HETATM 4276 O O   . HOH G 2 .   ? 9.423   32.413 6.437   1.00 29.18  ? 241 HOH C O   1 
HETATM 4277 O O   . HOH G 2 .   ? 12.390  38.575 3.213   1.00 31.85  ? 242 HOH C O   1 
HETATM 4278 O O   . HOH G 2 .   ? 10.144  28.705 20.942  1.00 25.85  ? 243 HOH C O   1 
HETATM 4279 O O   . HOH G 2 .   ? 2.196   31.676 10.746  1.00 24.12  ? 244 HOH C O   1 
HETATM 4280 O O   . HOH G 2 .   ? 18.305  44.358 16.303  1.00 43.81  ? 245 HOH C O   1 
HETATM 4281 O O   . HOH G 2 .   ? 19.226  28.830 10.565  1.00 35.86  ? 246 HOH C O   1 
HETATM 4282 O O   . HOH G 2 .   ? 13.429  46.017 19.194  1.00 41.17  ? 247 HOH C O   1 
HETATM 4283 O O   . HOH G 2 .   ? 20.436  39.634 21.471  1.00 45.51  ? 248 HOH C O   1 
HETATM 4284 O O   . HOH G 2 .   ? 28.775  11.220 13.527  1.00 53.31  ? 249 HOH C O   1 
HETATM 4285 O O   . HOH G 2 .   ? 15.202  26.937 20.359  1.00 29.63  ? 250 HOH C O   1 
HETATM 4286 O O   . HOH G 2 .   ? 7.825   30.066 23.250  1.00 32.86  ? 251 HOH C O   1 
HETATM 4287 O O   . HOH G 2 .   ? 5.348   37.674 27.186  1.00 50.32  ? 252 HOH C O   1 
HETATM 4288 O O   . HOH G 2 .   ? 17.118  25.557 20.015  1.00 41.97  ? 253 HOH C O   1 
HETATM 4289 O O   . HOH G 2 .   ? 17.660  14.381 2.090   1.00 54.61  ? 254 HOH C O   1 
HETATM 4290 O O   . HOH G 2 .   ? 16.278  13.059 6.235   1.00 43.23  ? 255 HOH C O   1 
HETATM 4291 O O   . HOH G 2 .   ? 14.218  12.293 4.342   1.00 56.54  ? 256 HOH C O   1 
HETATM 4292 O O   . HOH G 2 .   ? 9.768   49.493 12.910  1.00 39.51  ? 257 HOH C O   1 
HETATM 4293 O O   . HOH G 2 .   ? -0.934  30.289 4.138   1.00 56.27  ? 258 HOH C O   1 
HETATM 4294 O O   . HOH G 2 .   ? 16.747  41.755 8.174   1.00 49.22  ? 259 HOH C O   1 
HETATM 4295 O O   . HOH G 2 .   ? 6.059   38.042 1.910   1.00 36.94  ? 260 HOH C O   1 
HETATM 4296 O O   . HOH G 2 .   ? 17.554  15.494 19.080  1.00 52.62  ? 261 HOH C O   1 
HETATM 4297 O O   . HOH G 2 .   ? -3.569  36.727 14.074  1.00 47.58  ? 262 HOH C O   1 
HETATM 4298 O O   . HOH G 2 .   ? 9.752   42.412 26.117  1.00 46.95  ? 263 HOH C O   1 
HETATM 4299 O O   . HOH G 2 .   ? 13.761  31.274 1.808   1.00 41.94  ? 264 HOH C O   1 
HETATM 4300 O O   . HOH G 2 .   ? -12.595 42.869 7.130   1.00 49.47  ? 265 HOH C O   1 
HETATM 4301 O O   . HOH G 2 .   ? 17.179  11.850 8.890   1.00 43.60  ? 266 HOH C O   1 
HETATM 4302 O O   . HOH G 2 .   ? -2.082  37.630 3.402   1.00 45.50  ? 267 HOH C O   1 
HETATM 4303 O O   . HOH G 2 .   ? 7.063   53.171 4.466   1.00 57.72  ? 268 HOH C O   1 
HETATM 4304 O O   . HOH G 2 .   ? 8.306   27.441 23.481  1.00 51.66  ? 269 HOH C O   1 
HETATM 4305 O O   . HOH G 2 .   ? 25.614  37.804 18.804  1.00 49.72  ? 270 HOH C O   1 
HETATM 4306 O O   . HOH G 2 .   ? 11.395  32.660 0.416   1.00 35.85  ? 271 HOH C O   1 
HETATM 4307 O O   . HOH H 2 .   ? 16.950  47.985 -13.148 1.00 45.49  ? 201 HOH D O   1 
HETATM 4308 O O   . HOH H 2 .   ? 1.737   50.281 -1.614  1.00 40.06  ? 202 HOH D O   1 
HETATM 4309 O O   . HOH H 2 .   ? -1.170  41.987 -2.839  1.00 34.04  ? 203 HOH D O   1 
HETATM 4310 O O   . HOH H 2 .   ? 14.696  26.699 -0.526  1.00 33.90  ? 204 HOH D O   1 
HETATM 4311 O O   . HOH H 2 .   ? 26.321  22.534 -4.438  1.00 49.37  ? 205 HOH D O   1 
HETATM 4312 O O   . HOH H 2 .   ? 0.647   37.404 -7.543  1.00 31.60  ? 206 HOH D O   1 
HETATM 4313 O O   . HOH H 2 .   ? 20.453  39.737 2.413   1.00 45.21  ? 207 HOH D O   1 
HETATM 4314 O O   . HOH H 2 .   ? 9.567   36.237 1.247   1.00 40.22  ? 208 HOH D O   1 
HETATM 4315 O O   . HOH H 2 .   ? 19.495  22.872 -9.039  1.00 39.90  ? 209 HOH D O   1 
HETATM 4316 O O   . HOH H 2 .   ? 5.149   34.251 -11.193 1.00 36.11  ? 210 HOH D O   1 
HETATM 4317 O O   . HOH H 2 .   ? 3.350   51.088 -6.039  1.00 47.54  ? 211 HOH D O   1 
HETATM 4318 O O   . HOH H 2 .   ? 11.619  41.635 -0.987  1.00 31.01  ? 212 HOH D O   1 
HETATM 4319 O O   . HOH H 2 .   ? 5.429   40.302 -19.116 1.00 44.78  ? 213 HOH D O   1 
HETATM 4320 O O   . HOH H 2 .   ? 10.187  38.357 -23.633 1.00 42.63  ? 214 HOH D O   1 
HETATM 4321 O O   . HOH H 2 .   ? -1.593  38.404 -16.483 1.00 44.50  ? 215 HOH D O   1 
HETATM 4322 O O   . HOH H 2 .   ? 21.023  20.658 -6.887  1.00 50.52  ? 216 HOH D O   1 
HETATM 4323 O O   . HOH H 2 .   ? -0.011  36.321 -10.083 1.00 43.54  ? 217 HOH D O   1 
HETATM 4324 O O   . HOH H 2 .   ? -4.715  34.687 -11.477 1.00 43.02  ? 218 HOH D O   1 
HETATM 4325 O O   . HOH H 2 .   ? -2.050  34.632 -10.252 1.00 39.51  ? 219 HOH D O   1 
HETATM 4326 O O   . HOH H 2 .   ? 18.798  37.590 2.075   1.00 32.74  ? 220 HOH D O   1 
HETATM 4327 O O   . HOH H 2 .   ? 6.331   38.368 -2.013  1.00 24.10  ? 221 HOH D O   1 
HETATM 4328 O O   . HOH H 2 .   ? -9.296  37.420 -2.983  1.00 45.47  ? 222 HOH D O   1 
HETATM 4329 O O   . HOH H 2 .   ? 26.010  40.708 -3.112  1.00 57.72  ? 223 HOH D O   1 
HETATM 4330 O O   . HOH H 2 .   ? 9.412   26.137 -13.239 1.00 52.05  ? 224 HOH D O   1 
HETATM 4331 O O   . HOH H 2 .   ? 7.026   31.001 -9.565  1.00 44.02  ? 225 HOH D O   1 
HETATM 4332 O O   . HOH H 2 .   ? 12.379  39.122 0.437   1.00 40.53  ? 226 HOH D O   1 
HETATM 4333 O O   . HOH H 2 .   ? 6.516   34.943 -21.354 1.00 53.25  ? 227 HOH D O   1 
HETATM 4334 O O   . HOH H 2 .   ? 7.002   37.089 -4.336  1.00 35.53  ? 228 HOH D O   1 
HETATM 4335 O O   . HOH H 2 .   ? 3.558   47.618 -7.070  1.00 28.45  ? 229 HOH D O   1 
HETATM 4336 O O   . HOH H 2 .   ? 28.879  20.798 -3.504  1.00 41.20  ? 230 HOH D O   1 
HETATM 4337 O O   . HOH H 2 .   ? 24.329  34.722 3.597   1.00 34.72  ? 231 HOH D O   1 
HETATM 4338 O O   . HOH H 2 .   ? 17.015  38.973 1.119   1.00 39.82  ? 232 HOH D O   1 
HETATM 4339 O O   . HOH H 2 .   ? 10.545  44.053 -0.199  1.00 42.76  ? 233 HOH D O   1 
HETATM 4340 O O   . HOH H 2 .   ? 1.259   47.662 -16.336 1.00 49.24  ? 234 HOH D O   1 
HETATM 4341 O O   . HOH H 2 .   ? -10.771 39.273 -7.794  1.00 49.60  ? 235 HOH D O   1 
HETATM 4342 O O   . HOH H 2 .   ? 4.354   30.864 -8.646  1.00 37.33  ? 236 HOH D O   1 
HETATM 4343 O O   . HOH H 2 .   ? 21.399  22.069 -12.180 1.00 45.38  ? 237 HOH D O   1 
HETATM 4344 O O   . HOH H 2 .   ? 13.068  28.595 -11.853 1.00 37.36  ? 238 HOH D O   1 
HETATM 4345 O O   . HOH H 2 .   ? 19.324  42.635 -2.584  1.00 38.13  ? 239 HOH D O   1 
HETATM 4346 O O   . HOH H 2 .   ? 15.074  33.339 -22.218 1.00 41.95  ? 240 HOH D O   1 
HETATM 4347 O O   . HOH H 2 .   ? 14.552  26.990 -20.133 1.00 40.20  ? 241 HOH D O   1 
HETATM 4348 O O   . HOH H 2 .   ? 6.317   39.001 -21.259 1.00 56.89  ? 242 HOH D O   1 
HETATM 4349 O O   . HOH H 2 .   ? -6.415  50.169 -2.032  1.00 39.93  ? 243 HOH D O   1 
HETATM 4350 O O   . HOH H 2 .   ? 26.089  17.736 3.906   1.00 46.72  ? 244 HOH D O   1 
HETATM 4351 O O   . HOH H 2 .   ? 7.727   30.205 -1.262  1.00 51.85  ? 245 HOH D O   1 
HETATM 4352 O O   . HOH H 2 .   ? 27.993  16.233 3.283   1.00 57.77  ? 246 HOH D O   1 
HETATM 4353 O O   . HOH H 2 .   ? 25.826  14.421 2.401   1.00 52.44  ? 247 HOH D O   1 
HETATM 4354 O O   . HOH H 2 .   ? 19.255  20.747 -12.130 1.00 43.22  ? 248 HOH D O   1 
HETATM 4355 O O   . HOH H 2 .   ? 4.049   31.938 -3.048  1.00 50.88  ? 249 HOH D O   1 
HETATM 4356 O O   . HOH H 2 .   ? 16.200  31.290 -25.686 1.00 50.35  ? 250 HOH D O   1 
HETATM 4357 O O   . HOH H 2 .   ? 18.390  32.867 -26.123 1.00 55.76  ? 251 HOH D O   1 
HETATM 4358 O O   . HOH H 2 .   ? 4.282   40.363 1.015   1.00 31.66  ? 252 HOH D O   1 
HETATM 4359 O O   . HOH H 2 .   ? 12.908  25.481 -13.229 1.00 42.92  ? 253 HOH D O   1 
HETATM 4360 O O   . HOH H 2 .   ? 13.917  29.116 0.226   1.00 39.82  ? 254 HOH D O   1 
HETATM 4361 O O   . HOH H 2 .   ? 29.291  12.335 -6.225  1.00 48.84  ? 255 HOH D O   1 
HETATM 4362 O O   . HOH H 2 .   ? -4.093  40.955 -1.783  1.00 47.00  ? 256 HOH D O   1 
HETATM 4363 O O   . HOH H 2 .   ? 14.686  54.587 -12.030 1.00 54.08  ? 257 HOH D O   1 
HETATM 4364 O O   . HOH H 2 .   ? 10.758  31.602 -17.314 1.00 34.72  ? 258 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   19  19  ALA ALA A . n 
A 1 2   TYR 2   20  20  TYR TYR A . n 
A 1 3   VAL 3   21  21  VAL VAL A . n 
A 1 4   CYS 4   22  22  CYS CYS A . n 
A 1 5   ARG 5   23  23  ARG ARG A . n 
A 1 6   GLU 6   24  24  GLU GLU A . n 
A 1 7   ALA 7   25  25  ALA ALA A . n 
A 1 8   SER 8   26  26  SER SER A . n 
A 1 9   ILE 9   27  27  ILE ILE A . n 
A 1 10  SER 10  28  28  SER SER A . n 
A 1 11  GLY 11  29  29  GLY GLY A . n 
A 1 12  GLU 12  30  30  GLU GLU A . n 
A 1 13  ILE 13  31  31  ILE ILE A . n 
A 1 14  ARG 14  32  32  ARG ARG A . n 
A 1 15  TYR 15  33  33  TYR TYR A . n 
A 1 16  PRO 16  34  34  PRO PRO A . n 
A 1 17  GLN 17  35  35  GLN GLN A . n 
A 1 18  GLY 18  36  36  GLY GLY A . n 
A 1 19  THR 19  37  37  THR THR A . n 
A 1 20  CYS 20  38  38  CYS CYS A . n 
A 1 21  PRO 21  39  39  PRO PRO A . n 
A 1 22  THR 22  40  40  THR THR A . n 
A 1 23  LYS 23  41  41  LYS LYS A . n 
A 1 24  THR 24  42  42  THR THR A . n 
A 1 25  GLU 25  43  43  GLU GLU A . n 
A 1 26  ALA 26  44  44  ALA ALA A . n 
A 1 27  LEU 27  45  45  LEU LEU A . n 
A 1 28  ASN 28  46  46  ASN ASN A . n 
A 1 29  ASP 29  47  47  ASP ASP A . n 
A 1 30  CYS 30  48  48  CYS CYS A . n 
A 1 31  ASN 31  49  49  ASN ASN A . n 
A 1 32  LYS 32  50  50  LYS LYS A . n 
A 1 33  VAL 33  51  51  VAL VAL A . n 
A 1 34  THR 34  52  52  THR THR A . n 
A 1 35  LYS 35  53  53  LYS LYS A . n 
A 1 36  GLY 36  54  54  GLY GLY A . n 
A 1 37  LEU 37  55  55  LEU LEU A . n 
A 1 38  ILE 38  56  56  ILE ILE A . n 
A 1 39  ASP 39  57  57  ASP ASP A . n 
A 1 40  PHE 40  58  58  PHE PHE A . n 
A 1 41  SER 41  59  59  SER SER A . n 
A 1 42  GLN 42  60  60  GLN GLN A . n 
A 1 43  SER 43  61  61  SER SER A . n 
A 1 44  HIS 44  62  62  HIS HIS A . n 
A 1 45  GLN 45  63  63  GLN GLN A . n 
A 1 46  ARG 46  64  64  ARG ARG A . n 
A 1 47  ALA 47  65  65  ALA ALA A . n 
A 1 48  TRP 48  66  66  TRP TRP A . n 
A 1 49  GLY 49  67  67  GLY GLY A . n 
A 1 50  ILE 50  68  68  ILE ILE A . n 
A 1 51  ASP 51  69  69  ASP ASP A . n 
A 1 52  MET 52  70  70  MET MET A . n 
A 1 53  THR 53  71  71  THR THR A . n 
A 1 54  ALA 54  72  72  ALA ALA A . n 
A 1 55  LYS 55  73  73  LYS LYS A . n 
A 1 56  VAL 56  74  74  VAL VAL A . n 
A 1 57  GLN 57  75  75  GLN GLN A . n 
A 1 58  CYS 58  76  76  CYS CYS A . n 
A 1 59  ALA 59  77  77  ALA ALA A . n 
A 1 60  PRO 60  78  78  PRO PRO A . n 
A 1 61  CYS 61  79  79  CYS CYS A . n 
A 1 62  LYS 62  80  80  LYS LYS A . n 
A 1 63  THR 63  81  81  THR THR A . n 
A 1 64  THR 64  82  82  THR THR A . n 
A 1 65  ASP 65  83  83  ASP ASP A . n 
A 1 66  PRO 66  84  84  PRO PRO A . n 
A 1 67  TRP 67  85  85  TRP TRP A . n 
A 1 68  ASP 68  86  86  ASP ASP A . n 
A 1 69  VAL 69  87  87  VAL VAL A . n 
A 1 70  VAL 70  88  88  VAL VAL A . n 
A 1 71  LEU 71  89  89  LEU LEU A . n 
A 1 72  CYS 72  90  90  CYS CYS A . n 
A 1 73  THR 73  91  91  THR THR A . n 
A 1 74  CYS 74  92  92  CYS CYS A . n 
A 1 75  LYS 75  93  93  LYS LYS A . n 
A 1 76  ILE 76  94  94  ILE ILE A . n 
A 1 77  THR 77  95  95  THR THR A . n 
A 1 78  ALA 78  96  96  ALA ALA A . n 
A 1 79  HIS 79  97  97  HIS HIS A . n 
A 1 80  ARG 80  98  98  ARG ARG A . n 
A 1 81  TYR 81  99  99  TYR TYR A . n 
A 1 82  ARG 82  100 100 ARG ARG A . n 
A 1 83  GLU 83  101 101 GLU GLU A . n 
A 1 84  PHE 84  102 102 PHE PHE A . n 
A 1 85  VAL 85  103 103 VAL VAL A . n 
A 1 86  PRO 86  104 104 PRO PRO A . n 
A 1 87  LYS 87  105 105 LYS LYS A . n 
A 1 88  ILE 88  106 106 ILE ILE A . n 
A 1 89  PRO 89  107 107 PRO PRO A . n 
A 1 90  TYR 90  108 108 TYR TYR A . n 
A 1 91  SER 91  109 109 SER SER A . n 
A 1 92  SER 92  110 110 SER SER A . n 
A 1 93  PHE 93  111 111 PHE PHE A . n 
A 1 94  SER 94  112 112 SER SER A . n 
A 1 95  SER 95  113 113 SER SER A . n 
A 1 96  ALA 96  114 114 ALA ALA A . n 
A 1 97  PRO 97  115 115 PRO PRO A . n 
A 1 98  GLY 98  116 116 GLY GLY A . n 
A 1 99  VAL 99  117 117 VAL VAL A . n 
A 1 100 ILE 100 118 118 ILE ILE A . n 
A 1 101 PHE 101 119 119 PHE PHE A . n 
A 1 102 ARG 102 120 120 ARG ARG A . n 
A 1 103 GLN 103 121 121 GLN GLN A . n 
A 1 104 GLU 104 122 122 GLU GLU A . n 
A 1 105 THR 105 123 123 THR THR A . n 
A 1 106 GLY 106 124 124 GLY GLY A . n 
A 1 107 LEU 107 125 125 LEU LEU A . n 
A 1 108 ASP 108 126 126 ASP ASP A . n 
A 1 109 HIS 109 127 127 HIS HIS A . n 
A 1 110 ASP 110 128 128 ASP ASP A . n 
A 1 111 PRO 111 129 129 PRO PRO A . n 
A 1 112 GLU 112 130 130 GLU GLU A . n 
A 1 113 TRP 113 131 131 TRP TRP A . n 
A 1 114 VAL 114 132 132 VAL VAL A . n 
A 1 115 VAL 115 133 133 VAL VAL A . n 
A 1 116 ASN 116 134 134 ASN ASN A . n 
A 1 117 MET 117 135 135 MET MET A . n 
A 1 118 LYS 118 136 136 LYS LYS A . n 
A 1 119 ALA 119 137 137 ALA ALA A . n 
A 1 120 ARG 120 138 138 ARG ARG A . n 
A 1 121 THR 121 139 139 THR THR A . n 
A 1 122 ARG 122 140 140 ARG ARG A . n 
A 1 123 GLY 123 141 141 GLY GLY A . n 
A 1 124 CYS 124 142 142 CYS CYS A . n 
A 1 125 ASP 125 143 143 ASP ASP A . n 
A 1 126 HIS 126 144 144 HIS HIS A . n 
A 1 127 HIS 127 145 145 HIS HIS A . n 
A 1 128 HIS 128 146 146 HIS HIS A . n 
A 1 129 HIS 129 147 147 HIS HIS A . n 
A 1 130 HIS 130 148 148 HIS HIS A . n 
A 1 131 HIS 131 149 ?   ?   ?   A . n 
B 1 1   ALA 1   19  ?   ?   ?   B . n 
B 1 2   TYR 2   20  ?   ?   ?   B . n 
B 1 3   VAL 3   21  21  VAL VAL B . n 
B 1 4   CYS 4   22  22  CYS CYS B . n 
B 1 5   ARG 5   23  23  ARG ARG B . n 
B 1 6   GLU 6   24  24  GLU GLU B . n 
B 1 7   ALA 7   25  25  ALA ALA B . n 
B 1 8   SER 8   26  26  SER SER B . n 
B 1 9   ILE 9   27  27  ILE ILE B . n 
B 1 10  SER 10  28  28  SER SER B . n 
B 1 11  GLY 11  29  29  GLY GLY B . n 
B 1 12  GLU 12  30  30  GLU GLU B . n 
B 1 13  ILE 13  31  31  ILE ILE B . n 
B 1 14  ARG 14  32  32  ARG ARG B . n 
B 1 15  TYR 15  33  33  TYR TYR B . n 
B 1 16  PRO 16  34  34  PRO PRO B . n 
B 1 17  GLN 17  35  35  GLN GLN B . n 
B 1 18  GLY 18  36  36  GLY GLY B . n 
B 1 19  THR 19  37  37  THR THR B . n 
B 1 20  CYS 20  38  38  CYS CYS B . n 
B 1 21  PRO 21  39  39  PRO PRO B . n 
B 1 22  THR 22  40  40  THR THR B . n 
B 1 23  LYS 23  41  41  LYS LYS B . n 
B 1 24  THR 24  42  42  THR THR B . n 
B 1 25  GLU 25  43  43  GLU GLU B . n 
B 1 26  ALA 26  44  44  ALA ALA B . n 
B 1 27  LEU 27  45  45  LEU LEU B . n 
B 1 28  ASN 28  46  46  ASN ASN B . n 
B 1 29  ASP 29  47  47  ASP ASP B . n 
B 1 30  CYS 30  48  48  CYS CYS B . n 
B 1 31  ASN 31  49  49  ASN ASN B . n 
B 1 32  LYS 32  50  50  LYS LYS B . n 
B 1 33  VAL 33  51  51  VAL VAL B . n 
B 1 34  THR 34  52  52  THR THR B . n 
B 1 35  LYS 35  53  53  LYS LYS B . n 
B 1 36  GLY 36  54  54  GLY GLY B . n 
B 1 37  LEU 37  55  55  LEU LEU B . n 
B 1 38  ILE 38  56  56  ILE ILE B . n 
B 1 39  ASP 39  57  57  ASP ASP B . n 
B 1 40  PHE 40  58  58  PHE PHE B . n 
B 1 41  SER 41  59  59  SER SER B . n 
B 1 42  GLN 42  60  60  GLN GLN B . n 
B 1 43  SER 43  61  61  SER SER B . n 
B 1 44  HIS 44  62  62  HIS HIS B . n 
B 1 45  GLN 45  63  63  GLN GLN B . n 
B 1 46  ARG 46  64  64  ARG ARG B . n 
B 1 47  ALA 47  65  65  ALA ALA B . n 
B 1 48  TRP 48  66  66  TRP TRP B . n 
B 1 49  GLY 49  67  67  GLY GLY B . n 
B 1 50  ILE 50  68  68  ILE ILE B . n 
B 1 51  ASP 51  69  69  ASP ASP B . n 
B 1 52  MET 52  70  70  MET MET B . n 
B 1 53  THR 53  71  71  THR THR B . n 
B 1 54  ALA 54  72  72  ALA ALA B . n 
B 1 55  LYS 55  73  73  LYS LYS B . n 
B 1 56  VAL 56  74  74  VAL VAL B . n 
B 1 57  GLN 57  75  75  GLN GLN B . n 
B 1 58  CYS 58  76  76  CYS CYS B . n 
B 1 59  ALA 59  77  77  ALA ALA B . n 
B 1 60  PRO 60  78  78  PRO PRO B . n 
B 1 61  CYS 61  79  79  CYS CYS B . n 
B 1 62  LYS 62  80  80  LYS LYS B . n 
B 1 63  THR 63  81  81  THR THR B . n 
B 1 64  THR 64  82  82  THR THR B . n 
B 1 65  ASP 65  83  83  ASP ASP B . n 
B 1 66  PRO 66  84  84  PRO PRO B . n 
B 1 67  TRP 67  85  85  TRP TRP B . n 
B 1 68  ASP 68  86  86  ASP ASP B . n 
B 1 69  VAL 69  87  87  VAL VAL B . n 
B 1 70  VAL 70  88  88  VAL VAL B . n 
B 1 71  LEU 71  89  89  LEU LEU B . n 
B 1 72  CYS 72  90  90  CYS CYS B . n 
B 1 73  THR 73  91  91  THR THR B . n 
B 1 74  CYS 74  92  92  CYS CYS B . n 
B 1 75  LYS 75  93  93  LYS LYS B . n 
B 1 76  ILE 76  94  94  ILE ILE B . n 
B 1 77  THR 77  95  95  THR THR B . n 
B 1 78  ALA 78  96  96  ALA ALA B . n 
B 1 79  HIS 79  97  97  HIS HIS B . n 
B 1 80  ARG 80  98  98  ARG ARG B . n 
B 1 81  TYR 81  99  99  TYR TYR B . n 
B 1 82  ARG 82  100 100 ARG ARG B . n 
B 1 83  GLU 83  101 101 GLU GLU B . n 
B 1 84  PHE 84  102 102 PHE PHE B . n 
B 1 85  VAL 85  103 103 VAL VAL B . n 
B 1 86  PRO 86  104 104 PRO PRO B . n 
B 1 87  LYS 87  105 105 LYS LYS B . n 
B 1 88  ILE 88  106 106 ILE ILE B . n 
B 1 89  PRO 89  107 107 PRO PRO B . n 
B 1 90  TYR 90  108 108 TYR TYR B . n 
B 1 91  SER 91  109 109 SER SER B . n 
B 1 92  SER 92  110 110 SER SER B . n 
B 1 93  PHE 93  111 111 PHE PHE B . n 
B 1 94  SER 94  112 112 SER SER B . n 
B 1 95  SER 95  113 113 SER SER B . n 
B 1 96  ALA 96  114 114 ALA ALA B . n 
B 1 97  PRO 97  115 115 PRO PRO B . n 
B 1 98  GLY 98  116 116 GLY GLY B . n 
B 1 99  VAL 99  117 117 VAL VAL B . n 
B 1 100 ILE 100 118 118 ILE ILE B . n 
B 1 101 PHE 101 119 119 PHE PHE B . n 
B 1 102 ARG 102 120 120 ARG ARG B . n 
B 1 103 GLN 103 121 121 GLN GLN B . n 
B 1 104 GLU 104 122 122 GLU GLU B . n 
B 1 105 THR 105 123 123 THR THR B . n 
B 1 106 GLY 106 124 124 GLY GLY B . n 
B 1 107 LEU 107 125 125 LEU LEU B . n 
B 1 108 ASP 108 126 126 ASP ASP B . n 
B 1 109 HIS 109 127 127 HIS HIS B . n 
B 1 110 ASP 110 128 128 ASP ASP B . n 
B 1 111 PRO 111 129 129 PRO PRO B . n 
B 1 112 GLU 112 130 130 GLU GLU B . n 
B 1 113 TRP 113 131 131 TRP TRP B . n 
B 1 114 VAL 114 132 132 VAL VAL B . n 
B 1 115 VAL 115 133 133 VAL VAL B . n 
B 1 116 ASN 116 134 134 ASN ASN B . n 
B 1 117 MET 117 135 135 MET MET B . n 
B 1 118 LYS 118 136 136 LYS LYS B . n 
B 1 119 ALA 119 137 137 ALA ALA B . n 
B 1 120 ARG 120 138 138 ARG ARG B . n 
B 1 121 THR 121 139 139 THR THR B . n 
B 1 122 ARG 122 140 140 ARG ARG B . n 
B 1 123 GLY 123 141 141 GLY GLY B . n 
B 1 124 CYS 124 142 142 CYS CYS B . n 
B 1 125 ASP 125 143 143 ASP ASP B . n 
B 1 126 HIS 126 144 144 HIS HIS B . n 
B 1 127 HIS 127 145 145 HIS HIS B . n 
B 1 128 HIS 128 146 146 HIS HIS B . n 
B 1 129 HIS 129 147 147 HIS HIS B . n 
B 1 130 HIS 130 148 148 HIS HIS B . n 
B 1 131 HIS 131 149 ?   ?   ?   B . n 
C 1 1   ALA 1   19  19  ALA ALA C . n 
C 1 2   TYR 2   20  20  TYR TYR C . n 
C 1 3   VAL 3   21  21  VAL VAL C . n 
C 1 4   CYS 4   22  22  CYS CYS C . n 
C 1 5   ARG 5   23  23  ARG ARG C . n 
C 1 6   GLU 6   24  24  GLU GLU C . n 
C 1 7   ALA 7   25  25  ALA ALA C . n 
C 1 8   SER 8   26  26  SER SER C . n 
C 1 9   ILE 9   27  27  ILE ILE C . n 
C 1 10  SER 10  28  28  SER SER C . n 
C 1 11  GLY 11  29  29  GLY GLY C . n 
C 1 12  GLU 12  30  30  GLU GLU C . n 
C 1 13  ILE 13  31  31  ILE ILE C . n 
C 1 14  ARG 14  32  32  ARG ARG C . n 
C 1 15  TYR 15  33  33  TYR TYR C . n 
C 1 16  PRO 16  34  34  PRO PRO C . n 
C 1 17  GLN 17  35  35  GLN GLN C . n 
C 1 18  GLY 18  36  36  GLY GLY C . n 
C 1 19  THR 19  37  37  THR THR C . n 
C 1 20  CYS 20  38  38  CYS CYS C . n 
C 1 21  PRO 21  39  39  PRO PRO C . n 
C 1 22  THR 22  40  40  THR THR C . n 
C 1 23  LYS 23  41  41  LYS LYS C . n 
C 1 24  THR 24  42  42  THR THR C . n 
C 1 25  GLU 25  43  43  GLU GLU C . n 
C 1 26  ALA 26  44  44  ALA ALA C . n 
C 1 27  LEU 27  45  45  LEU LEU C . n 
C 1 28  ASN 28  46  46  ASN ASN C . n 
C 1 29  ASP 29  47  47  ASP ASP C . n 
C 1 30  CYS 30  48  48  CYS CYS C . n 
C 1 31  ASN 31  49  49  ASN ASN C . n 
C 1 32  LYS 32  50  50  LYS LYS C . n 
C 1 33  VAL 33  51  51  VAL VAL C . n 
C 1 34  THR 34  52  52  THR THR C . n 
C 1 35  LYS 35  53  53  LYS LYS C . n 
C 1 36  GLY 36  54  54  GLY GLY C . n 
C 1 37  LEU 37  55  55  LEU LEU C . n 
C 1 38  ILE 38  56  56  ILE ILE C . n 
C 1 39  ASP 39  57  57  ASP ASP C . n 
C 1 40  PHE 40  58  58  PHE PHE C . n 
C 1 41  SER 41  59  59  SER SER C . n 
C 1 42  GLN 42  60  60  GLN GLN C . n 
C 1 43  SER 43  61  61  SER SER C . n 
C 1 44  HIS 44  62  62  HIS HIS C . n 
C 1 45  GLN 45  63  63  GLN GLN C . n 
C 1 46  ARG 46  64  64  ARG ARG C . n 
C 1 47  ALA 47  65  65  ALA ALA C . n 
C 1 48  TRP 48  66  66  TRP TRP C . n 
C 1 49  GLY 49  67  67  GLY GLY C . n 
C 1 50  ILE 50  68  68  ILE ILE C . n 
C 1 51  ASP 51  69  69  ASP ASP C . n 
C 1 52  MET 52  70  70  MET MET C . n 
C 1 53  THR 53  71  71  THR THR C . n 
C 1 54  ALA 54  72  72  ALA ALA C . n 
C 1 55  LYS 55  73  73  LYS LYS C . n 
C 1 56  VAL 56  74  74  VAL VAL C . n 
C 1 57  GLN 57  75  75  GLN GLN C . n 
C 1 58  CYS 58  76  76  CYS CYS C . n 
C 1 59  ALA 59  77  77  ALA ALA C . n 
C 1 60  PRO 60  78  78  PRO PRO C . n 
C 1 61  CYS 61  79  79  CYS CYS C . n 
C 1 62  LYS 62  80  80  LYS LYS C . n 
C 1 63  THR 63  81  81  THR THR C . n 
C 1 64  THR 64  82  82  THR THR C . n 
C 1 65  ASP 65  83  83  ASP ASP C . n 
C 1 66  PRO 66  84  84  PRO PRO C . n 
C 1 67  TRP 67  85  85  TRP TRP C . n 
C 1 68  ASP 68  86  86  ASP ASP C . n 
C 1 69  VAL 69  87  87  VAL VAL C . n 
C 1 70  VAL 70  88  88  VAL VAL C . n 
C 1 71  LEU 71  89  89  LEU LEU C . n 
C 1 72  CYS 72  90  90  CYS CYS C . n 
C 1 73  THR 73  91  91  THR THR C . n 
C 1 74  CYS 74  92  92  CYS CYS C . n 
C 1 75  LYS 75  93  93  LYS LYS C . n 
C 1 76  ILE 76  94  94  ILE ILE C . n 
C 1 77  THR 77  95  95  THR THR C . n 
C 1 78  ALA 78  96  96  ALA ALA C . n 
C 1 79  HIS 79  97  97  HIS HIS C . n 
C 1 80  ARG 80  98  98  ARG ARG C . n 
C 1 81  TYR 81  99  99  TYR TYR C . n 
C 1 82  ARG 82  100 100 ARG ARG C . n 
C 1 83  GLU 83  101 101 GLU GLU C . n 
C 1 84  PHE 84  102 102 PHE PHE C . n 
C 1 85  VAL 85  103 103 VAL VAL C . n 
C 1 86  PRO 86  104 104 PRO PRO C . n 
C 1 87  LYS 87  105 105 LYS LYS C . n 
C 1 88  ILE 88  106 106 ILE ILE C . n 
C 1 89  PRO 89  107 107 PRO PRO C . n 
C 1 90  TYR 90  108 108 TYR TYR C . n 
C 1 91  SER 91  109 109 SER SER C . n 
C 1 92  SER 92  110 110 SER SER C . n 
C 1 93  PHE 93  111 111 PHE PHE C . n 
C 1 94  SER 94  112 112 SER SER C . n 
C 1 95  SER 95  113 113 SER SER C . n 
C 1 96  ALA 96  114 114 ALA ALA C . n 
C 1 97  PRO 97  115 115 PRO PRO C . n 
C 1 98  GLY 98  116 116 GLY GLY C . n 
C 1 99  VAL 99  117 117 VAL VAL C . n 
C 1 100 ILE 100 118 118 ILE ILE C . n 
C 1 101 PHE 101 119 119 PHE PHE C . n 
C 1 102 ARG 102 120 120 ARG ARG C . n 
C 1 103 GLN 103 121 121 GLN GLN C . n 
C 1 104 GLU 104 122 122 GLU GLU C . n 
C 1 105 THR 105 123 123 THR THR C . n 
C 1 106 GLY 106 124 124 GLY GLY C . n 
C 1 107 LEU 107 125 125 LEU LEU C . n 
C 1 108 ASP 108 126 126 ASP ASP C . n 
C 1 109 HIS 109 127 127 HIS HIS C . n 
C 1 110 ASP 110 128 128 ASP ASP C . n 
C 1 111 PRO 111 129 129 PRO PRO C . n 
C 1 112 GLU 112 130 130 GLU GLU C . n 
C 1 113 TRP 113 131 131 TRP TRP C . n 
C 1 114 VAL 114 132 132 VAL VAL C . n 
C 1 115 VAL 115 133 133 VAL VAL C . n 
C 1 116 ASN 116 134 134 ASN ASN C . n 
C 1 117 MET 117 135 135 MET MET C . n 
C 1 118 LYS 118 136 136 LYS LYS C . n 
C 1 119 ALA 119 137 137 ALA ALA C . n 
C 1 120 ARG 120 138 138 ARG ARG C . n 
C 1 121 THR 121 139 139 THR THR C . n 
C 1 122 ARG 122 140 140 ARG ARG C . n 
C 1 123 GLY 123 141 141 GLY GLY C . n 
C 1 124 CYS 124 142 142 CYS CYS C . n 
C 1 125 ASP 125 143 143 ASP ASP C . n 
C 1 126 HIS 126 144 144 HIS HIS C . n 
C 1 127 HIS 127 145 145 HIS HIS C . n 
C 1 128 HIS 128 146 146 HIS HIS C . n 
C 1 129 HIS 129 147 147 HIS HIS C . n 
C 1 130 HIS 130 148 148 HIS HIS C . n 
C 1 131 HIS 131 149 ?   ?   ?   C . n 
D 1 1   ALA 1   19  ?   ?   ?   D . n 
D 1 2   TYR 2   20  ?   ?   ?   D . n 
D 1 3   VAL 3   21  21  VAL VAL D . n 
D 1 4   CYS 4   22  22  CYS CYS D . n 
D 1 5   ARG 5   23  23  ARG ARG D . n 
D 1 6   GLU 6   24  24  GLU GLU D . n 
D 1 7   ALA 7   25  25  ALA ALA D . n 
D 1 8   SER 8   26  26  SER SER D . n 
D 1 9   ILE 9   27  27  ILE ILE D . n 
D 1 10  SER 10  28  28  SER SER D . n 
D 1 11  GLY 11  29  29  GLY GLY D . n 
D 1 12  GLU 12  30  30  GLU GLU D . n 
D 1 13  ILE 13  31  31  ILE ILE D . n 
D 1 14  ARG 14  32  32  ARG ARG D . n 
D 1 15  TYR 15  33  33  TYR TYR D . n 
D 1 16  PRO 16  34  34  PRO PRO D . n 
D 1 17  GLN 17  35  35  GLN GLN D . n 
D 1 18  GLY 18  36  36  GLY GLY D . n 
D 1 19  THR 19  37  37  THR THR D . n 
D 1 20  CYS 20  38  38  CYS CYS D . n 
D 1 21  PRO 21  39  39  PRO PRO D . n 
D 1 22  THR 22  40  40  THR THR D . n 
D 1 23  LYS 23  41  41  LYS LYS D . n 
D 1 24  THR 24  42  42  THR THR D . n 
D 1 25  GLU 25  43  43  GLU GLU D . n 
D 1 26  ALA 26  44  44  ALA ALA D . n 
D 1 27  LEU 27  45  45  LEU LEU D . n 
D 1 28  ASN 28  46  46  ASN ASN D . n 
D 1 29  ASP 29  47  47  ASP ASP D . n 
D 1 30  CYS 30  48  48  CYS CYS D . n 
D 1 31  ASN 31  49  49  ASN ASN D . n 
D 1 32  LYS 32  50  50  LYS LYS D . n 
D 1 33  VAL 33  51  51  VAL VAL D . n 
D 1 34  THR 34  52  52  THR THR D . n 
D 1 35  LYS 35  53  53  LYS LYS D . n 
D 1 36  GLY 36  54  54  GLY GLY D . n 
D 1 37  LEU 37  55  55  LEU LEU D . n 
D 1 38  ILE 38  56  56  ILE ILE D . n 
D 1 39  ASP 39  57  57  ASP ASP D . n 
D 1 40  PHE 40  58  58  PHE PHE D . n 
D 1 41  SER 41  59  59  SER SER D . n 
D 1 42  GLN 42  60  60  GLN GLN D . n 
D 1 43  SER 43  61  61  SER SER D . n 
D 1 44  HIS 44  62  62  HIS HIS D . n 
D 1 45  GLN 45  63  63  GLN GLN D . n 
D 1 46  ARG 46  64  64  ARG ARG D . n 
D 1 47  ALA 47  65  65  ALA ALA D . n 
D 1 48  TRP 48  66  66  TRP TRP D . n 
D 1 49  GLY 49  67  67  GLY GLY D . n 
D 1 50  ILE 50  68  68  ILE ILE D . n 
D 1 51  ASP 51  69  69  ASP ASP D . n 
D 1 52  MET 52  70  70  MET MET D . n 
D 1 53  THR 53  71  71  THR THR D . n 
D 1 54  ALA 54  72  72  ALA ALA D . n 
D 1 55  LYS 55  73  73  LYS LYS D . n 
D 1 56  VAL 56  74  74  VAL VAL D . n 
D 1 57  GLN 57  75  75  GLN GLN D . n 
D 1 58  CYS 58  76  76  CYS CYS D . n 
D 1 59  ALA 59  77  77  ALA ALA D . n 
D 1 60  PRO 60  78  78  PRO PRO D . n 
D 1 61  CYS 61  79  79  CYS CYS D . n 
D 1 62  LYS 62  80  80  LYS LYS D . n 
D 1 63  THR 63  81  81  THR THR D . n 
D 1 64  THR 64  82  82  THR THR D . n 
D 1 65  ASP 65  83  83  ASP ASP D . n 
D 1 66  PRO 66  84  84  PRO PRO D . n 
D 1 67  TRP 67  85  85  TRP TRP D . n 
D 1 68  ASP 68  86  86  ASP ASP D . n 
D 1 69  VAL 69  87  87  VAL VAL D . n 
D 1 70  VAL 70  88  88  VAL VAL D . n 
D 1 71  LEU 71  89  89  LEU LEU D . n 
D 1 72  CYS 72  90  90  CYS CYS D . n 
D 1 73  THR 73  91  91  THR THR D . n 
D 1 74  CYS 74  92  92  CYS CYS D . n 
D 1 75  LYS 75  93  93  LYS LYS D . n 
D 1 76  ILE 76  94  94  ILE ILE D . n 
D 1 77  THR 77  95  95  THR THR D . n 
D 1 78  ALA 78  96  96  ALA ALA D . n 
D 1 79  HIS 79  97  97  HIS HIS D . n 
D 1 80  ARG 80  98  98  ARG ARG D . n 
D 1 81  TYR 81  99  99  TYR TYR D . n 
D 1 82  ARG 82  100 100 ARG ARG D . n 
D 1 83  GLU 83  101 101 GLU GLU D . n 
D 1 84  PHE 84  102 102 PHE PHE D . n 
D 1 85  VAL 85  103 103 VAL VAL D . n 
D 1 86  PRO 86  104 104 PRO PRO D . n 
D 1 87  LYS 87  105 105 LYS LYS D . n 
D 1 88  ILE 88  106 106 ILE ILE D . n 
D 1 89  PRO 89  107 107 PRO PRO D . n 
D 1 90  TYR 90  108 108 TYR TYR D . n 
D 1 91  SER 91  109 109 SER SER D . n 
D 1 92  SER 92  110 110 SER SER D . n 
D 1 93  PHE 93  111 111 PHE PHE D . n 
D 1 94  SER 94  112 112 SER SER D . n 
D 1 95  SER 95  113 113 SER SER D . n 
D 1 96  ALA 96  114 114 ALA ALA D . n 
D 1 97  PRO 97  115 115 PRO PRO D . n 
D 1 98  GLY 98  116 116 GLY GLY D . n 
D 1 99  VAL 99  117 117 VAL VAL D . n 
D 1 100 ILE 100 118 118 ILE ILE D . n 
D 1 101 PHE 101 119 119 PHE PHE D . n 
D 1 102 ARG 102 120 120 ARG ARG D . n 
D 1 103 GLN 103 121 121 GLN GLN D . n 
D 1 104 GLU 104 122 122 GLU GLU D . n 
D 1 105 THR 105 123 123 THR THR D . n 
D 1 106 GLY 106 124 124 GLY GLY D . n 
D 1 107 LEU 107 125 125 LEU LEU D . n 
D 1 108 ASP 108 126 126 ASP ASP D . n 
D 1 109 HIS 109 127 127 HIS HIS D . n 
D 1 110 ASP 110 128 128 ASP ASP D . n 
D 1 111 PRO 111 129 129 PRO PRO D . n 
D 1 112 GLU 112 130 130 GLU GLU D . n 
D 1 113 TRP 113 131 131 TRP TRP D . n 
D 1 114 VAL 114 132 132 VAL VAL D . n 
D 1 115 VAL 115 133 133 VAL VAL D . n 
D 1 116 ASN 116 134 134 ASN ASN D . n 
D 1 117 MET 117 135 135 MET MET D . n 
D 1 118 LYS 118 136 136 LYS LYS D . n 
D 1 119 ALA 119 137 137 ALA ALA D . n 
D 1 120 ARG 120 138 138 ARG ARG D . n 
D 1 121 THR 121 139 139 THR THR D . n 
D 1 122 ARG 122 140 140 ARG ARG D . n 
D 1 123 GLY 123 141 141 GLY GLY D . n 
D 1 124 CYS 124 142 142 CYS CYS D . n 
D 1 125 ASP 125 143 143 ASP ASP D . n 
D 1 126 HIS 126 144 144 HIS HIS D . n 
D 1 127 HIS 127 145 145 HIS HIS D . n 
D 1 128 HIS 128 146 146 HIS HIS D . n 
D 1 129 HIS 129 147 147 HIS HIS D . n 
D 1 130 HIS 130 148 ?   ?   ?   D . n 
D 1 131 HIS 131 149 ?   ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 HOH 1  201 6   HOH HOH A . 
E 2 HOH 2  202 10  HOH HOH A . 
E 2 HOH 3  203 11  HOH HOH A . 
E 2 HOH 4  204 15  HOH HOH A . 
E 2 HOH 5  205 18  HOH HOH A . 
E 2 HOH 6  206 20  HOH HOH A . 
E 2 HOH 7  207 21  HOH HOH A . 
E 2 HOH 8  208 27  HOH HOH A . 
E 2 HOH 9  209 31  HOH HOH A . 
E 2 HOH 10 210 32  HOH HOH A . 
E 2 HOH 11 211 33  HOH HOH A . 
E 2 HOH 12 212 36  HOH HOH A . 
E 2 HOH 13 213 47  HOH HOH A . 
E 2 HOH 14 214 50  HOH HOH A . 
E 2 HOH 15 215 52  HOH HOH A . 
E 2 HOH 16 216 55  HOH HOH A . 
E 2 HOH 17 217 59  HOH HOH A . 
E 2 HOH 18 218 62  HOH HOH A . 
E 2 HOH 19 219 63  HOH HOH A . 
E 2 HOH 20 220 64  HOH HOH A . 
E 2 HOH 21 221 65  HOH HOH A . 
E 2 HOH 22 222 66  HOH HOH A . 
E 2 HOH 23 223 69  HOH HOH A . 
E 2 HOH 24 224 73  HOH HOH A . 
E 2 HOH 25 225 74  HOH HOH A . 
E 2 HOH 26 226 75  HOH HOH A . 
E 2 HOH 27 227 78  HOH HOH A . 
E 2 HOH 28 228 81  HOH HOH A . 
E 2 HOH 29 229 84  HOH HOH A . 
E 2 HOH 30 230 86  HOH HOH A . 
E 2 HOH 31 231 91  HOH HOH A . 
E 2 HOH 32 232 93  HOH HOH A . 
E 2 HOH 33 233 98  HOH HOH A . 
E 2 HOH 34 234 99  HOH HOH A . 
E 2 HOH 35 235 100 HOH HOH A . 
E 2 HOH 36 236 103 HOH HOH A . 
E 2 HOH 37 237 107 HOH HOH A . 
E 2 HOH 38 238 116 HOH HOH A . 
E 2 HOH 39 239 119 HOH HOH A . 
E 2 HOH 40 240 121 HOH HOH A . 
E 2 HOH 41 241 128 HOH HOH A . 
E 2 HOH 42 242 134 HOH HOH A . 
E 2 HOH 43 243 137 HOH HOH A . 
E 2 HOH 44 244 138 HOH HOH A . 
E 2 HOH 45 245 151 HOH HOH A . 
E 2 HOH 46 246 155 HOH HOH A . 
E 2 HOH 47 247 157 HOH HOH A . 
E 2 HOH 48 248 159 HOH HOH A . 
E 2 HOH 49 249 164 HOH HOH A . 
E 2 HOH 50 250 167 HOH HOH A . 
E 2 HOH 51 251 171 HOH HOH A . 
E 2 HOH 52 252 175 HOH HOH A . 
E 2 HOH 53 253 180 HOH HOH A . 
E 2 HOH 54 254 181 HOH HOH A . 
E 2 HOH 55 255 182 HOH HOH A . 
E 2 HOH 56 256 184 HOH HOH A . 
E 2 HOH 57 257 187 HOH HOH A . 
E 2 HOH 58 258 194 HOH HOH A . 
E 2 HOH 59 259 198 HOH HOH A . 
E 2 HOH 60 260 200 HOH HOH A . 
E 2 HOH 61 261 203 HOH HOH A . 
E 2 HOH 62 262 214 HOH HOH A . 
E 2 HOH 63 263 216 HOH HOH A . 
E 2 HOH 64 264 226 HOH HOH A . 
E 2 HOH 65 265 241 HOH HOH A . 
E 2 HOH 66 266 245 HOH HOH A . 
E 2 HOH 67 267 250 HOH HOH A . 
E 2 HOH 68 268 262 HOH HOH A . 
E 2 HOH 69 269 267 HOH HOH A . 
E 2 HOH 70 270 270 HOH HOH A . 
F 2 HOH 1  201 1   HOH HOH B . 
F 2 HOH 2  202 2   HOH HOH B . 
F 2 HOH 3  203 5   HOH HOH B . 
F 2 HOH 4  204 8   HOH HOH B . 
F 2 HOH 5  205 17  HOH HOH B . 
F 2 HOH 6  206 25  HOH HOH B . 
F 2 HOH 7  207 29  HOH HOH B . 
F 2 HOH 8  208 37  HOH HOH B . 
F 2 HOH 9  209 40  HOH HOH B . 
F 2 HOH 10 210 43  HOH HOH B . 
F 2 HOH 11 211 48  HOH HOH B . 
F 2 HOH 12 212 53  HOH HOH B . 
F 2 HOH 13 213 54  HOH HOH B . 
F 2 HOH 14 214 57  HOH HOH B . 
F 2 HOH 15 215 60  HOH HOH B . 
F 2 HOH 16 216 71  HOH HOH B . 
F 2 HOH 17 217 72  HOH HOH B . 
F 2 HOH 18 218 83  HOH HOH B . 
F 2 HOH 19 219 92  HOH HOH B . 
F 2 HOH 20 220 94  HOH HOH B . 
F 2 HOH 21 221 95  HOH HOH B . 
F 2 HOH 22 222 105 HOH HOH B . 
F 2 HOH 23 223 108 HOH HOH B . 
F 2 HOH 24 224 110 HOH HOH B . 
F 2 HOH 25 225 117 HOH HOH B . 
F 2 HOH 26 226 118 HOH HOH B . 
F 2 HOH 27 227 123 HOH HOH B . 
F 2 HOH 28 228 124 HOH HOH B . 
F 2 HOH 29 229 131 HOH HOH B . 
F 2 HOH 30 230 132 HOH HOH B . 
F 2 HOH 31 231 136 HOH HOH B . 
F 2 HOH 32 232 139 HOH HOH B . 
F 2 HOH 33 233 143 HOH HOH B . 
F 2 HOH 34 234 144 HOH HOH B . 
F 2 HOH 35 235 152 HOH HOH B . 
F 2 HOH 36 236 153 HOH HOH B . 
F 2 HOH 37 237 156 HOH HOH B . 
F 2 HOH 38 238 160 HOH HOH B . 
F 2 HOH 39 239 174 HOH HOH B . 
F 2 HOH 40 240 176 HOH HOH B . 
F 2 HOH 41 241 177 HOH HOH B . 
F 2 HOH 42 242 178 HOH HOH B . 
F 2 HOH 43 243 185 HOH HOH B . 
F 2 HOH 44 244 186 HOH HOH B . 
F 2 HOH 45 245 191 HOH HOH B . 
F 2 HOH 46 246 192 HOH HOH B . 
F 2 HOH 47 247 196 HOH HOH B . 
F 2 HOH 48 248 201 HOH HOH B . 
F 2 HOH 49 249 204 HOH HOH B . 
F 2 HOH 50 250 208 HOH HOH B . 
F 2 HOH 51 251 209 HOH HOH B . 
F 2 HOH 52 252 219 HOH HOH B . 
F 2 HOH 53 253 220 HOH HOH B . 
F 2 HOH 54 254 235 HOH HOH B . 
F 2 HOH 55 255 239 HOH HOH B . 
F 2 HOH 56 256 242 HOH HOH B . 
F 2 HOH 57 257 254 HOH HOH B . 
F 2 HOH 58 258 264 HOH HOH B . 
F 2 HOH 59 259 271 HOH HOH B . 
F 2 HOH 60 260 272 HOH HOH B . 
F 2 HOH 61 261 278 HOH HOH B . 
G 2 HOH 1  201 9   HOH HOH C . 
G 2 HOH 2  202 13  HOH HOH C . 
G 2 HOH 3  203 14  HOH HOH C . 
G 2 HOH 4  204 22  HOH HOH C . 
G 2 HOH 5  205 23  HOH HOH C . 
G 2 HOH 6  206 24  HOH HOH C . 
G 2 HOH 7  207 26  HOH HOH C . 
G 2 HOH 8  208 28  HOH HOH C . 
G 2 HOH 9  209 38  HOH HOH C . 
G 2 HOH 10 210 42  HOH HOH C . 
G 2 HOH 11 211 44  HOH HOH C . 
G 2 HOH 12 212 46  HOH HOH C . 
G 2 HOH 13 213 49  HOH HOH C . 
G 2 HOH 14 214 56  HOH HOH C . 
G 2 HOH 15 215 58  HOH HOH C . 
G 2 HOH 16 216 61  HOH HOH C . 
G 2 HOH 17 217 67  HOH HOH C . 
G 2 HOH 18 218 70  HOH HOH C . 
G 2 HOH 19 219 79  HOH HOH C . 
G 2 HOH 20 220 80  HOH HOH C . 
G 2 HOH 21 221 82  HOH HOH C . 
G 2 HOH 22 222 85  HOH HOH C . 
G 2 HOH 23 223 87  HOH HOH C . 
G 2 HOH 24 224 88  HOH HOH C . 
G 2 HOH 25 225 89  HOH HOH C . 
G 2 HOH 26 226 90  HOH HOH C . 
G 2 HOH 27 227 96  HOH HOH C . 
G 2 HOH 28 228 104 HOH HOH C . 
G 2 HOH 29 229 106 HOH HOH C . 
G 2 HOH 30 230 109 HOH HOH C . 
G 2 HOH 31 231 112 HOH HOH C . 
G 2 HOH 32 232 115 HOH HOH C . 
G 2 HOH 33 233 120 HOH HOH C . 
G 2 HOH 34 234 122 HOH HOH C . 
G 2 HOH 35 235 126 HOH HOH C . 
G 2 HOH 36 236 135 HOH HOH C . 
G 2 HOH 37 237 141 HOH HOH C . 
G 2 HOH 38 238 145 HOH HOH C . 
G 2 HOH 39 239 146 HOH HOH C . 
G 2 HOH 40 240 147 HOH HOH C . 
G 2 HOH 41 241 148 HOH HOH C . 
G 2 HOH 42 242 154 HOH HOH C . 
G 2 HOH 43 243 158 HOH HOH C . 
G 2 HOH 44 244 165 HOH HOH C . 
G 2 HOH 45 245 173 HOH HOH C . 
G 2 HOH 46 246 183 HOH HOH C . 
G 2 HOH 47 247 190 HOH HOH C . 
G 2 HOH 48 248 193 HOH HOH C . 
G 2 HOH 49 249 195 HOH HOH C . 
G 2 HOH 50 250 206 HOH HOH C . 
G 2 HOH 51 251 207 HOH HOH C . 
G 2 HOH 52 252 213 HOH HOH C . 
G 2 HOH 53 253 218 HOH HOH C . 
G 2 HOH 54 254 224 HOH HOH C . 
G 2 HOH 55 255 225 HOH HOH C . 
G 2 HOH 56 256 228 HOH HOH C . 
G 2 HOH 57 257 230 HOH HOH C . 
G 2 HOH 58 258 232 HOH HOH C . 
G 2 HOH 59 259 233 HOH HOH C . 
G 2 HOH 60 260 234 HOH HOH C . 
G 2 HOH 61 261 236 HOH HOH C . 
G 2 HOH 62 262 237 HOH HOH C . 
G 2 HOH 63 263 238 HOH HOH C . 
G 2 HOH 64 264 249 HOH HOH C . 
G 2 HOH 65 265 258 HOH HOH C . 
G 2 HOH 66 266 265 HOH HOH C . 
G 2 HOH 67 267 268 HOH HOH C . 
G 2 HOH 68 268 269 HOH HOH C . 
G 2 HOH 69 269 274 HOH HOH C . 
G 2 HOH 70 270 275 HOH HOH C . 
G 2 HOH 71 271 263 HOH HOH C . 
H 2 HOH 1  201 3   HOH HOH D . 
H 2 HOH 2  202 4   HOH HOH D . 
H 2 HOH 3  203 7   HOH HOH D . 
H 2 HOH 4  204 12  HOH HOH D . 
H 2 HOH 5  205 16  HOH HOH D . 
H 2 HOH 6  206 19  HOH HOH D . 
H 2 HOH 7  207 30  HOH HOH D . 
H 2 HOH 8  208 34  HOH HOH D . 
H 2 HOH 9  209 35  HOH HOH D . 
H 2 HOH 10 210 39  HOH HOH D . 
H 2 HOH 11 211 41  HOH HOH D . 
H 2 HOH 12 212 45  HOH HOH D . 
H 2 HOH 13 213 51  HOH HOH D . 
H 2 HOH 14 214 68  HOH HOH D . 
H 2 HOH 15 215 76  HOH HOH D . 
H 2 HOH 16 216 77  HOH HOH D . 
H 2 HOH 17 217 97  HOH HOH D . 
H 2 HOH 18 218 101 HOH HOH D . 
H 2 HOH 19 219 102 HOH HOH D . 
H 2 HOH 20 220 111 HOH HOH D . 
H 2 HOH 21 221 113 HOH HOH D . 
H 2 HOH 22 222 114 HOH HOH D . 
H 2 HOH 23 223 125 HOH HOH D . 
H 2 HOH 24 224 129 HOH HOH D . 
H 2 HOH 25 225 130 HOH HOH D . 
H 2 HOH 26 226 133 HOH HOH D . 
H 2 HOH 27 227 140 HOH HOH D . 
H 2 HOH 28 228 142 HOH HOH D . 
H 2 HOH 29 229 149 HOH HOH D . 
H 2 HOH 30 230 150 HOH HOH D . 
H 2 HOH 31 231 162 HOH HOH D . 
H 2 HOH 32 232 163 HOH HOH D . 
H 2 HOH 33 233 168 HOH HOH D . 
H 2 HOH 34 234 169 HOH HOH D . 
H 2 HOH 35 235 170 HOH HOH D . 
H 2 HOH 36 236 172 HOH HOH D . 
H 2 HOH 37 237 188 HOH HOH D . 
H 2 HOH 38 238 189 HOH HOH D . 
H 2 HOH 39 239 197 HOH HOH D . 
H 2 HOH 40 240 199 HOH HOH D . 
H 2 HOH 41 241 202 HOH HOH D . 
H 2 HOH 42 242 211 HOH HOH D . 
H 2 HOH 43 243 215 HOH HOH D . 
H 2 HOH 44 244 217 HOH HOH D . 
H 2 HOH 45 245 221 HOH HOH D . 
H 2 HOH 46 246 222 HOH HOH D . 
H 2 HOH 47 247 223 HOH HOH D . 
H 2 HOH 48 248 231 HOH HOH D . 
H 2 HOH 49 249 240 HOH HOH D . 
H 2 HOH 50 250 243 HOH HOH D . 
H 2 HOH 51 251 244 HOH HOH D . 
H 2 HOH 52 252 247 HOH HOH D . 
H 2 HOH 53 253 251 HOH HOH D . 
H 2 HOH 54 254 252 HOH HOH D . 
H 2 HOH 55 255 255 HOH HOH D . 
H 2 HOH 56 256 266 HOH HOH D . 
H 2 HOH 57 257 273 HOH HOH D . 
H 2 HOH 58 258 279 HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?    monomeric  1 
2 author_defined_assembly   ?    monomeric  1 
3 author_defined_assembly   ?    monomeric  1 
4 author_defined_assembly   ?    monomeric  1 
5 software_defined_assembly PISA dimeric    2 
6 software_defined_assembly PISA tetrameric 4 
7 software_defined_assembly PISA dimeric    2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,E             
2 1 B,F             
3 1 C,G             
4 1 D,H             
5 1 A,B,E,F         
6 1 A,B,C,D,E,F,G,H 
7 1 C,D,G,H         
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
5 'ABSA (A^2)' 1800  ? 
5 MORE         -11   ? 
5 'SSA (A^2)'  14460 ? 
6 'ABSA (A^2)' 6650  ? 
6 MORE         -31   ? 
6 'SSA (A^2)'  25720 ? 
7 'ABSA (A^2)' 1670  ? 
7 MORE         -11   ? 
7 'SSA (A^2)'  14430 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-12-11 
2 'Structure model' 1 1 2018-01-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 2 'Structure model' 'Structure summary'   
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' audit_author    
2 2 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_audit_author.name'    
2 2 'Structure model' '_citation_author.name' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC   'data collection' Quantum           ? 1 
SHARP  phasing           .                 ? 2 
PHENIX refinement        '(phenix.refine)' ? 3 
XDS    'data reduction'  .                 ? 4 
XSCALE 'data scaling'    .                 ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CD B ARG 100 ? ? NE B ARG 100 ? ? CZ  B ARG 100 ? ? 132.05 123.60 8.45  1.40 N 
2 1 NE B ARG 100 ? ? CZ B ARG 100 ? ? NH1 B ARG 100 ? ? 114.27 120.30 -6.03 0.50 N 
3 1 NE B ARG 100 ? ? CZ B ARG 100 ? ? NH2 B ARG 100 ? ? 125.95 120.30 5.65  0.50 N 
4 1 CD D ARG 100 ? ? NE D ARG 100 ? ? CZ  D ARG 100 ? ? 132.53 123.60 8.93  1.40 N 
5 1 NE D ARG 100 ? ? CZ D ARG 100 ? ? NH1 D ARG 100 ? ? 126.15 120.30 5.85  0.50 N 
6 1 NE D ARG 100 ? ? CZ D ARG 100 ? ? NH2 D ARG 100 ? ? 113.87 120.30 -6.43 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 THR A 82  ? ? -68.61 -92.28 
2  1 ASP A 83  ? ? -29.87 115.10 
3  1 SER B 112 ? ? -58.41 -7.98  
4  1 GLN B 121 ? ? -38.74 131.85 
5  1 ARG B 138 ? ? -34.56 137.44 
6  1 THR C 82  ? ? -68.62 -92.10 
7  1 ASP C 83  ? ? -29.90 115.13 
8  1 SER D 112 ? ? -58.67 -7.60  
9  1 GLN D 121 ? ? -38.84 132.20 
10 1 ARG D 138 ? ? -34.78 138.03 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A HIS 149 ? A HIS 131 
2 1 Y 1 B ALA 19  ? B ALA 1   
3 1 Y 1 B TYR 20  ? B TYR 2   
4 1 Y 1 B HIS 149 ? B HIS 131 
5 1 Y 1 C HIS 149 ? C HIS 131 
6 1 Y 1 D ALA 19  ? D ALA 1   
7 1 Y 1 D TYR 20  ? D TYR 2   
8 1 Y 1 D HIS 148 ? D HIS 130 
9 1 Y 1 D HIS 149 ? D HIS 131 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#