data_4FZY
# 
_entry.id   4FZY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4FZY         
NDB   NA1916       
RCSB  RCSB073563   
WWPDB D_1000073563 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4FZX . unspecified 
PDB 4FZZ . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4FZY 
_pdbx_database_status.recvd_initial_deposition_date   2012-07-08 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wang, T.'  1 
'Sun, H.'   2 
'Cheng, F.' 3 
'Bi, L.'    4 
'Jiang, T.' 5 
# 
_citation.id                        primary 
_citation.title                     
;Recognition and processing of double-stranded DNA by ExoX, a distributive 3'-5' exonuclease
;
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_volume            41 
_citation.page_first                7556 
_citation.page_last                 7565 
_citation.year                      2013 
_citation.journal_id_ASTM           NARHAD 
_citation.country                   UK 
_citation.journal_id_ISSN           0305-1048 
_citation.journal_id_CSD            0389 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23771145 
_citation.pdbx_database_id_DOI      10.1093/nar/gkt495 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wang, T.'    1 
primary 'Sun, H.L.'   2 
primary 'Cheng, F.'   3 
primary 'Zhang, X.E.' 4 
primary 'Bi, L.'      5 
primary 'Jiang, T.'   6 
# 
_cell.entry_id           4FZY 
_cell.length_a           37.282 
_cell.length_b           78.887 
_cell.length_c           146.668 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4FZY 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(*TP*GP*TP*AP*GP*AP*TP*TP*CP*GP*AP*G)-3')
;
3717.439  1  ?        ? ?                    ? 
2 polymer     man 'Exodeoxyribonuclease 10'                             20065.205 2  3.1.11.- ? 'UNP residues 1-167' ? 
3 polymer     syn 
;DNA (5'-D(P*CP*TP*CP*GP*AP*AP*TP*CP*TP*AP*CP*A)-3')
;
3606.381  1  ?        ? ?                    ? 
4 non-polymer syn 'SODIUM ION'                                          22.990    4  ?        ? ?                    ? 
5 water       nat water                                                 18.015    22 ?        ? ?                    ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        'Exodeoxyribonuclease X, Exo X, Exonuclease X' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DT)(DG)(DT)(DA)(DG)(DA)(DT)(DT)(DC)(DG)(DA)(DG)' TGTAGATTCGAG C   ? 
2 'polypeptide(L)'        no no 
;MLRIIDTETCGLQGGIVEIASVDVIDGKIVNPMSHLVRPDRPISPQAMAIHRITEAMVADKPWIEDVIPHYYGSEWYVAH
NASFDRRVLPEMPGEWICTMKLARRLWPGIKYSNMALYKTRKLNVQTPPGLHHHRALYDCYITAALLIDIMNTSGWTAEQ
MADITGRLEHHHHHH
;
;MLRIIDTETCGLQGGIVEIASVDVIDGKIVNPMSHLVRPDRPISPQAMAIHRITEAMVADKPWIEDVIPHYYGSEWYVAH
NASFDRRVLPEMPGEWICTMKLARRLWPGIKYSNMALYKTRKLNVQTPPGLHHHRALYDCYITAALLIDIMNTSGWTAEQ
MADITGRLEHHHHHH
;
A,B ? 
3 polydeoxyribonucleotide no no '(DC)(DT)(DC)(DG)(DA)(DA)(DT)(DC)(DT)(DA)(DC)(DA)' CTCGAATCTACA D   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DT  n 
1 2   DG  n 
1 3   DT  n 
1 4   DA  n 
1 5   DG  n 
1 6   DA  n 
1 7   DT  n 
1 8   DT  n 
1 9   DC  n 
1 10  DG  n 
1 11  DA  n 
1 12  DG  n 
2 1   MET n 
2 2   LEU n 
2 3   ARG n 
2 4   ILE n 
2 5   ILE n 
2 6   ASP n 
2 7   THR n 
2 8   GLU n 
2 9   THR n 
2 10  CYS n 
2 11  GLY n 
2 12  LEU n 
2 13  GLN n 
2 14  GLY n 
2 15  GLY n 
2 16  ILE n 
2 17  VAL n 
2 18  GLU n 
2 19  ILE n 
2 20  ALA n 
2 21  SER n 
2 22  VAL n 
2 23  ASP n 
2 24  VAL n 
2 25  ILE n 
2 26  ASP n 
2 27  GLY n 
2 28  LYS n 
2 29  ILE n 
2 30  VAL n 
2 31  ASN n 
2 32  PRO n 
2 33  MET n 
2 34  SER n 
2 35  HIS n 
2 36  LEU n 
2 37  VAL n 
2 38  ARG n 
2 39  PRO n 
2 40  ASP n 
2 41  ARG n 
2 42  PRO n 
2 43  ILE n 
2 44  SER n 
2 45  PRO n 
2 46  GLN n 
2 47  ALA n 
2 48  MET n 
2 49  ALA n 
2 50  ILE n 
2 51  HIS n 
2 52  ARG n 
2 53  ILE n 
2 54  THR n 
2 55  GLU n 
2 56  ALA n 
2 57  MET n 
2 58  VAL n 
2 59  ALA n 
2 60  ASP n 
2 61  LYS n 
2 62  PRO n 
2 63  TRP n 
2 64  ILE n 
2 65  GLU n 
2 66  ASP n 
2 67  VAL n 
2 68  ILE n 
2 69  PRO n 
2 70  HIS n 
2 71  TYR n 
2 72  TYR n 
2 73  GLY n 
2 74  SER n 
2 75  GLU n 
2 76  TRP n 
2 77  TYR n 
2 78  VAL n 
2 79  ALA n 
2 80  HIS n 
2 81  ASN n 
2 82  ALA n 
2 83  SER n 
2 84  PHE n 
2 85  ASP n 
2 86  ARG n 
2 87  ARG n 
2 88  VAL n 
2 89  LEU n 
2 90  PRO n 
2 91  GLU n 
2 92  MET n 
2 93  PRO n 
2 94  GLY n 
2 95  GLU n 
2 96  TRP n 
2 97  ILE n 
2 98  CYS n 
2 99  THR n 
2 100 MET n 
2 101 LYS n 
2 102 LEU n 
2 103 ALA n 
2 104 ARG n 
2 105 ARG n 
2 106 LEU n 
2 107 TRP n 
2 108 PRO n 
2 109 GLY n 
2 110 ILE n 
2 111 LYS n 
2 112 TYR n 
2 113 SER n 
2 114 ASN n 
2 115 MET n 
2 116 ALA n 
2 117 LEU n 
2 118 TYR n 
2 119 LYS n 
2 120 THR n 
2 121 ARG n 
2 122 LYS n 
2 123 LEU n 
2 124 ASN n 
2 125 VAL n 
2 126 GLN n 
2 127 THR n 
2 128 PRO n 
2 129 PRO n 
2 130 GLY n 
2 131 LEU n 
2 132 HIS n 
2 133 HIS n 
2 134 HIS n 
2 135 ARG n 
2 136 ALA n 
2 137 LEU n 
2 138 TYR n 
2 139 ASP n 
2 140 CYS n 
2 141 TYR n 
2 142 ILE n 
2 143 THR n 
2 144 ALA n 
2 145 ALA n 
2 146 LEU n 
2 147 LEU n 
2 148 ILE n 
2 149 ASP n 
2 150 ILE n 
2 151 MET n 
2 152 ASN n 
2 153 THR n 
2 154 SER n 
2 155 GLY n 
2 156 TRP n 
2 157 THR n 
2 158 ALA n 
2 159 GLU n 
2 160 GLN n 
2 161 MET n 
2 162 ALA n 
2 163 ASP n 
2 164 ILE n 
2 165 THR n 
2 166 GLY n 
2 167 ARG n 
2 168 LEU n 
2 169 GLU n 
2 170 HIS n 
2 171 HIS n 
2 172 HIS n 
2 173 HIS n 
2 174 HIS n 
2 175 HIS n 
3 1   DC  n 
3 2   DT  n 
3 3   DC  n 
3 4   DG  n 
3 5   DA  n 
3 6   DA  n 
3 7   DT  n 
3 8   DC  n 
3 9   DT  n 
3 10  DA  n 
3 11  DC  n 
3 12  DA  n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 exoX 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    K12 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     83333 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP EXOX_ECOLI P0AEK0 2 
;MLRIIDTETCGLQGGIVEIASVDVIDGKIVNPMSHLVRPDRPISPQAMAIHRITEAMVADKPWIEDVIPHYYGSEWYVAH
NASFDRRVLPEMPGEWICTMKLARRLWPGIKYSNMALYKTRKLNVQTPPGLHHHRALYDCYITAALLIDIMNTSGWTAEQ
MADITGR
;
1 ? 
2 PDB 4FZY       4FZY   1 ? ? ? 
3 PDB 4FZY       4FZY   3 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4FZY A 1 ? 167 ? P0AEK0 1 ? 167 ? 1 167 
2 1 4FZY B 1 ? 167 ? P0AEK0 1 ? 167 ? 1 167 
3 2 4FZY C 1 ? 12  ? 4FZY   1 ? 12  ? 1 12  
4 3 4FZY D 1 ? 12  ? 4FZY   1 ? 12  ? 1 12  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4FZY LEU A 168 ? UNP P0AEK0 ? ? 'EXPRESSION TAG' 168 1  
1 4FZY GLU A 169 ? UNP P0AEK0 ? ? 'EXPRESSION TAG' 169 2  
1 4FZY HIS A 170 ? UNP P0AEK0 ? ? 'EXPRESSION TAG' 170 3  
1 4FZY HIS A 171 ? UNP P0AEK0 ? ? 'EXPRESSION TAG' 171 4  
1 4FZY HIS A 172 ? UNP P0AEK0 ? ? 'EXPRESSION TAG' 172 5  
1 4FZY HIS A 173 ? UNP P0AEK0 ? ? 'EXPRESSION TAG' 173 6  
1 4FZY HIS A 174 ? UNP P0AEK0 ? ? 'EXPRESSION TAG' 174 7  
1 4FZY HIS A 175 ? UNP P0AEK0 ? ? 'EXPRESSION TAG' 175 8  
2 4FZY LEU B 168 ? UNP P0AEK0 ? ? 'EXPRESSION TAG' 168 9  
2 4FZY GLU B 169 ? UNP P0AEK0 ? ? 'EXPRESSION TAG' 169 10 
2 4FZY HIS B 170 ? UNP P0AEK0 ? ? 'EXPRESSION TAG' 170 11 
2 4FZY HIS B 171 ? UNP P0AEK0 ? ? 'EXPRESSION TAG' 171 12 
2 4FZY HIS B 172 ? UNP P0AEK0 ? ? 'EXPRESSION TAG' 172 13 
2 4FZY HIS B 173 ? UNP P0AEK0 ? ? 'EXPRESSION TAG' 173 14 
2 4FZY HIS B 174 ? UNP P0AEK0 ? ? 'EXPRESSION TAG' 174 15 
2 4FZY HIS B 175 ? UNP P0AEK0 ? ? 'EXPRESSION TAG' 175 16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
NA  non-polymer         . 'SODIUM ION'                         ? 'Na 1'            22.990  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          4FZY 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.27 
_exptl_crystal.density_percent_sol   45.87 
_exptl_crystal.description           'THE ENTRY CONTAINS FRIEDEL PAIRS IN F_PLUS/MINUS COLUMNS' 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.3 
_exptl_crystal_grow.pdbx_details    '0.1M MES, 17% PEG6000, pH 6.3, VAPOR DIFFUSION, HANGING DROP, temperature 289K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2011-07-12 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRF BEAMLINE BL17U' 
_diffrn_source.pdbx_synchrotron_site       SSRF 
_diffrn_source.pdbx_synchrotron_beamline   BL17U 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     4FZY 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30 
_reflns.d_resolution_high            2.5 
_reflns.number_obs                   15314 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  2.50 
_reflns_shell.d_res_low                   2.59 
_reflns_shell.percent_possible_all        97.8 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 4FZY 
_refine.ls_number_reflns_obs                     14545 
_refine.ls_number_reflns_all                     14545 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    97.62 
_refine.ls_R_factor_obs                          0.22023 
_refine.ls_R_factor_all                          0.22025 
_refine.ls_R_factor_R_work                       0.21918 
_refine.ls_R_factor_R_free                       0.24076 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  768 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.918 
_refine.correlation_coeff_Fo_to_Fc_free          0.895 
_refine.B_iso_mean                               24.068 
_refine.aniso_B[1][1]                            -1.66 
_refine.aniso_B[2][2]                            -2.46 
_refine.aniso_B[3][3]                            4.12 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.   
THE ENTRY CONTAINS FRIEDEL PAIRS IN F_PLUS/MINUS COLUMNS.
;
_refine.pdbx_starting_model                      4FZX 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.710 
_refine.pdbx_overall_ESU_R_Free                  0.287 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2647 
_refine_hist.pdbx_number_atoms_nucleic_acid   472 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             22 
_refine_hist.number_atoms_total               3145 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d             0.009  0.021  ? 3245 ? 'X-RAY DIFFRACTION' 
r_bond_other_d               ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg          0.842  2.137  ? 4510 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg       7.094  5.000  ? 331  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg       34.951 22.870 ? 115  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg       21.438 15.000 ? 459  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg       23.103 15.000 ? 21   ? 'X-RAY DIFFRACTION' 
r_chiral_restr               0.060  0.200  ? 503  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined         0.014  0.021  ? 2285 ? 'X-RAY DIFFRACTION' 
r_gen_planes_other           ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbd_refined                ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbd_other                  ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbtor_refined              ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbtor_other                ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined        ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_metal_ion_refined          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_metal_ion_other            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined       ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other         ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined     ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_other       ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_refined ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_other   ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_mcbond_it                  1.202  1.500  ? 1665 ? 'X-RAY DIFFRACTION' 
r_mcbond_other               ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_mcangle_it                 2.228  2.000  ? 2710 ? 'X-RAY DIFFRACTION' 
r_scbond_it                  3.381  3.000  ? 1580 ? 'X-RAY DIFFRACTION' 
r_scangle_it                 5.186  4.500  ? 1800 ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr           ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_sphericity_free            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.497 
_refine_ls_shell.d_res_low                        2.561 
_refine_ls_shell.number_reflns_R_work             1009 
_refine_ls_shell.R_factor_R_work                  0.300 
_refine_ls_shell.percent_reflns_obs               97.00 
_refine_ls_shell.R_factor_R_free                  0.377 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             58 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_struct.entry_id                  4FZY 
_struct.title                     'Exonuclease X in complex with 12bp blunt-ended dsDNA' 
_struct.pdbx_descriptor           'Exodeoxyribonuclease 10(E.C.3.1.11.-)/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4FZY 
_struct_keywords.pdbx_keywords   Hydrolase/DNA 
_struct_keywords.text            
;Exo, DnaQ family, DEDDh, Exonuclease, Nuclease, Mismatch repair, UV repair, homologous recombination, stabilization of tandem repeat, Hydrolase-DNA complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 2 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
L N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER B 44  ? ARG B 52  ? SER A 44  ARG A 52  1 ? 9  
HELX_P HELX_P2  2  THR B 54  ? VAL B 58  ? THR A 54  VAL A 58  5 ? 5  
HELX_P HELX_P3  3  TRP B 63  ? TYR B 71  ? TRP A 63  TYR A 71  5 ? 9  
HELX_P HELX_P4  4  ALA B 82  ? LEU B 89  ? ALA A 82  LEU A 89  1 ? 8  
HELX_P HELX_P5  5  THR B 99  ? TRP B 107 ? THR A 99  TRP A 107 1 ? 9  
HELX_P HELX_P6  6  SER B 113 ? ARG B 121 ? SER A 113 ARG A 121 1 ? 9  
HELX_P HELX_P7  7  ALA B 136 ? GLY B 155 ? ALA A 136 GLY A 155 1 ? 20 
HELX_P HELX_P8  8  THR B 157 ? GLY B 166 ? THR A 157 GLY A 166 1 ? 10 
HELX_P HELX_P9  9  SER D 44  ? ARG D 52  ? SER B 44  ARG B 52  1 ? 9  
HELX_P HELX_P10 10 THR D 54  ? ALA D 59  ? THR B 54  ALA B 59  1 ? 6  
HELX_P HELX_P11 11 TRP D 63  ? ILE D 68  ? TRP B 63  ILE B 68  1 ? 6  
HELX_P HELX_P12 12 PRO D 69  ? TYR D 72  ? PRO B 69  TYR B 72  5 ? 4  
HELX_P HELX_P13 13 ALA D 82  ? LEU D 89  ? ALA B 82  LEU B 89  1 ? 8  
HELX_P HELX_P14 14 THR D 99  ? TRP D 107 ? THR B 99  TRP B 107 1 ? 9  
HELX_P HELX_P15 15 SER D 113 ? ARG D 121 ? SER B 113 ARG B 121 1 ? 9  
HELX_P HELX_P16 16 ARG D 135 ? GLY D 155 ? ARG B 135 GLY B 155 1 ? 21 
HELX_P HELX_P17 17 THR D 157 ? GLY D 166 ? THR B 157 GLY B 166 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? B ASP 139 OD2   ? ? ? 1_555 F NA  .  NA ? ? A ASP 139 A NA  201 1_555 ? ? ? ? ? ? ?            2.106 ? 
metalc2  metalc ? ? D ASP 6   OD1   ? ? ? 1_555 G NA  .  NA ? ? B ASP 6   D NA  101 1_555 ? ? ? ? ? ? ?            2.181 ? 
metalc3  metalc ? ? B ASP 6   OD1   ? ? ? 1_555 E NA  .  NA ? ? A ASP 6   C NA  101 1_555 ? ? ? ? ? ? ?            2.218 ? 
metalc4  metalc ? ? A DG  12  OP1   ? ? ? 1_555 F NA  .  NA ? ? C DG  12  A NA  201 1_555 ? ? ? ? ? ? ?            2.223 ? 
metalc5  metalc ? ? C DA  12  OP1   ? ? ? 1_555 H NA  .  NA ? ? D DA  12  B NA  201 1_555 ? ? ? ? ? ? ?            2.281 ? 
metalc6  metalc ? ? D ASP 139 OD2   ? ? ? 1_555 H NA  .  NA ? ? B ASP 139 B NA  201 1_555 ? ? ? ? ? ? ?            2.293 ? 
metalc7  metalc ? ? A DG  12  OP1   ? ? ? 1_555 E NA  .  NA ? ? C DG  12  C NA  101 1_555 ? ? ? ? ? ? ?            2.425 ? 
metalc8  metalc ? ? B ASP 6   OD2   ? ? ? 1_555 F NA  .  NA ? ? A ASP 6   A NA  201 1_555 ? ? ? ? ? ? ?            2.613 ? 
metalc9  metalc ? ? C DA  12  OP1   ? ? ? 1_555 G NA  .  NA ? ? D DA  12  D NA  101 1_555 ? ? ? ? ? ? ?            2.616 ? 
metalc10 metalc ? ? B GLU 8   OE2   ? ? ? 1_555 F NA  .  NA ? ? A GLU 8   A NA  201 1_555 ? ? ? ? ? ? ?            2.636 ? 
metalc11 metalc ? ? D GLU 8   OE2   ? ? ? 1_555 H NA  .  NA ? ? B GLU 8   B NA  201 1_555 ? ? ? ? ? ? ?            2.737 ? 
metalc12 metalc ? ? C DC  11  "O3'" ? ? ? 1_555 G NA  .  NA ? ? D DC  11  D NA  101 1_555 ? ? ? ? ? ? ?            2.757 ? 
metalc13 metalc ? ? A DA  11  "O3'" ? ? ? 1_555 E NA  .  NA ? ? C DA  11  C NA  101 1_555 ? ? ? ? ? ? ?            2.767 ? 
metalc14 metalc ? ? D ASP 6   OD2   ? ? ? 1_555 H NA  .  NA ? ? B ASP 6   B NA  201 1_555 ? ? ? ? ? ? ?            2.768 ? 
metalc15 metalc ? ? G NA  .   NA    ? ? ? 1_555 K HOH .  O  ? ? D NA  101 D HOH 202 1_555 ? ? ? ? ? ? ?            2.129 ? 
metalc16 metalc ? ? G NA  .   NA    ? ? ? 1_555 L HOH .  O  ? ? D NA  101 B HOH 306 1_555 ? ? ? ? ? ? ?            2.199 ? 
metalc17 metalc ? ? E NA  .   NA    ? ? ? 1_555 I HOH .  O  ? ? C NA  101 C HOH 202 1_555 ? ? ? ? ? ? ?            2.221 ? 
metalc18 metalc ? ? E NA  .   NA    ? ? ? 1_555 J HOH .  O  ? ? C NA  101 A HOH 303 1_555 ? ? ? ? ? ? ?            2.233 ? 
metalc19 metalc ? ? G NA  .   NA    ? ? ? 1_555 L HOH .  O  ? ? D NA  101 B HOH 307 1_555 ? ? ? ? ? ? ?            2.347 ? 
metalc20 metalc ? ? E NA  .   NA    ? ? ? 1_555 J HOH .  O  ? ? C NA  101 A HOH 304 1_555 ? ? ? ? ? ? ?            2.379 ? 
hydrog1  hydrog ? ? A DG  2   N1    ? ? ? 1_555 C DC  11 N3 ? ? C DG  2   D DC  11  1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog2  hydrog ? ? A DT  3   N3    ? ? ? 1_555 C DA  10 N1 ? ? C DT  3   D DA  10  1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? 
hydrog3  hydrog ? ? A DA  4   N1    ? ? ? 1_555 C DT  9  N3 ? ? C DA  4   D DT  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DA  4   N6    ? ? ? 1_555 C DT  9  O4 ? ? C DA  4   D DT  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DG  5   N1    ? ? ? 1_555 C DC  8  N3 ? ? C DG  5   D DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DG  5   N2    ? ? ? 1_555 C DC  8  O2 ? ? C DG  5   D DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DG  5   O6    ? ? ? 1_555 C DC  8  N4 ? ? C DG  5   D DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DA  6   N1    ? ? ? 1_555 C DT  7  N3 ? ? C DA  6   D DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DA  6   N6    ? ? ? 1_555 C DT  7  O4 ? ? C DA  6   D DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DT  7   N3    ? ? ? 1_555 C DA  6  N1 ? ? C DT  7   D DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DT  7   O4    ? ? ? 1_555 C DA  6  N6 ? ? C DT  7   D DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DT  8   N3    ? ? ? 1_555 C DA  5  N1 ? ? C DT  8   D DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DT  8   O4    ? ? ? 1_555 C DA  5  N6 ? ? C DT  8   D DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DC  9   N3    ? ? ? 1_555 C DG  4  N1 ? ? C DC  9   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DC  9   N4    ? ? ? 1_555 C DG  4  O6 ? ? C DC  9   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DC  9   O2    ? ? ? 1_555 C DG  4  N2 ? ? C DC  9   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DG  10  N1    ? ? ? 1_555 C DC  3  N3 ? ? C DG  10  D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DG  10  N2    ? ? ? 1_555 C DC  3  O2 ? ? C DG  10  D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DG  10  O6    ? ? ? 1_555 C DC  3  N4 ? ? C DG  10  D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DA  11  N1    ? ? ? 1_555 C DT  2  N3 ? ? C DA  11  D DT  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DA  11  N6    ? ? ? 1_555 C DT  2  O4 ? ? C DA  11  D DT  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DG  12  N1    ? ? ? 1_555 C DC  1  N3 ? ? C DG  12  D DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DG  12  N2    ? ? ? 1_555 C DC  1  O2 ? ? C DG  12  D DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DG  12  O6    ? ? ? 1_555 C DC  1  N4 ? ? C DG  12  D DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS B 28 ? LEU B 36 ? LYS A 28 LEU A 36 
A 2 ILE B 16 ? ILE B 25 ? ILE A 16 ILE A 25 
A 3 LEU B 2  ? THR B 9  ? LEU A 2  THR A 9  
A 4 TRP B 76 ? ALA B 79 ? TRP A 76 ALA A 79 
A 5 GLU B 95 ? CYS B 98 ? GLU A 95 CYS A 98 
B 1 LYS D 28 ? LEU D 36 ? LYS B 28 LEU B 36 
B 2 GLU D 18 ? ILE D 25 ? GLU B 18 ILE B 25 
B 3 LEU D 2  ? GLU D 8  ? LEU B 2  GLU B 8  
B 4 TRP D 76 ? ALA D 79 ? TRP B 76 ALA B 79 
B 5 GLU D 95 ? CYS D 98 ? GLU B 95 CYS B 98 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL B 30 ? O VAL A 30 N ASP B 23 ? N ASP A 23 
A 2 3 O VAL B 24 ? O VAL A 24 N LEU B 2  ? N LEU A 2  
A 3 4 N ILE B 5  ? N ILE A 5  O VAL B 78 ? O VAL A 78 
A 4 5 N TYR B 77 ? N TYR A 77 O GLU B 95 ? O GLU A 95 
B 1 2 O VAL D 30 ? O VAL B 30 N ASP D 23 ? N ASP B 23 
B 2 3 O VAL D 24 ? O VAL B 24 N LEU D 2  ? N LEU B 2  
B 3 4 N ILE D 5  ? N ILE B 5  O VAL D 78 ? O VAL B 78 
B 4 5 N TYR D 77 ? N TYR B 77 O GLU D 95 ? O GLU B 95 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA C 101' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 201' 
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA D 101' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA B 201' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 ASP B 6   ? ASP A 6   . ? 1_555 ? 
2  AC1 7 NA  F .   ? NA  A 201 . ? 1_555 ? 
3  AC1 7 HOH J .   ? HOH A 303 . ? 1_555 ? 
4  AC1 7 HOH J .   ? HOH A 304 . ? 1_555 ? 
5  AC1 7 DA  A 11  ? DA  C 11  . ? 1_555 ? 
6  AC1 7 DG  A 12  ? DG  C 12  . ? 1_555 ? 
7  AC1 7 HOH I .   ? HOH C 202 . ? 1_555 ? 
8  AC2 5 ASP B 6   ? ASP A 6   . ? 1_555 ? 
9  AC2 5 GLU B 8   ? GLU A 8   . ? 1_555 ? 
10 AC2 5 ASP B 139 ? ASP A 139 . ? 1_555 ? 
11 AC2 5 DG  A 12  ? DG  C 12  . ? 1_555 ? 
12 AC2 5 NA  E .   ? NA  C 101 . ? 1_555 ? 
13 AC3 6 ASP D 6   ? ASP B 6   . ? 1_555 ? 
14 AC3 6 HOH L .   ? HOH B 306 . ? 1_555 ? 
15 AC3 6 HOH L .   ? HOH B 307 . ? 1_555 ? 
16 AC3 6 DC  C 11  ? DC  D 11  . ? 1_555 ? 
17 AC3 6 DA  C 12  ? DA  D 12  . ? 1_555 ? 
18 AC3 6 HOH K .   ? HOH D 202 . ? 1_555 ? 
19 AC4 4 ASP D 6   ? ASP B 6   . ? 1_555 ? 
20 AC4 4 GLU D 8   ? GLU B 8   . ? 1_555 ? 
21 AC4 4 ASP D 139 ? ASP B 139 . ? 1_555 ? 
22 AC4 4 DA  C 12  ? DA  D 12  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4FZY 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4FZY 
_atom_sites.fract_transf_matrix[1][1]   0.026823 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012676 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006818 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    P  P     . DG  A 1 2   ? 7.514   20.809  42.786 1.00 60.37 ? 2   DG  C P     1 
ATOM   2    O  OP1   . DG  A 1 2   ? 8.003   22.061  43.415 1.00 58.88 ? 2   DG  C OP1   1 
ATOM   3    O  OP2   . DG  A 1 2   ? 6.161   20.767  42.168 1.00 53.75 ? 2   DG  C OP2   1 
ATOM   4    O  "O5'" . DG  A 1 2   ? 7.677   19.585  43.830 1.00 58.35 ? 2   DG  C "O5'" 1 
ATOM   5    C  "C5'" . DG  A 1 2   ? 8.174   19.802  45.168 1.00 55.10 ? 2   DG  C "C5'" 1 
ATOM   6    C  "C4'" . DG  A 1 2   ? 7.965   18.597  46.091 1.00 52.50 ? 2   DG  C "C4'" 1 
ATOM   7    O  "O4'" . DG  A 1 2   ? 6.581   18.151  46.081 1.00 51.43 ? 2   DG  C "O4'" 1 
ATOM   8    C  "C3'" . DG  A 1 2   ? 8.783   17.361  45.767 1.00 52.36 ? 2   DG  C "C3'" 1 
ATOM   9    O  "O3'" . DG  A 1 2   ? 9.072   16.653  46.961 1.00 58.01 ? 2   DG  C "O3'" 1 
ATOM   10   C  "C2'" . DG  A 1 2   ? 7.842   16.570  44.865 1.00 48.84 ? 2   DG  C "C2'" 1 
ATOM   11   C  "C1'" . DG  A 1 2   ? 6.484   16.867  45.494 1.00 48.03 ? 2   DG  C "C1'" 1 
ATOM   12   N  N9    . DG  A 1 2   ? 5.388   16.860  44.520 1.00 42.98 ? 2   DG  C N9    1 
ATOM   13   C  C8    . DG  A 1 2   ? 5.276   17.619  43.374 1.00 41.80 ? 2   DG  C C8    1 
ATOM   14   N  N7    . DG  A 1 2   ? 4.204   17.367  42.673 1.00 36.80 ? 2   DG  C N7    1 
ATOM   15   C  C5    . DG  A 1 2   ? 3.568   16.375  43.402 1.00 33.93 ? 2   DG  C C5    1 
ATOM   16   C  C6    . DG  A 1 2   ? 2.374   15.692  43.119 1.00 31.74 ? 2   DG  C C6    1 
ATOM   17   O  O6    . DG  A 1 2   ? 1.623   15.864  42.136 1.00 27.05 ? 2   DG  C O6    1 
ATOM   18   N  N1    . DG  A 1 2   ? 2.084   14.746  44.114 1.00 30.42 ? 2   DG  C N1    1 
ATOM   19   C  C2    . DG  A 1 2   ? 2.878   14.485  45.215 1.00 33.84 ? 2   DG  C C2    1 
ATOM   20   N  N2    . DG  A 1 2   ? 2.456   13.542  46.072 1.00 31.55 ? 2   DG  C N2    1 
ATOM   21   N  N3    . DG  A 1 2   ? 4.005   15.126  45.478 1.00 35.96 ? 2   DG  C N3    1 
ATOM   22   C  C4    . DG  A 1 2   ? 4.285   16.047  44.532 1.00 37.10 ? 2   DG  C C4    1 
ATOM   23   P  P     . DT  A 1 3   ? 10.144  15.454  46.936 1.00 65.05 ? 3   DT  C P     1 
ATOM   24   O  OP1   . DT  A 1 3   ? 10.682  15.287  48.312 1.00 63.77 ? 3   DT  C OP1   1 
ATOM   25   O  OP2   . DT  A 1 3   ? 11.072  15.683  45.799 1.00 62.17 ? 3   DT  C OP2   1 
ATOM   26   O  "O5'" . DT  A 1 3   ? 9.242   14.182  46.573 1.00 61.51 ? 3   DT  C "O5'" 1 
ATOM   27   C  "C5'" . DT  A 1 3   ? 8.301   13.683  47.529 1.00 56.69 ? 3   DT  C "C5'" 1 
ATOM   28   C  "C4'" . DT  A 1 3   ? 7.891   12.266  47.153 1.00 51.35 ? 3   DT  C "C4'" 1 
ATOM   29   O  "O4'" . DT  A 1 3   ? 6.521   12.307  46.666 1.00 51.59 ? 3   DT  C "O4'" 1 
ATOM   30   C  "C3'" . DT  A 1 3   ? 8.658   11.672  45.986 1.00 50.64 ? 3   DT  C "C3'" 1 
ATOM   31   O  "O3'" . DT  A 1 3   ? 9.899   11.098  46.413 1.00 54.93 ? 3   DT  C "O3'" 1 
ATOM   32   C  "C2'" . DT  A 1 3   ? 7.680   10.637  45.445 1.00 48.18 ? 3   DT  C "C2'" 1 
ATOM   33   C  "C1'" . DT  A 1 3   ? 6.332   11.312  45.680 1.00 45.53 ? 3   DT  C "C1'" 1 
ATOM   34   N  N1    . DT  A 1 3   ? 5.770   11.954  44.473 1.00 37.75 ? 3   DT  C N1    1 
ATOM   35   C  C2    . DT  A 1 3   ? 4.541   11.550  43.998 1.00 36.72 ? 3   DT  C C2    1 
ATOM   36   O  O2    . DT  A 1 3   ? 3.859   10.686  44.520 1.00 38.83 ? 3   DT  C O2    1 
ATOM   37   N  N3    . DT  A 1 3   ? 4.125   12.199  42.870 1.00 33.51 ? 3   DT  C N3    1 
ATOM   38   C  C4    . DT  A 1 3   ? 4.790   13.187  42.179 1.00 34.04 ? 3   DT  C C4    1 
ATOM   39   O  O4    . DT  A 1 3   ? 4.315   13.690  41.161 1.00 32.16 ? 3   DT  C O4    1 
ATOM   40   C  C5    . DT  A 1 3   ? 6.086   13.541  42.710 1.00 35.30 ? 3   DT  C C5    1 
ATOM   41   C  C7    . DT  A 1 3   ? 6.929   14.582  42.031 1.00 35.61 ? 3   DT  C C7    1 
ATOM   42   C  C6    . DT  A 1 3   ? 6.503   12.916  43.823 1.00 36.87 ? 3   DT  C C6    1 
ATOM   43   P  P     . DA  A 1 4   ? 10.010  9.816   47.378 1.00 54.79 ? 4   DA  C P     1 
ATOM   44   O  OP1   . DA  A 1 4   ? 9.427   10.184  48.685 1.00 57.12 ? 4   DA  C OP1   1 
ATOM   45   O  OP2   . DA  A 1 4   ? 11.396  9.313   47.303 1.00 52.61 ? 4   DA  C OP2   1 
ATOM   46   O  "O5'" . DA  A 1 4   ? 9.090   8.715   46.681 1.00 54.81 ? 4   DA  C "O5'" 1 
ATOM   47   C  "C5'" . DA  A 1 4   ? 8.204   7.929   47.450 1.00 49.36 ? 4   DA  C "C5'" 1 
ATOM   48   C  "C4'" . DA  A 1 4   ? 7.577   6.909   46.520 1.00 47.31 ? 4   DA  C "C4'" 1 
ATOM   49   O  "O4'" . DA  A 1 4   ? 6.823   7.590   45.476 1.00 45.01 ? 4   DA  C "O4'" 1 
ATOM   50   C  "C3'" . DA  A 1 4   ? 8.583   6.011   45.812 1.00 46.63 ? 4   DA  C "C3'" 1 
ATOM   51   O  "O3'" . DA  A 1 4   ? 8.128   4.661   45.884 1.00 50.35 ? 4   DA  C "O3'" 1 
ATOM   52   C  "C2'" . DA  A 1 4   ? 8.618   6.562   44.383 1.00 43.47 ? 4   DA  C "C2'" 1 
ATOM   53   C  "C1'" . DA  A 1 4   ? 7.195   7.084   44.211 1.00 41.04 ? 4   DA  C "C1'" 1 
ATOM   54   N  N9    . DA  A 1 4   ? 7.056   8.150   43.220 1.00 34.75 ? 4   DA  C N9    1 
ATOM   55   C  C8    . DA  A 1 4   ? 7.995   9.081   42.874 1.00 35.01 ? 4   DA  C C8    1 
ATOM   56   N  N7    . DA  A 1 4   ? 7.610   9.910   41.929 1.00 32.82 ? 4   DA  C N7    1 
ATOM   57   C  C5    . DA  A 1 4   ? 6.317   9.503   41.646 1.00 30.94 ? 4   DA  C C5    1 
ATOM   58   C  C6    . DA  A 1 4   ? 5.366   9.971   40.727 1.00 30.08 ? 4   DA  C C6    1 
ATOM   59   N  N6    . DA  A 1 4   ? 5.587   11.010  39.915 1.00 30.30 ? 4   DA  C N6    1 
ATOM   60   N  N1    . DA  A 1 4   ? 4.186   9.322   40.655 1.00 30.67 ? 4   DA  C N1    1 
ATOM   61   C  C2    . DA  A 1 4   ? 3.971   8.284   41.475 1.00 31.33 ? 4   DA  C C2    1 
ATOM   62   N  N3    . DA  A 1 4   ? 4.787   7.760   42.393 1.00 33.29 ? 4   DA  C N3    1 
ATOM   63   C  C4    . DA  A 1 4   ? 5.956   8.422   42.429 1.00 32.39 ? 4   DA  C C4    1 
ATOM   64   P  P     . DG  A 1 5   ? 8.862   3.491   45.077 1.00 52.45 ? 5   DG  C P     1 
ATOM   65   O  OP1   . DG  A 1 5   ? 9.598   2.666   46.057 1.00 52.06 ? 5   DG  C OP1   1 
ATOM   66   O  OP2   . DG  A 1 5   ? 9.591   4.095   43.941 1.00 54.54 ? 5   DG  C OP2   1 
ATOM   67   O  "O5'" . DG  A 1 5   ? 7.637   2.632   44.484 1.00 50.81 ? 5   DG  C "O5'" 1 
ATOM   68   C  "C5'" . DG  A 1 5   ? 6.278   3.038   44.721 1.00 49.08 ? 5   DG  C "C5'" 1 
ATOM   69   C  "C4'" . DG  A 1 5   ? 5.333   2.537   43.635 1.00 48.26 ? 5   DG  C "C4'" 1 
ATOM   70   O  "O4'" . DG  A 1 5   ? 4.996   3.624   42.726 1.00 45.80 ? 5   DG  C "O4'" 1 
ATOM   71   C  "C3'" . DG  A 1 5   ? 5.892   1.418   42.759 1.00 48.86 ? 5   DG  C "C3'" 1 
ATOM   72   O  "O3'" . DG  A 1 5   ? 4.848   0.510   42.351 1.00 48.83 ? 5   DG  C "O3'" 1 
ATOM   73   C  "C2'" . DG  A 1 5   ? 6.488   2.188   41.580 1.00 43.80 ? 5   DG  C "C2'" 1 
ATOM   74   C  "C1'" . DG  A 1 5   ? 5.501   3.341   41.429 1.00 41.35 ? 5   DG  C "C1'" 1 
ATOM   75   N  N9    . DG  A 1 5   ? 6.107   4.547   40.864 1.00 32.84 ? 5   DG  C N9    1 
ATOM   76   C  C8    . DG  A 1 5   ? 7.344   5.065   41.151 1.00 29.93 ? 5   DG  C C8    1 
ATOM   77   N  N7    . DG  A 1 5   ? 7.633   6.143   40.481 1.00 28.21 ? 5   DG  C N7    1 
ATOM   78   C  C5    . DG  A 1 5   ? 6.505   6.368   39.708 1.00 30.21 ? 5   DG  C C5    1 
ATOM   79   C  C6    . DG  A 1 5   ? 6.236   7.398   38.766 1.00 29.42 ? 5   DG  C C6    1 
ATOM   80   O  O6    . DG  A 1 5   ? 6.961   8.347   38.440 1.00 28.45 ? 5   DG  C O6    1 
ATOM   81   N  N1    . DG  A 1 5   ? 4.978   7.254   38.184 1.00 29.96 ? 5   DG  C N1    1 
ATOM   82   C  C2    . DG  A 1 5   ? 4.098   6.231   38.470 1.00 32.60 ? 5   DG  C C2    1 
ATOM   83   N  N2    . DG  A 1 5   ? 2.934   6.259   37.799 1.00 30.18 ? 5   DG  C N2    1 
ATOM   84   N  N3    . DG  A 1 5   ? 4.336   5.259   39.357 1.00 28.82 ? 5   DG  C N3    1 
ATOM   85   C  C4    . DG  A 1 5   ? 5.560   5.387   39.925 1.00 29.41 ? 5   DG  C C4    1 
ATOM   86   P  P     . DA  A 1 6   ? 5.164   -0.686  41.322 1.00 50.47 ? 6   DA  C P     1 
ATOM   87   O  OP1   . DA  A 1 6   ? 4.607   -1.946  41.857 1.00 50.25 ? 6   DA  C OP1   1 
ATOM   88   O  OP2   . DA  A 1 6   ? 6.605   -0.647  40.961 1.00 49.54 ? 6   DA  C OP2   1 
ATOM   89   O  "O5'" . DA  A 1 6   ? 4.281   -0.230  40.059 1.00 48.37 ? 6   DA  C "O5'" 1 
ATOM   90   C  "C5'" . DA  A 1 6   ? 2.963   0.291   40.251 1.00 42.67 ? 6   DA  C "C5'" 1 
ATOM   91   C  "C4'" . DA  A 1 6   ? 2.287   0.574   38.917 1.00 40.98 ? 6   DA  C "C4'" 1 
ATOM   92   O  "O4'" . DA  A 1 6   ? 2.792   1.822   38.362 1.00 42.05 ? 6   DA  C "O4'" 1 
ATOM   93   C  "C3'" . DA  A 1 6   ? 2.518   -0.470  37.827 1.00 42.77 ? 6   DA  C "C3'" 1 
ATOM   94   O  "O3'" . DA  A 1 6   ? 1.374   -0.535  36.964 1.00 44.66 ? 6   DA  C "O3'" 1 
ATOM   95   C  "C2'" . DA  A 1 6   ? 3.747   0.071   37.091 1.00 40.57 ? 6   DA  C "C2'" 1 
ATOM   96   C  "C1'" . DA  A 1 6   ? 3.494   1.578   37.150 1.00 36.12 ? 6   DA  C "C1'" 1 
ATOM   97   N  N9    . DA  A 1 6   ? 4.717   2.379   37.156 1.00 29.42 ? 6   DA  C N9    1 
ATOM   98   C  C8    . DA  A 1 6   ? 5.854   2.169   37.901 1.00 28.64 ? 6   DA  C C8    1 
ATOM   99   N  N7    . DA  A 1 6   ? 6.792   3.070   37.702 1.00 23.55 ? 6   DA  C N7    1 
ATOM   100  C  C5    . DA  A 1 6   ? 6.228   3.926   36.764 1.00 22.82 ? 6   DA  C C5    1 
ATOM   101  C  C6    . DA  A 1 6   ? 6.700   5.109   36.144 1.00 21.84 ? 6   DA  C C6    1 
ATOM   102  N  N6    . DA  A 1 6   ? 7.916   5.635   36.360 1.00 16.19 ? 6   DA  C N6    1 
ATOM   103  N  N1    . DA  A 1 6   ? 5.878   5.717   35.264 1.00 20.53 ? 6   DA  C N1    1 
ATOM   104  C  C2    . DA  A 1 6   ? 4.666   5.192   35.042 1.00 22.25 ? 6   DA  C C2    1 
ATOM   105  N  N3    . DA  A 1 6   ? 4.118   4.094   35.556 1.00 23.33 ? 6   DA  C N3    1 
ATOM   106  C  C4    . DA  A 1 6   ? 4.952   3.513   36.426 1.00 22.46 ? 6   DA  C C4    1 
ATOM   107  P  P     . DT  A 1 7   ? 1.366   -1.504  35.680 1.00 43.86 ? 7   DT  C P     1 
ATOM   108  O  OP1   . DT  A 1 7   ? -0.029  -1.947  35.459 1.00 42.96 ? 7   DT  C OP1   1 
ATOM   109  O  OP2   . DT  A 1 7   ? 2.447   -2.505  35.842 1.00 37.67 ? 7   DT  C OP2   1 
ATOM   110  O  "O5'" . DT  A 1 7   ? 1.710   -0.470  34.511 1.00 42.52 ? 7   DT  C "O5'" 1 
ATOM   111  C  "C5'" . DT  A 1 7   ? 1.029   0.789   34.511 1.00 41.89 ? 7   DT  C "C5'" 1 
ATOM   112  C  "C4'" . DT  A 1 7   ? 1.158   1.484   33.170 1.00 39.02 ? 7   DT  C "C4'" 1 
ATOM   113  O  "O4'" . DT  A 1 7   ? 2.286   2.394   33.193 1.00 39.85 ? 7   DT  C "O4'" 1 
ATOM   114  C  "C3'" . DT  A 1 7   ? 1.399   0.550   31.997 1.00 40.85 ? 7   DT  C "C3'" 1 
ATOM   115  O  "O3'" . DT  A 1 7   ? 0.685   1.028   30.874 1.00 41.79 ? 7   DT  C "O3'" 1 
ATOM   116  C  "C2'" . DT  A 1 7   ? 2.914   0.604   31.803 1.00 38.70 ? 7   DT  C "C2'" 1 
ATOM   117  C  "C1'" . DT  A 1 7   ? 3.208   2.050   32.179 1.00 36.20 ? 7   DT  C "C1'" 1 
ATOM   118  N  N1    . DT  A 1 7   ? 4.587   2.285   32.693 1.00 28.93 ? 7   DT  C N1    1 
ATOM   119  C  C2    . DT  A 1 7   ? 5.303   3.372   32.228 1.00 27.22 ? 7   DT  C C2    1 
ATOM   120  O  O2    . DT  A 1 7   ? 4.853   4.175   31.428 1.00 33.20 ? 7   DT  C O2    1 
ATOM   121  N  N3    . DT  A 1 7   ? 6.564   3.500   32.747 1.00 19.78 ? 7   DT  C N3    1 
ATOM   122  C  C4    . DT  A 1 7   ? 7.178   2.647   33.642 1.00 25.44 ? 7   DT  C C4    1 
ATOM   123  O  O4    . DT  A 1 7   ? 8.310   2.855   34.076 1.00 24.40 ? 7   DT  C O4    1 
ATOM   124  C  C5    . DT  A 1 7   ? 6.382   1.517   34.072 1.00 26.69 ? 7   DT  C C5    1 
ATOM   125  C  C7    . DT  A 1 7   ? 6.943   0.541   35.063 1.00 26.36 ? 7   DT  C C7    1 
ATOM   126  C  C6    . DT  A 1 7   ? 5.143   1.385   33.577 1.00 28.08 ? 7   DT  C C6    1 
ATOM   127  P  P     . DT  A 1 8   ? 0.954   0.404   29.433 1.00 46.05 ? 8   DT  C P     1 
ATOM   128  O  OP1   . DT  A 1 8   ? -0.316  0.463   28.671 1.00 43.78 ? 8   DT  C OP1   1 
ATOM   129  O  OP2   . DT  A 1 8   ? 1.701   -0.871  29.598 1.00 35.95 ? 8   DT  C OP2   1 
ATOM   130  O  "O5'" . DT  A 1 8   ? 1.934   1.514   28.833 1.00 47.54 ? 8   DT  C "O5'" 1 
ATOM   131  C  "C5'" . DT  A 1 8   ? 1.545   2.896   28.920 1.00 41.54 ? 8   DT  C "C5'" 1 
ATOM   132  C  "C4'" . DT  A 1 8   ? 2.429   3.733   28.017 1.00 37.33 ? 8   DT  C "C4'" 1 
ATOM   133  O  "O4'" . DT  A 1 8   ? 3.749   3.867   28.604 1.00 34.57 ? 8   DT  C "O4'" 1 
ATOM   134  C  "C3'" . DT  A 1 8   ? 2.652   3.153   26.626 1.00 33.50 ? 8   DT  C "C3'" 1 
ATOM   135  O  "O3'" . DT  A 1 8   ? 2.665   4.215   25.693 1.00 34.59 ? 8   DT  C "O3'" 1 
ATOM   136  C  "C2'" . DT  A 1 8   ? 4.012   2.466   26.745 1.00 30.40 ? 8   DT  C "C2'" 1 
ATOM   137  C  "C1'" . DT  A 1 8   ? 4.733   3.403   27.700 1.00 31.96 ? 8   DT  C "C1'" 1 
ATOM   138  N  N1    . DT  A 1 8   ? 5.835   2.783   28.510 1.00 30.91 ? 8   DT  C N1    1 
ATOM   139  C  C2    . DT  A 1 8   ? 6.997   3.493   28.722 1.00 28.03 ? 8   DT  C C2    1 
ATOM   140  O  O2    . DT  A 1 8   ? 7.210   4.576   28.216 1.00 30.32 ? 8   DT  C O2    1 
ATOM   141  N  N3    . DT  A 1 8   ? 7.924   2.864   29.514 1.00 26.66 ? 8   DT  C N3    1 
ATOM   142  C  C4    . DT  A 1 8   ? 7.782   1.639   30.142 1.00 26.98 ? 8   DT  C C4    1 
ATOM   143  O  O4    . DT  A 1 8   ? 8.657   1.167   30.874 1.00 28.68 ? 8   DT  C O4    1 
ATOM   144  C  C5    . DT  A 1 8   ? 6.532   0.969   29.895 1.00 22.91 ? 8   DT  C C5    1 
ATOM   145  C  C7    . DT  A 1 8   ? 6.251   -0.367  30.516 1.00 25.81 ? 8   DT  C C7    1 
ATOM   146  C  C6    . DT  A 1 8   ? 5.631   1.566   29.109 1.00 27.62 ? 8   DT  C C6    1 
ATOM   147  P  P     . DC  A 1 9   ? 2.537   3.890   24.142 1.00 39.22 ? 9   DC  C P     1 
ATOM   148  O  OP1   . DC  A 1 9   ? 1.277   4.480   23.646 1.00 38.92 ? 9   DC  C OP1   1 
ATOM   149  O  OP2   . DC  A 1 9   ? 2.783   2.433   23.977 1.00 40.97 ? 9   DC  C OP2   1 
ATOM   150  O  "O5'" . DC  A 1 9   ? 3.764   4.700   23.490 1.00 35.69 ? 9   DC  C "O5'" 1 
ATOM   151  C  "C5'" . DC  A 1 9   ? 4.824   5.185   24.297 1.00 34.13 ? 9   DC  C "C5'" 1 
ATOM   152  C  "C4'" . DC  A 1 9   ? 6.142   5.194   23.536 1.00 34.09 ? 9   DC  C "C4'" 1 
ATOM   153  O  "O4'" . DC  A 1 9   ? 7.199   4.575   24.324 1.00 30.32 ? 9   DC  C "O4'" 1 
ATOM   154  C  "C3'" . DC  A 1 9   ? 6.138   4.466   22.201 1.00 31.79 ? 9   DC  C "C3'" 1 
ATOM   155  O  "O3'" . DC  A 1 9   ? 7.000   5.152   21.300 1.00 30.20 ? 9   DC  C "O3'" 1 
ATOM   156  C  "C2'" . DC  A 1 9   ? 6.684   3.090   22.576 1.00 30.25 ? 9   DC  C "C2'" 1 
ATOM   157  C  "C1'" . DC  A 1 9   ? 7.721   3.457   23.636 1.00 26.76 ? 9   DC  C "C1'" 1 
ATOM   158  N  N1    . DC  A 1 9   ? 7.973   2.383   24.633 1.00 21.73 ? 9   DC  C N1    1 
ATOM   159  C  C2    . DC  A 1 9   ? 9.111   2.442   25.448 1.00 24.51 ? 9   DC  C C2    1 
ATOM   160  O  O2    . DC  A 1 9   ? 9.936   3.361   25.293 1.00 25.66 ? 9   DC  C O2    1 
ATOM   161  N  N3    . DC  A 1 9   ? 9.293   1.474   26.385 1.00 22.85 ? 9   DC  C N3    1 
ATOM   162  C  C4    . DC  A 1 9   ? 8.410   0.489   26.510 1.00 21.79 ? 9   DC  C C4    1 
ATOM   163  N  N4    . DC  A 1 9   ? 8.659   -0.436  27.437 1.00 24.54 ? 9   DC  C N4    1 
ATOM   164  C  C5    . DC  A 1 9   ? 7.224   0.426   25.718 1.00 21.96 ? 9   DC  C C5    1 
ATOM   165  C  C6    . DC  A 1 9   ? 7.053   1.384   24.796 1.00 24.38 ? 9   DC  C C6    1 
ATOM   166  P  P     . DG  A 1 10  ? 6.489   5.545   19.832 1.00 28.70 ? 10  DG  C P     1 
ATOM   167  O  OP1   . DG  A 1 10  ? 5.795   6.868   19.908 1.00 30.33 ? 10  DG  C OP1   1 
ATOM   168  O  OP2   . DG  A 1 10  ? 5.794   4.360   19.279 1.00 24.45 ? 10  DG  C OP2   1 
ATOM   169  O  "O5'" . DG  A 1 10  ? 7.859   5.778   19.037 1.00 28.76 ? 10  DG  C "O5'" 1 
ATOM   170  C  "C5'" . DG  A 1 10  ? 8.694   4.675   18.750 1.00 24.10 ? 10  DG  C "C5'" 1 
ATOM   171  C  "C4'" . DG  A 1 10  ? 10.139  4.978   19.082 1.00 17.70 ? 10  DG  C "C4'" 1 
ATOM   172  O  "O4'" . DG  A 1 10  ? 10.322  4.886   20.509 1.00 20.08 ? 10  DG  C "O4'" 1 
ATOM   173  C  "C3'" . DG  A 1 10  ? 11.106  3.980   18.476 1.00 14.83 ? 10  DG  C "C3'" 1 
ATOM   174  O  "O3'" . DG  A 1 10  ? 11.600  4.533   17.298 1.00 12.57 ? 10  DG  C "O3'" 1 
ATOM   175  C  "C2'" . DG  A 1 10  ? 12.212  3.901   19.517 1.00 23.11 ? 10  DG  C "C2'" 1 
ATOM   176  C  "C1'" . DG  A 1 10  ? 11.437  4.059   20.810 1.00 21.26 ? 10  DG  C "C1'" 1 
ATOM   177  N  N9    . DG  A 1 10  ? 10.945  2.785   21.327 1.00 20.29 ? 10  DG  C N9    1 
ATOM   178  C  C8    . DG  A 1 10  ? 9.847   2.089   20.879 1.00 19.45 ? 10  DG  C C8    1 
ATOM   179  N  N7    . DG  A 1 10  ? 9.620   1.000   21.555 1.00 23.53 ? 10  DG  C N7    1 
ATOM   180  C  C5    . DG  A 1 10  ? 10.618  0.982   22.516 1.00 20.85 ? 10  DG  C C5    1 
ATOM   181  C  C6    . DG  A 1 10  ? 10.861  0.040   23.536 1.00 21.17 ? 10  DG  C C6    1 
ATOM   182  O  O6    . DG  A 1 10  ? 10.208  -0.992  23.775 1.00 21.69 ? 10  DG  C O6    1 
ATOM   183  N  N1    . DG  A 1 10  ? 11.966  0.401   24.317 1.00 16.24 ? 10  DG  C N1    1 
ATOM   184  C  C2    . DG  A 1 10  ? 12.763  1.503   24.083 1.00 19.55 ? 10  DG  C C2    1 
ATOM   185  N  N2    . DG  A 1 10  ? 13.796  1.689   24.919 1.00 17.82 ? 10  DG  C N2    1 
ATOM   186  N  N3    . DG  A 1 10  ? 12.536  2.393   23.124 1.00 19.47 ? 10  DG  C N3    1 
ATOM   187  C  C4    . DG  A 1 10  ? 11.444  2.073   22.391 1.00 18.39 ? 10  DG  C C4    1 
ATOM   188  P  P     . DA  A 1 11  ? 11.933  3.611   16.060 1.00 13.21 ? 11  DA  C P     1 
ATOM   189  O  OP1   . DA  A 1 11  ? 11.902  4.485   14.857 1.00 10.41 ? 11  DA  C OP1   1 
ATOM   190  O  OP2   . DA  A 1 11  ? 11.086  2.379   16.116 1.00 11.37 ? 11  DA  C OP2   1 
ATOM   191  O  "O5'" . DA  A 1 11  ? 13.448  3.223   16.376 1.00 13.12 ? 11  DA  C "O5'" 1 
ATOM   192  C  "C5'" . DA  A 1 11  ? 14.434  4.200   16.654 1.00 8.69  ? 11  DA  C "C5'" 1 
ATOM   193  C  "C4'" . DA  A 1 11  ? 15.702  3.506   17.129 1.00 9.62  ? 11  DA  C "C4'" 1 
ATOM   194  O  "O4'" . DA  A 1 11  ? 15.505  3.145   18.518 1.00 12.38 ? 11  DA  C "O4'" 1 
ATOM   195  C  "C3'" . DA  A 1 11  ? 16.030  2.188   16.434 1.00 11.69 ? 11  DA  C "C3'" 1 
ATOM   196  O  "O3'" . DA  A 1 11  ? 16.855  2.398   15.309 1.00 11.23 ? 11  DA  C "O3'" 1 
ATOM   197  C  "C2'" . DA  A 1 11  ? 16.763  1.420   17.520 1.00 10.65 ? 11  DA  C "C2'" 1 
ATOM   198  C  "C1'" . DA  A 1 11  ? 15.981  1.841   18.753 1.00 12.39 ? 11  DA  C "C1'" 1 
ATOM   199  N  N9    . DA  A 1 11  ? 14.844  0.983   19.036 1.00 14.74 ? 11  DA  C N9    1 
ATOM   200  C  C8    . DA  A 1 11  ? 13.838  0.617   18.176 1.00 11.50 ? 11  DA  C C8    1 
ATOM   201  N  N7    . DA  A 1 11  ? 12.959  -0.184  18.724 1.00 9.39  ? 11  DA  C N7    1 
ATOM   202  C  C5    . DA  A 1 11  ? 13.443  -0.403  20.005 1.00 11.92 ? 11  DA  C C5    1 
ATOM   203  C  C6    . DA  A 1 11  ? 12.971  -1.183  21.081 1.00 16.24 ? 11  DA  C C6    1 
ATOM   204  N  N6    . DA  A 1 11  ? 11.855  -1.924  21.035 1.00 17.45 ? 11  DA  C N6    1 
ATOM   205  N  N1    . DA  A 1 11  ? 13.684  -1.152  22.223 1.00 16.56 ? 11  DA  C N1    1 
ATOM   206  C  C2    . DA  A 1 11  ? 14.804  -0.405  22.272 1.00 19.41 ? 11  DA  C C2    1 
ATOM   207  N  N3    . DA  A 1 11  ? 15.334  0.388   21.339 1.00 11.03 ? 11  DA  C N3    1 
ATOM   208  C  C4    . DA  A 1 11  ? 14.595  0.335   20.223 1.00 11.39 ? 11  DA  C C4    1 
ATOM   209  P  P     . DG  A 1 12  ? 16.558  1.595   13.967 1.00 16.97 ? 12  DG  C P     1 
ATOM   210  O  OP1   . DG  A 1 12  ? 17.285  2.275   12.872 1.00 20.12 ? 12  DG  C OP1   1 
ATOM   211  O  OP2   . DG  A 1 12  ? 15.092  1.428   13.867 1.00 14.69 ? 12  DG  C OP2   1 
ATOM   212  O  "O5'" . DG  A 1 12  ? 17.215  0.143   14.205 1.00 14.88 ? 12  DG  C "O5'" 1 
ATOM   213  C  "C5'" . DG  A 1 12  ? 18.419  0.003   14.918 1.00 11.58 ? 12  DG  C "C5'" 1 
ATOM   214  C  "C4'" . DG  A 1 12  ? 18.859  -1.450  14.946 1.00 15.67 ? 12  DG  C "C4'" 1 
ATOM   215  O  "O4'" . DG  A 1 12  ? 18.404  -2.047  16.183 1.00 16.93 ? 12  DG  C "O4'" 1 
ATOM   216  C  "C3'" . DG  A 1 12  ? 18.305  -2.349  13.846 1.00 15.35 ? 12  DG  C "C3'" 1 
ATOM   217  O  "O3'" . DG  A 1 12  ? 19.176  -2.368  12.715 1.00 17.22 ? 12  DG  C "O3'" 1 
ATOM   218  C  "C2'" . DG  A 1 12  ? 18.306  -3.714  14.512 1.00 12.06 ? 12  DG  C "C2'" 1 
ATOM   219  C  "C1'" . DG  A 1 12  ? 17.951  -3.359  15.941 1.00 16.29 ? 12  DG  C "C1'" 1 
ATOM   220  N  N9    . DG  A 1 12  ? 16.524  -3.376  16.197 1.00 22.19 ? 12  DG  C N9    1 
ATOM   221  C  C8    . DG  A 1 12  ? 15.604  -2.434  15.812 1.00 19.56 ? 12  DG  C C8    1 
ATOM   222  N  N7    . DG  A 1 12  ? 14.398  -2.699  16.227 1.00 19.94 ? 12  DG  C N7    1 
ATOM   223  C  C5    . DG  A 1 12  ? 14.528  -3.886  16.932 1.00 19.27 ? 12  DG  C C5    1 
ATOM   224  C  C6    . DG  A 1 12  ? 13.549  -4.664  17.597 1.00 21.60 ? 12  DG  C C6    1 
ATOM   225  O  O6    . DG  A 1 12  ? 12.336  -4.431  17.705 1.00 22.06 ? 12  DG  C O6    1 
ATOM   226  N  N1    . DG  A 1 12  ? 14.095  -5.805  18.185 1.00 13.63 ? 12  DG  C N1    1 
ATOM   227  C  C2    . DG  A 1 12  ? 15.426  -6.132  18.131 1.00 17.30 ? 12  DG  C C2    1 
ATOM   228  N  N2    . DG  A 1 12  ? 15.787  -7.234  18.782 1.00 13.44 ? 12  DG  C N2    1 
ATOM   229  N  N3    . DG  A 1 12  ? 16.350  -5.434  17.477 1.00 19.43 ? 12  DG  C N3    1 
ATOM   230  C  C4    . DG  A 1 12  ? 15.828  -4.323  16.912 1.00 21.02 ? 12  DG  C C4    1 
ATOM   231  N  N     . MET B 2 1   ? 26.411  23.051  10.010 1.00 21.76 ? 1   MET A N     1 
ATOM   232  C  CA    . MET B 2 1   ? 26.295  21.745  9.296  1.00 21.58 ? 1   MET A CA    1 
ATOM   233  C  C     . MET B 2 1   ? 25.842  20.681  10.288 1.00 19.74 ? 1   MET A C     1 
ATOM   234  O  O     . MET B 2 1   ? 26.401  20.561  11.377 1.00 18.83 ? 1   MET A O     1 
ATOM   235  C  CB    . MET B 2 1   ? 27.639  21.349  8.659  1.00 22.35 ? 1   MET A CB    1 
ATOM   236  C  CG    . MET B 2 1   ? 27.572  20.127  7.766  1.00 24.98 ? 1   MET A CG    1 
ATOM   237  S  SD    . MET B 2 1   ? 27.689  18.572  8.684  1.00 36.44 ? 1   MET A SD    1 
ATOM   238  C  CE    . MET B 2 1   ? 29.464  18.271  8.613  1.00 34.80 ? 1   MET A CE    1 
ATOM   239  N  N     . LEU B 2 2   ? 24.761  19.988  9.954  1.00 18.41 ? 2   LEU A N     1 
ATOM   240  C  CA    . LEU B 2 2   ? 24.266  18.913  10.804 1.00 17.58 ? 2   LEU A CA    1 
ATOM   241  C  C     . LEU B 2 2   ? 24.392  17.569  10.102 1.00 17.10 ? 2   LEU A C     1 
ATOM   242  O  O     . LEU B 2 2   ? 24.037  17.427  8.921  1.00 15.55 ? 2   LEU A O     1 
ATOM   243  C  CB    . LEU B 2 2   ? 22.822  19.174  11.249 1.00 17.52 ? 2   LEU A CB    1 
ATOM   244  C  CG    . LEU B 2 2   ? 22.514  20.613  11.664 1.00 17.38 ? 2   LEU A CG    1 
ATOM   245  C  CD1   . LEU B 2 2   ? 21.064  20.968  11.379 1.00 18.16 ? 2   LEU A CD1   1 
ATOM   246  C  CD2   . LEU B 2 2   ? 22.864  20.857  13.108 1.00 19.07 ? 2   LEU A CD2   1 
ATOM   247  N  N     . ARG B 2 3   ? 25.038  16.635  10.794 1.00 16.95 ? 3   ARG A N     1 
ATOM   248  C  CA    . ARG B 2 3   ? 25.273  15.303  10.263 1.00 16.24 ? 3   ARG A CA    1 
ATOM   249  C  C     . ARG B 2 3   ? 24.288  14.320  10.859 1.00 15.45 ? 3   ARG A C     1 
ATOM   250  O  O     . ARG B 2 3   ? 24.230  14.127  12.083 1.00 15.35 ? 3   ARG A O     1 
ATOM   251  C  CB    . ARG B 2 3   ? 26.703  14.842  10.541 1.00 15.05 ? 3   ARG A CB    1 
ATOM   252  C  CG    . ARG B 2 3   ? 26.957  13.412  10.081 1.00 19.20 ? 3   ARG A CG    1 
ATOM   253  C  CD    . ARG B 2 3   ? 28.432  13.147  9.912  1.00 23.09 ? 3   ARG A CD    1 
ATOM   254  N  NE    . ARG B 2 3   ? 28.981  13.953  8.834  1.00 23.28 ? 3   ARG A NE    1 
ATOM   255  C  CZ    . ARG B 2 3   ? 30.277  14.097  8.587  1.00 21.47 ? 3   ARG A CZ    1 
ATOM   256  N  NH1   . ARG B 2 3   ? 31.175  13.523  9.379  1.00 19.66 ? 3   ARG A NH1   1 
ATOM   257  N  NH2   . ARG B 2 3   ? 30.671  14.839  7.556  1.00 17.32 ? 3   ARG A NH2   1 
ATOM   258  N  N     . ILE B 2 4   ? 23.459  13.763  9.990  1.00 14.68 ? 4   ILE A N     1 
ATOM   259  C  CA    . ILE B 2 4   ? 22.536  12.721  10.371 1.00 15.48 ? 4   ILE A CA    1 
ATOM   260  C  C     . ILE B 2 4   ? 23.271  11.387  10.422 1.00 15.84 ? 4   ILE A C     1 
ATOM   261  O  O     . ILE B 2 4   ? 23.941  11.012  9.468  1.00 16.71 ? 4   ILE A O     1 
ATOM   262  C  CB    . ILE B 2 4   ? 21.385  12.637  9.367  1.00 14.30 ? 4   ILE A CB    1 
ATOM   263  C  CG1   . ILE B 2 4   ? 20.346  13.735  9.645  1.00 17.73 ? 4   ILE A CG1   1 
ATOM   264  C  CG2   . ILE B 2 4   ? 20.741  11.280  9.421  1.00 17.31 ? 4   ILE A CG2   1 
ATOM   265  C  CD1   . ILE B 2 4   ? 20.746  15.125  9.176  1.00 12.78 ? 4   ILE A CD1   1 
ATOM   266  N  N     . ILE B 2 5   ? 23.163  10.688  11.544 1.00 16.24 ? 5   ILE A N     1 
ATOM   267  C  CA    . ILE B 2 5   ? 23.863  9.429   11.733 1.00 17.38 ? 5   ILE A CA    1 
ATOM   268  C  C     . ILE B 2 5   ? 22.847  8.311   11.937 1.00 15.83 ? 5   ILE A C     1 
ATOM   269  O  O     . ILE B 2 5   ? 21.908  8.464   12.699 1.00 15.79 ? 5   ILE A O     1 
ATOM   270  C  CB    . ILE B 2 5   ? 24.800  9.494   12.970 1.00 18.34 ? 5   ILE A CB    1 
ATOM   271  C  CG1   . ILE B 2 5   ? 26.145  10.085  12.581 1.00 23.41 ? 5   ILE A CG1   1 
ATOM   272  C  CG2   . ILE B 2 5   ? 25.106  8.101   13.487 1.00 21.47 ? 5   ILE A CG2   1 
ATOM   273  C  CD1   . ILE B 2 5   ? 27.243  9.011   12.387 1.00 22.05 ? 5   ILE A CD1   1 
ATOM   274  N  N     . ASP B 2 6   ? 23.059  7.176   11.278 1.00 14.87 ? 6   ASP A N     1 
ATOM   275  C  CA    . ASP B 2 6   ? 22.224  6.005   11.515 1.00 14.80 ? 6   ASP A CA    1 
ATOM   276  C  C     . ASP B 2 6   ? 23.009  4.707   11.408 1.00 14.56 ? 6   ASP A C     1 
ATOM   277  O  O     . ASP B 2 6   ? 23.973  4.624   10.646 1.00 14.28 ? 6   ASP A O     1 
ATOM   278  C  CB    . ASP B 2 6   ? 21.033  5.978   10.558 1.00 13.14 ? 6   ASP A CB    1 
ATOM   279  C  CG    . ASP B 2 6   ? 20.007  4.916   10.931 1.00 15.74 ? 6   ASP A CG    1 
ATOM   280  O  OD1   . ASP B 2 6   ? 19.696  4.776   12.134 1.00 14.38 ? 6   ASP A OD1   1 
ATOM   281  O  OD2   . ASP B 2 6   ? 19.506  4.210   10.020 1.00 18.10 ? 6   ASP A OD2   1 
ATOM   282  N  N     . THR B 2 7   ? 22.513  3.673   12.088 1.00 13.33 ? 7   THR A N     1 
ATOM   283  C  CA    . THR B 2 7   ? 23.294  2.496   12.397 1.00 14.41 ? 7   THR A CA    1 
ATOM   284  C  C     . THR B 2 7   ? 22.407  1.218   12.394 1.00 14.53 ? 7   THR A C     1 
ATOM   285  O  O     . THR B 2 7   ? 21.319  1.213   12.961 1.00 15.88 ? 7   THR A O     1 
ATOM   286  C  CB    . THR B 2 7   ? 24.043  2.705   13.746 1.00 14.55 ? 7   THR A CB    1 
ATOM   287  O  OG1   . THR B 2 7   ? 25.119  1.773   13.866 1.00 18.95 ? 7   THR A OG1   1 
ATOM   288  C  CG2   . THR B 2 7   ? 23.115  2.550   14.921 1.00 16.41 ? 7   THR A CG2   1 
ATOM   289  N  N     . GLU B 2 8   ? 22.776  0.218   11.597 1.00 14.53 ? 8   GLU A N     1 
ATOM   290  C  CA    . GLU B 2 8   ? 22.125  -1.106  11.698 1.00 13.68 ? 8   GLU A CA    1 
ATOM   291  C  C     . GLU B 2 8   ? 22.972  -2.053  12.578 1.00 13.36 ? 8   GLU A C     1 
ATOM   292  O  O     . GLU B 2 8   ? 24.191  -2.060  12.484 1.00 12.83 ? 8   GLU A O     1 
ATOM   293  C  CB    . GLU B 2 8   ? 21.875  -1.733  10.306 1.00 12.48 ? 8   GLU A CB    1 
ATOM   294  C  CG    . GLU B 2 8   ? 21.070  -0.874  9.286  1.00 12.10 ? 8   GLU A CG    1 
ATOM   295  C  CD    . GLU B 2 8   ? 19.805  -0.202  9.873  1.00 17.15 ? 8   GLU A CD    1 
ATOM   296  O  OE1   . GLU B 2 8   ? 19.159  -0.783  10.772 1.00 12.85 ? 8   GLU A OE1   1 
ATOM   297  O  OE2   . GLU B 2 8   ? 19.426  0.893   9.390  1.00 13.86 ? 8   GLU A OE2   1 
ATOM   298  N  N     . THR B 2 9   ? 22.316  -2.812  13.453 1.00 12.83 ? 9   THR A N     1 
ATOM   299  C  CA    . THR B 2 9   ? 23.001  -3.552  14.502 1.00 11.82 ? 9   THR A CA    1 
ATOM   300  C  C     . THR B 2 9   ? 22.605  -5.039  14.534 1.00 12.92 ? 9   THR A C     1 
ATOM   301  O  O     . THR B 2 9   ? 21.753  -5.484  13.767 1.00 11.72 ? 9   THR A O     1 
ATOM   302  C  CB    . THR B 2 9   ? 22.683  -2.973  15.893 1.00 13.34 ? 9   THR A CB    1 
ATOM   303  O  OG1   . THR B 2 9   ? 21.360  -3.364  16.282 1.00 15.02 ? 9   THR A OG1   1 
ATOM   304  C  CG2   . THR B 2 9   ? 22.787  -1.440  15.916 1.00 14.44 ? 9   THR A CG2   1 
ATOM   305  N  N     . CYS B 2 10  ? 23.171  -5.761  15.503 1.00 13.71 ? 10  CYS A N     1 
ATOM   306  C  CA    . CYS B 2 10  ? 22.912  -7.182  15.740 1.00 15.33 ? 10  CYS A CA    1 
ATOM   307  C  C     . CYS B 2 10  ? 21.757  -7.425  16.734 1.00 16.98 ? 10  CYS A C     1 
ATOM   308  O  O     . CYS B 2 10  ? 21.324  -8.567  16.935 1.00 17.20 ? 10  CYS A O     1 
ATOM   309  C  CB    . CYS B 2 10  ? 24.162  -7.850  16.317 1.00 15.17 ? 10  CYS A CB    1 
ATOM   310  S  SG    . CYS B 2 10  ? 25.677  -7.715  15.336 1.00 18.85 ? 10  CYS A SG    1 
ATOM   311  N  N     . GLY B 2 11  ? 21.352  -6.378  17.439 1.00 16.67 ? 11  GLY A N     1 
ATOM   312  C  CA    . GLY B 2 11  ? 20.327  -6.495  18.460 1.00 15.97 ? 11  GLY A CA    1 
ATOM   313  C  C     . GLY B 2 11  ? 20.226  -5.160  19.155 1.00 17.42 ? 11  GLY A C     1 
ATOM   314  O  O     . GLY B 2 11  ? 20.781  -4.162  18.693 1.00 17.27 ? 11  GLY A O     1 
ATOM   315  N  N     . LEU B 2 12  ? 19.599  -5.150  20.310 1.00 17.01 ? 12  LEU A N     1 
ATOM   316  C  CA    . LEU B 2 12  ? 19.385  -3.913  21.018 1.00 18.95 ? 12  LEU A CA    1 
ATOM   317  C  C     . LEU B 2 12  ? 20.476  -3.662  22.054 1.00 20.31 ? 12  LEU A C     1 
ATOM   318  O  O     . LEU B 2 12  ? 20.370  -2.733  22.860 1.00 21.70 ? 12  LEU A O     1 
ATOM   319  C  CB    . LEU B 2 12  ? 18.007  -3.939  21.670 1.00 18.89 ? 12  LEU A CB    1 
ATOM   320  C  CG    . LEU B 2 12  ? 16.914  -4.148  20.632 1.00 15.30 ? 12  LEU A CG    1 
ATOM   321  C  CD1   . LEU B 2 12  ? 15.660  -4.688  21.266 1.00 18.07 ? 12  LEU A CD1   1 
ATOM   322  C  CD2   . LEU B 2 12  ? 16.650  -2.842  19.907 1.00 19.01 ? 12  LEU A CD2   1 
ATOM   323  N  N     . GLN B 2 13  ? 21.510  -4.503  22.035 1.00 20.93 ? 13  GLN A N     1 
ATOM   324  C  CA    . GLN B 2 13  ? 22.691  -4.320  22.886 1.00 21.80 ? 13  GLN A CA    1 
ATOM   325  C  C     . GLN B 2 13  ? 23.850  -3.703  22.093 1.00 20.82 ? 13  GLN A C     1 
ATOM   326  O  O     . GLN B 2 13  ? 24.755  -3.092  22.663 1.00 21.51 ? 13  GLN A O     1 
ATOM   327  C  CB    . GLN B 2 13  ? 23.140  -5.661  23.469 1.00 23.02 ? 13  GLN A CB    1 
ATOM   328  C  CG    . GLN B 2 13  ? 22.443  -6.057  24.750 1.00 29.42 ? 13  GLN A CG    1 
ATOM   329  C  CD    . GLN B 2 13  ? 20.968  -6.302  24.546 1.00 39.33 ? 13  GLN A CD    1 
ATOM   330  O  OE1   . GLN B 2 13  ? 20.552  -6.833  23.508 1.00 38.86 ? 13  GLN A OE1   1 
ATOM   331  N  NE2   . GLN B 2 13  ? 20.155  -5.888  25.524 1.00 43.16 ? 13  GLN A NE2   1 
ATOM   332  N  N     . GLY B 2 14  ? 23.845  -3.907  20.786 1.00 20.43 ? 14  GLY A N     1 
ATOM   333  C  CA    . GLY B 2 14  ? 24.887  -3.360  19.935 1.00 19.67 ? 14  GLY A CA    1 
ATOM   334  C  C     . GLY B 2 14  ? 25.410  -4.363  18.936 1.00 18.86 ? 14  GLY A C     1 
ATOM   335  O  O     . GLY B 2 14  ? 24.715  -5.312  18.574 1.00 19.16 ? 14  GLY A O     1 
ATOM   336  N  N     . GLY B 2 15  ? 26.664  -4.187  18.534 1.00 17.98 ? 15  GLY A N     1 
ATOM   337  C  CA    . GLY B 2 15  ? 27.181  -4.858  17.354 1.00 17.17 ? 15  GLY A CA    1 
ATOM   338  C  C     . GLY B 2 15  ? 26.748  -4.112  16.115 1.00 17.09 ? 15  GLY A C     1 
ATOM   339  O  O     . GLY B 2 15  ? 25.553  -3.949  15.866 1.00 17.87 ? 15  GLY A O     1 
ATOM   340  N  N     . ILE B 2 16  ? 27.719  -3.622  15.355 1.00 15.39 ? 16  ILE A N     1 
ATOM   341  C  CA    . ILE B 2 16  ? 27.428  -2.800  14.193 1.00 13.61 ? 16  ILE A CA    1 
ATOM   342  C  C     . ILE B 2 16  ? 27.613  -3.598  12.912 1.00 13.55 ? 16  ILE A C     1 
ATOM   343  O  O     . ILE B 2 16  ? 28.695  -4.097  12.639 1.00 13.89 ? 16  ILE A O     1 
ATOM   344  C  CB    . ILE B 2 16  ? 28.348  -1.548  14.150 1.00 14.24 ? 16  ILE A CB    1 
ATOM   345  C  CG1   . ILE B 2 16  ? 28.335  -0.813  15.496 1.00 13.20 ? 16  ILE A CG1   1 
ATOM   346  C  CG2   . ILE B 2 16  ? 27.972  -0.634  13.002 1.00 12.02 ? 16  ILE A CG2   1 
ATOM   347  C  CD1   . ILE B 2 16  ? 26.985  -0.247  15.875 1.00 8.75  ? 16  ILE A CD1   1 
ATOM   348  N  N     . VAL B 2 17  ? 26.560  -3.677  12.106 1.00 14.11 ? 17  VAL A N     1 
ATOM   349  C  CA    . VAL B 2 17  ? 26.658  -4.282  10.787 1.00 14.10 ? 17  VAL A CA    1 
ATOM   350  C  C     . VAL B 2 17  ? 26.587  -3.257  9.670  1.00 14.89 ? 17  VAL A C     1 
ATOM   351  O  O     . VAL B 2 17  ? 26.901  -3.570  8.529  1.00 15.79 ? 17  VAL A O     1 
ATOM   352  C  CB    . VAL B 2 17  ? 25.563  -5.351  10.558 1.00 14.53 ? 17  VAL A CB    1 
ATOM   353  C  CG1   . VAL B 2 17  ? 25.728  -6.481  11.531 1.00 14.55 ? 17  VAL A CG1   1 
ATOM   354  C  CG2   . VAL B 2 17  ? 24.190  -4.749  10.686 1.00 14.76 ? 17  VAL A CG2   1 
ATOM   355  N  N     . GLU B 2 18  ? 26.140  -2.043  9.981  1.00 14.91 ? 18  GLU A N     1 
ATOM   356  C  CA    . GLU B 2 18  ? 26.102  -0.988  8.975  1.00 14.48 ? 18  GLU A CA    1 
ATOM   357  C  C     . GLU B 2 18  ? 26.136  0.359   9.630  1.00 14.71 ? 18  GLU A C     1 
ATOM   358  O  O     . GLU B 2 18  ? 25.643  0.525   10.737 1.00 16.63 ? 18  GLU A O     1 
ATOM   359  C  CB    . GLU B 2 18  ? 24.850  -1.101  8.105  1.00 14.84 ? 18  GLU A CB    1 
ATOM   360  C  CG    . GLU B 2 18  ? 25.003  -0.458  6.730  1.00 14.85 ? 18  GLU A CG    1 
ATOM   361  C  CD    . GLU B 2 18  ? 23.741  -0.558  5.883  1.00 16.54 ? 18  GLU A CD    1 
ATOM   362  O  OE1   . GLU B 2 18  ? 22.629  -0.622  6.452  1.00 13.31 ? 18  GLU A OE1   1 
ATOM   363  O  OE2   . GLU B 2 18  ? 23.862  -0.518  4.638  1.00 19.32 ? 18  GLU A OE2   1 
ATOM   364  N  N     . ILE B 2 19  ? 26.718  1.330   8.940  1.00 15.22 ? 19  ILE A N     1 
ATOM   365  C  CA    . ILE B 2 19  ? 26.662  2.716   9.382  1.00 13.94 ? 19  ILE A CA    1 
ATOM   366  C  C     . ILE B 2 19  ? 26.585  3.618   8.173  1.00 13.97 ? 19  ILE A C     1 
ATOM   367  O  O     . ILE B 2 19  ? 27.019  3.244   7.075  1.00 13.47 ? 19  ILE A O     1 
ATOM   368  C  CB    . ILE B 2 19  ? 27.894  3.089   10.236 1.00 13.80 ? 19  ILE A CB    1 
ATOM   369  C  CG1   . ILE B 2 19  ? 27.718  4.476   10.870 1.00 11.37 ? 19  ILE A CG1   1 
ATOM   370  C  CG2   . ILE B 2 19  ? 29.164  3.028   9.394  1.00 13.72 ? 19  ILE A CG2   1 
ATOM   371  C  CD1   . ILE B 2 19  ? 28.767  4.827   11.918 1.00 5.66  ? 19  ILE A CD1   1 
ATOM   372  N  N     . ALA B 2 20  ? 25.976  4.787   8.356  1.00 14.60 ? 20  ALA A N     1 
ATOM   373  C  CA    . ALA B 2 20  ? 25.792  5.731   7.257  1.00 13.03 ? 20  ALA A CA    1 
ATOM   374  C  C     . ALA B 2 20  ? 25.453  7.101   7.791  1.00 12.99 ? 20  ALA A C     1 
ATOM   375  O  O     . ALA B 2 20  ? 24.889  7.229   8.876  1.00 12.67 ? 20  ALA A O     1 
ATOM   376  C  CB    . ALA B 2 20  ? 24.698  5.249   6.318  1.00 11.27 ? 20  ALA A CB    1 
ATOM   377  N  N     . SER B 2 21  ? 25.742  8.121   6.989  1.00 13.05 ? 21  SER A N     1 
ATOM   378  C  CA    . SER B 2 21  ? 25.376  9.474   7.325  1.00 13.66 ? 21  SER A CA    1 
ATOM   379  C  C     . SER B 2 21  ? 25.060  10.285  6.077  1.00 13.36 ? 21  SER A C     1 
ATOM   380  O  O     . SER B 2 21  ? 25.376  9.875   4.964  1.00 12.29 ? 21  SER A O     1 
ATOM   381  C  CB    . SER B 2 21  ? 26.487  10.147  8.137  1.00 13.78 ? 21  SER A CB    1 
ATOM   382  O  OG    . SER B 2 21  ? 27.622  10.372  7.326  1.00 19.79 ? 21  SER A OG    1 
ATOM   383  N  N     . VAL B 2 22  ? 24.353  11.397  6.275  1.00 13.06 ? 22  VAL A N     1 
ATOM   384  C  CA    . VAL B 2 22  ? 24.273  12.462  5.285  1.00 11.54 ? 22  VAL A CA    1 
ATOM   385  C  C     . VAL B 2 22  ? 24.458  13.788  5.996  1.00 11.39 ? 22  VAL A C     1 
ATOM   386  O  O     . VAL B 2 22  ? 24.341  13.875  7.212  1.00 11.66 ? 22  VAL A O     1 
ATOM   387  C  CB    . VAL B 2 22  ? 22.908  12.470  4.524  1.00 11.31 ? 22  VAL A CB    1 
ATOM   388  C  CG1   . VAL B 2 22  ? 22.803  11.287  3.612  1.00 9.21  ? 22  VAL A CG1   1 
ATOM   389  C  CG2   . VAL B 2 22  ? 21.735  12.487  5.499  1.00 12.17 ? 22  VAL A CG2   1 
ATOM   390  N  N     . ASP B 2 23  ? 24.794  14.815  5.237  1.00 12.26 ? 23  ASP A N     1 
ATOM   391  C  CA    . ASP B 2 23  ? 24.983  16.124  5.804  1.00 13.24 ? 23  ASP A CA    1 
ATOM   392  C  C     . ASP B 2 23  ? 23.870  17.053  5.358  1.00 14.16 ? 23  ASP A C     1 
ATOM   393  O  O     . ASP B 2 23  ? 23.405  16.968  4.214  1.00 14.41 ? 23  ASP A O     1 
ATOM   394  C  CB    . ASP B 2 23  ? 26.362  16.658  5.435  1.00 12.86 ? 23  ASP A CB    1 
ATOM   395  C  CG    . ASP B 2 23  ? 27.464  15.969  6.222  1.00 17.14 ? 23  ASP A CG    1 
ATOM   396  O  OD1   . ASP B 2 23  ? 27.109  15.202  7.145  1.00 19.48 ? 23  ASP A OD1   1 
ATOM   397  O  OD2   . ASP B 2 23  ? 28.668  16.191  5.948  1.00 17.33 ? 23  ASP A OD2   1 
ATOM   398  N  N     . VAL B 2 24  ? 23.332  17.803  6.317  1.00 14.94 ? 24  VAL A N     1 
ATOM   399  C  CA    . VAL B 2 24  ? 22.291  18.788  6.051  1.00 16.15 ? 24  VAL A CA    1 
ATOM   400  C  C     . VAL B 2 24  ? 22.836  20.218  6.193  1.00 18.27 ? 24  VAL A C     1 
ATOM   401  O  O     . VAL B 2 24  ? 23.179  20.670  7.280  1.00 18.28 ? 24  VAL A O     1 
ATOM   402  C  CB    . VAL B 2 24  ? 21.053  18.581  6.979  1.00 16.07 ? 24  VAL A CB    1 
ATOM   403  C  CG1   . VAL B 2 24  ? 20.207  19.860  7.054  1.00 13.67 ? 24  VAL A CG1   1 
ATOM   404  C  CG2   . VAL B 2 24  ? 20.206  17.408  6.487  1.00 13.96 ? 24  VAL A CG2   1 
ATOM   405  N  N     . ILE B 2 25  ? 22.937  20.911  5.069  1.00 22.72 ? 25  ILE A N     1 
ATOM   406  C  CA    . ILE B 2 25  ? 23.465  22.270  5.037  1.00 24.45 ? 25  ILE A CA    1 
ATOM   407  C  C     . ILE B 2 25  ? 22.462  23.187  4.352  1.00 24.95 ? 25  ILE A C     1 
ATOM   408  O  O     . ILE B 2 25  ? 22.120  22.973  3.196  1.00 26.34 ? 25  ILE A O     1 
ATOM   409  C  CB    . ILE B 2 25  ? 24.781  22.300  4.246  1.00 25.34 ? 25  ILE A CB    1 
ATOM   410  C  CG1   . ILE B 2 25  ? 25.912  21.686  5.081  1.00 27.46 ? 25  ILE A CG1   1 
ATOM   411  C  CG2   . ILE B 2 25  ? 25.118  23.715  3.813  1.00 26.49 ? 25  ILE A CG2   1 
ATOM   412  C  CD1   . ILE B 2 25  ? 27.257  21.646  4.377  1.00 27.73 ? 25  ILE A CD1   1 
ATOM   413  N  N     . ASP B 2 26  ? 21.976  24.195  5.069  1.00 25.74 ? 26  ASP A N     1 
ATOM   414  C  CA    . ASP B 2 26  ? 20.971  25.120  4.518  1.00 26.12 ? 26  ASP A CA    1 
ATOM   415  C  C     . ASP B 2 26  ? 19.801  24.369  3.896  1.00 25.52 ? 26  ASP A C     1 
ATOM   416  O  O     . ASP B 2 26  ? 19.442  24.623  2.745  1.00 25.65 ? 26  ASP A O     1 
ATOM   417  C  CB    . ASP B 2 26  ? 21.584  26.021  3.444  1.00 26.81 ? 26  ASP A CB    1 
ATOM   418  C  CG    . ASP B 2 26  ? 22.651  26.938  3.988  1.00 31.51 ? 26  ASP A CG    1 
ATOM   419  O  OD1   . ASP B 2 26  ? 23.631  27.202  3.254  1.00 35.83 ? 26  ASP A OD1   1 
ATOM   420  O  OD2   . ASP B 2 26  ? 22.503  27.417  5.135  1.00 34.20 ? 26  ASP A OD2   1 
ATOM   421  N  N     . GLY B 2 27  ? 19.229  23.428  4.640  1.00 24.14 ? 27  GLY A N     1 
ATOM   422  C  CA    . GLY B 2 27  ? 18.065  22.690  4.165  1.00 21.90 ? 27  GLY A CA    1 
ATOM   423  C  C     . GLY B 2 27  ? 18.336  21.815  2.958  1.00 20.92 ? 27  GLY A C     1 
ATOM   424  O  O     . GLY B 2 27  ? 17.410  21.383  2.281  1.00 20.83 ? 27  GLY A O     1 
ATOM   425  N  N     . LYS B 2 28  ? 19.602  21.537  2.676  1.00 20.53 ? 28  LYS A N     1 
ATOM   426  C  CA    . LYS B 2 28  ? 19.903  20.582  1.615  1.00 20.45 ? 28  LYS A CA    1 
ATOM   427  C  C     . LYS B 2 28  ? 20.756  19.426  2.102  1.00 19.44 ? 28  LYS A C     1 
ATOM   428  O  O     . LYS B 2 28  ? 21.614  19.595  2.964  1.00 20.51 ? 28  LYS A O     1 
ATOM   429  C  CB    . LYS B 2 28  ? 20.527  21.265  0.400  1.00 20.01 ? 28  LYS A CB    1 
ATOM   430  C  CG    . LYS B 2 28  ? 19.798  20.951  -0.921 1.00 27.00 ? 28  LYS A CG    1 
ATOM   431  C  CD    . LYS B 2 28  ? 20.791  20.765  -2.099 1.00 35.75 ? 28  LYS A CD    1 
ATOM   432  C  CE    . LYS B 2 28  ? 22.177  21.385  -1.781 1.00 35.27 ? 28  LYS A CE    1 
ATOM   433  N  NZ    . LYS B 2 28  ? 22.955  21.750  -2.998 1.00 30.86 ? 28  LYS A NZ    1 
ATOM   434  N  N     . ILE B 2 29  ? 20.471  18.247  1.571  1.00 18.13 ? 29  ILE A N     1 
ATOM   435  C  CA    . ILE B 2 29  ? 21.117  17.012  1.990  1.00 18.62 ? 29  ILE A CA    1 
ATOM   436  C  C     . ILE B 2 29  ? 22.263  16.686  1.053  1.00 17.65 ? 29  ILE A C     1 
ATOM   437  O  O     . ILE B 2 29  ? 22.039  16.441  -0.132 1.00 17.83 ? 29  ILE A O     1 
ATOM   438  C  CB    . ILE B 2 29  ? 20.111  15.822  1.928  1.00 18.89 ? 29  ILE A CB    1 
ATOM   439  C  CG1   . ILE B 2 29  ? 18.864  16.126  2.774  1.00 18.01 ? 29  ILE A CG1   1 
ATOM   440  C  CG2   . ILE B 2 29  ? 20.781  14.535  2.367  1.00 19.46 ? 29  ILE A CG2   1 
ATOM   441  C  CD1   . ILE B 2 29  ? 17.698  15.239  2.494  1.00 14.86 ? 29  ILE A CD1   1 
ATOM   442  N  N     . VAL B 2 30  ? 23.483  16.661  1.583  1.00 16.85 ? 30  VAL A N     1 
ATOM   443  C  CA    . VAL B 2 30  ? 24.673  16.382  0.759  1.00 15.81 ? 30  VAL A CA    1 
ATOM   444  C  C     . VAL B 2 30  ? 25.645  15.399  1.447  1.00 16.56 ? 30  VAL A C     1 
ATOM   445  O  O     . VAL B 2 30  ? 25.410  14.974  2.590  1.00 15.73 ? 30  VAL A O     1 
ATOM   446  C  CB    . VAL B 2 30  ? 25.431  17.689  0.382  1.00 15.92 ? 30  VAL A CB    1 
ATOM   447  C  CG1   . VAL B 2 30  ? 24.470  18.729  -0.221 1.00 14.50 ? 30  VAL A CG1   1 
ATOM   448  C  CG2   . VAL B 2 30  ? 26.161  18.264  1.593  1.00 13.08 ? 30  VAL A CG2   1 
ATOM   449  N  N     . ASN B 2 31  ? 26.722  15.031  0.745  1.00 14.69 ? 31  ASN A N     1 
ATOM   450  C  CA    . ASN B 2 31  ? 27.806  14.255  1.346  1.00 14.40 ? 31  ASN A CA    1 
ATOM   451  C  C     . ASN B 2 31  ? 27.367  12.927  1.991  1.00 14.29 ? 31  ASN A C     1 
ATOM   452  O  O     . ASN B 2 31  ? 27.656  12.679  3.153  1.00 13.09 ? 31  ASN A O     1 
ATOM   453  C  CB    . ASN B 2 31  ? 28.546  15.108  2.382  1.00 15.20 ? 31  ASN A CB    1 
ATOM   454  C  CG    . ASN B 2 31  ? 29.883  14.502  2.791  1.00 15.51 ? 31  ASN A CG    1 
ATOM   455  O  OD1   . ASN B 2 31  ? 30.575  13.887  1.972  1.00 16.58 ? 31  ASN A OD1   1 
ATOM   456  N  ND2   . ASN B 2 31  ? 30.243  14.660  4.059  1.00 12.16 ? 31  ASN A ND2   1 
ATOM   457  N  N     . PRO B 2 32  ? 26.646  12.083  1.241  1.00 14.78 ? 32  PRO A N     1 
ATOM   458  C  CA    . PRO B 2 32  ? 26.222  10.801  1.787  1.00 15.30 ? 32  PRO A CA    1 
ATOM   459  C  C     . PRO B 2 32  ? 27.390  9.840   1.956  1.00 16.37 ? 32  PRO A C     1 
ATOM   460  O  O     . PRO B 2 32  ? 28.216  9.722   1.054  1.00 16.59 ? 32  PRO A O     1 
ATOM   461  C  CB    . PRO B 2 32  ? 25.271  10.271  0.713  1.00 15.85 ? 32  PRO A CB    1 
ATOM   462  C  CG    . PRO B 2 32  ? 25.639  11.026  -0.539 1.00 14.57 ? 32  PRO A CG    1 
ATOM   463  C  CD    . PRO B 2 32  ? 25.989  12.372  -0.045 1.00 14.79 ? 32  PRO A CD    1 
ATOM   464  N  N     . MET B 2 33  ? 27.466  9.180   3.111  1.00 15.97 ? 33  MET A N     1 
ATOM   465  C  CA    . MET B 2 33  ? 28.387  8.061   3.306  1.00 16.65 ? 33  MET A CA    1 
ATOM   466  C  C     . MET B 2 33  ? 27.668  6.857   3.891  1.00 17.22 ? 33  MET A C     1 
ATOM   467  O  O     . MET B 2 33  ? 26.797  7.009   4.750  1.00 16.89 ? 33  MET A O     1 
ATOM   468  C  CB    . MET B 2 33  ? 29.518  8.445   4.253  1.00 17.06 ? 33  MET A CB    1 
ATOM   469  C  CG    . MET B 2 33  ? 30.102  9.825   4.052  1.00 17.75 ? 33  MET A CG    1 
ATOM   470  S  SD    . MET B 2 33  ? 31.458  10.047  5.225  1.00 21.25 ? 33  MET A SD    1 
ATOM   471  C  CE    . MET B 2 33  ? 30.619  10.886  6.572  1.00 16.84 ? 33  MET A CE    1 
ATOM   472  N  N     . SER B 2 34  ? 28.140  5.662   3.543  1.00 17.74 ? 34  SER A N     1 
ATOM   473  C  CA    . SER B 2 34  ? 27.733  4.447   4.257  1.00 18.74 ? 34  SER A CA    1 
ATOM   474  C  C     . SER B 2 34  ? 28.770  3.340   4.149  1.00 17.87 ? 34  SER A C     1 
ATOM   475  O  O     . SER B 2 34  ? 29.397  3.170   3.112  1.00 16.79 ? 34  SER A O     1 
ATOM   476  C  CB    . SER B 2 34  ? 26.387  3.938   3.734  1.00 19.21 ? 34  SER A CB    1 
ATOM   477  O  OG    . SER B 2 34  ? 26.498  3.496   2.391  1.00 22.11 ? 34  SER A OG    1 
ATOM   478  N  N     . HIS B 2 35  ? 28.848  2.520   5.191  1.00 16.89 ? 35  HIS A N     1 
ATOM   479  C  CA    . HIS B 2 35  ? 29.708  1.348   5.198  1.00 15.28 ? 35  HIS A CA    1 
ATOM   480  C  C     . HIS B 2 35  ? 28.973  0.155   5.801  1.00 14.27 ? 35  HIS A C     1 
ATOM   481  O  O     . HIS B 2 35  ? 28.329  0.270   6.846  1.00 14.27 ? 35  HIS A O     1 
ATOM   482  C  CB    . HIS B 2 35  ? 30.968  1.634   6.012  1.00 16.08 ? 35  HIS A CB    1 
ATOM   483  C  CG    . HIS B 2 35  ? 31.789  2.760   5.471  1.00 20.82 ? 35  HIS A CG    1 
ATOM   484  N  ND1   . HIS B 2 35  ? 31.652  4.060   5.910  1.00 23.12 ? 35  HIS A ND1   1 
ATOM   485  C  CD2   . HIS B 2 35  ? 32.710  2.793   4.478  1.00 20.82 ? 35  HIS A CD2   1 
ATOM   486  C  CE1   . HIS B 2 35  ? 32.452  4.846   5.208  1.00 21.62 ? 35  HIS A CE1   1 
ATOM   487  N  NE2   . HIS B 2 35  ? 33.100  4.102   4.329  1.00 20.94 ? 35  HIS A NE2   1 
ATOM   488  N  N     . LEU B 2 36  ? 29.079  -0.993  5.148  1.00 13.32 ? 36  LEU A N     1 
ATOM   489  C  CA    . LEU B 2 36  ? 28.815  -2.257  5.810  1.00 14.35 ? 36  LEU A CA    1 
ATOM   490  C  C     . LEU B 2 36  ? 29.986  -2.603  6.703  1.00 15.20 ? 36  LEU A C     1 
ATOM   491  O  O     . LEU B 2 36  ? 31.128  -2.296  6.366  1.00 17.54 ? 36  LEU A O     1 
ATOM   492  C  CB    . LEU B 2 36  ? 28.595  -3.361  4.786  1.00 14.40 ? 36  LEU A CB    1 
ATOM   493  C  CG    . LEU B 2 36  ? 27.257  -3.372  4.058  1.00 13.72 ? 36  LEU A CG    1 
ATOM   494  C  CD1   . LEU B 2 36  ? 27.337  -4.320  2.862  1.00 11.38 ? 36  LEU A CD1   1 
ATOM   495  C  CD2   . LEU B 2 36  ? 26.138  -3.797  5.036  1.00 11.80 ? 36  LEU A CD2   1 
ATOM   496  N  N     . VAL B 2 37  ? 29.693  -3.157  7.875  1.00 15.09 ? 37  VAL A N     1 
ATOM   497  C  CA    . VAL B 2 37  ? 30.689  -3.343  8.928  1.00 16.45 ? 37  VAL A CA    1 
ATOM   498  C  C     . VAL B 2 37  ? 30.582  -4.765  9.459  1.00 18.05 ? 37  VAL A C     1 
ATOM   499  O  O     . VAL B 2 37  ? 29.486  -5.313  9.557  1.00 17.87 ? 37  VAL A O     1 
ATOM   500  C  CB    . VAL B 2 37  ? 30.447  -2.369  10.102 1.00 17.32 ? 37  VAL A CB    1 
ATOM   501  C  CG1   . VAL B 2 37  ? 31.416  -2.636  11.248 1.00 12.51 ? 37  VAL A CG1   1 
ATOM   502  C  CG2   . VAL B 2 37  ? 30.546  -0.915  9.618  1.00 18.23 ? 37  VAL A CG2   1 
ATOM   503  N  N     . ARG B 2 38  ? 31.724  -5.361  9.784  1.00 18.75 ? 38  ARG A N     1 
ATOM   504  C  CA    . ARG B 2 38  ? 31.755  -6.666  10.423 1.00 18.17 ? 38  ARG A CA    1 
ATOM   505  C  C     . ARG B 2 38  ? 31.546  -6.467  11.917 1.00 17.84 ? 38  ARG A C     1 
ATOM   506  O  O     . ARG B 2 38  ? 32.301  -5.735  12.561 1.00 17.45 ? 38  ARG A O     1 
ATOM   507  C  CB    . ARG B 2 38  ? 33.100  -7.359  10.141 1.00 18.98 ? 38  ARG A CB    1 
ATOM   508  C  CG    . ARG B 2 38  ? 33.398  -8.601  10.989 1.00 20.12 ? 38  ARG A CG    1 
ATOM   509  C  CD    . ARG B 2 38  ? 33.506  -9.848  10.121 1.00 24.20 ? 38  ARG A CD    1 
ATOM   510  N  NE    . ARG B 2 38  ? 33.533  -11.071 10.922 1.00 29.11 ? 38  ARG A NE    1 
ATOM   511  C  CZ    . ARG B 2 38  ? 34.603  -11.849 11.071 1.00 27.95 ? 38  ARG A CZ    1 
ATOM   512  N  NH1   . ARG B 2 38  ? 35.736  -11.557 10.443 1.00 25.45 ? 38  ARG A NH1   1 
ATOM   513  N  NH2   . ARG B 2 38  ? 34.529  -12.934 11.829 1.00 25.93 ? 38  ARG A NH2   1 
ATOM   514  N  N     . PRO B 2 39  ? 30.475  -7.060  12.461 1.00 17.32 ? 39  PRO A N     1 
ATOM   515  C  CA    . PRO B 2 39  ? 30.137  -6.856  13.853 1.00 17.63 ? 39  PRO A CA    1 
ATOM   516  C  C     . PRO B 2 39  ? 31.034  -7.660  14.775 1.00 19.03 ? 39  PRO A C     1 
ATOM   517  O  O     . PRO B 2 39  ? 31.462  -8.780  14.434 1.00 20.22 ? 39  PRO A O     1 
ATOM   518  C  CB    . PRO B 2 39  ? 28.694  -7.366  13.959 1.00 16.53 ? 39  PRO A CB    1 
ATOM   519  C  CG    . PRO B 2 39  ? 28.322  -7.846  12.614 1.00 18.87 ? 39  PRO A CG    1 
ATOM   520  C  CD    . PRO B 2 39  ? 29.556  -7.995  11.809 1.00 17.01 ? 39  PRO A CD    1 
ATOM   521  N  N     . ASP B 2 40  ? 31.224  -7.125  15.973 1.00 18.05 ? 40  ASP A N     1 
ATOM   522  C  CA    . ASP B 2 40  ? 31.958  -7.778  17.018 1.00 18.51 ? 40  ASP A CA    1 
ATOM   523  C  C     . ASP B 2 40  ? 31.188  -8.968  17.617 1.00 17.65 ? 40  ASP A C     1 
ATOM   524  O  O     . ASP B 2 40  ? 31.623  -9.560  18.603 1.00 17.27 ? 40  ASP A O     1 
ATOM   525  C  CB    . ASP B 2 40  ? 32.289  -6.754  18.107 1.00 19.45 ? 40  ASP A CB    1 
ATOM   526  C  CG    . ASP B 2 40  ? 31.070  -6.350  18.917 1.00 23.62 ? 40  ASP A CG    1 
ATOM   527  O  OD1   . ASP B 2 40  ? 29.943  -6.423  18.383 1.00 30.21 ? 40  ASP A OD1   1 
ATOM   528  O  OD2   . ASP B 2 40  ? 31.230  -6.022  20.107 1.00 25.58 ? 40  ASP A OD2   1 
ATOM   529  N  N     . ARG B 2 41  ? 30.047  -9.313  17.028 1.00 16.67 ? 41  ARG A N     1 
ATOM   530  C  CA    . ARG B 2 41  ? 29.199  -10.372 17.591 1.00 16.52 ? 41  ARG A CA    1 
ATOM   531  C  C     . ARG B 2 41  ? 28.218  -10.929 16.564 1.00 14.92 ? 41  ARG A C     1 
ATOM   532  O  O     . ARG B 2 41  ? 28.168  -10.455 15.439 1.00 13.92 ? 41  ARG A O     1 
ATOM   533  C  CB    . ARG B 2 41  ? 28.465  -9.883  18.860 1.00 17.27 ? 41  ARG A CB    1 
ATOM   534  C  CG    . ARG B 2 41  ? 27.082  -9.239  18.610 1.00 17.03 ? 41  ARG A CG    1 
ATOM   535  C  CD    . ARG B 2 41  ? 26.644  -8.405  19.807 1.00 13.64 ? 41  ARG A CD    1 
ATOM   536  N  NE    . ARG B 2 41  ? 27.606  -7.343  20.072 1.00 16.04 ? 41  ARG A NE    1 
ATOM   537  C  CZ    . ARG B 2 41  ? 27.571  -6.532  21.128 1.00 18.54 ? 41  ARG A CZ    1 
ATOM   538  N  NH1   . ARG B 2 41  ? 26.626  -6.666  22.052 1.00 19.14 ? 41  ARG A NH1   1 
ATOM   539  N  NH2   . ARG B 2 41  ? 28.499  -5.596  21.270 1.00 14.71 ? 41  ARG A NH2   1 
ATOM   540  N  N     . PRO B 2 42  ? 27.503  -12.005 16.925 1.00 14.27 ? 42  PRO A N     1 
ATOM   541  C  CA    . PRO B 2 42  ? 26.613  -12.621 15.932 1.00 14.15 ? 42  PRO A CA    1 
ATOM   542  C  C     . PRO B 2 42  ? 25.414  -11.722 15.645 1.00 14.53 ? 42  PRO A C     1 
ATOM   543  O  O     . PRO B 2 42  ? 24.849  -11.134 16.568 1.00 14.98 ? 42  PRO A O     1 
ATOM   544  C  CB    . PRO B 2 42  ? 26.146  -13.926 16.614 1.00 12.91 ? 42  PRO A CB    1 
ATOM   545  C  CG    . PRO B 2 42  ? 27.164  -14.196 17.697 1.00 15.28 ? 42  PRO A CG    1 
ATOM   546  C  CD    . PRO B 2 42  ? 27.683  -12.838 18.131 1.00 13.05 ? 42  PRO A CD    1 
ATOM   547  N  N     . ILE B 2 43  ? 24.987  -11.689 14.390 1.00 13.70 ? 43  ILE A N     1 
ATOM   548  C  CA    . ILE B 2 43  ? 23.724  -11.072 14.034 1.00 14.63 ? 43  ILE A CA    1 
ATOM   549  C  C     . ILE B 2 43  ? 22.523  -11.927 14.459 1.00 15.84 ? 43  ILE A C     1 
ATOM   550  O  O     . ILE B 2 43  ? 22.212  -12.943 13.828 1.00 17.22 ? 43  ILE A O     1 
ATOM   551  C  CB    . ILE B 2 43  ? 23.649  -10.764 12.516 1.00 13.38 ? 43  ILE A CB    1 
ATOM   552  C  CG1   . ILE B 2 43  ? 24.862  -9.916  12.085 1.00 11.62 ? 43  ILE A CG1   1 
ATOM   553  C  CG2   . ILE B 2 43  ? 22.392  -10.032 12.221 1.00 11.82 ? 43  ILE A CG2   1 
ATOM   554  C  CD1   . ILE B 2 43  ? 25.010  -9.744  10.622 1.00 4.48  ? 43  ILE A CD1   1 
ATOM   555  N  N     . SER B 2 44  ? 21.833  -11.478 15.504 1.00 15.11 ? 44  SER A N     1 
ATOM   556  C  CA    . SER B 2 44  ? 20.662  -12.167 16.017 1.00 16.33 ? 44  SER A CA    1 
ATOM   557  C  C     . SER B 2 44  ? 19.586  -12.177 14.950 1.00 17.05 ? 44  SER A C     1 
ATOM   558  O  O     . SER B 2 44  ? 19.538  -11.280 14.108 1.00 17.91 ? 44  SER A O     1 
ATOM   559  C  CB    . SER B 2 44  ? 20.138  -11.462 17.272 1.00 16.30 ? 44  SER A CB    1 
ATOM   560  O  OG    . SER B 2 44  ? 19.453  -10.272 16.921 1.00 17.50 ? 44  SER A OG    1 
ATOM   561  N  N     . PRO B 2 45  ? 18.743  -13.221 14.946 1.00 16.78 ? 45  PRO A N     1 
ATOM   562  C  CA    . PRO B 2 45  ? 17.698  -13.305 13.919 1.00 15.66 ? 45  PRO A CA    1 
ATOM   563  C  C     . PRO B 2 45  ? 16.645  -12.191 14.047 1.00 15.42 ? 45  PRO A C     1 
ATOM   564  O  O     . PRO B 2 45  ? 16.066  -11.776 13.041 1.00 15.82 ? 45  PRO A O     1 
ATOM   565  C  CB    . PRO B 2 45  ? 17.079  -14.693 14.148 1.00 15.19 ? 45  PRO A CB    1 
ATOM   566  C  CG    . PRO B 2 45  ? 17.532  -15.123 15.486 1.00 15.61 ? 45  PRO A CG    1 
ATOM   567  C  CD    . PRO B 2 45  ? 18.841  -14.448 15.752 1.00 16.55 ? 45  PRO A CD    1 
ATOM   568  N  N     . GLN B 2 46  ? 16.464  -11.666 15.263 1.00 14.76 ? 46  GLN A N     1 
ATOM   569  C  CA    . GLN B 2 46  ? 15.547  -10.537 15.504 1.00 13.38 ? 46  GLN A CA    1 
ATOM   570  C  C     . GLN B 2 46  ? 15.986  -9.268  14.772 1.00 13.74 ? 46  GLN A C     1 
ATOM   571  O  O     . GLN B 2 46  ? 15.185  -8.599  14.125 1.00 13.93 ? 46  GLN A O     1 
ATOM   572  C  CB    . GLN B 2 46  ? 15.434  -10.246 16.996 1.00 12.06 ? 46  GLN A CB    1 
ATOM   573  C  CG    . GLN B 2 46  ? 14.783  -11.359 17.796 1.00 13.25 ? 46  GLN A CG    1 
ATOM   574  C  CD    . GLN B 2 46  ? 15.789  -12.412 18.299 1.00 16.18 ? 46  GLN A CD    1 
ATOM   575  O  OE1   . GLN B 2 46  ? 17.005  -12.258 18.152 1.00 13.76 ? 46  GLN A OE1   1 
ATOM   576  N  NE2   . GLN B 2 46  ? 15.271  -13.504 18.855 1.00 13.09 ? 46  GLN A NE2   1 
ATOM   577  N  N     . ALA B 2 47  ? 17.271  -8.954  14.856 1.00 13.81 ? 47  ALA A N     1 
ATOM   578  C  CA    . ALA B 2 47  ? 17.812  -7.845  14.105 1.00 12.78 ? 47  ALA A CA    1 
ATOM   579  C  C     . ALA B 2 47  ? 17.797  -8.135  12.612 1.00 13.31 ? 47  ALA A C     1 
ATOM   580  O  O     . ALA B 2 47  ? 17.458  -7.261  11.827 1.00 16.01 ? 47  ALA A O     1 
ATOM   581  C  CB    . ALA B 2 47  ? 19.218  -7.516  14.586 1.00 12.81 ? 47  ALA A CB    1 
ATOM   582  N  N     . MET B 2 48  ? 18.134  -9.363  12.219 1.00 13.00 ? 48  MET A N     1 
ATOM   583  C  CA    . MET B 2 48  ? 18.245  -9.702  10.790 1.00 14.62 ? 48  MET A CA    1 
ATOM   584  C  C     . MET B 2 48  ? 16.914  -9.601  10.044 1.00 14.73 ? 48  MET A C     1 
ATOM   585  O  O     . MET B 2 48  ? 16.872  -9.254  8.864  1.00 16.21 ? 48  MET A O     1 
ATOM   586  C  CB    . MET B 2 48  ? 18.855  -11.095 10.594 1.00 13.71 ? 48  MET A CB    1 
ATOM   587  C  CG    . MET B 2 48  ? 19.451  -11.323 9.201  1.00 14.26 ? 48  MET A CG    1 
ATOM   588  S  SD    . MET B 2 48  ? 20.292  -12.939 9.016  1.00 16.53 ? 48  MET A SD    1 
ATOM   589  C  CE    . MET B 2 48  ? 21.705  -12.762 10.109 1.00 5.03  ? 48  MET A CE    1 
ATOM   590  N  N     . ALA B 2 49  ? 15.826  -9.929  10.725 1.00 14.74 ? 49  ALA A N     1 
ATOM   591  C  CA    . ALA B 2 49  ? 14.499  -9.768  10.141 1.00 15.12 ? 49  ALA A CA    1 
ATOM   592  C  C     . ALA B 2 49  ? 14.173  -8.297  9.823  1.00 14.38 ? 49  ALA A C     1 
ATOM   593  O  O     . ALA B 2 49  ? 13.336  -8.007  8.970  1.00 14.81 ? 49  ALA A O     1 
ATOM   594  C  CB    . ALA B 2 49  ? 13.436  -10.370 11.065 1.00 15.06 ? 49  ALA A CB    1 
ATOM   595  N  N     . ILE B 2 50  ? 14.850  -7.379  10.496 1.00 13.18 ? 50  ILE A N     1 
ATOM   596  C  CA    . ILE B 2 50  ? 14.615  -5.964  10.284 1.00 13.00 ? 50  ILE A CA    1 
ATOM   597  C  C     . ILE B 2 50  ? 15.493  -5.439  9.153  1.00 13.43 ? 50  ILE A C     1 
ATOM   598  O  O     . ILE B 2 50  ? 14.989  -5.078  8.087  1.00 14.37 ? 50  ILE A O     1 
ATOM   599  C  CB    . ILE B 2 50  ? 14.836  -5.149  11.593 1.00 14.57 ? 50  ILE A CB    1 
ATOM   600  C  CG1   . ILE B 2 50  ? 13.826  -5.588  12.658 1.00 8.33  ? 50  ILE A CG1   1 
ATOM   601  C  CG2   . ILE B 2 50  ? 14.696  -3.642  11.335 1.00 12.77 ? 50  ILE A CG2   1 
ATOM   602  C  CD1   . ILE B 2 50  ? 14.275  -5.310  14.039 1.00 9.73  ? 50  ILE A CD1   1 
ATOM   603  N  N     . HIS B 2 51  ? 16.806  -5.462  9.349  1.00 13.29 ? 51  HIS A N     1 
ATOM   604  C  CA    . HIS B 2 51  ? 17.703  -4.803  8.408  1.00 12.65 ? 51  HIS A CA    1 
ATOM   605  C  C     . HIS B 2 51  ? 18.008  -5.667  7.216  1.00 12.83 ? 51  HIS A C     1 
ATOM   606  O  O     . HIS B 2 51  ? 18.356  -5.157  6.160  1.00 14.47 ? 51  HIS A O     1 
ATOM   607  C  CB    . HIS B 2 51  ? 18.993  -4.343  9.073  1.00 12.10 ? 51  HIS A CB    1 
ATOM   608  C  CG    . HIS B 2 51  ? 19.708  -5.422  9.822  1.00 10.08 ? 51  HIS A CG    1 
ATOM   609  N  ND1   . HIS B 2 51  ? 20.310  -6.489  9.190  1.00 13.03 ? 51  HIS A ND1   1 
ATOM   610  C  CD2   . HIS B 2 51  ? 20.003  -5.547  11.137 1.00 5.87  ? 51  HIS A CD2   1 
ATOM   611  C  CE1   . HIS B 2 51  ? 20.907  -7.250  10.092 1.00 13.05 ? 51  HIS A CE1   1 
ATOM   612  N  NE2   . HIS B 2 51  ? 20.764  -6.682  11.275 1.00 10.29 ? 51  HIS A NE2   1 
ATOM   613  N  N     . ARG B 2 52  ? 17.877  -6.976  7.373  1.00 13.59 ? 52  ARG A N     1 
ATOM   614  C  CA    . ARG B 2 52  ? 18.001  -7.888  6.229  1.00 15.29 ? 52  ARG A CA    1 
ATOM   615  C  C     . ARG B 2 52  ? 19.464  -8.123  5.806  1.00 14.46 ? 52  ARG A C     1 
ATOM   616  O  O     . ARG B 2 52  ? 19.735  -8.439  4.642  1.00 12.20 ? 52  ARG A O     1 
ATOM   617  C  CB    . ARG B 2 52  ? 17.217  -7.325  5.040  1.00 15.45 ? 52  ARG A CB    1 
ATOM   618  C  CG    . ARG B 2 52  ? 16.298  -8.315  4.360  1.00 24.18 ? 52  ARG A CG    1 
ATOM   619  C  CD    . ARG B 2 52  ? 14.834  -8.084  4.730  1.00 29.87 ? 52  ARG A CD    1 
ATOM   620  N  NE    . ARG B 2 52  ? 14.406  -8.970  5.808  1.00 37.88 ? 52  ARG A NE    1 
ATOM   621  C  CZ    . ARG B 2 52  ? 13.174  -9.463  5.933  1.00 43.09 ? 52  ARG A CZ    1 
ATOM   622  N  NH1   . ARG B 2 52  ? 12.239  -9.160  5.037  1.00 48.22 ? 52  ARG A NH1   1 
ATOM   623  N  NH2   . ARG B 2 52  ? 12.864  -10.228 6.975  1.00 38.83 ? 52  ARG A NH2   1 
ATOM   624  N  N     . ILE B 2 53  ? 20.403  -7.882  6.723  1.00 14.54 ? 53  ILE A N     1 
ATOM   625  C  CA    . ILE B 2 53  ? 21.829  -8.044  6.421  1.00 14.98 ? 53  ILE A CA    1 
ATOM   626  C  C     . ILE B 2 53  ? 22.368  -9.347  7.004  1.00 15.60 ? 53  ILE A C     1 
ATOM   627  O  O     . ILE B 2 53  ? 22.297  -9.568  8.209  1.00 16.21 ? 53  ILE A O     1 
ATOM   628  C  CB    . ILE B 2 53  ? 22.664  -6.871  6.959  1.00 14.27 ? 53  ILE A CB    1 
ATOM   629  C  CG1   . ILE B 2 53  ? 22.125  -5.544  6.434  1.00 16.14 ? 53  ILE A CG1   1 
ATOM   630  C  CG2   . ILE B 2 53  ? 24.114  -7.017  6.562  1.00 12.80 ? 53  ILE A CG2   1 
ATOM   631  C  CD1   . ILE B 2 53  ? 22.560  -4.322  7.289  1.00 16.97 ? 53  ILE A CD1   1 
ATOM   632  N  N     . THR B 2 54  ? 22.905  -10.209 6.138  1.00 17.57 ? 54  THR A N     1 
ATOM   633  C  CA    . THR B 2 54  ? 23.310  -11.560 6.535  1.00 18.42 ? 54  THR A CA    1 
ATOM   634  C  C     . THR B 2 54  ? 24.737  -11.532 7.029  1.00 18.78 ? 54  THR A C     1 
ATOM   635  O  O     . THR B 2 54  ? 25.470  -10.597 6.731  1.00 20.49 ? 54  THR A O     1 
ATOM   636  C  CB    . THR B 2 54  ? 23.233  -12.518 5.352  1.00 18.56 ? 54  THR A CB    1 
ATOM   637  O  OG1   . THR B 2 54  ? 23.866  -11.910 4.231  1.00 20.19 ? 54  THR A OG1   1 
ATOM   638  C  CG2   . THR B 2 54  ? 21.798  -12.798 4.975  1.00 18.41 ? 54  THR A CG2   1 
ATOM   639  N  N     . GLU B 2 55  ? 25.152  -12.577 7.743  1.00 20.03 ? 55  GLU A N     1 
ATOM   640  C  CA    . GLU B 2 55  ? 26.560  -12.718 8.139  1.00 19.68 ? 55  GLU A CA    1 
ATOM   641  C  C     . GLU B 2 55  ? 27.511  -12.667 6.932  1.00 19.37 ? 55  GLU A C     1 
ATOM   642  O  O     . GLU B 2 55  ? 28.551  -12.006 6.986  1.00 19.56 ? 55  GLU A O     1 
ATOM   643  C  CB    . GLU B 2 55  ? 26.791  -13.992 8.965  1.00 18.75 ? 55  GLU A CB    1 
ATOM   644  C  CG    . GLU B 2 55  ? 25.994  -14.048 10.267 1.00 19.97 ? 55  GLU A CG    1 
ATOM   645  C  CD    . GLU B 2 55  ? 26.672  -13.324 11.433 1.00 23.60 ? 55  GLU A CD    1 
ATOM   646  O  OE1   . GLU B 2 55  ? 27.490  -12.410 11.197 1.00 29.11 ? 55  GLU A OE1   1 
ATOM   647  O  OE2   . GLU B 2 55  ? 26.345  -13.643 12.595 1.00 26.53 ? 55  GLU A OE2   1 
ATOM   648  N  N     . ALA B 2 56  ? 27.100  -13.281 5.826  1.00 17.64 ? 56  ALA A N     1 
ATOM   649  C  CA    . ALA B 2 56  ? 27.932  -13.365 4.630  1.00 18.70 ? 56  ALA A CA    1 
ATOM   650  C  C     . ALA B 2 56  ? 28.116  -12.002 3.974  1.00 20.20 ? 56  ALA A C     1 
ATOM   651  O  O     . ALA B 2 56  ? 29.082  -11.774 3.220  1.00 19.64 ? 56  ALA A O     1 
ATOM   652  C  CB    . ALA B 2 56  ? 27.325  -14.335 3.638  1.00 19.04 ? 56  ALA A CB    1 
ATOM   653  N  N     . MET B 2 57  ? 27.151  -11.119 4.202  1.00 19.51 ? 57  MET A N     1 
ATOM   654  C  CA    . MET B 2 57  ? 27.213  -9.785  3.652  1.00 19.84 ? 57  MET A CA    1 
ATOM   655  C  C     . MET B 2 57  ? 28.295  -8.941  4.294  1.00 18.55 ? 57  MET A C     1 
ATOM   656  O  O     . MET B 2 57  ? 28.783  -8.011  3.685  1.00 20.51 ? 57  MET A O     1 
ATOM   657  C  CB    . MET B 2 57  ? 25.862  -9.090  3.761  1.00 20.52 ? 57  MET A CB    1 
ATOM   658  C  CG    . MET B 2 57  ? 24.986  -9.313  2.552  1.00 20.23 ? 57  MET A CG    1 
ATOM   659  S  SD    . MET B 2 57  ? 23.268  -8.859  2.860  1.00 22.32 ? 57  MET A SD    1 
ATOM   660  C  CE    . MET B 2 57  ? 23.285  -7.118  2.398  1.00 19.69 ? 57  MET A CE    1 
ATOM   661  N  N     . VAL B 2 58  ? 28.692  -9.278  5.512  1.00 18.78 ? 58  VAL A N     1 
ATOM   662  C  CA    . VAL B 2 58  ? 29.628  -8.425  6.253  1.00 18.94 ? 58  VAL A CA    1 
ATOM   663  C  C     . VAL B 2 58  ? 30.815  -9.235  6.778  1.00 20.99 ? 58  VAL A C     1 
ATOM   664  O  O     . VAL B 2 58  ? 31.534  -8.786  7.672  1.00 21.72 ? 58  VAL A O     1 
ATOM   665  C  CB    . VAL B 2 58  ? 28.938  -7.703  7.455  1.00 18.52 ? 58  VAL A CB    1 
ATOM   666  C  CG1   . VAL B 2 58  ? 27.824  -6.771  6.980  1.00 15.28 ? 58  VAL A CG1   1 
ATOM   667  C  CG2   . VAL B 2 58  ? 28.401  -8.718  8.439  1.00 16.76 ? 58  VAL A CG2   1 
ATOM   668  N  N     . ALA B 2 59  ? 31.011  -10.437 6.232  1.00 21.82 ? 59  ALA A N     1 
ATOM   669  C  CA    . ALA B 2 59  ? 32.049  -11.332 6.739  1.00 22.07 ? 59  ALA A CA    1 
ATOM   670  C  C     . ALA B 2 59  ? 33.453  -10.778 6.515  1.00 23.00 ? 59  ALA A C     1 
ATOM   671  O  O     . ALA B 2 59  ? 34.299  -10.886 7.390  1.00 24.05 ? 59  ALA A O     1 
ATOM   672  C  CB    . ALA B 2 59  ? 31.919  -12.717 6.136  1.00 21.77 ? 59  ALA A CB    1 
ATOM   673  N  N     . ASP B 2 60  ? 33.704  -10.171 5.360  1.00 23.07 ? 60  ASP A N     1 
ATOM   674  C  CA    . ASP B 2 60  ? 35.017  -9.575  5.130  1.00 25.09 ? 60  ASP A CA    1 
ATOM   675  C  C     . ASP B 2 60  ? 34.974  -8.054  4.991  1.00 24.01 ? 60  ASP A C     1 
ATOM   676  O  O     . ASP B 2 60  ? 35.773  -7.460  4.258  1.00 23.70 ? 60  ASP A O     1 
ATOM   677  C  CB    . ASP B 2 60  ? 35.693  -10.202 3.916  1.00 27.04 ? 60  ASP A CB    1 
ATOM   678  C  CG    . ASP B 2 60  ? 34.737  -10.439 2.803  1.00 33.21 ? 60  ASP A CG    1 
ATOM   679  O  OD1   . ASP B 2 60  ? 34.011  -9.477  2.456  1.00 40.32 ? 60  ASP A OD1   1 
ATOM   680  O  OD2   . ASP B 2 60  ? 34.615  -11.613 2.365  1.00 38.82 ? 60  ASP A OD2   1 
ATOM   681  N  N     . LYS B 2 61  ? 34.092  -7.424  5.758  1.00 21.76 ? 61  LYS A N     1 
ATOM   682  C  CA    . LYS B 2 61  ? 34.136  -5.989  5.930  1.00 18.04 ? 61  LYS A CA    1 
ATOM   683  C  C     . LYS B 2 61  ? 34.975  -5.609  7.121  1.00 16.64 ? 61  LYS A C     1 
ATOM   684  O  O     . LYS B 2 61  ? 35.321  -6.450  7.956  1.00 16.58 ? 61  LYS A O     1 
ATOM   685  C  CB    . LYS B 2 61  ? 32.732  -5.412  6.079  1.00 18.55 ? 61  LYS A CB    1 
ATOM   686  C  CG    . LYS B 2 61  ? 31.787  -5.785  4.959  1.00 18.77 ? 61  LYS A CG    1 
ATOM   687  C  CD    . LYS B 2 61  ? 32.299  -5.299  3.645  1.00 17.69 ? 61  LYS A CD    1 
ATOM   688  C  CE    . LYS B 2 61  ? 31.177  -4.803  2.800  1.00 18.08 ? 61  LYS A CE    1 
ATOM   689  N  NZ    . LYS B 2 61  ? 31.416  -5.128  1.378  1.00 20.99 ? 61  LYS A NZ    1 
ATOM   690  N  N     . PRO B 2 62  ? 35.336  -4.332  7.191  1.00 16.00 ? 62  PRO A N     1 
ATOM   691  C  CA    . PRO B 2 62  ? 36.139  -3.791  8.272  1.00 15.56 ? 62  PRO A CA    1 
ATOM   692  C  C     . PRO B 2 62  ? 35.336  -3.694  9.566  1.00 15.79 ? 62  PRO A C     1 
ATOM   693  O  O     . PRO B 2 62  ? 34.105  -3.699  9.521  1.00 16.34 ? 62  PRO A O     1 
ATOM   694  C  CB    . PRO B 2 62  ? 36.518  -2.405  7.760  1.00 16.75 ? 62  PRO A CB    1 
ATOM   695  C  CG    . PRO B 2 62  ? 35.533  -2.103  6.664  1.00 15.92 ? 62  PRO A CG    1 
ATOM   696  C  CD    . PRO B 2 62  ? 35.218  -3.399  6.057  1.00 16.26 ? 62  PRO A CD    1 
ATOM   697  N  N     . TRP B 2 63  ? 36.024  -3.756  10.707 1.00 15.16 ? 63  TRP A N     1 
ATOM   698  C  CA    . TRP B 2 63  ? 35.385  -3.543  12.000 1.00 16.52 ? 63  TRP A CA    1 
ATOM   699  C  C     . TRP B 2 63  ? 34.997  -2.064  12.197 1.00 16.33 ? 63  TRP A C     1 
ATOM   700  O  O     . TRP B 2 63  ? 35.495  -1.172  11.503 1.00 16.18 ? 63  TRP A O     1 
ATOM   701  C  CB    . TRP B 2 63  ? 36.292  -4.023  13.148 1.00 17.40 ? 63  TRP A CB    1 
ATOM   702  C  CG    . TRP B 2 63  ? 37.017  -5.340  12.868 1.00 22.53 ? 63  TRP A CG    1 
ATOM   703  C  CD1   . TRP B 2 63  ? 38.244  -5.490  12.284 1.00 24.52 ? 63  TRP A CD1   1 
ATOM   704  C  CD2   . TRP B 2 63  ? 36.546  -6.667  13.148 1.00 23.66 ? 63  TRP A CD2   1 
ATOM   705  N  NE1   . TRP B 2 63  ? 38.573  -6.814  12.199 1.00 24.69 ? 63  TRP A NE1   1 
ATOM   706  C  CE2   . TRP B 2 63  ? 37.538  -7.564  12.695 1.00 27.47 ? 63  TRP A CE2   1 
ATOM   707  C  CE3   . TRP B 2 63  ? 35.393  -7.183  13.744 1.00 25.64 ? 63  TRP A CE3   1 
ATOM   708  C  CZ2   . TRP B 2 63  ? 37.407  -8.953  12.816 1.00 23.78 ? 63  TRP A CZ2   1 
ATOM   709  C  CZ3   . TRP B 2 63  ? 35.284  -8.559  13.905 1.00 27.65 ? 63  TRP A CZ3   1 
ATOM   710  C  CH2   . TRP B 2 63  ? 36.277  -9.428  13.421 1.00 28.42 ? 63  TRP A CH2   1 
ATOM   711  N  N     . ILE B 2 64  ? 34.095  -1.806  13.134 1.00 16.01 ? 64  ILE A N     1 
ATOM   712  C  CA    . ILE B 2 64  ? 33.654  -0.442  13.363 1.00 16.00 ? 64  ILE A CA    1 
ATOM   713  C  C     . ILE B 2 64  ? 34.843  0.494   13.607 1.00 16.87 ? 64  ILE A C     1 
ATOM   714  O  O     . ILE B 2 64  ? 34.864  1.606   13.108 1.00 17.25 ? 64  ILE A O     1 
ATOM   715  C  CB    . ILE B 2 64  ? 32.608  -0.350  14.513 1.00 15.65 ? 64  ILE A CB    1 
ATOM   716  C  CG1   . ILE B 2 64  ? 32.010  1.052   14.591 1.00 11.29 ? 64  ILE A CG1   1 
ATOM   717  C  CG2   . ILE B 2 64  ? 33.200  -0.787  15.838 1.00 13.70 ? 64  ILE A CG2   1 
ATOM   718  C  CD1   . ILE B 2 64  ? 31.465  1.535   13.267 1.00 12.46 ? 64  ILE A CD1   1 
ATOM   719  N  N     . GLU B 2 65  ? 35.860  -0.005  14.304 1.00 18.59 ? 65  GLU A N     1 
ATOM   720  C  CA    . GLU B 2 65  ? 37.033  0.787   14.648 1.00 20.08 ? 65  GLU A CA    1 
ATOM   721  C  C     . GLU B 2 65  ? 37.695  1.378   13.398 1.00 19.81 ? 65  GLU A C     1 
ATOM   722  O  O     . GLU B 2 65  ? 38.155  2.515   13.426 1.00 17.25 ? 65  GLU A O     1 
ATOM   723  C  CB    . GLU B 2 65  ? 38.053  -0.057  15.436 1.00 21.28 ? 65  GLU A CB    1 
ATOM   724  C  CG    . GLU B 2 65  ? 37.648  -0.382  16.884 1.00 25.74 ? 65  GLU A CG    1 
ATOM   725  C  CD    . GLU B 2 65  ? 36.665  -1.573  16.985 1.00 33.19 ? 65  GLU A CD    1 
ATOM   726  O  OE1   . GLU B 2 65  ? 35.914  -1.647  18.000 1.00 35.19 ? 65  GLU A OE1   1 
ATOM   727  O  OE2   . GLU B 2 65  ? 36.639  -2.424  16.053 1.00 23.73 ? 65  GLU A OE2   1 
ATOM   728  N  N     . ASP B 2 66  ? 37.752  0.600   12.314 1.00 19.90 ? 66  ASP A N     1 
ATOM   729  C  CA    . ASP B 2 66  ? 38.515  1.014   11.129 1.00 22.02 ? 66  ASP A CA    1 
ATOM   730  C  C     . ASP B 2 66  ? 37.707  1.946   10.238 1.00 21.25 ? 66  ASP A C     1 
ATOM   731  O  O     . ASP B 2 66  ? 38.160  2.326   9.155  1.00 22.98 ? 66  ASP A O     1 
ATOM   732  C  CB    . ASP B 2 66  ? 38.985  -0.193  10.292 1.00 22.80 ? 66  ASP A CB    1 
ATOM   733  C  CG    . ASP B 2 66  ? 39.523  -1.339  11.144 1.00 28.61 ? 66  ASP A CG    1 
ATOM   734  O  OD1   . ASP B 2 66  ? 40.329  -1.087  12.088 1.00 28.80 ? 66  ASP A OD1   1 
ATOM   735  O  OD2   . ASP B 2 66  ? 39.178  -2.504  10.817 1.00 32.84 ? 66  ASP A OD2   1 
ATOM   736  N  N     . VAL B 2 67  ? 36.459  2.186   10.618 1.00 19.13 ? 67  VAL A N     1 
ATOM   737  C  CA    . VAL B 2 67  ? 35.522  2.807   9.714  1.00 17.46 ? 67  VAL A CA    1 
ATOM   738  C  C     . VAL B 2 67  ? 34.875  4.044   10.338 1.00 16.78 ? 67  VAL A C     1 
ATOM   739  O  O     . VAL B 2 67  ? 34.490  4.965   9.629  1.00 16.35 ? 67  VAL A O     1 
ATOM   740  C  CB    . VAL B 2 67  ? 34.474  1.796   9.217  1.00 17.45 ? 67  VAL A CB    1 
ATOM   741  C  CG1   . VAL B 2 67  ? 33.083  2.308   9.426  1.00 15.88 ? 67  VAL A CG1   1 
ATOM   742  C  CG2   . VAL B 2 67  ? 34.717  1.452   7.760  1.00 20.36 ? 67  VAL A CG2   1 
ATOM   743  N  N     . ILE B 2 68  ? 34.903  4.126   11.665 1.00 15.75 ? 68  ILE A N     1 
ATOM   744  C  CA    . ILE B 2 68  ? 34.305  5.256   12.359 1.00 15.66 ? 68  ILE A CA    1 
ATOM   745  C  C     . ILE B 2 68  ? 35.082  6.557   12.148 1.00 16.98 ? 68  ILE A C     1 
ATOM   746  O  O     . ILE B 2 68  ? 34.558  7.637   12.390 1.00 16.93 ? 68  ILE A O     1 
ATOM   747  C  CB    . ILE B 2 68  ? 34.138  4.994   13.861 1.00 15.31 ? 68  ILE A CB    1 
ATOM   748  C  CG1   . ILE B 2 68  ? 33.146  5.997   14.456 1.00 14.42 ? 68  ILE A CG1   1 
ATOM   749  C  CG2   . ILE B 2 68  ? 35.472  5.053   14.581 1.00 11.76 ? 68  ILE A CG2   1 
ATOM   750  C  CD1   . ILE B 2 68  ? 31.701  5.636   14.189 1.00 10.95 ? 68  ILE A CD1   1 
ATOM   751  N  N     . PRO B 2 69  ? 36.329  6.455   11.663 1.00 17.72 ? 69  PRO A N     1 
ATOM   752  C  CA    . PRO B 2 69  ? 37.066  7.690   11.466 1.00 17.43 ? 69  PRO A CA    1 
ATOM   753  C  C     . PRO B 2 69  ? 36.534  8.522   10.307 1.00 17.42 ? 69  PRO A C     1 
ATOM   754  O  O     . PRO B 2 69  ? 36.737  9.734   10.283 1.00 18.12 ? 69  PRO A O     1 
ATOM   755  C  CB    . PRO B 2 69  ? 38.483  7.202   11.172 1.00 18.21 ? 69  PRO A CB    1 
ATOM   756  C  CG    . PRO B 2 69  ? 38.569  5.891   11.891 1.00 17.83 ? 69  PRO A CG    1 
ATOM   757  C  CD    . PRO B 2 69  ? 37.222  5.281   11.694 1.00 17.05 ? 69  PRO A CD    1 
ATOM   758  N  N     . HIS B 2 70  ? 35.808  7.902   9.382  1.00 16.97 ? 70  HIS A N     1 
ATOM   759  C  CA    . HIS B 2 70  ? 35.225  8.663   8.281  1.00 15.51 ? 70  HIS A CA    1 
ATOM   760  C  C     . HIS B 2 70  ? 34.078  9.538   8.756  1.00 15.35 ? 70  HIS A C     1 
ATOM   761  O  O     . HIS B 2 70  ? 33.728  10.514  8.091  1.00 14.90 ? 70  HIS A O     1 
ATOM   762  C  CB    . HIS B 2 70  ? 34.765  7.755   7.159  1.00 13.82 ? 70  HIS A CB    1 
ATOM   763  C  CG    . HIS B 2 70  ? 35.853  6.899   6.598  1.00 19.05 ? 70  HIS A CG    1 
ATOM   764  N  ND1   . HIS B 2 70  ? 36.814  7.386   5.737  1.00 19.31 ? 70  HIS A ND1   1 
ATOM   765  C  CD2   . HIS B 2 70  ? 36.126  5.582   6.764  1.00 18.65 ? 70  HIS A CD2   1 
ATOM   766  C  CE1   . HIS B 2 70  ? 37.652  6.414   5.424  1.00 23.25 ? 70  HIS A CE1   1 
ATOM   767  N  NE2   . HIS B 2 70  ? 37.249  5.307   6.024  1.00 24.11 ? 70  HIS A NE2   1 
ATOM   768  N  N     . TYR B 2 71  ? 33.498  9.189   9.903  1.00 14.81 ? 71  TYR A N     1 
ATOM   769  C  CA    . TYR B 2 71  ? 32.271  9.846   10.382 1.00 15.34 ? 71  TYR A CA    1 
ATOM   770  C  C     . TYR B 2 71  ? 32.530  10.954  11.393 1.00 17.25 ? 71  TYR A C     1 
ATOM   771  O  O     . TYR B 2 71  ? 31.730  11.858  11.528 1.00 15.93 ? 71  TYR A O     1 
ATOM   772  C  CB    . TYR B 2 71  ? 31.287  8.824   10.950 1.00 12.92 ? 71  TYR A CB    1 
ATOM   773  C  CG    . TYR B 2 71  ? 30.755  7.901   9.898  1.00 10.21 ? 71  TYR A CG    1 
ATOM   774  C  CD1   . TYR B 2 71  ? 29.591  8.212   9.196  1.00 7.25  ? 71  TYR A CD1   1 
ATOM   775  C  CD2   . TYR B 2 71  ? 31.492  6.778   9.497  1.00 8.80  ? 71  TYR A CD2   1 
ATOM   776  C  CE1   . TYR B 2 71  ? 29.139  7.376   8.163  1.00 7.73  ? 71  TYR A CE1   1 
ATOM   777  C  CE2   . TYR B 2 71  ? 31.072  5.965   8.460  1.00 2.00  ? 71  TYR A CE2   1 
ATOM   778  C  CZ    . TYR B 2 71  ? 29.904  6.254   7.802  1.00 6.57  ? 71  TYR A CZ    1 
ATOM   779  O  OH    . TYR B 2 71  ? 29.518  5.441   6.757  1.00 11.49 ? 71  TYR A OH    1 
ATOM   780  N  N     . TYR B 2 72  ? 33.700  10.924  12.025 1.00 21.00 ? 72  TYR A N     1 
ATOM   781  C  CA    . TYR B 2 72  ? 34.109  11.949  12.979 1.00 24.02 ? 72  TYR A CA    1 
ATOM   782  C  C     . TYR B 2 72  ? 34.149  13.355  12.374 1.00 25.90 ? 72  TYR A C     1 
ATOM   783  O  O     . TYR B 2 72  ? 34.248  13.531  11.170 1.00 24.26 ? 72  TYR A O     1 
ATOM   784  C  CB    . TYR B 2 72  ? 35.496  11.640  13.533 1.00 24.27 ? 72  TYR A CB    1 
ATOM   785  C  CG    . TYR B 2 72  ? 35.563  10.516  14.519 1.00 24.06 ? 72  TYR A CG    1 
ATOM   786  C  CD1   . TYR B 2 72  ? 34.507  10.241  15.358 1.00 26.61 ? 72  TYR A CD1   1 
ATOM   787  C  CD2   . TYR B 2 72  ? 36.719  9.773   14.659 1.00 26.25 ? 72  TYR A CD2   1 
ATOM   788  C  CE1   . TYR B 2 72  ? 34.579  9.222   16.280 1.00 28.15 ? 72  TYR A CE1   1 
ATOM   789  C  CE2   . TYR B 2 72  ? 36.806  8.760   15.577 1.00 27.11 ? 72  TYR A CE2   1 
ATOM   790  C  CZ    . TYR B 2 72  ? 35.730  8.484   16.383 1.00 28.62 ? 72  TYR A CZ    1 
ATOM   791  O  OH    . TYR B 2 72  ? 35.804  7.466   17.296 1.00 31.16 ? 72  TYR A OH    1 
ATOM   792  N  N     . GLY B 2 73  ? 34.158  14.360  13.241 1.00 29.82 ? 73  GLY A N     1 
ATOM   793  C  CA    . GLY B 2 73  ? 34.565  15.696  12.803 1.00 32.63 ? 73  GLY A CA    1 
ATOM   794  C  C     . GLY B 2 73  ? 33.435  16.672  12.499 1.00 34.24 ? 73  GLY A C     1 
ATOM   795  O  O     . GLY B 2 73  ? 33.676  17.871  12.360 1.00 38.16 ? 73  GLY A O     1 
ATOM   796  N  N     . SER B 2 74  ? 32.194  16.194  12.508 1.00 32.33 ? 74  SER A N     1 
ATOM   797  C  CA    . SER B 2 74  ? 31.041  17.093  12.575 1.00 29.59 ? 74  SER A CA    1 
ATOM   798  C  C     . SER B 2 74  ? 30.924  17.776  13.946 1.00 29.50 ? 74  SER A C     1 
ATOM   799  O  O     . SER B 2 74  ? 31.297  17.205  14.972 1.00 29.49 ? 74  SER A O     1 
ATOM   800  C  CB    . SER B 2 74  ? 29.762  16.322  12.274 1.00 30.52 ? 74  SER A CB    1 
ATOM   801  O  OG    . SER B 2 74  ? 28.639  17.177  12.288 1.00 26.99 ? 74  SER A OG    1 
ATOM   802  N  N     . GLU B 2 75  ? 30.309  18.955  13.968 1.00 28.62 ? 75  GLU A N     1 
ATOM   803  C  CA    . GLU B 2 75  ? 30.088  19.672  15.222 1.00 28.48 ? 75  GLU A CA    1 
ATOM   804  C  C     . GLU B 2 75  ? 28.803  19.207  15.881 1.00 24.90 ? 75  GLU A C     1 
ATOM   805  O  O     . GLU B 2 75  ? 28.669  19.238  17.100 1.00 24.98 ? 75  GLU A O     1 
ATOM   806  C  CB    . GLU B 2 75  ? 30.037  21.182  14.962 1.00 30.87 ? 75  GLU A CB    1 
ATOM   807  C  CG    . GLU B 2 75  ? 30.728  21.600  13.655 1.00 37.22 ? 75  GLU A CG    1 
ATOM   808  C  CD    . GLU B 2 75  ? 31.583  22.862  13.801 1.00 46.48 ? 75  GLU A CD    1 
ATOM   809  O  OE1   . GLU B 2 75  ? 31.555  23.486  14.888 1.00 48.73 ? 75  GLU A OE1   1 
ATOM   810  O  OE2   . GLU B 2 75  ? 32.278  23.230  12.820 1.00 48.22 ? 75  GLU A OE2   1 
ATOM   811  N  N     . TRP B 2 76  ? 27.873  18.754  15.049 1.00 22.40 ? 76  TRP A N     1 
ATOM   812  C  CA    . TRP B 2 76  ? 26.538  18.376  15.471 1.00 18.78 ? 76  TRP A CA    1 
ATOM   813  C  C     . TRP B 2 76  ? 26.228  17.024  14.857 1.00 18.26 ? 76  TRP A C     1 
ATOM   814  O  O     . TRP B 2 76  ? 26.365  16.836  13.642 1.00 16.54 ? 76  TRP A O     1 
ATOM   815  C  CB    . TRP B 2 76  ? 25.501  19.389  14.953 1.00 18.99 ? 76  TRP A CB    1 
ATOM   816  C  CG    . TRP B 2 76  ? 25.725  20.800  15.392 1.00 18.27 ? 76  TRP A CG    1 
ATOM   817  C  CD1   . TRP B 2 76  ? 26.298  21.795  14.665 1.00 19.71 ? 76  TRP A CD1   1 
ATOM   818  C  CD2   . TRP B 2 76  ? 25.360  21.380  16.652 1.00 16.36 ? 76  TRP A CD2   1 
ATOM   819  N  NE1   . TRP B 2 76  ? 26.325  22.955  15.392 1.00 22.50 ? 76  TRP A NE1   1 
ATOM   820  C  CE2   . TRP B 2 76  ? 25.764  22.725  16.622 1.00 18.23 ? 76  TRP A CE2   1 
ATOM   821  C  CE3   . TRP B 2 76  ? 24.721  20.891  17.801 1.00 19.06 ? 76  TRP A CE3   1 
ATOM   822  C  CZ2   . TRP B 2 76  ? 25.531  23.605  17.687 1.00 18.79 ? 76  TRP A CZ2   1 
ATOM   823  C  CZ3   . TRP B 2 76  ? 24.511  21.754  18.869 1.00 17.41 ? 76  TRP A CZ3   1 
ATOM   824  C  CH2   . TRP B 2 76  ? 24.923  23.099  18.805 1.00 19.09 ? 76  TRP A CH2   1 
ATOM   825  N  N     . TYR B 2 77  ? 25.733  16.106  15.678 1.00 17.07 ? 77  TYR A N     1 
ATOM   826  C  CA    . TYR B 2 77  ? 25.221  14.851  15.163 1.00 16.01 ? 77  TYR A CA    1 
ATOM   827  C  C     . TYR B 2 77  ? 23.730  14.750  15.404 1.00 15.11 ? 77  TYR A C     1 
ATOM   828  O  O     . TYR B 2 77  ? 23.236  15.185  16.442 1.00 15.15 ? 77  TYR A O     1 
ATOM   829  C  CB    . TYR B 2 77  ? 25.964  13.671  15.784 1.00 15.66 ? 77  TYR A CB    1 
ATOM   830  C  CG    . TYR B 2 77  ? 27.390  13.580  15.318 1.00 15.03 ? 77  TYR A CG    1 
ATOM   831  C  CD1   . TYR B 2 77  ? 27.701  13.031  14.075 1.00 16.63 ? 77  TYR A CD1   1 
ATOM   832  C  CD2   . TYR B 2 77  ? 28.425  14.131  16.073 1.00 17.76 ? 77  TYR A CD2   1 
ATOM   833  C  CE1   . TYR B 2 77  ? 29.021  12.986  13.613 1.00 18.68 ? 77  TYR A CE1   1 
ATOM   834  C  CE2   . TYR B 2 77  ? 29.743  14.111  15.615 1.00 18.94 ? 77  TYR A CE2   1 
ATOM   835  C  CZ    . TYR B 2 77  ? 30.033  13.536  14.386 1.00 19.27 ? 77  TYR A CZ    1 
ATOM   836  O  OH    . TYR B 2 77  ? 31.324  13.544  13.920 1.00 18.76 ? 77  TYR A OH    1 
ATOM   837  N  N     . VAL B 2 78  ? 23.011  14.238  14.409 1.00 12.71 ? 78  VAL A N     1 
ATOM   838  C  CA    . VAL B 2 78  ? 21.573  14.063  14.512 1.00 11.06 ? 78  VAL A CA    1 
ATOM   839  C  C     . VAL B 2 78  ? 21.233  12.582  14.347 1.00 11.89 ? 78  VAL A C     1 
ATOM   840  O  O     . VAL B 2 78  ? 21.706  11.933  13.415 1.00 12.31 ? 78  VAL A O     1 
ATOM   841  C  CB    . VAL B 2 78  ? 20.829  14.880  13.418 1.00 10.78 ? 78  VAL A CB    1 
ATOM   842  C  CG1   . VAL B 2 78  ? 19.326  14.624  13.494 1.00 6.53  ? 78  VAL A CG1   1 
ATOM   843  C  CG2   . VAL B 2 78  ? 21.145  16.392  13.558 1.00 7.76  ? 78  VAL A CG2   1 
ATOM   844  N  N     . ALA B 2 79  ? 20.377  12.060  15.213 1.00 10.19 ? 79  ALA A N     1 
ATOM   845  C  CA    . ALA B 2 79  ? 19.886  10.703  15.029 1.00 11.37 ? 79  ALA A CA    1 
ATOM   846  C  C     . ALA B 2 79  ? 18.523  10.512  15.671 1.00 10.77 ? 79  ALA A C     1 
ATOM   847  O  O     . ALA B 2 79  ? 18.204  11.147  16.670 1.00 10.65 ? 79  ALA A O     1 
ATOM   848  C  CB    . ALA B 2 79  ? 20.896  9.678   15.586 1.00 11.10 ? 79  ALA A CB    1 
ATOM   849  N  N     . HIS B 2 80  ? 17.732  9.619   15.096 1.00 10.98 ? 80  HIS A N     1 
ATOM   850  C  CA    . HIS B 2 80  ? 16.404  9.345   15.610 1.00 12.01 ? 80  HIS A CA    1 
ATOM   851  C  C     . HIS B 2 80  ? 16.456  8.367   16.786 1.00 12.38 ? 80  HIS A C     1 
ATOM   852  O  O     . HIS B 2 80  ? 16.709  7.184   16.597 1.00 12.09 ? 80  HIS A O     1 
ATOM   853  C  CB    . HIS B 2 80  ? 15.486  8.820   14.501 1.00 10.25 ? 80  HIS A CB    1 
ATOM   854  C  CG    . HIS B 2 80  ? 14.033  8.923   14.836 1.00 11.92 ? 80  HIS A CG    1 
ATOM   855  N  ND1   . HIS B 2 80  ? 13.368  10.127  14.875 1.00 9.58  ? 80  HIS A ND1   1 
ATOM   856  C  CD2   . HIS B 2 80  ? 13.140  7.985   15.236 1.00 9.31  ? 80  HIS A CD2   1 
ATOM   857  C  CE1   . HIS B 2 80  ? 12.102  9.914   15.191 1.00 12.06 ? 80  HIS A CE1   1 
ATOM   858  N  NE2   . HIS B 2 80  ? 11.944  8.628   15.441 1.00 11.87 ? 80  HIS A NE2   1 
ATOM   859  N  N     . ASN B 2 81  ? 16.180  8.870   17.991 1.00 14.70 ? 81  ASN A N     1 
ATOM   860  C  CA    . ASN B 2 81  ? 16.510  8.166   19.232 1.00 16.89 ? 81  ASN A CA    1 
ATOM   861  C  C     . ASN B 2 81  ? 18.021  8.041   19.438 1.00 18.03 ? 81  ASN A C     1 
ATOM   862  O  O     . ASN B 2 81  ? 18.555  6.936   19.573 1.00 18.05 ? 81  ASN A O     1 
ATOM   863  C  CB    . ASN B 2 81  ? 15.843  6.782   19.271 1.00 18.11 ? 81  ASN A CB    1 
ATOM   864  C  CG    . ASN B 2 81  ? 15.817  6.174   20.677 1.00 18.70 ? 81  ASN A CG    1 
ATOM   865  O  OD1   . ASN B 2 81  ? 15.884  6.886   21.678 1.00 24.49 ? 81  ASN A OD1   1 
ATOM   866  N  ND2   . ASN B 2 81  ? 15.666  4.861   20.747 1.00 12.53 ? 81  ASN A ND2   1 
ATOM   867  N  N     . ALA B 2 82  ? 18.691  9.192   19.471 1.00 18.73 ? 82  ALA A N     1 
ATOM   868  C  CA    . ALA B 2 82  ? 20.144  9.265   19.432 1.00 17.89 ? 82  ALA A CA    1 
ATOM   869  C  C     . ALA B 2 82  ? 20.759  8.509   20.586 1.00 18.01 ? 82  ALA A C     1 
ATOM   870  O  O     . ALA B 2 82  ? 21.861  7.987   20.480 1.00 20.40 ? 82  ALA A O     1 
ATOM   871  C  CB    . ALA B 2 82  ? 20.575  10.699  19.463 1.00 17.61 ? 82  ALA A CB    1 
ATOM   872  N  N     . SER B 2 83  ? 20.053  8.495   21.707 1.00 17.88 ? 83  SER A N     1 
ATOM   873  C  CA    . SER B 2 83  ? 20.306  7.554   22.790 1.00 18.01 ? 83  SER A CA    1 
ATOM   874  C  C     . SER B 2 83  ? 20.851  6.193   22.314 1.00 17.88 ? 83  SER A C     1 
ATOM   875  O  O     . SER B 2 83  ? 21.758  5.623   22.928 1.00 19.74 ? 83  SER A O     1 
ATOM   876  C  CB    . SER B 2 83  ? 19.010  7.321   23.547 1.00 18.61 ? 83  SER A CB    1 
ATOM   877  O  OG    . SER B 2 83  ? 19.180  7.620   24.903 1.00 21.84 ? 83  SER A OG    1 
ATOM   878  N  N     . PHE B 2 84  ? 20.193  5.610   21.323 1.00 15.20 ? 84  PHE A N     1 
ATOM   879  C  CA    . PHE B 2 84  ? 20.528  4.271   20.890 1.00 15.36 ? 84  PHE A CA    1 
ATOM   880  C  C     . PHE B 2 84  ? 21.864  4.270   20.153 1.00 15.72 ? 84  PHE A C     1 
ATOM   881  O  O     . PHE B 2 84  ? 22.804  3.595   20.575 1.00 14.75 ? 84  PHE A O     1 
ATOM   882  C  CB    . PHE B 2 84  ? 19.417  3.694   20.008 1.00 13.77 ? 84  PHE A CB    1 
ATOM   883  C  CG    . PHE B 2 84  ? 19.706  2.310   19.489 1.00 13.78 ? 84  PHE A CG    1 
ATOM   884  C  CD1   . PHE B 2 84  ? 19.378  1.182   20.236 1.00 10.53 ? 84  PHE A CD1   1 
ATOM   885  C  CD2   . PHE B 2 84  ? 20.304  2.135   18.259 1.00 11.04 ? 84  PHE A CD2   1 
ATOM   886  C  CE1   . PHE B 2 84  ? 19.658  -0.079  19.764 1.00 11.14 ? 84  PHE A CE1   1 
ATOM   887  C  CE2   . PHE B 2 84  ? 20.554  0.878   17.766 1.00 10.71 ? 84  PHE A CE2   1 
ATOM   888  C  CZ    . PHE B 2 84  ? 20.221  -0.233  18.508 1.00 13.49 ? 84  PHE A CZ    1 
ATOM   889  N  N     . ASP B 2 85  ? 21.942  5.052   19.074 1.00 16.69 ? 85  ASP A N     1 
ATOM   890  C  CA    . ASP B 2 85  ? 23.141  5.141   18.239 1.00 18.02 ? 85  ASP A CA    1 
ATOM   891  C  C     . ASP B 2 85  ? 24.353  5.536   19.073 1.00 19.72 ? 85  ASP A C     1 
ATOM   892  O  O     . ASP B 2 85  ? 25.409  4.900   19.004 1.00 19.00 ? 85  ASP A O     1 
ATOM   893  C  CB    . ASP B 2 85  ? 22.932  6.158   17.112 1.00 18.49 ? 85  ASP A CB    1 
ATOM   894  C  CG    . ASP B 2 85  ? 21.717  5.835   16.240 1.00 19.34 ? 85  ASP A CG    1 
ATOM   895  O  OD1   . ASP B 2 85  ? 20.588  6.137   16.654 1.00 21.01 ? 85  ASP A OD1   1 
ATOM   896  O  OD2   . ASP B 2 85  ? 21.892  5.299   15.130 1.00 21.69 ? 85  ASP A OD2   1 
ATOM   897  N  N     . ARG B 2 86  ? 24.161  6.540   19.922 1.00 21.76 ? 86  ARG A N     1 
ATOM   898  C  CA    . ARG B 2 86  ? 25.183  6.995   20.855 1.00 24.58 ? 86  ARG A CA    1 
ATOM   899  C  C     . ARG B 2 86  ? 25.714  5.869   21.743 1.00 25.47 ? 86  ARG A C     1 
ATOM   900  O  O     . ARG B 2 86  ? 26.872  5.883   22.147 1.00 26.71 ? 86  ARG A O     1 
ATOM   901  C  CB    . ARG B 2 86  ? 24.622  8.117   21.722 1.00 25.18 ? 86  ARG A CB    1 
ATOM   902  C  CG    . ARG B 2 86  ? 25.663  8.870   22.522 1.00 31.67 ? 86  ARG A CG    1 
ATOM   903  C  CD    . ARG B 2 86  ? 25.046  10.074  23.254 1.00 42.77 ? 86  ARG A CD    1 
ATOM   904  N  NE    . ARG B 2 86  ? 26.061  11.076  23.600 1.00 50.64 ? 86  ARG A NE    1 
ATOM   905  C  CZ    . ARG B 2 86  ? 26.558  11.261  24.825 1.00 53.78 ? 86  ARG A CZ    1 
ATOM   906  N  NH1   . ARG B 2 86  ? 26.121  10.534  25.854 1.00 54.61 ? 86  ARG A NH1   1 
ATOM   907  N  NH2   . ARG B 2 86  ? 27.498  12.178  25.022 1.00 54.35 ? 86  ARG A NH2   1 
ATOM   908  N  N     . ARG B 2 87  ? 24.861  4.903   22.063 1.00 25.55 ? 87  ARG A N     1 
ATOM   909  C  CA    . ARG B 2 87  ? 25.244  3.846   22.982 1.00 24.45 ? 87  ARG A CA    1 
ATOM   910  C  C     . ARG B 2 87  ? 26.013  2.725   22.293 1.00 23.50 ? 87  ARG A C     1 
ATOM   911  O  O     . ARG B 2 87  ? 26.901  2.111   22.890 1.00 25.39 ? 87  ARG A O     1 
ATOM   912  C  CB    . ARG B 2 87  ? 24.019  3.277   23.679 1.00 25.39 ? 87  ARG A CB    1 
ATOM   913  C  CG    . ARG B 2 87  ? 24.325  2.662   25.032 1.00 28.94 ? 87  ARG A CG    1 
ATOM   914  C  CD    . ARG B 2 87  ? 23.051  2.286   25.773 1.00 32.61 ? 87  ARG A CD    1 
ATOM   915  N  NE    . ARG B 2 87  ? 22.352  1.206   25.087 1.00 35.03 ? 87  ARG A NE    1 
ATOM   916  C  CZ    . ARG B 2 87  ? 21.140  1.315   24.556 1.00 34.28 ? 87  ARG A CZ    1 
ATOM   917  N  NH1   . ARG B 2 87  ? 20.440  2.440   24.702 1.00 31.07 ? 87  ARG A NH1   1 
ATOM   918  N  NH2   . ARG B 2 87  ? 20.611  0.278   23.918 1.00 34.01 ? 87  ARG A NH2   1 
ATOM   919  N  N     . VAL B 2 88  ? 25.649  2.431   21.054 1.00 20.02 ? 88  VAL A N     1 
ATOM   920  C  CA    . VAL B 2 88  ? 26.171  1.261   20.373 1.00 19.11 ? 88  VAL A CA    1 
ATOM   921  C  C     . VAL B 2 88  ? 27.392  1.613   19.506 1.00 19.35 ? 88  VAL A C     1 
ATOM   922  O  O     . VAL B 2 88  ? 28.140  0.737   19.086 1.00 19.37 ? 88  VAL A O     1 
ATOM   923  C  CB    . VAL B 2 88  ? 25.084  0.618   19.493 1.00 18.59 ? 88  VAL A CB    1 
ATOM   924  C  CG1   . VAL B 2 88  ? 23.877  0.303   20.322 1.00 18.02 ? 88  VAL A CG1   1 
ATOM   925  C  CG2   . VAL B 2 88  ? 24.698  1.551   18.356 1.00 16.78 ? 88  VAL A CG2   1 
ATOM   926  N  N     . LEU B 2 89  ? 27.511  2.894   19.163 1.00 20.10 ? 89  LEU A N     1 
ATOM   927  C  CA    . LEU B 2 89  ? 28.613  3.406   18.348 1.00 18.64 ? 89  LEU A CA    1 
ATOM   928  C  C     . LEU B 2 89  ? 29.762  3.739   19.272 1.00 18.02 ? 89  LEU A C     1 
ATOM   929  O  O     . LEU B 2 89  ? 29.553  3.933   20.462 1.00 16.52 ? 89  LEU A O     1 
ATOM   930  C  CB    . LEU B 2 89  ? 28.175  4.677   17.604 1.00 18.04 ? 89  LEU A CB    1 
ATOM   931  C  CG    . LEU B 2 89  ? 28.080  4.618   16.080 1.00 18.08 ? 89  LEU A CG    1 
ATOM   932  C  CD1   . LEU B 2 89  ? 28.029  3.197   15.584 1.00 18.54 ? 89  LEU A CD1   1 
ATOM   933  C  CD2   . LEU B 2 89  ? 26.912  5.441   15.535 1.00 14.38 ? 89  LEU A CD2   1 
ATOM   934  N  N     . PRO B 2 90  ? 30.983  3.834   18.723 1.00 19.34 ? 90  PRO A N     1 
ATOM   935  C  CA    . PRO B 2 90  ? 32.113  4.369   19.494 1.00 21.11 ? 90  PRO A CA    1 
ATOM   936  C  C     . PRO B 2 90  ? 31.925  5.852   19.835 1.00 22.82 ? 90  PRO A C     1 
ATOM   937  O  O     . PRO B 2 90  ? 31.161  6.545   19.162 1.00 23.13 ? 90  PRO A O     1 
ATOM   938  C  CB    . PRO B 2 90  ? 33.297  4.176   18.548 1.00 21.14 ? 90  PRO A CB    1 
ATOM   939  C  CG    . PRO B 2 90  ? 32.863  3.104   17.606 1.00 17.91 ? 90  PRO A CG    1 
ATOM   940  C  CD    . PRO B 2 90  ? 31.407  3.315   17.415 1.00 17.66 ? 90  PRO A CD    1 
ATOM   941  N  N     . GLU B 2 91  ? 32.520  6.298   20.939 1.00 25.95 ? 91  GLU A N     1 
ATOM   942  C  CA    . GLU B 2 91  ? 32.240  7.644   21.471 1.00 28.59 ? 91  GLU A CA    1 
ATOM   943  C  C     . GLU B 2 91  ? 32.524  8.676   20.391 1.00 28.59 ? 91  GLU A C     1 
ATOM   944  O  O     . GLU B 2 91  ? 33.480  8.523   19.622 1.00 28.87 ? 91  GLU A O     1 
ATOM   945  C  CB    . GLU B 2 91  ? 33.083  7.923   22.739 1.00 31.02 ? 91  GLU A CB    1 
ATOM   946  C  CG    . GLU B 2 91  ? 33.265  9.426   23.112 1.00 37.91 ? 91  GLU A CG    1 
ATOM   947  C  CD    . GLU B 2 91  ? 34.694  9.956   22.843 1.00 46.15 ? 91  GLU A CD    1 
ATOM   948  O  OE1   . GLU B 2 91  ? 35.543  9.912   23.773 1.00 46.93 ? 91  GLU A OE1   1 
ATOM   949  O  OE2   . GLU B 2 91  ? 34.959  10.427  21.705 1.00 49.09 ? 91  GLU A OE2   1 
ATOM   950  N  N     . MET B 2 92  ? 31.649  9.679   20.289 1.00 28.65 ? 92  MET A N     1 
ATOM   951  C  CA    . MET B 2 92  ? 31.615  10.591  19.142 1.00 28.68 ? 92  MET A CA    1 
ATOM   952  C  C     . MET B 2 92  ? 31.688  12.032  19.613 1.00 28.44 ? 92  MET A C     1 
ATOM   953  O  O     . MET B 2 92  ? 30.891  12.450  20.437 1.00 30.11 ? 92  MET A O     1 
ATOM   954  C  CB    . MET B 2 92  ? 30.312  10.416  18.352 1.00 29.14 ? 92  MET A CB    1 
ATOM   955  C  CG    . MET B 2 92  ? 29.997  8.995   17.928 1.00 29.07 ? 92  MET A CG    1 
ATOM   956  S  SD    . MET B 2 92  ? 30.592  8.592   16.265 1.00 29.23 ? 92  MET A SD    1 
ATOM   957  C  CE    . MET B 2 92  ? 30.416  10.143  15.411 1.00 23.12 ? 92  MET A CE    1 
ATOM   958  N  N     . PRO B 2 93  ? 32.562  12.831  19.000 1.00 28.51 ? 93  PRO A N     1 
ATOM   959  C  CA    . PRO B 2 93  ? 32.662  14.207  19.453 1.00 29.03 ? 93  PRO A CA    1 
ATOM   960  C  C     . PRO B 2 93  ? 31.432  14.974  18.976 1.00 29.24 ? 93  PRO A C     1 
ATOM   961  O  O     . PRO B 2 93  ? 30.522  14.367  18.435 1.00 30.94 ? 93  PRO A O     1 
ATOM   962  C  CB    . PRO B 2 93  ? 33.906  14.701  18.723 1.00 29.67 ? 93  PRO A CB    1 
ATOM   963  C  CG    . PRO B 2 93  ? 33.838  13.986  17.389 1.00 27.88 ? 93  PRO A CG    1 
ATOM   964  C  CD    . PRO B 2 93  ? 33.104  12.668  17.639 1.00 28.03 ? 93  PRO A CD    1 
ATOM   965  N  N     . GLY B 2 94  ? 31.404  16.288  19.169 1.00 28.01 ? 94  GLY A N     1 
ATOM   966  C  CA    . GLY B 2 94  ? 30.270  17.094  18.735 1.00 26.54 ? 94  GLY A CA    1 
ATOM   967  C  C     . GLY B 2 94  ? 29.029  16.971  19.603 1.00 25.96 ? 94  GLY A C     1 
ATOM   968  O  O     . GLY B 2 94  ? 28.976  16.156  20.528 1.00 25.18 ? 94  GLY A O     1 
ATOM   969  N  N     . GLU B 2 95  ? 28.015  17.773  19.279 1.00 25.56 ? 95  GLU A N     1 
ATOM   970  C  CA    . GLU B 2 95  ? 26.773  17.817  20.056 1.00 25.12 ? 95  GLU A CA    1 
ATOM   971  C  C     . GLU B 2 95  ? 25.652  16.998  19.406 1.00 22.54 ? 95  GLU A C     1 
ATOM   972  O  O     . GLU B 2 95  ? 25.456  17.028  18.189 1.00 21.78 ? 95  GLU A O     1 
ATOM   973  C  CB    . GLU B 2 95  ? 26.313  19.274  20.249 1.00 26.78 ? 95  GLU A CB    1 
ATOM   974  C  CG    . GLU B 2 95  ? 27.023  20.034  21.380 1.00 32.21 ? 95  GLU A CG    1 
ATOM   975  C  CD    . GLU B 2 95  ? 26.685  19.499  22.769 1.00 39.39 ? 95  GLU A CD    1 
ATOM   976  O  OE1   . GLU B 2 95  ? 25.990  18.459  22.876 1.00 40.07 ? 95  GLU A OE1   1 
ATOM   977  O  OE2   . GLU B 2 95  ? 27.119  20.123  23.757 1.00 41.94 ? 95  GLU A OE2   1 
ATOM   978  N  N     . TRP B 2 96  ? 24.862  16.345  20.243 1.00 21.56 ? 96  TRP A N     1 
ATOM   979  C  CA    . TRP B 2 96  ? 23.814  15.446  19.768 1.00 20.49 ? 96  TRP A CA    1 
ATOM   980  C  C     . TRP B 2 96  ? 22.432  16.088  19.699 1.00 18.11 ? 96  TRP A C     1 
ATOM   981  O  O     . TRP B 2 96  ? 22.015  16.796  20.610 1.00 17.55 ? 96  TRP A O     1 
ATOM   982  C  CB    . TRP B 2 96  ? 23.764  14.197  20.633 1.00 21.79 ? 96  TRP A CB    1 
ATOM   983  C  CG    . TRP B 2 96  ? 24.778  13.178  20.239 1.00 25.81 ? 96  TRP A CG    1 
ATOM   984  C  CD1   . TRP B 2 96  ? 26.009  12.990  20.793 1.00 32.94 ? 96  TRP A CD1   1 
ATOM   985  C  CD2   . TRP B 2 96  ? 24.662  12.221  19.181 1.00 29.07 ? 96  TRP A CD2   1 
ATOM   986  N  NE1   . TRP B 2 96  ? 26.660  11.952  20.164 1.00 37.47 ? 96  TRP A NE1   1 
ATOM   987  C  CE2   . TRP B 2 96  ? 25.848  11.457  19.175 1.00 33.58 ? 96  TRP A CE2   1 
ATOM   988  C  CE3   . TRP B 2 96  ? 23.654  11.909  18.265 1.00 25.65 ? 96  TRP A CE3   1 
ATOM   989  C  CZ2   . TRP B 2 96  ? 26.056  10.410  18.283 1.00 31.02 ? 96  TRP A CZ2   1 
ATOM   990  C  CZ3   . TRP B 2 96  ? 23.858  10.870  17.387 1.00 25.62 ? 96  TRP A CZ3   1 
ATOM   991  C  CH2   . TRP B 2 96  ? 25.052  10.134  17.396 1.00 29.74 ? 96  TRP A CH2   1 
ATOM   992  N  N     . ILE B 2 97  ? 21.729  15.818  18.609 1.00 15.72 ? 97  ILE A N     1 
ATOM   993  C  CA    . ILE B 2 97  ? 20.342  16.191  18.470 1.00 14.35 ? 97  ILE A CA    1 
ATOM   994  C  C     . ILE B 2 97  ? 19.500  14.938  18.194 1.00 14.82 ? 97  ILE A C     1 
ATOM   995  O  O     . ILE B 2 97  ? 19.852  14.113  17.334 1.00 14.28 ? 97  ILE A O     1 
ATOM   996  C  CB    . ILE B 2 97  ? 20.151  17.223  17.326 1.00 14.41 ? 97  ILE A CB    1 
ATOM   997  C  CG1   . ILE B 2 97  ? 20.698  18.601  17.742 1.00 14.97 ? 97  ILE A CG1   1 
ATOM   998  C  CG2   . ILE B 2 97  ? 18.679  17.325  16.928 1.00 10.75 ? 97  ILE A CG2   1 
ATOM   999  C  CD1   . ILE B 2 97  ? 21.026  19.526  16.561 1.00 9.77  ? 97  ILE A CD1   1 
ATOM   1000 N  N     . CYS B 2 98  ? 18.390  14.810  18.924 1.00 14.70 ? 98  CYS A N     1 
ATOM   1001 C  CA    . CYS B 2 98  ? 17.483  13.667  18.804 1.00 14.39 ? 98  CYS A CA    1 
ATOM   1002 C  C     . CYS B 2 98  ? 16.153  14.105  18.186 1.00 14.46 ? 98  CYS A C     1 
ATOM   1003 O  O     . CYS B 2 98  ? 15.364  14.803  18.827 1.00 13.85 ? 98  CYS A O     1 
ATOM   1004 C  CB    . CYS B 2 98  ? 17.242  13.055  20.190 1.00 15.16 ? 98  CYS A CB    1 
ATOM   1005 S  SG    . CYS B 2 98  ? 16.174  11.601  20.235 1.00 14.99 ? 98  CYS A SG    1 
ATOM   1006 N  N     . THR B 2 99  ? 15.909  13.678  16.948 1.00 14.26 ? 99  THR A N     1 
ATOM   1007 C  CA    . THR B 2 99  ? 14.673  13.993  16.233 1.00 13.70 ? 99  THR A CA    1 
ATOM   1008 C  C     . THR B 2 99  ? 13.413  13.415  16.893 1.00 14.19 ? 99  THR A C     1 
ATOM   1009 O  O     . THR B 2 99  ? 12.310  13.950  16.738 1.00 12.96 ? 99  THR A O     1 
ATOM   1010 C  CB    . THR B 2 99  ? 14.737  13.496  14.784 1.00 14.69 ? 99  THR A CB    1 
ATOM   1011 O  OG1   . THR B 2 99  ? 15.436  12.239  14.733 1.00 12.85 ? 99  THR A OG1   1 
ATOM   1012 C  CG2   . THR B 2 99  ? 15.454  14.518  13.913 1.00 13.58 ? 99  THR A CG2   1 
ATOM   1013 N  N     . MET B 2 100 ? 13.567  12.310  17.609 1.00 15.26 ? 100 MET A N     1 
ATOM   1014 C  CA    . MET B 2 100 ? 12.435  11.725  18.292 1.00 15.39 ? 100 MET A CA    1 
ATOM   1015 C  C     . MET B 2 100 ? 11.968  12.695  19.349 1.00 15.22 ? 100 MET A C     1 
ATOM   1016 O  O     . MET B 2 100 ? 10.799  13.059  19.383 1.00 15.93 ? 100 MET A O     1 
ATOM   1017 C  CB    . MET B 2 100 ? 12.805  10.396  18.936 1.00 16.11 ? 100 MET A CB    1 
ATOM   1018 C  CG    . MET B 2 100 ? 11.636  9.742   19.650 1.00 16.85 ? 100 MET A CG    1 
ATOM   1019 S  SD    . MET B 2 100 ? 12.061  8.125   20.299 1.00 22.73 ? 100 MET A SD    1 
ATOM   1020 C  CE    . MET B 2 100 ? 12.781  8.598   21.876 1.00 22.69 ? 100 MET A CE    1 
ATOM   1021 N  N     . LYS B 2 101 ? 12.894  13.135  20.192 1.00 13.95 ? 101 LYS A N     1 
ATOM   1022 C  CA    . LYS B 2 101 ? 12.593  14.129  21.217 1.00 14.48 ? 101 LYS A CA    1 
ATOM   1023 C  C     . LYS B 2 101 ? 12.000  15.416  20.652 1.00 13.81 ? 101 LYS A C     1 
ATOM   1024 O  O     . LYS B 2 101 ? 11.067  15.955  21.220 1.00 14.71 ? 101 LYS A O     1 
ATOM   1025 C  CB    . LYS B 2 101 ? 13.832  14.448  22.052 1.00 14.45 ? 101 LYS A CB    1 
ATOM   1026 C  CG    . LYS B 2 101 ? 13.982  13.574  23.278 1.00 20.03 ? 101 LYS A CG    1 
ATOM   1027 C  CD    . LYS B 2 101 ? 15.000  14.152  24.251 1.00 30.67 ? 101 LYS A CD    1 
ATOM   1028 C  CE    . LYS B 2 101 ? 14.376  14.382  25.648 1.00 38.19 ? 101 LYS A CE    1 
ATOM   1029 N  NZ    . LYS B 2 101 ? 13.803  15.773  25.829 1.00 36.21 ? 101 LYS A NZ    1 
ATOM   1030 N  N     . LEU B 2 102 ? 12.561  15.914  19.548 1.00 13.76 ? 102 LEU A N     1 
ATOM   1031 C  CA    . LEU B 2 102 ? 12.081  17.146  18.925 1.00 12.15 ? 102 LEU A CA    1 
ATOM   1032 C  C     . LEU B 2 102 ? 10.669  16.984  18.401 1.00 13.43 ? 102 LEU A C     1 
ATOM   1033 O  O     . LEU B 2 102 ? 9.861   17.908  18.479 1.00 14.10 ? 102 LEU A O     1 
ATOM   1034 C  CB    . LEU B 2 102 ? 12.983  17.562  17.775 1.00 10.41 ? 102 LEU A CB    1 
ATOM   1035 C  CG    . LEU B 2 102 ? 14.448  17.800  18.112 1.00 9.59  ? 102 LEU A CG    1 
ATOM   1036 C  CD1   . LEU B 2 102 ? 15.211  18.080  16.846 1.00 8.34  ? 102 LEU A CD1   1 
ATOM   1037 C  CD2   . LEU B 2 102 ? 14.633  18.916  19.115 1.00 7.76  ? 102 LEU A CD2   1 
ATOM   1038 N  N     . ALA B 2 103 ? 10.385  15.819  17.826 1.00 13.41 ? 103 ALA A N     1 
ATOM   1039 C  CA    . ALA B 2 103 ? 9.057   15.547  17.313 1.00 13.18 ? 103 ALA A CA    1 
ATOM   1040 C  C     . ALA B 2 103 ? 8.051   15.451  18.444 1.00 12.92 ? 103 ALA A C     1 
ATOM   1041 O  O     . ALA B 2 103 ? 6.982   16.028  18.371 1.00 13.60 ? 103 ALA A O     1 
ATOM   1042 C  CB    . ALA B 2 103 ? 9.048   14.292  16.459 1.00 10.68 ? 103 ALA A CB    1 
ATOM   1043 N  N     . ARG B 2 104 ? 8.448   14.821  19.534 1.00 14.72 ? 104 ARG A N     1 
ATOM   1044 C  CA    . ARG B 2 104 ? 7.599   14.727  20.702 1.00 18.21 ? 104 ARG A CA    1 
ATOM   1045 C  C     . ARG B 2 104 ? 7.199   16.101  21.199 1.00 18.84 ? 104 ARG A C     1 
ATOM   1046 O  O     . ARG B 2 104 ? 6.091   16.277  21.691 1.00 20.69 ? 104 ARG A O     1 
ATOM   1047 C  CB    . ARG B 2 104 ? 8.324   13.997  21.827 1.00 19.56 ? 104 ARG A CB    1 
ATOM   1048 C  CG    . ARG B 2 104 ? 8.249   12.492  21.745 1.00 27.26 ? 104 ARG A CG    1 
ATOM   1049 C  CD    . ARG B 2 104 ? 8.818   11.866  23.007 1.00 36.03 ? 104 ARG A CD    1 
ATOM   1050 N  NE    . ARG B 2 104 ? 7.771   11.247  23.807 1.00 41.18 ? 104 ARG A NE    1 
ATOM   1051 C  CZ    . ARG B 2 104 ? 7.452   9.957   23.743 1.00 45.52 ? 104 ARG A CZ    1 
ATOM   1052 N  NH1   . ARG B 2 104 ? 8.112   9.144   22.918 1.00 47.18 ? 104 ARG A NH1   1 
ATOM   1053 N  NH2   . ARG B 2 104 ? 6.483   9.474   24.513 1.00 47.33 ? 104 ARG A NH2   1 
ATOM   1054 N  N     . ARG B 2 105 ? 8.154   17.027  21.231 1.00 18.43 ? 105 ARG A N     1 
ATOM   1055 C  CA    . ARG B 2 105 ? 7.892   18.350  21.766 1.00 18.64 ? 105 ARG A CA    1 
ATOM   1056 C  C     . ARG B 2 105 ? 7.097   19.205  20.788 1.00 18.81 ? 105 ARG A C     1 
ATOM   1057 O  O     . ARG B 2 105 ? 6.257   20.005  21.189 1.00 18.28 ? 105 ARG A O     1 
ATOM   1058 C  CB    . ARG B 2 105 ? 9.191   19.058  22.130 1.00 19.31 ? 105 ARG A CB    1 
ATOM   1059 C  CG    . ARG B 2 105 ? 9.011   20.546  22.400 1.00 19.52 ? 105 ARG A CG    1 
ATOM   1060 C  CD    . ARG B 2 105 ? 8.669   20.801  23.846 1.00 16.86 ? 105 ARG A CD    1 
ATOM   1061 N  NE    . ARG B 2 105 ? 9.826   20.560  24.689 1.00 27.14 ? 105 ARG A NE    1 
ATOM   1062 C  CZ    . ARG B 2 105 ? 10.647  21.510  25.120 1.00 28.12 ? 105 ARG A CZ    1 
ATOM   1063 N  NH1   . ARG B 2 105 ? 10.360  22.783  24.883 1.00 26.74 ? 105 ARG A NH1   1 
ATOM   1064 N  NH2   . ARG B 2 105 ? 11.720  21.186  25.836 1.00 25.89 ? 105 ARG A NH2   1 
ATOM   1065 N  N     . LEU B 2 106 ? 7.389   19.058  19.505 1.00 18.26 ? 106 LEU A N     1 
ATOM   1066 C  CA    . LEU B 2 106 ? 6.744   19.883  18.490 1.00 19.77 ? 106 LEU A CA    1 
ATOM   1067 C  C     . LEU B 2 106 ? 5.298   19.412  18.240 1.00 20.29 ? 106 LEU A C     1 
ATOM   1068 O  O     . LEU B 2 106 ? 4.396   20.221  18.060 1.00 19.32 ? 106 LEU A O     1 
ATOM   1069 C  CB    . LEU B 2 106 ? 7.568   19.854  17.198 1.00 19.35 ? 106 LEU A CB    1 
ATOM   1070 C  CG    . LEU B 2 106 ? 7.231   20.816  16.067 1.00 20.21 ? 106 LEU A CG    1 
ATOM   1071 C  CD1   . LEU B 2 106 ? 7.188   22.239  16.594 1.00 22.67 ? 106 LEU A CD1   1 
ATOM   1072 C  CD2   . LEU B 2 106 ? 8.260   20.683  14.964 1.00 18.04 ? 106 LEU A CD2   1 
ATOM   1073 N  N     . TRP B 2 107 ? 5.095   18.095  18.249 1.00 20.43 ? 107 TRP A N     1 
ATOM   1074 C  CA    . TRP B 2 107 ? 3.796   17.507  17.956 1.00 19.38 ? 107 TRP A CA    1 
ATOM   1075 C  C     . TRP B 2 107 ? 3.451   16.435  18.983 1.00 19.95 ? 107 TRP A C     1 
ATOM   1076 O  O     . TRP B 2 107 ? 3.648   15.246  18.729 1.00 19.46 ? 107 TRP A O     1 
ATOM   1077 C  CB    . TRP B 2 107 ? 3.800   16.891  16.563 1.00 19.00 ? 107 TRP A CB    1 
ATOM   1078 C  CG    . TRP B 2 107 ? 4.225   17.833  15.477 1.00 20.64 ? 107 TRP A CG    1 
ATOM   1079 C  CD1   . TRP B 2 107 ? 3.586   18.975  15.093 1.00 20.41 ? 107 TRP A CD1   1 
ATOM   1080 C  CD2   . TRP B 2 107 ? 5.345   17.674  14.574 1.00 18.76 ? 107 TRP A CD2   1 
ATOM   1081 N  NE1   . TRP B 2 107 ? 4.239   19.544  14.021 1.00 25.97 ? 107 TRP A NE1   1 
ATOM   1082 C  CE2   . TRP B 2 107 ? 5.333   18.779  13.698 1.00 18.78 ? 107 TRP A CE2   1 
ATOM   1083 C  CE3   . TRP B 2 107 ? 6.347   16.711  14.428 1.00 16.00 ? 107 TRP A CE3   1 
ATOM   1084 C  CZ2   . TRP B 2 107 ? 6.294   18.955  12.692 1.00 16.39 ? 107 TRP A CZ2   1 
ATOM   1085 C  CZ3   . TRP B 2 107 ? 7.317   16.893  13.427 1.00 16.86 ? 107 TRP A CZ3   1 
ATOM   1086 C  CH2   . TRP B 2 107 ? 7.281   18.007  12.579 1.00 13.56 ? 107 TRP A CH2   1 
ATOM   1087 N  N     . PRO B 2 108 ? 2.933   16.851  20.153 1.00 21.42 ? 108 PRO A N     1 
ATOM   1088 C  CA    . PRO B 2 108 ? 2.501   15.885  21.154 1.00 20.78 ? 108 PRO A CA    1 
ATOM   1089 C  C     . PRO B 2 108 ? 1.304   15.108  20.667 1.00 21.16 ? 108 PRO A C     1 
ATOM   1090 O  O     . PRO B 2 108 ? 0.601   15.560  19.752 1.00 21.29 ? 108 PRO A O     1 
ATOM   1091 C  CB    . PRO B 2 108 ? 2.110   16.757  22.345 1.00 20.26 ? 108 PRO A CB    1 
ATOM   1092 C  CG    . PRO B 2 108 ? 1.694   18.045  21.756 1.00 21.85 ? 108 PRO A CG    1 
ATOM   1093 C  CD    . PRO B 2 108 ? 2.468   18.217  20.462 1.00 23.03 ? 108 PRO A CD    1 
ATOM   1094 N  N     . GLY B 2 109 ? 1.145   13.900  21.206 1.00 21.07 ? 109 GLY A N     1 
ATOM   1095 C  CA    . GLY B 2 109 ? -0.027  13.074  20.957 1.00 22.10 ? 109 GLY A CA    1 
ATOM   1096 C  C     . GLY B 2 109 ? -0.033  12.308  19.645 1.00 22.08 ? 109 GLY A C     1 
ATOM   1097 O  O     . GLY B 2 109 ? -1.088  11.985  19.134 1.00 24.65 ? 109 GLY A O     1 
ATOM   1098 N  N     . ILE B 2 110 ? 1.134   11.970  19.120 1.00 20.63 ? 110 ILE A N     1 
ATOM   1099 C  CA    . ILE B 2 110 ? 1.199   11.080  17.963 1.00 20.25 ? 110 ILE A CA    1 
ATOM   1100 C  C     . ILE B 2 110 ? 2.267   9.992   18.145 1.00 19.22 ? 110 ILE A C     1 
ATOM   1101 O  O     . ILE B 2 110 ? 2.813   9.853   19.219 1.00 21.07 ? 110 ILE A O     1 
ATOM   1102 C  CB    . ILE B 2 110 ? 1.426   11.871  16.658 1.00 20.89 ? 110 ILE A CB    1 
ATOM   1103 C  CG1   . ILE B 2 110 ? 2.791   12.548  16.653 1.00 17.97 ? 110 ILE A CG1   1 
ATOM   1104 C  CG2   . ILE B 2 110 ? 0.364   12.934  16.480 1.00 22.02 ? 110 ILE A CG2   1 
ATOM   1105 C  CD1   . ILE B 2 110 ? 3.077   13.249  15.362 1.00 15.25 ? 110 ILE A CD1   1 
ATOM   1106 N  N     . LYS B 2 111 ? 2.553   9.223   17.102 1.00 18.56 ? 111 LYS A N     1 
ATOM   1107 C  CA    . LYS B 2 111 ? 3.652   8.252   17.150 1.00 17.14 ? 111 LYS A CA    1 
ATOM   1108 C  C     . LYS B 2 111 ? 4.970   8.851   16.683 1.00 16.75 ? 111 LYS A C     1 
ATOM   1109 O  O     . LYS B 2 111 ? 4.992   9.691   15.781 1.00 15.69 ? 111 LYS A O     1 
ATOM   1110 C  CB    . LYS B 2 111 ? 3.326   7.057   16.284 1.00 17.84 ? 111 LYS A CB    1 
ATOM   1111 C  CG    . LYS B 2 111 ? 1.934   6.564   16.480 1.00 21.83 ? 111 LYS A CG    1 
ATOM   1112 C  CD    . LYS B 2 111 ? 1.818   5.751   17.743 1.00 24.69 ? 111 LYS A CD    1 
ATOM   1113 C  CE    . LYS B 2 111 ? 1.320   4.383   17.383 1.00 27.53 ? 111 LYS A CE    1 
ATOM   1114 N  NZ    . LYS B 2 111 ? 1.735   4.097   15.953 1.00 26.56 ? 111 LYS A NZ    1 
ATOM   1115 N  N     . TYR B 2 112 ? 6.074   8.334   17.220 1.00 16.13 ? 112 TYR A N     1 
ATOM   1116 C  CA    . TYR B 2 112 ? 7.367   8.997   17.097 1.00 15.89 ? 112 TYR A CA    1 
ATOM   1117 C  C     . TYR B 2 112 ? 8.459   8.118   16.516 1.00 18.32 ? 112 TYR A C     1 
ATOM   1118 O  O     . TYR B 2 112 ? 9.650   8.458   16.597 1.00 19.12 ? 112 TYR A O     1 
ATOM   1119 C  CB    . TYR B 2 112 ? 7.802   9.573   18.430 1.00 13.66 ? 112 TYR A CB    1 
ATOM   1120 C  CG    . TYR B 2 112 ? 6.808   10.573  18.968 1.00 16.30 ? 112 TYR A CG    1 
ATOM   1121 C  CD1   . TYR B 2 112 ? 6.010   10.266  20.080 1.00 12.37 ? 112 TYR A CD1   1 
ATOM   1122 C  CD2   . TYR B 2 112 ? 6.539   11.756  18.267 1.00 11.59 ? 112 TYR A CD2   1 
ATOM   1123 C  CE1   . TYR B 2 112 ? 5.044   11.154  20.545 1.00 9.14  ? 112 TYR A CE1   1 
ATOM   1124 C  CE2   . TYR B 2 112 ? 5.566   12.643  18.716 1.00 15.66 ? 112 TYR A CE2   1 
ATOM   1125 C  CZ    . TYR B 2 112 ? 4.821   12.331  19.853 1.00 14.36 ? 112 TYR A CZ    1 
ATOM   1126 O  OH    . TYR B 2 112 ? 3.882   13.216  20.298 1.00 13.36 ? 112 TYR A OH    1 
ATOM   1127 N  N     . SER B 2 113 ? 8.061   7.030   15.859 1.00 17.77 ? 113 SER A N     1 
ATOM   1128 C  CA    . SER B 2 113 ? 9.019   6.221   15.114 1.00 17.94 ? 113 SER A CA    1 
ATOM   1129 C  C     . SER B 2 113 ? 9.377   6.921   13.809 1.00 18.16 ? 113 SER A C     1 
ATOM   1130 O  O     . SER B 2 113 ? 8.562   7.639   13.246 1.00 19.88 ? 113 SER A O     1 
ATOM   1131 C  CB    . SER B 2 113 ? 8.469   4.814   14.850 1.00 16.54 ? 113 SER A CB    1 
ATOM   1132 O  OG    . SER B 2 113 ? 7.580   4.812   13.745 1.00 14.55 ? 113 SER A OG    1 
ATOM   1133 N  N     . ASN B 2 114 ? 10.640  6.811   13.412 1.00 18.67 ? 114 ASN A N     1 
ATOM   1134 C  CA    . ASN B 2 114 ? 11.108  7.351   12.145 1.00 18.00 ? 114 ASN A CA    1 
ATOM   1135 C  C     . ASN B 2 114 ? 10.013  7.262   11.088 1.00 18.49 ? 114 ASN A C     1 
ATOM   1136 O  O     . ASN B 2 114 ? 9.665   8.257   10.460 1.00 19.88 ? 114 ASN A O     1 
ATOM   1137 C  CB    . ASN B 2 114 ? 12.361  6.586   11.691 1.00 17.24 ? 114 ASN A CB    1 
ATOM   1138 C  CG    . ASN B 2 114 ? 13.290  7.423   10.816 1.00 16.91 ? 114 ASN A CG    1 
ATOM   1139 O  OD1   . ASN B 2 114 ? 13.346  8.645   10.935 1.00 12.53 ? 114 ASN A OD1   1 
ATOM   1140 N  ND2   . ASN B 2 114 ? 14.102  6.746   10.007 1.00 16.90 ? 114 ASN A ND2   1 
ATOM   1141 N  N     . MET B 2 115 ? 9.385   6.097   10.987 1.00 19.15 ? 115 MET A N     1 
ATOM   1142 C  CA    . MET B 2 115 ? 8.476   5.802   9.873  1.00 18.56 ? 115 MET A CA    1 
ATOM   1143 C  C     . MET B 2 115 ? 7.034   6.290   10.152 1.00 16.66 ? 115 MET A C     1 
ATOM   1144 O  O     . MET B 2 115 ? 6.332   6.706   9.246  1.00 16.70 ? 115 MET A O     1 
ATOM   1145 C  CB    . MET B 2 115 ? 8.515   4.296   9.550  1.00 19.03 ? 115 MET A CB    1 
ATOM   1146 C  CG    . MET B 2 115 ? 7.643   3.843   8.376  1.00 22.68 ? 115 MET A CG    1 
ATOM   1147 S  SD    . MET B 2 115 ? 7.845   4.803   6.855  1.00 33.54 ? 115 MET A SD    1 
ATOM   1148 C  CE    . MET B 2 115 ? 9.585   4.592   6.481  1.00 31.08 ? 115 MET A CE    1 
ATOM   1149 N  N     . ALA B 2 116 ? 6.621   6.281   11.415 1.00 15.46 ? 116 ALA A N     1 
ATOM   1150 C  CA    . ALA B 2 116 ? 5.361   6.912   11.800 1.00 13.19 ? 116 ALA A CA    1 
ATOM   1151 C  C     . ALA B 2 116 ? 5.378   8.382   11.404 1.00 13.41 ? 116 ALA A C     1 
ATOM   1152 O  O     . ALA B 2 116 ? 4.485   8.854   10.718 1.00 13.35 ? 116 ALA A O     1 
ATOM   1153 C  CB    . ALA B 2 116 ? 5.123   6.761   13.291 1.00 10.49 ? 116 ALA A CB    1 
ATOM   1154 N  N     . LEU B 2 117 ? 6.445   9.083   11.769 1.00 15.33 ? 117 LEU A N     1 
ATOM   1155 C  CA    . LEU B 2 117 ? 6.547   10.523  11.511 1.00 15.06 ? 117 LEU A CA    1 
ATOM   1156 C  C     . LEU B 2 117 ? 6.587   10.788  10.027 1.00 15.32 ? 117 LEU A C     1 
ATOM   1157 O  O     . LEU B 2 117 ? 6.057   11.789  9.550  1.00 15.31 ? 117 LEU A O     1 
ATOM   1158 C  CB    . LEU B 2 117 ? 7.814   11.092  12.154 1.00 15.45 ? 117 LEU A CB    1 
ATOM   1159 C  CG    . LEU B 2 117 ? 7.738   11.586  13.595 1.00 14.69 ? 117 LEU A CG    1 
ATOM   1160 C  CD1   . LEU B 2 117 ? 6.305   11.610  14.109 1.00 15.50 ? 117 LEU A CD1   1 
ATOM   1161 C  CD2   . LEU B 2 117 ? 8.631   10.758  14.479 1.00 9.77  ? 117 LEU A CD2   1 
ATOM   1162 N  N     . TYR B 2 118 ? 7.288   9.919   9.308  1.00 16.27 ? 118 TYR A N     1 
ATOM   1163 C  CA    . TYR B 2 118 ? 7.444   10.062  7.867  1.00 17.75 ? 118 TYR A CA    1 
ATOM   1164 C  C     . TYR B 2 118 ? 6.083   10.160  7.231  1.00 17.08 ? 118 TYR A C     1 
ATOM   1165 O  O     . TYR B 2 118 ? 5.902   10.875  6.254  1.00 17.45 ? 118 TYR A O     1 
ATOM   1166 C  CB    . TYR B 2 118 ? 8.200   8.855   7.278  1.00 18.16 ? 118 TYR A CB    1 
ATOM   1167 C  CG    . TYR B 2 118 ? 8.460   8.962   5.790  1.00 21.41 ? 118 TYR A CG    1 
ATOM   1168 C  CD1   . TYR B 2 118 ? 7.743   8.204   4.886  1.00 25.72 ? 118 TYR A CD1   1 
ATOM   1169 C  CD2   . TYR B 2 118 ? 9.381   9.868   5.292  1.00 28.16 ? 118 TYR A CD2   1 
ATOM   1170 C  CE1   . TYR B 2 118 ? 7.974   8.301   3.518  1.00 29.10 ? 118 TYR A CE1   1 
ATOM   1171 C  CE2   . TYR B 2 118 ? 9.611   9.985   3.926  1.00 30.02 ? 118 TYR A CE2   1 
ATOM   1172 C  CZ    . TYR B 2 118 ? 8.917   9.183   3.048  1.00 31.22 ? 118 TYR A CZ    1 
ATOM   1173 O  OH    . TYR B 2 118 ? 9.163   9.277   1.689  1.00 37.41 ? 118 TYR A OH    1 
ATOM   1174 N  N     . LYS B 2 119 ? 5.152   9.362   7.747  1.00 17.70 ? 119 LYS A N     1 
ATOM   1175 C  CA    . LYS B 2 119 ? 3.793   9.281   7.217  1.00 18.13 ? 119 LYS A CA    1 
ATOM   1176 C  C     . LYS B 2 119 ? 2.923   10.461  7.678  1.00 17.68 ? 119 LYS A C     1 
ATOM   1177 O  O     . LYS B 2 119 ? 2.194   11.048  6.883  1.00 17.78 ? 119 LYS A O     1 
ATOM   1178 C  CB    . LYS B 2 119 ? 3.141   7.972   7.667  1.00 19.11 ? 119 LYS A CB    1 
ATOM   1179 C  CG    . LYS B 2 119 ? 3.783   6.715   7.102  1.00 20.58 ? 119 LYS A CG    1 
ATOM   1180 C  CD    . LYS B 2 119 ? 3.301   5.500   7.870  1.00 26.66 ? 119 LYS A CD    1 
ATOM   1181 C  CE    . LYS B 2 119 ? 3.653   4.195   7.164  1.00 29.93 ? 119 LYS A CE    1 
ATOM   1182 N  NZ    . LYS B 2 119 ? 3.368   3.047   8.077  1.00 31.82 ? 119 LYS A NZ    1 
ATOM   1183 N  N     . THR B 2 120 ? 2.931   10.743  8.976  1.00 16.99 ? 120 THR A N     1 
ATOM   1184 C  CA    . THR B 2 120 ? 2.122   11.830  9.514  1.00 18.24 ? 120 THR A CA    1 
ATOM   1185 C  C     . THR B 2 120 ? 2.541   13.198  8.948  1.00 19.70 ? 120 THR A C     1 
ATOM   1186 O  O     . THR B 2 120 ? 1.693   14.038  8.642  1.00 19.38 ? 120 THR A O     1 
ATOM   1187 C  CB    . THR B 2 120 ? 2.179   11.885  11.045 1.00 17.63 ? 120 THR A CB    1 
ATOM   1188 O  OG1   . THR B 2 120 ? 1.548   10.721  11.588 1.00 20.83 ? 120 THR A OG1   1 
ATOM   1189 C  CG2   . THR B 2 120 ? 1.459   13.135  11.561 1.00 13.92 ? 120 THR A CG2   1 
ATOM   1190 N  N     . ARG B 2 121 ? 3.846   13.427  8.834  1.00 19.66 ? 121 ARG A N     1 
ATOM   1191 C  CA    . ARG B 2 121 ? 4.332   14.676  8.278  1.00 20.18 ? 121 ARG A CA    1 
ATOM   1192 C  C     . ARG B 2 121 ? 4.303   14.627  6.764  1.00 21.93 ? 121 ARG A C     1 
ATOM   1193 O  O     . ARG B 2 121 ? 4.576   15.628  6.093  1.00 23.29 ? 121 ARG A O     1 
ATOM   1194 C  CB    . ARG B 2 121 ? 5.739   14.989  8.786  1.00 19.20 ? 121 ARG A CB    1 
ATOM   1195 C  CG    . ARG B 2 121 ? 5.814   15.273  10.292 1.00 19.78 ? 121 ARG A CG    1 
ATOM   1196 C  CD    . ARG B 2 121 ? 4.812   16.370  10.719 1.00 20.39 ? 121 ARG A CD    1 
ATOM   1197 N  NE    . ARG B 2 121 ? 5.069   17.627  10.023 1.00 16.31 ? 121 ARG A NE    1 
ATOM   1198 C  CZ    . ARG B 2 121 ? 4.251   18.672  10.011 1.00 16.24 ? 121 ARG A CZ    1 
ATOM   1199 N  NH1   . ARG B 2 121 ? 3.087   18.636  10.652 1.00 12.22 ? 121 ARG A NH1   1 
ATOM   1200 N  NH2   . ARG B 2 121 ? 4.613   19.768  9.358  1.00 18.54 ? 121 ARG A NH2   1 
ATOM   1201 N  N     . LYS B 2 122 ? 3.947   13.468  6.218  1.00 22.52 ? 122 LYS A N     1 
ATOM   1202 C  CA    . LYS B 2 122 ? 3.771   13.347  4.785  1.00 23.73 ? 122 LYS A CA    1 
ATOM   1203 C  C     . LYS B 2 122 ? 5.044   13.794  4.074  1.00 23.77 ? 122 LYS A C     1 
ATOM   1204 O  O     . LYS B 2 122 ? 4.999   14.608  3.154  1.00 23.55 ? 122 LYS A O     1 
ATOM   1205 C  CB    . LYS B 2 122 ? 2.602   14.227  4.329  1.00 24.38 ? 122 LYS A CB    1 
ATOM   1206 C  CG    . LYS B 2 122 ? 1.391   13.464  3.856  1.00 26.54 ? 122 LYS A CG    1 
ATOM   1207 C  CD    . LYS B 2 122 ? 0.185   14.392  3.718  1.00 31.57 ? 122 LYS A CD    1 
ATOM   1208 C  CE    . LYS B 2 122 ? -0.872  14.081  4.752  1.00 31.08 ? 122 LYS A CE    1 
ATOM   1209 N  NZ    . LYS B 2 122 ? -0.840  15.050  5.873  1.00 32.84 ? 122 LYS A NZ    1 
ATOM   1210 N  N     . LEU B 2 123 ? 6.180   13.280  4.522  1.00 23.86 ? 123 LEU A N     1 
ATOM   1211 C  CA    . LEU B 2 123 ? 7.462   13.733  4.005  1.00 24.39 ? 123 LEU A CA    1 
ATOM   1212 C  C     . LEU B 2 123 ? 7.711   13.225  2.586  1.00 25.69 ? 123 LEU A C     1 
ATOM   1213 O  O     . LEU B 2 123 ? 7.119   12.226  2.144  1.00 23.93 ? 123 LEU A O     1 
ATOM   1214 C  CB    . LEU B 2 123 ? 8.603   13.310  4.937  1.00 23.98 ? 123 LEU A CB    1 
ATOM   1215 C  CG    . LEU B 2 123 ? 8.593   13.866  6.372  1.00 22.99 ? 123 LEU A CG    1 
ATOM   1216 C  CD1   . LEU B 2 123 ? 9.646   13.178  7.200  1.00 22.37 ? 123 LEU A CD1   1 
ATOM   1217 C  CD2   . LEU B 2 123 ? 8.811   15.367  6.388  1.00 23.92 ? 123 LEU A CD2   1 
ATOM   1218 N  N     . ASN B 2 124 ? 8.536   13.957  1.848  1.00 27.39 ? 124 ASN A N     1 
ATOM   1219 C  CA    . ASN B 2 124 ? 9.082   13.443  0.603  1.00 29.69 ? 124 ASN A CA    1 
ATOM   1220 C  C     . ASN B 2 124 ? 10.584  13.505  0.622  1.00 29.58 ? 124 ASN A C     1 
ATOM   1221 O  O     . ASN B 2 124 ? 11.165  14.568  0.833  1.00 29.37 ? 124 ASN A O     1 
ATOM   1222 C  CB    . ASN B 2 124 ? 8.546   14.212  -0.611 1.00 30.67 ? 124 ASN A CB    1 
ATOM   1223 C  CG    . ASN B 2 124 ? 8.604   13.376  -1.908 1.00 33.13 ? 124 ASN A CG    1 
ATOM   1224 O  OD1   . ASN B 2 124 ? 7.726   12.539  -2.166 1.00 28.17 ? 124 ASN A OD1   1 
ATOM   1225 N  ND2   . ASN B 2 124 ? 9.650   13.596  -2.716 1.00 30.92 ? 124 ASN A ND2   1 
ATOM   1226 N  N     . VAL B 2 125 ? 11.219  12.358  0.441  1.00 29.68 ? 125 VAL A N     1 
ATOM   1227 C  CA    . VAL B 2 125 ? 12.659  12.336  0.358  1.00 31.21 ? 125 VAL A CA    1 
ATOM   1228 C  C     . VAL B 2 125 ? 13.162  11.482  -0.790 1.00 31.66 ? 125 VAL A C     1 
ATOM   1229 O  O     . VAL B 2 125 ? 12.480  10.569  -1.232 1.00 31.55 ? 125 VAL A O     1 
ATOM   1230 C  CB    . VAL B 2 125 ? 13.313  11.940  1.705  1.00 31.59 ? 125 VAL A CB    1 
ATOM   1231 C  CG1   . VAL B 2 125 ? 13.116  10.455  2.000  1.00 29.12 ? 125 VAL A CG1   1 
ATOM   1232 C  CG2   . VAL B 2 125 ? 14.799  12.340  1.710  1.00 32.65 ? 125 VAL A CG2   1 
ATOM   1233 N  N     . GLN B 2 126 ? 14.291  11.880  -1.364 1.00 33.91 ? 126 GLN A N     1 
ATOM   1234 C  CA    . GLN B 2 126 ? 14.922  11.096  -2.413 1.00 36.37 ? 126 GLN A CA    1 
ATOM   1235 C  C     . GLN B 2 126 ? 15.830  10.030  -1.804 1.00 35.82 ? 126 GLN A C     1 
ATOM   1236 O  O     . GLN B 2 126 ? 16.876  10.344  -1.241 1.00 37.09 ? 126 GLN A O     1 
ATOM   1237 C  CB    . GLN B 2 126 ? 15.714  11.999  -3.363 1.00 37.63 ? 126 GLN A CB    1 
ATOM   1238 C  CG    . GLN B 2 126 ? 16.510  11.241  -4.444 1.00 44.31 ? 126 GLN A CG    1 
ATOM   1239 C  CD    . GLN B 2 126 ? 15.659  10.842  -5.645 1.00 51.12 ? 126 GLN A CD    1 
ATOM   1240 O  OE1   . GLN B 2 126 ? 14.826  9.929   -5.565 1.00 52.78 ? 126 GLN A OE1   1 
ATOM   1241 N  NE2   . GLN B 2 126 ? 15.900  11.496  -6.779 1.00 52.09 ? 126 GLN A NE2   1 
ATOM   1242 N  N     . THR B 2 127 ? 15.402  8.775   -1.906 1.00 34.88 ? 127 THR A N     1 
ATOM   1243 C  CA    . THR B 2 127 ? 16.070  7.658   -1.249 1.00 34.27 ? 127 THR A CA    1 
ATOM   1244 C  C     . THR B 2 127 ? 17.130  7.048   -2.162 1.00 32.22 ? 127 THR A C     1 
ATOM   1245 O  O     . THR B 2 127 ? 17.107  7.255   -3.367 1.00 31.95 ? 127 THR A O     1 
ATOM   1246 C  CB    . THR B 2 127 ? 15.046  6.559   -0.853 1.00 36.39 ? 127 THR A CB    1 
ATOM   1247 O  OG1   . THR B 2 127 ? 13.884  6.663   -1.693 1.00 33.96 ? 127 THR A OG1   1 
ATOM   1248 C  CG2   . THR B 2 127 ? 14.629  6.698   0.649  1.00 34.24 ? 127 THR A CG2   1 
ATOM   1249 N  N     . PRO B 2 128 ? 18.079  6.307   -1.582 1.00 31.22 ? 128 PRO A N     1 
ATOM   1250 C  CA    . PRO B 2 128 ? 19.138  5.756   -2.416 1.00 30.48 ? 128 PRO A CA    1 
ATOM   1251 C  C     . PRO B 2 128 ? 18.653  4.543   -3.196 1.00 30.19 ? 128 PRO A C     1 
ATOM   1252 O  O     . PRO B 2 128 ? 17.567  4.021   -2.923 1.00 29.97 ? 128 PRO A O     1 
ATOM   1253 C  CB    . PRO B 2 128 ? 20.208  5.332   -1.399 1.00 30.59 ? 128 PRO A CB    1 
ATOM   1254 C  CG    . PRO B 2 128 ? 19.920  6.107   -0.187 1.00 31.46 ? 128 PRO A CG    1 
ATOM   1255 C  CD    . PRO B 2 128 ? 18.427  6.268   -0.156 1.00 30.84 ? 128 PRO A CD    1 
ATOM   1256 N  N     . PRO B 2 129 ? 19.434  4.118   -4.199 1.00 29.50 ? 129 PRO A N     1 
ATOM   1257 C  CA    . PRO B 2 129 ? 18.945  3.038   -5.058 1.00 28.16 ? 129 PRO A CA    1 
ATOM   1258 C  C     . PRO B 2 129 ? 19.262  1.644   -4.502 1.00 26.31 ? 129 PRO A C     1 
ATOM   1259 O  O     . PRO B 2 129 ? 20.349  1.427   -3.978 1.00 28.37 ? 129 PRO A O     1 
ATOM   1260 C  CB    . PRO B 2 129 ? 19.665  3.291   -6.383 1.00 28.62 ? 129 PRO A CB    1 
ATOM   1261 C  CG    . PRO B 2 129 ? 20.864  4.106   -6.025 1.00 28.93 ? 129 PRO A CG    1 
ATOM   1262 C  CD    . PRO B 2 129 ? 20.534  4.887   -4.813 1.00 27.37 ? 129 PRO A CD    1 
ATOM   1263 N  N     . GLY B 2 130 ? 18.277  0.749   -4.528 1.00 24.25 ? 130 GLY A N     1 
ATOM   1264 C  CA    . GLY B 2 130 ? 18.487  -0.663  -4.191 1.00 22.35 ? 130 GLY A CA    1 
ATOM   1265 C  C     . GLY B 2 130 ? 18.531  -0.974  -2.695 1.00 21.68 ? 130 GLY A C     1 
ATOM   1266 O  O     . GLY B 2 130 ? 19.095  -1.998  -2.274 1.00 20.01 ? 130 GLY A O     1 
ATOM   1267 N  N     . LEU B 2 131 ? 17.955  -0.087  -1.891 1.00 18.82 ? 131 LEU A N     1 
ATOM   1268 C  CA    . LEU B 2 131 ? 17.927  -0.276  -0.449 1.00 17.45 ? 131 LEU A CA    1 
ATOM   1269 C  C     . LEU B 2 131 ? 16.477  -0.411  0.020  1.00 17.34 ? 131 LEU A C     1 
ATOM   1270 O  O     . LEU B 2 131 ? 15.589  -0.689  -0.770 1.00 16.53 ? 131 LEU A O     1 
ATOM   1271 C  CB    . LEU B 2 131 ? 18.604  0.908   0.269  1.00 16.51 ? 131 LEU A CB    1 
ATOM   1272 C  CG    . LEU B 2 131 ? 20.098  1.101   -0.016 1.00 15.85 ? 131 LEU A CG    1 
ATOM   1273 C  CD1   . LEU B 2 131 ? 20.581  2.472   0.456  1.00 16.40 ? 131 LEU A CD1   1 
ATOM   1274 C  CD2   . LEU B 2 131 ? 20.923  -0.023  0.644  1.00 17.78 ? 131 LEU A CD2   1 
ATOM   1275 N  N     . HIS B 2 132 ? 16.243  -0.173  1.305  1.00 17.97 ? 132 HIS A N     1 
ATOM   1276 C  CA    . HIS B 2 132 ? 14.899  -0.222  1.853  1.00 16.93 ? 132 HIS A CA    1 
ATOM   1277 C  C     . HIS B 2 132 ? 14.902  0.309   3.280  1.00 16.84 ? 132 HIS A C     1 
ATOM   1278 O  O     . HIS B 2 132 ? 15.948  0.723   3.798  1.00 17.00 ? 132 HIS A O     1 
ATOM   1279 C  CB    . HIS B 2 132 ? 14.360  -1.662  1.817  1.00 16.99 ? 132 HIS A CB    1 
ATOM   1280 C  CG    . HIS B 2 132 ? 15.277  -2.665  2.445  1.00 18.38 ? 132 HIS A CG    1 
ATOM   1281 N  ND1   . HIS B 2 132 ? 15.381  -2.823  3.811  1.00 21.87 ? 132 HIS A ND1   1 
ATOM   1282 C  CD2   . HIS B 2 132 ? 16.178  -3.515  1.897  1.00 17.10 ? 132 HIS A CD2   1 
ATOM   1283 C  CE1   . HIS B 2 132 ? 16.282  -3.754  4.075  1.00 19.66 ? 132 HIS A CE1   1 
ATOM   1284 N  NE2   . HIS B 2 132 ? 16.782  -4.188  2.930  1.00 19.11 ? 132 HIS A NE2   1 
ATOM   1285 N  N     . HIS B 2 133 ? 13.721  0.353   3.890  1.00 14.92 ? 133 HIS A N     1 
ATOM   1286 C  CA    . HIS B 2 133 ? 13.590  0.750   5.280  1.00 14.18 ? 133 HIS A CA    1 
ATOM   1287 C  C     . HIS B 2 133 ? 14.541  -0.071  6.167  1.00 15.16 ? 133 HIS A C     1 
ATOM   1288 O  O     . HIS B 2 133 ? 14.638  -1.294  6.033  1.00 12.81 ? 133 HIS A O     1 
ATOM   1289 C  CB    . HIS B 2 133 ? 12.143  0.560   5.735  1.00 15.11 ? 133 HIS A CB    1 
ATOM   1290 C  CG    . HIS B 2 133 ? 11.861  1.087   7.105  1.00 17.30 ? 133 HIS A CG    1 
ATOM   1291 N  ND1   . HIS B 2 133 ? 12.482  2.209   7.616  1.00 20.16 ? 133 HIS A ND1   1 
ATOM   1292 C  CD2   . HIS B 2 133 ? 10.928  0.725   8.020  1.00 21.06 ? 133 HIS A CD2   1 
ATOM   1293 C  CE1   . HIS B 2 133 ? 11.989  2.474   8.815  1.00 23.87 ? 133 HIS A CE1   1 
ATOM   1294 N  NE2   . HIS B 2 133 ? 11.051  1.583   9.088  1.00 22.15 ? 133 HIS A NE2   1 
ATOM   1295 N  N     . HIS B 2 134 ? 15.213  0.611   7.091  1.00 14.95 ? 134 HIS A N     1 
ATOM   1296 C  CA    . HIS B 2 134 ? 16.138  -0.034  8.012  1.00 15.01 ? 134 HIS A CA    1 
ATOM   1297 C  C     . HIS B 2 134 ? 17.404  -0.460  7.283  1.00 15.83 ? 134 HIS A C     1 
ATOM   1298 O  O     . HIS B 2 134 ? 18.050  -1.430  7.660  1.00 13.66 ? 134 HIS A O     1 
ATOM   1299 C  CB    . HIS B 2 134 ? 15.486  -1.236  8.717  1.00 14.88 ? 134 HIS A CB    1 
ATOM   1300 C  CG    . HIS B 2 134 ? 14.587  -0.853  9.856  1.00 14.87 ? 134 HIS A CG    1 
ATOM   1301 N  ND1   . HIS B 2 134 ? 13.212  -0.968  9.794  1.00 16.47 ? 134 HIS A ND1   1 
ATOM   1302 C  CD2   . HIS B 2 134 ? 14.863  -0.308  11.066 1.00 13.03 ? 134 HIS A CD2   1 
ATOM   1303 C  CE1   . HIS B 2 134 ? 12.685  -0.536  10.929 1.00 19.89 ? 134 HIS A CE1   1 
ATOM   1304 N  NE2   . HIS B 2 134 ? 13.664  -0.115  11.711 1.00 21.10 ? 134 HIS A NE2   1 
ATOM   1305 N  N     . ARG B 2 135 ? 17.826  0.363   6.328  1.00 18.40 ? 135 ARG A N     1 
ATOM   1306 C  CA    . ARG B 2 135 ? 19.187  0.293   5.796  1.00 17.65 ? 135 ARG A CA    1 
ATOM   1307 C  C     . ARG B 2 135 ? 19.967  1.597   6.061  1.00 18.07 ? 135 ARG A C     1 
ATOM   1308 O  O     . ARG B 2 135 ? 20.190  2.377   5.147  1.00 23.55 ? 135 ARG A O     1 
ATOM   1309 C  CB    . ARG B 2 135 ? 19.123  0.058   4.294  1.00 18.58 ? 135 ARG A CB    1 
ATOM   1310 C  CG    . ARG B 2 135 ? 19.485  -1.365  3.829  1.00 20.16 ? 135 ARG A CG    1 
ATOM   1311 C  CD    . ARG B 2 135 ? 20.271  -2.161  4.853  1.00 22.12 ? 135 ARG A CD    1 
ATOM   1312 N  NE    . ARG B 2 135 ? 21.677  -2.280  4.451  1.00 27.05 ? 135 ARG A NE    1 
ATOM   1313 C  CZ    . ARG B 2 135 ? 22.086  -2.773  3.280  1.00 22.00 ? 135 ARG A CZ    1 
ATOM   1314 N  NH1   . ARG B 2 135 ? 21.203  -3.227  2.406  1.00 21.37 ? 135 ARG A NH1   1 
ATOM   1315 N  NH2   . ARG B 2 135 ? 23.375  -2.764  2.969  1.00 21.15 ? 135 ARG A NH2   1 
ATOM   1316 N  N     . ALA B 2 136 ? 20.430  1.806   7.287  1.00 17.07 ? 136 ALA A N     1 
ATOM   1317 C  CA    . ALA B 2 136 ? 21.279  2.970   7.604  1.00 14.71 ? 136 ALA A CA    1 
ATOM   1318 C  C     . ALA B 2 136 ? 21.145  4.140   6.618  1.00 12.69 ? 136 ALA A C     1 
ATOM   1319 O  O     . ALA B 2 136 ? 20.484  5.136   6.910  1.00 14.01 ? 136 ALA A O     1 
ATOM   1320 C  CB    . ALA B 2 136 ? 22.710  2.546   7.726  1.00 14.71 ? 136 ALA A CB    1 
ATOM   1321 N  N     . LEU B 2 137 ? 21.746  4.004   5.441  1.00 10.81 ? 137 LEU A N     1 
ATOM   1322 C  CA    . LEU B 2 137 ? 21.696  5.075   4.453  1.00 13.04 ? 137 LEU A CA    1 
ATOM   1323 C  C     . LEU B 2 137 ? 20.271  5.462   4.056  1.00 13.64 ? 137 LEU A C     1 
ATOM   1324 O  O     . LEU B 2 137 ? 19.924  6.637   4.057  1.00 16.28 ? 137 LEU A O     1 
ATOM   1325 C  CB    . LEU B 2 137 ? 22.519  4.734   3.216  1.00 11.42 ? 137 LEU A CB    1 
ATOM   1326 C  CG    . LEU B 2 137 ? 22.764  5.895   2.237  1.00 13.36 ? 137 LEU A CG    1 
ATOM   1327 C  CD1   . LEU B 2 137 ? 23.341  7.131   2.967  1.00 8.22  ? 137 LEU A CD1   1 
ATOM   1328 C  CD2   . LEU B 2 137 ? 23.705  5.456   1.092  1.00 17.04 ? 137 LEU A CD2   1 
ATOM   1329 N  N     . TYR B 2 138 ? 19.446  4.472   3.754  1.00 12.58 ? 138 TYR A N     1 
ATOM   1330 C  CA    . TYR B 2 138 ? 18.046  4.714   3.444  1.00 12.81 ? 138 TYR A CA    1 
ATOM   1331 C  C     . TYR B 2 138 ? 17.339  5.503   4.553  1.00 14.40 ? 138 TYR A C     1 
ATOM   1332 O  O     . TYR B 2 138 ? 16.500  6.358   4.274  1.00 17.04 ? 138 TYR A O     1 
ATOM   1333 C  CB    . TYR B 2 138 ? 17.336  3.387   3.229  1.00 12.10 ? 138 TYR A CB    1 
ATOM   1334 C  CG    . TYR B 2 138 ? 15.924  3.504   2.741  1.00 11.56 ? 138 TYR A CG    1 
ATOM   1335 C  CD1   . TYR B 2 138 ? 14.879  3.734   3.624  1.00 14.76 ? 138 TYR A CD1   1 
ATOM   1336 C  CD2   . TYR B 2 138 ? 15.614  3.271   1.407  1.00 12.10 ? 138 TYR A CD2   1 
ATOM   1337 C  CE1   . TYR B 2 138 ? 13.557  3.775   3.175  1.00 13.68 ? 138 TYR A CE1   1 
ATOM   1338 C  CE2   . TYR B 2 138 ? 14.317  3.301   0.955  1.00 13.36 ? 138 TYR A CE2   1 
ATOM   1339 C  CZ    . TYR B 2 138 ? 13.286  3.543   1.838  1.00 16.96 ? 138 TYR A CZ    1 
ATOM   1340 O  OH    . TYR B 2 138 ? 11.977  3.560   1.371  1.00 16.48 ? 138 TYR A OH    1 
ATOM   1341 N  N     . ASP B 2 139 ? 17.637  5.171   5.807  1.00 13.80 ? 139 ASP A N     1 
ATOM   1342 C  CA    . ASP B 2 139 ? 16.943  5.757   6.940  1.00 12.87 ? 139 ASP A CA    1 
ATOM   1343 C  C     . ASP B 2 139 ? 17.461  7.165   7.171  1.00 14.23 ? 139 ASP A C     1 
ATOM   1344 O  O     . ASP B 2 139 ? 16.713  8.055   7.591  1.00 14.68 ? 139 ASP A O     1 
ATOM   1345 C  CB    . ASP B 2 139 ? 17.162  4.915   8.194  1.00 11.48 ? 139 ASP A CB    1 
ATOM   1346 C  CG    . ASP B 2 139 ? 16.248  3.698   8.250  1.00 17.07 ? 139 ASP A CG    1 
ATOM   1347 O  OD1   . ASP B 2 139 ? 15.499  3.466   7.278  1.00 16.96 ? 139 ASP A OD1   1 
ATOM   1348 O  OD2   . ASP B 2 139 ? 16.274  2.969   9.271  1.00 18.24 ? 139 ASP A OD2   1 
ATOM   1349 N  N     . CYS B 2 140 ? 18.744  7.366   6.878  1.00 13.07 ? 140 CYS A N     1 
ATOM   1350 C  CA    . CYS B 2 140 ? 19.349  8.679   6.961  1.00 13.83 ? 140 CYS A CA    1 
ATOM   1351 C  C     . CYS B 2 140 ? 18.533  9.707   6.195  1.00 13.09 ? 140 CYS A C     1 
ATOM   1352 O  O     . CYS B 2 140 ? 18.212  10.767  6.723  1.00 12.64 ? 140 CYS A O     1 
ATOM   1353 C  CB    . CYS B 2 140 ? 20.776  8.645   6.424  1.00 14.67 ? 140 CYS A CB    1 
ATOM   1354 S  SG    . CYS B 2 140 ? 22.037  8.310   7.678  1.00 16.53 ? 140 CYS A SG    1 
ATOM   1355 N  N     . TYR B 2 141 ? 18.188  9.381   4.951  1.00 12.30 ? 141 TYR A N     1 
ATOM   1356 C  CA    . TYR B 2 141 ? 17.442  10.303  4.099  1.00 12.70 ? 141 TYR A CA    1 
ATOM   1357 C  C     . TYR B 2 141 ? 16.037  10.558  4.653  1.00 13.86 ? 141 TYR A C     1 
ATOM   1358 O  O     . TYR B 2 141 ? 15.497  11.664  4.534  1.00 15.02 ? 141 TYR A O     1 
ATOM   1359 C  CB    . TYR B 2 141 ? 17.368  9.774   2.669  1.00 11.53 ? 141 TYR A CB    1 
ATOM   1360 C  CG    . TYR B 2 141 ? 18.621  10.027  1.851  1.00 12.72 ? 141 TYR A CG    1 
ATOM   1361 C  CD1   . TYR B 2 141 ? 18.878  11.280  1.296  1.00 15.95 ? 141 TYR A CD1   1 
ATOM   1362 C  CD2   . TYR B 2 141 ? 19.572  9.030   1.680  1.00 14.87 ? 141 TYR A CD2   1 
ATOM   1363 C  CE1   . TYR B 2 141 ? 20.035  11.518  0.572  1.00 18.58 ? 141 TYR A CE1   1 
ATOM   1364 C  CE2   . TYR B 2 141 ? 20.726  9.249   0.958  1.00 13.82 ? 141 TYR A CE2   1 
ATOM   1365 C  CZ    . TYR B 2 141 ? 20.952  10.491  0.400  1.00 21.51 ? 141 TYR A CZ    1 
ATOM   1366 O  OH    . TYR B 2 141 ? 22.076  10.694  -0.360 1.00 21.43 ? 141 TYR A OH    1 
ATOM   1367 N  N     . ILE B 2 142 ? 15.475  9.547   5.310  1.00 12.84 ? 142 ILE A N     1 
ATOM   1368 C  CA    . ILE B 2 142 ? 14.206  9.694   5.978  1.00 12.51 ? 142 ILE A CA    1 
ATOM   1369 C  C     . ILE B 2 142 ? 14.351  10.637  7.173  1.00 12.01 ? 142 ILE A C     1 
ATOM   1370 O  O     . ILE B 2 142 ? 13.547  11.550  7.344  1.00 13.53 ? 142 ILE A O     1 
ATOM   1371 C  CB    . ILE B 2 142 ? 13.673  8.345   6.494  1.00 14.07 ? 142 ILE A CB    1 
ATOM   1372 C  CG1   . ILE B 2 142 ? 13.516  7.330   5.354  1.00 15.40 ? 142 ILE A CG1   1 
ATOM   1373 C  CG2   . ILE B 2 142 ? 12.399  8.557   7.300  1.00 9.64  ? 142 ILE A CG2   1 
ATOM   1374 C  CD1   . ILE B 2 142 ? 12.422  7.659   4.362  1.00 18.89 ? 142 ILE A CD1   1 
ATOM   1375 N  N     . THR B 2 143 ? 15.358  10.393  8.007  1.00 9.03  ? 143 THR A N     1 
ATOM   1376 C  CA    . THR B 2 143 ? 15.545  11.161  9.227  1.00 8.63  ? 143 THR A CA    1 
ATOM   1377 C  C     . THR B 2 143 ? 15.968  12.589  8.892  1.00 9.74  ? 143 THR A C     1 
ATOM   1378 O  O     . THR B 2 143 ? 15.560  13.539  9.565  1.00 9.93  ? 143 THR A O     1 
ATOM   1379 C  CB    . THR B 2 143 ? 16.577  10.486  10.162 1.00 8.31  ? 143 THR A CB    1 
ATOM   1380 O  OG1   . THR B 2 143 ? 16.024  9.275   10.682 1.00 9.63  ? 143 THR A OG1   1 
ATOM   1381 C  CG2   . THR B 2 143 ? 16.947  11.381  11.323 1.00 8.08  ? 143 THR A CG2   1 
ATOM   1382 N  N     . ALA B 2 144 ? 16.716  12.734  7.798  1.00 10.44 ? 144 ALA A N     1 
ATOM   1383 C  CA    . ALA B 2 144 ? 17.123  14.037  7.293  1.00 10.34 ? 144 ALA A CA    1 
ATOM   1384 C  C     . ALA B 2 144 ? 15.927  14.873  6.857  1.00 10.09 ? 144 ALA A C     1 
ATOM   1385 O  O     . ALA B 2 144 ? 15.802  16.011  7.260  1.00 8.85  ? 144 ALA A O     1 
ATOM   1386 C  CB    . ALA B 2 144 ? 18.119  13.887  6.145  1.00 11.25 ? 144 ALA A CB    1 
ATOM   1387 N  N     . ALA B 2 145 ? 15.034  14.286  6.065  1.00 10.77 ? 145 ALA A N     1 
ATOM   1388 C  CA    . ALA B 2 145 ? 13.788  14.962  5.680  1.00 10.71 ? 145 ALA A CA    1 
ATOM   1389 C  C     . ALA B 2 145 ? 12.956  15.404  6.892  1.00 12.01 ? 145 ALA A C     1 
ATOM   1390 O  O     . ALA B 2 145 ? 12.281  16.441  6.848  1.00 13.74 ? 145 ALA A O     1 
ATOM   1391 C  CB    . ALA B 2 145 ? 12.953  14.078  4.766  1.00 8.30  ? 145 ALA A CB    1 
ATOM   1392 N  N     . LEU B 2 146 ? 12.919  14.567  7.924  1.00 10.88 ? 146 LEU A N     1 
ATOM   1393 C  CA    . LEU B 2 146 ? 12.153  14.876  9.115  1.00 10.88 ? 146 LEU A CA    1 
ATOM   1394 C  C     . LEU B 2 146 ? 12.792  16.046  9.854  1.00 12.43 ? 146 LEU A C     1 
ATOM   1395 O  O     . LEU B 2 146 ? 12.101  16.890  10.444 1.00 13.62 ? 146 LEU A O     1 
ATOM   1396 C  CB    . LEU B 2 146 ? 12.069  13.651  10.030 1.00 9.37  ? 146 LEU A CB    1 
ATOM   1397 C  CG    . LEU B 2 146 ? 11.675  13.886  11.494 1.00 9.76  ? 146 LEU A CG    1 
ATOM   1398 C  CD1   . LEU B 2 146 ? 10.200  14.263  11.615 1.00 9.39  ? 146 LEU A CD1   1 
ATOM   1399 C  CD2   . LEU B 2 146 ? 11.970  12.662  12.348 1.00 6.13  ? 146 LEU A CD2   1 
ATOM   1400 N  N     . LEU B 2 147 ? 14.116  16.084  9.846  1.00 13.61 ? 147 LEU A N     1 
ATOM   1401 C  CA    . LEU B 2 147 ? 14.826  17.161  10.506 1.00 14.23 ? 147 LEU A CA    1 
ATOM   1402 C  C     . LEU B 2 147 ? 14.534  18.464  9.782  1.00 14.43 ? 147 LEU A C     1 
ATOM   1403 O  O     . LEU B 2 147 ? 14.255  19.483  10.412 1.00 15.78 ? 147 LEU A O     1 
ATOM   1404 C  CB    . LEU B 2 147 ? 16.330  16.899  10.541 1.00 12.82 ? 147 LEU A CB    1 
ATOM   1405 C  CG    . LEU B 2 147 ? 17.156  18.089  11.050 1.00 13.86 ? 147 LEU A CG    1 
ATOM   1406 C  CD1   . LEU B 2 147 ? 17.102  18.182  12.559 1.00 9.87  ? 147 LEU A CD1   1 
ATOM   1407 C  CD2   . LEU B 2 147 ? 18.606  18.055  10.547 1.00 11.21 ? 147 LEU A CD2   1 
ATOM   1408 N  N     . ILE B 2 148 ? 14.552  18.419  8.457  1.00 14.47 ? 148 ILE A N     1 
ATOM   1409 C  CA    . ILE B 2 148 ? 14.340  19.622  7.670  1.00 15.48 ? 148 ILE A CA    1 
ATOM   1410 C  C     . ILE B 2 148 ? 12.911  20.139  7.826  1.00 17.11 ? 148 ILE A C     1 
ATOM   1411 O  O     . ILE B 2 148 ? 12.696  21.338  7.948  1.00 18.03 ? 148 ILE A O     1 
ATOM   1412 C  CB    . ILE B 2 148 ? 14.685  19.403  6.206  1.00 15.23 ? 148 ILE A CB    1 
ATOM   1413 C  CG1   . ILE B 2 148 ? 16.208  19.334  6.042  1.00 12.61 ? 148 ILE A CG1   1 
ATOM   1414 C  CG2   . ILE B 2 148 ? 14.080  20.517  5.332  1.00 13.32 ? 148 ILE A CG2   1 
ATOM   1415 C  CD1   . ILE B 2 148 ? 16.644  18.621  4.804  1.00 17.36 ? 148 ILE A CD1   1 
ATOM   1416 N  N     . ASP B 2 149 ? 11.979  19.217  8.035  1.00 17.87 ? 149 ASP A N     1 
ATOM   1417 C  CA    . ASP B 2 149 ? 10.595  19.572  8.345  1.00 19.24 ? 149 ASP A CA    1 
ATOM   1418 C  C     . ASP B 2 149 ? 10.454  20.146  9.748  1.00 18.90 ? 149 ASP A C     1 
ATOM   1419 O  O     . ASP B 2 149 ? 9.718   21.104  9.963  1.00 20.98 ? 149 ASP A O     1 
ATOM   1420 C  CB    . ASP B 2 149 ? 9.673   18.357  8.180  1.00 19.88 ? 149 ASP A CB    1 
ATOM   1421 C  CG    . ASP B 2 149 ? 8.203   18.709  8.367  1.00 22.82 ? 149 ASP A CG    1 
ATOM   1422 O  OD1   . ASP B 2 149 ? 7.716   19.646  7.711  1.00 27.02 ? 149 ASP A OD1   1 
ATOM   1423 O  OD2   . ASP B 2 149 ? 7.535   18.057  9.187  1.00 27.67 ? 149 ASP A OD2   1 
ATOM   1424 N  N     . ILE B 2 150 ? 11.138  19.531  10.703 1.00 18.43 ? 150 ILE A N     1 
ATOM   1425 C  CA    . ILE B 2 150 ? 11.130  19.987  12.088 1.00 17.31 ? 150 ILE A CA    1 
ATOM   1426 C  C     . ILE B 2 150 ? 11.702  21.401  12.240 1.00 18.86 ? 150 ILE A C     1 
ATOM   1427 O  O     . ILE B 2 150 ? 11.229  22.196  13.062 1.00 19.32 ? 150 ILE A O     1 
ATOM   1428 C  CB    . ILE B 2 150 ? 11.906  19.000  12.974 1.00 16.79 ? 150 ILE A CB    1 
ATOM   1429 C  CG1   . ILE B 2 150 ? 11.090  17.716  13.172 1.00 16.15 ? 150 ILE A CG1   1 
ATOM   1430 C  CG2   . ILE B 2 150 ? 12.283  19.625  14.298 1.00 13.59 ? 150 ILE A CG2   1 
ATOM   1431 C  CD1   . ILE B 2 150 ? 11.713  16.714  14.149 1.00 10.52 ? 150 ILE A CD1   1 
ATOM   1432 N  N     . MET B 2 151 ? 12.678  21.732  11.401 1.00 19.77 ? 151 MET A N     1 
ATOM   1433 C  CA    . MET B 2 151 ? 13.348  23.020  11.477 1.00 19.21 ? 151 MET A CA    1 
ATOM   1434 C  C     . MET B 2 151 ? 12.517  24.101  10.803 1.00 19.12 ? 151 MET A C     1 
ATOM   1435 O  O     . MET B 2 151 ? 12.375  25.211  11.319 1.00 17.76 ? 151 MET A O     1 
ATOM   1436 C  CB    . MET B 2 151 ? 14.726  22.932  10.827 1.00 19.02 ? 151 MET A CB    1 
ATOM   1437 C  CG    . MET B 2 151 ? 15.834  22.619  11.804 1.00 20.20 ? 151 MET A CG    1 
ATOM   1438 S  SD    . MET B 2 151 ? 17.289  21.922  11.008 1.00 23.53 ? 151 MET A SD    1 
ATOM   1439 C  CE    . MET B 2 151 ? 18.236  23.414  10.671 1.00 21.26 ? 151 MET A CE    1 
ATOM   1440 N  N     . ASN B 2 152 ? 11.979  23.776  9.638  1.00 19.58 ? 152 ASN A N     1 
ATOM   1441 C  CA    . ASN B 2 152 ? 11.084  24.690  8.955  1.00 21.35 ? 152 ASN A CA    1 
ATOM   1442 C  C     . ASN B 2 152 ? 9.854   25.017  9.803  1.00 20.79 ? 152 ASN A C     1 
ATOM   1443 O  O     . ASN B 2 152 ? 9.426   26.171  9.880  1.00 20.65 ? 152 ASN A O     1 
ATOM   1444 C  CB    . ASN B 2 152 ? 10.672  24.113  7.609  1.00 21.27 ? 152 ASN A CB    1 
ATOM   1445 C  CG    . ASN B 2 152 ? 11.820  24.071  6.629  1.00 25.94 ? 152 ASN A CG    1 
ATOM   1446 O  OD1   . ASN B 2 152 ? 12.831  24.762  6.815  1.00 28.92 ? 152 ASN A OD1   1 
ATOM   1447 N  ND2   . ASN B 2 152 ? 11.686  23.246  5.580  1.00 25.61 ? 152 ASN A ND2   1 
ATOM   1448 N  N     . THR B 2 153 ? 9.330   24.003  10.484 1.00 18.67 ? 153 THR A N     1 
ATOM   1449 C  CA    . THR B 2 153 ? 8.117   24.160  11.242 1.00 17.32 ? 153 THR A CA    1 
ATOM   1450 C  C     . THR B 2 153 ? 8.333   24.901  12.562 1.00 18.39 ? 153 THR A C     1 
ATOM   1451 O  O     . THR B 2 153 ? 7.492   25.696  12.976 1.00 18.99 ? 153 THR A O     1 
ATOM   1452 C  CB    . THR B 2 153 ? 7.444   22.824  11.498 1.00 16.52 ? 153 THR A CB    1 
ATOM   1453 O  OG1   . THR B 2 153 ? 7.272   22.132  10.257 1.00 16.17 ? 153 THR A OG1   1 
ATOM   1454 C  CG2   . THR B 2 153 ? 6.086   23.039  12.141 1.00 15.22 ? 153 THR A CG2   1 
ATOM   1455 N  N     . SER B 2 154 ? 9.456   24.642  13.224 1.00 17.54 ? 154 SER A N     1 
ATOM   1456 C  CA    . SER B 2 154 ? 9.705   25.246  14.531 1.00 17.47 ? 154 SER A CA    1 
ATOM   1457 C  C     . SER B 2 154 ? 10.595  26.491  14.441 1.00 15.92 ? 154 SER A C     1 
ATOM   1458 O  O     . SER B 2 154 ? 10.604  27.320  15.349 1.00 15.94 ? 154 SER A O     1 
ATOM   1459 C  CB    . SER B 2 154 ? 10.335  24.224  15.483 1.00 17.99 ? 154 SER A CB    1 
ATOM   1460 O  OG    . SER B 2 154 ? 11.611  23.828  15.010 1.00 17.31 ? 154 SER A OG    1 
ATOM   1461 N  N     . GLY B 2 155 ? 11.400  26.561  13.386 1.00 14.25 ? 155 GLY A N     1 
ATOM   1462 C  CA    . GLY B 2 155 ? 12.465  27.538  13.292 1.00 13.80 ? 155 GLY A CA    1 
ATOM   1463 C  C     . GLY B 2 155 ? 13.546  27.418  14.348 1.00 15.17 ? 155 GLY A C     1 
ATOM   1464 O  O     . GLY B 2 155 ? 14.366  28.318  14.484 1.00 15.92 ? 155 GLY A O     1 
ATOM   1465 N  N     . TRP B 2 156 ? 13.567  26.305  15.086 1.00 16.30 ? 156 TRP A N     1 
ATOM   1466 C  CA    . TRP B 2 156 ? 14.603  26.069  16.101 1.00 16.55 ? 156 TRP A CA    1 
ATOM   1467 C  C     . TRP B 2 156 ? 16.006  26.092  15.507 1.00 17.63 ? 156 TRP A C     1 
ATOM   1468 O  O     . TRP B 2 156 ? 16.246  25.512  14.453 1.00 19.81 ? 156 TRP A O     1 
ATOM   1469 C  CB    . TRP B 2 156 ? 14.374  24.734  16.803 1.00 16.75 ? 156 TRP A CB    1 
ATOM   1470 C  CG    . TRP B 2 156 ? 13.282  24.773  17.810 1.00 17.26 ? 156 TRP A CG    1 
ATOM   1471 C  CD1   . TRP B 2 156 ? 12.932  25.831  18.589 1.00 18.83 ? 156 TRP A CD1   1 
ATOM   1472 C  CD2   . TRP B 2 156 ? 12.387  23.706  18.156 1.00 18.73 ? 156 TRP A CD2   1 
ATOM   1473 N  NE1   . TRP B 2 156 ? 11.862  25.503  19.386 1.00 22.17 ? 156 TRP A NE1   1 
ATOM   1474 C  CE2   . TRP B 2 156 ? 11.510  24.202  19.142 1.00 19.86 ? 156 TRP A CE2   1 
ATOM   1475 C  CE3   . TRP B 2 156 ? 12.240  22.382  17.727 1.00 16.48 ? 156 TRP A CE3   1 
ATOM   1476 C  CZ2   . TRP B 2 156 ? 10.515  23.419  19.722 1.00 17.93 ? 156 TRP A CZ2   1 
ATOM   1477 C  CZ3   . TRP B 2 156 ? 11.234  21.608  18.293 1.00 18.51 ? 156 TRP A CZ3   1 
ATOM   1478 C  CH2   . TRP B 2 156 ? 10.372  22.140  19.268 1.00 15.74 ? 156 TRP A CH2   1 
ATOM   1479 N  N     . THR B 2 157 ? 16.937  26.748  16.186 1.00 17.72 ? 157 THR A N     1 
ATOM   1480 C  CA    . THR B 2 157 ? 18.348  26.599  15.841 1.00 21.07 ? 157 THR A CA    1 
ATOM   1481 C  C     . THR B 2 157 ? 18.901  25.291  16.395 1.00 21.53 ? 157 THR A C     1 
ATOM   1482 O  O     . THR B 2 157 ? 18.396  24.767  17.386 1.00 21.87 ? 157 THR A O     1 
ATOM   1483 C  CB    . THR B 2 157 ? 19.210  27.729  16.431 1.00 21.48 ? 157 THR A CB    1 
ATOM   1484 O  OG1   . THR B 2 157 ? 18.943  27.838  17.834 1.00 23.36 ? 157 THR A OG1   1 
ATOM   1485 C  CG2   . THR B 2 157 ? 18.936  29.054  15.735 1.00 19.34 ? 157 THR A CG2   1 
ATOM   1486 N  N     . ALA B 2 158 ? 20.022  24.851  15.833 1.00 22.08 ? 158 ALA A N     1 
ATOM   1487 C  CA    . ALA B 2 158 ? 20.774  23.728  16.373 1.00 22.26 ? 158 ALA A CA    1 
ATOM   1488 C  C     . ALA B 2 158 ? 20.995  23.825  17.880 1.00 22.83 ? 158 ALA A C     1 
ATOM   1489 O  O     . ALA B 2 158 ? 20.790  22.853  18.601 1.00 22.17 ? 158 ALA A O     1 
ATOM   1490 C  CB    . ALA B 2 158 ? 22.100  23.593  15.654 1.00 23.40 ? 158 ALA A CB    1 
ATOM   1491 N  N     . GLU B 2 159 ? 21.459  24.975  18.361 1.00 23.78 ? 159 GLU A N     1 
ATOM   1492 C  CA    . GLU B 2 159 ? 21.718  25.102  19.794 1.00 25.44 ? 159 GLU A CA    1 
ATOM   1493 C  C     . GLU B 2 159 ? 20.429  24.904  20.584 1.00 25.31 ? 159 GLU A C     1 
ATOM   1494 O  O     . GLU B 2 159 ? 20.417  24.212  21.601 1.00 26.84 ? 159 GLU A O     1 
ATOM   1495 C  CB    . GLU B 2 159 ? 22.390  26.439  20.143 1.00 26.19 ? 159 GLU A CB    1 
ATOM   1496 C  CG    . GLU B 2 159 ? 22.252  27.522  19.063 1.00 33.20 ? 159 GLU A CG    1 
ATOM   1497 C  CD    . GLU B 2 159 ? 23.355  27.471  18.013 1.00 36.48 ? 159 GLU A CD    1 
ATOM   1498 O  OE1   . GLU B 2 159 ? 23.031  27.551  16.802 1.00 35.21 ? 159 GLU A OE1   1 
ATOM   1499 O  OE2   . GLU B 2 159 ? 24.543  27.381  18.403 1.00 39.32 ? 159 GLU A OE2   1 
ATOM   1500 N  N     . GLN B 2 160 ? 19.322  25.413  20.047 1.00 24.87 ? 160 GLN A N     1 
ATOM   1501 C  CA    . GLN B 2 160 ? 18.009  25.189  20.646 1.00 23.32 ? 160 GLN A CA    1 
ATOM   1502 C  C     . GLN B 2 160 ? 17.604  23.708  20.591 1.00 22.42 ? 160 GLN A C     1 
ATOM   1503 O  O     . GLN B 2 160 ? 16.978  23.191  21.518 1.00 22.11 ? 160 GLN A O     1 
ATOM   1504 C  CB    . GLN B 2 160 ? 16.951  26.026  19.936 1.00 23.98 ? 160 GLN A CB    1 
ATOM   1505 C  CG    . GLN B 2 160 ? 16.951  27.511  20.281 1.00 23.14 ? 160 GLN A CG    1 
ATOM   1506 C  CD    . GLN B 2 160 ? 15.682  28.168  19.810 1.00 24.87 ? 160 GLN A CD    1 
ATOM   1507 O  OE1   . GLN B 2 160 ? 15.415  28.205  18.607 1.00 18.92 ? 160 GLN A OE1   1 
ATOM   1508 N  NE2   . GLN B 2 160 ? 14.789  28.477  20.758 1.00 26.70 ? 160 GLN A NE2   1 
ATOM   1509 N  N     . MET B 2 161 ? 17.929  23.042  19.488 1.00 20.16 ? 161 MET A N     1 
ATOM   1510 C  CA    . MET B 2 161 ? 17.627  21.624  19.348 1.00 18.67 ? 161 MET A CA    1 
ATOM   1511 C  C     . MET B 2 161 ? 18.473  20.751  20.291 1.00 19.12 ? 161 MET A C     1 
ATOM   1512 O  O     . MET B 2 161 ? 17.973  19.778  20.850 1.00 16.45 ? 161 MET A O     1 
ATOM   1513 C  CB    . MET B 2 161 ? 17.795  21.174  17.899 1.00 18.53 ? 161 MET A CB    1 
ATOM   1514 C  CG    . MET B 2 161 ? 16.582  21.443  17.005 1.00 18.14 ? 161 MET A CG    1 
ATOM   1515 S  SD    . MET B 2 161 ? 16.851  20.981  15.261 1.00 20.42 ? 161 MET A SD    1 
ATOM   1516 C  CE    . MET B 2 161 ? 17.842  22.354  14.670 1.00 21.86 ? 161 MET A CE    1 
ATOM   1517 N  N     . ALA B 2 162 ? 19.732  21.137  20.513 1.00 20.08 ? 162 ALA A N     1 
ATOM   1518 C  CA    . ALA B 2 162 ? 20.585  20.420  21.467 1.00 21.02 ? 162 ALA A CA    1 
ATOM   1519 C  C     . ALA B 2 162 ? 20.112  20.610  22.905 1.00 21.05 ? 162 ALA A C     1 
ATOM   1520 O  O     . ALA B 2 162 ? 20.172  19.682  23.712 1.00 18.66 ? 162 ALA A O     1 
ATOM   1521 C  CB    . ALA B 2 162 ? 22.051  20.841  21.321 1.00 21.26 ? 162 ALA A CB    1 
ATOM   1522 N  N     . ASP B 2 163 ? 19.627  21.807  23.217 1.00 21.84 ? 163 ASP A N     1 
ATOM   1523 C  CA    . ASP B 2 163 ? 19.011  22.043  24.511 1.00 25.12 ? 163 ASP A CA    1 
ATOM   1524 C  C     . ASP B 2 163 ? 17.842  21.092  24.742 1.00 25.68 ? 163 ASP A C     1 
ATOM   1525 O  O     . ASP B 2 163 ? 17.691  20.526  25.829 1.00 25.65 ? 163 ASP A O     1 
ATOM   1526 C  CB    . ASP B 2 163 ? 18.514  23.476  24.605 1.00 27.26 ? 163 ASP A CB    1 
ATOM   1527 C  CG    . ASP B 2 163 ? 19.540  24.408  25.195 1.00 34.11 ? 163 ASP A CG    1 
ATOM   1528 O  OD1   . ASP B 2 163 ? 20.693  23.965  25.421 1.00 39.74 ? 163 ASP A OD1   1 
ATOM   1529 O  OD2   . ASP B 2 163 ? 19.199  25.596  25.399 1.00 40.51 ? 163 ASP A OD2   1 
ATOM   1530 N  N     . ILE B 2 164 ? 16.962  21.003  23.750 1.00 25.36 ? 164 ILE A N     1 
ATOM   1531 C  CA    . ILE B 2 164 ? 15.759  20.204  23.866 1.00 26.28 ? 164 ILE A CA    1 
ATOM   1532 C  C     . ILE B 2 164 ? 16.106  18.718  24.002 1.00 28.15 ? 164 ILE A C     1 
ATOM   1533 O  O     . ILE B 2 164 ? 15.501  17.995  24.796 1.00 27.90 ? 164 ILE A O     1 
ATOM   1534 C  CB    . ILE B 2 164 ? 14.840  20.436  22.663 1.00 25.70 ? 164 ILE A CB    1 
ATOM   1535 C  CG1   . ILE B 2 164 ? 14.431  21.917  22.616 1.00 26.51 ? 164 ILE A CG1   1 
ATOM   1536 C  CG2   . ILE B 2 164 ? 13.636  19.502  22.716 1.00 23.65 ? 164 ILE A CG2   1 
ATOM   1537 C  CD1   . ILE B 2 164 ? 13.376  22.257  21.586 1.00 22.34 ? 164 ILE A CD1   1 
ATOM   1538 N  N     . THR B 2 165 ? 17.136  18.298  23.270 1.00 29.63 ? 165 THR A N     1 
ATOM   1539 C  CA    . THR B 2 165 ? 17.633  16.934  23.316 1.00 30.87 ? 165 THR A CA    1 
ATOM   1540 C  C     . THR B 2 165 ? 18.115  16.554  24.712 1.00 33.25 ? 165 THR A C     1 
ATOM   1541 O  O     . THR B 2 165 ? 17.846  15.453  25.194 1.00 33.80 ? 165 THR A O     1 
ATOM   1542 C  CB    . THR B 2 165 ? 18.779  16.745  22.317 1.00 29.73 ? 165 THR A CB    1 
ATOM   1543 O  OG1   . THR B 2 165 ? 18.275  16.908  20.986 1.00 28.37 ? 165 THR A OG1   1 
ATOM   1544 C  CG2   . THR B 2 165 ? 19.409  15.364  22.469 1.00 27.96 ? 165 THR A CG2   1 
ATOM   1545 N  N     . GLY B 2 166 ? 18.854  17.460  25.348 1.00 35.68 ? 166 GLY A N     1 
ATOM   1546 C  CA    . GLY B 2 166 ? 19.346  17.212  26.694 1.00 39.05 ? 166 GLY A CA    1 
ATOM   1547 C  C     . GLY B 2 166 ? 20.855  17.212  26.758 1.00 41.80 ? 166 GLY A C     1 
ATOM   1548 O  O     . GLY B 2 166 ? 21.496  16.165  26.687 1.00 42.44 ? 166 GLY A O     1 
ATOM   1549 N  N     . ARG B 2 167 ? 21.414  18.413  26.858 1.00 45.23 ? 167 ARG A N     1 
ATOM   1550 C  CA    . ARG B 2 167 ? 22.853  18.632  26.890 1.00 47.33 ? 167 ARG A CA    1 
ATOM   1551 C  C     . ARG B 2 167 ? 23.450  18.172  28.225 1.00 48.79 ? 167 ARG A C     1 
ATOM   1552 O  O     . ARG B 2 167 ? 23.864  17.010  28.373 1.00 49.96 ? 167 ARG A O     1 
ATOM   1553 C  CB    . ARG B 2 167 ? 23.136  20.121  26.683 1.00 47.60 ? 167 ARG A CB    1 
ATOM   1554 C  CG    . ARG B 2 167 ? 24.355  20.419  25.824 1.00 52.43 ? 167 ARG A CG    1 
ATOM   1555 C  CD    . ARG B 2 167 ? 23.961  20.964  24.457 1.00 53.91 ? 167 ARG A CD    1 
ATOM   1556 N  NE    . ARG B 2 167 ? 23.406  22.316  24.541 1.00 58.27 ? 167 ARG A NE    1 
ATOM   1557 C  CZ    . ARG B 2 167 ? 23.812  23.345  23.795 1.00 60.53 ? 167 ARG A CZ    1 
ATOM   1558 N  NH1   . ARG B 2 167 ? 24.800  23.192  22.912 1.00 59.50 ? 167 ARG A NH1   1 
ATOM   1559 N  NH2   . ARG B 2 167 ? 23.224  24.528  23.925 1.00 60.48 ? 167 ARG A NH2   1 
ATOM   1560 P  P     . DC  C 3 1   ? 8.828   -10.331 26.627 1.00 81.47 ? 1   DC  D P     1 
ATOM   1561 O  OP1   . DC  C 3 1   ? 9.100   -11.158 27.847 1.00 81.97 ? 1   DC  D OP1   1 
ATOM   1562 O  OP2   . DC  C 3 1   ? 7.430   -10.188 26.116 1.00 81.96 ? 1   DC  D OP2   1 
ATOM   1563 O  "O5'" . DC  C 3 1   ? 9.757   -10.836 25.411 1.00 74.52 ? 1   DC  D "O5'" 1 
ATOM   1564 C  "C5'" . DC  C 3 1   ? 10.845  -10.031 24.977 1.00 64.79 ? 1   DC  D "C5'" 1 
ATOM   1565 C  "C4'" . DC  C 3 1   ? 11.934  -10.855 24.307 1.00 56.23 ? 1   DC  D "C4'" 1 
ATOM   1566 O  "O4'" . DC  C 3 1   ? 11.550  -11.091 22.927 1.00 52.19 ? 1   DC  D "O4'" 1 
ATOM   1567 C  "C3'" . DC  C 3 1   ? 13.285  -10.143 24.250 1.00 54.42 ? 1   DC  D "C3'" 1 
ATOM   1568 O  "O3'" . DC  C 3 1   ? 14.142  -10.613 25.295 1.00 54.96 ? 1   DC  D "O3'" 1 
ATOM   1569 C  "C2'" . DC  C 3 1   ? 13.829  -10.500 22.869 1.00 50.04 ? 1   DC  D "C2'" 1 
ATOM   1570 C  "C1'" . DC  C 3 1   ? 12.551  -10.611 22.051 1.00 46.97 ? 1   DC  D "C1'" 1 
ATOM   1571 N  N1    . DC  C 3 1   ? 12.110  -9.320  21.424 1.00 45.18 ? 1   DC  D N1    1 
ATOM   1572 C  C2    . DC  C 3 1   ? 12.968  -8.654  20.532 1.00 43.29 ? 1   DC  D C2    1 
ATOM   1573 O  O2    . DC  C 3 1   ? 14.091  -9.121  20.292 1.00 42.52 ? 1   DC  D O2    1 
ATOM   1574 N  N3    . DC  C 3 1   ? 12.541  -7.515  19.939 1.00 42.76 ? 1   DC  D N3    1 
ATOM   1575 C  C4    . DC  C 3 1   ? 11.325  -7.027  20.208 1.00 44.34 ? 1   DC  D C4    1 
ATOM   1576 N  N4    . DC  C 3 1   ? 10.966  -5.888  19.604 1.00 39.29 ? 1   DC  D N4    1 
ATOM   1577 C  C5    . DC  C 3 1   ? 10.436  -7.677  21.121 1.00 43.29 ? 1   DC  D C5    1 
ATOM   1578 C  C6    . DC  C 3 1   ? 10.864  -8.815  21.688 1.00 45.37 ? 1   DC  D C6    1 
ATOM   1579 P  P     . DT  C 3 2   ? 14.218  -9.844  26.706 1.00 53.06 ? 2   DT  D P     1 
ATOM   1580 O  OP1   . DT  C 3 2   ? 15.052  -10.664 27.616 1.00 51.94 ? 2   DT  D OP1   1 
ATOM   1581 O  OP2   . DT  C 3 2   ? 12.843  -9.450  27.094 1.00 48.29 ? 2   DT  D OP2   1 
ATOM   1582 O  "O5'" . DT  C 3 2   ? 15.049  -8.522  26.373 1.00 50.51 ? 2   DT  D "O5'" 1 
ATOM   1583 C  "C5'" . DT  C 3 2   ? 16.365  -8.620  25.872 1.00 51.49 ? 2   DT  D "C5'" 1 
ATOM   1584 C  "C4'" . DT  C 3 2   ? 17.134  -7.366  26.236 1.00 51.46 ? 2   DT  D "C4'" 1 
ATOM   1585 O  "O4'" . DT  C 3 2   ? 16.683  -6.257  25.411 1.00 51.35 ? 2   DT  D "O4'" 1 
ATOM   1586 C  "C3'" . DT  C 3 2   ? 16.940  -6.912  27.674 1.00 50.09 ? 2   DT  D "C3'" 1 
ATOM   1587 O  "O3'" . DT  C 3 2   ? 18.140  -6.324  28.142 1.00 49.58 ? 2   DT  D "O3'" 1 
ATOM   1588 C  "C2'" . DT  C 3 2   ? 15.793  -5.902  27.565 1.00 47.60 ? 2   DT  D "C2'" 1 
ATOM   1589 C  "C1'" . DT  C 3 2   ? 16.065  -5.257  26.207 1.00 44.42 ? 2   DT  D "C1'" 1 
ATOM   1590 N  N1    . DT  C 3 2   ? 14.851  -4.806  25.473 1.00 36.71 ? 2   DT  D N1    1 
ATOM   1591 C  C2    . DT  C 3 2   ? 14.908  -3.659  24.700 1.00 36.74 ? 2   DT  D C2    1 
ATOM   1592 O  O2    . DT  C 3 2   ? 15.887  -2.917  24.643 1.00 38.34 ? 2   DT  D O2    1 
ATOM   1593 N  N3    . DT  C 3 2   ? 13.747  -3.381  24.020 1.00 31.79 ? 2   DT  D N3    1 
ATOM   1594 C  C4    . DT  C 3 2   ? 12.578  -4.128  24.012 1.00 33.10 ? 2   DT  D C4    1 
ATOM   1595 O  O4    . DT  C 3 2   ? 11.589  -3.801  23.359 1.00 31.24 ? 2   DT  D O4    1 
ATOM   1596 C  C5    . DT  C 3 2   ? 12.599  -5.324  24.824 1.00 34.73 ? 2   DT  D C5    1 
ATOM   1597 C  C7    . DT  C 3 2   ? 11.382  -6.205  24.912 1.00 32.03 ? 2   DT  D C7    1 
ATOM   1598 C  C6    . DT  C 3 2   ? 13.727  -5.606  25.492 1.00 34.61 ? 2   DT  D C6    1 
ATOM   1599 P  P     . DC  C 3 3   ? 18.219  -5.785  29.642 1.00 56.43 ? 3   DC  D P     1 
ATOM   1600 O  OP1   . DC  C 3 3   ? 19.300  -6.528  30.330 1.00 56.01 ? 3   DC  D OP1   1 
ATOM   1601 O  OP2   . DC  C 3 3   ? 16.844  -5.789  30.205 1.00 56.25 ? 3   DC  D OP2   1 
ATOM   1602 O  "O5'" . DC  C 3 3   ? 18.676  -4.252  29.462 1.00 57.36 ? 3   DC  D "O5'" 1 
ATOM   1603 C  "C5'" . DC  C 3 3   ? 18.231  -3.496  28.335 1.00 54.93 ? 3   DC  D "C5'" 1 
ATOM   1604 C  "C4'" . DC  C 3 3   ? 17.942  -2.060  28.728 1.00 54.88 ? 3   DC  D "C4'" 1 
ATOM   1605 O  "O4'" . DC  C 3 3   ? 16.805  -1.538  27.980 1.00 52.09 ? 3   DC  D "O4'" 1 
ATOM   1606 C  "C3'" . DC  C 3 3   ? 17.605  -1.851  30.199 1.00 55.67 ? 3   DC  D "C3'" 1 
ATOM   1607 O  "O3'" . DC  C 3 3   ? 18.063  -0.554  30.588 1.00 60.97 ? 3   DC  D "O3'" 1 
ATOM   1608 C  "C2'" . DC  C 3 3   ? 16.081  -1.946  30.186 1.00 50.46 ? 3   DC  D "C2'" 1 
ATOM   1609 C  "C1'" . DC  C 3 3   ? 15.740  -1.241  28.869 1.00 46.59 ? 3   DC  D "C1'" 1 
ATOM   1610 N  N1    . DC  C 3 3   ? 14.450  -1.687  28.246 1.00 35.52 ? 3   DC  D N1    1 
ATOM   1611 C  C2    . DC  C 3 3   ? 14.011  -1.087  27.072 1.00 29.25 ? 3   DC  D C2    1 
ATOM   1612 O  O2    . DC  C 3 3   ? 14.691  -0.185  26.577 1.00 31.23 ? 3   DC  D O2    1 
ATOM   1613 N  N3    . DC  C 3 3   ? 12.853  -1.517  26.508 1.00 28.90 ? 3   DC  D N3    1 
ATOM   1614 C  C4    . DC  C 3 3   ? 12.142  -2.507  27.072 1.00 29.74 ? 3   DC  D C4    1 
ATOM   1615 N  N4    . DC  C 3 3   ? 11.013  -2.906  26.464 1.00 22.85 ? 3   DC  D N4    1 
ATOM   1616 C  C5    . DC  C 3 3   ? 12.574  -3.140  28.277 1.00 29.94 ? 3   DC  D C5    1 
ATOM   1617 C  C6    . DC  C 3 3   ? 13.717  -2.692  28.823 1.00 37.02 ? 3   DC  D C6    1 
ATOM   1618 P  P     . DG  C 3 4   ? 18.154  -0.131  32.131 1.00 63.19 ? 4   DG  D P     1 
ATOM   1619 O  OP1   . DG  C 3 4   ? 19.553  -0.331  32.568 1.00 62.76 ? 4   DG  D OP1   1 
ATOM   1620 O  OP2   . DG  C 3 4   ? 17.046  -0.802  32.852 1.00 64.28 ? 4   DG  D OP2   1 
ATOM   1621 O  "O5'" . DG  C 3 4   ? 17.840  1.448   32.083 1.00 62.29 ? 4   DG  D "O5'" 1 
ATOM   1622 C  "C5'" . DG  C 3 4   ? 18.824  2.373   31.609 1.00 57.87 ? 4   DG  D "C5'" 1 
ATOM   1623 C  "C4'" . DG  C 3 4   ? 18.177  3.557   30.906 1.00 53.54 ? 4   DG  D "C4'" 1 
ATOM   1624 O  "O4'" . DG  C 3 4   ? 17.463  3.067   29.742 1.00 48.55 ? 4   DG  D "O4'" 1 
ATOM   1625 C  "C3'" . DG  C 3 4   ? 17.136  4.316   31.726 1.00 52.63 ? 4   DG  D "C3'" 1 
ATOM   1626 O  "O3'" . DG  C 3 4   ? 17.717  5.377   32.509 1.00 53.84 ? 4   DG  D "O3'" 1 
ATOM   1627 C  "C2'" . DG  C 3 4   ? 16.209  4.850   30.644 1.00 50.56 ? 4   DG  D "C2'" 1 
ATOM   1628 C  "C1'" . DG  C 3 4   ? 16.199  3.700   29.646 1.00 46.14 ? 4   DG  D "C1'" 1 
ATOM   1629 N  N9    . DG  C 3 4   ? 15.138  2.720   29.878 1.00 39.41 ? 4   DG  D N9    1 
ATOM   1630 C  C8    . DG  C 3 4   ? 15.109  1.743   30.850 1.00 35.22 ? 4   DG  D C8    1 
ATOM   1631 N  N7    . DG  C 3 4   ? 14.038  0.991   30.796 1.00 33.90 ? 4   DG  D N7    1 
ATOM   1632 C  C5    . DG  C 3 4   ? 13.295  1.521   29.740 1.00 32.46 ? 4   DG  D C5    1 
ATOM   1633 C  C6    . DG  C 3 4   ? 12.035  1.125   29.210 1.00 33.32 ? 4   DG  D C6    1 
ATOM   1634 O  O6    . DG  C 3 4   ? 11.304  0.187   29.558 1.00 33.78 ? 4   DG  D O6    1 
ATOM   1635 N  N1    . DG  C 3 4   ? 11.636  1.926   28.143 1.00 32.04 ? 4   DG  D N1    1 
ATOM   1636 C  C2    . DG  C 3 4   ? 12.369  2.967   27.626 1.00 31.74 ? 4   DG  D C2    1 
ATOM   1637 N  N2    . DG  C 3 4   ? 11.808  3.598   26.583 1.00 25.69 ? 4   DG  D N2    1 
ATOM   1638 N  N3    . DG  C 3 4   ? 13.564  3.350   28.098 1.00 33.59 ? 4   DG  D N3    1 
ATOM   1639 C  C4    . DG  C 3 4   ? 13.963  2.581   29.154 1.00 35.52 ? 4   DG  D C4    1 
ATOM   1640 P  P     . DA  C 3 5   ? 18.338  6.697   31.835 1.00 56.48 ? 5   DA  D P     1 
ATOM   1641 O  OP1   . DA  C 3 5   ? 19.522  6.296   31.040 1.00 57.32 ? 5   DA  D OP1   1 
ATOM   1642 O  OP2   . DA  C 3 5   ? 18.463  7.737   32.874 1.00 58.10 ? 5   DA  D OP2   1 
ATOM   1643 O  "O5'" . DA  C 3 5   ? 17.206  7.202   30.834 1.00 54.31 ? 5   DA  D "O5'" 1 
ATOM   1644 C  "C5'" . DA  C 3 5   ? 17.588  7.925   29.676 1.00 48.71 ? 5   DA  D "C5'" 1 
ATOM   1645 C  "C4'" . DA  C 3 5   ? 16.369  8.541   29.024 1.00 43.26 ? 5   DA  D "C4'" 1 
ATOM   1646 O  "O4'" . DA  C 3 5   ? 15.277  7.581   28.985 1.00 40.64 ? 5   DA  D "O4'" 1 
ATOM   1647 C  "C3'" . DA  C 3 5   ? 15.823  9.744   29.760 1.00 41.83 ? 5   DA  D "C3'" 1 
ATOM   1648 O  "O3'" . DA  C 3 5   ? 15.262  10.653  28.816 1.00 41.33 ? 5   DA  D "O3'" 1 
ATOM   1649 C  "C2'" . DA  C 3 5   ? 14.759  9.115   30.662 1.00 40.72 ? 5   DA  D "C2'" 1 
ATOM   1650 C  "C1'" . DA  C 3 5   ? 14.176  8.051   29.739 1.00 38.97 ? 5   DA  D "C1'" 1 
ATOM   1651 N  N9    . DA  C 3 5   ? 13.589  6.909   30.439 1.00 35.73 ? 5   DA  D N9    1 
ATOM   1652 C  C8    . DA  C 3 5   ? 14.026  6.352   31.611 1.00 35.81 ? 5   DA  D C8    1 
ATOM   1653 N  N7    . DA  C 3 5   ? 13.349  5.287   31.987 1.00 33.50 ? 5   DA  D N7    1 
ATOM   1654 C  C5    . DA  C 3 5   ? 12.385  5.148   31.003 1.00 31.46 ? 5   DA  D C5    1 
ATOM   1655 C  C6    . DA  C 3 5   ? 11.344  4.217   30.827 1.00 30.36 ? 5   DA  D C6    1 
ATOM   1656 N  N6    . DA  C 3 5   ? 11.090  3.231   31.692 1.00 29.59 ? 5   DA  D N6    1 
ATOM   1657 N  N1    . DA  C 3 5   ? 10.539  4.370   29.754 1.00 30.84 ? 5   DA  D N1    1 
ATOM   1658 C  C2    . DA  C 3 5   ? 10.789  5.369   28.892 1.00 29.86 ? 5   DA  D C2    1 
ATOM   1659 N  N3    . DA  C 3 5   ? 11.750  6.297   28.945 1.00 33.59 ? 5   DA  D N3    1 
ATOM   1660 C  C4    . DA  C 3 5   ? 12.512  6.140   30.043 1.00 32.98 ? 5   DA  D C4    1 
ATOM   1661 P  P     . DA  C 3 6   ? 14.531  11.973  29.345 1.00 43.61 ? 6   DA  D P     1 
ATOM   1662 O  OP1   . DA  C 3 6   ? 15.026  13.124  28.553 1.00 42.72 ? 6   DA  D OP1   1 
ATOM   1663 O  OP2   . DA  C 3 6   ? 14.619  11.976  30.828 1.00 44.92 ? 6   DA  D OP2   1 
ATOM   1664 O  "O5'" . DA  C 3 6   ? 13.004  11.728  28.972 1.00 39.57 ? 6   DA  D "O5'" 1 
ATOM   1665 C  "C5'" . DA  C 3 6   ? 12.665  11.177  27.711 1.00 35.17 ? 6   DA  D "C5'" 1 
ATOM   1666 C  "C4'" . DA  C 3 6   ? 11.155  11.093  27.599 1.00 34.38 ? 6   DA  D "C4'" 1 
ATOM   1667 O  "O4'" . DA  C 3 6   ? 10.683  9.879   28.242 1.00 30.74 ? 6   DA  D "O4'" 1 
ATOM   1668 C  "C3'" . DA  C 3 6   ? 10.386  12.242  28.256 1.00 36.45 ? 6   DA  D "C3'" 1 
ATOM   1669 O  "O3'" . DA  C 3 6   ? 9.261   12.571  27.433 1.00 43.21 ? 6   DA  D "O3'" 1 
ATOM   1670 C  "C2'" . DA  C 3 6   ? 9.963   11.663  29.605 1.00 31.80 ? 6   DA  D "C2'" 1 
ATOM   1671 C  "C1'" . DA  C 3 6   ? 9.754   10.190  29.255 1.00 27.50 ? 6   DA  D "C1'" 1 
ATOM   1672 N  N9    . DA  C 3 6   ? 9.988   9.252   30.356 1.00 24.09 ? 6   DA  D N9    1 
ATOM   1673 C  C8    . DA  C 3 6   ? 11.032  9.245   31.243 1.00 24.55 ? 6   DA  D C8    1 
ATOM   1674 N  N7    . DA  C 3 6   ? 10.988  8.251   32.111 1.00 21.79 ? 6   DA  D N7    1 
ATOM   1675 C  C5    . DA  C 3 6   ? 9.839   7.556   31.760 1.00 20.01 ? 6   DA  D C5    1 
ATOM   1676 C  C6    . DA  C 3 6   ? 9.217   6.401   32.296 1.00 21.27 ? 6   DA  D C6    1 
ATOM   1677 N  N6    . DA  C 3 6   ? 9.710   5.713   33.339 1.00 17.32 ? 6   DA  D N6    1 
ATOM   1678 N  N1    . DA  C 3 6   ? 8.071   5.966   31.708 1.00 20.73 ? 6   DA  D N1    1 
ATOM   1679 C  C2    . DA  C 3 6   ? 7.584   6.640   30.653 1.00 20.35 ? 6   DA  D C2    1 
ATOM   1680 N  N3    . DA  C 3 6   ? 8.071   7.745   30.079 1.00 21.90 ? 6   DA  D N3    1 
ATOM   1681 C  C4    . DA  C 3 6   ? 9.197   8.169   30.699 1.00 20.13 ? 6   DA  D C4    1 
ATOM   1682 P  P     . DT  C 3 7   ? 8.140   13.625  27.907 1.00 46.36 ? 7   DT  D P     1 
ATOM   1683 O  OP1   . DT  C 3 7   ? 7.686   14.393  26.713 1.00 40.18 ? 7   DT  D OP1   1 
ATOM   1684 O  OP2   . DT  C 3 7   ? 8.660   14.313  29.118 1.00 39.91 ? 7   DT  D OP2   1 
ATOM   1685 O  "O5'" . DT  C 3 7   ? 6.919   12.698  28.344 1.00 42.27 ? 7   DT  D "O5'" 1 
ATOM   1686 C  "C5'" . DT  C 3 7   ? 6.975   11.309  28.067 1.00 48.30 ? 7   DT  D "C5'" 1 
ATOM   1687 C  "C4'" . DT  C 3 7   ? 5.633   10.661  28.348 1.00 46.04 ? 7   DT  D "C4'" 1 
ATOM   1688 O  "O4'" . DT  C 3 7   ? 5.772   9.684   29.411 1.00 42.53 ? 7   DT  D "O4'" 1 
ATOM   1689 C  "C3'" . DT  C 3 7   ? 4.553   11.625  28.808 1.00 43.47 ? 7   DT  D "C3'" 1 
ATOM   1690 O  "O3'" . DT  C 3 7   ? 3.308   11.184  28.283 1.00 49.75 ? 7   DT  D "O3'" 1 
ATOM   1691 C  "C2'" . DT  C 3 7   ? 4.635   11.524  30.332 1.00 39.59 ? 7   DT  D "C2'" 1 
ATOM   1692 C  "C1'" . DT  C 3 7   ? 4.959   10.047  30.513 1.00 34.89 ? 7   DT  D "C1'" 1 
ATOM   1693 N  N1    . DT  C 3 7   ? 5.724   9.694   31.743 1.00 27.36 ? 7   DT  D N1    1 
ATOM   1694 C  C2    . DT  C 3 7   ? 5.469   8.479   32.359 1.00 24.76 ? 7   DT  D C2    1 
ATOM   1695 O  O2    . DT  C 3 7   ? 4.588   7.715   31.996 1.00 31.31 ? 7   DT  D O2    1 
ATOM   1696 N  N3    . DT  C 3 7   ? 6.254   8.198   33.446 1.00 19.24 ? 7   DT  D N3    1 
ATOM   1697 C  C4    . DT  C 3 7   ? 7.293   8.963   33.935 1.00 24.57 ? 7   DT  D C4    1 
ATOM   1698 O  O4    . DT  C 3 7   ? 7.967   8.622   34.914 1.00 22.78 ? 7   DT  D O4    1 
ATOM   1699 C  C5    . DT  C 3 7   ? 7.505   10.226  33.254 1.00 25.03 ? 7   DT  D C5    1 
ATOM   1700 C  C7    . DT  C 3 7   ? 8.600   11.130  33.741 1.00 23.62 ? 7   DT  D C7    1 
ATOM   1701 C  C6    . DT  C 3 7   ? 6.733   10.527  32.190 1.00 24.50 ? 7   DT  D C6    1 
ATOM   1702 P  P     . DC  C 3 8   ? 1.926   11.708  28.909 1.00 52.72 ? 8   DC  D P     1 
ATOM   1703 O  OP1   . DC  C 3 8   ? 0.794   11.030  28.232 1.00 46.42 ? 8   DC  D OP1   1 
ATOM   1704 O  OP2   . DC  C 3 8   ? 1.966   13.184  28.986 1.00 50.20 ? 8   DC  D OP2   1 
ATOM   1705 O  "O5'" . DC  C 3 8   ? 2.047   11.169  30.395 1.00 48.08 ? 8   DC  D "O5'" 1 
ATOM   1706 C  "C5'" . DC  C 3 8   ? 0.945   11.261  31.235 1.00 45.63 ? 8   DC  D "C5'" 1 
ATOM   1707 C  "C4'" . DC  C 3 8   ? 0.409   9.880   31.540 1.00 40.53 ? 8   DC  D "C4'" 1 
ATOM   1708 O  "O4'" . DC  C 3 8   ? 1.432   9.077   32.200 1.00 39.83 ? 8   DC  D "O4'" 1 
ATOM   1709 C  "C3'" . DC  C 3 8   ? -0.737  9.936   32.520 1.00 38.47 ? 8   DC  D "C3'" 1 
ATOM   1710 O  "O3'" . DC  C 3 8   ? -1.588  8.834   32.321 1.00 39.32 ? 8   DC  D "O3'" 1 
ATOM   1711 C  "C2'" . DC  C 3 8   ? -0.017  9.878   33.860 1.00 36.18 ? 8   DC  D "C2'" 1 
ATOM   1712 C  "C1'" . DC  C 3 8   ? 1.100   8.894   33.563 1.00 31.08 ? 8   DC  D "C1'" 1 
ATOM   1713 N  N1    . DC  C 3 8   ? 2.310   9.111   34.392 1.00 25.92 ? 8   DC  D N1    1 
ATOM   1714 C  C2    . DC  C 3 8   ? 2.630   8.190   35.404 1.00 28.26 ? 8   DC  D C2    1 
ATOM   1715 O  O2    . DC  C 3 8   ? 1.912   7.190   35.575 1.00 30.93 ? 8   DC  D O2    1 
ATOM   1716 N  N3    . DC  C 3 8   ? 3.742   8.403   36.157 1.00 26.01 ? 8   DC  D N3    1 
ATOM   1717 C  C4    . DC  C 3 8   ? 4.501   9.493   35.932 1.00 25.43 ? 8   DC  D C4    1 
ATOM   1718 N  N4    . DC  C 3 8   ? 5.600   9.662   36.672 1.00 19.14 ? 8   DC  D N4    1 
ATOM   1719 C  C5    . DC  C 3 8   ? 4.164   10.462  34.943 1.00 21.45 ? 8   DC  D C5    1 
ATOM   1720 C  C6    . DC  C 3 8   ? 3.079   10.221  34.194 1.00 24.17 ? 8   DC  D C6    1 
ATOM   1721 P  P     . DT  C 3 9   ? -3.157  9.042   32.534 1.00 39.97 ? 9   DT  D P     1 
ATOM   1722 O  OP1   . DT  C 3 9   ? -3.877  8.143   31.595 1.00 38.26 ? 9   DT  D OP1   1 
ATOM   1723 O  OP2   . DT  C 3 9   ? -3.439  10.509  32.583 1.00 35.74 ? 9   DT  D OP2   1 
ATOM   1724 O  "O5'" . DT  C 3 9   ? -3.363  8.484   33.995 1.00 38.62 ? 9   DT  D "O5'" 1 
ATOM   1725 C  "C5'" . DT  C 3 9   ? -2.606  9.027   35.029 1.00 39.58 ? 9   DT  D "C5'" 1 
ATOM   1726 C  "C4'" . DT  C 3 9   ? -2.681  8.086   36.199 1.00 39.32 ? 9   DT  D "C4'" 1 
ATOM   1727 O  "O4'" . DT  C 3 9   ? -1.364  7.964   36.782 1.00 38.76 ? 9   DT  D "O4'" 1 
ATOM   1728 C  "C3'" . DT  C 3 9   ? -3.604  8.587   37.294 1.00 38.90 ? 9   DT  D "C3'" 1 
ATOM   1729 O  "O3'" . DT  C 3 9   ? -4.226  7.477   37.936 1.00 37.17 ? 9   DT  D "O3'" 1 
ATOM   1730 C  "C2'" . DT  C 3 9   ? -2.645  9.355   38.207 1.00 38.24 ? 9   DT  D "C2'" 1 
ATOM   1731 C  "C1'" . DT  C 3 9   ? -1.339  8.575   38.054 1.00 37.10 ? 9   DT  D "C1'" 1 
ATOM   1732 N  N1    . DT  C 3 9   ? -0.104  9.398   38.137 1.00 34.84 ? 9   DT  D N1    1 
ATOM   1733 C  C2    . DT  C 3 9   ? 0.843   9.068   39.078 1.00 34.44 ? 9   DT  D C2    1 
ATOM   1734 O  O2    . DT  C 3 9   ? 0.719   8.140   39.849 1.00 40.42 ? 9   DT  D O2    1 
ATOM   1735 N  N3    . DT  C 3 9   ? 1.964   9.856   39.075 1.00 37.35 ? 9   DT  D N3    1 
ATOM   1736 C  C4    . DT  C 3 9   ? 2.217   10.944  38.250 1.00 38.07 ? 9   DT  D C4    1 
ATOM   1737 O  O4    . DT  C 3 9   ? 3.258   11.596  38.329 1.00 38.55 ? 9   DT  D O4    1 
ATOM   1738 C  C5    . DT  C 3 9   ? 1.173   11.256  37.296 1.00 35.86 ? 9   DT  D C5    1 
ATOM   1739 C  C7    . DT  C 3 9   ? 1.353   12.400  36.340 1.00 32.77 ? 9   DT  D C7    1 
ATOM   1740 C  C6    . DT  C 3 9   ? 0.078   10.470  37.275 1.00 35.37 ? 9   DT  D C6    1 
ATOM   1741 P  P     . DA  C 3 10  ? -5.822  7.429   38.111 1.00 36.33 ? 10  DA  D P     1 
ATOM   1742 O  OP1   . DA  C 3 10  ? -6.304  6.140   37.575 1.00 35.92 ? 10  DA  D OP1   1 
ATOM   1743 O  OP2   . DA  C 3 10  ? -6.391  8.687   37.565 1.00 37.80 ? 10  DA  D OP2   1 
ATOM   1744 O  "O5'" . DA  C 3 10  ? -6.000  7.424   39.709 1.00 27.71 ? 10  DA  D "O5'" 1 
ATOM   1745 C  "C5'" . DA  C 3 10  ? -5.730  8.600   40.466 1.00 22.53 ? 10  DA  D "C5'" 1 
ATOM   1746 C  "C4'" . DA  C 3 10  ? -5.086  8.272   41.802 1.00 19.13 ? 10  DA  D "C4'" 1 
ATOM   1747 O  "O4'" . DA  C 3 10  ? -3.662  8.077   41.619 1.00 19.08 ? 10  DA  D "O4'" 1 
ATOM   1748 C  "C3'" . DA  C 3 10  ? -5.212  9.366   42.850 1.00 18.59 ? 10  DA  D "C3'" 1 
ATOM   1749 O  "O3'" . DA  C 3 10  ? -6.371  9.147   43.648 1.00 17.38 ? 10  DA  D "O3'" 1 
ATOM   1750 C  "C2'" . DA  C 3 10  ? -3.933  9.233   43.673 1.00 19.06 ? 10  DA  D "C2'" 1 
ATOM   1751 C  "C1'" . DA  C 3 10  ? -2.936  8.750   42.635 1.00 19.21 ? 10  DA  D "C1'" 1 
ATOM   1752 N  N9    . DA  C 3 10  ? -2.196  9.836   42.006 1.00 20.40 ? 10  DA  D N9    1 
ATOM   1753 C  C8    . DA  C 3 10  ? -2.679  10.683  41.050 1.00 18.72 ? 10  DA  D C8    1 
ATOM   1754 N  N7    . DA  C 3 10  ? -1.792  11.539  40.620 1.00 19.18 ? 10  DA  D N7    1 
ATOM   1755 C  C5    . DA  C 3 10  ? -0.646  11.219  41.335 1.00 17.38 ? 10  DA  D C5    1 
ATOM   1756 C  C6    . DA  C 3 10  ? 0.651   11.761  41.318 1.00 16.37 ? 10  DA  D C6    1 
ATOM   1757 N  N6    . DA  C 3 10  ? 0.985   12.770  40.516 1.00 13.92 ? 10  DA  D N6    1 
ATOM   1758 N  N1    . DA  C 3 10  ? 1.573   11.243  42.166 1.00 15.32 ? 10  DA  D N1    1 
ATOM   1759 C  C2    . DA  C 3 10  ? 1.220   10.212  42.953 1.00 15.40 ? 10  DA  D C2    1 
ATOM   1760 N  N3    . DA  C 3 10  ? 0.021   9.626   43.055 1.00 17.09 ? 10  DA  D N3    1 
ATOM   1761 C  C4    . DA  C 3 10  ? -0.873  10.180  42.204 1.00 16.36 ? 10  DA  D C4    1 
ATOM   1762 P  P     . DC  C 3 11  ? -7.051  10.395  44.356 1.00 18.18 ? 11  DC  D P     1 
ATOM   1763 O  OP1   . DC  C 3 11  ? -8.229  9.894   45.062 1.00 16.40 ? 11  DC  D OP1   1 
ATOM   1764 O  OP2   . DC  C 3 11  ? -7.170  11.468  43.343 1.00 18.91 ? 11  DC  D OP2   1 
ATOM   1765 O  "O5'" . DC  C 3 11  ? -5.972  10.872  45.440 1.00 17.11 ? 11  DC  D "O5'" 1 
ATOM   1766 C  "C5'" . DC  C 3 11  ? -5.562  10.018  46.468 1.00 13.76 ? 11  DC  D "C5'" 1 
ATOM   1767 C  "C4'" . DC  C 3 11  ? -4.599  10.748  47.391 1.00 15.52 ? 11  DC  D "C4'" 1 
ATOM   1768 O  "O4'" . DC  C 3 11  ? -3.256  10.736  46.832 1.00 19.75 ? 11  DC  D "O4'" 1 
ATOM   1769 C  "C3'" . DC  C 3 11  ? -4.929  12.207  47.634 1.00 12.14 ? 11  DC  D "C3'" 1 
ATOM   1770 O  "O3'" . DC  C 3 11  ? -5.821  12.305  48.736 1.00 16.72 ? 11  DC  D "O3'" 1 
ATOM   1771 C  "C2'" . DC  C 3 11  ? -3.561  12.778  47.984 1.00 17.28 ? 11  DC  D "C2'" 1 
ATOM   1772 C  "C1'" . DC  C 3 11  ? -2.635  11.989  47.047 1.00 17.91 ? 11  DC  D "C1'" 1 
ATOM   1773 N  N1    . DC  C 3 11  ? -2.403  12.648  45.732 1.00 13.40 ? 11  DC  D N1    1 
ATOM   1774 C  C2    . DC  C 3 11  ? -1.106  12.797  45.224 1.00 15.97 ? 11  DC  D C2    1 
ATOM   1775 O  O2    . DC  C 3 11  ? -0.144  12.335  45.848 1.00 17.83 ? 11  DC  D O2    1 
ATOM   1776 N  N3    . DC  C 3 11  ? -0.930  13.440  44.045 1.00 16.35 ? 11  DC  D N3    1 
ATOM   1777 C  C4    . DC  C 3 11  ? -1.982  13.917  43.383 1.00 16.03 ? 11  DC  D C4    1 
ATOM   1778 N  N4    . DC  C 3 11  ? -1.749  14.541  42.220 1.00 13.33 ? 11  DC  D N4    1 
ATOM   1779 C  C5    . DC  C 3 11  ? -3.308  13.785  43.885 1.00 11.41 ? 11  DC  D C5    1 
ATOM   1780 C  C6    . DC  C 3 11  ? -3.457  13.185  45.067 1.00 15.52 ? 11  DC  D C6    1 
ATOM   1781 P  P     . DA  C 3 12  ? -6.994  13.402  48.754 1.00 11.92 ? 12  DA  D P     1 
ATOM   1782 O  OP1   . DA  C 3 12  ? -7.906  13.053  49.847 1.00 12.38 ? 12  DA  D OP1   1 
ATOM   1783 O  OP2   . DA  C 3 12  ? -7.539  13.537  47.395 1.00 13.25 ? 12  DA  D OP2   1 
ATOM   1784 O  "O5'" . DA  C 3 12  ? -6.230  14.750  49.170 1.00 12.92 ? 12  DA  D "O5'" 1 
ATOM   1785 C  "C5'" . DA  C 3 12  ? -5.250  14.739  50.195 1.00 16.86 ? 12  DA  D "C5'" 1 
ATOM   1786 C  "C4'" . DA  C 3 12  ? -4.747  16.148  50.483 1.00 18.41 ? 12  DA  D "C4'" 1 
ATOM   1787 O  "O4'" . DA  C 3 12  ? -3.657  16.513  49.584 1.00 17.02 ? 12  DA  D "O4'" 1 
ATOM   1788 C  "C3'" . DA  C 3 12  ? -5.788  17.237  50.298 1.00 18.81 ? 12  DA  D "C3'" 1 
ATOM   1789 O  "O3'" . DA  C 3 12  ? -6.515  17.401  51.496 1.00 20.11 ? 12  DA  D "O3'" 1 
ATOM   1790 C  "C2'" . DA  C 3 12  ? -4.931  18.460  50.019 1.00 19.46 ? 12  DA  D "C2'" 1 
ATOM   1791 C  "C1'" . DA  C 3 12  ? -3.778  17.869  49.210 1.00 16.48 ? 12  DA  D "C1'" 1 
ATOM   1792 N  N9    . DA  C 3 12  ? -3.976  17.918  47.772 1.00 16.47 ? 12  DA  D N9    1 
ATOM   1793 C  C8    . DA  C 3 12  ? -4.640  17.003  47.002 1.00 21.95 ? 12  DA  D C8    1 
ATOM   1794 N  N7    . DA  C 3 12  ? -4.636  17.284  45.711 1.00 15.58 ? 12  DA  D N7    1 
ATOM   1795 C  C5    . DA  C 3 12  ? -3.907  18.454  45.631 1.00 14.50 ? 12  DA  D C5    1 
ATOM   1796 C  C6    . DA  C 3 12  ? -3.537  19.280  44.537 1.00 17.76 ? 12  DA  D C6    1 
ATOM   1797 N  N6    . DA  C 3 12  ? -3.867  19.037  43.263 1.00 13.21 ? 12  DA  D N6    1 
ATOM   1798 N  N1    . DA  C 3 12  ? -2.814  20.384  44.805 1.00 15.82 ? 12  DA  D N1    1 
ATOM   1799 C  C2    . DA  C 3 12  ? -2.491  20.654  46.076 1.00 14.75 ? 12  DA  D C2    1 
ATOM   1800 N  N3    . DA  C 3 12  ? -2.777  19.963  47.182 1.00 17.57 ? 12  DA  D N3    1 
ATOM   1801 C  C4    . DA  C 3 12  ? -3.499  18.864  46.890 1.00 17.00 ? 12  DA  D C4    1 
ATOM   1802 N  N     . MET D 2 1   ? -9.475  -6.541  62.471 1.00 31.66 ? 1   MET B N     1 
ATOM   1803 C  CA    . MET D 2 1   ? -10.099 -5.177  62.451 1.00 30.54 ? 1   MET B CA    1 
ATOM   1804 C  C     . MET D 2 1   ? -9.282  -4.222  61.589 1.00 29.10 ? 1   MET B C     1 
ATOM   1805 O  O     . MET D 2 1   ? -8.081  -4.049  61.813 1.00 29.63 ? 1   MET B O     1 
ATOM   1806 C  CB    . MET D 2 1   ? -10.223 -4.618  63.871 1.00 30.01 ? 1   MET B CB    1 
ATOM   1807 C  CG    . MET D 2 1   ? -10.829 -3.215  63.936 1.00 32.26 ? 1   MET B CG    1 
ATOM   1808 S  SD    . MET D 2 1   ? -9.615  -1.896  63.665 1.00 36.46 ? 1   MET B SD    1 
ATOM   1809 C  CE    . MET D 2 1   ? -9.737  -1.015  65.226 1.00 29.97 ? 1   MET B CE    1 
ATOM   1810 N  N     . LEU D 2 2   ? -9.937  -3.604  60.606 1.00 26.49 ? 2   LEU B N     1 
ATOM   1811 C  CA    . LEU D 2 2   ? -9.250  -2.714  59.665 1.00 23.19 ? 2   LEU B CA    1 
ATOM   1812 C  C     . LEU D 2 2   ? -9.637  -1.271  59.921 1.00 22.30 ? 2   LEU B C     1 
ATOM   1813 O  O     . LEU D 2 2   ? -10.801 -0.965  60.190 1.00 23.19 ? 2   LEU B O     1 
ATOM   1814 C  CB    . LEU D 2 2   ? -9.590  -3.091  58.224 1.00 22.66 ? 2   LEU B CB    1 
ATOM   1815 C  CG    . LEU D 2 2   ? -9.031  -4.409  57.710 1.00 21.12 ? 2   LEU B CG    1 
ATOM   1816 C  CD1   . LEU D 2 2   ? -10.089 -5.157  56.941 1.00 19.62 ? 2   LEU B CD1   1 
ATOM   1817 C  CD2   . LEU D 2 2   ? -7.814  -4.167  56.855 1.00 19.15 ? 2   LEU B CD2   1 
ATOM   1818 N  N     . ARG D 2 3   ? -8.669  -0.374  59.820 1.00 20.74 ? 3   ARG B N     1 
ATOM   1819 C  CA    . ARG D 2 3   ? -8.910  1.026   60.155 1.00 18.63 ? 3   ARG B CA    1 
ATOM   1820 C  C     . ARG D 2 3   ? -8.624  1.939   58.973 1.00 17.26 ? 3   ARG B C     1 
ATOM   1821 O  O     . ARG D 2 3   ? -7.470  2.202   58.657 1.00 16.35 ? 3   ARG B O     1 
ATOM   1822 C  CB    . ARG D 2 3   ? -8.068  1.434   61.356 1.00 18.32 ? 3   ARG B CB    1 
ATOM   1823 C  CG    . ARG D 2 3   ? -8.060  2.931   61.634 1.00 20.29 ? 3   ARG B CG    1 
ATOM   1824 C  CD    . ARG D 2 3   ? -7.724  3.215   63.091 1.00 22.88 ? 3   ARG B CD    1 
ATOM   1825 N  NE    . ARG D 2 3   ? -8.791  2.779   63.998 1.00 23.05 ? 3   ARG B NE    1 
ATOM   1826 C  CZ    . ARG D 2 3   ? -8.655  2.657   65.317 1.00 21.75 ? 3   ARG B CZ    1 
ATOM   1827 N  NH1   . ARG D 2 3   ? -7.486  2.905   65.899 1.00 18.44 ? 3   ARG B NH1   1 
ATOM   1828 N  NH2   . ARG D 2 3   ? -9.685  2.249   66.054 1.00 21.32 ? 3   ARG B NH2   1 
ATOM   1829 N  N     . ILE D 2 4   ? -9.673  2.361   58.272 1.00 16.80 ? 4   ILE B N     1 
ATOM   1830 C  CA    . ILE D 2 4   ? -9.481  3.288   57.166 1.00 16.49 ? 4   ILE B CA    1 
ATOM   1831 C  C     . ILE D 2 4   ? -9.005  4.600   57.715 1.00 15.45 ? 4   ILE B C     1 
ATOM   1832 O  O     . ILE D 2 4   ? -9.505  5.087   58.727 1.00 16.05 ? 4   ILE B O     1 
ATOM   1833 C  CB    . ILE D 2 4   ? -10.753 3.513   56.324 1.00 15.08 ? 4   ILE B CB    1 
ATOM   1834 C  CG1   . ILE D 2 4   ? -11.038 2.282   55.467 1.00 16.55 ? 4   ILE B CG1   1 
ATOM   1835 C  CG2   . ILE D 2 4   ? -10.549 4.685   55.403 1.00 13.76 ? 4   ILE B CG2   1 
ATOM   1836 C  CD1   . ILE D 2 4   ? -11.248 1.046   56.259 1.00 10.33 ? 4   ILE B CD1   1 
ATOM   1837 N  N     . ILE D 2 5   ? -8.001  5.156   57.073 1.00 15.10 ? 5   ILE B N     1 
ATOM   1838 C  CA    . ILE D 2 5   ? -7.436  6.392   57.537 1.00 15.78 ? 5   ILE B CA    1 
ATOM   1839 C  C     . ILE D 2 5   ? -7.360  7.393   56.390 1.00 15.04 ? 5   ILE B C     1 
ATOM   1840 O  O     . ILE D 2 5   ? -7.082  7.021   55.246 1.00 15.17 ? 5   ILE B O     1 
ATOM   1841 C  CB    . ILE D 2 5   ? -6.067  6.145   58.201 1.00 15.88 ? 5   ILE B CB    1 
ATOM   1842 C  CG1   . ILE D 2 5   ? -6.180  6.325   59.707 1.00 17.93 ? 5   ILE B CG1   1 
ATOM   1843 C  CG2   . ILE D 2 5   ? -5.022  7.100   57.667 1.00 17.69 ? 5   ILE B CG2   1 
ATOM   1844 C  CD1   . ILE D 2 5   ? -5.747  7.706   60.161 1.00 24.22 ? 5   ILE B CD1   1 
ATOM   1845 N  N     . ASP D 2 6   ? -7.662  8.653   56.680 1.00 15.40 ? 6   ASP B N     1 
ATOM   1846 C  CA    . ASP D 2 6   ? -7.544  9.714   55.664 1.00 15.45 ? 6   ASP B CA    1 
ATOM   1847 C  C     . ASP D 2 6   ? -7.143  11.042  56.286 1.00 15.16 ? 6   ASP B C     1 
ATOM   1848 O  O     . ASP D 2 6   ? -7.482  11.330  57.446 1.00 15.01 ? 6   ASP B O     1 
ATOM   1849 C  CB    . ASP D 2 6   ? -8.855  9.869   54.878 1.00 14.89 ? 6   ASP B CB    1 
ATOM   1850 C  CG    . ASP D 2 6   ? -8.729  10.838  53.699 1.00 19.75 ? 6   ASP B CG    1 
ATOM   1851 O  OD1   . ASP D 2 6   ? -7.735  10.754  52.943 1.00 20.70 ? 6   ASP B OD1   1 
ATOM   1852 O  OD2   . ASP D 2 6   ? -9.659  11.650  53.490 1.00 20.02 ? 6   ASP B OD2   1 
ATOM   1853 N  N     . THR D 2 7   ? -6.460  11.868  55.497 1.00 14.28 ? 7   THR B N     1 
ATOM   1854 C  CA    . THR D 2 7   ? -5.887  13.085  56.003 1.00 14.61 ? 7   THR B CA    1 
ATOM   1855 C  C     . THR D 2 7   ? -6.009  14.197  54.971 1.00 15.37 ? 7   THR B C     1 
ATOM   1856 O  O     . THR D 2 7   ? -5.816  13.964  53.796 1.00 17.26 ? 7   THR B O     1 
ATOM   1857 C  CB    . THR D 2 7   ? -4.423  12.880  56.373 1.00 14.43 ? 7   THR B CB    1 
ATOM   1858 O  OG1   . THR D 2 7   ? -3.985  13.950  57.215 1.00 17.24 ? 7   THR B OG1   1 
ATOM   1859 C  CG2   . THR D 2 7   ? -3.581  12.864  55.154 1.00 14.17 ? 7   THR B CG2   1 
ATOM   1860 N  N     . GLU D 2 8   ? -6.405  15.390  55.404 1.00 15.12 ? 8   GLU B N     1 
ATOM   1861 C  CA    . GLU D 2 8   ? -6.322  16.575  54.542 1.00 14.36 ? 8   GLU B CA    1 
ATOM   1862 C  C     . GLU D 2 8   ? -5.111  17.392  54.938 1.00 13.21 ? 8   GLU B C     1 
ATOM   1863 O  O     . GLU D 2 8   ? -4.807  17.511  56.124 1.00 13.64 ? 8   GLU B O     1 
ATOM   1864 C  CB    . GLU D 2 8   ? -7.580  17.449  54.668 1.00 14.61 ? 8   GLU B CB    1 
ATOM   1865 C  CG    . GLU D 2 8   ? -8.890  16.689  54.656 1.00 12.96 ? 8   GLU B CG    1 
ATOM   1866 C  CD    . GLU D 2 8   ? -9.164  16.008  53.337 1.00 14.89 ? 8   GLU B CD    1 
ATOM   1867 O  OE1   . GLU D 2 8   ? -8.595  16.411  52.291 1.00 13.42 ? 8   GLU B OE1   1 
ATOM   1868 O  OE2   . GLU D 2 8   ? -10.012 15.104  53.334 1.00 17.01 ? 8   GLU B OE2   1 
ATOM   1869 N  N     . THR D 2 9   ? -4.455  17.991  53.950 1.00 11.28 ? 9   THR B N     1 
ATOM   1870 C  CA    . THR D 2 9   ? -3.158  18.608  54.164 1.00 12.18 ? 9   THR B CA    1 
ATOM   1871 C  C     . THR D 2 9   ? -3.094  20.036  53.603 1.00 13.33 ? 9   THR B C     1 
ATOM   1872 O  O     . THR D 2 9   ? -3.911  20.419  52.769 1.00 12.21 ? 9   THR B O     1 
ATOM   1873 C  CB    . THR D 2 9   ? -2.024  17.794  53.499 1.00 11.60 ? 9   THR B CB    1 
ATOM   1874 O  OG1   . THR D 2 9   ? -2.192  17.823  52.085 1.00 7.70  ? 9   THR B OG1   1 
ATOM   1875 C  CG2   . THR D 2 9   ? -2.002  16.352  53.990 1.00 9.31  ? 9   THR B CG2   1 
ATOM   1876 N  N     . CYS D 2 10  ? -2.036  20.762  53.971 1.00 13.82 ? 10  CYS B N     1 
ATOM   1877 C  CA    . CYS D 2 10  ? -1.714  22.050  53.334 1.00 14.53 ? 10  CYS B CA    1 
ATOM   1878 C  C     . CYS D 2 10  ? -1.310  21.954  51.868 1.00 14.45 ? 10  CYS B C     1 
ATOM   1879 O  O     . CYS D 2 10  ? -1.235  22.979  51.179 1.00 15.00 ? 10  CYS B O     1 
ATOM   1880 C  CB    . CYS D 2 10  ? -0.609  22.784  54.088 1.00 12.47 ? 10  CYS B CB    1 
ATOM   1881 S  SG    . CYS D 2 10  ? -0.879  22.917  55.835 1.00 13.85 ? 10  CYS B SG    1 
ATOM   1882 N  N     . GLY D 2 11  ? -0.942  20.759  51.420 1.00 13.44 ? 11  GLY B N     1 
ATOM   1883 C  CA    . GLY D 2 11  ? -0.562  20.560  50.011 1.00 14.40 ? 11  GLY B CA    1 
ATOM   1884 C  C     . GLY D 2 11  ? 0.101   19.215  49.787 1.00 15.91 ? 11  GLY B C     1 
ATOM   1885 O  O     . GLY D 2 11  ? 0.042   18.335  50.646 1.00 15.91 ? 11  GLY B O     1 
ATOM   1886 N  N     . LEU D 2 12  ? 0.754   19.049  48.644 1.00 16.82 ? 12  LEU B N     1 
ATOM   1887 C  CA    . LEU D 2 12  ? 1.309   17.749  48.297 1.00 18.52 ? 12  LEU B CA    1 
ATOM   1888 C  C     . LEU D 2 12  ? 2.554   17.407  49.132 1.00 20.31 ? 12  LEU B C     1 
ATOM   1889 O  O     . LEU D 2 12  ? 2.825   16.239  49.411 1.00 20.27 ? 12  LEU B O     1 
ATOM   1890 C  CB    . LEU D 2 12  ? 1.599   17.676  46.807 1.00 17.43 ? 12  LEU B CB    1 
ATOM   1891 C  CG    . LEU D 2 12  ? 0.334   17.717  45.932 1.00 19.23 ? 12  LEU B CG    1 
ATOM   1892 C  CD1   . LEU D 2 12  ? 0.678   17.781  44.438 1.00 20.62 ? 12  LEU B CD1   1 
ATOM   1893 C  CD2   . LEU D 2 12  ? -0.552  16.511  46.232 1.00 14.77 ? 12  LEU B CD2   1 
ATOM   1894 N  N     . GLN D 2 13  ? 3.252   18.434  49.606 1.00 22.05 ? 13  GLN B N     1 
ATOM   1895 C  CA    . GLN D 2 13  ? 4.520   18.227  50.292 1.00 24.11 ? 13  GLN B CA    1 
ATOM   1896 C  C     . GLN D 2 13  ? 4.301   17.767  51.732 1.00 24.05 ? 13  GLN B C     1 
ATOM   1897 O  O     . GLN D 2 13  ? 5.150   17.087  52.311 1.00 25.95 ? 13  GLN B O     1 
ATOM   1898 C  CB    . GLN D 2 13  ? 5.382   19.497  50.251 1.00 25.30 ? 13  GLN B CB    1 
ATOM   1899 C  CG    . GLN D 2 13  ? 6.032   19.785  48.887 1.00 30.00 ? 13  GLN B CG    1 
ATOM   1900 C  CD    . GLN D 2 13  ? 5.025   20.287  47.844 1.00 39.52 ? 13  GLN B CD    1 
ATOM   1901 O  OE1   . GLN D 2 13  ? 3.901   20.674  48.175 1.00 43.00 ? 13  GLN B OE1   1 
ATOM   1902 N  NE2   . GLN D 2 13  ? 5.439   20.300  46.579 1.00 42.82 ? 13  GLN B NE2   1 
ATOM   1903 N  N     . GLY D 2 14  ? 3.122   18.068  52.277 1.00 23.95 ? 14  GLY B N     1 
ATOM   1904 C  CA    . GLY D 2 14  ? 2.794   17.673  53.656 1.00 23.79 ? 14  GLY B CA    1 
ATOM   1905 C  C     . GLY D 2 14  ? 2.005   18.739  54.436 1.00 23.43 ? 14  GLY B C     1 
ATOM   1906 O  O     . GLY D 2 14  ? 1.491   19.691  53.852 1.00 24.45 ? 14  GLY B O     1 
ATOM   1907 N  N     . GLY D 2 15  ? 1.952   18.612  55.763 1.00 22.92 ? 15  GLY B N     1 
ATOM   1908 C  CA    . GLY D 2 15  ? 1.016   19.418  56.578 1.00 22.43 ? 15  GLY B CA    1 
ATOM   1909 C  C     . GLY D 2 15  ? -0.382  18.817  56.636 1.00 23.86 ? 15  GLY B C     1 
ATOM   1910 O  O     . GLY D 2 15  ? -0.834  18.170  55.666 1.00 27.43 ? 15  GLY B O     1 
ATOM   1911 N  N     . ILE D 2 16  ? -0.984  18.834  57.827 1.00 21.61 ? 16  ILE B N     1 
ATOM   1912 C  CA    . ILE D 2 16  ? -2.292  18.200  58.030 1.00 20.47 ? 16  ILE B CA    1 
ATOM   1913 C  C     . ILE D 2 16  ? -3.310  19.238  58.494 1.00 19.54 ? 16  ILE B C     1 
ATOM   1914 O  O     . ILE D 2 16  ? -3.062  19.957  59.445 1.00 17.30 ? 16  ILE B O     1 
ATOM   1915 C  CB    . ILE D 2 16  ? -2.207  17.040  59.067 1.00 20.62 ? 16  ILE B CB    1 
ATOM   1916 C  CG1   . ILE D 2 16  ? -1.162  16.001  58.614 1.00 22.75 ? 16  ILE B CG1   1 
ATOM   1917 C  CG2   . ILE D 2 16  ? -3.590  16.377  59.259 1.00 21.70 ? 16  ILE B CG2   1 
ATOM   1918 C  CD1   . ILE D 2 16  ? -1.318  15.561  57.139 1.00 20.31 ? 16  ILE B CD1   1 
ATOM   1919 N  N     . VAL D 2 17  ? -4.396  19.388  57.747 1.00 20.19 ? 17  VAL B N     1 
ATOM   1920 C  CA    . VAL D 2 17  ? -5.463  20.291  58.137 1.00 20.44 ? 17  VAL B CA    1 
ATOM   1921 C  C     . VAL D 2 17  ? -6.524  19.491  58.895 1.00 21.90 ? 17  VAL B C     1 
ATOM   1922 O  O     . VAL D 2 17  ? -7.460  20.070  59.456 1.00 23.50 ? 17  VAL B O     1 
ATOM   1923 C  CB    . VAL D 2 17  ? -6.105  20.957  56.906 1.00 19.95 ? 17  VAL B CB    1 
ATOM   1924 C  CG1   . VAL D 2 17  ? -5.326  22.206  56.538 1.00 23.05 ? 17  VAL B CG1   1 
ATOM   1925 C  CG2   . VAL D 2 17  ? -6.168  19.970  55.711 1.00 19.53 ? 17  VAL B CG2   1 
ATOM   1926 N  N     . GLU D 2 18  ? -6.497  18.168  58.699 1.00 20.17 ? 18  GLU B N     1 
ATOM   1927 C  CA    . GLU D 2 18  ? -7.481  17.267  59.301 1.00 17.52 ? 18  GLU B CA    1 
ATOM   1928 C  C     . GLU D 2 18  ? -6.992  15.844  59.250 1.00 17.04 ? 18  GLU B C     1 
ATOM   1929 O  O     . GLU D 2 18  ? -6.183  15.490  58.405 1.00 17.08 ? 18  GLU B O     1 
ATOM   1930 C  CB    . GLU D 2 18  ? -8.839  17.346  58.599 1.00 15.78 ? 18  GLU B CB    1 
ATOM   1931 C  CG    . GLU D 2 18  ? -10.012 16.928  59.501 1.00 13.00 ? 18  GLU B CG    1 
ATOM   1932 C  CD    . GLU D 2 18  ? -11.370 17.074  58.819 1.00 17.07 ? 18  GLU B CD    1 
ATOM   1933 O  OE1   . GLU D 2 18  ? -11.409 17.219  57.578 1.00 11.65 ? 18  GLU B OE1   1 
ATOM   1934 O  OE2   . GLU D 2 18  ? -12.405 16.984  59.520 1.00 20.50 ? 18  GLU B OE2   1 
ATOM   1935 N  N     . ILE D 2 19  ? -7.491  15.033  60.171 1.00 17.43 ? 19  ILE B N     1 
ATOM   1936 C  CA    . ILE D 2 19  ? -7.413  13.599  60.050 1.00 17.10 ? 19  ILE B CA    1 
ATOM   1937 C  C     . ILE D 2 19  ? -8.691  12.960  60.559 1.00 18.40 ? 19  ILE B C     1 
ATOM   1938 O  O     . ILE D 2 19  ? -9.327  13.466  61.505 1.00 18.75 ? 19  ILE B O     1 
ATOM   1939 C  CB    . ILE D 2 19  ? -6.218  13.025  60.827 1.00 16.64 ? 19  ILE B CB    1 
ATOM   1940 C  CG1   . ILE D 2 19  ? -6.096  11.510  60.564 1.00 15.88 ? 19  ILE B CG1   1 
ATOM   1941 C  CG2   . ILE D 2 19  ? -6.346  13.353  62.321 1.00 15.05 ? 19  ILE B CG2   1 
ATOM   1942 C  CD1   . ILE D 2 19  ? -5.044  10.803  61.416 1.00 12.23 ? 19  ILE B CD1   1 
ATOM   1943 N  N     . ALA D 2 20  ? -9.039  11.830  59.943 1.00 17.80 ? 20  ALA B N     1 
ATOM   1944 C  CA    . ALA D 2 20  ? -10.253 11.087  60.262 1.00 16.37 ? 20  ALA B CA    1 
ATOM   1945 C  C     . ALA D 2 20  ? -10.000 9.586   60.122 1.00 15.84 ? 20  ALA B C     1 
ATOM   1946 O  O     . ALA D 2 20  ? -9.141  9.161   59.349 1.00 14.98 ? 20  ALA B O     1 
ATOM   1947 C  CB    . ALA D 2 20  ? -11.363 11.505  59.336 1.00 14.58 ? 20  ALA B CB    1 
ATOM   1948 N  N     . SER D 2 21  ? -10.817 8.782   60.790 1.00 15.60 ? 21  SER B N     1 
ATOM   1949 C  CA    . SER D 2 21  ? -10.855 7.345   60.498 1.00 16.12 ? 21  SER B CA    1 
ATOM   1950 C  C     . SER D 2 21  ? -12.219 6.721   60.745 1.00 15.28 ? 21  SER B C     1 
ATOM   1951 O  O     . SER D 2 21  ? -13.026 7.234   61.519 1.00 14.16 ? 21  SER B O     1 
ATOM   1952 C  CB    . SER D 2 21  ? -9.780  6.592   61.295 1.00 15.31 ? 21  SER B CB    1 
ATOM   1953 O  OG    . SER D 2 21  ? -10.047 6.631   62.683 1.00 16.80 ? 21  SER B OG    1 
ATOM   1954 N  N     . VAL D 2 22  ? -12.461 5.602   60.073 1.00 15.63 ? 22  VAL B N     1 
ATOM   1955 C  CA    . VAL D 2 22  ? -13.529 4.695   60.438 1.00 14.08 ? 22  VAL B CA    1 
ATOM   1956 C  C     . VAL D 2 22  ? -12.973 3.271   60.485 1.00 16.75 ? 22  VAL B C     1 
ATOM   1957 O  O     . VAL D 2 22  ? -11.982 2.965   59.815 1.00 15.49 ? 22  VAL B O     1 
ATOM   1958 C  CB    . VAL D 2 22  ? -14.687 4.758   59.439 1.00 12.57 ? 22  VAL B CB    1 
ATOM   1959 C  CG1   . VAL D 2 22  ? -15.250 6.192   59.330 1.00 10.76 ? 22  VAL B CG1   1 
ATOM   1960 C  CG2   . VAL D 2 22  ? -14.256 4.237   58.115 1.00 6.75  ? 22  VAL B CG2   1 
ATOM   1961 N  N     . ASP D 2 23  ? -13.588 2.414   61.305 1.00 17.77 ? 23  ASP B N     1 
ATOM   1962 C  CA    . ASP D 2 23  ? -13.214 1.005   61.344 1.00 19.94 ? 23  ASP B CA    1 
ATOM   1963 C  C     . ASP D 2 23  ? -14.132 0.117   60.515 1.00 20.19 ? 23  ASP B C     1 
ATOM   1964 O  O     . ASP D 2 23  ? -15.338 0.330   60.476 1.00 19.80 ? 23  ASP B O     1 
ATOM   1965 C  CB    . ASP D 2 23  ? -13.174 0.492   62.776 1.00 19.29 ? 23  ASP B CB    1 
ATOM   1966 C  CG    . ASP D 2 23  ? -12.121 1.164   63.594 1.00 20.48 ? 23  ASP B CG    1 
ATOM   1967 O  OD1   . ASP D 2 23  ? -11.150 1.708   63.007 1.00 19.32 ? 23  ASP B OD1   1 
ATOM   1968 O  OD2   . ASP D 2 23  ? -12.263 1.151   64.834 1.00 23.55 ? 23  ASP B OD2   1 
ATOM   1969 N  N     . VAL D 2 24  ? -13.540 -0.905  59.897 1.00 20.92 ? 24  VAL B N     1 
ATOM   1970 C  CA    . VAL D 2 24  ? -14.281 -1.934  59.189 1.00 21.56 ? 24  VAL B CA    1 
ATOM   1971 C  C     . VAL D 2 24  ? -14.178 -3.248  59.956 1.00 23.31 ? 24  VAL B C     1 
ATOM   1972 O  O     . VAL D 2 24  ? -13.096 -3.818  60.092 1.00 24.28 ? 24  VAL B O     1 
ATOM   1973 C  CB    . VAL D 2 24  ? -13.747 -2.120  57.752 1.00 21.64 ? 24  VAL B CB    1 
ATOM   1974 C  CG1   . VAL D 2 24  ? -14.459 -3.286  57.055 1.00 20.85 ? 24  VAL B CG1   1 
ATOM   1975 C  CG2   . VAL D 2 24  ? -13.929 -0.838  56.954 1.00 18.60 ? 24  VAL B CG2   1 
ATOM   1976 N  N     . ILE D 2 25  ? -15.290 -3.662  60.557 1.00 24.78 ? 25  ILE B N     1 
ATOM   1977 C  CA    . ILE D 2 25  ? -15.357 -4.945  61.252 1.00 25.21 ? 25  ILE B CA    1 
ATOM   1978 C  C     . ILE D 2 25  ? -16.564 -5.719  60.778 1.00 25.12 ? 25  ILE B C     1 
ATOM   1979 O  O     . ILE D 2 25  ? -17.677 -5.218  60.828 1.00 26.44 ? 25  ILE B O     1 
ATOM   1980 C  CB    . ILE D 2 25  ? -15.501 -4.755  62.751 1.00 25.78 ? 25  ILE B CB    1 
ATOM   1981 C  CG1   . ILE D 2 25  ? -14.199 -4.213  63.362 1.00 24.94 ? 25  ILE B CG1   1 
ATOM   1982 C  CG2   . ILE D 2 25  ? -15.925 -6.059  63.406 1.00 24.64 ? 25  ILE B CG2   1 
ATOM   1983 C  CD1   . ILE D 2 25  ? -14.404 -3.535  64.731 1.00 20.25 ? 25  ILE B CD1   1 
ATOM   1984 N  N     . ASP D 2 26  ? -16.346 -6.940  60.311 1.00 25.69 ? 26  ASP B N     1 
ATOM   1985 C  CA    . ASP D 2 26  ? -17.456 -7.816  59.936 1.00 27.23 ? 26  ASP B CA    1 
ATOM   1986 C  C     . ASP D 2 26  ? -18.306 -7.187  58.849 1.00 25.14 ? 26  ASP B C     1 
ATOM   1987 O  O     . ASP D 2 26  ? -19.525 -7.341  58.834 1.00 24.03 ? 26  ASP B O     1 
ATOM   1988 C  CB    . ASP D 2 26  ? -18.333 -8.137  61.156 1.00 28.83 ? 26  ASP B CB    1 
ATOM   1989 C  CG    . ASP D 2 26  ? -18.871 -9.562  61.131 1.00 37.25 ? 26  ASP B CG    1 
ATOM   1990 O  OD1   . ASP D 2 26  ? -20.023 -9.765  60.655 1.00 39.87 ? 26  ASP B OD1   1 
ATOM   1991 O  OD2   . ASP D 2 26  ? -18.125 -10.484 61.561 1.00 43.41 ? 26  ASP B OD2   1 
ATOM   1992 N  N     . GLY D 2 27  ? -17.649 -6.497  57.926 1.00 24.87 ? 27  GLY B N     1 
ATOM   1993 C  CA    . GLY D 2 27  ? -18.315 -5.943  56.756 1.00 24.18 ? 27  GLY B CA    1 
ATOM   1994 C  C     . GLY D 2 27  ? -19.196 -4.755  57.091 1.00 24.66 ? 27  GLY B C     1 
ATOM   1995 O  O     . GLY D 2 27  ? -20.094 -4.413  56.336 1.00 26.72 ? 27  GLY B O     1 
ATOM   1996 N  N     . LYS D 2 28  ? -18.927 -4.105  58.214 1.00 23.26 ? 28  LYS B N     1 
ATOM   1997 C  CA    . LYS D 2 28  ? -19.702 -2.944  58.593 1.00 22.81 ? 28  LYS B CA    1 
ATOM   1998 C  C     . LYS D 2 28  ? -18.808 -1.827  59.103 1.00 21.79 ? 28  LYS B C     1 
ATOM   1999 O  O     . LYS D 2 28  ? -17.822 -2.080  59.805 1.00 21.05 ? 28  LYS B O     1 
ATOM   2000 C  CB    . LYS D 2 28  ? -20.756 -3.319  59.637 1.00 24.33 ? 28  LYS B CB    1 
ATOM   2001 C  CG    . LYS D 2 28  ? -21.955 -4.083  59.060 1.00 25.62 ? 28  LYS B CG    1 
ATOM   2002 C  CD    . LYS D 2 28  ? -22.767 -4.761  60.166 1.00 34.17 ? 28  LYS B CD    1 
ATOM   2003 C  CE    . LYS D 2 28  ? -22.041 -5.979  60.736 1.00 38.64 ? 28  LYS B CE    1 
ATOM   2004 N  NZ    . LYS D 2 28  ? -22.637 -6.461  62.027 1.00 39.57 ? 28  LYS B NZ    1 
ATOM   2005 N  N     . ILE D 2 29  ? -19.109 -0.597  58.688 1.00 20.45 ? 29  ILE B N     1 
ATOM   2006 C  CA    . ILE D 2 29  ? -18.343 0.568   59.143 1.00 18.58 ? 29  ILE B CA    1 
ATOM   2007 C  C     . ILE D 2 29  ? -18.784 1.002   60.540 1.00 17.82 ? 29  ILE B C     1 
ATOM   2008 O  O     . ILE D 2 29  ? -19.976 1.171   60.796 1.00 17.64 ? 29  ILE B O     1 
ATOM   2009 C  CB    . ILE D 2 29  ? -18.469 1.743   58.171 1.00 18.29 ? 29  ILE B CB    1 
ATOM   2010 C  CG1   . ILE D 2 29  ? -17.939 1.355   56.793 1.00 16.20 ? 29  ILE B CG1   1 
ATOM   2011 C  CG2   . ILE D 2 29  ? -17.750 2.965   58.711 1.00 19.33 ? 29  ILE B CG2   1 
ATOM   2012 C  CD1   . ILE D 2 29  ? -18.768 1.917   55.663 1.00 13.49 ? 29  ILE B CD1   1 
ATOM   2013 N  N     . VAL D 2 30  ? -17.826 1.082   61.460 1.00 17.49 ? 30  VAL B N     1 
ATOM   2014 C  CA    . VAL D 2 30  ? -18.095 1.550   62.815 1.00 17.71 ? 30  VAL B CA    1 
ATOM   2015 C  C     . VAL D 2 30  ? -17.001 2.481   63.350 1.00 19.12 ? 30  VAL B C     1 
ATOM   2016 O  O     . VAL D 2 30  ? -15.926 2.608   62.759 1.00 19.22 ? 30  VAL B O     1 
ATOM   2017 C  CB    . VAL D 2 30  ? -18.290 0.369   63.797 1.00 18.45 ? 30  VAL B CB    1 
ATOM   2018 C  CG1   . VAL D 2 30  ? -19.395 -0.573  63.290 1.00 18.10 ? 30  VAL B CG1   1 
ATOM   2019 C  CG2   . VAL D 2 30  ? -16.966 -0.388  64.015 1.00 14.62 ? 30  VAL B CG2   1 
ATOM   2020 N  N     . ASN D 2 31  ? -17.283 3.114   64.486 1.00 20.75 ? 31  ASN B N     1 
ATOM   2021 C  CA    . ASN D 2 31  ? -16.275 3.867   65.244 1.00 21.99 ? 31  ASN B CA    1 
ATOM   2022 C  C     . ASN D 2 31  ? -15.579 5.007   64.466 1.00 21.48 ? 31  ASN B C     1 
ATOM   2023 O  O     . ASN D 2 31  ? -14.365 5.068   64.419 1.00 22.16 ? 31  ASN B O     1 
ATOM   2024 C  CB    . ASN D 2 31  ? -15.239 2.911   65.846 1.00 21.12 ? 31  ASN B CB    1 
ATOM   2025 C  CG    . ASN D 2 31  ? -14.323 3.595   66.859 1.00 21.58 ? 31  ASN B CG    1 
ATOM   2026 O  OD1   . ASN D 2 31  ? -14.768 4.391   67.692 1.00 21.48 ? 31  ASN B OD1   1 
ATOM   2027 N  ND2   . ASN D 2 31  ? -13.042 3.264   66.803 1.00 18.48 ? 31  ASN B ND2   1 
ATOM   2028 N  N     . PRO D 2 32  ? -16.355 5.951   63.927 1.00 22.36 ? 32  PRO B N     1 
ATOM   2029 C  CA    . PRO D 2 32  ? -15.740 7.086   63.242 1.00 22.11 ? 32  PRO B CA    1 
ATOM   2030 C  C     . PRO D 2 32  ? -15.097 8.088   64.210 1.00 22.22 ? 32  PRO B C     1 
ATOM   2031 O  O     . PRO D 2 32  ? -15.660 8.378   65.262 1.00 21.52 ? 32  PRO B O     1 
ATOM   2032 C  CB    . PRO D 2 32  ? -16.919 7.732   62.506 1.00 21.61 ? 32  PRO B CB    1 
ATOM   2033 C  CG    . PRO D 2 32  ? -18.120 7.331   63.279 1.00 23.22 ? 32  PRO B CG    1 
ATOM   2034 C  CD    . PRO D 2 32  ? -17.827 5.963   63.823 1.00 22.41 ? 32  PRO B CD    1 
ATOM   2035 N  N     . MET D 2 33  ? -13.871 8.511   63.897 1.00 22.35 ? 33  MET B N     1 
ATOM   2036 C  CA    . MET D 2 33  ? -13.241 9.669   64.549 1.00 22.37 ? 33  MET B CA    1 
ATOM   2037 C  C     . MET D 2 33  ? -12.838 10.723  63.517 1.00 20.85 ? 33  MET B C     1 
ATOM   2038 O  O     . MET D 2 33  ? -12.518 10.407  62.375 1.00 19.89 ? 33  MET B O     1 
ATOM   2039 C  CB    . MET D 2 33  ? -11.988 9.243   65.311 1.00 23.10 ? 33  MET B CB    1 
ATOM   2040 C  CG    . MET D 2 33  ? -12.165 8.073   66.238 1.00 28.34 ? 33  MET B CG    1 
ATOM   2041 S  SD    . MET D 2 33  ? -10.569 7.501   66.875 1.00 34.86 ? 33  MET B SD    1 
ATOM   2042 C  CE    . MET D 2 33  ? -11.119 6.370   68.163 1.00 40.15 ? 33  MET B CE    1 
ATOM   2043 N  N     . SER D 2 34  ? -12.758 11.969  63.945 1.00 20.43 ? 34  SER B N     1 
ATOM   2044 C  CA    . SER D 2 34  ? -12.231 13.001  63.082 1.00 19.94 ? 34  SER B CA    1 
ATOM   2045 C  C     . SER D 2 34  ? -11.716 14.138  63.931 1.00 19.17 ? 34  SER B C     1 
ATOM   2046 O  O     . SER D 2 34  ? -12.209 14.365  65.043 1.00 18.48 ? 34  SER B O     1 
ATOM   2047 C  CB    . SER D 2 34  ? -13.301 13.499  62.113 1.00 19.49 ? 34  SER B CB    1 
ATOM   2048 O  OG    . SER D 2 34  ? -14.325 14.193  62.809 1.00 24.00 ? 34  SER B OG    1 
ATOM   2049 N  N     . HIS D 2 35  ? -10.696 14.823  63.411 1.00 17.57 ? 35  HIS B N     1 
ATOM   2050 C  CA    . HIS D 2 35  ? -10.010 15.887  64.122 1.00 14.87 ? 35  HIS B CA    1 
ATOM   2051 C  C     . HIS D 2 35  ? -9.502  16.896  63.126 1.00 15.23 ? 35  HIS B C     1 
ATOM   2052 O  O     . HIS D 2 35  ? -8.734  16.555  62.210 1.00 16.16 ? 35  HIS B O     1 
ATOM   2053 C  CB    . HIS D 2 35  ? -8.821  15.331  64.894 1.00 15.10 ? 35  HIS B CB    1 
ATOM   2054 C  CG    . HIS D 2 35  ? -9.196  14.622  66.148 1.00 10.62 ? 35  HIS B CG    1 
ATOM   2055 N  ND1   . HIS D 2 35  ? -9.466  13.270  66.185 1.00 14.61 ? 35  HIS B ND1   1 
ATOM   2056 C  CD2   . HIS D 2 35  ? -9.342  15.071  67.414 1.00 10.79 ? 35  HIS B CD2   1 
ATOM   2057 C  CE1   . HIS D 2 35  ? -9.783  12.922  67.419 1.00 14.63 ? 35  HIS B CE1   1 
ATOM   2058 N  NE2   . HIS D 2 35  ? -9.695  13.992  68.188 1.00 17.38 ? 35  HIS B NE2   1 
ATOM   2059 N  N     . LEU D 2 36  ? -9.896  18.145  63.315 1.00 14.07 ? 36  LEU B N     1 
ATOM   2060 C  CA    . LEU D 2 36  ? -9.199  19.251  62.690 1.00 12.31 ? 36  LEU B CA    1 
ATOM   2061 C  C     . LEU D 2 36  ? -7.880  19.464  63.418 1.00 11.34 ? 36  LEU B C     1 
ATOM   2062 O  O     . LEU D 2 36  ? -7.787  19.209  64.610 1.00 11.57 ? 36  LEU B O     1 
ATOM   2063 C  CB    . LEU D 2 36  ? -10.050 20.508  62.737 1.00 11.58 ? 36  LEU B CB    1 
ATOM   2064 C  CG    . LEU D 2 36  ? -11.244 20.524  61.786 1.00 13.45 ? 36  LEU B CG    1 
ATOM   2065 C  CD1   . LEU D 2 36  ? -12.159 21.700  62.116 1.00 12.52 ? 36  LEU B CD1   1 
ATOM   2066 C  CD2   . LEU D 2 36  ? -10.799 20.554  60.318 1.00 10.40 ? 36  LEU B CD2   1 
ATOM   2067 N  N     . VAL D 2 37  ? -6.831  19.784  62.664 1.00 10.56 ? 37  VAL B N     1 
ATOM   2068 C  CA    . VAL D 2 37  ? -5.477  19.791  63.197 1.00 9.51  ? 37  VAL B CA    1 
ATOM   2069 C  C     . VAL D 2 37  ? -4.783  21.093  62.807 1.00 9.32  ? 37  VAL B C     1 
ATOM   2070 O  O     . VAL D 2 37  ? -4.855  21.526  61.664 1.00 7.72  ? 37  VAL B O     1 
ATOM   2071 C  CB    . VAL D 2 37  ? -4.625  18.591  62.649 1.00 10.18 ? 37  VAL B CB    1 
ATOM   2072 C  CG1   . VAL D 2 37  ? -3.192  18.671  63.167 1.00 12.13 ? 37  VAL B CG1   1 
ATOM   2073 C  CG2   . VAL D 2 37  ? -5.242  17.256  63.022 1.00 9.63  ? 37  VAL B CG2   1 
ATOM   2074 N  N     . ARG D 2 38  ? -4.040  21.662  63.747 1.00 10.04 ? 38  ARG B N     1 
ATOM   2075 C  CA    . ARG D 2 38  ? -3.160  22.800  63.476 1.00 11.89 ? 38  ARG B CA    1 
ATOM   2076 C  C     . ARG D 2 38  ? -1.872  22.414  62.708 1.00 11.32 ? 38  ARG B C     1 
ATOM   2077 O  O     . ARG D 2 38  ? -0.996  21.761  63.256 1.00 12.95 ? 38  ARG B O     1 
ATOM   2078 C  CB    . ARG D 2 38  ? -2.795  23.471  64.799 1.00 13.01 ? 38  ARG B CB    1 
ATOM   2079 C  CG    . ARG D 2 38  ? -2.097  24.795  64.633 1.00 16.61 ? 38  ARG B CG    1 
ATOM   2080 C  CD    . ARG D 2 38  ? -2.031  25.481  65.942 1.00 19.61 ? 38  ARG B CD    1 
ATOM   2081 N  NE    . ARG D 2 38  ? -1.461  26.811  65.831 1.00 23.95 ? 38  ARG B NE    1 
ATOM   2082 C  CZ    . ARG D 2 38  ? -1.162  27.559  66.882 1.00 24.84 ? 38  ARG B CZ    1 
ATOM   2083 N  NH1   . ARG D 2 38  ? -1.395  27.090  68.100 1.00 24.09 ? 38  ARG B NH1   1 
ATOM   2084 N  NH2   . ARG D 2 38  ? -0.664  28.776  66.722 1.00 21.53 ? 38  ARG B NH2   1 
ATOM   2085 N  N     . PRO D 2 39  ? -1.739  22.869  61.454 1.00 12.21 ? 39  PRO B N     1 
ATOM   2086 C  CA    . PRO D 2 39  ? -0.663  22.386  60.600 1.00 13.19 ? 39  PRO B CA    1 
ATOM   2087 C  C     . PRO D 2 39  ? 0.687   23.024  60.946 1.00 15.34 ? 39  PRO B C     1 
ATOM   2088 O  O     . PRO D 2 39  ? 0.741   24.047  61.640 1.00 15.51 ? 39  PRO B O     1 
ATOM   2089 C  CB    . PRO D 2 39  ? -1.114  22.806  59.194 1.00 13.36 ? 39  PRO B CB    1 
ATOM   2090 C  CG    . PRO D 2 39  ? -1.970  24.014  59.415 1.00 13.25 ? 39  PRO B CG    1 
ATOM   2091 C  CD    . PRO D 2 39  ? -2.543  23.925  60.804 1.00 12.83 ? 39  PRO B CD    1 
ATOM   2092 N  N     . ASP D 2 40  ? 1.765   22.420  60.453 1.00 16.58 ? 40  ASP B N     1 
ATOM   2093 C  CA    . ASP D 2 40  ? 3.113   22.882  60.764 1.00 17.17 ? 40  ASP B CA    1 
ATOM   2094 C  C     . ASP D 2 40  ? 3.608   23.886  59.716 1.00 16.63 ? 40  ASP B C     1 
ATOM   2095 O  O     . ASP D 2 40  ? 4.782   24.254  59.699 1.00 17.24 ? 40  ASP B O     1 
ATOM   2096 C  CB    . ASP D 2 40  ? 4.069   21.697  60.867 1.00 16.59 ? 40  ASP B CB    1 
ATOM   2097 C  CG    . ASP D 2 40  ? 4.434   21.124  59.505 1.00 22.65 ? 40  ASP B CG    1 
ATOM   2098 O  OD1   . ASP D 2 40  ? 3.606   21.231  58.570 1.00 26.97 ? 40  ASP B OD1   1 
ATOM   2099 O  OD2   . ASP D 2 40  ? 5.547   20.566  59.368 1.00 24.02 ? 40  ASP B OD2   1 
ATOM   2100 N  N     . ARG D 2 41  ? 2.684   24.381  58.901 1.00 15.98 ? 41  ARG B N     1 
ATOM   2101 C  CA    . ARG D 2 41  ? 3.003   25.362  57.875 1.00 16.68 ? 41  ARG B CA    1 
ATOM   2102 C  C     . ARG D 2 41  ? 1.717   25.997  57.362 1.00 17.89 ? 41  ARG B C     1 
ATOM   2103 O  O     . ARG D 2 41  ? 0.622   25.525  57.676 1.00 19.57 ? 41  ARG B O     1 
ATOM   2104 C  CB    . ARG D 2 41  ? 3.750   24.695  56.727 1.00 16.25 ? 41  ARG B CB    1 
ATOM   2105 C  CG    . ARG D 2 41  ? 2.855   23.877  55.801 1.00 21.05 ? 41  ARG B CG    1 
ATOM   2106 C  CD    . ARG D 2 41  ? 3.668   22.932  54.920 1.00 17.31 ? 41  ARG B CD    1 
ATOM   2107 N  NE    . ARG D 2 41  ? 4.163   21.788  55.671 1.00 14.52 ? 41  ARG B NE    1 
ATOM   2108 C  CZ    . ARG D 2 41  ? 4.904   20.814  55.144 1.00 16.60 ? 41  ARG B CZ    1 
ATOM   2109 N  NH1   . ARG D 2 41  ? 5.248   20.852  53.860 1.00 13.73 ? 41  ARG B NH1   1 
ATOM   2110 N  NH2   . ARG D 2 41  ? 5.284   19.795  55.896 1.00 12.82 ? 41  ARG B NH2   1 
ATOM   2111 N  N     . PRO D 2 42  ? 1.839   27.066  56.562 1.00 17.47 ? 42  PRO B N     1 
ATOM   2112 C  CA    . PRO D 2 42  ? 0.662   27.710  55.978 1.00 16.05 ? 42  PRO B CA    1 
ATOM   2113 C  C     . PRO D 2 42  ? -0.123  26.746  55.107 1.00 16.17 ? 42  PRO B C     1 
ATOM   2114 O  O     . PRO D 2 42  ? 0.472   25.875  54.466 1.00 15.79 ? 42  PRO B O     1 
ATOM   2115 C  CB    . PRO D 2 42  ? 1.265   28.814  55.094 1.00 12.97 ? 42  PRO B CB    1 
ATOM   2116 C  CG    . PRO D 2 42  ? 2.538   29.133  55.724 1.00 16.68 ? 42  PRO B CG    1 
ATOM   2117 C  CD    . PRO D 2 42  ? 3.067   27.839  56.311 1.00 18.11 ? 42  PRO B CD    1 
ATOM   2118 N  N     . ILE D 2 43  ? -1.418  27.026  54.947 1.00 16.33 ? 43  ILE B N     1 
ATOM   2119 C  CA    . ILE D 2 43  ? -2.268  26.252  54.063 1.00 15.73 ? 43  ILE B CA    1 
ATOM   2120 C  C     . ILE D 2 43  ? -2.262  26.862  52.684 1.00 17.82 ? 43  ILE B C     1 
ATOM   2121 O  O     . ILE D 2 43  ? -2.785  27.949  52.477 1.00 20.34 ? 43  ILE B O     1 
ATOM   2122 C  CB    . ILE D 2 43  ? -3.711  26.185  54.587 1.00 14.16 ? 43  ILE B CB    1 
ATOM   2123 C  CG1   . ILE D 2 43  ? -3.724  25.697  56.030 1.00 11.82 ? 43  ILE B CG1   1 
ATOM   2124 C  CG2   . ILE D 2 43  ? -4.575  25.297  53.696 1.00 9.10  ? 43  ILE B CG2   1 
ATOM   2125 C  CD1   . ILE D 2 43  ? -5.042  25.938  56.741 1.00 13.67 ? 43  ILE B CD1   1 
ATOM   2126 N  N     . SER D 2 44  ? -1.680  26.151  51.731 1.00 18.89 ? 44  SER B N     1 
ATOM   2127 C  CA    . SER D 2 44  ? -1.603  26.638  50.361 1.00 20.28 ? 44  SER B CA    1 
ATOM   2128 C  C     . SER D 2 44  ? -3.000  26.872  49.728 1.00 21.84 ? 44  SER B C     1 
ATOM   2129 O  O     . SER D 2 44  ? -3.918  26.084  49.923 1.00 22.59 ? 44  SER B O     1 
ATOM   2130 C  CB    . SER D 2 44  ? -0.769  25.670  49.514 1.00 19.81 ? 44  SER B CB    1 
ATOM   2131 O  OG    . SER D 2 44  ? -1.518  24.509  49.166 1.00 20.23 ? 44  SER B OG    1 
ATOM   2132 N  N     . PRO D 2 45  ? -3.139  27.929  48.913 1.00 23.23 ? 45  PRO B N     1 
ATOM   2133 C  CA    . PRO D 2 45  ? -4.423  28.162  48.234 1.00 23.84 ? 45  PRO B CA    1 
ATOM   2134 C  C     . PRO D 2 45  ? -4.929  26.954  47.415 1.00 24.53 ? 45  PRO B C     1 
ATOM   2135 O  O     . PRO D 2 45  ? -6.133  26.670  47.427 1.00 26.39 ? 45  PRO B O     1 
ATOM   2136 C  CB    . PRO D 2 45  ? -4.130  29.353  47.308 1.00 23.75 ? 45  PRO B CB    1 
ATOM   2137 C  CG    . PRO D 2 45  ? -2.921  30.008  47.889 1.00 24.50 ? 45  PRO B CG    1 
ATOM   2138 C  CD    . PRO D 2 45  ? -2.115  28.912  48.527 1.00 22.93 ? 45  PRO B CD    1 
ATOM   2139 N  N     . GLN D 2 46  ? -4.037  26.265  46.702 1.00 23.84 ? 46  GLN B N     1 
ATOM   2140 C  CA    . GLN D 2 46  ? -4.445  25.130  45.850 1.00 24.06 ? 46  GLN B CA    1 
ATOM   2141 C  C     . GLN D 2 46  ? -5.135  24.044  46.659 1.00 23.17 ? 46  GLN B C     1 
ATOM   2142 O  O     . GLN D 2 46  ? -6.083  23.418  46.186 1.00 24.15 ? 46  GLN B O     1 
ATOM   2143 C  CB    . GLN D 2 46  ? -3.249  24.518  45.118 1.00 24.03 ? 46  GLN B CB    1 
ATOM   2144 C  CG    . GLN D 2 46  ? -2.450  25.505  44.274 1.00 30.76 ? 46  GLN B CG    1 
ATOM   2145 C  CD    . GLN D 2 46  ? -1.316  26.151  45.057 1.00 35.70 ? 46  GLN B CD    1 
ATOM   2146 O  OE1   . GLN D 2 46  ? -1.546  27.007  45.924 1.00 33.45 ? 46  GLN B OE1   1 
ATOM   2147 N  NE2   . GLN D 2 46  ? -0.086  25.702  44.793 1.00 36.25 ? 46  GLN B NE2   1 
ATOM   2148 N  N     . ALA D 2 47  ? -4.660  23.839  47.885 1.00 20.86 ? 47  ALA B N     1 
ATOM   2149 C  CA    . ALA D 2 47  ? -5.169  22.797  48.737 1.00 19.84 ? 47  ALA B CA    1 
ATOM   2150 C  C     . ALA D 2 47  ? -6.439  23.229  49.446 1.00 19.56 ? 47  ALA B C     1 
ATOM   2151 O  O     . ALA D 2 47  ? -7.331  22.417  49.666 1.00 20.23 ? 47  ALA B O     1 
ATOM   2152 C  CB    . ALA D 2 47  ? -4.128  22.381  49.739 1.00 19.94 ? 47  ALA B CB    1 
ATOM   2153 N  N     . MET D 2 48  ? -6.506  24.497  49.838 1.00 18.63 ? 48  MET B N     1 
ATOM   2154 C  CA    . MET D 2 48  ? -7.744  25.069  50.384 1.00 17.34 ? 48  MET B CA    1 
ATOM   2155 C  C     . MET D 2 48  ? -8.895  25.052  49.358 1.00 17.34 ? 48  MET B C     1 
ATOM   2156 O  O     . MET D 2 48  ? -10.048 24.826  49.719 1.00 16.88 ? 48  MET B O     1 
ATOM   2157 C  CB    . MET D 2 48  ? -7.506  26.493  50.871 1.00 16.97 ? 48  MET B CB    1 
ATOM   2158 C  CG    . MET D 2 48  ? -8.294  26.882  52.100 1.00 17.57 ? 48  MET B CG    1 
ATOM   2159 S  SD    . MET D 2 48  ? -8.014  28.615  52.537 1.00 20.65 ? 48  MET B SD    1 
ATOM   2160 C  CE    . MET D 2 48  ? -6.641  28.473  53.685 1.00 15.95 ? 48  MET B CE    1 
ATOM   2161 N  N     . ALA D 2 49  ? -8.592  25.322  48.092 1.00 16.58 ? 49  ALA B N     1 
ATOM   2162 C  CA    . ALA D 2 49  ? -9.613  25.214  47.051 1.00 18.13 ? 49  ALA B CA    1 
ATOM   2163 C  C     . ALA D 2 49  ? -10.261 23.856  47.117 1.00 19.60 ? 49  ALA B C     1 
ATOM   2164 O  O     . ALA D 2 49  ? -11.396 23.686  46.671 1.00 20.05 ? 49  ALA B O     1 
ATOM   2165 C  CB    . ALA D 2 49  ? -9.020  25.438  45.666 1.00 17.01 ? 49  ALA B CB    1 
ATOM   2166 N  N     . ILE D 2 50  ? -9.515  22.874  47.632 1.00 21.01 ? 50  ILE B N     1 
ATOM   2167 C  CA    . ILE D 2 50  ? -9.924  21.471  47.558 1.00 21.20 ? 50  ILE B CA    1 
ATOM   2168 C  C     . ILE D 2 50  ? -10.733 21.013  48.785 1.00 21.45 ? 50  ILE B C     1 
ATOM   2169 O  O     . ILE D 2 50  ? -11.894 20.626  48.658 1.00 22.88 ? 50  ILE B O     1 
ATOM   2170 C  CB    . ILE D 2 50  ? -8.717  20.539  47.278 1.00 20.30 ? 50  ILE B CB    1 
ATOM   2171 C  CG1   . ILE D 2 50  ? -8.356  20.607  45.794 1.00 20.61 ? 50  ILE B CG1   1 
ATOM   2172 C  CG2   . ILE D 2 50  ? -9.046  19.109  47.661 1.00 22.39 ? 50  ILE B CG2   1 
ATOM   2173 C  CD1   . ILE D 2 50  ? -6.953  20.150  45.464 1.00 18.10 ? 50  ILE B CD1   1 
ATOM   2174 N  N     . HIS D 2 51  ? -10.153 21.151  49.972 1.00 21.22 ? 51  HIS B N     1 
ATOM   2175 C  CA    . HIS D 2 51  ? -10.830 20.764  51.216 1.00 21.27 ? 51  HIS B CA    1 
ATOM   2176 C  C     . HIS D 2 51  ? -11.550 21.943  51.894 1.00 21.22 ? 51  HIS B C     1 
ATOM   2177 O  O     . HIS D 2 51  ? -12.377 21.751  52.798 1.00 21.82 ? 51  HIS B O     1 
ATOM   2178 C  CB    . HIS D 2 51  ? -9.833  20.116  52.193 1.00 20.37 ? 51  HIS B CB    1 
ATOM   2179 C  CG    . HIS D 2 51  ? -8.629  20.963  52.488 1.00 21.05 ? 51  HIS B CG    1 
ATOM   2180 N  ND1   . HIS D 2 51  ? -8.719  22.222  53.051 1.00 19.61 ? 51  HIS B ND1   1 
ATOM   2181 C  CD2   . HIS D 2 51  ? -7.306  20.693  52.382 1.00 19.81 ? 51  HIS B CD2   1 
ATOM   2182 C  CE1   . HIS D 2 51  ? -7.504  22.703  53.238 1.00 21.79 ? 51  HIS B CE1   1 
ATOM   2183 N  NE2   . HIS D 2 51  ? -6.629  21.778  52.883 1.00 21.34 ? 51  HIS B NE2   1 
ATOM   2184 N  N     . ARG D 2 52  ? -11.159 23.156  51.528 1.00 19.59 ? 52  ARG B N     1 
ATOM   2185 C  CA    . ARG D 2 52  ? -11.867 24.345  51.976 1.00 20.43 ? 52  ARG B CA    1 
ATOM   2186 C  C     . ARG D 2 52  ? -11.781 24.552  53.483 1.00 19.29 ? 52  ARG B C     1 
ATOM   2187 O  O     . ARG D 2 52  ? -12.627 25.214  54.059 1.00 19.05 ? 52  ARG B O     1 
ATOM   2188 C  CB    . ARG D 2 52  ? -13.332 24.291  51.529 1.00 21.43 ? 52  ARG B CB    1 
ATOM   2189 C  CG    . ARG D 2 52  ? -13.497 24.024  50.022 1.00 24.05 ? 52  ARG B CG    1 
ATOM   2190 C  CD    . ARG D 2 52  ? -14.888 24.386  49.533 1.00 37.19 ? 52  ARG B CD    1 
ATOM   2191 N  NE    . ARG D 2 52  ? -14.893 24.802  48.125 1.00 45.53 ? 52  ARG B NE    1 
ATOM   2192 C  CZ    . ARG D 2 52  ? -15.462 25.922  47.674 1.00 47.53 ? 52  ARG B CZ    1 
ATOM   2193 N  NH1   . ARG D 2 52  ? -16.088 26.746  48.514 1.00 48.94 ? 52  ARG B NH1   1 
ATOM   2194 N  NH2   . ARG D 2 52  ? -15.414 26.215  46.383 1.00 45.42 ? 52  ARG B NH2   1 
ATOM   2195 N  N     . ILE D 2 53  ? -10.750 23.984  54.108 1.00 17.71 ? 53  ILE B N     1 
ATOM   2196 C  CA    . ILE D 2 53  ? -10.405 24.310  55.484 1.00 16.06 ? 53  ILE B CA    1 
ATOM   2197 C  C     . ILE D 2 53  ? -9.545  25.568  55.591 1.00 15.04 ? 53  ILE B C     1 
ATOM   2198 O  O     . ILE D 2 53  ? -8.528  25.706  54.916 1.00 15.61 ? 53  ILE B O     1 
ATOM   2199 C  CB    . ILE D 2 53  ? -9.684  23.137  56.156 1.00 16.33 ? 53  ILE B CB    1 
ATOM   2200 C  CG1   . ILE D 2 53  ? -10.547 21.867  56.051 1.00 18.44 ? 53  ILE B CG1   1 
ATOM   2201 C  CG2   . ILE D 2 53  ? -9.363  23.471  57.614 1.00 11.40 ? 53  ILE B CG2   1 
ATOM   2202 C  CD1   . ILE D 2 53  ? -9.770  20.535  56.265 1.00 15.63 ? 53  ILE B CD1   1 
ATOM   2203 N  N     . THR D 2 54  ? -9.941  26.476  56.460 1.00 13.71 ? 54  THR B N     1 
ATOM   2204 C  CA    . THR D 2 54  ? -9.282  27.766  56.533 1.00 13.45 ? 54  THR B CA    1 
ATOM   2205 C  C     . THR D 2 54  ? -8.357  27.838  57.741 1.00 13.74 ? 54  THR B C     1 
ATOM   2206 O  O     . THR D 2 54  ? -8.475  27.045  58.676 1.00 13.91 ? 54  THR B O     1 
ATOM   2207 C  CB    . THR D 2 54  ? -10.299 28.915  56.629 1.00 13.67 ? 54  THR B CB    1 
ATOM   2208 O  OG1   . THR D 2 54  ? -11.090 28.748  57.815 1.00 10.77 ? 54  THR B OG1   1 
ATOM   2209 C  CG2   . THR D 2 54  ? -11.186 28.959  55.391 1.00 9.84  ? 54  THR B CG2   1 
ATOM   2210 N  N     . GLU D 2 55  ? -7.469  28.825  57.736 1.00 13.50 ? 55  GLU B N     1 
ATOM   2211 C  CA    . GLU D 2 55  ? -6.537  29.021  58.843 1.00 13.57 ? 55  GLU B CA    1 
ATOM   2212 C  C     . GLU D 2 55  ? -7.281  29.203  60.144 1.00 13.68 ? 55  GLU B C     1 
ATOM   2213 O  O     . GLU D 2 55  ? -6.946  28.586  61.147 1.00 16.44 ? 55  GLU B O     1 
ATOM   2214 C  CB    . GLU D 2 55  ? -5.606  30.220  58.569 1.00 13.05 ? 55  GLU B CB    1 
ATOM   2215 C  CG    . GLU D 2 55  ? -4.691  30.041  57.330 1.00 12.48 ? 55  GLU B CG    1 
ATOM   2216 C  CD    . GLU D 2 55  ? -3.465  29.144  57.603 1.00 13.81 ? 55  GLU B CD    1 
ATOM   2217 O  OE1   . GLU D 2 55  ? -3.301  28.679  58.754 1.00 13.51 ? 55  GLU B OE1   1 
ATOM   2218 O  OE2   . GLU D 2 55  ? -2.637  28.951  56.682 1.00 16.40 ? 55  GLU B OE2   1 
ATOM   2219 N  N     . ALA D 2 56  ? -8.345  29.994  60.113 1.00 15.56 ? 56  ALA B N     1 
ATOM   2220 C  CA    . ALA D 2 56  ? -9.142  30.243  61.324 1.00 15.94 ? 56  ALA B CA    1 
ATOM   2221 C  C     . ALA D 2 56  ? -9.750  28.957  61.898 1.00 16.11 ? 56  ALA B C     1 
ATOM   2222 O  O     . ALA D 2 56  ? -9.947  28.846  63.111 1.00 16.04 ? 56  ALA B O     1 
ATOM   2223 C  CB    . ALA D 2 56  ? -10.227 31.272  61.047 1.00 15.40 ? 56  ALA B CB    1 
ATOM   2224 N  N     . MET D 2 57  ? -9.977  27.968  61.032 1.00 16.13 ? 57  MET B N     1 
ATOM   2225 C  CA    . MET D 2 57  ? -10.587 26.698  61.457 1.00 16.89 ? 57  MET B CA    1 
ATOM   2226 C  C     . MET D 2 57  ? -9.611  25.806  62.187 1.00 17.29 ? 57  MET B C     1 
ATOM   2227 O  O     . MET D 2 57  ? -10.022 24.914  62.927 1.00 17.58 ? 57  MET B O     1 
ATOM   2228 C  CB    . MET D 2 57  ? -11.172 25.925  60.275 1.00 16.64 ? 57  MET B CB    1 
ATOM   2229 C  CG    . MET D 2 57  ? -12.516 26.436  59.790 1.00 16.03 ? 57  MET B CG    1 
ATOM   2230 S  SD    . MET D 2 57  ? -12.923 25.791  58.158 1.00 16.72 ? 57  MET B SD    1 
ATOM   2231 C  CE    . MET D 2 57  ? -13.432 24.124  58.576 1.00 13.40 ? 57  MET B CE    1 
ATOM   2232 N  N     . VAL D 2 58  ? -8.319  25.995  61.946 1.00 17.66 ? 58  VAL B N     1 
ATOM   2233 C  CA    . VAL D 2 58  ? -7.341  25.107  62.560 1.00 17.93 ? 58  VAL B CA    1 
ATOM   2234 C  C     . VAL D 2 58  ? -6.410  25.802  63.553 1.00 19.57 ? 58  VAL B C     1 
ATOM   2235 O  O     . VAL D 2 58  ? -5.543  25.148  64.147 1.00 21.11 ? 58  VAL B O     1 
ATOM   2236 C  CB    . VAL D 2 58  ? -6.519  24.319  61.515 1.00 16.49 ? 58  VAL B CB    1 
ATOM   2237 C  CG1   . VAL D 2 58  ? -7.424  23.491  60.625 1.00 12.79 ? 58  VAL B CG1   1 
ATOM   2238 C  CG2   . VAL D 2 58  ? -5.698  25.257  60.697 1.00 18.61 ? 58  VAL B CG2   1 
ATOM   2239 N  N     . ALA D 2 59  ? -6.642  27.095  63.792 1.00 19.42 ? 59  ALA B N     1 
ATOM   2240 C  CA    . ALA D 2 59  ? -5.718  27.923  64.578 1.00 20.58 ? 59  ALA B CA    1 
ATOM   2241 C  C     . ALA D 2 59  ? -5.744  27.636  66.076 1.00 20.98 ? 59  ALA B C     1 
ATOM   2242 O  O     . ALA D 2 59  ? -4.768  27.887  66.778 1.00 21.68 ? 59  ALA B O     1 
ATOM   2243 C  CB    . ALA D 2 59  ? -5.959  29.423  64.311 1.00 19.97 ? 59  ALA B CB    1 
ATOM   2244 N  N     . ASP D 2 60  ? -6.873  27.165  66.579 1.00 21.70 ? 60  ASP B N     1 
ATOM   2245 C  CA    . ASP D 2 60  ? -6.964  26.827  67.988 1.00 23.13 ? 60  ASP B CA    1 
ATOM   2246 C  C     . ASP D 2 60  ? -7.011  25.311  68.206 1.00 22.78 ? 60  ASP B C     1 
ATOM   2247 O  O     . ASP D 2 60  ? -7.637  24.840  69.153 1.00 25.03 ? 60  ASP B O     1 
ATOM   2248 C  CB    . ASP D 2 60  ? -8.191  27.492  68.620 1.00 24.33 ? 60  ASP B CB    1 
ATOM   2249 C  CG    . ASP D 2 60  ? -9.514  27.016  67.996 1.00 30.90 ? 60  ASP B CG    1 
ATOM   2250 O  OD1   . ASP D 2 60  ? -9.508  26.588  66.809 1.00 32.70 ? 60  ASP B OD1   1 
ATOM   2251 O  OD2   . ASP D 2 60  ? -10.559 27.075  68.696 1.00 33.90 ? 60  ASP B OD2   1 
ATOM   2252 N  N     . LYS D 2 61  ? -6.388  24.552  67.306 1.00 21.30 ? 61  LYS B N     1 
ATOM   2253 C  CA    . LYS D 2 61  ? -6.435  23.086  67.358 1.00 19.84 ? 61  LYS B CA    1 
ATOM   2254 C  C     . LYS D 2 61  ? -5.100  22.516  67.819 1.00 19.14 ? 61  LYS B C     1 
ATOM   2255 O  O     . LYS D 2 61  ? -4.128  23.246  67.970 1.00 20.92 ? 61  LYS B O     1 
ATOM   2256 C  CB    . LYS D 2 61  ? -6.793  22.502  65.983 1.00 19.76 ? 61  LYS B CB    1 
ATOM   2257 C  CG    . LYS D 2 61  ? -8.109  22.982  65.407 1.00 19.06 ? 61  LYS B CG    1 
ATOM   2258 C  CD    . LYS D 2 61  ? -9.282  22.366  66.145 1.00 24.09 ? 61  LYS B CD    1 
ATOM   2259 C  CE    . LYS D 2 61  ? -10.587 23.034  65.742 1.00 26.42 ? 61  LYS B CE    1 
ATOM   2260 N  NZ    . LYS D 2 61  ? -11.459 23.308  66.917 1.00 28.87 ? 61  LYS B NZ    1 
ATOM   2261 N  N     . PRO D 2 62  ? -5.030  21.194  67.988 1.00 19.45 ? 62  PRO B N     1 
ATOM   2262 C  CA    . PRO D 2 62  ? -3.771  20.623  68.480 1.00 18.65 ? 62  PRO B CA    1 
ATOM   2263 C  C     . PRO D 2 62  ? -2.831  20.280  67.338 1.00 17.91 ? 62  PRO B C     1 
ATOM   2264 O  O     . PRO D 2 62  ? -3.256  20.159  66.192 1.00 18.77 ? 62  PRO B O     1 
ATOM   2265 C  CB    . PRO D 2 62  ? -4.216  19.334  69.206 1.00 19.25 ? 62  PRO B CB    1 
ATOM   2266 C  CG    . PRO D 2 62  ? -5.719  19.462  69.369 1.00 19.74 ? 62  PRO B CG    1 
ATOM   2267 C  CD    . PRO D 2 62  ? -6.165  20.277  68.183 1.00 19.02 ? 62  PRO B CD    1 
ATOM   2268 N  N     . TRP D 2 63  ? -1.546  20.208  67.638 1.00 17.92 ? 63  TRP B N     1 
ATOM   2269 C  CA    . TRP D 2 63  ? -0.566  19.756  66.663 1.00 18.70 ? 63  TRP B CA    1 
ATOM   2270 C  C     . TRP D 2 63  ? -0.776  18.278  66.376 1.00 17.34 ? 63  TRP B C     1 
ATOM   2271 O  O     . TRP D 2 63  ? -1.157  17.528  67.265 1.00 18.32 ? 63  TRP B O     1 
ATOM   2272 C  CB    . TRP D 2 63  ? 0.850   19.973  67.206 1.00 19.84 ? 63  TRP B CB    1 
ATOM   2273 C  CG    . TRP D 2 63  ? 1.130   21.384  67.635 1.00 20.83 ? 63  TRP B CG    1 
ATOM   2274 C  CD1   . TRP D 2 63  ? 1.215   21.849  68.917 1.00 20.89 ? 63  TRP B CD1   1 
ATOM   2275 C  CD2   . TRP D 2 63  ? 1.311   22.525  66.780 1.00 21.32 ? 63  TRP B CD2   1 
ATOM   2276 N  NE1   . TRP D 2 63  ? 1.489   23.203  68.909 1.00 22.53 ? 63  TRP B NE1   1 
ATOM   2277 C  CE2   . TRP D 2 63  ? 1.548   23.637  67.610 1.00 20.29 ? 63  TRP B CE2   1 
ATOM   2278 C  CE3   . TRP D 2 63  ? 1.291   22.711  65.396 1.00 23.21 ? 63  TRP B CE3   1 
ATOM   2279 C  CZ2   . TRP D 2 63  ? 1.788   24.906  67.100 1.00 21.86 ? 63  TRP B CZ2   1 
ATOM   2280 C  CZ3   . TRP D 2 63  ? 1.537   23.977  64.891 1.00 23.92 ? 63  TRP B CZ3   1 
ATOM   2281 C  CH2   . TRP D 2 63  ? 1.777   25.057  65.740 1.00 20.86 ? 63  TRP B CH2   1 
ATOM   2282 N  N     . ILE D 2 64  ? -0.481  17.862  65.151 1.00 17.14 ? 64  ILE B N     1 
ATOM   2283 C  CA    . ILE D 2 64  ? -0.594  16.460  64.757 1.00 18.12 ? 64  ILE B CA    1 
ATOM   2284 C  C     . ILE D 2 64  ? 0.024   15.483  65.761 1.00 18.63 ? 64  ILE B C     1 
ATOM   2285 O  O     . ILE D 2 64  ? -0.524  14.416  66.010 1.00 19.50 ? 64  ILE B O     1 
ATOM   2286 C  CB    . ILE D 2 64  ? -0.004  16.216  63.361 1.00 19.04 ? 64  ILE B CB    1 
ATOM   2287 C  CG1   . ILE D 2 64  ? -0.338  14.801  62.879 1.00 19.96 ? 64  ILE B CG1   1 
ATOM   2288 C  CG2   . ILE D 2 64  ? 1.501   16.484  63.348 1.00 16.81 ? 64  ILE B CG2   1 
ATOM   2289 C  CD1   . ILE D 2 64  ? -1.821  14.533  62.815 1.00 23.87 ? 64  ILE B CD1   1 
ATOM   2290 N  N     . GLU D 2 65  ? 1.122   15.889  66.387 1.00 19.98 ? 65  GLU B N     1 
ATOM   2291 C  CA    . GLU D 2 65  ? 1.800   15.064  67.375 1.00 21.04 ? 65  GLU B CA    1 
ATOM   2292 C  C     . GLU D 2 65  ? 0.861   14.710  68.517 1.00 21.50 ? 65  GLU B C     1 
ATOM   2293 O  O     . GLU D 2 65  ? 1.051   13.706  69.197 1.00 21.47 ? 65  GLU B O     1 
ATOM   2294 C  CB    . GLU D 2 65  ? 3.030   15.797  67.920 1.00 22.03 ? 65  GLU B CB    1 
ATOM   2295 C  CG    . GLU D 2 65  ? 4.237   15.818  66.961 1.00 28.23 ? 65  GLU B CG    1 
ATOM   2296 C  CD    . GLU D 2 65  ? 4.100   16.828  65.799 1.00 32.64 ? 65  GLU B CD    1 
ATOM   2297 O  OE1   . GLU D 2 65  ? 4.862   16.683  64.808 1.00 34.75 ? 65  GLU B OE1   1 
ATOM   2298 O  OE2   . GLU D 2 65  ? 3.265   17.765  65.883 1.00 23.89 ? 65  GLU B OE2   1 
ATOM   2299 N  N     . ASP D 2 66  ? -0.123  15.563  68.760 1.00 22.11 ? 66  ASP B N     1 
ATOM   2300 C  CA    . ASP D 2 66  ? -0.960  15.423  69.938 1.00 24.19 ? 66  ASP B CA    1 
ATOM   2301 C  C     . ASP D 2 66  ? -2.301  14.802  69.594 1.00 24.22 ? 66  ASP B C     1 
ATOM   2302 O  O     . ASP D 2 66  ? -3.040  14.392  70.479 1.00 25.13 ? 66  ASP B O     1 
ATOM   2303 C  CB    . ASP D 2 66  ? -1.163  16.773  70.622 1.00 25.50 ? 66  ASP B CB    1 
ATOM   2304 C  CG    . ASP D 2 66  ? 0.132   17.333  71.213 1.00 30.91 ? 66  ASP B CG    1 
ATOM   2305 O  OD1   . ASP D 2 66  ? 0.563   16.842  72.282 1.00 34.50 ? 66  ASP B OD1   1 
ATOM   2306 O  OD2   . ASP D 2 66  ? 0.703   18.275  70.617 1.00 33.94 ? 66  ASP B OD2   1 
ATOM   2307 N  N     . VAL D 2 67  ? -2.619  14.740  68.305 1.00 23.95 ? 67  VAL B N     1 
ATOM   2308 C  CA    . VAL D 2 67  ? -3.846  14.084  67.879 1.00 24.81 ? 67  VAL B CA    1 
ATOM   2309 C  C     . VAL D 2 67  ? -3.596  12.663  67.396 1.00 23.17 ? 67  VAL B C     1 
ATOM   2310 O  O     . VAL D 2 67  ? -4.416  11.784  67.624 1.00 23.29 ? 67  VAL B O     1 
ATOM   2311 C  CB    . VAL D 2 67  ? -4.605  14.881  66.790 1.00 25.05 ? 67  VAL B CB    1 
ATOM   2312 C  CG1   . VAL D 2 67  ? -4.407  16.360  66.986 1.00 23.81 ? 67  VAL B CG1   1 
ATOM   2313 C  CG2   . VAL D 2 67  ? -4.161  14.452  65.407 1.00 25.66 ? 67  VAL B CG2   1 
ATOM   2314 N  N     . ILE D 2 68  ? -2.452  12.436  66.759 1.00 21.49 ? 68  ILE B N     1 
ATOM   2315 C  CA    . ILE D 2 68  ? -2.196  11.150  66.111 1.00 21.29 ? 68  ILE B CA    1 
ATOM   2316 C  C     . ILE D 2 68  ? -2.389  9.927   67.023 1.00 20.72 ? 68  ILE B C     1 
ATOM   2317 O  O     . ILE D 2 68  ? -2.817  8.879   66.550 1.00 21.39 ? 68  ILE B O     1 
ATOM   2318 C  CB    . ILE D 2 68  ? -0.814  11.093  65.416 1.00 20.56 ? 68  ILE B CB    1 
ATOM   2319 C  CG1   . ILE D 2 68  ? -0.701  9.823   64.580 1.00 21.68 ? 68  ILE B CG1   1 
ATOM   2320 C  CG2   . ILE D 2 68  ? 0.306   11.146  66.434 1.00 18.46 ? 68  ILE B CG2   1 
ATOM   2321 C  CD1   . ILE D 2 68  ? -1.593  9.803   63.366 1.00 19.05 ? 68  ILE B CD1   1 
ATOM   2322 N  N     . PRO D 2 69  ? -2.120  10.067  68.338 1.00 20.34 ? 69  PRO B N     1 
ATOM   2323 C  CA    . PRO D 2 69  ? -2.218  8.884   69.194 1.00 22.28 ? 69  PRO B CA    1 
ATOM   2324 C  C     . PRO D 2 69  ? -3.655  8.426   69.432 1.00 22.11 ? 69  PRO B C     1 
ATOM   2325 O  O     . PRO D 2 69  ? -3.876  7.357   69.979 1.00 23.58 ? 69  PRO B O     1 
ATOM   2326 C  CB    . PRO D 2 69  ? -1.582  9.351   70.513 1.00 22.56 ? 69  PRO B CB    1 
ATOM   2327 C  CG    . PRO D 2 69  ? -0.667  10.450  70.105 1.00 20.54 ? 69  PRO B CG    1 
ATOM   2328 C  CD    . PRO D 2 69  ? -1.430  11.166  69.027 1.00 20.79 ? 69  PRO B CD    1 
ATOM   2329 N  N     . HIS D 2 70  ? -4.619  9.250   69.063 1.00 21.32 ? 70  HIS B N     1 
ATOM   2330 C  CA    . HIS D 2 70  ? -6.002  8.842   69.127 1.00 20.77 ? 70  HIS B CA    1 
ATOM   2331 C  C     . HIS D 2 70  ? -6.286  7.772   68.087 1.00 18.85 ? 70  HIS B C     1 
ATOM   2332 O  O     . HIS D 2 70  ? -7.319  7.125   68.120 1.00 17.86 ? 70  HIS B O     1 
ATOM   2333 C  CB    . HIS D 2 70  ? -6.922  10.053  68.946 1.00 21.24 ? 70  HIS B CB    1 
ATOM   2334 C  CG    . HIS D 2 70  ? -6.766  11.083  70.023 1.00 28.92 ? 70  HIS B CG    1 
ATOM   2335 N  ND1   . HIS D 2 70  ? -6.968  12.431  69.807 1.00 30.00 ? 70  HIS B ND1   1 
ATOM   2336 C  CD2   . HIS D 2 70  ? -6.365  10.966  71.314 1.00 31.66 ? 70  HIS B CD2   1 
ATOM   2337 C  CE1   . HIS D 2 70  ? -6.727  13.094  70.925 1.00 31.15 ? 70  HIS B CE1   1 
ATOM   2338 N  NE2   . HIS D 2 70  ? -6.361  12.228  71.854 1.00 32.46 ? 70  HIS B NE2   1 
ATOM   2339 N  N     . TYR D 2 71  ? -5.351  7.579   67.169 1.00 18.65 ? 71  TYR B N     1 
ATOM   2340 C  CA    . TYR D 2 71  ? -5.597  6.718   66.011 1.00 17.56 ? 71  TYR B CA    1 
ATOM   2341 C  C     . TYR D 2 71  ? -4.782  5.434   66.133 1.00 17.89 ? 71  TYR B C     1 
ATOM   2342 O  O     . TYR D 2 71  ? -4.888  4.537   65.304 1.00 17.79 ? 71  TYR B O     1 
ATOM   2343 C  CB    . TYR D 2 71  ? -5.289  7.471   64.705 1.00 15.41 ? 71  TYR B CB    1 
ATOM   2344 C  CG    . TYR D 2 71  ? -6.226  8.636   64.472 1.00 14.61 ? 71  TYR B CG    1 
ATOM   2345 C  CD1   . TYR D 2 71  ? -7.384  8.475   63.725 1.00 12.49 ? 71  TYR B CD1   1 
ATOM   2346 C  CD2   . TYR D 2 71  ? -6.018  9.867   65.101 1.00 14.16 ? 71  TYR B CD2   1 
ATOM   2347 C  CE1   . TYR D 2 71  ? -8.293  9.505   63.564 1.00 8.62  ? 71  TYR B CE1   1 
ATOM   2348 C  CE2   . TYR D 2 71  ? -6.946  10.908  64.960 1.00 14.37 ? 71  TYR B CE2   1 
ATOM   2349 C  CZ    . TYR D 2 71  ? -8.088  10.700  64.204 1.00 14.77 ? 71  TYR B CZ    1 
ATOM   2350 O  OH    . TYR D 2 71  ? -9.008  11.703  64.041 1.00 23.02 ? 71  TYR B OH    1 
ATOM   2351 N  N     . TYR D 2 72  ? -4.023  5.336   67.222 1.00 19.06 ? 72  TYR B N     1 
ATOM   2352 C  CA    . TYR D 2 72  ? -3.190  4.180   67.492 1.00 20.34 ? 72  TYR B CA    1 
ATOM   2353 C  C     . TYR D 2 72  ? -4.052  2.977   67.812 1.00 21.52 ? 72  TYR B C     1 
ATOM   2354 O  O     . TYR D 2 72  ? -5.180  3.120   68.269 1.00 22.43 ? 72  TYR B O     1 
ATOM   2355 C  CB    . TYR D 2 72  ? -2.283  4.451   68.690 1.00 20.30 ? 72  TYR B CB    1 
ATOM   2356 C  CG    . TYR D 2 72  ? -1.132  5.389   68.419 1.00 20.32 ? 72  TYR B CG    1 
ATOM   2357 C  CD1   . TYR D 2 72  ? -0.934  5.945   67.164 1.00 18.51 ? 72  TYR B CD1   1 
ATOM   2358 C  CD2   . TYR D 2 72  ? -0.264  5.753   69.441 1.00 24.02 ? 72  TYR B CD2   1 
ATOM   2359 C  CE1   . TYR D 2 72  ? 0.112   6.816   66.925 1.00 15.63 ? 72  TYR B CE1   1 
ATOM   2360 C  CE2   . TYR D 2 72  ? 0.784   6.619   69.212 1.00 22.91 ? 72  TYR B CE2   1 
ATOM   2361 C  CZ    . TYR D 2 72  ? 0.973   7.140   67.951 1.00 21.57 ? 72  TYR B CZ    1 
ATOM   2362 O  OH    . TYR D 2 72  ? 2.020   8.011   67.731 1.00 25.01 ? 72  TYR B OH    1 
ATOM   2363 N  N     . GLY D 2 73  ? -3.484  1.789   67.656 1.00 22.24 ? 73  GLY B N     1 
ATOM   2364 C  CA    . GLY D 2 73  ? -4.077  0.595   68.229 1.00 21.80 ? 73  GLY B CA    1 
ATOM   2365 C  C     . GLY D 2 73  ? -4.786  -0.305  67.237 1.00 22.22 ? 73  GLY B C     1 
ATOM   2366 O  O     . GLY D 2 73  ? -5.341  -1.325  67.622 1.00 24.61 ? 73  GLY B O     1 
ATOM   2367 N  N     . SER D 2 74  ? -4.789  0.062   65.962 1.00 22.35 ? 74  SER B N     1 
ATOM   2368 C  CA    . SER D 2 74  ? -5.199  -0.886  64.940 1.00 22.27 ? 74  SER B CA    1 
ATOM   2369 C  C     . SER D 2 74  ? -4.003  -1.626  64.408 1.00 23.48 ? 74  SER B C     1 
ATOM   2370 O  O     . SER D 2 74  ? -2.916  -1.057  64.275 1.00 24.12 ? 74  SER B O     1 
ATOM   2371 C  CB    . SER D 2 74  ? -5.917  -0.202  63.783 1.00 23.31 ? 74  SER B CB    1 
ATOM   2372 O  OG    . SER D 2 74  ? -6.272  -1.157  62.792 1.00 19.10 ? 74  SER B OG    1 
ATOM   2373 N  N     . GLU D 2 75  ? -4.219  -2.886  64.051 1.00 23.59 ? 75  GLU B N     1 
ATOM   2374 C  CA    . GLU D 2 75  ? -3.206  -3.671  63.382 1.00 23.41 ? 75  GLU B CA    1 
ATOM   2375 C  C     . GLU D 2 75  ? -2.980  -3.091  62.005 1.00 21.32 ? 75  GLU B C     1 
ATOM   2376 O  O     . GLU D 2 75  ? -1.856  -2.949  61.556 1.00 21.97 ? 75  GLU B O     1 
ATOM   2377 C  CB    . GLU D 2 75  ? -3.671  -5.121  63.256 1.00 25.41 ? 75  GLU B CB    1 
ATOM   2378 C  CG    . GLU D 2 75  ? -2.552  -6.150  63.358 1.00 32.99 ? 75  GLU B CG    1 
ATOM   2379 C  CD    . GLU D 2 75  ? -3.036  -7.477  63.927 1.00 43.05 ? 75  GLU B CD    1 
ATOM   2380 O  OE1   . GLU D 2 75  ? -2.914  -8.512  63.224 1.00 42.03 ? 75  GLU B OE1   1 
ATOM   2381 O  OE2   . GLU D 2 75  ? -3.560  -7.475  65.073 1.00 47.00 ? 75  GLU B OE2   1 
ATOM   2382 N  N     . TRP D 2 76  ? -4.066  -2.755  61.329 1.00 19.42 ? 76  TRP B N     1 
ATOM   2383 C  CA    . TRP D 2 76  ? -3.993  -2.456  59.923 1.00 16.01 ? 76  TRP B CA    1 
ATOM   2384 C  C     . TRP D 2 76  ? -4.481  -1.040  59.651 1.00 14.72 ? 76  TRP B C     1 
ATOM   2385 O  O     . TRP D 2 76  ? -5.496  -0.609  60.186 1.00 13.95 ? 76  TRP B O     1 
ATOM   2386 C  CB    . TRP D 2 76  ? -4.789  -3.493  59.122 1.00 14.69 ? 76  TRP B CB    1 
ATOM   2387 C  CG    . TRP D 2 76  ? -4.411  -4.949  59.455 1.00 16.85 ? 76  TRP B CG    1 
ATOM   2388 C  CD1   . TRP D 2 76  ? -5.132  -5.832  60.224 1.00 15.47 ? 76  TRP B CD1   1 
ATOM   2389 C  CD2   . TRP D 2 76  ? -3.219  -5.658  59.051 1.00 16.00 ? 76  TRP B CD2   1 
ATOM   2390 N  NE1   . TRP D 2 76  ? -4.471  -7.038  60.311 1.00 20.20 ? 76  TRP B NE1   1 
ATOM   2391 C  CE2   . TRP D 2 76  ? -3.300  -6.961  59.600 1.00 19.76 ? 76  TRP B CE2   1 
ATOM   2392 C  CE3   . TRP D 2 76  ? -2.106  -5.324  58.271 1.00 20.39 ? 76  TRP B CE3   1 
ATOM   2393 C  CZ2   . TRP D 2 76  ? -2.309  -7.920  59.399 1.00 18.28 ? 76  TRP B CZ2   1 
ATOM   2394 C  CZ3   . TRP D 2 76  ? -1.134  -6.295  58.043 1.00 19.83 ? 76  TRP B CZ3   1 
ATOM   2395 C  CH2   . TRP D 2 76  ? -1.232  -7.568  58.625 1.00 20.14 ? 76  TRP B CH2   1 
ATOM   2396 N  N     . TYR D 2 77  ? -3.722  -0.298  58.860 1.00 13.70 ? 77  TYR B N     1 
ATOM   2397 C  CA    . TYR D 2 77  ? -4.160  1.012   58.425 1.00 12.21 ? 77  TYR B CA    1 
ATOM   2398 C  C     . TYR D 2 77  ? -4.383  1.007   56.952 1.00 14.54 ? 77  TYR B C     1 
ATOM   2399 O  O     . TYR D 2 77  ? -3.498  0.613   56.190 1.00 16.19 ? 77  TYR B O     1 
ATOM   2400 C  CB    . TYR D 2 77  ? -3.134  2.065   58.800 1.00 11.32 ? 77  TYR B CB    1 
ATOM   2401 C  CG    . TYR D 2 77  ? -3.098  2.272   60.276 1.00 8.76  ? 77  TYR B CG    1 
ATOM   2402 C  CD1   . TYR D 2 77  ? -3.991  3.146   60.877 1.00 7.42  ? 77  TYR B CD1   1 
ATOM   2403 C  CD2   . TYR D 2 77  ? -2.378  1.410   61.094 1.00 8.28  ? 77  TYR B CD2   1 
ATOM   2404 C  CE1   . TYR D 2 77  ? -4.075  3.259   62.244 1.00 11.71 ? 77  TYR B CE1   1 
ATOM   2405 C  CE2   . TYR D 2 77  ? -2.448  1.524   62.491 1.00 14.43 ? 77  TYR B CE2   1 
ATOM   2406 C  CZ    . TYR D 2 77  ? -3.296  2.463   63.052 1.00 13.12 ? 77  TYR B CZ    1 
ATOM   2407 O  OH    . TYR D 2 77  ? -3.427  2.574   64.421 1.00 17.26 ? 77  TYR B OH    1 
ATOM   2408 N  N     . VAL D 2 78  ? -5.597  1.374   56.549 1.00 14.68 ? 78  VAL B N     1 
ATOM   2409 C  CA    . VAL D 2 78  ? -5.977  1.394   55.138 1.00 13.05 ? 78  VAL B CA    1 
ATOM   2410 C  C     . VAL D 2 78  ? -6.084  2.828   54.651 1.00 13.18 ? 78  VAL B C     1 
ATOM   2411 O  O     . VAL D 2 78  ? -6.687  3.670   55.312 1.00 14.19 ? 78  VAL B O     1 
ATOM   2412 C  CB    . VAL D 2 78  ? -7.344  0.723   54.940 1.00 12.75 ? 78  VAL B CB    1 
ATOM   2413 C  CG1   . VAL D 2 78  ? -7.760  0.772   53.491 1.00 10.82 ? 78  VAL B CG1   1 
ATOM   2414 C  CG2   . VAL D 2 78  ? -7.309  -0.702  55.455 1.00 13.28 ? 78  VAL B CG2   1 
ATOM   2415 N  N     . ALA D 2 79  ? -5.589  3.088   53.455 1.00 12.45 ? 79  ALA B N     1 
ATOM   2416 C  CA    . ALA D 2 79  ? -5.824  4.372   52.824 1.00 13.76 ? 79  ALA B CA    1 
ATOM   2417 C  C     . ALA D 2 79  ? -5.796  4.274   51.292 1.00 15.08 ? 79  ALA B C     1 
ATOM   2418 O  O     . ALA D 2 79  ? -5.200  3.346   50.728 1.00 15.49 ? 79  ALA B O     1 
ATOM   2419 C  CB    . ALA D 2 79  ? -4.819  5.377   53.311 1.00 14.14 ? 79  ALA B CB    1 
ATOM   2420 N  N     . HIS D 2 80  ? -6.489  5.196   50.629 1.00 14.99 ? 80  HIS B N     1 
ATOM   2421 C  CA    . HIS D 2 80  ? -6.415  5.312   49.185 1.00 16.26 ? 80  HIS B CA    1 
ATOM   2422 C  C     . HIS D 2 80  ? -5.178  6.085   48.773 1.00 17.06 ? 80  HIS B C     1 
ATOM   2423 O  O     . HIS D 2 80  ? -4.982  7.214   49.202 1.00 19.99 ? 80  HIS B O     1 
ATOM   2424 C  CB    . HIS D 2 80  ? -7.662  5.994   48.631 1.00 16.29 ? 80  HIS B CB    1 
ATOM   2425 C  CG    . HIS D 2 80  ? -7.934  5.656   47.200 1.00 20.44 ? 80  HIS B CG    1 
ATOM   2426 N  ND1   . HIS D 2 80  ? -8.212  4.367   46.787 1.00 20.58 ? 80  HIS B ND1   1 
ATOM   2427 C  CD2   . HIS D 2 80  ? -7.819  6.397   46.072 1.00 17.61 ? 80  HIS B CD2   1 
ATOM   2428 C  CE1   . HIS D 2 80  ? -8.339  4.348   45.473 1.00 22.94 ? 80  HIS B CE1   1 
ATOM   2429 N  NE2   . HIS D 2 80  ? -8.086  5.562   45.013 1.00 23.61 ? 80  HIS B NE2   1 
ATOM   2430 N  N     . ASN D 2 81  ? -4.303  5.447   48.002 1.00 17.60 ? 81  ASN B N     1 
ATOM   2431 C  CA    . ASN D 2 81  ? -2.953  5.951   47.797 1.00 17.04 ? 81  ASN B CA    1 
ATOM   2432 C  C     . ASN D 2 81  ? -2.165  6.067   49.105 1.00 17.22 ? 81  ASN B C     1 
ATOM   2433 O  O     . ASN D 2 81  ? -1.535  7.096   49.374 1.00 15.92 ? 81  ASN B O     1 
ATOM   2434 C  CB    . ASN D 2 81  ? -2.984  7.295   47.080 1.00 17.50 ? 81  ASN B CB    1 
ATOM   2435 C  CG    . ASN D 2 81  ? -1.683  7.599   46.362 1.00 21.49 ? 81  ASN B CG    1 
ATOM   2436 O  OD1   . ASN D 2 81  ? -0.799  6.746   46.263 1.00 23.79 ? 81  ASN B OD1   1 
ATOM   2437 N  ND2   . ASN D 2 81  ? -1.588  8.798   45.793 1.00 22.44 ? 81  ASN B ND2   1 
ATOM   2438 N  N     . ALA D 2 82  ? -2.115  4.966   49.856 1.00 16.35 ? 82  ALA B N     1 
ATOM   2439 C  CA    . ALA D 2 82  ? -1.653  4.985   51.238 1.00 16.20 ? 82  ALA B CA    1 
ATOM   2440 C  C     . ALA D 2 82  ? -0.255  5.580   51.402 1.00 17.75 ? 82  ALA B C     1 
ATOM   2441 O  O     . ALA D 2 82  ? 0.087   6.120   52.455 1.00 18.96 ? 82  ALA B O     1 
ATOM   2442 C  CB    . ALA D 2 82  ? -1.708  3.610   51.818 1.00 15.45 ? 82  ALA B CB    1 
ATOM   2443 N  N     . SER D 2 83  ? 0.563   5.437   50.374 1.00 18.70 ? 83  SER B N     1 
ATOM   2444 C  CA    . SER D 2 83  ? 1.866   6.085   50.319 1.00 19.15 ? 83  SER B CA    1 
ATOM   2445 C  C     . SER D 2 83  ? 1.817   7.582   50.662 1.00 18.61 ? 83  SER B C     1 
ATOM   2446 O  O     . SER D 2 83  ? 2.717   8.106   51.327 1.00 18.25 ? 83  SER B O     1 
ATOM   2447 C  CB    . SER D 2 83  ? 2.465   5.902   48.927 1.00 20.02 ? 83  SER B CB    1 
ATOM   2448 O  OG    . SER D 2 83  ? 3.491   4.945   48.959 1.00 24.37 ? 83  SER B OG    1 
ATOM   2449 N  N     . PHE D 2 84  ? 0.815   8.284   50.146 1.00 17.79 ? 84  PHE B N     1 
ATOM   2450 C  CA    . PHE D 2 84  ? 0.618   9.681   50.519 1.00 18.61 ? 84  PHE B CA    1 
ATOM   2451 C  C     . PHE D 2 84  ? 0.493   9.833   52.025 1.00 19.08 ? 84  PHE B C     1 
ATOM   2452 O  O     . PHE D 2 84  ? 1.329   10.459  52.665 1.00 21.17 ? 84  PHE B O     1 
ATOM   2453 C  CB    . PHE D 2 84  ? -0.618  10.264  49.831 1.00 18.25 ? 84  PHE B CB    1 
ATOM   2454 C  CG    . PHE D 2 84  ? -0.820  11.729  50.094 1.00 20.76 ? 84  PHE B CG    1 
ATOM   2455 C  CD1   . PHE D 2 84  ? -0.012  12.681  49.483 1.00 18.71 ? 84  PHE B CD1   1 
ATOM   2456 C  CD2   . PHE D 2 84  ? -1.814  12.158  50.957 1.00 20.69 ? 84  PHE B CD2   1 
ATOM   2457 C  CE1   . PHE D 2 84  ? -0.212  14.015  49.718 1.00 21.44 ? 84  PHE B CE1   1 
ATOM   2458 C  CE2   . PHE D 2 84  ? -2.006  13.499  51.207 1.00 17.97 ? 84  PHE B CE2   1 
ATOM   2459 C  CZ    . PHE D 2 84  ? -1.218  14.426  50.593 1.00 18.06 ? 84  PHE B CZ    1 
ATOM   2460 N  N     . ASP D 2 85  ? -0.522  9.201   52.596 1.00 19.49 ? 85  ASP B N     1 
ATOM   2461 C  CA    . ASP D 2 85  ? -0.865  9.408   53.992 1.00 21.32 ? 85  ASP B CA    1 
ATOM   2462 C  C     . ASP D 2 85  ? 0.240   8.941   54.930 1.00 22.97 ? 85  ASP B C     1 
ATOM   2463 O  O     . ASP D 2 85  ? 0.445   9.506   56.014 1.00 24.81 ? 85  ASP B O     1 
ATOM   2464 C  CB    . ASP D 2 85  ? -2.168  8.689   54.320 1.00 20.88 ? 85  ASP B CB    1 
ATOM   2465 C  CG    . ASP D 2 85  ? -3.319  9.142   53.439 1.00 23.97 ? 85  ASP B CG    1 
ATOM   2466 O  OD1   . ASP D 2 85  ? -3.388  8.708   52.264 1.00 21.60 ? 85  ASP B OD1   1 
ATOM   2467 O  OD2   . ASP D 2 85  ? -4.146  9.954   53.917 1.00 29.01 ? 85  ASP B OD2   1 
ATOM   2468 N  N     . ARG D 2 86  ? 0.933   7.886   54.536 1.00 23.27 ? 86  ARG B N     1 
ATOM   2469 C  CA    . ARG D 2 86  ? 2.009   7.363   55.351 1.00 24.64 ? 86  ARG B CA    1 
ATOM   2470 C  C     . ARG D 2 86  ? 3.230   8.288   55.305 1.00 23.45 ? 86  ARG B C     1 
ATOM   2471 O  O     . ARG D 2 86  ? 3.988   8.358   56.258 1.00 24.18 ? 86  ARG B O     1 
ATOM   2472 C  CB    . ARG D 2 86  ? 2.352   5.942   54.910 1.00 25.25 ? 86  ARG B CB    1 
ATOM   2473 C  CG    . ARG D 2 86  ? 3.729   5.445   55.302 1.00 29.54 ? 86  ARG B CG    1 
ATOM   2474 C  CD    . ARG D 2 86  ? 4.363   4.743   54.107 1.00 36.60 ? 86  ARG B CD    1 
ATOM   2475 N  NE    . ARG D 2 86  ? 4.715   3.351   54.377 1.00 42.51 ? 86  ARG B NE    1 
ATOM   2476 C  CZ    . ARG D 2 86  ? 4.523   2.353   53.514 1.00 44.58 ? 86  ARG B CZ    1 
ATOM   2477 N  NH1   . ARG D 2 86  ? 3.923   2.587   52.348 1.00 42.82 ? 86  ARG B NH1   1 
ATOM   2478 N  NH2   . ARG D 2 86  ? 4.913   1.118   53.823 1.00 40.02 ? 86  ARG B NH2   1 
ATOM   2479 N  N     . ARG D 2 87  ? 3.307   9.113   54.271 1.00 22.71 ? 87  ARG B N     1 
ATOM   2480 C  CA    . ARG D 2 87  ? 4.405   10.065  54.137 1.00 23.10 ? 87  ARG B CA    1 
ATOM   2481 C  C     . ARG D 2 87  ? 4.146   11.362  54.916 1.00 22.42 ? 87  ARG B C     1 
ATOM   2482 O  O     . ARG D 2 87  ? 4.992   11.814  55.688 1.00 23.05 ? 87  ARG B O     1 
ATOM   2483 C  CB    . ARG D 2 87  ? 4.662   10.373  52.666 1.00 23.71 ? 87  ARG B CB    1 
ATOM   2484 C  CG    . ARG D 2 87  ? 5.658   11.494  52.432 1.00 25.78 ? 87  ARG B CG    1 
ATOM   2485 C  CD    . ARG D 2 87  ? 6.223   11.435  51.027 1.00 25.42 ? 87  ARG B CD    1 
ATOM   2486 N  NE    . ARG D 2 87  ? 5.252   11.865  50.032 1.00 26.67 ? 87  ARG B NE    1 
ATOM   2487 C  CZ    . ARG D 2 87  ? 4.752   11.080  49.076 1.00 29.41 ? 87  ARG B CZ    1 
ATOM   2488 N  NH1   . ARG D 2 87  ? 5.143   9.814   48.976 1.00 23.67 ? 87  ARG B NH1   1 
ATOM   2489 N  NH2   . ARG D 2 87  ? 3.905   11.582  48.182 1.00 31.05 ? 87  ARG B NH2   1 
ATOM   2490 N  N     . VAL D 2 88  ? 2.960   11.931  54.747 1.00 21.05 ? 88  VAL B N     1 
ATOM   2491 C  CA    . VAL D 2 88  ? 2.599   13.161  55.454 1.00 19.91 ? 88  VAL B CA    1 
ATOM   2492 C  C     . VAL D 2 88  ? 2.343   12.981  56.953 1.00 20.24 ? 88  VAL B C     1 
ATOM   2493 O  O     . VAL D 2 88  ? 2.580   13.896  57.734 1.00 21.48 ? 88  VAL B O     1 
ATOM   2494 C  CB    . VAL D 2 88  ? 1.394   13.851  54.808 1.00 19.48 ? 88  VAL B CB    1 
ATOM   2495 C  CG1   . VAL D 2 88  ? 1.695   14.177  53.344 1.00 17.90 ? 88  VAL B CG1   1 
ATOM   2496 C  CG2   . VAL D 2 88  ? 0.169   12.976  54.919 1.00 15.43 ? 88  VAL B CG2   1 
ATOM   2497 N  N     . LEU D 2 89  ? 1.875   11.806  57.367 1.00 20.24 ? 89  LEU B N     1 
ATOM   2498 C  CA    . LEU D 2 89  ? 1.615   11.579  58.796 1.00 20.40 ? 89  LEU B CA    1 
ATOM   2499 C  C     . LEU D 2 89  ? 2.858   11.100  59.510 1.00 21.56 ? 89  LEU B C     1 
ATOM   2500 O  O     . LEU D 2 89  ? 3.798   10.633  58.878 1.00 21.42 ? 89  LEU B O     1 
ATOM   2501 C  CB    . LEU D 2 89  ? 0.479   10.590  59.003 1.00 19.57 ? 89  LEU B CB    1 
ATOM   2502 C  CG    . LEU D 2 89  ? -0.900  11.172  58.728 1.00 21.93 ? 89  LEU B CG    1 
ATOM   2503 C  CD1   . LEU D 2 89  ? -1.958  10.080  58.823 1.00 23.50 ? 89  LEU B CD1   1 
ATOM   2504 C  CD2   . LEU D 2 89  ? -1.209  12.348  59.665 1.00 20.69 ? 89  LEU B CD2   1 
ATOM   2505 N  N     . PRO D 2 90  ? 2.894   11.259  60.839 1.00 23.12 ? 90  PRO B N     1 
ATOM   2506 C  CA    . PRO D 2 90  ? 3.984   10.649  61.563 1.00 23.66 ? 90  PRO B CA    1 
ATOM   2507 C  C     . PRO D 2 90  ? 3.877   9.134   61.475 1.00 24.81 ? 90  PRO B C     1 
ATOM   2508 O  O     . PRO D 2 90  ? 2.930   8.599   60.879 1.00 24.06 ? 90  PRO B O     1 
ATOM   2509 C  CB    . PRO D 2 90  ? 3.749   11.108  63.010 1.00 23.26 ? 90  PRO B CB    1 
ATOM   2510 C  CG    . PRO D 2 90  ? 2.892   12.301  62.902 1.00 22.70 ? 90  PRO B CG    1 
ATOM   2511 C  CD    . PRO D 2 90  ? 2.023   12.053  61.717 1.00 22.83 ? 90  PRO B CD    1 
ATOM   2512 N  N     . GLU D 2 91  ? 4.820   8.454   62.110 1.00 26.25 ? 91  GLU B N     1 
ATOM   2513 C  CA    . GLU D 2 91  ? 4.902   7.014   62.029 1.00 27.55 ? 91  GLU B CA    1 
ATOM   2514 C  C     . GLU D 2 91  ? 3.713   6.371   62.709 1.00 25.20 ? 91  GLU B C     1 
ATOM   2515 O  O     . GLU D 2 91  ? 3.406   6.685   63.852 1.00 23.67 ? 91  GLU B O     1 
ATOM   2516 C  CB    . GLU D 2 91  ? 6.213   6.517   62.637 1.00 28.88 ? 91  GLU B CB    1 
ATOM   2517 C  CG    . GLU D 2 91  ? 7.380   6.570   61.652 1.00 37.15 ? 91  GLU B CG    1 
ATOM   2518 C  CD    . GLU D 2 91  ? 8.323   5.383   61.790 1.00 47.46 ? 91  GLU B CD    1 
ATOM   2519 O  OE1   . GLU D 2 91  ? 8.001   4.449   62.565 1.00 48.80 ? 91  GLU B OE1   1 
ATOM   2520 O  OE2   . GLU D 2 91  ? 9.405   5.409   61.153 1.00 50.35 ? 91  GLU B OE2   1 
ATOM   2521 N  N     . MET D 2 92  ? 2.992   5.545   61.954 1.00 23.83 ? 92  MET B N     1 
ATOM   2522 C  CA    . MET D 2 92  ? 1.905   4.749   62.507 1.00 22.38 ? 92  MET B CA    1 
ATOM   2523 C  C     . MET D 2 92  ? 2.393   3.370   62.934 1.00 22.40 ? 92  MET B C     1 
ATOM   2524 O  O     . MET D 2 92  ? 3.127   2.698   62.197 1.00 21.11 ? 92  MET B O     1 
ATOM   2525 C  CB    . MET D 2 92  ? 0.762   4.615   61.501 1.00 22.03 ? 92  MET B CB    1 
ATOM   2526 C  CG    . MET D 2 92  ? 0.092   5.941   61.139 1.00 25.21 ? 92  MET B CG    1 
ATOM   2527 S  SD    . MET D 2 92  ? -0.629  6.777   62.581 1.00 29.48 ? 92  MET B SD    1 
ATOM   2528 C  CE    . MET D 2 92  ? -1.891  5.618   63.076 1.00 14.54 ? 92  MET B CE    1 
ATOM   2529 N  N     . PRO D 2 93  ? 1.952   2.925   64.115 1.00 22.19 ? 93  PRO B N     1 
ATOM   2530 C  CA    . PRO D 2 93  ? 2.368   1.654   64.664 1.00 22.56 ? 93  PRO B CA    1 
ATOM   2531 C  C     . PRO D 2 93  ? 1.500   0.507   64.169 1.00 22.73 ? 93  PRO B C     1 
ATOM   2532 O  O     . PRO D 2 93  ? 0.714   -0.032  64.928 1.00 25.43 ? 93  PRO B O     1 
ATOM   2533 C  CB    . PRO D 2 93  ? 2.201   1.861   66.170 1.00 22.07 ? 93  PRO B CB    1 
ATOM   2534 C  CG    . PRO D 2 93  ? 1.104   2.842   66.291 1.00 22.75 ? 93  PRO B CG    1 
ATOM   2535 C  CD    . PRO D 2 93  ? 1.142   3.707   65.066 1.00 22.67 ? 93  PRO B CD    1 
ATOM   2536 N  N     . GLY D 2 94  ? 1.680   0.115   62.910 1.00 23.56 ? 94  GLY B N     1 
ATOM   2537 C  CA    . GLY D 2 94  ? 0.845   -0.910  62.280 1.00 21.14 ? 94  GLY B CA    1 
ATOM   2538 C  C     . GLY D 2 94  ? 1.213   -1.043  60.813 1.00 21.70 ? 94  GLY B C     1 
ATOM   2539 O  O     . GLY D 2 94  ? 2.053   -0.297  60.310 1.00 21.80 ? 94  GLY B O     1 
ATOM   2540 N  N     . GLU D 2 95  ? 0.568   -1.970  60.117 1.00 20.57 ? 95  GLU B N     1 
ATOM   2541 C  CA    . GLU D 2 95  ? 0.869   -2.215  58.718 1.00 21.50 ? 95  GLU B CA    1 
ATOM   2542 C  C     . GLU D 2 95  ? -0.046  -1.406  57.820 1.00 20.09 ? 95  GLU B C     1 
ATOM   2543 O  O     . GLU D 2 95  ? -1.157  -1.055  58.212 1.00 21.35 ? 95  GLU B O     1 
ATOM   2544 C  CB    . GLU D 2 95  ? 0.704   -3.702  58.396 1.00 23.64 ? 95  GLU B CB    1 
ATOM   2545 C  CG    . GLU D 2 95  ? 1.490   -4.628  59.309 1.00 29.71 ? 95  GLU B CG    1 
ATOM   2546 C  CD    . GLU D 2 95  ? 2.966   -4.627  58.984 1.00 38.92 ? 95  GLU B CD    1 
ATOM   2547 O  OE1   . GLU D 2 95  ? 3.604   -3.553  59.117 1.00 35.62 ? 95  GLU B OE1   1 
ATOM   2548 O  OE2   . GLU D 2 95  ? 3.480   -5.694  58.574 1.00 41.69 ? 95  GLU B OE2   1 
ATOM   2549 N  N     . TRP D 2 96  ? 0.372   -1.194  56.578 1.00 18.47 ? 96  TRP B N     1 
ATOM   2550 C  CA    . TRP D 2 96  ? -0.405  -0.367  55.669 1.00 17.66 ? 96  TRP B CA    1 
ATOM   2551 C  C     . TRP D 2 96  ? -1.057  -1.172  54.548 1.00 17.16 ? 96  TRP B C     1 
ATOM   2552 O  O     . TRP D 2 96  ? -0.505  -2.162  54.075 1.00 18.27 ? 96  TRP B O     1 
ATOM   2553 C  CB    . TRP D 2 96  ? 0.451   0.761   55.103 1.00 16.66 ? 96  TRP B CB    1 
ATOM   2554 C  CG    . TRP D 2 96  ? 0.661   1.900   56.070 1.00 17.35 ? 96  TRP B CG    1 
ATOM   2555 C  CD1   . TRP D 2 96  ? 1.717   2.073   56.921 1.00 19.03 ? 96  TRP B CD1   1 
ATOM   2556 C  CD2   . TRP D 2 96  ? -0.176  3.054   56.234 1.00 18.06 ? 96  TRP B CD2   1 
ATOM   2557 N  NE1   . TRP D 2 96  ? 1.568   3.242   57.630 1.00 20.13 ? 96  TRP B NE1   1 
ATOM   2558 C  CE2   . TRP D 2 96  ? 0.417   3.865   57.227 1.00 16.29 ? 96  TRP B CE2   1 
ATOM   2559 C  CE3   . TRP D 2 96  ? -1.387  3.464   55.659 1.00 14.91 ? 96  TRP B CE3   1 
ATOM   2560 C  CZ2   . TRP D 2 96  ? -0.141  5.073   57.635 1.00 16.23 ? 96  TRP B CZ2   1 
ATOM   2561 C  CZ3   . TRP D 2 96  ? -1.960  4.639   56.090 1.00 13.49 ? 96  TRP B CZ3   1 
ATOM   2562 C  CH2   . TRP D 2 96  ? -1.328  5.445   57.058 1.00 17.48 ? 96  TRP B CH2   1 
ATOM   2563 N  N     . ILE D 2 97  ? -2.255  -0.757  54.156 1.00 17.55 ? 97  ILE B N     1 
ATOM   2564 C  CA    . ILE D 2 97  ? -2.959  -1.352  53.020 1.00 17.46 ? 97  ILE B CA    1 
ATOM   2565 C  C     . ILE D 2 97  ? -3.425  -0.248  52.069 1.00 17.46 ? 97  ILE B C     1 
ATOM   2566 O  O     . ILE D 2 97  ? -3.934  0.771   52.504 1.00 19.97 ? 97  ILE B O     1 
ATOM   2567 C  CB    . ILE D 2 97  ? -4.181  -2.178  53.498 1.00 17.24 ? 97  ILE B CB    1 
ATOM   2568 C  CG1   . ILE D 2 97  ? -3.710  -3.409  54.276 1.00 16.95 ? 97  ILE B CG1   1 
ATOM   2569 C  CG2   . ILE D 2 97  ? -5.052  -2.596  52.319 1.00 16.67 ? 97  ILE B CG2   1 
ATOM   2570 C  CD1   . ILE D 2 97  ? -4.794  -4.056  55.121 1.00 21.00 ? 97  ILE B CD1   1 
ATOM   2571 N  N     . CYS D 2 98  ? -3.199  -0.433  50.776 1.00 17.58 ? 98  CYS B N     1 
ATOM   2572 C  CA    . CYS D 2 98  ? -3.540  0.577   49.787 1.00 17.06 ? 98  CYS B CA    1 
ATOM   2573 C  C     . CYS D 2 98  ? -4.704  0.110   48.887 1.00 17.32 ? 98  CYS B C     1 
ATOM   2574 O  O     . CYS D 2 98  ? -4.542  -0.785  48.050 1.00 17.95 ? 98  CYS B O     1 
ATOM   2575 C  CB    . CYS D 2 98  ? -2.292  0.942   48.949 1.00 16.77 ? 98  CYS B CB    1 
ATOM   2576 S  SG    . CYS D 2 98  ? -2.576  2.152   47.611 1.00 15.98 ? 98  CYS B SG    1 
ATOM   2577 N  N     . THR D 2 99  ? -5.874  0.723   49.063 1.00 17.66 ? 99  THR B N     1 
ATOM   2578 C  CA    . THR D 2 99  ? -7.065  0.357   48.284 1.00 16.21 ? 99  THR B CA    1 
ATOM   2579 C  C     . THR D 2 99  ? -6.883  0.665   46.801 1.00 18.54 ? 99  THR B C     1 
ATOM   2580 O  O     . THR D 2 99  ? -7.528  0.055   45.944 1.00 17.27 ? 99  THR B O     1 
ATOM   2581 C  CB    . THR D 2 99  ? -8.326  1.076   48.780 1.00 14.78 ? 99  THR B CB    1 
ATOM   2582 O  OG1   . THR D 2 99  ? -8.043  2.460   48.974 1.00 13.10 ? 99  THR B OG1   1 
ATOM   2583 C  CG2   . THR D 2 99  ? -8.817  0.480   50.086 1.00 13.88 ? 99  THR B CG2   1 
ATOM   2584 N  N     . MET D 2 100 ? -5.983  1.596   46.495 1.00 20.35 ? 100 MET B N     1 
ATOM   2585 C  CA    . MET D 2 100 ? -5.724  1.957   45.099 1.00 21.56 ? 100 MET B CA    1 
ATOM   2586 C  C     . MET D 2 100 ? -5.019  0.799   44.388 1.00 21.03 ? 100 MET B C     1 
ATOM   2587 O  O     . MET D 2 100 ? -5.463  0.341   43.344 1.00 19.62 ? 100 MET B O     1 
ATOM   2588 C  CB    . MET D 2 100 ? -4.902  3.260   45.001 1.00 21.14 ? 100 MET B CB    1 
ATOM   2589 C  CG    . MET D 2 100 ? -4.551  3.680   43.591 1.00 20.10 ? 100 MET B CG    1 
ATOM   2590 S  SD    . MET D 2 100 ? -3.594  5.207   43.524 1.00 23.39 ? 100 MET B SD    1 
ATOM   2591 C  CE    . MET D 2 100 ? -1.930  4.575   43.761 1.00 25.98 ? 100 MET B CE    1 
ATOM   2592 N  N     . LYS D 2 101 ? -3.991  0.258   45.025 1.00 22.71 ? 101 LYS B N     1 
ATOM   2593 C  CA    . LYS D 2 101 ? -3.251  -0.860  44.451 1.00 24.18 ? 101 LYS B CA    1 
ATOM   2594 C  C     . LYS D 2 101 ? -4.117  -2.107  44.325 1.00 24.11 ? 101 LYS B C     1 
ATOM   2595 O  O     . LYS D 2 101 ? -3.988  -2.859  43.358 1.00 26.17 ? 101 LYS B O     1 
ATOM   2596 C  CB    . LYS D 2 101 ? -2.001  -1.166  45.279 1.00 25.89 ? 101 LYS B CB    1 
ATOM   2597 C  CG    . LYS D 2 101 ? -1.013  -2.134  44.600 1.00 29.70 ? 101 LYS B CG    1 
ATOM   2598 C  CD    . LYS D 2 101 ? 0.392   -2.000  45.195 1.00 34.50 ? 101 LYS B CD    1 
ATOM   2599 C  CE    . LYS D 2 101 ? 1.265   -3.205  44.840 1.00 35.11 ? 101 LYS B CE    1 
ATOM   2600 N  NZ    . LYS D 2 101 ? 2.398   -2.820  43.955 1.00 38.76 ? 101 LYS B NZ    1 
ATOM   2601 N  N     . LEU D 2 102 ? -5.026  -2.306  45.279 1.00 22.79 ? 102 LEU B N     1 
ATOM   2602 C  CA    . LEU D 2 102 ? -5.912  -3.464  45.250 1.00 21.81 ? 102 LEU B CA    1 
ATOM   2603 C  C     . LEU D 2 102 ? -6.999  -3.326  44.203 1.00 21.24 ? 102 LEU B C     1 
ATOM   2604 O  O     . LEU D 2 102 ? -7.488  -4.318  43.680 1.00 20.41 ? 102 LEU B O     1 
ATOM   2605 C  CB    . LEU D 2 102 ? -6.554  -3.701  46.618 1.00 22.32 ? 102 LEU B CB    1 
ATOM   2606 C  CG    . LEU D 2 102 ? -5.664  -3.774  47.855 1.00 20.67 ? 102 LEU B CG    1 
ATOM   2607 C  CD1   . LEU D 2 102 ? -6.510  -3.619  49.115 1.00 22.39 ? 102 LEU B CD1   1 
ATOM   2608 C  CD2   . LEU D 2 102 ? -4.895  -5.066  47.894 1.00 17.64 ? 102 LEU B CD2   1 
ATOM   2609 N  N     . ALA D 2 103 ? -7.437  -2.097  43.959 1.00 23.27 ? 103 ALA B N     1 
ATOM   2610 C  CA    . ALA D 2 103 ? -8.492  -1.858  42.983 1.00 24.46 ? 103 ALA B CA    1 
ATOM   2611 C  C     . ALA D 2 103 ? -7.958  -2.117  41.590 1.00 26.91 ? 103 ALA B C     1 
ATOM   2612 O  O     . ALA D 2 103 ? -8.673  -2.630  40.732 1.00 28.45 ? 103 ALA B O     1 
ATOM   2613 C  CB    . ALA D 2 103 ? -9.019  -0.448  43.092 1.00 23.11 ? 103 ALA B CB    1 
ATOM   2614 N  N     . ARG D 2 104 ? -6.692  -1.773  41.373 1.00 28.17 ? 104 ARG B N     1 
ATOM   2615 C  CA    . ARG D 2 104 ? -6.036  -2.044  40.103 1.00 31.15 ? 104 ARG B CA    1 
ATOM   2616 C  C     . ARG D 2 104 ? -5.900  -3.543  39.836 1.00 31.66 ? 104 ARG B C     1 
ATOM   2617 O  O     . ARG D 2 104 ? -6.320  -4.033  38.785 1.00 33.23 ? 104 ARG B O     1 
ATOM   2618 C  CB    . ARG D 2 104 ? -4.664  -1.375  40.048 1.00 32.05 ? 104 ARG B CB    1 
ATOM   2619 C  CG    . ARG D 2 104 ? -4.608  -0.191  39.128 1.00 36.99 ? 104 ARG B CG    1 
ATOM   2620 C  CD    . ARG D 2 104 ? -3.378  -0.252  38.222 1.00 48.47 ? 104 ARG B CD    1 
ATOM   2621 N  NE    . ARG D 2 104 ? -2.759  1.066   38.083 1.00 50.64 ? 104 ARG B NE    1 
ATOM   2622 C  CZ    . ARG D 2 104 ? -2.282  1.772   39.104 1.00 51.97 ? 104 ARG B CZ    1 
ATOM   2623 N  NH1   . ARG D 2 104 ? -2.296  1.265   40.331 1.00 50.65 ? 104 ARG B NH1   1 
ATOM   2624 N  NH2   . ARG D 2 104 ? -1.764  2.969   38.896 1.00 54.90 ? 104 ARG B NH2   1 
ATOM   2625 N  N     . ARG D 2 105 ? -5.337  -4.270  40.797 1.00 30.60 ? 105 ARG B N     1 
ATOM   2626 C  CA    . ARG D 2 105 ? -5.273  -5.727  40.707 1.00 31.20 ? 105 ARG B CA    1 
ATOM   2627 C  C     . ARG D 2 105 ? -6.619  -6.357  40.325 1.00 30.74 ? 105 ARG B C     1 
ATOM   2628 O  O     . ARG D 2 105 ? -6.693  -7.190  39.423 1.00 30.20 ? 105 ARG B O     1 
ATOM   2629 C  CB    . ARG D 2 105 ? -4.768  -6.328  42.015 1.00 31.02 ? 105 ARG B CB    1 
ATOM   2630 C  CG    . ARG D 2 105 ? -5.004  -7.833  42.134 1.00 33.97 ? 105 ARG B CG    1 
ATOM   2631 C  CD    . ARG D 2 105 ? -3.877  -8.628  41.497 1.00 40.12 ? 105 ARG B CD    1 
ATOM   2632 N  NE    . ARG D 2 105 ? -2.612  -7.894  41.533 1.00 45.64 ? 105 ARG B NE    1 
ATOM   2633 C  CZ    . ARG D 2 105 ? -1.640  -8.118  42.417 1.00 46.52 ? 105 ARG B CZ    1 
ATOM   2634 N  NH1   . ARG D 2 105 ? -1.768  -9.087  43.318 1.00 44.66 ? 105 ARG B NH1   1 
ATOM   2635 N  NH2   . ARG D 2 105 ? -0.536  -7.379  42.392 1.00 46.01 ? 105 ARG B NH2   1 
ATOM   2636 N  N     . LEU D 2 106 ? -7.680  -5.926  41.000 1.00 30.72 ? 106 LEU B N     1 
ATOM   2637 C  CA    . LEU D 2 106 ? -9.019  -6.473  40.785 1.00 30.05 ? 106 LEU B CA    1 
ATOM   2638 C  C     . LEU D 2 106 ? -9.660  -6.045  39.456 1.00 30.30 ? 106 LEU B C     1 
ATOM   2639 O  O     . LEU D 2 106 ? -10.289 -6.860  38.773 1.00 30.43 ? 106 LEU B O     1 
ATOM   2640 C  CB    . LEU D 2 106 ? -9.931  -6.077  41.941 1.00 29.32 ? 106 LEU B CB    1 
ATOM   2641 C  CG    . LEU D 2 106 ? -10.411 -7.203  42.843 1.00 27.60 ? 106 LEU B CG    1 
ATOM   2642 C  CD1   . LEU D 2 106 ? -9.357  -8.262  42.978 1.00 23.48 ? 106 LEU B CD1   1 
ATOM   2643 C  CD2   . LEU D 2 106 ? -10.819 -6.654  44.195 1.00 24.94 ? 106 LEU B CD2   1 
ATOM   2644 N  N     . TRP D 2 107 ? -9.583  -4.752  39.148 1.00 29.89 ? 107 TRP B N     1 
ATOM   2645 C  CA    . TRP D 2 107 ? -10.336 -4.177  38.030 1.00 30.39 ? 107 TRP B CA    1 
ATOM   2646 C  C     . TRP D 2 107 ? -9.448  -3.328  37.109 1.00 30.50 ? 107 TRP B C     1 
ATOM   2647 O  O     . TRP D 2 107 ? -9.419  -2.096  37.217 1.00 29.07 ? 107 TRP B O     1 
ATOM   2648 C  CB    . TRP D 2 107 ? -11.524 -3.350  38.535 1.00 29.73 ? 107 TRP B CB    1 
ATOM   2649 C  CG    . TRP D 2 107 ? -12.382 -4.055  39.539 1.00 30.69 ? 107 TRP B CG    1 
ATOM   2650 C  CD1   . TRP D 2 107 ? -13.178 -5.147  39.321 1.00 30.65 ? 107 TRP B CD1   1 
ATOM   2651 C  CD2   . TRP D 2 107 ? -12.585 -3.679  40.911 1.00 29.89 ? 107 TRP B CD2   1 
ATOM   2652 N  NE1   . TRP D 2 107 ? -13.852 -5.477  40.477 1.00 28.76 ? 107 TRP B NE1   1 
ATOM   2653 C  CE2   . TRP D 2 107 ? -13.492 -4.604  41.471 1.00 27.06 ? 107 TRP B CE2   1 
ATOM   2654 C  CE3   . TRP D 2 107 ? -12.088 -2.643  41.721 1.00 31.36 ? 107 TRP B CE3   1 
ATOM   2655 C  CZ2   . TRP D 2 107 ? -13.903 -4.537  42.811 1.00 29.29 ? 107 TRP B CZ2   1 
ATOM   2656 C  CZ3   . TRP D 2 107 ? -12.525 -2.559  43.054 1.00 28.83 ? 107 TRP B CZ3   1 
ATOM   2657 C  CH2   . TRP D 2 107 ? -13.412 -3.508  43.582 1.00 26.74 ? 107 TRP B CH2   1 
ATOM   2658 N  N     . PRO D 2 108 ? -8.718  -3.994  36.202 1.00 31.26 ? 108 PRO B N     1 
ATOM   2659 C  CA    . PRO D 2 108 ? -7.736  -3.337  35.332 1.00 31.66 ? 108 PRO B CA    1 
ATOM   2660 C  C     . PRO D 2 108 ? -8.374  -2.424  34.284 1.00 32.16 ? 108 PRO B C     1 
ATOM   2661 O  O     . PRO D 2 108 ? -9.526  -2.629  33.881 1.00 31.49 ? 108 PRO B O     1 
ATOM   2662 C  CB    . PRO D 2 108 ? -7.031  -4.512  34.642 1.00 32.24 ? 108 PRO B CB    1 
ATOM   2663 C  CG    . PRO D 2 108 ? -7.225  -5.672  35.567 1.00 33.56 ? 108 PRO B CG    1 
ATOM   2664 C  CD    . PRO D 2 108 ? -8.588  -5.461  36.177 1.00 31.47 ? 108 PRO B CD    1 
ATOM   2665 N  N     . GLY D 2 109 ? -7.621  -1.422  33.850 1.00 32.86 ? 109 GLY B N     1 
ATOM   2666 C  CA    . GLY D 2 109 ? -8.020  -0.596  32.716 1.00 33.45 ? 109 GLY B CA    1 
ATOM   2667 C  C     . GLY D 2 109 ? -9.196  0.304   33.015 1.00 33.60 ? 109 GLY B C     1 
ATOM   2668 O  O     . GLY D 2 109 ? -10.045 0.521   32.155 1.00 34.72 ? 109 GLY B O     1 
ATOM   2669 N  N     . ILE D 2 110 ? -9.260  0.815   34.243 1.00 33.77 ? 110 ILE B N     1 
ATOM   2670 C  CA    . ILE D 2 110 ? -10.186 1.903   34.576 1.00 33.26 ? 110 ILE B CA    1 
ATOM   2671 C  C     . ILE D 2 110 ? -9.500  3.056   35.324 1.00 33.21 ? 110 ILE B C     1 
ATOM   2672 O  O     . ILE D 2 110 ? -8.273  3.095   35.430 1.00 32.85 ? 110 ILE B O     1 
ATOM   2673 C  CB    . ILE D 2 110 ? -11.415 1.401   35.388 1.00 33.24 ? 110 ILE B CB    1 
ATOM   2674 C  CG1   . ILE D 2 110 ? -10.975 0.595   36.612 1.00 32.09 ? 110 ILE B CG1   1 
ATOM   2675 C  CG2   . ILE D 2 110 ? -12.334 0.574   34.510 1.00 34.47 ? 110 ILE B CG2   1 
ATOM   2676 C  CD1   . ILE D 2 110 ? -12.088 0.374   37.639 1.00 28.16 ? 110 ILE B CD1   1 
ATOM   2677 N  N     . LYS D 2 111 ? -10.308 4.007   35.798 1.00 33.04 ? 111 LYS B N     1 
ATOM   2678 C  CA    . LYS D 2 111 ? -9.831  5.126   36.612 1.00 31.41 ? 111 LYS B CA    1 
ATOM   2679 C  C     . LYS D 2 111 ? -9.844  4.757   38.097 1.00 29.77 ? 111 LYS B C     1 
ATOM   2680 O  O     . LYS D 2 111 ? -10.745 4.055   38.560 1.00 29.65 ? 111 LYS B O     1 
ATOM   2681 C  CB    . LYS D 2 111 ? -10.713 6.354   36.379 1.00 33.00 ? 111 LYS B CB    1 
ATOM   2682 C  CG    . LYS D 2 111 ? -11.194 6.530   34.924 1.00 37.06 ? 111 LYS B CG    1 
ATOM   2683 C  CD    . LYS D 2 111 ? -10.029 6.710   33.951 1.00 43.91 ? 111 LYS B CD    1 
ATOM   2684 C  CE    . LYS D 2 111 ? -9.631  8.178   33.827 1.00 50.77 ? 111 LYS B CE    1 
ATOM   2685 N  NZ    . LYS D 2 111 ? -8.461  8.519   34.691 1.00 54.19 ? 111 LYS B NZ    1 
ATOM   2686 N  N     . TYR D 2 112 ? -8.857  5.247   38.844 1.00 28.08 ? 112 TYR B N     1 
ATOM   2687 C  CA    . TYR D 2 112 ? -8.611  4.757   40.211 1.00 26.50 ? 112 TYR B CA    1 
ATOM   2688 C  C     . TYR D 2 112 ? -8.556  5.833   41.293 1.00 24.57 ? 112 TYR B C     1 
ATOM   2689 O  O     . TYR D 2 112 ? -7.960  5.619   42.346 1.00 22.73 ? 112 TYR B O     1 
ATOM   2690 C  CB    . TYR D 2 112 ? -7.328  3.947   40.259 1.00 25.87 ? 112 TYR B CB    1 
ATOM   2691 C  CG    . TYR D 2 112 ? -7.324  2.807   39.299 1.00 29.10 ? 112 TYR B CG    1 
ATOM   2692 C  CD1   . TYR D 2 112 ? -7.982  1.626   39.602 1.00 31.76 ? 112 TYR B CD1   1 
ATOM   2693 C  CD2   . TYR D 2 112 ? -6.729  2.927   38.056 1.00 30.45 ? 112 TYR B CD2   1 
ATOM   2694 C  CE1   . TYR D 2 112 ? -8.024  0.589   38.704 1.00 34.78 ? 112 TYR B CE1   1 
ATOM   2695 C  CE2   . TYR D 2 112 ? -6.758  1.888   37.150 1.00 32.58 ? 112 TYR B CE2   1 
ATOM   2696 C  CZ    . TYR D 2 112 ? -7.404  0.720   37.482 1.00 33.85 ? 112 TYR B CZ    1 
ATOM   2697 O  OH    . TYR D 2 112 ? -7.446  -0.327  36.591 1.00 35.60 ? 112 TYR B OH    1 
ATOM   2698 N  N     . SER D 2 113 ? -9.171  6.984   41.043 1.00 23.61 ? 113 SER B N     1 
ATOM   2699 C  CA    . SER D 2 113 ? -9.390  7.948   42.116 1.00 23.50 ? 113 SER B CA    1 
ATOM   2700 C  C     . SER D 2 113 ? -10.357 7.363   43.143 1.00 22.92 ? 113 SER B C     1 
ATOM   2701 O  O     . SER D 2 113 ? -11.118 6.441   42.846 1.00 23.11 ? 113 SER B O     1 
ATOM   2702 C  CB    . SER D 2 113 ? -9.924  9.270   41.570 1.00 22.33 ? 113 SER B CB    1 
ATOM   2703 O  OG    . SER D 2 113 ? -11.230 9.108   41.066 1.00 24.43 ? 113 SER B OG    1 
ATOM   2704 N  N     . ASN D 2 114 ? -10.266 7.855   44.367 1.00 23.09 ? 114 ASN B N     1 
ATOM   2705 C  CA    . ASN D 2 114 ? -11.178 7.451   45.428 1.00 23.96 ? 114 ASN B CA    1 
ATOM   2706 C  C     . ASN D 2 114 ? -12.611 7.444   44.916 1.00 23.57 ? 114 ASN B C     1 
ATOM   2707 O  O     . ASN D 2 114 ? -13.317 6.448   45.018 1.00 23.96 ? 114 ASN B O     1 
ATOM   2708 C  CB    . ASN D 2 114 ? -11.041 8.407   46.624 1.00 23.74 ? 114 ASN B CB    1 
ATOM   2709 C  CG    . ASN D 2 114 ? -11.515 7.789   47.926 1.00 25.36 ? 114 ASN B CG    1 
ATOM   2710 O  OD1   . ASN D 2 114 ? -11.461 6.574   48.110 1.00 25.79 ? 114 ASN B OD1   1 
ATOM   2711 N  ND2   . ASN D 2 114 ? -11.943 8.631   48.855 1.00 26.48 ? 114 ASN B ND2   1 
ATOM   2712 N  N     . MET D 2 115 ? -12.973 8.518   44.236 1.00 24.73 ? 115 MET B N     1 
ATOM   2713 C  CA    . MET D 2 115 ? -14.353 8.822   43.947 1.00 25.39 ? 115 MET B CA    1 
ATOM   2714 C  C     . MET D 2 115 ? -14.796 8.176   42.635 1.00 24.94 ? 115 MET B C     1 
ATOM   2715 O  O     . MET D 2 115 ? -15.977 7.943   42.421 1.00 24.50 ? 115 MET B O     1 
ATOM   2716 C  CB    . MET D 2 115 ? -14.543 10.340  43.880 1.00 25.79 ? 115 MET B CB    1 
ATOM   2717 C  CG    . MET D 2 115 ? -15.992 10.790  43.799 1.00 31.76 ? 115 MET B CG    1 
ATOM   2718 S  SD    . MET D 2 115 ? -17.010 10.200  45.183 1.00 36.83 ? 115 MET B SD    1 
ATOM   2719 C  CE    . MET D 2 115 ? -16.048 10.809  46.574 1.00 34.28 ? 115 MET B CE    1 
ATOM   2720 N  N     . ALA D 2 116 ? -13.851 7.914   41.742 1.00 25.10 ? 116 ALA B N     1 
ATOM   2721 C  CA    . ALA D 2 116 ? -14.188 7.282   40.472 1.00 24.21 ? 116 ALA B CA    1 
ATOM   2722 C  C     . ALA D 2 116 ? -14.487 5.800   40.664 1.00 23.96 ? 116 ALA B C     1 
ATOM   2723 O  O     . ALA D 2 116 ? -15.386 5.262   40.025 1.00 24.84 ? 116 ALA B O     1 
ATOM   2724 C  CB    . ALA D 2 116 ? -13.085 7.483   39.456 1.00 23.52 ? 116 ALA B CB    1 
ATOM   2725 N  N     . LEU D 2 117 ? -13.750 5.156   41.566 1.00 23.00 ? 117 LEU B N     1 
ATOM   2726 C  CA    . LEU D 2 117 ? -14.002 3.764   41.909 1.00 23.28 ? 117 LEU B CA    1 
ATOM   2727 C  C     . LEU D 2 117 ? -15.360 3.639   42.577 1.00 23.90 ? 117 LEU B C     1 
ATOM   2728 O  O     . LEU D 2 117 ? -16.074 2.657   42.371 1.00 22.28 ? 117 LEU B O     1 
ATOM   2729 C  CB    . LEU D 2 117 ? -12.916 3.235   42.855 1.00 24.14 ? 117 LEU B CB    1 
ATOM   2730 C  CG    . LEU D 2 117 ? -11.700 2.476   42.313 1.00 20.37 ? 117 LEU B CG    1 
ATOM   2731 C  CD1   . LEU D 2 117 ? -11.755 2.321   40.817 1.00 21.99 ? 117 LEU B CD1   1 
ATOM   2732 C  CD2   . LEU D 2 117 ? -10.425 3.173   42.748 1.00 18.22 ? 117 LEU B CD2   1 
ATOM   2733 N  N     . TYR D 2 118 ? -15.711 4.647   43.375 1.00 25.16 ? 118 TYR B N     1 
ATOM   2734 C  CA    . TYR D 2 118 ? -16.982 4.662   44.081 1.00 26.01 ? 118 TYR B CA    1 
ATOM   2735 C  C     . TYR D 2 118 ? -18.121 4.569   43.086 1.00 27.62 ? 118 TYR B C     1 
ATOM   2736 O  O     . TYR D 2 118 ? -18.989 3.704   43.207 1.00 28.91 ? 118 TYR B O     1 
ATOM   2737 C  CB    . TYR D 2 118 ? -17.121 5.935   44.924 1.00 26.15 ? 118 TYR B CB    1 
ATOM   2738 C  CG    . TYR D 2 118 ? -18.343 5.963   45.846 1.00 24.84 ? 118 TYR B CG    1 
ATOM   2739 C  CD1   . TYR D 2 118 ? -19.396 6.837   45.607 1.00 23.33 ? 118 TYR B CD1   1 
ATOM   2740 C  CD2   . TYR D 2 118 ? -18.404 5.164   46.994 1.00 24.94 ? 118 TYR B CD2   1 
ATOM   2741 C  CE1   . TYR D 2 118 ? -20.495 6.892   46.457 1.00 24.50 ? 118 TYR B CE1   1 
ATOM   2742 C  CE2   . TYR D 2 118 ? -19.491 5.227   47.862 1.00 19.80 ? 118 TYR B CE2   1 
ATOM   2743 C  CZ    . TYR D 2 118 ? -20.527 6.095   47.587 1.00 22.88 ? 118 TYR B CZ    1 
ATOM   2744 O  OH    . TYR D 2 118 ? -21.619 6.144   48.413 1.00 24.73 ? 118 TYR B OH    1 
ATOM   2745 N  N     . LYS D 2 119 ? -18.104 5.438   42.080 1.00 29.32 ? 119 LYS B N     1 
ATOM   2746 C  CA    . LYS D 2 119 ? -19.195 5.486   41.102 1.00 30.75 ? 119 LYS B CA    1 
ATOM   2747 C  C     . LYS D 2 119 ? -19.171 4.278   40.150 1.00 29.72 ? 119 LYS B C     1 
ATOM   2748 O  O     . LYS D 2 119 ? -20.199 3.660   39.906 1.00 27.65 ? 119 LYS B O     1 
ATOM   2749 C  CB    . LYS D 2 119 ? -19.184 6.812   40.327 1.00 31.19 ? 119 LYS B CB    1 
ATOM   2750 C  CG    . LYS D 2 119 ? -18.396 6.763   39.020 1.00 38.05 ? 119 LYS B CG    1 
ATOM   2751 C  CD    . LYS D 2 119 ? -18.976 7.714   37.961 1.00 44.57 ? 119 LYS B CD    1 
ATOM   2752 C  CE    . LYS D 2 119 ? -18.637 9.185   38.283 1.00 49.73 ? 119 LYS B CE    1 
ATOM   2753 N  NZ    . LYS D 2 119 ? -18.184 9.969   37.083 1.00 51.59 ? 119 LYS B NZ    1 
ATOM   2754 N  N     . THR D 2 120 ? -17.981 3.929   39.661 1.00 29.80 ? 120 THR B N     1 
ATOM   2755 C  CA    . THR D 2 120 ? -17.809 2.799   38.758 1.00 30.22 ? 120 THR B CA    1 
ATOM   2756 C  C     . THR D 2 120 ? -18.311 1.508   39.395 1.00 31.82 ? 120 THR B C     1 
ATOM   2757 O  O     . THR D 2 120 ? -18.901 0.659   38.718 1.00 32.42 ? 120 THR B O     1 
ATOM   2758 C  CB    . THR D 2 120 ? -16.330 2.615   38.355 1.00 29.90 ? 120 THR B CB    1 
ATOM   2759 O  OG1   . THR D 2 120 ? -15.936 3.672   37.475 1.00 32.66 ? 120 THR B OG1   1 
ATOM   2760 C  CG2   . THR D 2 120 ? -16.127 1.292   37.651 1.00 29.09 ? 120 THR B CG2   1 
ATOM   2761 N  N     . ARG D 2 121 ? -18.074 1.362   40.696 1.00 32.38 ? 121 ARG B N     1 
ATOM   2762 C  CA    . ARG D 2 121 ? -18.529 0.184   41.424 1.00 33.20 ? 121 ARG B CA    1 
ATOM   2763 C  C     . ARG D 2 121 ? -19.946 0.394   41.954 1.00 33.56 ? 121 ARG B C     1 
ATOM   2764 O  O     . ARG D 2 121 ? -20.538 -0.506  42.553 1.00 33.76 ? 121 ARG B O     1 
ATOM   2765 C  CB    . ARG D 2 121 ? -17.573 -0.146  42.579 1.00 33.56 ? 121 ARG B CB    1 
ATOM   2766 C  CG    . ARG D 2 121 ? -16.127 -0.393  42.158 1.00 34.14 ? 121 ARG B CG    1 
ATOM   2767 C  CD    . ARG D 2 121 ? -15.978 -1.699  41.399 1.00 37.61 ? 121 ARG B CD    1 
ATOM   2768 N  NE    . ARG D 2 121 ? -16.730 -2.787  42.021 1.00 39.68 ? 121 ARG B NE    1 
ATOM   2769 C  CZ    . ARG D 2 121 ? -17.100 -3.899  41.388 1.00 40.64 ? 121 ARG B CZ    1 
ATOM   2770 N  NH1   . ARG D 2 121 ? -16.790 -4.073  40.110 1.00 41.36 ? 121 ARG B NH1   1 
ATOM   2771 N  NH2   . ARG D 2 121 ? -17.786 -4.834  42.028 1.00 40.31 ? 121 ARG B NH2   1 
ATOM   2772 N  N     . LYS D 2 122 ? -20.503 1.570   41.685 1.00 34.48 ? 122 LYS B N     1 
ATOM   2773 C  CA    . LYS D 2 122 ? -21.897 1.849   42.014 1.00 34.76 ? 122 LYS B CA    1 
ATOM   2774 C  C     . LYS D 2 122 ? -22.103 1.578   43.490 1.00 34.19 ? 122 LYS B C     1 
ATOM   2775 O  O     . LYS D 2 122 ? -22.907 0.740   43.869 1.00 33.72 ? 122 LYS B O     1 
ATOM   2776 C  CB    . LYS D 2 122 ? -22.848 0.966   41.184 1.00 35.22 ? 122 LYS B CB    1 
ATOM   2777 C  CG    . LYS D 2 122 ? -22.697 1.086   39.667 1.00 36.89 ? 122 LYS B CG    1 
ATOM   2778 C  CD    . LYS D 2 122 ? -23.896 0.462   38.927 1.00 40.23 ? 122 LYS B CD    1 
ATOM   2779 C  CE    . LYS D 2 122 ? -23.450 -0.512  37.822 1.00 43.90 ? 122 LYS B CE    1 
ATOM   2780 N  NZ    . LYS D 2 122 ? -22.853 0.186   36.624 1.00 47.63 ? 122 LYS B NZ    1 
ATOM   2781 N  N     . LEU D 2 123 ? -21.306 2.226   44.320 1.00 34.50 ? 123 LEU B N     1 
ATOM   2782 C  CA    . LEU D 2 123 ? -21.369 1.982   45.742 1.00 34.84 ? 123 LEU B CA    1 
ATOM   2783 C  C     . LEU D 2 123 ? -22.312 2.951   46.436 1.00 36.16 ? 123 LEU B C     1 
ATOM   2784 O  O     . LEU D 2 123 ? -22.657 3.996   45.889 1.00 36.46 ? 123 LEU B O     1 
ATOM   2785 C  CB    . LEU D 2 123 ? -19.967 2.021   46.358 1.00 34.10 ? 123 LEU B CB    1 
ATOM   2786 C  CG    . LEU D 2 123 ? -19.046 0.909   45.843 1.00 31.85 ? 123 LEU B CG    1 
ATOM   2787 C  CD1   . LEU D 2 123 ? -17.642 1.028   46.398 1.00 25.71 ? 123 LEU B CD1   1 
ATOM   2788 C  CD2   . LEU D 2 123 ? -19.645 -0.465  46.144 1.00 30.66 ? 123 LEU B CD2   1 
ATOM   2789 N  N     . ASN D 2 124 ? -22.775 2.570   47.620 1.00 38.36 ? 124 ASN B N     1 
ATOM   2790 C  CA    . ASN D 2 124 ? -23.542 3.474   48.459 1.00 40.56 ? 124 ASN B CA    1 
ATOM   2791 C  C     . ASN D 2 124 ? -23.234 3.318   49.939 1.00 42.30 ? 124 ASN B C     1 
ATOM   2792 O  O     . ASN D 2 124 ? -23.466 2.257   50.513 1.00 42.84 ? 124 ASN B O     1 
ATOM   2793 C  CB    . ASN D 2 124 ? -25.029 3.278   48.226 1.00 39.90 ? 124 ASN B CB    1 
ATOM   2794 C  CG    . ASN D 2 124 ? -25.793 4.568   48.313 1.00 43.11 ? 124 ASN B CG    1 
ATOM   2795 O  OD1   . ASN D 2 124 ? -26.044 5.214   47.298 1.00 50.51 ? 124 ASN B OD1   1 
ATOM   2796 N  ND2   . ASN D 2 124 ? -26.085 5.008   49.535 1.00 43.22 ? 124 ASN B ND2   1 
ATOM   2797 N  N     . VAL D 2 125 ? -22.767 4.394   50.570 1.00 44.56 ? 125 VAL B N     1 
ATOM   2798 C  CA    . VAL D 2 125 ? -22.695 4.441   52.032 1.00 47.97 ? 125 VAL B CA    1 
ATOM   2799 C  C     . VAL D 2 125 ? -23.455 5.619   52.616 1.00 49.57 ? 125 VAL B C     1 
ATOM   2800 O  O     . VAL D 2 125 ? -23.515 6.693   52.013 1.00 49.22 ? 125 VAL B O     1 
ATOM   2801 C  CB    . VAL D 2 125 ? -21.236 4.487   52.550 1.00 47.94 ? 125 VAL B CB    1 
ATOM   2802 C  CG1   . VAL D 2 125 ? -20.660 3.080   52.651 1.00 50.26 ? 125 VAL B CG1   1 
ATOM   2803 C  CG2   . VAL D 2 125 ? -20.379 5.372   51.657 1.00 48.84 ? 125 VAL B CG2   1 
ATOM   2804 N  N     . GLN D 2 126 ? -23.938 5.459   53.838 1.00 53.15 ? 126 GLN B N     1 
ATOM   2805 C  CA    . GLN D 2 126 ? -24.292 6.603   54.688 1.00 56.73 ? 126 GLN B CA    1 
ATOM   2806 C  C     . GLN D 2 126 ? -23.050 7.405   55.078 1.00 58.27 ? 126 GLN B C     1 
ATOM   2807 O  O     . GLN D 2 126 ? -22.105 6.864   55.664 1.00 58.27 ? 126 GLN B O     1 
ATOM   2808 C  CB    . GLN D 2 126 ? -25.029 6.144   55.957 1.00 56.95 ? 126 GLN B CB    1 
ATOM   2809 C  CG    . GLN D 2 126 ? -25.510 7.301   56.862 1.00 59.92 ? 126 GLN B CG    1 
ATOM   2810 C  CD    . GLN D 2 126 ? -24.367 8.254   57.290 1.00 61.42 ? 126 GLN B CD    1 
ATOM   2811 O  OE1   . GLN D 2 126 ? -23.181 7.930   57.167 1.00 64.48 ? 126 GLN B OE1   1 
ATOM   2812 N  NE2   . GLN D 2 126 ? -24.734 9.425   57.804 1.00 56.10 ? 126 GLN B NE2   1 
ATOM   2813 N  N     . THR D 2 127 ? -23.046 8.680   54.695 1.00 60.43 ? 127 THR B N     1 
ATOM   2814 C  CA    . THR D 2 127 ? -21.941 9.576   54.999 1.00 62.71 ? 127 THR B CA    1 
ATOM   2815 C  C     . THR D 2 127 ? -22.406 10.675  55.948 1.00 65.13 ? 127 THR B C     1 
ATOM   2816 O  O     . THR D 2 127 ? -23.518 11.186  55.813 1.00 65.71 ? 127 THR B O     1 
ATOM   2817 C  CB    . THR D 2 127 ? -21.399 10.233  53.710 1.00 62.83 ? 127 THR B CB    1 
ATOM   2818 O  OG1   . THR D 2 127 ? -22.460 10.937  53.050 1.00 63.29 ? 127 THR B OG1   1 
ATOM   2819 C  CG2   . THR D 2 127 ? -20.840 9.185   52.760 1.00 62.81 ? 127 THR B CG2   1 
ATOM   2820 N  N     . PRO D 2 128 ? -21.521 11.049  56.927 1.00 67.42 ? 128 PRO B N     1 
ATOM   2821 C  CA    . PRO D 2 128 ? -22.008 11.849  58.061 1.00 69.01 ? 128 PRO B CA    1 
ATOM   2822 C  C     . PRO D 2 128 ? -22.557 13.213  57.617 1.00 70.26 ? 128 PRO B C     1 
ATOM   2823 O  O     . PRO D 2 128 ? -22.049 13.798  56.649 1.00 70.92 ? 128 PRO B O     1 
ATOM   2824 C  CB    . PRO D 2 128 ? -20.744 12.046  58.904 1.00 69.04 ? 128 PRO B CB    1 
ATOM   2825 C  CG    . PRO D 2 128 ? -19.638 12.094  57.889 1.00 67.86 ? 128 PRO B CG    1 
ATOM   2826 C  CD    . PRO D 2 128 ? -20.045 11.130  56.782 1.00 67.27 ? 128 PRO B CD    1 
ATOM   2827 N  N     . PRO D 2 129 ? -23.556 13.737  58.351 1.00 71.02 ? 129 PRO B N     1 
ATOM   2828 C  CA    . PRO D 2 129 ? -24.114 15.065  58.062 1.00 71.28 ? 129 PRO B CA    1 
ATOM   2829 C  C     . PRO D 2 129 ? -23.111 16.193  58.323 1.00 71.84 ? 129 PRO B C     1 
ATOM   2830 O  O     . PRO D 2 129 ? -22.357 16.140  59.294 1.00 71.52 ? 129 PRO B O     1 
ATOM   2831 C  CB    . PRO D 2 129 ? -25.293 15.165  59.035 1.00 71.80 ? 129 PRO B CB    1 
ATOM   2832 C  CG    . PRO D 2 129 ? -24.953 14.209  60.146 1.00 71.34 ? 129 PRO B CG    1 
ATOM   2833 C  CD    . PRO D 2 129 ? -24.243 13.078  59.479 1.00 71.12 ? 129 PRO B CD    1 
ATOM   2834 N  N     . GLY D 2 130 ? -23.099 17.192  57.446 1.00 72.31 ? 130 GLY B N     1 
ATOM   2835 C  CA    . GLY D 2 130 ? -22.288 18.388  57.657 1.00 73.08 ? 130 GLY B CA    1 
ATOM   2836 C  C     . GLY D 2 130 ? -20.900 18.275  57.048 1.00 73.83 ? 130 GLY B C     1 
ATOM   2837 O  O     . GLY D 2 130 ? -20.051 19.165  57.222 1.00 74.77 ? 130 GLY B O     1 
ATOM   2838 N  N     . LEU D 2 131 ? -20.655 17.174  56.346 1.00 72.95 ? 131 LEU B N     1 
ATOM   2839 C  CA    . LEU D 2 131 ? -19.320 16.882  55.859 1.00 72.70 ? 131 LEU B CA    1 
ATOM   2840 C  C     . LEU D 2 131 ? -19.379 16.541  54.385 1.00 71.93 ? 131 LEU B C     1 
ATOM   2841 O  O     . LEU D 2 131 ? -20.036 15.572  53.995 1.00 72.88 ? 131 LEU B O     1 
ATOM   2842 C  CB    . LEU D 2 131 ? -18.698 15.727  56.658 1.00 73.65 ? 131 LEU B CB    1 
ATOM   2843 C  CG    . LEU D 2 131 ? -18.103 16.075  58.035 1.00 75.47 ? 131 LEU B CG    1 
ATOM   2844 C  CD1   . LEU D 2 131 ? -17.083 15.000  58.503 1.00 76.35 ? 131 LEU B CD1   1 
ATOM   2845 C  CD2   . LEU D 2 131 ? -17.473 17.497  58.041 1.00 73.25 ? 131 LEU B CD2   1 
ATOM   2846 N  N     . HIS D 2 132 ? -18.744 17.379  53.562 1.00 69.74 ? 132 HIS B N     1 
ATOM   2847 C  CA    . HIS D 2 132 ? -18.764 17.206  52.108 1.00 67.78 ? 132 HIS B CA    1 
ATOM   2848 C  C     . HIS D 2 132 ? -17.524 16.458  51.665 1.00 65.05 ? 132 HIS B C     1 
ATOM   2849 O  O     . HIS D 2 132 ? -16.612 16.239  52.470 1.00 65.05 ? 132 HIS B O     1 
ATOM   2850 C  CB    . HIS D 2 132 ? -18.809 18.561  51.421 1.00 68.87 ? 132 HIS B CB    1 
ATOM   2851 C  CG    . HIS D 2 132 ? -17.607 19.415  51.701 1.00 73.51 ? 132 HIS B CG    1 
ATOM   2852 N  ND1   . HIS D 2 132 ? -17.549 20.289  52.770 1.00 77.58 ? 132 HIS B ND1   1 
ATOM   2853 C  CD2   . HIS D 2 132 ? -16.402 19.502  51.073 1.00 74.52 ? 132 HIS B CD2   1 
ATOM   2854 C  CE1   . HIS D 2 132 ? -16.375 20.907  52.766 1.00 76.54 ? 132 HIS B CE1   1 
ATOM   2855 N  NE2   . HIS D 2 132 ? -15.658 20.442  51.752 1.00 74.63 ? 132 HIS B NE2   1 
ATOM   2856 N  N     . HIS D 2 133 ? -17.481 16.063  50.388 1.00 61.91 ? 133 HIS B N     1 
ATOM   2857 C  CA    . HIS D 2 133 ? -16.350 15.277  49.899 1.00 60.05 ? 133 HIS B CA    1 
ATOM   2858 C  C     . HIS D 2 133 ? -15.069 16.066  50.131 1.00 56.80 ? 133 HIS B C     1 
ATOM   2859 O  O     . HIS D 2 133 ? -15.111 17.269  50.372 1.00 55.63 ? 133 HIS B O     1 
ATOM   2860 C  CB    . HIS D 2 133 ? -16.534 14.854  48.431 1.00 61.03 ? 133 HIS B CB    1 
ATOM   2861 C  CG    . HIS D 2 133 ? -15.747 15.676  47.455 1.00 67.22 ? 133 HIS B CG    1 
ATOM   2862 N  ND1   . HIS D 2 133 ? -14.749 15.139  46.663 1.00 70.69 ? 133 HIS B ND1   1 
ATOM   2863 C  CD2   . HIS D 2 133 ? -15.846 16.984  47.104 1.00 69.64 ? 133 HIS B CD2   1 
ATOM   2864 C  CE1   . HIS D 2 133 ? -14.257 16.085  45.880 1.00 71.52 ? 133 HIS B CE1   1 
ATOM   2865 N  NE2   . HIS D 2 133 ? -14.899 17.215  46.135 1.00 70.32 ? 133 HIS B NE2   1 
ATOM   2866 N  N     . HIS D 2 134 ? -13.953 15.351  50.205 1.00 53.62 ? 134 HIS B N     1 
ATOM   2867 C  CA    . HIS D 2 134 ? -12.671 15.958  50.526 1.00 50.26 ? 134 HIS B CA    1 
ATOM   2868 C  C     . HIS D 2 134 ? -12.638 16.560  51.927 1.00 45.85 ? 134 HIS B C     1 
ATOM   2869 O  O     . HIS D 2 134 ? -11.827 17.439  52.219 1.00 44.36 ? 134 HIS B O     1 
ATOM   2870 C  CB    . HIS D 2 134 ? -12.281 16.993  49.469 1.00 51.89 ? 134 HIS B CB    1 
ATOM   2871 C  CG    . HIS D 2 134 ? -11.543 16.403  48.300 1.00 57.15 ? 134 HIS B CG    1 
ATOM   2872 N  ND1   . HIS D 2 134 ? -10.426 15.598  48.448 1.00 57.60 ? 134 HIS B ND1   1 
ATOM   2873 C  CD2   . HIS D 2 134 ? -11.784 16.462  46.965 1.00 62.03 ? 134 HIS B CD2   1 
ATOM   2874 C  CE1   . HIS D 2 134 ? -9.992  15.216  47.255 1.00 58.82 ? 134 HIS B CE1   1 
ATOM   2875 N  NE2   . HIS D 2 134 ? -10.799 15.725  46.337 1.00 63.38 ? 134 HIS B NE2   1 
ATOM   2876 N  N     . ARG D 2 135 ? -13.437 15.983  52.819 1.00 40.87 ? 135 ARG B N     1 
ATOM   2877 C  CA    . ARG D 2 135 ? -13.162 16.068  54.238 1.00 36.02 ? 135 ARG B CA    1 
ATOM   2878 C  C     . ARG D 2 135 ? -12.687 14.729  54.766 1.00 33.56 ? 135 ARG B C     1 
ATOM   2879 O  O     . ARG D 2 135 ? -13.126 13.681  54.305 1.00 33.57 ? 135 ARG B O     1 
ATOM   2880 C  CB    . ARG D 2 135 ? -14.408 16.514  54.991 1.00 36.59 ? 135 ARG B CB    1 
ATOM   2881 C  CG    . ARG D 2 135 ? -14.808 17.934  54.713 1.00 30.93 ? 135 ARG B CG    1 
ATOM   2882 C  CD    . ARG D 2 135 ? -13.684 18.889  55.062 1.00 28.28 ? 135 ARG B CD    1 
ATOM   2883 N  NE    . ARG D 2 135 ? -13.478 18.978  56.510 1.00 29.25 ? 135 ARG B NE    1 
ATOM   2884 C  CZ    . ARG D 2 135 ? -14.047 19.891  57.302 1.00 24.66 ? 135 ARG B CZ    1 
ATOM   2885 N  NH1   . ARG D 2 135 ? -14.832 20.832  56.789 1.00 28.67 ? 135 ARG B NH1   1 
ATOM   2886 N  NH2   . ARG D 2 135 ? -13.820 19.871  58.610 1.00 20.43 ? 135 ARG B NH2   1 
ATOM   2887 N  N     . ALA D 2 136 ? -11.799 14.770  55.752 1.00 31.24 ? 136 ALA B N     1 
ATOM   2888 C  CA    . ALA D 2 136 ? -11.155 13.563  56.233 1.00 29.77 ? 136 ALA B CA    1 
ATOM   2889 C  C     . ALA D 2 136 ? -12.170 12.432  56.433 1.00 29.40 ? 136 ALA B C     1 
ATOM   2890 O  O     . ALA D 2 136 ? -11.897 11.276  56.122 1.00 31.55 ? 136 ALA B O     1 
ATOM   2891 C  CB    . ALA D 2 136 ? -10.404 13.839  57.512 1.00 29.09 ? 136 ALA B CB    1 
ATOM   2892 N  N     . LEU D 2 137 ? -13.317 12.759  57.012 1.00 27.27 ? 137 LEU B N     1 
ATOM   2893 C  CA    . LEU D 2 137 ? -14.224 11.724  57.484 1.00 25.06 ? 137 LEU B CA    1 
ATOM   2894 C  C     . LEU D 2 137 ? -15.109 11.205  56.353 1.00 24.82 ? 137 LEU B C     1 
ATOM   2895 O  O     . LEU D 2 137 ? -15.156 10.005  56.086 1.00 26.88 ? 137 LEU B O     1 
ATOM   2896 C  CB    . LEU D 2 137 ? -15.079 12.246  58.635 1.00 24.31 ? 137 LEU B CB    1 
ATOM   2897 C  CG    . LEU D 2 137 ? -16.010 11.235  59.316 1.00 24.90 ? 137 LEU B CG    1 
ATOM   2898 C  CD1   . LEU D 2 137 ? -15.272 9.974   59.698 1.00 18.28 ? 137 LEU B CD1   1 
ATOM   2899 C  CD2   . LEU D 2 137 ? -16.678 11.849  60.535 1.00 20.46 ? 137 LEU B CD2   1 
ATOM   2900 N  N     . TYR D 2 138 ? -15.745 12.125  55.642 1.00 21.65 ? 138 TYR B N     1 
ATOM   2901 C  CA    . TYR D 2 138 ? -16.474 11.777  54.452 1.00 19.84 ? 138 TYR B CA    1 
ATOM   2902 C  C     . TYR D 2 138 ? -15.698 10.802  53.573 1.00 19.06 ? 138 TYR B C     1 
ATOM   2903 O  O     . TYR D 2 138 ? -16.187 9.725   53.259 1.00 17.51 ? 138 TYR B O     1 
ATOM   2904 C  CB    . TYR D 2 138 ? -16.820 13.028  53.658 1.00 20.21 ? 138 TYR B CB    1 
ATOM   2905 C  CG    . TYR D 2 138 ? -17.785 12.770  52.533 1.00 20.96 ? 138 TYR B CG    1 
ATOM   2906 C  CD1   . TYR D 2 138 ? -17.329 12.442  51.264 1.00 20.34 ? 138 TYR B CD1   1 
ATOM   2907 C  CD2   . TYR D 2 138 ? -19.156 12.785  52.754 1.00 23.02 ? 138 TYR B CD2   1 
ATOM   2908 C  CE1   . TYR D 2 138 ? -18.211 12.191  50.235 1.00 22.32 ? 138 TYR B CE1   1 
ATOM   2909 C  CE2   . TYR D 2 138 ? -20.045 12.545  51.728 1.00 22.83 ? 138 TYR B CE2   1 
ATOM   2910 C  CZ    . TYR D 2 138 ? -19.567 12.259  50.467 1.00 24.10 ? 138 TYR B CZ    1 
ATOM   2911 O  OH    . TYR D 2 138 ? -20.447 11.976  49.445 1.00 27.23 ? 138 TYR B OH    1 
ATOM   2912 N  N     . ASP D 2 139 ? -14.503 11.200  53.148 1.00 18.30 ? 139 ASP B N     1 
ATOM   2913 C  CA    . ASP D 2 139 ? -13.698 10.359  52.284 1.00 19.25 ? 139 ASP B CA    1 
ATOM   2914 C  C     . ASP D 2 139 ? -13.346 9.004   52.925 1.00 18.24 ? 139 ASP B C     1 
ATOM   2915 O  O     . ASP D 2 139 ? -13.191 8.008   52.225 1.00 18.06 ? 139 ASP B O     1 
ATOM   2916 C  CB    . ASP D 2 139 ? -12.437 11.091  51.847 1.00 20.36 ? 139 ASP B CB    1 
ATOM   2917 C  CG    . ASP D 2 139 ? -12.720 12.186  50.821 1.00 28.63 ? 139 ASP B CG    1 
ATOM   2918 O  OD1   . ASP D 2 139 ? -13.863 12.250  50.305 1.00 29.63 ? 139 ASP B OD1   1 
ATOM   2919 O  OD2   . ASP D 2 139 ? -11.791 12.977  50.524 1.00 32.91 ? 139 ASP B OD2   1 
ATOM   2920 N  N     . CYS D 2 140 ? -13.253 8.969   54.250 1.00 16.43 ? 140 CYS B N     1 
ATOM   2921 C  CA    . CYS D 2 140 ? -13.108 7.704   54.975 1.00 18.49 ? 140 CYS B CA    1 
ATOM   2922 C  C     . CYS D 2 140 ? -14.254 6.742   54.664 1.00 18.19 ? 140 CYS B C     1 
ATOM   2923 O  O     . CYS D 2 140 ? -14.033 5.569   54.381 1.00 19.11 ? 140 CYS B O     1 
ATOM   2924 C  CB    . CYS D 2 140 ? -13.031 7.946   56.483 1.00 16.89 ? 140 CYS B CB    1 
ATOM   2925 S  SG    . CYS D 2 140 ? -11.370 8.316   57.090 1.00 24.01 ? 140 CYS B SG    1 
ATOM   2926 N  N     . TYR D 2 141 ? -15.477 7.249   54.706 1.00 16.91 ? 141 TYR B N     1 
ATOM   2927 C  CA    . TYR D 2 141 ? -16.636 6.427   54.454 1.00 17.09 ? 141 TYR B CA    1 
ATOM   2928 C  C     . TYR D 2 141 ? -16.622 5.931   53.025 1.00 17.62 ? 141 TYR B C     1 
ATOM   2929 O  O     . TYR D 2 141 ? -17.063 4.822   52.737 1.00 17.51 ? 141 TYR B O     1 
ATOM   2930 C  CB    . TYR D 2 141 ? -17.917 7.208   54.738 1.00 16.98 ? 141 TYR B CB    1 
ATOM   2931 C  CG    . TYR D 2 141 ? -18.310 7.206   56.201 1.00 16.98 ? 141 TYR B CG    1 
ATOM   2932 C  CD1   . TYR D 2 141 ? -18.978 6.122   56.758 1.00 16.57 ? 141 TYR B CD1   1 
ATOM   2933 C  CD2   . TYR D 2 141 ? -17.999 8.277   57.027 1.00 16.18 ? 141 TYR B CD2   1 
ATOM   2934 C  CE1   . TYR D 2 141 ? -19.343 6.111   58.103 1.00 17.87 ? 141 TYR B CE1   1 
ATOM   2935 C  CE2   . TYR D 2 141 ? -18.361 8.281   58.366 1.00 17.45 ? 141 TYR B CE2   1 
ATOM   2936 C  CZ    . TYR D 2 141 ? -19.033 7.192   58.899 1.00 20.08 ? 141 TYR B CZ    1 
ATOM   2937 O  OH    . TYR D 2 141 ? -19.382 7.185   60.234 1.00 20.98 ? 141 TYR B OH    1 
ATOM   2938 N  N     . ILE D 2 142 ? -16.108 6.758   52.127 1.00 17.49 ? 142 ILE B N     1 
ATOM   2939 C  CA    . ILE D 2 142 ? -15.950 6.361   50.746 1.00 17.41 ? 142 ILE B CA    1 
ATOM   2940 C  C     . ILE D 2 142 ? -14.887 5.261   50.609 1.00 17.86 ? 142 ILE B C     1 
ATOM   2941 O  O     . ILE D 2 142 ? -15.145 4.206   50.037 1.00 19.10 ? 142 ILE B O     1 
ATOM   2942 C  CB    . ILE D 2 142 ? -15.610 7.562   49.857 1.00 17.06 ? 142 ILE B CB    1 
ATOM   2943 C  CG1   . ILE D 2 142 ? -16.658 8.661   50.032 1.00 18.11 ? 142 ILE B CG1   1 
ATOM   2944 C  CG2   . ILE D 2 142 ? -15.506 7.139   48.403 1.00 18.72 ? 142 ILE B CG2   1 
ATOM   2945 C  CD1   . ILE D 2 142 ? -18.036 8.295   49.524 1.00 17.46 ? 142 ILE B CD1   1 
ATOM   2946 N  N     . THR D 2 143 ? -13.724 5.462   51.211 1.00 17.85 ? 143 THR B N     1 
ATOM   2947 C  CA    . THR D 2 143 ? -12.652 4.490   51.053 1.00 18.19 ? 143 THR B CA    1 
ATOM   2948 C  C     . THR D 2 143 ? -12.962 3.178   51.775 1.00 18.71 ? 143 THR B C     1 
ATOM   2949 O  O     . THR D 2 143 ? -12.530 2.118   51.349 1.00 18.32 ? 143 THR B O     1 
ATOM   2950 C  CB    . THR D 2 143 ? -11.306 5.055   51.480 1.00 16.99 ? 143 THR B CB    1 
ATOM   2951 O  OG1   . THR D 2 143 ? -10.970 6.145   50.610 1.00 19.05 ? 143 THR B OG1   1 
ATOM   2952 C  CG2   . THR D 2 143 ? -10.224 3.991   51.387 1.00 14.03 ? 143 THR B CG2   1 
ATOM   2953 N  N     . ALA D 2 144 ? -13.822 3.244   52.786 1.00 19.04 ? 144 ALA B N     1 
ATOM   2954 C  CA    . ALA D 2 144 ? -14.186 2.050   53.550 1.00 18.56 ? 144 ALA B CA    1 
ATOM   2955 C  C     . ALA D 2 144 ? -15.201 1.227   52.775 1.00 18.29 ? 144 ALA B C     1 
ATOM   2956 O  O     . ALA D 2 144 ? -15.085 -0.002  52.695 1.00 17.66 ? 144 ALA B O     1 
ATOM   2957 C  CB    . ALA D 2 144 ? -14.744 2.432   54.917 1.00 18.17 ? 144 ALA B CB    1 
ATOM   2958 N  N     . ALA D 2 145 ? -16.175 1.916   52.173 1.00 15.94 ? 145 ALA B N     1 
ATOM   2959 C  CA    . ALA D 2 145 ? -17.118 1.275   51.273 1.00 13.93 ? 145 ALA B CA    1 
ATOM   2960 C  C     . ALA D 2 145 ? -16.365 0.541   50.193 1.00 14.34 ? 145 ALA B C     1 
ATOM   2961 O  O     . ALA D 2 145 ? -16.748 -0.553  49.797 1.00 17.45 ? 145 ALA B O     1 
ATOM   2962 C  CB    . ALA D 2 145 ? -18.051 2.285   50.660 1.00 11.84 ? 145 ALA B CB    1 
ATOM   2963 N  N     . LEU D 2 146 ? -15.288 1.144   49.714 1.00 14.08 ? 146 LEU B N     1 
ATOM   2964 C  CA    . LEU D 2 146 ? -14.525 0.562   48.627 1.00 13.41 ? 146 LEU B CA    1 
ATOM   2965 C  C     . LEU D 2 146 ? -13.785 -0.696  49.082 1.00 13.45 ? 146 LEU B C     1 
ATOM   2966 O  O     . LEU D 2 146 ? -13.839 -1.735  48.413 1.00 14.56 ? 146 LEU B O     1 
ATOM   2967 C  CB    . LEU D 2 146 ? -13.574 1.590   48.034 1.00 11.54 ? 146 LEU B CB    1 
ATOM   2968 C  CG    . LEU D 2 146 ? -12.588 1.072   46.999 1.00 16.31 ? 146 LEU B CG    1 
ATOM   2969 C  CD1   . LEU D 2 146 ? -13.318 0.535   45.755 1.00 18.02 ? 146 LEU B CD1   1 
ATOM   2970 C  CD2   . LEU D 2 146 ? -11.610 2.183   46.620 1.00 15.64 ? 146 LEU B CD2   1 
ATOM   2971 N  N     . LEU D 2 147 ? -13.191 -0.628  50.269 1.00 12.55 ? 147 LEU B N     1 
ATOM   2972 C  CA    . LEU D 2 147 ? -12.530 -1.774  50.881 1.00 11.61 ? 147 LEU B CA    1 
ATOM   2973 C  C     . LEU D 2 147 ? -13.495 -2.953  51.010 1.00 12.98 ? 147 LEU B C     1 
ATOM   2974 O  O     . LEU D 2 147 ? -13.222 -4.052  50.541 1.00 13.78 ? 147 LEU B O     1 
ATOM   2975 C  CB    . LEU D 2 147 ? -12.009 -1.386  52.265 1.00 10.63 ? 147 LEU B CB    1 
ATOM   2976 C  CG    . LEU D 2 147 ? -11.220 -2.462  52.997 1.00 6.61  ? 147 LEU B CG    1 
ATOM   2977 C  CD1   . LEU D 2 147 ? -9.992  -2.853  52.172 1.00 3.75  ? 147 LEU B CD1   1 
ATOM   2978 C  CD2   . LEU D 2 147 ? -10.819 -1.995  54.390 1.00 2.00  ? 147 LEU B CD2   1 
ATOM   2979 N  N     . ILE D 2 148 ? -14.641 -2.699  51.618 1.00 13.73 ? 148 ILE B N     1 
ATOM   2980 C  CA    . ILE D 2 148 ? -15.649 -3.722  51.812 1.00 15.37 ? 148 ILE B CA    1 
ATOM   2981 C  C     . ILE D 2 148 ? -16.019 -4.371  50.476 1.00 17.21 ? 148 ILE B C     1 
ATOM   2982 O  O     . ILE D 2 148 ? -16.165 -5.599  50.383 1.00 18.41 ? 148 ILE B O     1 
ATOM   2983 C  CB    . ILE D 2 148 ? -16.893 -3.140  52.500 1.00 14.10 ? 148 ILE B CB    1 
ATOM   2984 C  CG1   . ILE D 2 148 ? -16.607 -2.900  53.982 1.00 13.62 ? 148 ILE B CG1   1 
ATOM   2985 C  CG2   . ILE D 2 148 ? -18.096 -4.040  52.294 1.00 13.19 ? 148 ILE B CG2   1 
ATOM   2986 C  CD1   . ILE D 2 148 ? -17.459 -1.805  54.609 1.00 16.26 ? 148 ILE B CD1   1 
ATOM   2987 N  N     . ASP D 2 149 ? -16.086 -3.565  49.425 1.00 17.75 ? 149 ASP B N     1 
ATOM   2988 C  CA    . ASP D 2 149 ? -16.364 -4.115  48.102 1.00 20.79 ? 149 ASP B CA    1 
ATOM   2989 C  C     . ASP D 2 149 ? -15.210 -4.995  47.626 1.00 19.96 ? 149 ASP B C     1 
ATOM   2990 O  O     . ASP D 2 149 ? -15.428 -6.092  47.114 1.00 21.17 ? 149 ASP B O     1 
ATOM   2991 C  CB    . ASP D 2 149 ? -16.660 -3.012  47.082 1.00 20.85 ? 149 ASP B CB    1 
ATOM   2992 C  CG    . ASP D 2 149 ? -17.171 -3.564  45.772 1.00 23.54 ? 149 ASP B CG    1 
ATOM   2993 O  OD1   . ASP D 2 149 ? -17.849 -4.615  45.803 1.00 29.24 ? 149 ASP B OD1   1 
ATOM   2994 O  OD2   . ASP D 2 149 ? -16.864 -2.981  44.708 1.00 22.16 ? 149 ASP B OD2   1 
ATOM   2995 N  N     . ILE D 2 150 ? -13.989 -4.556  47.921 1.00 19.14 ? 150 ILE B N     1 
ATOM   2996 C  CA    . ILE D 2 150 ? -12.787 -5.293  47.554 1.00 16.83 ? 150 ILE B CA    1 
ATOM   2997 C  C     . ILE D 2 150 ? -12.704 -6.630  48.313 1.00 16.41 ? 150 ILE B C     1 
ATOM   2998 O  O     . ILE D 2 150 ? -12.326 -7.654  47.750 1.00 14.90 ? 150 ILE B O     1 
ATOM   2999 C  CB    . ILE D 2 150 ? -11.511 -4.435  47.793 1.00 14.76 ? 150 ILE B CB    1 
ATOM   3000 C  CG1   . ILE D 2 150 ? -11.413 -3.307  46.757 1.00 14.48 ? 150 ILE B CG1   1 
ATOM   3001 C  CG2   . ILE D 2 150 ? -10.261 -5.281  47.725 1.00 11.05 ? 150 ILE B CG2   1 
ATOM   3002 C  CD1   . ILE D 2 150 ? -10.255 -2.309  47.024 1.00 9.19  ? 150 ILE B CD1   1 
ATOM   3003 N  N     . MET D 2 151 ? -13.110 -6.615  49.576 1.00 16.85 ? 151 MET B N     1 
ATOM   3004 C  CA    . MET D 2 151 ? -13.087 -7.819  50.406 1.00 17.59 ? 151 MET B CA    1 
ATOM   3005 C  C     . MET D 2 151 ? -14.198 -8.802  50.018 1.00 18.97 ? 151 MET B C     1 
ATOM   3006 O  O     . MET D 2 151 ? -13.991 -10.003 50.015 1.00 20.11 ? 151 MET B O     1 
ATOM   3007 C  CB    . MET D 2 151 ? -13.199 -7.451  51.878 1.00 15.20 ? 151 MET B CB    1 
ATOM   3008 C  CG    . MET D 2 151 ? -12.083 -6.530  52.375 1.00 17.50 ? 151 MET B CG    1 
ATOM   3009 S  SD    . MET D 2 151 ? -12.246 -6.084  54.115 1.00 20.66 ? 151 MET B SD    1 
ATOM   3010 C  CE    . MET D 2 151 ? -11.810 -7.658  54.895 1.00 14.59 ? 151 MET B CE    1 
ATOM   3011 N  N     . ASN D 2 152 ? -15.367 -8.273  49.670 1.00 20.47 ? 152 ASN B N     1 
ATOM   3012 C  CA    . ASN D 2 152 ? -16.496 -9.094  49.234 1.00 20.18 ? 152 ASN B CA    1 
ATOM   3013 C  C     . ASN D 2 152 ? -16.296 -9.629  47.817 1.00 20.55 ? 152 ASN B C     1 
ATOM   3014 O  O     . ASN D 2 152 ? -17.044 -10.469 47.368 1.00 22.16 ? 152 ASN B O     1 
ATOM   3015 C  CB    . ASN D 2 152 ? -17.806 -8.292  49.292 1.00 19.36 ? 152 ASN B CB    1 
ATOM   3016 C  CG    . ASN D 2 152 ? -18.358 -8.133  50.715 1.00 21.54 ? 152 ASN B CG    1 
ATOM   3017 O  OD1   . ASN D 2 152 ? -17.893 -8.763  51.664 1.00 26.85 ? 152 ASN B OD1   1 
ATOM   3018 N  ND2   . ASN D 2 152 ? -19.396 -7.316  50.846 1.00 25.79 ? 152 ASN B ND2   1 
ATOM   3019 N  N     . THR D 2 153 ? -15.325 -9.082  47.096 1.00 20.77 ? 153 THR B N     1 
ATOM   3020 C  CA    . THR D 2 153 ? -15.078 -9.478  45.716 1.00 19.65 ? 153 THR B CA    1 
ATOM   3021 C  C     . THR D 2 153 ? -13.948 -10.503 45.634 1.00 19.38 ? 153 THR B C     1 
ATOM   3022 O  O     . THR D 2 153 ? -13.936 -11.366 44.758 1.00 19.15 ? 153 THR B O     1 
ATOM   3023 C  CB    . THR D 2 153 ? -14.744 -8.256  44.825 1.00 18.89 ? 153 THR B CB    1 
ATOM   3024 O  OG1   . THR D 2 153 ? -15.878 -7.381  44.773 1.00 22.00 ? 153 THR B OG1   1 
ATOM   3025 C  CG2   . THR D 2 153 ? -14.411 -8.700  43.399 1.00 17.89 ? 153 THR B CG2   1 
ATOM   3026 N  N     . SER D 2 154 ? -13.016 -10.425 46.568 1.00 18.41 ? 154 SER B N     1 
ATOM   3027 C  CA    . SER D 2 154 ? -11.800 -11.197 46.461 1.00 18.28 ? 154 SER B CA    1 
ATOM   3028 C  C     . SER D 2 154 ? -11.678 -12.203 47.588 1.00 18.20 ? 154 SER B C     1 
ATOM   3029 O  O     . SER D 2 154 ? -10.887 -13.143 47.497 1.00 18.79 ? 154 SER B O     1 
ATOM   3030 C  CB    . SER D 2 154 ? -10.593 -10.271 46.486 1.00 17.75 ? 154 SER B CB    1 
ATOM   3031 O  OG    . SER D 2 154 ? -10.280 -9.903  47.823 1.00 18.46 ? 154 SER B OG    1 
ATOM   3032 N  N     . GLY D 2 155 ? -12.346 -11.915 48.703 1.00 17.08 ? 155 GLY B N     1 
ATOM   3033 C  CA    . GLY D 2 155 ? -12.137 -12.650 49.949 1.00 17.96 ? 155 GLY B CA    1 
ATOM   3034 C  C     . GLY D 2 155 ? -10.781 -12.442 50.625 1.00 18.26 ? 155 GLY B C     1 
ATOM   3035 O  O     . GLY D 2 155 ? -10.457 -13.128 51.608 1.00 18.98 ? 155 GLY B O     1 
ATOM   3036 N  N     . TRP D 2 156 ? -9.979  -11.523 50.095 1.00 17.90 ? 156 TRP B N     1 
ATOM   3037 C  CA    . TRP D 2 156 ? -8.690  -11.187 50.707 1.00 19.12 ? 156 TRP B CA    1 
ATOM   3038 C  C     . TRP D 2 156 ? -8.768  -10.796 52.189 1.00 20.28 ? 156 TRP B C     1 
ATOM   3039 O  O     . TRP D 2 156 ? -9.527  -9.897  52.579 1.00 20.41 ? 156 TRP B O     1 
ATOM   3040 C  CB    . TRP D 2 156 ? -7.964  -10.102 49.913 1.00 19.01 ? 156 TRP B CB    1 
ATOM   3041 C  CG    . TRP D 2 156 ? -7.478  -10.567 48.599 1.00 21.42 ? 156 TRP B CG    1 
ATOM   3042 C  CD1   . TRP D 2 156 ? -7.122  -11.840 48.261 1.00 23.57 ? 156 TRP B CD1   1 
ATOM   3043 C  CD2   . TRP D 2 156 ? -7.260  -9.767  47.436 1.00 24.69 ? 156 TRP B CD2   1 
ATOM   3044 N  NE1   . TRP D 2 156 ? -6.732  -11.889 46.947 1.00 26.27 ? 156 TRP B NE1   1 
ATOM   3045 C  CE2   . TRP D 2 156 ? -6.800  -10.626 46.419 1.00 26.62 ? 156 TRP B CE2   1 
ATOM   3046 C  CE3   . TRP D 2 156 ? -7.425  -8.411  47.147 1.00 25.37 ? 156 TRP B CE3   1 
ATOM   3047 C  CZ2   . TRP D 2 156 ? -6.518  -10.174 45.132 1.00 28.10 ? 156 TRP B CZ2   1 
ATOM   3048 C  CZ3   . TRP D 2 156 ? -7.127  -7.962  45.866 1.00 25.21 ? 156 TRP B CZ3   1 
ATOM   3049 C  CH2   . TRP D 2 156 ? -6.679  -8.838  44.881 1.00 23.22 ? 156 TRP B CH2   1 
ATOM   3050 N  N     . THR D 2 157 ? -7.926  -11.441 52.997 1.00 20.48 ? 157 THR B N     1 
ATOM   3051 C  CA    . THR D 2 157 ? -7.725  -11.037 54.381 1.00 20.35 ? 157 THR B CA    1 
ATOM   3052 C  C     . THR D 2 157 ? -6.850  -9.787  54.503 1.00 19.64 ? 157 THR B C     1 
ATOM   3053 O  O     . THR D 2 157 ? -6.169  -9.376  53.552 1.00 18.29 ? 157 THR B O     1 
ATOM   3054 C  CB    . THR D 2 157 ? -7.065  -12.162 55.202 1.00 21.18 ? 157 THR B CB    1 
ATOM   3055 O  OG1   . THR D 2 157 ? -5.743  -12.385 54.710 1.00 22.97 ? 157 THR B OG1   1 
ATOM   3056 C  CG2   . THR D 2 157 ? -7.862  -13.461 55.092 1.00 20.06 ? 157 THR B CG2   1 
ATOM   3057 N  N     . ALA D 2 158 ? -6.844  -9.218  55.701 1.00 19.56 ? 158 ALA B N     1 
ATOM   3058 C  CA    . ALA D 2 158 ? -5.989  -8.090  56.018 1.00 19.26 ? 158 ALA B CA    1 
ATOM   3059 C  C     . ALA D 2 158 ? -4.539  -8.412  55.671 1.00 20.18 ? 158 ALA B C     1 
ATOM   3060 O  O     . ALA D 2 158 ? -3.885  -7.670  54.937 1.00 21.35 ? 158 ALA B O     1 
ATOM   3061 C  CB    . ALA D 2 158 ? -6.126  -7.737  57.501 1.00 18.98 ? 158 ALA B CB    1 
ATOM   3062 N  N     . GLU D 2 159 ? -4.072  -9.562  56.134 1.00 21.02 ? 159 GLU B N     1 
ATOM   3063 C  CA    . GLU D 2 159 ? -2.695  -9.990  55.906 1.00 22.75 ? 159 GLU B CA    1 
ATOM   3064 C  C     . GLU D 2 159 ? -2.366  -10.130 54.425 1.00 21.78 ? 159 GLU B C     1 
ATOM   3065 O  O     . GLU D 2 159 ? -1.316  -9.693  53.984 1.00 23.77 ? 159 GLU B O     1 
ATOM   3066 C  CB    . GLU D 2 159 ? -2.412  -11.304 56.650 1.00 23.51 ? 159 GLU B CB    1 
ATOM   3067 C  CG    . GLU D 2 159 ? -3.542  -11.716 57.595 1.00 28.20 ? 159 GLU B CG    1 
ATOM   3068 C  CD    . GLU D 2 159 ? -3.252  -11.394 59.048 1.00 38.47 ? 159 GLU B CD    1 
ATOM   3069 O  OE1   . GLU D 2 159 ? -2.052  -11.332 59.413 1.00 44.17 ? 159 GLU B OE1   1 
ATOM   3070 O  OE2   . GLU D 2 159 ? -4.221  -11.261 59.839 1.00 36.77 ? 159 GLU B OE2   1 
ATOM   3071 N  N     . GLN D 2 160 ? -3.276  -10.699 53.649 1.00 21.48 ? 160 GLN B N     1 
ATOM   3072 C  CA    . GLN D 2 160 ? -3.087  -10.741 52.201 1.00 22.78 ? 160 GLN B CA    1 
ATOM   3073 C  C     . GLN D 2 160 ? -3.072  -9.329  51.592 1.00 22.62 ? 160 GLN B C     1 
ATOM   3074 O  O     . GLN D 2 160 ? -2.327  -9.061  50.645 1.00 23.10 ? 160 GLN B O     1 
ATOM   3075 C  CB    . GLN D 2 160 ? -4.166  -11.589 51.513 1.00 22.46 ? 160 GLN B CB    1 
ATOM   3076 C  CG    . GLN D 2 160 ? -4.248  -13.057 51.964 1.00 25.79 ? 160 GLN B CG    1 
ATOM   3077 C  CD    . GLN D 2 160 ? -5.256  -13.864 51.127 1.00 28.62 ? 160 GLN B CD    1 
ATOM   3078 O  OE1   . GLN D 2 160 ? -6.484  -13.675 51.231 1.00 26.37 ? 160 GLN B OE1   1 
ATOM   3079 N  NE2   . GLN D 2 160 ? -4.737  -14.712 50.248 1.00 24.96 ? 160 GLN B NE2   1 
ATOM   3080 N  N     . MET D 2 161 ? -3.953  -8.456  52.074 1.00 20.56 ? 161 MET B N     1 
ATOM   3081 C  CA    . MET D 2 161 ? -4.073  -7.137  51.479 1.00 19.34 ? 161 MET B CA    1 
ATOM   3082 C  C     . MET D 2 161 ? -2.808  -6.327  51.732 1.00 20.33 ? 161 MET B C     1 
ATOM   3083 O  O     . MET D 2 161 ? -2.369  -5.576  50.873 1.00 19.58 ? 161 MET B O     1 
ATOM   3084 C  CB    . MET D 2 161 ? -5.320  -6.408  51.983 1.00 19.04 ? 161 MET B CB    1 
ATOM   3085 C  CG    . MET D 2 161 ? -6.631  -6.922  51.376 1.00 16.51 ? 161 MET B CG    1 
ATOM   3086 S  SD    . MET D 2 161 ? -8.093  -5.953  51.844 1.00 15.80 ? 161 MET B SD    1 
ATOM   3087 C  CE    . MET D 2 161 ? -8.301  -6.407  53.568 1.00 11.02 ? 161 MET B CE    1 
ATOM   3088 N  N     . ALA D 2 162 ? -2.153  -6.591  52.858 1.00 21.32 ? 162 ALA B N     1 
ATOM   3089 C  CA    . ALA D 2 162 ? -0.900  -5.935  53.178 1.00 22.90 ? 162 ALA B CA    1 
ATOM   3090 C  C     . ALA D 2 162 ? 0.246   -6.498  52.352 1.00 25.31 ? 162 ALA B C     1 
ATOM   3091 O  O     . ALA D 2 162 ? 1.116   -5.754  51.890 1.00 25.85 ? 162 ALA B O     1 
ATOM   3092 C  CB    . ALA D 2 162 ? -0.601  -6.057  54.654 1.00 23.52 ? 162 ALA B CB    1 
ATOM   3093 N  N     . ASP D 2 163 ? 0.226   -7.809  52.131 1.00 27.16 ? 163 ASP B N     1 
ATOM   3094 C  CA    . ASP D 2 163 ? 1.223   -8.437  51.276 1.00 29.23 ? 163 ASP B CA    1 
ATOM   3095 C  C     . ASP D 2 163 ? 1.194   -7.826  49.895 1.00 28.62 ? 163 ASP B C     1 
ATOM   3096 O  O     . ASP D 2 163 ? 2.243   -7.551  49.311 1.00 29.65 ? 163 ASP B O     1 
ATOM   3097 C  CB    . ASP D 2 163 ? 1.002   -9.952  51.182 1.00 30.99 ? 163 ASP B CB    1 
ATOM   3098 C  CG    . ASP D 2 163 ? 1.854   -10.729 52.179 1.00 35.96 ? 163 ASP B CG    1 
ATOM   3099 O  OD1   . ASP D 2 163 ? 2.262   -10.138 53.206 1.00 37.72 ? 163 ASP B OD1   1 
ATOM   3100 O  OD2   . ASP D 2 163 ? 2.101   -11.934 51.942 1.00 43.80 ? 163 ASP B OD2   1 
ATOM   3101 N  N     . ILE D 2 164 ? -0.008  -7.647  49.356 1.00 27.90 ? 164 ILE B N     1 
ATOM   3102 C  CA    . ILE D 2 164 ? -0.159  -7.012  48.052 1.00 28.27 ? 164 ILE B CA    1 
ATOM   3103 C  C     . ILE D 2 164 ? 0.288   -5.549  48.097 1.00 29.01 ? 164 ILE B C     1 
ATOM   3104 O  O     . ILE D 2 164 ? 0.855   -5.040  47.136 1.00 29.20 ? 164 ILE B O     1 
ATOM   3105 C  CB    . ILE D 2 164 ? -1.599  -7.089  47.531 1.00 27.14 ? 164 ILE B CB    1 
ATOM   3106 C  CG1   . ILE D 2 164 ? -2.073  -8.541  47.450 1.00 28.41 ? 164 ILE B CG1   1 
ATOM   3107 C  CG2   . ILE D 2 164 ? -1.696  -6.447  46.165 1.00 29.40 ? 164 ILE B CG2   1 
ATOM   3108 C  CD1   . ILE D 2 164 ? -3.484  -8.691  46.855 1.00 28.08 ? 164 ILE B CD1   1 
ATOM   3109 N  N     . THR D 2 165 ? 0.048   -4.885  49.225 1.00 29.23 ? 165 THR B N     1 
ATOM   3110 C  CA    . THR D 2 165 ? 0.433   -3.490  49.379 1.00 30.15 ? 165 THR B CA    1 
ATOM   3111 C  C     . THR D 2 165 ? 1.959   -3.303  49.363 1.00 32.20 ? 165 THR B C     1 
ATOM   3112 O  O     . THR D 2 165 ? 2.465   -2.446  48.648 1.00 32.10 ? 165 THR B O     1 
ATOM   3113 C  CB    . THR D 2 165 ? -0.177  -2.861  50.651 1.00 29.46 ? 165 THR B CB    1 
ATOM   3114 O  OG1   . THR D 2 165 ? -1.564  -2.596  50.426 1.00 25.44 ? 165 THR B OG1   1 
ATOM   3115 C  CG2   . THR D 2 165 ? 0.524   -1.558  50.999 1.00 28.74 ? 165 THR B CG2   1 
ATOM   3116 N  N     . GLY D 2 166 ? 2.680   -4.135  50.122 1.00 34.14 ? 166 GLY B N     1 
ATOM   3117 C  CA    . GLY D 2 166 ? 4.143   -4.084  50.165 1.00 35.48 ? 166 GLY B CA    1 
ATOM   3118 C  C     . GLY D 2 166 ? 4.801   -4.907  49.062 1.00 37.63 ? 166 GLY B C     1 
ATOM   3119 O  O     . GLY D 2 166 ? 4.679   -4.587  47.865 1.00 38.80 ? 166 GLY B O     1 
HETATM 3120 NA NA    . NA  E 4 .   ? 18.624  4.006   13.916 1.00 30.97 ? 101 NA  C NA    1 
HETATM 3121 NA NA    . NA  F 4 .   ? 17.724  2.423   10.698 1.00 22.34 ? 201 NA  A NA    1 
HETATM 3122 NA NA    . NA  G 4 .   ? -6.624  11.154  51.109 1.00 27.02 ? 101 NA  D NA    1 
HETATM 3123 NA NA    . NA  H 4 .   ? -9.656  13.324  51.285 1.00 24.70 ? 201 NA  B NA    1 
HETATM 3124 O  O     . HOH I 5 .   ? 7.017   2.289   18.662 1.00 36.46 ? 201 HOH C O     1 
HETATM 3125 O  O     . HOH I 5 .   ? 16.697  4.983   13.400 1.00 23.31 ? 202 HOH C O     1 
HETATM 3126 O  O     . HOH J 5 .   ? 12.786  -8.385  15.041 1.00 15.58 ? 301 HOH A O     1 
HETATM 3127 O  O     . HOH J 5 .   ? 13.635  4.131   10.631 1.00 31.64 ? 302 HOH A O     1 
HETATM 3128 O  O     . HOH J 5 .   ? 20.359  3.111   14.999 1.00 25.39 ? 303 HOH A O     1 
HETATM 3129 O  O     . HOH J 5 .   ? 18.605  5.969   15.260 1.00 16.05 ? 304 HOH A O     1 
HETATM 3130 O  O     . HOH J 5 .   ? 22.806  1.646   3.796  1.00 8.50  ? 305 HOH A O     1 
HETATM 3131 O  O     . HOH J 5 .   ? 30.593  -3.973  16.436 1.00 18.23 ? 306 HOH A O     1 
HETATM 3132 O  O     . HOH J 5 .   ? 32.743  -4.112  14.392 1.00 11.14 ? 307 HOH A O     1 
HETATM 3133 O  O     . HOH J 5 .   ? 23.190  -6.560  20.470 1.00 27.12 ? 308 HOH A O     1 
HETATM 3134 O  O     . HOH J 5 .   ? 19.911  29.267  19.997 1.00 16.61 ? 309 HOH A O     1 
HETATM 3135 O  O     . HOH K 5 .   ? 18.978  -0.023  27.561 1.00 41.04 ? 201 HOH D O     1 
HETATM 3136 O  O     . HOH K 5 .   ? -7.927  9.997   49.885 1.00 24.89 ? 202 HOH D O     1 
HETATM 3137 O  O     . HOH L 5 .   ? -9.848  8.649   51.451 1.00 25.17 ? 301 HOH B O     1 
HETATM 3138 O  O     . HOH L 5 .   ? -19.479 21.431  55.447 1.00 19.07 ? 302 HOH B O     1 
HETATM 3139 O  O     . HOH L 5 .   ? -14.338 15.551  58.451 1.00 14.52 ? 303 HOH B O     1 
HETATM 3140 O  O     . HOH L 5 .   ? 5.152   6.625   52.486 1.00 18.87 ? 304 HOH B O     1 
HETATM 3141 O  O     . HOH L 5 .   ? -0.751  0.945   42.532 1.00 31.22 ? 305 HOH B O     1 
HETATM 3142 O  O     . HOH L 5 .   ? -4.949  11.891  52.329 1.00 25.22 ? 306 HOH B O     1 
HETATM 3143 O  O     . HOH L 5 .   ? -5.684  9.004   51.050 1.00 19.13 ? 307 HOH B O     1 
HETATM 3144 O  O     . HOH L 5 .   ? -16.275 14.600  55.913 1.00 27.57 ? 308 HOH B O     1 
HETATM 3145 O  O     . HOH L 5 .   ? -1.112  27.542  59.009 1.00 17.05 ? 309 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DT  1   1   ?   ?   ?   C . n 
A 1 2   DG  2   2   2   DG  DG  C . n 
A 1 3   DT  3   3   3   DT  DT  C . n 
A 1 4   DA  4   4   4   DA  DA  C . n 
A 1 5   DG  5   5   5   DG  DG  C . n 
A 1 6   DA  6   6   6   DA  DA  C . n 
A 1 7   DT  7   7   7   DT  DT  C . n 
A 1 8   DT  8   8   8   DT  DT  C . n 
A 1 9   DC  9   9   9   DC  DC  C . n 
A 1 10  DG  10  10  10  DG  DG  C . n 
A 1 11  DA  11  11  11  DA  DA  C . n 
A 1 12  DG  12  12  12  DG  DG  C . n 
B 2 1   MET 1   1   1   MET MET A . n 
B 2 2   LEU 2   2   2   LEU LEU A . n 
B 2 3   ARG 3   3   3   ARG ARG A . n 
B 2 4   ILE 4   4   4   ILE ILE A . n 
B 2 5   ILE 5   5   5   ILE ILE A . n 
B 2 6   ASP 6   6   6   ASP ASP A . n 
B 2 7   THR 7   7   7   THR THR A . n 
B 2 8   GLU 8   8   8   GLU GLU A . n 
B 2 9   THR 9   9   9   THR THR A . n 
B 2 10  CYS 10  10  10  CYS CYS A . n 
B 2 11  GLY 11  11  11  GLY GLY A . n 
B 2 12  LEU 12  12  12  LEU LEU A . n 
B 2 13  GLN 13  13  13  GLN GLN A . n 
B 2 14  GLY 14  14  14  GLY GLY A . n 
B 2 15  GLY 15  15  15  GLY GLY A . n 
B 2 16  ILE 16  16  16  ILE ILE A . n 
B 2 17  VAL 17  17  17  VAL VAL A . n 
B 2 18  GLU 18  18  18  GLU GLU A . n 
B 2 19  ILE 19  19  19  ILE ILE A . n 
B 2 20  ALA 20  20  20  ALA ALA A . n 
B 2 21  SER 21  21  21  SER SER A . n 
B 2 22  VAL 22  22  22  VAL VAL A . n 
B 2 23  ASP 23  23  23  ASP ASP A . n 
B 2 24  VAL 24  24  24  VAL VAL A . n 
B 2 25  ILE 25  25  25  ILE ILE A . n 
B 2 26  ASP 26  26  26  ASP ASP A . n 
B 2 27  GLY 27  27  27  GLY GLY A . n 
B 2 28  LYS 28  28  28  LYS LYS A . n 
B 2 29  ILE 29  29  29  ILE ILE A . n 
B 2 30  VAL 30  30  30  VAL VAL A . n 
B 2 31  ASN 31  31  31  ASN ASN A . n 
B 2 32  PRO 32  32  32  PRO PRO A . n 
B 2 33  MET 33  33  33  MET MET A . n 
B 2 34  SER 34  34  34  SER SER A . n 
B 2 35  HIS 35  35  35  HIS HIS A . n 
B 2 36  LEU 36  36  36  LEU LEU A . n 
B 2 37  VAL 37  37  37  VAL VAL A . n 
B 2 38  ARG 38  38  38  ARG ARG A . n 
B 2 39  PRO 39  39  39  PRO PRO A . n 
B 2 40  ASP 40  40  40  ASP ASP A . n 
B 2 41  ARG 41  41  41  ARG ARG A . n 
B 2 42  PRO 42  42  42  PRO PRO A . n 
B 2 43  ILE 43  43  43  ILE ILE A . n 
B 2 44  SER 44  44  44  SER SER A . n 
B 2 45  PRO 45  45  45  PRO PRO A . n 
B 2 46  GLN 46  46  46  GLN GLN A . n 
B 2 47  ALA 47  47  47  ALA ALA A . n 
B 2 48  MET 48  48  48  MET MET A . n 
B 2 49  ALA 49  49  49  ALA ALA A . n 
B 2 50  ILE 50  50  50  ILE ILE A . n 
B 2 51  HIS 51  51  51  HIS HIS A . n 
B 2 52  ARG 52  52  52  ARG ARG A . n 
B 2 53  ILE 53  53  53  ILE ILE A . n 
B 2 54  THR 54  54  54  THR THR A . n 
B 2 55  GLU 55  55  55  GLU GLU A . n 
B 2 56  ALA 56  56  56  ALA ALA A . n 
B 2 57  MET 57  57  57  MET MET A . n 
B 2 58  VAL 58  58  58  VAL VAL A . n 
B 2 59  ALA 59  59  59  ALA ALA A . n 
B 2 60  ASP 60  60  60  ASP ASP A . n 
B 2 61  LYS 61  61  61  LYS LYS A . n 
B 2 62  PRO 62  62  62  PRO PRO A . n 
B 2 63  TRP 63  63  63  TRP TRP A . n 
B 2 64  ILE 64  64  64  ILE ILE A . n 
B 2 65  GLU 65  65  65  GLU GLU A . n 
B 2 66  ASP 66  66  66  ASP ASP A . n 
B 2 67  VAL 67  67  67  VAL VAL A . n 
B 2 68  ILE 68  68  68  ILE ILE A . n 
B 2 69  PRO 69  69  69  PRO PRO A . n 
B 2 70  HIS 70  70  70  HIS HIS A . n 
B 2 71  TYR 71  71  71  TYR TYR A . n 
B 2 72  TYR 72  72  72  TYR TYR A . n 
B 2 73  GLY 73  73  73  GLY GLY A . n 
B 2 74  SER 74  74  74  SER SER A . n 
B 2 75  GLU 75  75  75  GLU GLU A . n 
B 2 76  TRP 76  76  76  TRP TRP A . n 
B 2 77  TYR 77  77  77  TYR TYR A . n 
B 2 78  VAL 78  78  78  VAL VAL A . n 
B 2 79  ALA 79  79  79  ALA ALA A . n 
B 2 80  HIS 80  80  80  HIS HIS A . n 
B 2 81  ASN 81  81  81  ASN ASN A . n 
B 2 82  ALA 82  82  82  ALA ALA A . n 
B 2 83  SER 83  83  83  SER SER A . n 
B 2 84  PHE 84  84  84  PHE PHE A . n 
B 2 85  ASP 85  85  85  ASP ASP A . n 
B 2 86  ARG 86  86  86  ARG ARG A . n 
B 2 87  ARG 87  87  87  ARG ARG A . n 
B 2 88  VAL 88  88  88  VAL VAL A . n 
B 2 89  LEU 89  89  89  LEU LEU A . n 
B 2 90  PRO 90  90  90  PRO PRO A . n 
B 2 91  GLU 91  91  91  GLU GLU A . n 
B 2 92  MET 92  92  92  MET MET A . n 
B 2 93  PRO 93  93  93  PRO PRO A . n 
B 2 94  GLY 94  94  94  GLY GLY A . n 
B 2 95  GLU 95  95  95  GLU GLU A . n 
B 2 96  TRP 96  96  96  TRP TRP A . n 
B 2 97  ILE 97  97  97  ILE ILE A . n 
B 2 98  CYS 98  98  98  CYS CYS A . n 
B 2 99  THR 99  99  99  THR THR A . n 
B 2 100 MET 100 100 100 MET MET A . n 
B 2 101 LYS 101 101 101 LYS LYS A . n 
B 2 102 LEU 102 102 102 LEU LEU A . n 
B 2 103 ALA 103 103 103 ALA ALA A . n 
B 2 104 ARG 104 104 104 ARG ARG A . n 
B 2 105 ARG 105 105 105 ARG ARG A . n 
B 2 106 LEU 106 106 106 LEU LEU A . n 
B 2 107 TRP 107 107 107 TRP TRP A . n 
B 2 108 PRO 108 108 108 PRO PRO A . n 
B 2 109 GLY 109 109 109 GLY GLY A . n 
B 2 110 ILE 110 110 110 ILE ILE A . n 
B 2 111 LYS 111 111 111 LYS LYS A . n 
B 2 112 TYR 112 112 112 TYR TYR A . n 
B 2 113 SER 113 113 113 SER SER A . n 
B 2 114 ASN 114 114 114 ASN ASN A . n 
B 2 115 MET 115 115 115 MET MET A . n 
B 2 116 ALA 116 116 116 ALA ALA A . n 
B 2 117 LEU 117 117 117 LEU LEU A . n 
B 2 118 TYR 118 118 118 TYR TYR A . n 
B 2 119 LYS 119 119 119 LYS LYS A . n 
B 2 120 THR 120 120 120 THR THR A . n 
B 2 121 ARG 121 121 121 ARG ARG A . n 
B 2 122 LYS 122 122 122 LYS LYS A . n 
B 2 123 LEU 123 123 123 LEU LEU A . n 
B 2 124 ASN 124 124 124 ASN ASN A . n 
B 2 125 VAL 125 125 125 VAL VAL A . n 
B 2 126 GLN 126 126 126 GLN GLN A . n 
B 2 127 THR 127 127 127 THR THR A . n 
B 2 128 PRO 128 128 128 PRO PRO A . n 
B 2 129 PRO 129 129 129 PRO PRO A . n 
B 2 130 GLY 130 130 130 GLY GLY A . n 
B 2 131 LEU 131 131 131 LEU LEU A . n 
B 2 132 HIS 132 132 132 HIS HIS A . n 
B 2 133 HIS 133 133 133 HIS HIS A . n 
B 2 134 HIS 134 134 134 HIS HIS A . n 
B 2 135 ARG 135 135 135 ARG ARG A . n 
B 2 136 ALA 136 136 136 ALA ALA A . n 
B 2 137 LEU 137 137 137 LEU LEU A . n 
B 2 138 TYR 138 138 138 TYR TYR A . n 
B 2 139 ASP 139 139 139 ASP ASP A . n 
B 2 140 CYS 140 140 140 CYS CYS A . n 
B 2 141 TYR 141 141 141 TYR TYR A . n 
B 2 142 ILE 142 142 142 ILE ILE A . n 
B 2 143 THR 143 143 143 THR THR A . n 
B 2 144 ALA 144 144 144 ALA ALA A . n 
B 2 145 ALA 145 145 145 ALA ALA A . n 
B 2 146 LEU 146 146 146 LEU LEU A . n 
B 2 147 LEU 147 147 147 LEU LEU A . n 
B 2 148 ILE 148 148 148 ILE ILE A . n 
B 2 149 ASP 149 149 149 ASP ASP A . n 
B 2 150 ILE 150 150 150 ILE ILE A . n 
B 2 151 MET 151 151 151 MET MET A . n 
B 2 152 ASN 152 152 152 ASN ASN A . n 
B 2 153 THR 153 153 153 THR THR A . n 
B 2 154 SER 154 154 154 SER SER A . n 
B 2 155 GLY 155 155 155 GLY GLY A . n 
B 2 156 TRP 156 156 156 TRP TRP A . n 
B 2 157 THR 157 157 157 THR THR A . n 
B 2 158 ALA 158 158 158 ALA ALA A . n 
B 2 159 GLU 159 159 159 GLU GLU A . n 
B 2 160 GLN 160 160 160 GLN GLN A . n 
B 2 161 MET 161 161 161 MET MET A . n 
B 2 162 ALA 162 162 162 ALA ALA A . n 
B 2 163 ASP 163 163 163 ASP ASP A . n 
B 2 164 ILE 164 164 164 ILE ILE A . n 
B 2 165 THR 165 165 165 THR THR A . n 
B 2 166 GLY 166 166 166 GLY GLY A . n 
B 2 167 ARG 167 167 167 ARG ARG A . n 
B 2 168 LEU 168 168 ?   ?   ?   A . n 
B 2 169 GLU 169 169 ?   ?   ?   A . n 
B 2 170 HIS 170 170 ?   ?   ?   A . n 
B 2 171 HIS 171 171 ?   ?   ?   A . n 
B 2 172 HIS 172 172 ?   ?   ?   A . n 
B 2 173 HIS 173 173 ?   ?   ?   A . n 
B 2 174 HIS 174 174 ?   ?   ?   A . n 
B 2 175 HIS 175 175 ?   ?   ?   A . n 
C 3 1   DC  1   1   1   DC  DC  D . n 
C 3 2   DT  2   2   2   DT  DT  D . n 
C 3 3   DC  3   3   3   DC  DC  D . n 
C 3 4   DG  4   4   4   DG  DG  D . n 
C 3 5   DA  5   5   5   DA  DA  D . n 
C 3 6   DA  6   6   6   DA  DA  D . n 
C 3 7   DT  7   7   7   DT  DT  D . n 
C 3 8   DC  8   8   8   DC  DC  D . n 
C 3 9   DT  9   9   9   DT  DT  D . n 
C 3 10  DA  10  10  10  DA  DA  D . n 
C 3 11  DC  11  11  11  DC  DC  D . n 
C 3 12  DA  12  12  12  DA  DA  D . n 
D 2 1   MET 1   1   1   MET MET B . n 
D 2 2   LEU 2   2   2   LEU LEU B . n 
D 2 3   ARG 3   3   3   ARG ARG B . n 
D 2 4   ILE 4   4   4   ILE ILE B . n 
D 2 5   ILE 5   5   5   ILE ILE B . n 
D 2 6   ASP 6   6   6   ASP ASP B . n 
D 2 7   THR 7   7   7   THR THR B . n 
D 2 8   GLU 8   8   8   GLU GLU B . n 
D 2 9   THR 9   9   9   THR THR B . n 
D 2 10  CYS 10  10  10  CYS CYS B . n 
D 2 11  GLY 11  11  11  GLY GLY B . n 
D 2 12  LEU 12  12  12  LEU LEU B . n 
D 2 13  GLN 13  13  13  GLN GLN B . n 
D 2 14  GLY 14  14  14  GLY GLY B . n 
D 2 15  GLY 15  15  15  GLY GLY B . n 
D 2 16  ILE 16  16  16  ILE ILE B . n 
D 2 17  VAL 17  17  17  VAL VAL B . n 
D 2 18  GLU 18  18  18  GLU GLU B . n 
D 2 19  ILE 19  19  19  ILE ILE B . n 
D 2 20  ALA 20  20  20  ALA ALA B . n 
D 2 21  SER 21  21  21  SER SER B . n 
D 2 22  VAL 22  22  22  VAL VAL B . n 
D 2 23  ASP 23  23  23  ASP ASP B . n 
D 2 24  VAL 24  24  24  VAL VAL B . n 
D 2 25  ILE 25  25  25  ILE ILE B . n 
D 2 26  ASP 26  26  26  ASP ASP B . n 
D 2 27  GLY 27  27  27  GLY GLY B . n 
D 2 28  LYS 28  28  28  LYS LYS B . n 
D 2 29  ILE 29  29  29  ILE ILE B . n 
D 2 30  VAL 30  30  30  VAL VAL B . n 
D 2 31  ASN 31  31  31  ASN ASN B . n 
D 2 32  PRO 32  32  32  PRO PRO B . n 
D 2 33  MET 33  33  33  MET MET B . n 
D 2 34  SER 34  34  34  SER SER B . n 
D 2 35  HIS 35  35  35  HIS HIS B . n 
D 2 36  LEU 36  36  36  LEU LEU B . n 
D 2 37  VAL 37  37  37  VAL VAL B . n 
D 2 38  ARG 38  38  38  ARG ARG B . n 
D 2 39  PRO 39  39  39  PRO PRO B . n 
D 2 40  ASP 40  40  40  ASP ASP B . n 
D 2 41  ARG 41  41  41  ARG ARG B . n 
D 2 42  PRO 42  42  42  PRO PRO B . n 
D 2 43  ILE 43  43  43  ILE ILE B . n 
D 2 44  SER 44  44  44  SER SER B . n 
D 2 45  PRO 45  45  45  PRO PRO B . n 
D 2 46  GLN 46  46  46  GLN GLN B . n 
D 2 47  ALA 47  47  47  ALA ALA B . n 
D 2 48  MET 48  48  48  MET MET B . n 
D 2 49  ALA 49  49  49  ALA ALA B . n 
D 2 50  ILE 50  50  50  ILE ILE B . n 
D 2 51  HIS 51  51  51  HIS HIS B . n 
D 2 52  ARG 52  52  52  ARG ARG B . n 
D 2 53  ILE 53  53  53  ILE ILE B . n 
D 2 54  THR 54  54  54  THR THR B . n 
D 2 55  GLU 55  55  55  GLU GLU B . n 
D 2 56  ALA 56  56  56  ALA ALA B . n 
D 2 57  MET 57  57  57  MET MET B . n 
D 2 58  VAL 58  58  58  VAL VAL B . n 
D 2 59  ALA 59  59  59  ALA ALA B . n 
D 2 60  ASP 60  60  60  ASP ASP B . n 
D 2 61  LYS 61  61  61  LYS LYS B . n 
D 2 62  PRO 62  62  62  PRO PRO B . n 
D 2 63  TRP 63  63  63  TRP TRP B . n 
D 2 64  ILE 64  64  64  ILE ILE B . n 
D 2 65  GLU 65  65  65  GLU GLU B . n 
D 2 66  ASP 66  66  66  ASP ASP B . n 
D 2 67  VAL 67  67  67  VAL VAL B . n 
D 2 68  ILE 68  68  68  ILE ILE B . n 
D 2 69  PRO 69  69  69  PRO PRO B . n 
D 2 70  HIS 70  70  70  HIS HIS B . n 
D 2 71  TYR 71  71  71  TYR TYR B . n 
D 2 72  TYR 72  72  72  TYR TYR B . n 
D 2 73  GLY 73  73  73  GLY GLY B . n 
D 2 74  SER 74  74  74  SER SER B . n 
D 2 75  GLU 75  75  75  GLU GLU B . n 
D 2 76  TRP 76  76  76  TRP TRP B . n 
D 2 77  TYR 77  77  77  TYR TYR B . n 
D 2 78  VAL 78  78  78  VAL VAL B . n 
D 2 79  ALA 79  79  79  ALA ALA B . n 
D 2 80  HIS 80  80  80  HIS HIS B . n 
D 2 81  ASN 81  81  81  ASN ASN B . n 
D 2 82  ALA 82  82  82  ALA ALA B . n 
D 2 83  SER 83  83  83  SER SER B . n 
D 2 84  PHE 84  84  84  PHE PHE B . n 
D 2 85  ASP 85  85  85  ASP ASP B . n 
D 2 86  ARG 86  86  86  ARG ARG B . n 
D 2 87  ARG 87  87  87  ARG ARG B . n 
D 2 88  VAL 88  88  88  VAL VAL B . n 
D 2 89  LEU 89  89  89  LEU LEU B . n 
D 2 90  PRO 90  90  90  PRO PRO B . n 
D 2 91  GLU 91  91  91  GLU GLU B . n 
D 2 92  MET 92  92  92  MET MET B . n 
D 2 93  PRO 93  93  93  PRO PRO B . n 
D 2 94  GLY 94  94  94  GLY GLY B . n 
D 2 95  GLU 95  95  95  GLU GLU B . n 
D 2 96  TRP 96  96  96  TRP TRP B . n 
D 2 97  ILE 97  97  97  ILE ILE B . n 
D 2 98  CYS 98  98  98  CYS CYS B . n 
D 2 99  THR 99  99  99  THR THR B . n 
D 2 100 MET 100 100 100 MET MET B . n 
D 2 101 LYS 101 101 101 LYS LYS B . n 
D 2 102 LEU 102 102 102 LEU LEU B . n 
D 2 103 ALA 103 103 103 ALA ALA B . n 
D 2 104 ARG 104 104 104 ARG ARG B . n 
D 2 105 ARG 105 105 105 ARG ARG B . n 
D 2 106 LEU 106 106 106 LEU LEU B . n 
D 2 107 TRP 107 107 107 TRP TRP B . n 
D 2 108 PRO 108 108 108 PRO PRO B . n 
D 2 109 GLY 109 109 109 GLY GLY B . n 
D 2 110 ILE 110 110 110 ILE ILE B . n 
D 2 111 LYS 111 111 111 LYS LYS B . n 
D 2 112 TYR 112 112 112 TYR TYR B . n 
D 2 113 SER 113 113 113 SER SER B . n 
D 2 114 ASN 114 114 114 ASN ASN B . n 
D 2 115 MET 115 115 115 MET MET B . n 
D 2 116 ALA 116 116 116 ALA ALA B . n 
D 2 117 LEU 117 117 117 LEU LEU B . n 
D 2 118 TYR 118 118 118 TYR TYR B . n 
D 2 119 LYS 119 119 119 LYS LYS B . n 
D 2 120 THR 120 120 120 THR THR B . n 
D 2 121 ARG 121 121 121 ARG ARG B . n 
D 2 122 LYS 122 122 122 LYS LYS B . n 
D 2 123 LEU 123 123 123 LEU LEU B . n 
D 2 124 ASN 124 124 124 ASN ASN B . n 
D 2 125 VAL 125 125 125 VAL VAL B . n 
D 2 126 GLN 126 126 126 GLN GLN B . n 
D 2 127 THR 127 127 127 THR THR B . n 
D 2 128 PRO 128 128 128 PRO PRO B . n 
D 2 129 PRO 129 129 129 PRO PRO B . n 
D 2 130 GLY 130 130 130 GLY GLY B . n 
D 2 131 LEU 131 131 131 LEU LEU B . n 
D 2 132 HIS 132 132 132 HIS HIS B . n 
D 2 133 HIS 133 133 133 HIS HIS B . n 
D 2 134 HIS 134 134 134 HIS HIS B . n 
D 2 135 ARG 135 135 135 ARG ARG B . n 
D 2 136 ALA 136 136 136 ALA ALA B . n 
D 2 137 LEU 137 137 137 LEU LEU B . n 
D 2 138 TYR 138 138 138 TYR TYR B . n 
D 2 139 ASP 139 139 139 ASP ASP B . n 
D 2 140 CYS 140 140 140 CYS CYS B . n 
D 2 141 TYR 141 141 141 TYR TYR B . n 
D 2 142 ILE 142 142 142 ILE ILE B . n 
D 2 143 THR 143 143 143 THR THR B . n 
D 2 144 ALA 144 144 144 ALA ALA B . n 
D 2 145 ALA 145 145 145 ALA ALA B . n 
D 2 146 LEU 146 146 146 LEU LEU B . n 
D 2 147 LEU 147 147 147 LEU LEU B . n 
D 2 148 ILE 148 148 148 ILE ILE B . n 
D 2 149 ASP 149 149 149 ASP ASP B . n 
D 2 150 ILE 150 150 150 ILE ILE B . n 
D 2 151 MET 151 151 151 MET MET B . n 
D 2 152 ASN 152 152 152 ASN ASN B . n 
D 2 153 THR 153 153 153 THR THR B . n 
D 2 154 SER 154 154 154 SER SER B . n 
D 2 155 GLY 155 155 155 GLY GLY B . n 
D 2 156 TRP 156 156 156 TRP TRP B . n 
D 2 157 THR 157 157 157 THR THR B . n 
D 2 158 ALA 158 158 158 ALA ALA B . n 
D 2 159 GLU 159 159 159 GLU GLU B . n 
D 2 160 GLN 160 160 160 GLN GLN B . n 
D 2 161 MET 161 161 161 MET MET B . n 
D 2 162 ALA 162 162 162 ALA ALA B . n 
D 2 163 ASP 163 163 163 ASP ASP B . n 
D 2 164 ILE 164 164 164 ILE ILE B . n 
D 2 165 THR 165 165 165 THR THR B . n 
D 2 166 GLY 166 166 166 GLY GLY B . n 
D 2 167 ARG 167 167 ?   ?   ?   B . n 
D 2 168 LEU 168 168 ?   ?   ?   B . n 
D 2 169 GLU 169 169 ?   ?   ?   B . n 
D 2 170 HIS 170 170 ?   ?   ?   B . n 
D 2 171 HIS 171 171 ?   ?   ?   B . n 
D 2 172 HIS 172 172 ?   ?   ?   B . n 
D 2 173 HIS 173 173 ?   ?   ?   B . n 
D 2 174 HIS 174 174 ?   ?   ?   B . n 
D 2 175 HIS 175 175 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4870  ? 
1 MORE         -68   ? 
1 'SSA (A^2)'  18070 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD2   ? B ASP 139 ? A ASP 139 ? 1_555 NA ? F NA . ? A NA 201 ? 1_555 OP1   ? A DG  12  ? C DG  12  ? 1_555 122.9 ? 
2  OD2   ? B ASP 139 ? A ASP 139 ? 1_555 NA ? F NA . ? A NA 201 ? 1_555 OD2   ? B ASP 6   ? A ASP 6   ? 1_555 96.7  ? 
3  OP1   ? A DG  12  ? C DG  12  ? 1_555 NA ? F NA . ? A NA 201 ? 1_555 OD2   ? B ASP 6   ? A ASP 6   ? 1_555 115.7 ? 
4  OD2   ? B ASP 139 ? A ASP 139 ? 1_555 NA ? F NA . ? A NA 201 ? 1_555 OE2   ? B GLU 8   ? A GLU 8   ? 1_555 105.0 ? 
5  OP1   ? A DG  12  ? C DG  12  ? 1_555 NA ? F NA . ? A NA 201 ? 1_555 OE2   ? B GLU 8   ? A GLU 8   ? 1_555 125.0 ? 
6  OD2   ? B ASP 6   ? A ASP 6   ? 1_555 NA ? F NA . ? A NA 201 ? 1_555 OE2   ? B GLU 8   ? A GLU 8   ? 1_555 80.1  ? 
7  OD1   ? D ASP 6   ? B ASP 6   ? 1_555 NA ? G NA . ? D NA 101 ? 1_555 OP1   ? C DA  12  ? D DA  12  ? 1_555 106.8 ? 
8  OD1   ? D ASP 6   ? B ASP 6   ? 1_555 NA ? G NA . ? D NA 101 ? 1_555 "O3'" ? C DC  11  ? D DC  11  ? 1_555 161.6 ? 
9  OP1   ? C DA  12  ? D DA  12  ? 1_555 NA ? G NA . ? D NA 101 ? 1_555 "O3'" ? C DC  11  ? D DC  11  ? 1_555 54.9  ? 
10 OD1   ? D ASP 6   ? B ASP 6   ? 1_555 NA ? G NA . ? D NA 101 ? 1_555 O     ? K HOH .   ? D HOH 202 ? 1_555 94.1  ? 
11 OP1   ? C DA  12  ? D DA  12  ? 1_555 NA ? G NA . ? D NA 101 ? 1_555 O     ? K HOH .   ? D HOH 202 ? 1_555 79.5  ? 
12 "O3'" ? C DC  11  ? D DC  11  ? 1_555 NA ? G NA . ? D NA 101 ? 1_555 O     ? K HOH .   ? D HOH 202 ? 1_555 84.9  ? 
13 OD1   ? D ASP 6   ? B ASP 6   ? 1_555 NA ? G NA . ? D NA 101 ? 1_555 O     ? L HOH .   ? B HOH 306 ? 1_555 89.0  ? 
14 OP1   ? C DA  12  ? D DA  12  ? 1_555 NA ? G NA . ? D NA 101 ? 1_555 O     ? L HOH .   ? B HOH 306 ? 1_555 113.4 ? 
15 "O3'" ? C DC  11  ? D DC  11  ? 1_555 NA ? G NA . ? D NA 101 ? 1_555 O     ? L HOH .   ? B HOH 306 ? 1_555 96.6  ? 
16 O     ? K HOH .   ? D HOH 202 ? 1_555 NA ? G NA . ? D NA 101 ? 1_555 O     ? L HOH .   ? B HOH 306 ? 1_555 165.2 ? 
17 OD1   ? D ASP 6   ? B ASP 6   ? 1_555 NA ? G NA . ? D NA 101 ? 1_555 O     ? L HOH .   ? B HOH 307 ? 1_555 93.3  ? 
18 OP1   ? C DA  12  ? D DA  12  ? 1_555 NA ? G NA . ? D NA 101 ? 1_555 O     ? L HOH .   ? B HOH 307 ? 1_555 148.1 ? 
19 "O3'" ? C DC  11  ? D DC  11  ? 1_555 NA ? G NA . ? D NA 101 ? 1_555 O     ? L HOH .   ? B HOH 307 ? 1_555 104.1 ? 
20 O     ? K HOH .   ? D HOH 202 ? 1_555 NA ? G NA . ? D NA 101 ? 1_555 O     ? L HOH .   ? B HOH 307 ? 1_555 74.5  ? 
21 O     ? L HOH .   ? B HOH 306 ? 1_555 NA ? G NA . ? D NA 101 ? 1_555 O     ? L HOH .   ? B HOH 307 ? 1_555 90.9  ? 
22 OD1   ? B ASP 6   ? A ASP 6   ? 1_555 NA ? E NA . ? C NA 101 ? 1_555 OP1   ? A DG  12  ? C DG  12  ? 1_555 99.7  ? 
23 OD1   ? B ASP 6   ? A ASP 6   ? 1_555 NA ? E NA . ? C NA 101 ? 1_555 "O3'" ? A DA  11  ? C DA  11  ? 1_555 156.3 ? 
24 OP1   ? A DG  12  ? C DG  12  ? 1_555 NA ? E NA . ? C NA 101 ? 1_555 "O3'" ? A DA  11  ? C DA  11  ? 1_555 56.6  ? 
25 OD1   ? B ASP 6   ? A ASP 6   ? 1_555 NA ? E NA . ? C NA 101 ? 1_555 O     ? I HOH .   ? C HOH 202 ? 1_555 94.6  ? 
26 OP1   ? A DG  12  ? C DG  12  ? 1_555 NA ? E NA . ? C NA 101 ? 1_555 O     ? I HOH .   ? C HOH 202 ? 1_555 74.6  ? 
27 "O3'" ? A DA  11  ? C DA  11  ? 1_555 NA ? E NA . ? C NA 101 ? 1_555 O     ? I HOH .   ? C HOH 202 ? 1_555 79.5  ? 
28 OD1   ? B ASP 6   ? A ASP 6   ? 1_555 NA ? E NA . ? C NA 101 ? 1_555 O     ? J HOH .   ? A HOH 303 ? 1_555 98.8  ? 
29 OP1   ? A DG  12  ? C DG  12  ? 1_555 NA ? E NA . ? C NA 101 ? 1_555 O     ? J HOH .   ? A HOH 303 ? 1_555 110.6 ? 
30 "O3'" ? A DA  11  ? C DA  11  ? 1_555 NA ? E NA . ? C NA 101 ? 1_555 O     ? J HOH .   ? A HOH 303 ? 1_555 91.1  ? 
31 O     ? I HOH .   ? C HOH 202 ? 1_555 NA ? E NA . ? C NA 101 ? 1_555 O     ? J HOH .   ? A HOH 303 ? 1_555 164.4 ? 
32 OD1   ? B ASP 6   ? A ASP 6   ? 1_555 NA ? E NA . ? C NA 101 ? 1_555 O     ? J HOH .   ? A HOH 304 ? 1_555 99.9  ? 
33 OP1   ? A DG  12  ? C DG  12  ? 1_555 NA ? E NA . ? C NA 101 ? 1_555 O     ? J HOH .   ? A HOH 304 ? 1_555 145.9 ? 
34 "O3'" ? A DA  11  ? C DA  11  ? 1_555 NA ? E NA . ? C NA 101 ? 1_555 O     ? J HOH .   ? A HOH 304 ? 1_555 101.0 ? 
35 O     ? I HOH .   ? C HOH 202 ? 1_555 NA ? E NA . ? C NA 101 ? 1_555 O     ? J HOH .   ? A HOH 304 ? 1_555 76.2  ? 
36 O     ? J HOH .   ? A HOH 303 ? 1_555 NA ? E NA . ? C NA 101 ? 1_555 O     ? J HOH .   ? A HOH 304 ? 1_555 93.6  ? 
37 OP1   ? C DA  12  ? D DA  12  ? 1_555 NA ? H NA . ? B NA 201 ? 1_555 OD2   ? D ASP 139 ? B ASP 139 ? 1_555 119.2 ? 
38 OP1   ? C DA  12  ? D DA  12  ? 1_555 NA ? H NA . ? B NA 201 ? 1_555 OE2   ? D GLU 8   ? B GLU 8   ? 1_555 130.5 ? 
39 OD2   ? D ASP 139 ? B ASP 139 ? 1_555 NA ? H NA . ? B NA 201 ? 1_555 OE2   ? D GLU 8   ? B GLU 8   ? 1_555 103.0 ? 
40 OP1   ? C DA  12  ? D DA  12  ? 1_555 NA ? H NA . ? B NA 201 ? 1_555 OD2   ? D ASP 6   ? B ASP 6   ? 1_555 115.5 ? 
41 OD2   ? D ASP 139 ? B ASP 139 ? 1_555 NA ? H NA . ? B NA 201 ? 1_555 OD2   ? D ASP 6   ? B ASP 6   ? 1_555 99.9  ? 
42 OE2   ? D GLU 8   ? B GLU 8   ? 1_555 NA ? H NA . ? B NA 201 ? 1_555 OD2   ? D ASP 6   ? B ASP 6   ? 1_555 78.3  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-07-03 
2 'Structure model' 1 1 2013-10-09 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MAR345dtb 'data collection' .        ? 1 
MOLREP    phasing           .        ? 2 
REFMAC    refinement        5.5.0109 ? 3 
HKL-2000  'data reduction'  .        ? 4 
HKL-2000  'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 131 ? ? -116.87 -159.63 
2 1 HIS A 134 ? ? 72.20   36.41   
3 1 ARG A 135 ? ? -117.65 76.56   
4 1 ALA A 136 ? ? 21.95   -75.96  
5 1 PRO B 90  ? ? -66.17  -179.59 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 C DT  1   ? A DT  1   
2  1 Y 1 A LEU 168 ? B LEU 168 
3  1 Y 1 A GLU 169 ? B GLU 169 
4  1 Y 1 A HIS 170 ? B HIS 170 
5  1 Y 1 A HIS 171 ? B HIS 171 
6  1 Y 1 A HIS 172 ? B HIS 172 
7  1 Y 1 A HIS 173 ? B HIS 173 
8  1 Y 1 A HIS 174 ? B HIS 174 
9  1 Y 1 A HIS 175 ? B HIS 175 
10 1 Y 1 B ARG 167 ? D ARG 167 
11 1 Y 1 B LEU 168 ? D LEU 168 
12 1 Y 1 B GLU 169 ? D GLU 169 
13 1 Y 1 B HIS 170 ? D HIS 170 
14 1 Y 1 B HIS 171 ? D HIS 171 
15 1 Y 1 B HIS 172 ? D HIS 172 
16 1 Y 1 B HIS 173 ? D HIS 173 
17 1 Y 1 B HIS 174 ? D HIS 174 
18 1 Y 1 B HIS 175 ? D HIS 175 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4FZY 'double helix'        
4FZY 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 2  1_555 C DC 11 1_555 -0.636 0.400  -0.904 -35.912 -8.930  8.572  1  C_DG2:DC11_D C 2  ? D 11 ? ?  1 
1 A DT 3  1_555 C DA 10 1_555 0.167  0.001  0.058  -10.740 -7.563  13.720 2  C_DT3:DA10_D C 3  ? D 10 ? ?  1 
1 A DA 4  1_555 C DT 9  1_555 0.389  -0.168 0.219  4.145   -1.935  -1.259 3  C_DA4:DT9_D  C 4  ? D 9  ? 20 1 
1 A DG 5  1_555 C DC 8  1_555 0.773  -0.393 -0.059 4.601   -8.892  -1.947 4  C_DG5:DC8_D  C 5  ? D 8  ? 19 1 
1 A DA 6  1_555 C DT 7  1_555 0.447  0.179  -0.074 -2.574  -17.920 1.876  5  C_DA6:DT7_D  C 6  ? D 7  ? 20 1 
1 A DT 7  1_555 C DA 6  1_555 0.087  0.123  0.136  -3.060  -12.469 0.682  6  C_DT7:DA6_D  C 7  ? D 6  ? 20 1 
1 A DT 8  1_555 C DA 5  1_555 0.084  0.077  -0.069 -10.691 -19.013 3.222  7  C_DT8:DA5_D  C 8  ? D 5  ? 20 1 
1 A DC 9  1_555 C DG 4  1_555 0.192  0.092  0.352  0.467   -5.451  12.181 8  C_DC9:DG4_D  C 9  ? D 4  ? 19 1 
1 A DG 10 1_555 C DC 3  1_555 -0.480 0.056  -0.339 -6.133  -8.880  8.378  9  C_DG10:DC3_D C 10 ? D 3  ? 19 1 
1 A DA 11 1_555 C DT 2  1_555 0.269  -0.023 0.089  29.317  -14.092 1.254  10 C_DA11:DT2_D C 11 ? D 2  ? 20 1 
1 A DG 12 1_555 C DC 1  1_555 0.230  -0.108 0.010  -9.324  -8.610  -4.586 11 C_DG12:DC1_D C 12 ? D 1  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 2  1_555 C DC 11 1_555 A DT 3  1_555 C DA 10 1_555 -0.400 0.014  2.916 -10.282 8.425  31.909 -1.170 -0.783 2.822 14.561 
17.769 34.501 1  CC_DG2DT3:DA10DC11_DD C 2  ? D 11 ? C 3  ? D 10 ? 
1 A DT 3  1_555 C DA 10 1_555 A DA 4  1_555 C DT 9  1_555 -0.175 0.987  3.009 -1.377  4.899  29.967 0.953  0.073  3.132 9.389  
2.640  30.386 2  CC_DT3DA4:DT9DA10_DD  C 3  ? D 10 ? C 4  ? D 9  ? 
1 A DA 4  1_555 C DT 9  1_555 A DG 5  1_555 C DC 8  1_555 -0.428 -0.236 3.390 -0.232  6.510  34.635 -1.387 0.672  3.296 10.817 
0.385  35.224 3  CC_DA4DG5:DC8DT9_DD   C 4  ? D 9  ? C 5  ? D 8  ? 
1 A DG 5  1_555 C DC 8  1_555 A DA 6  1_555 C DT 7  1_555 -0.298 -0.592 3.346 0.224   2.935  34.376 -1.461 0.538  3.284 4.954  
-0.379 34.498 4  CC_DG5DA6:DT7DC8_DD   C 5  ? D 8  ? C 6  ? D 7  ? 
1 A DA 6  1_555 C DT 7  1_555 A DT 7  1_555 C DA 6  1_555 -0.173 -0.946 3.271 -3.637  -3.603 32.208 -1.047 -0.337 3.353 -6.443 
6.504  32.601 5  CC_DA6DT7:DA6DT7_DD   C 6  ? D 7  ? C 7  ? D 6  ? 
1 A DT 7  1_555 C DA 6  1_555 A DT 8  1_555 C DA 5  1_555 0.150  -0.370 3.322 4.056   1.874  36.549 -0.845 0.322  3.297 2.974  
-6.438 36.812 6  CC_DT7DT8:DA5DA6_DD   C 7  ? D 6  ? C 8  ? D 5  ? 
1 A DT 8  1_555 C DA 5  1_555 A DC 9  1_555 C DG 4  1_555 0.668  0.856  3.141 -2.300  3.721  33.069 0.894  -1.535 3.163 6.501  
4.019  33.349 7  CC_DT8DC9:DG4DA5_DD   C 8  ? D 5  ? C 9  ? D 4  ? 
1 A DC 9  1_555 C DG 4  1_555 A DG 10 1_555 C DC 3  1_555 0.086  1.711  3.590 5.781   -0.944 37.049 2.797  0.694  3.520 -1.474 
-9.029 37.493 8  CC_DC9DG10:DC3DG4_DD  C 9  ? D 4  ? C 10 ? D 3  ? 
1 A DG 10 1_555 C DC 3  1_555 A DA 11 1_555 C DT 2  1_555 -0.444 0.914  2.599 1.715   6.524  27.798 0.633  1.219  2.707 13.331 
-3.505 28.589 9  CC_DG10DA11:DT2DC3_DD C 10 ? D 3  ? C 11 ? D 2  ? 
1 A DA 11 1_555 C DT 2  1_555 A DG 12 1_555 C DC 1  1_555 0.259  -0.661 5.898 -3.653  46.348 31.997 -5.479 -0.652 2.917 57.137 
4.503  55.931 10 CC_DA11DG12:DC1DT2_DD C 11 ? D 2  ? C 12 ? D 1  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'SODIUM ION' NA  
5 water        HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 4 NA  1 101 3  NA  NA  C . 
F 4 NA  1 201 2  NA  NA  A . 
G 4 NA  1 101 4  NA  NA  D . 
H 4 NA  1 201 1  NA  NA  B . 
I 5 HOH 1 201 6  HOH HOH C . 
I 5 HOH 2 202 9  HOH HOH C . 
J 5 HOH 1 301 5  HOH HOH A . 
J 5 HOH 2 302 7  HOH HOH A . 
J 5 HOH 3 303 8  HOH HOH A . 
J 5 HOH 4 304 10 HOH HOH A . 
J 5 HOH 5 305 11 HOH HOH A . 
J 5 HOH 6 306 12 HOH HOH A . 
J 5 HOH 7 307 13 HOH HOH A . 
J 5 HOH 8 308 14 HOH HOH A . 
J 5 HOH 9 309 17 HOH HOH A . 
K 5 HOH 1 201 16 HOH HOH D . 
K 5 HOH 2 202 19 HOH HOH D . 
L 5 HOH 1 301 1  HOH HOH B . 
L 5 HOH 2 302 2  HOH HOH B . 
L 5 HOH 3 303 3  HOH HOH B . 
L 5 HOH 4 304 4  HOH HOH B . 
L 5 HOH 5 305 18 HOH HOH B . 
L 5 HOH 6 306 20 HOH HOH B . 
L 5 HOH 7 307 21 HOH HOH B . 
L 5 HOH 8 308 22 HOH HOH B . 
L 5 HOH 9 309 24 HOH HOH B . 
#