data_4G3I
# 
_entry.id   4G3I 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4G3I         
NDB   NA1941       
RCSB  RCSB073691   
WWPDB D_1000073691 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2AGQ 
_pdbx_database_related.details        'Fidelity of Dpo4: effect of metal ions, nucleotide selection and pyrophosphorolysis' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4G3I 
_pdbx_database_status.recvd_initial_deposition_date   2012-07-14 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Yan, Y.Y.' 1 
'Gan, J.H.' 2 
'Huang, Z.' 3 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of Dpo4 in complex with DNA duplex' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yan, Y.Y.' 1 
primary 'Gan, J.H.' 2 
primary 'Huang, Z.' 3 
# 
_cell.entry_id           4G3I 
_cell.length_a           52.472 
_cell.length_b           52.634 
_cell.length_c           99.445 
_cell.angle_alpha        75.40 
_cell.angle_beta         80.35 
_cell.angle_gamma        70.97 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4G3I 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn DNA                 4834.142  2  ?       ? ? ? 
2 polymer     syn DNA                 3976.599  2  ?       ? ? ? 
3 polymer     man 'DNA polymerase IV' 39106.598 2  2.7.7.7 ? ? ? 
4 non-polymer syn 'CALCIUM ION'       40.078    2  ?       ? ? ? 
5 water       nat water               18.015    20 ?       ? ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'Pol IV' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DT)(DC)(DA)(DC)(DG)(DA)(DG)(DT)(DC)(DC)(DT)(DT)(DA)(DG)(DC)(DC)' TCACGAGTCCTTAGCC C,E ? 
2 polydeoxyribonucleotide no no '(DG)(DG)(DC)(DT)(DA)(DC)(DA)(DG)(DG)(DA)(DC)(DT)(DC)' GGCTACAGGACTC D,F ? 
3 'polypeptide(L)'        no no 
;SMIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKE
VYQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAK
PNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRT
RVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLL
QKILEEDERKIRRIGVRFSKFI
;
;SMIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKE
VYQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAK
PNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRT
RVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLL
QKILEEDERKIRRIGVRFSKFI
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DT  n 
1 2   DC  n 
1 3   DA  n 
1 4   DC  n 
1 5   DG  n 
1 6   DA  n 
1 7   DG  n 
1 8   DT  n 
1 9   DC  n 
1 10  DC  n 
1 11  DT  n 
1 12  DT  n 
1 13  DA  n 
1 14  DG  n 
1 15  DC  n 
1 16  DC  n 
2 1   DG  n 
2 2   DG  n 
2 3   DC  n 
2 4   DT  n 
2 5   DA  n 
2 6   DC  n 
2 7   DA  n 
2 8   DG  n 
2 9   DG  n 
2 10  DA  n 
2 11  DC  n 
2 12  DT  n 
2 13  DC  n 
3 1   SER n 
3 2   MET n 
3 3   ILE n 
3 4   VAL n 
3 5   LEU n 
3 6   PHE n 
3 7   VAL n 
3 8   ASP n 
3 9   PHE n 
3 10  ASP n 
3 11  TYR n 
3 12  PHE n 
3 13  TYR n 
3 14  ALA n 
3 15  GLN n 
3 16  VAL n 
3 17  GLU n 
3 18  GLU n 
3 19  VAL n 
3 20  LEU n 
3 21  ASN n 
3 22  PRO n 
3 23  SER n 
3 24  LEU n 
3 25  LYS n 
3 26  GLY n 
3 27  LYS n 
3 28  PRO n 
3 29  VAL n 
3 30  VAL n 
3 31  VAL n 
3 32  CYS n 
3 33  VAL n 
3 34  PHE n 
3 35  SER n 
3 36  GLY n 
3 37  ARG n 
3 38  PHE n 
3 39  GLU n 
3 40  ASP n 
3 41  SER n 
3 42  GLY n 
3 43  ALA n 
3 44  VAL n 
3 45  ALA n 
3 46  THR n 
3 47  ALA n 
3 48  ASN n 
3 49  TYR n 
3 50  GLU n 
3 51  ALA n 
3 52  ARG n 
3 53  LYS n 
3 54  PHE n 
3 55  GLY n 
3 56  VAL n 
3 57  LYS n 
3 58  ALA n 
3 59  GLY n 
3 60  ILE n 
3 61  PRO n 
3 62  ILE n 
3 63  VAL n 
3 64  GLU n 
3 65  ALA n 
3 66  LYS n 
3 67  LYS n 
3 68  ILE n 
3 69  LEU n 
3 70  PRO n 
3 71  ASN n 
3 72  ALA n 
3 73  VAL n 
3 74  TYR n 
3 75  LEU n 
3 76  PRO n 
3 77  MET n 
3 78  ARG n 
3 79  LYS n 
3 80  GLU n 
3 81  VAL n 
3 82  TYR n 
3 83  GLN n 
3 84  GLN n 
3 85  VAL n 
3 86  SER n 
3 87  SER n 
3 88  ARG n 
3 89  ILE n 
3 90  MET n 
3 91  ASN n 
3 92  LEU n 
3 93  LEU n 
3 94  ARG n 
3 95  GLU n 
3 96  TYR n 
3 97  SER n 
3 98  GLU n 
3 99  LYS n 
3 100 ILE n 
3 101 GLU n 
3 102 ILE n 
3 103 ALA n 
3 104 SER n 
3 105 ILE n 
3 106 ASP n 
3 107 GLU n 
3 108 ALA n 
3 109 TYR n 
3 110 LEU n 
3 111 ASP n 
3 112 ILE n 
3 113 SER n 
3 114 ASP n 
3 115 LYS n 
3 116 VAL n 
3 117 ARG n 
3 118 ASP n 
3 119 TYR n 
3 120 ARG n 
3 121 GLU n 
3 122 ALA n 
3 123 TYR n 
3 124 ASN n 
3 125 LEU n 
3 126 GLY n 
3 127 LEU n 
3 128 GLU n 
3 129 ILE n 
3 130 LYS n 
3 131 ASN n 
3 132 LYS n 
3 133 ILE n 
3 134 LEU n 
3 135 GLU n 
3 136 LYS n 
3 137 GLU n 
3 138 LYS n 
3 139 ILE n 
3 140 THR n 
3 141 VAL n 
3 142 THR n 
3 143 VAL n 
3 144 GLY n 
3 145 ILE n 
3 146 SER n 
3 147 LYS n 
3 148 ASN n 
3 149 LYS n 
3 150 VAL n 
3 151 PHE n 
3 152 ALA n 
3 153 LYS n 
3 154 ILE n 
3 155 ALA n 
3 156 ALA n 
3 157 ASP n 
3 158 MET n 
3 159 ALA n 
3 160 LYS n 
3 161 PRO n 
3 162 ASN n 
3 163 GLY n 
3 164 ILE n 
3 165 LYS n 
3 166 VAL n 
3 167 ILE n 
3 168 ASP n 
3 169 ASP n 
3 170 GLU n 
3 171 GLU n 
3 172 VAL n 
3 173 LYS n 
3 174 ARG n 
3 175 LEU n 
3 176 ILE n 
3 177 ARG n 
3 178 GLU n 
3 179 LEU n 
3 180 ASP n 
3 181 ILE n 
3 182 ALA n 
3 183 ASP n 
3 184 VAL n 
3 185 PRO n 
3 186 GLY n 
3 187 ILE n 
3 188 GLY n 
3 189 ASN n 
3 190 ILE n 
3 191 THR n 
3 192 ALA n 
3 193 GLU n 
3 194 LYS n 
3 195 LEU n 
3 196 LYS n 
3 197 LYS n 
3 198 LEU n 
3 199 GLY n 
3 200 ILE n 
3 201 ASN n 
3 202 LYS n 
3 203 LEU n 
3 204 VAL n 
3 205 ASP n 
3 206 THR n 
3 207 LEU n 
3 208 SER n 
3 209 ILE n 
3 210 GLU n 
3 211 PHE n 
3 212 ASP n 
3 213 LYS n 
3 214 LEU n 
3 215 LYS n 
3 216 GLY n 
3 217 MET n 
3 218 ILE n 
3 219 GLY n 
3 220 GLU n 
3 221 ALA n 
3 222 LYS n 
3 223 ALA n 
3 224 LYS n 
3 225 TYR n 
3 226 LEU n 
3 227 ILE n 
3 228 SER n 
3 229 LEU n 
3 230 ALA n 
3 231 ARG n 
3 232 ASP n 
3 233 GLU n 
3 234 TYR n 
3 235 ASN n 
3 236 GLU n 
3 237 PRO n 
3 238 ILE n 
3 239 ARG n 
3 240 THR n 
3 241 ARG n 
3 242 VAL n 
3 243 ARG n 
3 244 LYS n 
3 245 SER n 
3 246 ILE n 
3 247 GLY n 
3 248 ARG n 
3 249 ILE n 
3 250 VAL n 
3 251 THR n 
3 252 MET n 
3 253 LYS n 
3 254 ARG n 
3 255 ASN n 
3 256 SER n 
3 257 ARG n 
3 258 ASN n 
3 259 LEU n 
3 260 GLU n 
3 261 GLU n 
3 262 ILE n 
3 263 LYS n 
3 264 PRO n 
3 265 TYR n 
3 266 LEU n 
3 267 PHE n 
3 268 ARG n 
3 269 ALA n 
3 270 ILE n 
3 271 GLU n 
3 272 GLU n 
3 273 SER n 
3 274 TYR n 
3 275 TYR n 
3 276 LYS n 
3 277 LEU n 
3 278 ASP n 
3 279 LYS n 
3 280 ARG n 
3 281 ILE n 
3 282 PRO n 
3 283 LYS n 
3 284 ALA n 
3 285 ILE n 
3 286 HIS n 
3 287 VAL n 
3 288 VAL n 
3 289 ALA n 
3 290 VAL n 
3 291 THR n 
3 292 GLU n 
3 293 ASP n 
3 294 LEU n 
3 295 ASP n 
3 296 ILE n 
3 297 VAL n 
3 298 SER n 
3 299 ARG n 
3 300 GLY n 
3 301 ARG n 
3 302 THR n 
3 303 PHE n 
3 304 PRO n 
3 305 HIS n 
3 306 GLY n 
3 307 ILE n 
3 308 SER n 
3 309 LYS n 
3 310 GLU n 
3 311 THR n 
3 312 ALA n 
3 313 TYR n 
3 314 SER n 
3 315 GLU n 
3 316 SER n 
3 317 VAL n 
3 318 LYS n 
3 319 LEU n 
3 320 LEU n 
3 321 GLN n 
3 322 LYS n 
3 323 ILE n 
3 324 LEU n 
3 325 GLU n 
3 326 GLU n 
3 327 ASP n 
3 328 GLU n 
3 329 ARG n 
3 330 LYS n 
3 331 ILE n 
3 332 ARG n 
3 333 ARG n 
3 334 ILE n 
3 335 GLY n 
3 336 VAL n 
3 337 ARG n 
3 338 PHE n 
3 339 SER n 
3 340 LYS n 
3 341 PHE n 
3 342 ILE n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'dbh, dpo4, SSO2448' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'ATCC 35092 / DSM 1617 / JCM 11322 / P2' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Sulfolobus solfataricus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     273057 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample ? ? 'synthetic construct' ? 32630 ? 
2 1 sample ? ? 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPO4_SULSO Q97W02 3 
;MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEV
YQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKP
NGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTR
VRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQ
KILEEDERKIRRIGVRFSKFI
;
1 ? 
2 PDB 4G3I       4G3I   1 ? ? ? 
3 PDB 4G3I       4G3I   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4G3I A 2 ? 342 ? Q97W02 1  ? 341 ? 1  341 
2 1 4G3I B 2 ? 342 ? Q97W02 1  ? 341 ? 1  341 
3 2 4G3I C 1 ? 16  ? 4G3I   -2 ? 13  ? -2 13  
4 2 4G3I E 1 ? 16  ? 4G3I   -2 ? 13  ? -2 13  
5 3 4G3I D 1 ? 13  ? 4G3I   5  ? 17  ? 5  17  
6 3 4G3I F 1 ? 13  ? 4G3I   5  ? 17  ? 5  17  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4G3I SER A 1 ? UNP Q97W02 ? ? 'EXPRESSION TAG' 0 1 
2 4G3I SER B 1 ? UNP Q97W02 ? ? 'EXPRESSION TAG' 0 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CA  non-polymer         . 'CALCIUM ION'                        ? 'Ca 2'            40.078  
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          4G3I 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.61 
_exptl_crystal.density_percent_sol   52.88 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'0.2 M CaCl2, 0.1 M Na Cacodylate pH 6.5, 19 % PEG 8000, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2010-02-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    mirror 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X12B' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X12B 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     4G3I 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             95.813 
_reflns.d_resolution_high            2.48 
_reflns.number_obs                   33414 
_reflns.number_all                   34376 
_reflns.percent_possible_obs         97.2 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.083 
_reflns.pdbx_netI_over_sigmaI        12.4 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.48 
_reflns_shell.d_res_low              2.61 
_reflns_shell.percent_possible_all   96.1 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.297 
_reflns_shell.meanI_over_sigI_obs    4.1 
_reflns_shell.pdbx_redundancy        3.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      4951 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4G3I 
_refine.ls_number_reflns_obs                     30884 
_refine.ls_number_reflns_all                     34376 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             95.81 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    97.10 
_refine.ls_R_factor_obs                          0.24337 
_refine.ls_R_factor_all                          0.24337 
_refine.ls_R_factor_R_work                       0.24067 
_refine.ls_R_factor_R_free                       0.29363 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1650 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.913 
_refine.correlation_coeff_Fo_to_Fc_free          0.882 
_refine.B_iso_mean                               33.155 
_refine.aniso_B[1][1]                            -2.09 
_refine.aniso_B[2][2]                            0.00 
_refine.aniso_B[3][3]                            1.47 
_refine.aniso_B[1][2]                            2.12 
_refine.aniso_B[1][3]                            0.02 
_refine.aniso_B[2][3]                            -1.51 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 2AGQ' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.339 
_refine.overall_SU_ML                            0.262 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             25.325 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5494 
_refine_hist.pdbx_number_atoms_nucleic_acid   722 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             20 
_refine_hist.number_atoms_total               6238 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        95.81 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d             0.018  0.022  ? 6378 ? 'X-RAY DIFFRACTION' 
r_bond_other_d               ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg          1.923  2.135  ? 8720 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg       6.753  5.000  ? 681  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg       38.424 23.636 ? 242  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg       20.407 15.000 ? 1127 ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg       21.341 15.000 ? 48   ? 'X-RAY DIFFRACTION' 
r_chiral_restr               0.118  0.200  ? 997  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined         0.008  0.021  ? 4410 ? 'X-RAY DIFFRACTION' 
r_gen_planes_other           ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbd_refined                ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbd_other                  ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbtor_refined              ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbtor_other                ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined        ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_metal_ion_refined          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_metal_ion_other            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined       ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other         ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined     ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_other       ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_refined ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_other   ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_mcbond_it                  1.151  1.500  ? 3403 ? 'X-RAY DIFFRACTION' 
r_mcbond_other               ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_mcangle_it                 2.026  2.000  ? 5532 ? 'X-RAY DIFFRACTION' 
r_scbond_it                  2.689  3.000  ? 2975 ? 'X-RAY DIFFRACTION' 
r_scangle_it                 4.116  4.500  ? 3188 ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr           1.556  3.000  ? 6378 ? 'X-RAY DIFFRACTION' 
r_sphericity_free            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 'X-RAY DIFFRACTION' 1 1 'MEDIUM POSITIONAL' A 2744 0.510 0.500 ? ? ? 
2 'X-RAY DIFFRACTION' 1 1 'MEDIUM THERMAL'    A 2744 0.900 2.000 ? ? ? 
3 'X-RAY DIFFRACTION' 2 1 'MEDIUM POSITIONAL' C 198  0.500 0.500 ? ? ? 
4 'X-RAY DIFFRACTION' 2 1 'MEDIUM THERMAL'    C 198  0.620 2.000 ? ? ? 
5 'X-RAY DIFFRACTION' 3 1 'MEDIUM POSITIONAL' D 163  0.440 0.500 ? ? ? 
6 'X-RAY DIFFRACTION' 3 1 'MEDIUM THERMAL'    D 163  0.750 2.000 ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.500 
_refine_ls_shell.d_res_low                        2.565 
_refine_ls_shell.number_reflns_R_work             2231 
_refine_ls_shell.R_factor_R_work                  0.261 
_refine_ls_shell.percent_reflns_obs               96.07 
_refine_ls_shell.R_factor_R_free                  0.334 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             117 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 B 
2 1 C 
2 2 E 
3 1 D 
3 2 F 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 1 4 A 1 A 341 ? . . . . . . . . 
1 2 1 4 B 1 B 341 ? . . . . . . . . 
2 1 1 4 C 4 C 13  ? . . . . . . . . 
2 2 1 4 E 4 E 13  ? . . . . . . . . 
3 1 1 4 D 5 D 12  ? . . . . . . . . 
3 2 1 4 F 5 F 12  ? . . . . . . . . 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
# 
_struct.entry_id                  4G3I 
_struct.title                     'Crystal structure of Dpo4 in complex with DNA duplex' 
_struct.pdbx_descriptor           'PROTEIN/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4G3I 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'DNA synthesis, TRANSFERASE-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR E 11  ? ASN E 21  ? TYR A 10  ASN A 20  1 ? 11 
HELX_P HELX_P2  2  PRO E 22  ? LYS E 25  ? PRO A 21  LYS A 24  5 ? 4  
HELX_P HELX_P3  3  ASN E 48  ? LYS E 53  ? ASN A 47  LYS A 52  1 ? 6  
HELX_P HELX_P4  4  PRO E 61  ? LEU E 69  ? PRO A 60  LEU A 68  1 ? 9  
HELX_P HELX_P5  5  ARG E 78  ? SER E 97  ? ARG A 77  SER A 96  1 ? 20 
HELX_P HELX_P6  6  ASP E 118 ? LYS E 138 ? ASP A 117 LYS A 137 1 ? 21 
HELX_P HELX_P7  7  ASN E 148 ? LYS E 160 ? ASN A 147 LYS A 159 1 ? 13 
HELX_P HELX_P8  8  ASP E 168 ? LEU E 179 ? ASP A 167 LEU A 178 1 ? 12 
HELX_P HELX_P9  9  ASP E 180 ? VAL E 184 ? ASP A 179 VAL A 183 5 ? 5  
HELX_P HELX_P10 10 GLY E 188 ? LYS E 197 ? GLY A 187 LYS A 196 1 ? 10 
HELX_P HELX_P11 11 LYS E 202 ? ILE E 209 ? LYS A 201 ILE A 208 5 ? 8  
HELX_P HELX_P12 12 PHE E 211 ? GLY E 216 ? PHE A 210 GLY A 215 1 ? 6  
HELX_P HELX_P13 13 GLY E 219 ? ARG E 231 ? GLY A 218 ARG A 230 1 ? 13 
HELX_P HELX_P14 14 ASN E 258 ? ASP E 278 ? ASN A 257 ASP A 277 1 ? 21 
HELX_P HELX_P15 15 SER E 308 ? GLU E 325 ? SER A 307 GLU A 324 1 ? 18 
HELX_P HELX_P16 16 TYR F 11  ? ASN F 21  ? TYR B 10  ASN B 20  1 ? 11 
HELX_P HELX_P17 17 PRO F 22  ? LYS F 25  ? PRO B 21  LYS B 24  5 ? 4  
HELX_P HELX_P18 18 ASN F 48  ? LYS F 53  ? ASN B 47  LYS B 52  1 ? 6  
HELX_P HELX_P19 19 PRO F 61  ? LEU F 69  ? PRO B 60  LEU B 68  1 ? 9  
HELX_P HELX_P20 20 ARG F 78  ? SER F 97  ? ARG B 77  SER B 96  1 ? 20 
HELX_P HELX_P21 21 ASP F 118 ? LYS F 138 ? ASP B 117 LYS B 137 1 ? 21 
HELX_P HELX_P22 22 ASN F 148 ? LYS F 160 ? ASN B 147 LYS B 159 1 ? 13 
HELX_P HELX_P23 23 ASP F 168 ? LEU F 179 ? ASP B 167 LEU B 178 1 ? 12 
HELX_P HELX_P24 24 ASP F 180 ? VAL F 184 ? ASP B 179 VAL B 183 5 ? 5  
HELX_P HELX_P25 25 GLY F 188 ? LYS F 197 ? GLY B 187 LYS B 196 1 ? 10 
HELX_P HELX_P26 26 LEU F 203 ? SER F 208 ? LEU B 202 SER B 207 5 ? 6  
HELX_P HELX_P27 27 GLU F 210 ? GLY F 219 ? GLU B 209 GLY B 218 1 ? 10 
HELX_P HELX_P28 28 GLY F 219 ? ARG F 231 ? GLY B 218 ARG B 230 1 ? 13 
HELX_P HELX_P29 29 ASN F 258 ? ASP F 278 ? ASN B 257 ASP B 277 1 ? 21 
HELX_P HELX_P30 30 SER F 308 ? ASP F 327 ? SER B 307 ASP B 326 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E ASP 8   OD2 ? ? ? 1_555 G CA  . CA ? ? A ASP 7   A CA  401 1_555 ? ? ? ? ? ? ?               2.007 ? 
metalc2  metalc ? ? A DC  16  OP1 ? ? ? 1_555 G CA  . CA ? ? C DC  13  A CA  401 1_555 ? ? ? ? ? ? ?               2.097 ? 
metalc3  metalc ? ? C DC  16  OP1 ? ? ? 1_555 H CA  . CA ? ? E DC  13  B CA  401 1_555 ? ? ? ? ? ? ?               2.189 ? 
metalc4  metalc ? ? F ASP 8   OD2 ? ? ? 1_555 H CA  . CA ? ? B ASP 7   B CA  401 1_555 ? ? ? ? ? ? ?               2.273 ? 
metalc5  metalc ? ? F GLU 107 OE2 ? ? ? 1_555 H CA  . CA ? ? B GLU 106 B CA  401 1_555 ? ? ? ? ? ? ?               2.510 ? 
metalc6  metalc ? ? H CA  .   CA  ? ? ? 1_555 K HOH . O  ? ? B CA  401 B HOH 502 1_555 ? ? ? ? ? ? ?               2.614 ? 
metalc7  metalc ? ? E GLU 107 OE1 ? ? ? 1_555 G CA  . CA ? ? A GLU 106 A CA  401 1_555 ? ? ? ? ? ? ?               2.809 ? 
metalc8  metalc ? ? E ASP 106 OD1 ? ? ? 1_555 G CA  . CA ? ? A ASP 105 A CA  401 1_555 ? ? ? ? ? ? ?               2.856 ? 
metalc9  metalc ? ? F ASP 106 OD1 ? ? ? 1_555 H CA  . CA ? ? B ASP 105 B CA  401 1_555 ? ? ? ? ? ? ?               2.899 ? 
hydrog1  hydrog ? ? A DC  10  N3  ? ? ? 1_555 B DG  8 N1 ? ? C DC  7   D DG  12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2  hydrog ? ? A DC  10  N4  ? ? ? 1_555 B DG  8 O6 ? ? C DC  7   D DG  12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3  hydrog ? ? A DC  10  O2  ? ? ? 1_555 B DG  8 N2 ? ? C DC  7   D DG  12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4  hydrog ? ? A DT  11  N3  ? ? ? 1_555 B DA  7 N1 ? ? C DT  8   D DA  11  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog5  hydrog ? ? A DT  12  N3  ? ? ? 1_555 B DA  5 N1 ? ? C DT  9   D DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6  hydrog ? ? A DT  12  O4  ? ? ? 1_555 B DA  5 N6 ? ? C DT  9   D DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7  hydrog ? ? A DA  13  N1  ? ? ? 1_555 B DT  4 N3 ? ? C DA  10  D DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8  hydrog ? ? A DA  13  N6  ? ? ? 1_555 B DT  4 O4 ? ? C DA  10  D DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9  hydrog ? ? A DG  14  N1  ? ? ? 1_555 B DC  3 N3 ? ? C DG  11  D DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10 hydrog ? ? A DG  14  N2  ? ? ? 1_555 B DC  3 O2 ? ? C DG  11  D DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11 hydrog ? ? A DG  14  O6  ? ? ? 1_555 B DC  3 N4 ? ? C DG  11  D DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12 hydrog ? ? A DC  15  N3  ? ? ? 1_555 B DG  2 N1 ? ? C DC  12  D DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13 hydrog ? ? A DC  15  N4  ? ? ? 1_555 B DG  2 O6 ? ? C DC  12  D DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14 hydrog ? ? A DC  15  O2  ? ? ? 1_555 B DG  2 N2 ? ? C DC  12  D DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15 hydrog ? ? A DC  16  N3  ? ? ? 1_555 B DG  1 N1 ? ? C DC  13  D DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16 hydrog ? ? A DC  16  N4  ? ? ? 1_555 B DG  1 O6 ? ? C DC  13  D DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17 hydrog ? ? A DC  16  O2  ? ? ? 1_555 B DG  1 N2 ? ? C DC  13  D DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18 hydrog ? ? C DC  10  N3  ? ? ? 1_555 D DA  7 N6 ? ? E DC  7   F DA  11  1_555 ? ? ? ? ? ? 'DC-DA MISPAIR' ?     ? 
hydrog19 hydrog ? ? C DC  10  O2  ? ? ? 1_555 D DG  8 N1 ? ? E DC  7   F DG  12  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog20 hydrog ? ? C DT  11  O4  ? ? ? 1_555 D DC  6 N4 ? ? E DT  8   F DC  10  1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ?     ? 
hydrog21 hydrog ? ? C DT  11  N3  ? ? ? 1_555 D DA  7 N1 ? ? E DT  8   F DA  11  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog22 hydrog ? ? C DT  12  N3  ? ? ? 1_555 D DA  5 N1 ? ? E DT  9   F DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23 hydrog ? ? C DT  12  O4  ? ? ? 1_555 D DA  5 N6 ? ? E DT  9   F DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24 hydrog ? ? C DA  13  N1  ? ? ? 1_555 D DT  4 N3 ? ? E DA  10  F DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25 hydrog ? ? C DA  13  N6  ? ? ? 1_555 D DT  4 O4 ? ? E DA  10  F DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26 hydrog ? ? C DG  14  N1  ? ? ? 1_555 D DC  3 N3 ? ? E DG  11  F DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27 hydrog ? ? C DG  14  N2  ? ? ? 1_555 D DC  3 O2 ? ? E DG  11  F DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28 hydrog ? ? C DG  14  O6  ? ? ? 1_555 D DC  3 N4 ? ? E DG  11  F DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29 hydrog ? ? C DC  15  N3  ? ? ? 1_555 D DG  2 N1 ? ? E DC  12  F DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30 hydrog ? ? C DC  15  N4  ? ? ? 1_555 D DG  2 O6 ? ? E DC  12  F DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31 hydrog ? ? C DC  15  O2  ? ? ? 1_555 D DG  2 N2 ? ? E DC  12  F DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32 hydrog ? ? C DC  16  N3  ? ? ? 1_555 D DG  1 N1 ? ? E DC  13  F DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33 hydrog ? ? C DC  16  N4  ? ? ? 1_555 D DG  1 O6 ? ? E DC  13  F DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34 hydrog ? ? C DC  16  O2  ? ? ? 1_555 D DG  1 N2 ? ? E DC  13  F DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 160 E . ? LYS 159 A PRO 161 E ? PRO 160 A 1 9.28 
2 LYS 160 F . ? LYS 159 B PRO 161 F ? PRO 160 B 1 7.49 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 4 ? 
D ? 5 ? 
E ? 3 ? 
F ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE E 100 ? SER E 104 ? ILE A 99  SER A 103 
A 2 GLU E 107 ? ASP E 111 ? GLU A 106 ASP A 110 
A 3 VAL E 4   ? PHE E 9   ? VAL A 3   PHE A 8   
A 4 VAL E 141 ? SER E 146 ? VAL A 140 SER A 145 
A 5 GLY E 163 ? ILE E 167 ? GLY A 162 ILE A 166 
B 1 GLY E 42  ? ALA E 47  ? GLY A 41  ALA A 46  
B 2 VAL E 29  ? PHE E 34  ? VAL A 28  PHE A 33  
B 3 VAL E 73  ? PRO E 76  ? VAL A 72  PRO A 75  
C 1 SER E 245 ? SER E 256 ? SER A 244 SER A 255 
C 2 ILE E 331 ? PHE E 341 ? ILE A 330 PHE A 340 
C 3 PRO E 282 ? THR E 291 ? PRO A 281 THR A 290 
C 4 VAL E 297 ? THR E 302 ? VAL A 296 THR A 301 
D 1 ILE F 100 ? ILE F 102 ? ILE B 99  ILE B 101 
D 2 GLU F 107 ? ASP F 111 ? GLU B 106 ASP B 110 
D 3 VAL F 4   ? PHE F 9   ? VAL B 3   PHE B 8   
D 4 VAL F 141 ? SER F 146 ? VAL B 140 SER B 145 
D 5 ILE F 164 ? VAL F 166 ? ILE B 163 VAL B 165 
E 1 GLY F 42  ? ALA F 47  ? GLY B 41  ALA B 46  
E 2 VAL F 29  ? PHE F 34  ? VAL B 28  PHE B 33  
E 3 VAL F 73  ? PRO F 76  ? VAL B 72  PRO B 75  
F 1 SER F 245 ? THR F 251 ? SER B 244 THR B 250 
F 2 ILE F 331 ? PHE F 341 ? ILE B 330 PHE B 340 
F 3 PRO F 282 ? THR F 291 ? PRO B 281 THR B 290 
F 4 ILE F 296 ? THR F 302 ? ILE B 295 THR B 301 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU E 101 ? N GLU A 100 O TYR E 109 ? O TYR A 108 
A 2 3 O LEU E 110 ? O LEU A 109 N LEU E 5   ? N LEU A 4   
A 3 4 N PHE E 6   ? N PHE A 5   O GLY E 144 ? O GLY A 143 
A 4 5 N ILE E 145 ? N ILE A 144 O ILE E 167 ? O ILE A 166 
B 1 2 O ALA E 43  ? O ALA A 42  N VAL E 33  ? N VAL A 32  
B 2 3 N CYS E 32  ? N CYS A 31  O LEU E 75  ? O LEU A 74  
C 1 2 N ILE E 246 ? N ILE A 245 O PHE E 338 ? O PHE A 337 
C 2 3 O ARG E 332 ? O ARG A 331 N VAL E 290 ? N VAL A 289 
C 3 4 N ALA E 289 ? N ALA A 288 O VAL E 297 ? O VAL A 296 
D 1 2 N GLU F 101 ? N GLU B 100 O TYR F 109 ? O TYR B 108 
D 2 3 O LEU F 110 ? O LEU B 109 N LEU F 5   ? N LEU B 4   
D 3 4 N PHE F 6   ? N PHE B 5   O GLY F 144 ? O GLY B 143 
D 4 5 N ILE F 145 ? N ILE B 144 O LYS F 165 ? O LYS B 164 
E 1 2 O THR F 46  ? O THR B 45  N VAL F 31  ? N VAL B 30  
E 2 3 N CYS F 32  ? N CYS B 31  O LEU F 75  ? O LEU B 74  
F 1 2 N ILE F 246 ? N ILE B 245 O PHE F 338 ? O PHE B 337 
F 2 3 O ARG F 332 ? O ARG B 331 N VAL F 290 ? N VAL B 289 
F 3 4 N ALA F 289 ? N ALA B 288 O VAL F 297 ? O VAL B 296 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CA A 401' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA B 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 ASP E 8   ? ASP A 7   . ? 1_555 ? 
2 AC1 4 ASP E 106 ? ASP A 105 . ? 1_555 ? 
3 AC1 4 GLU E 107 ? GLU A 106 . ? 1_555 ? 
4 AC1 4 DC  A 16  ? DC  C 13  . ? 1_555 ? 
5 AC2 5 ASP F 8   ? ASP B 7   . ? 1_555 ? 
6 AC2 5 ASP F 106 ? ASP B 105 . ? 1_555 ? 
7 AC2 5 GLU F 107 ? GLU B 106 . ? 1_555 ? 
8 AC2 5 HOH K .   ? HOH B 502 . ? 1_555 ? 
9 AC2 5 DC  C 16  ? DC  E 13  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4G3I 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4G3I 
_atom_sites.fract_transf_matrix[1][1]   0.019058 
_atom_sites.fract_transf_matrix[1][2]   -0.006572 
_atom_sites.fract_transf_matrix[1][3]   -0.001891 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020097 
_atom_sites.fract_transf_matrix[2][3]   -0.004356 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010437 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DG  A 1 7   ? 25.578  34.443  -35.192 1.00 49.00  ? 4   DG  C "O5'" 1 
ATOM   2    C  "C5'" . DG  A 1 7   ? 24.769  34.370  -34.014 1.00 49.10  ? 4   DG  C "C5'" 1 
ATOM   3    C  "C4'" . DG  A 1 7   ? 23.292  34.589  -34.335 1.00 48.94  ? 4   DG  C "C4'" 1 
ATOM   4    O  "O4'" . DG  A 1 7   ? 22.952  33.889  -35.557 1.00 49.09  ? 4   DG  C "O4'" 1 
ATOM   5    C  "C3'" . DG  A 1 7   ? 22.261  34.064  -33.327 1.00 49.04  ? 4   DG  C "C3'" 1 
ATOM   6    O  "O3'" . DG  A 1 7   ? 21.099  34.901  -33.308 1.00 48.43  ? 4   DG  C "O3'" 1 
ATOM   7    C  "C2'" . DG  A 1 7   ? 21.886  32.687  -33.886 1.00 49.50  ? 4   DG  C "C2'" 1 
ATOM   8    C  "C1'" . DG  A 1 7   ? 21.734  33.217  -35.302 1.00 48.98  ? 4   DG  C "C1'" 1 
ATOM   9    N  N9    . DG  A 1 7   ? 21.430  32.344  -36.425 1.00 48.97  ? 4   DG  C N9    1 
ATOM   10   C  C8    . DG  A 1 7   ? 22.214  31.387  -37.032 1.00 49.05  ? 4   DG  C C8    1 
ATOM   11   N  N7    . DG  A 1 7   ? 21.615  30.833  -38.055 1.00 49.67  ? 4   DG  C N7    1 
ATOM   12   C  C5    . DG  A 1 7   ? 20.368  31.474  -38.120 1.00 50.19  ? 4   DG  C C5    1 
ATOM   13   C  C6    . DG  A 1 7   ? 19.273  31.309  -39.016 1.00 50.94  ? 4   DG  C C6    1 
ATOM   14   O  O6    . DG  A 1 7   ? 19.205  30.520  -39.976 1.00 52.27  ? 4   DG  C O6    1 
ATOM   15   N  N1    . DG  A 1 7   ? 18.196  32.166  -38.713 1.00 50.66  ? 4   DG  C N1    1 
ATOM   16   C  C2    . DG  A 1 7   ? 18.174  33.082  -37.678 1.00 49.78  ? 4   DG  C C2    1 
ATOM   17   N  N2    . DG  A 1 7   ? 17.072  33.830  -37.532 1.00 49.32  ? 4   DG  C N2    1 
ATOM   18   N  N3    . DG  A 1 7   ? 19.190  33.250  -36.840 1.00 49.83  ? 4   DG  C N3    1 
ATOM   19   C  C4    . DG  A 1 7   ? 20.244  32.417  -37.120 1.00 49.53  ? 4   DG  C C4    1 
ATOM   20   P  P     . DT  A 1 8   ? 20.209  34.906  -31.985 1.00 48.39  ? 5   DT  C P     1 
ATOM   21   O  OP1   . DT  A 1 8   ? 20.121  36.297  -31.506 1.00 48.09  ? 5   DT  C OP1   1 
ATOM   22   O  OP2   . DT  A 1 8   ? 20.748  33.846  -31.110 1.00 48.85  ? 5   DT  C OP2   1 
ATOM   23   O  "O5'" . DT  A 1 8   ? 18.734  34.490  -32.426 1.00 48.64  ? 5   DT  C "O5'" 1 
ATOM   24   C  "C5'" . DT  A 1 8   ? 17.800  35.547  -32.571 1.00 47.96  ? 5   DT  C "C5'" 1 
ATOM   25   C  "C4'" . DT  A 1 8   ? 16.399  35.013  -32.739 1.00 47.75  ? 5   DT  C "C4'" 1 
ATOM   26   O  "O4'" . DT  A 1 8   ? 16.389  34.063  -33.833 1.00 48.27  ? 5   DT  C "O4'" 1 
ATOM   27   C  "C3'" . DT  A 1 8   ? 15.875  34.285  -31.505 1.00 46.91  ? 5   DT  C "C3'" 1 
ATOM   28   O  "O3'" . DT  A 1 8   ? 14.533  34.641  -31.206 1.00 44.94  ? 5   DT  C "O3'" 1 
ATOM   29   C  "C2'" . DT  A 1 8   ? 15.960  32.824  -31.917 1.00 48.42  ? 5   DT  C "C2'" 1 
ATOM   30   C  "C1'" . DT  A 1 8   ? 15.654  32.939  -33.401 1.00 48.97  ? 5   DT  C "C1'" 1 
ATOM   31   N  N1    . DT  A 1 8   ? 16.061  31.747  -34.191 1.00 50.67  ? 5   DT  C N1    1 
ATOM   32   C  C2    . DT  A 1 8   ? 15.608  31.637  -35.493 1.00 50.85  ? 5   DT  C C2    1 
ATOM   33   O  O2    . DT  A 1 8   ? 14.881  32.458  -36.022 1.00 50.30  ? 5   DT  C O2    1 
ATOM   34   N  N3    . DT  A 1 8   ? 16.040  30.505  -36.141 1.00 51.84  ? 5   DT  C N3    1 
ATOM   35   C  C4    . DT  A 1 8   ? 16.856  29.501  -35.629 1.00 51.80  ? 5   DT  C C4    1 
ATOM   36   O  O4    . DT  A 1 8   ? 17.172  28.523  -36.304 1.00 52.61  ? 5   DT  C O4    1 
ATOM   37   C  C5    . DT  A 1 8   ? 17.299  29.677  -34.260 1.00 51.63  ? 5   DT  C C5    1 
ATOM   38   C  C7    . DT  A 1 8   ? 18.188  28.661  -33.584 1.00 51.35  ? 5   DT  C C7    1 
ATOM   39   C  C6    . DT  A 1 8   ? 16.879  30.780  -33.615 1.00 51.14  ? 5   DT  C C6    1 
ATOM   40   P  P     . DC  A 1 9   ? 14.035  34.612  -29.685 1.00 43.51  ? 6   DC  C P     1 
ATOM   41   O  OP1   . DC  A 1 9   ? 13.903  36.019  -29.244 1.00 42.29  ? 6   DC  C OP1   1 
ATOM   42   O  OP2   . DC  A 1 9   ? 14.820  33.642  -28.893 1.00 41.76  ? 6   DC  C OP2   1 
ATOM   43   O  "O5'" . DC  A 1 9   ? 12.576  33.954  -29.825 1.00 45.09  ? 6   DC  C "O5'" 1 
ATOM   44   C  "C5'" . DC  A 1 9   ? 11.578  34.559  -30.661 1.00 45.24  ? 6   DC  C "C5'" 1 
ATOM   45   C  "C4'" . DC  A 1 9   ? 10.506  33.595  -31.127 1.00 44.29  ? 6   DC  C "C4'" 1 
ATOM   46   O  "O4'" . DC  A 1 9   ? 10.909  32.954  -32.356 1.00 45.08  ? 6   DC  C "O4'" 1 
ATOM   47   C  "C3'" . DC  A 1 9   ? 10.152  32.458  -30.188 1.00 43.38  ? 6   DC  C "C3'" 1 
ATOM   48   O  "O3'" . DC  A 1 9   ? 8.794   32.283  -30.293 1.00 41.37  ? 6   DC  C "O3'" 1 
ATOM   49   C  "C2'" . DC  A 1 9   ? 10.784  31.246  -30.821 1.00 44.41  ? 6   DC  C "C2'" 1 
ATOM   50   C  "C1'" . DC  A 1 9   ? 10.494  31.607  -32.265 1.00 46.31  ? 6   DC  C "C1'" 1 
ATOM   51   N  N1    . DC  A 1 9   ? 11.234  30.778  -33.293 1.00 48.42  ? 6   DC  C N1    1 
ATOM   52   C  C2    . DC  A 1 9   ? 10.526  30.312  -34.433 1.00 49.39  ? 6   DC  C C2    1 
ATOM   53   O  O2    . DC  A 1 9   ? 9.303   30.584  -34.571 1.00 49.93  ? 6   DC  C O2    1 
ATOM   54   N  N3    . DC  A 1 9   ? 11.229  29.569  -35.349 1.00 49.34  ? 6   DC  C N3    1 
ATOM   55   C  C4    . DC  A 1 9   ? 12.532  29.287  -35.161 1.00 48.80  ? 6   DC  C C4    1 
ATOM   56   N  N4    . DC  A 1 9   ? 13.148  28.556  -36.088 1.00 49.10  ? 6   DC  C N4    1 
ATOM   57   C  C5    . DC  A 1 9   ? 13.257  29.742  -34.017 1.00 48.52  ? 6   DC  C C5    1 
ATOM   58   C  C6    . DC  A 1 9   ? 12.574  30.479  -33.123 1.00 48.18  ? 6   DC  C C6    1 
ATOM   59   P  P     . DC  A 1 10  ? 8.070   31.425  -29.172 1.00 41.17  ? 7   DC  C P     1 
ATOM   60   O  OP1   . DC  A 1 10  ? 6.829   32.129  -28.831 1.00 42.09  ? 7   DC  C OP1   1 
ATOM   61   O  OP2   . DC  A 1 10  ? 9.049   31.193  -28.113 1.00 39.79  ? 7   DC  C OP2   1 
ATOM   62   O  "O5'" . DC  A 1 10  ? 7.703   30.023  -29.863 1.00 42.94  ? 7   DC  C "O5'" 1 
ATOM   63   C  "C5'" . DC  A 1 10  ? 6.998   29.921  -31.091 1.00 47.17  ? 7   DC  C "C5'" 1 
ATOM   64   C  "C4'" . DC  A 1 10  ? 6.921   28.477  -31.553 1.00 51.28  ? 7   DC  C "C4'" 1 
ATOM   65   O  "O4'" . DC  A 1 10  ? 8.137   28.102  -32.237 1.00 52.75  ? 7   DC  C "O4'" 1 
ATOM   66   C  "C3'" . DC  A 1 10  ? 6.733   27.446  -30.448 1.00 53.33  ? 7   DC  C "C3'" 1 
ATOM   67   O  "O3'" . DC  A 1 10  ? 5.409   26.882  -30.585 1.00 54.36  ? 7   DC  C "O3'" 1 
ATOM   68   C  "C2'" . DC  A 1 10  ? 7.890   26.442  -30.625 1.00 54.42  ? 7   DC  C "C2'" 1 
ATOM   69   C  "C1'" . DC  A 1 10  ? 8.475   26.755  -32.002 1.00 54.78  ? 7   DC  C "C1'" 1 
ATOM   70   N  N1    . DC  A 1 10  ? 9.980   26.693  -32.171 1.00 56.78  ? 7   DC  C N1    1 
ATOM   71   C  C2    . DC  A 1 10  ? 10.576  26.077  -33.298 1.00 57.96  ? 7   DC  C C2    1 
ATOM   72   O  O2    . DC  A 1 10  ? 9.862   25.548  -34.159 1.00 58.96  ? 7   DC  C O2    1 
ATOM   73   N  N3    . DC  A 1 10  ? 11.940  26.059  -33.433 1.00 57.92  ? 7   DC  C N3    1 
ATOM   74   C  C4    . DC  A 1 10  ? 12.715  26.630  -32.506 1.00 57.70  ? 7   DC  C C4    1 
ATOM   75   N  N4    . DC  A 1 10  ? 14.042  26.598  -32.676 1.00 57.04  ? 7   DC  C N4    1 
ATOM   76   C  C5    . DC  A 1 10  ? 12.142  27.262  -31.356 1.00 58.11  ? 7   DC  C C5    1 
ATOM   77   C  C6    . DC  A 1 10  ? 10.799  27.275  -31.237 1.00 57.59  ? 7   DC  C C6    1 
ATOM   78   P  P     . DT  A 1 11  ? 4.610   26.075  -29.428 1.00 54.59  ? 8   DT  C P     1 
ATOM   79   O  OP1   . DT  A 1 11  ? 3.303   26.745  -29.240 1.00 53.60  ? 8   DT  C OP1   1 
ATOM   80   O  OP2   . DT  A 1 11  ? 5.496   25.907  -28.248 1.00 53.29  ? 8   DT  C OP2   1 
ATOM   81   O  "O5'" . DT  A 1 11  ? 4.368   24.643  -30.148 1.00 56.76  ? 8   DT  C "O5'" 1 
ATOM   82   C  "C5'" . DT  A 1 11  ? 4.104   24.537  -31.604 1.00 59.81  ? 8   DT  C "C5'" 1 
ATOM   83   C  "C4'" . DT  A 1 11  ? 4.719   23.350  -32.377 1.00 61.10  ? 8   DT  C "C4'" 1 
ATOM   84   O  "O4'" . DT  A 1 11  ? 6.161   23.458  -32.561 1.00 61.66  ? 8   DT  C "O4'" 1 
ATOM   85   C  "C3'" . DT  A 1 11  ? 4.525   21.934  -31.819 1.00 61.69  ? 8   DT  C "C3'" 1 
ATOM   86   O  "O3'" . DT  A 1 11  ? 4.443   20.984  -32.904 1.00 60.71  ? 8   DT  C "O3'" 1 
ATOM   87   C  "C2'" . DT  A 1 11  ? 5.805   21.709  -31.025 1.00 62.41  ? 8   DT  C "C2'" 1 
ATOM   88   C  "C1'" . DT  A 1 11  ? 6.796   22.306  -32.017 1.00 63.28  ? 8   DT  C "C1'" 1 
ATOM   89   N  N1    . DT  A 1 11  ? 8.083   22.726  -31.397 1.00 65.10  ? 8   DT  C N1    1 
ATOM   90   C  C2    . DT  A 1 11  ? 9.180   22.903  -32.213 1.00 65.61  ? 8   DT  C C2    1 
ATOM   91   O  O2    . DT  A 1 11  ? 9.155   22.718  -33.413 1.00 65.52  ? 8   DT  C O2    1 
ATOM   92   N  N3    . DT  A 1 11  ? 10.321  23.294  -31.561 1.00 66.00  ? 8   DT  C N3    1 
ATOM   93   C  C4    . DT  A 1 11  ? 10.471  23.531  -30.204 1.00 66.24  ? 8   DT  C C4    1 
ATOM   94   O  O4    . DT  A 1 11  ? 11.553  23.885  -29.740 1.00 66.52  ? 8   DT  C O4    1 
ATOM   95   C  C5    . DT  A 1 11  ? 9.280   23.327  -29.387 1.00 66.37  ? 8   DT  C C5    1 
ATOM   96   C  C7    . DT  A 1 11  ? 9.294   23.536  -27.885 1.00 65.55  ? 8   DT  C C7    1 
ATOM   97   C  C6    . DT  A 1 11  ? 8.159   22.938  -30.028 1.00 65.65  ? 8   DT  C C6    1 
ATOM   98   P  P     . DT  A 1 12  ? 4.346   19.401  -32.658 1.00 59.94  ? 9   DT  C P     1 
ATOM   99   O  OP1   . DT  A 1 12  ? 3.436   18.850  -33.685 1.00 59.78  ? 9   DT  C OP1   1 
ATOM   100  O  OP2   . DT  A 1 12  ? 4.032   19.194  -31.226 1.00 58.44  ? 9   DT  C OP2   1 
ATOM   101  O  "O5'" . DT  A 1 12  ? 5.855   18.887  -32.957 1.00 60.65  ? 9   DT  C "O5'" 1 
ATOM   102  C  "C5'" . DT  A 1 12  ? 6.403   18.532  -34.289 1.00 60.45  ? 9   DT  C "C5'" 1 
ATOM   103  C  "C4'" . DT  A 1 12  ? 7.457   17.411  -34.245 1.00 60.03  ? 9   DT  C "C4'" 1 
ATOM   104  O  "O4'" . DT  A 1 12  ? 8.577   17.792  -33.387 1.00 60.53  ? 9   DT  C "O4'" 1 
ATOM   105  C  "C3'" . DT  A 1 12  ? 6.932   16.060  -33.713 1.00 59.01  ? 9   DT  C "C3'" 1 
ATOM   106  O  "O3'" . DT  A 1 12  ? 7.306   14.893  -34.489 1.00 56.27  ? 9   DT  C "O3'" 1 
ATOM   107  C  "C2'" . DT  A 1 12  ? 7.515   15.979  -32.309 1.00 59.84  ? 9   DT  C "C2'" 1 
ATOM   108  C  "C1'" . DT  A 1 12  ? 8.822   16.735  -32.460 1.00 60.57  ? 9   DT  C "C1'" 1 
ATOM   109  N  N1    . DT  A 1 12  ? 9.258   17.196  -31.103 1.00 61.29  ? 9   DT  C N1    1 
ATOM   110  C  C2    . DT  A 1 12  ? 10.343  16.589  -30.477 1.00 61.03  ? 9   DT  C C2    1 
ATOM   111  O  O2    . DT  A 1 12  ? 11.017  15.701  -30.975 1.00 59.80  ? 9   DT  C O2    1 
ATOM   112  N  N3    . DT  A 1 12  ? 10.633  17.085  -29.223 1.00 61.25  ? 9   DT  C N3    1 
ATOM   113  C  C4    . DT  A 1 12  ? 9.950   18.092  -28.537 1.00 61.93  ? 9   DT  C C4    1 
ATOM   114  O  O4    . DT  A 1 12  ? 10.285  18.482  -27.416 1.00 61.86  ? 9   DT  C O4    1 
ATOM   115  C  C5    . DT  A 1 12  ? 8.820   18.666  -29.242 1.00 62.27  ? 9   DT  C C5    1 
ATOM   116  C  C7    . DT  A 1 12  ? 8.009   19.763  -28.610 1.00 62.79  ? 9   DT  C C7    1 
ATOM   117  C  C6    . DT  A 1 12  ? 8.533   18.197  -30.470 1.00 62.21  ? 9   DT  C C6    1 
ATOM   118  P  P     . DA  A 1 13  ? 7.302   13.413  -33.853 1.00 53.20  ? 10  DA  C P     1 
ATOM   119  O  OP1   . DA  A 1 13  ? 6.611   12.522  -34.791 1.00 54.04  ? 10  DA  C OP1   1 
ATOM   120  O  OP2   . DA  A 1 13  ? 6.849   13.455  -32.447 1.00 52.98  ? 10  DA  C OP2   1 
ATOM   121  O  "O5'" . DA  A 1 13  ? 8.837   12.993  -33.881 1.00 52.47  ? 10  DA  C "O5'" 1 
ATOM   122  C  "C5'" . DA  A 1 13  ? 9.204   11.626  -34.051 1.00 49.72  ? 10  DA  C "C5'" 1 
ATOM   123  C  "C4'" . DA  A 1 13  ? 10.485  11.326  -33.305 1.00 47.19  ? 10  DA  C "C4'" 1 
ATOM   124  O  "O4'" . DA  A 1 13  ? 10.715  12.289  -32.237 1.00 46.32  ? 10  DA  C "O4'" 1 
ATOM   125  C  "C3'" . DA  A 1 13  ? 10.534  9.954   -32.645 1.00 46.03  ? 10  DA  C "C3'" 1 
ATOM   126  O  "O3'" . DA  A 1 13  ? 11.674  9.281   -33.177 1.00 43.98  ? 10  DA  C "O3'" 1 
ATOM   127  C  "C2'" . DA  A 1 13  ? 10.622  10.241  -31.126 1.00 45.23  ? 10  DA  C "C2'" 1 
ATOM   128  C  "C1'" . DA  A 1 13  ? 11.286  11.618  -31.109 1.00 44.90  ? 10  DA  C "C1'" 1 
ATOM   129  N  N9    . DA  A 1 13  ? 11.117  12.469  -29.909 1.00 42.47  ? 10  DA  C N9    1 
ATOM   130  C  C8    . DA  A 1 13  ? 9.918   12.909  -29.417 1.00 41.87  ? 10  DA  C C8    1 
ATOM   131  N  N7    . DA  A 1 13  ? 10.011  13.683  -28.366 1.00 40.21  ? 10  DA  C N7    1 
ATOM   132  C  C5    . DA  A 1 13  ? 11.370  13.773  -28.146 1.00 39.79  ? 10  DA  C C5    1 
ATOM   133  C  C6    . DA  A 1 13  ? 12.094  14.465  -27.150 1.00 39.28  ? 10  DA  C C6    1 
ATOM   134  N  N6    . DA  A 1 13  ? 11.445  15.180  -26.218 1.00 39.00  ? 10  DA  C N6    1 
ATOM   135  N  N1    . DA  A 1 13  ? 13.447  14.384  -27.158 1.00 38.69  ? 10  DA  C N1    1 
ATOM   136  C  C2    . DA  A 1 13  ? 14.023  13.651  -28.129 1.00 38.70  ? 10  DA  C C2    1 
ATOM   137  N  N3    . DA  A 1 13  ? 13.444  12.947  -29.119 1.00 39.45  ? 10  DA  C N3    1 
ATOM   138  C  C4    . DA  A 1 13  ? 12.087  13.040  -29.079 1.00 40.38  ? 10  DA  C C4    1 
ATOM   139  P  P     . DG  A 1 14  ? 12.018  7.743   -32.887 1.00 43.54  ? 11  DG  C P     1 
ATOM   140  O  OP1   . DG  A 1 14  ? 12.651  7.227   -34.127 1.00 43.73  ? 11  DG  C OP1   1 
ATOM   141  O  OP2   . DG  A 1 14  ? 10.862  7.024   -32.282 1.00 43.26  ? 11  DG  C OP2   1 
ATOM   142  O  "O5'" . DG  A 1 14  ? 13.171  7.829   -31.776 1.00 42.02  ? 11  DG  C "O5'" 1 
ATOM   143  C  "C5'" . DG  A 1 14  ? 14.522  8.034   -32.201 1.00 38.95  ? 11  DG  C "C5'" 1 
ATOM   144  C  "C4'" . DG  A 1 14  ? 15.432  8.231   -31.019 1.00 35.83  ? 11  DG  C "C4'" 1 
ATOM   145  O  "O4'" . DG  A 1 14  ? 14.860  9.229   -30.140 1.00 34.62  ? 11  DG  C "O4'" 1 
ATOM   146  C  "C3'" . DG  A 1 14  ? 15.597  6.972   -30.187 1.00 34.40  ? 11  DG  C "C3'" 1 
ATOM   147  O  "O3'" . DG  A 1 14  ? 16.921  6.931   -29.838 1.00 32.59  ? 11  DG  C "O3'" 1 
ATOM   148  C  "C2'" . DG  A 1 14  ? 14.752  7.205   -28.935 1.00 33.02  ? 11  DG  C "C2'" 1 
ATOM   149  C  "C1'" . DG  A 1 14  ? 14.930  8.714   -28.810 1.00 33.39  ? 11  DG  C "C1'" 1 
ATOM   150  N  N9    . DG  A 1 14  ? 13.954  9.416   -27.965 1.00 30.21  ? 11  DG  C N9    1 
ATOM   151  C  C8    . DG  A 1 14  ? 12.579  9.444   -28.083 1.00 29.37  ? 11  DG  C C8    1 
ATOM   152  N  N7    . DG  A 1 14  ? 11.990  10.175  -27.178 1.00 27.66  ? 11  DG  C N7    1 
ATOM   153  C  C5    . DG  A 1 14  ? 13.044  10.682  -26.425 1.00 26.86  ? 11  DG  C C5    1 
ATOM   154  C  C6    . DG  A 1 14  ? 13.039  11.535  -25.305 1.00 25.39  ? 11  DG  C C6    1 
ATOM   155  O  O6    . DG  A 1 14  ? 12.070  12.047  -24.758 1.00 26.59  ? 11  DG  C O6    1 
ATOM   156  N  N1    . DG  A 1 14  ? 14.312  11.782  -24.819 1.00 24.23  ? 11  DG  C N1    1 
ATOM   157  C  C2    . DG  A 1 14  ? 15.471  11.285  -25.369 1.00 24.46  ? 11  DG  C C2    1 
ATOM   158  N  N2    . DG  A 1 14  ? 16.633  11.622  -24.777 1.00 24.00  ? 11  DG  C N2    1 
ATOM   159  N  N3    . DG  A 1 14  ? 15.497  10.492  -26.434 1.00 25.29  ? 11  DG  C N3    1 
ATOM   160  C  C4    . DG  A 1 14  ? 14.254  10.229  -26.900 1.00 27.20  ? 11  DG  C C4    1 
ATOM   161  P  P     . DC  A 1 15  ? 17.510  5.566   -29.254 1.00 33.40  ? 12  DC  C P     1 
ATOM   162  O  OP1   . DC  A 1 15  ? 18.810  5.416   -29.974 1.00 32.67  ? 12  DC  C OP1   1 
ATOM   163  O  OP2   . DC  A 1 15  ? 16.490  4.480   -29.418 1.00 31.84  ? 12  DC  C OP2   1 
ATOM   164  O  "O5'" . DC  A 1 15  ? 17.726  5.891   -27.659 1.00 31.03  ? 12  DC  C "O5'" 1 
ATOM   165  C  "C5'" . DC  A 1 15  ? 18.590  6.917   -27.123 1.00 29.02  ? 12  DC  C "C5'" 1 
ATOM   166  C  "C4'" . DC  A 1 15  ? 18.296  7.247   -25.671 1.00 29.72  ? 12  DC  C "C4'" 1 
ATOM   167  O  "O4'" . DC  A 1 15  ? 17.003  7.890   -25.489 1.00 29.50  ? 12  DC  C "O4'" 1 
ATOM   168  C  "C3'" . DC  A 1 15  ? 18.142  6.076   -24.704 1.00 29.50  ? 12  DC  C "C3'" 1 
ATOM   169  O  "O3'" . DC  A 1 15  ? 19.384  5.699   -24.225 1.00 28.51  ? 12  DC  C "O3'" 1 
ATOM   170  C  "C2'" . DC  A 1 15  ? 17.304  6.642   -23.547 1.00 29.18  ? 12  DC  C "C2'" 1 
ATOM   171  C  "C1'" . DC  A 1 15  ? 16.781  7.976   -24.077 1.00 29.53  ? 12  DC  C "C1'" 1 
ATOM   172  N  N1    . DC  A 1 15  ? 15.307  8.274   -23.778 1.00 29.08  ? 12  DC  C N1    1 
ATOM   173  C  C2    . DC  A 1 15  ? 14.838  8.926   -22.603 1.00 28.12  ? 12  DC  C C2    1 
ATOM   174  O  O2    . DC  A 1 15  ? 15.568  9.315   -21.675 1.00 27.17  ? 12  DC  C O2    1 
ATOM   175  N  N3    . DC  A 1 15  ? 13.514  9.142   -22.485 1.00 28.19  ? 12  DC  C N3    1 
ATOM   176  C  C4    . DC  A 1 15  ? 12.677  8.726   -23.429 1.00 29.62  ? 12  DC  C C4    1 
ATOM   177  N  N4    . DC  A 1 15  ? 11.379  8.973   -23.242 1.00 31.34  ? 12  DC  C N4    1 
ATOM   178  C  C5    . DC  A 1 15  ? 13.110  8.051   -24.608 1.00 29.24  ? 12  DC  C C5    1 
ATOM   179  C  C6    . DC  A 1 15  ? 14.416  7.854   -24.726 1.00 28.61  ? 12  DC  C C6    1 
ATOM   180  P  P     . DC  A 1 16  ? 19.461  4.512   -23.157 1.00 29.66  ? 13  DC  C P     1 
ATOM   181  O  OP1   . DC  A 1 16  ? 20.882  4.121   -23.236 1.00 29.92  ? 13  DC  C OP1   1 
ATOM   182  O  OP2   . DC  A 1 16  ? 18.423  3.461   -23.383 1.00 29.56  ? 13  DC  C OP2   1 
ATOM   183  O  "O5'" . DC  A 1 16  ? 19.098  5.117   -21.704 1.00 26.98  ? 13  DC  C "O5'" 1 
ATOM   184  C  "C5'" . DC  A 1 16  ? 19.790  6.227   -21.175 1.00 22.68  ? 13  DC  C "C5'" 1 
ATOM   185  C  "C4'" . DC  A 1 16  ? 19.522  6.304   -19.691 1.00 20.95  ? 13  DC  C "C4'" 1 
ATOM   186  O  "O4'" . DC  A 1 16  ? 18.309  7.049   -19.591 1.00 22.27  ? 13  DC  C "O4'" 1 
ATOM   187  C  "C3'" . DC  A 1 16  ? 19.217  4.981   -18.964 1.00 20.05  ? 13  DC  C "C3'" 1 
ATOM   188  O  "O3'" . DC  A 1 16  ? 20.369  4.564   -18.278 1.00 18.67  ? 13  DC  C "O3'" 1 
ATOM   189  C  "C2'" . DC  A 1 16  ? 18.121  5.324   -17.961 1.00 18.77  ? 13  DC  C "C2'" 1 
ATOM   190  C  "C1'" . DC  A 1 16  ? 17.508  6.619   -18.487 1.00 20.24  ? 13  DC  C "C1'" 1 
ATOM   191  N  N1    . DC  A 1 16  ? 16.120  6.551   -19.088 1.00 20.47  ? 13  DC  C N1    1 
ATOM   192  C  C2    . DC  A 1 16  ? 15.023  7.271   -18.539 1.00 20.31  ? 13  DC  C C2    1 
ATOM   193  O  O2    . DC  A 1 16  ? 15.148  7.983   -17.520 1.00 21.05  ? 13  DC  C O2    1 
ATOM   194  N  N3    . DC  A 1 16  ? 13.821  7.180   -19.180 1.00 18.71  ? 13  DC  C N3    1 
ATOM   195  C  C4    . DC  A 1 16  ? 13.704  6.438   -20.284 1.00 17.42  ? 13  DC  C C4    1 
ATOM   196  N  N4    . DC  A 1 16  ? 12.517  6.363   -20.843 1.00 16.69  ? 13  DC  C N4    1 
ATOM   197  C  C5    . DC  A 1 16  ? 14.783  5.712   -20.857 1.00 18.13  ? 13  DC  C C5    1 
ATOM   198  C  C6    . DC  A 1 16  ? 15.962  5.810   -20.244 1.00 19.20  ? 13  DC  C C6    1 
ATOM   199  O  "O5'" . DG  B 2 1   ? 4.540   12.221  -16.205 1.00 31.63  ? 5   DG  D "O5'" 1 
ATOM   200  C  "C5'" . DG  B 2 1   ? 4.779   11.474  -14.964 1.00 32.14  ? 5   DG  D "C5'" 1 
ATOM   201  C  "C4'" . DG  B 2 1   ? 6.136   11.799  -14.331 1.00 30.85  ? 5   DG  D "C4'" 1 
ATOM   202  O  "O4'" . DG  B 2 1   ? 7.210   10.965  -14.831 1.00 28.50  ? 5   DG  D "O4'" 1 
ATOM   203  C  "C3'" . DG  B 2 1   ? 6.658   13.209  -14.560 1.00 31.37  ? 5   DG  D "C3'" 1 
ATOM   204  O  "O3'" . DG  B 2 1   ? 7.363   13.611  -13.397 1.00 31.52  ? 5   DG  D "O3'" 1 
ATOM   205  C  "C2'" . DG  B 2 1   ? 7.524   13.094  -15.826 1.00 30.12  ? 5   DG  D "C2'" 1 
ATOM   206  C  "C1'" . DG  B 2 1   ? 8.082   11.686  -15.680 1.00 28.55  ? 5   DG  D "C1'" 1 
ATOM   207  N  N9    . DG  B 2 1   ? 8.326   10.795  -16.828 1.00 26.74  ? 5   DG  D N9    1 
ATOM   208  C  C8    . DG  B 2 1   ? 7.474   10.323  -17.806 1.00 24.70  ? 5   DG  D C8    1 
ATOM   209  N  N7    . DG  B 2 1   ? 8.056   9.484   -18.634 1.00 22.98  ? 5   DG  D N7    1 
ATOM   210  C  C5    . DG  B 2 1   ? 9.365   9.376   -18.160 1.00 23.04  ? 5   DG  D C5    1 
ATOM   211  C  C6    . DG  B 2 1   ? 10.477  8.604   -18.613 1.00 22.26  ? 5   DG  D C6    1 
ATOM   212  O  O6    . DG  B 2 1   ? 10.509  7.827   -19.585 1.00 19.51  ? 5   DG  D O6    1 
ATOM   213  N  N1    . DG  B 2 1   ? 11.629  8.803   -17.820 1.00 23.36  ? 5   DG  D N1    1 
ATOM   214  C  C2    . DG  B 2 1   ? 11.687  9.641   -16.709 1.00 23.84  ? 5   DG  D C2    1 
ATOM   215  N  N2    . DG  B 2 1   ? 12.850  9.770   -16.040 1.00 23.56  ? 5   DG  D N2    1 
ATOM   216  N  N3    . DG  B 2 1   ? 10.647  10.334  -16.274 1.00 23.58  ? 5   DG  D N3    1 
ATOM   217  C  C4    . DG  B 2 1   ? 9.538   10.169  -17.046 1.00 24.39  ? 5   DG  D C4    1 
ATOM   218  P  P     . DG  B 2 2   ? 7.874   15.112  -13.222 1.00 31.67  ? 6   DG  D P     1 
ATOM   219  O  OP1   . DG  B 2 2   ? 8.116   15.316  -11.785 1.00 31.64  ? 6   DG  D OP1   1 
ATOM   220  O  OP2   . DG  B 2 2   ? 7.052   16.061  -13.982 1.00 32.07  ? 6   DG  D OP2   1 
ATOM   221  O  "O5'" . DG  B 2 2   ? 9.245   15.030  -14.014 1.00 31.98  ? 6   DG  D "O5'" 1 
ATOM   222  C  "C5'" . DG  B 2 2   ? 10.398  14.843  -13.235 1.00 29.73  ? 6   DG  D "C5'" 1 
ATOM   223  C  "C4'" . DG  B 2 2   ? 11.592  14.761  -14.145 1.00 27.96  ? 6   DG  D "C4'" 1 
ATOM   224  O  "O4'" . DG  B 2 2   ? 11.324  13.782  -15.183 1.00 26.80  ? 6   DG  D "O4'" 1 
ATOM   225  C  "C3'" . DG  B 2 2   ? 11.967  16.074  -14.838 1.00 26.74  ? 6   DG  D "C3'" 1 
ATOM   226  O  "O3'" . DG  B 2 2   ? 13.280  16.379  -14.369 1.00 26.95  ? 6   DG  D "O3'" 1 
ATOM   227  C  "C2'" . DG  B 2 2   ? 11.897  15.714  -16.315 1.00 25.36  ? 6   DG  D "C2'" 1 
ATOM   228  C  "C1'" . DG  B 2 2   ? 12.112  14.211  -16.266 1.00 26.25  ? 6   DG  D "C1'" 1 
ATOM   229  N  N9    . DG  B 2 2   ? 11.642  13.537  -17.460 1.00 28.12  ? 6   DG  D N9    1 
ATOM   230  C  C8    . DG  B 2 2   ? 10.397  13.701  -18.022 1.00 28.09  ? 6   DG  D C8    1 
ATOM   231  N  N7    . DG  B 2 2   ? 10.220  12.994  -19.106 1.00 29.30  ? 6   DG  D N7    1 
ATOM   232  C  C5    . DG  B 2 2   ? 11.426  12.314  -19.282 1.00 29.40  ? 6   DG  D C5    1 
ATOM   233  C  C6    . DG  B 2 2   ? 11.797  11.397  -20.300 1.00 28.79  ? 6   DG  D C6    1 
ATOM   234  O  O6    . DG  B 2 2   ? 11.141  10.998  -21.274 1.00 29.60  ? 6   DG  D O6    1 
ATOM   235  N  N1    . DG  B 2 2   ? 13.098  10.941  -20.117 1.00 28.03  ? 6   DG  D N1    1 
ATOM   236  C  C2    . DG  B 2 2   ? 13.930  11.321  -19.079 1.00 27.80  ? 6   DG  D C2    1 
ATOM   237  N  N2    . DG  B 2 2   ? 15.140  10.759  -19.133 1.00 28.53  ? 6   DG  D N2    1 
ATOM   238  N  N3    . DG  B 2 2   ? 13.617  12.164  -18.097 1.00 28.18  ? 6   DG  D N3    1 
ATOM   239  C  C4    . DG  B 2 2   ? 12.334  12.631  -18.267 1.00 29.01  ? 6   DG  D C4    1 
ATOM   240  P  P     . DC  B 2 3   ? 14.230  17.541  -14.924 1.00 27.42  ? 7   DC  D P     1 
ATOM   241  O  OP1   . DC  B 2 3   ? 15.157  17.862  -13.830 1.00 27.77  ? 7   DC  D OP1   1 
ATOM   242  O  OP2   . DC  B 2 3   ? 13.380  18.566  -15.526 1.00 27.00  ? 7   DC  D OP2   1 
ATOM   243  O  "O5'" . DC  B 2 3   ? 15.028  16.982  -16.216 1.00 27.44  ? 7   DC  D "O5'" 1 
ATOM   244  C  "C5'" . DC  B 2 3   ? 16.086  15.998  -16.166 1.00 25.76  ? 7   DC  D "C5'" 1 
ATOM   245  C  "C4'" . DC  B 2 3   ? 16.658  15.724  -17.548 1.00 25.84  ? 7   DC  D "C4'" 1 
ATOM   246  O  "O4'" . DC  B 2 3   ? 15.745  14.962  -18.386 1.00 26.60  ? 7   DC  D "O4'" 1 
ATOM   247  C  "C3'" . DC  B 2 3   ? 16.964  16.974  -18.358 1.00 26.22  ? 7   DC  D "C3'" 1 
ATOM   248  O  "O3'" . DC  B 2 3   ? 18.381  17.104  -18.414 1.00 27.39  ? 7   DC  D "O3'" 1 
ATOM   249  C  "C2'" . DC  B 2 3   ? 16.386  16.690  -19.746 1.00 25.62  ? 7   DC  D "C2'" 1 
ATOM   250  C  "C1'" . DC  B 2 3   ? 16.038  15.209  -19.756 1.00 24.90  ? 7   DC  D "C1'" 1 
ATOM   251  N  N1    . DC  B 2 3   ? 14.824  14.860  -20.619 1.00 24.72  ? 7   DC  D N1    1 
ATOM   252  C  C2    . DC  B 2 3   ? 14.880  14.128  -21.852 1.00 25.05  ? 7   DC  D C2    1 
ATOM   253  O  O2    . DC  B 2 3   ? 15.922  13.695  -22.367 1.00 25.55  ? 7   DC  D O2    1 
ATOM   254  N  N3    . DC  B 2 3   ? 13.751  13.846  -22.536 1.00 24.08  ? 7   DC  D N3    1 
ATOM   255  C  C4    . DC  B 2 3   ? 12.612  14.279  -22.075 1.00 24.96  ? 7   DC  D C4    1 
ATOM   256  N  N4    . DC  B 2 3   ? 11.565  13.976  -22.818 1.00 25.27  ? 7   DC  D N4    1 
ATOM   257  C  C5    . DC  B 2 3   ? 12.499  15.026  -20.854 1.00 25.91  ? 7   DC  D C5    1 
ATOM   258  C  C6    . DC  B 2 3   ? 13.615  15.285  -20.157 1.00 24.36  ? 7   DC  D C6    1 
ATOM   259  P  P     . DT  B 2 4   ? 19.182  18.453  -18.778 1.00 27.70  ? 8   DT  D P     1 
ATOM   260  O  OP1   . DT  B 2 4   ? 20.464  18.280  -18.052 1.00 27.47  ? 8   DT  D OP1   1 
ATOM   261  O  OP2   . DT  B 2 4   ? 18.405  19.704  -18.582 1.00 26.38  ? 8   DT  D OP2   1 
ATOM   262  O  "O5'" . DT  B 2 4   ? 19.398  18.286  -20.344 1.00 27.09  ? 8   DT  D "O5'" 1 
ATOM   263  C  "C5'" . DT  B 2 4   ? 19.968  17.068  -20.802 1.00 28.28  ? 8   DT  D "C5'" 1 
ATOM   264  C  "C4'" . DT  B 2 4   ? 19.766  16.899  -22.285 1.00 27.80  ? 8   DT  D "C4'" 1 
ATOM   265  O  "O4'" . DT  B 2 4   ? 18.430  16.418  -22.458 1.00 27.16  ? 8   DT  D "O4'" 1 
ATOM   266  C  "C3'" . DT  B 2 4   ? 19.835  18.175  -23.088 1.00 29.01  ? 8   DT  D "C3'" 1 
ATOM   267  O  "O3'" . DT  B 2 4   ? 21.148  18.300  -23.551 1.00 31.40  ? 8   DT  D "O3'" 1 
ATOM   268  C  "C2'" . DT  B 2 4   ? 18.809  17.950  -24.193 1.00 28.80  ? 8   DT  D "C2'" 1 
ATOM   269  C  "C1'" . DT  B 2 4   ? 18.097  16.661  -23.795 1.00 27.75  ? 8   DT  D "C1'" 1 
ATOM   270  N  N1    . DT  B 2 4   ? 16.587  16.677  -23.929 1.00 28.49  ? 8   DT  D N1    1 
ATOM   271  C  C2    . DT  B 2 4   ? 16.042  15.953  -24.978 1.00 28.67  ? 8   DT  D C2    1 
ATOM   272  O  O2    . DT  B 2 4   ? 16.726  15.327  -25.776 1.00 29.01  ? 8   DT  D O2    1 
ATOM   273  N  N3    . DT  B 2 4   ? 14.673  15.982  -25.059 1.00 27.71  ? 8   DT  D N3    1 
ATOM   274  C  C4    . DT  B 2 4   ? 13.825  16.678  -24.231 1.00 26.41  ? 8   DT  D C4    1 
ATOM   275  O  O4    . DT  B 2 4   ? 12.616  16.645  -24.400 1.00 25.10  ? 8   DT  D O4    1 
ATOM   276  C  C5    . DT  B 2 4   ? 14.442  17.440  -23.163 1.00 27.00  ? 8   DT  D C5    1 
ATOM   277  C  C7    . DT  B 2 4   ? 13.575  18.233  -22.196 1.00 26.02  ? 8   DT  D C7    1 
ATOM   278  C  C6    . DT  B 2 4   ? 15.784  17.388  -23.052 1.00 26.58  ? 8   DT  D C6    1 
ATOM   279  P  P     . DA  B 2 5   ? 21.692  19.351  -24.641 1.00 34.42  ? 9   DA  D P     1 
ATOM   280  O  OP1   . DA  B 2 5   ? 23.162  19.292  -24.530 1.00 35.92  ? 9   DA  D OP1   1 
ATOM   281  O  OP2   . DA  B 2 5   ? 21.062  20.665  -24.521 1.00 34.96  ? 9   DA  D OP2   1 
ATOM   282  O  "O5'" . DA  B 2 5   ? 21.234  18.662  -26.014 1.00 37.40  ? 9   DA  D "O5'" 1 
ATOM   283  C  "C5'" . DA  B 2 5   ? 21.775  17.359  -26.395 1.00 39.10  ? 9   DA  D "C5'" 1 
ATOM   284  C  "C4'" . DA  B 2 5   ? 21.138  16.784  -27.659 1.00 40.57  ? 9   DA  D "C4'" 1 
ATOM   285  O  "O4'" . DA  B 2 5   ? 19.733  16.481  -27.422 1.00 38.15  ? 9   DA  D "O4'" 1 
ATOM   286  C  "C3'" . DA  B 2 5   ? 21.203  17.643  -28.937 1.00 42.92  ? 9   DA  D "C3'" 1 
ATOM   287  O  "O3'" . DA  B 2 5   ? 21.466  16.843  -30.108 1.00 47.47  ? 9   DA  D "O3'" 1 
ATOM   288  C  "C2'" . DA  B 2 5   ? 19.789  18.179  -29.011 1.00 41.34  ? 9   DA  D "C2'" 1 
ATOM   289  C  "C1'" . DA  B 2 5   ? 19.004  16.969  -28.519 1.00 39.85  ? 9   DA  D "C1'" 1 
ATOM   290  N  N9    . DA  B 2 5   ? 17.696  17.414  -28.103 1.00 39.38  ? 9   DA  D N9    1 
ATOM   291  C  C8    . DA  B 2 5   ? 17.410  18.261  -27.062 1.00 39.55  ? 9   DA  D C8    1 
ATOM   292  N  N7    . DA  B 2 5   ? 16.132  18.509  -26.914 1.00 39.70  ? 9   DA  D N7    1 
ATOM   293  C  C5    . DA  B 2 5   ? 15.544  17.790  -27.951 1.00 39.97  ? 9   DA  D C5    1 
ATOM   294  C  C6    . DA  B 2 5   ? 14.195  17.634  -28.360 1.00 39.48  ? 9   DA  D C6    1 
ATOM   295  N  N6    . DA  B 2 5   ? 13.173  18.232  -27.720 1.00 38.69  ? 9   DA  D N6    1 
ATOM   296  N  N1    . DA  B 2 5   ? 13.944  16.862  -29.451 1.00 38.52  ? 9   DA  D N1    1 
ATOM   297  C  C2    . DA  B 2 5   ? 14.981  16.257  -30.067 1.00 39.07  ? 9   DA  D C2    1 
ATOM   298  N  N3    . DA  B 2 5   ? 16.286  16.318  -29.771 1.00 39.32  ? 9   DA  D N3    1 
ATOM   299  C  C4    . DA  B 2 5   ? 16.499  17.111  -28.700 1.00 39.67  ? 9   DA  D C4    1 
ATOM   300  P  P     . DC  B 2 6   ? 21.593  17.388  -31.634 1.00 51.13  ? 10  DC  D P     1 
ATOM   301  O  OP1   . DC  B 2 6   ? 23.044  17.424  -31.909 1.00 51.54  ? 10  DC  D OP1   1 
ATOM   302  O  OP2   . DC  B 2 6   ? 20.783  18.611  -31.927 1.00 51.31  ? 10  DC  D OP2   1 
ATOM   303  O  "O5'" . DC  B 2 6   ? 20.933  16.159  -32.445 1.00 52.49  ? 10  DC  D "O5'" 1 
ATOM   304  C  "C5'" . DC  B 2 6   ? 19.758  15.466  -31.953 1.00 53.12  ? 10  DC  D "C5'" 1 
ATOM   305  C  "C4'" . DC  B 2 6   ? 18.560  15.573  -32.896 1.00 53.75  ? 10  DC  D "C4'" 1 
ATOM   306  O  "O4'" . DC  B 2 6   ? 17.448  16.246  -32.245 1.00 53.30  ? 10  DC  D "O4'" 1 
ATOM   307  C  "C3'" . DC  B 2 6   ? 18.749  16.303  -34.229 1.00 54.02  ? 10  DC  D "C3'" 1 
ATOM   308  O  "O3'" . DC  B 2 6   ? 18.047  15.498  -35.215 1.00 55.36  ? 10  DC  D "O3'" 1 
ATOM   309  C  "C2'" . DC  B 2 6   ? 18.179  17.703  -33.959 1.00 52.59  ? 10  DC  D "C2'" 1 
ATOM   310  C  "C1'" . DC  B 2 6   ? 16.996  17.326  -33.067 1.00 52.54  ? 10  DC  D "C1'" 1 
ATOM   311  N  N1    . DC  B 2 6   ? 16.387  18.394  -32.181 1.00 50.39  ? 10  DC  D N1    1 
ATOM   312  C  C2    . DC  B 2 6   ? 14.979  18.654  -32.222 1.00 49.44  ? 10  DC  D C2    1 
ATOM   313  O  O2    . DC  B 2 6   ? 14.239  18.012  -32.983 1.00 47.80  ? 10  DC  D O2    1 
ATOM   314  N  N3    . DC  B 2 6   ? 14.427  19.611  -31.417 1.00 49.33  ? 10  DC  D N3    1 
ATOM   315  C  C4    . DC  B 2 6   ? 15.221  20.294  -30.586 1.00 49.60  ? 10  DC  D C4    1 
ATOM   316  N  N4    . DC  B 2 6   ? 14.638  21.219  -29.806 1.00 48.66  ? 10  DC  D N4    1 
ATOM   317  C  C5    . DC  B 2 6   ? 16.652  20.045  -30.529 1.00 50.29  ? 10  DC  D C5    1 
ATOM   318  C  C6    . DC  B 2 6   ? 17.191  19.104  -31.331 1.00 50.08  ? 10  DC  D C6    1 
ATOM   319  P  P     . DA  B 2 7   ? 17.851  15.849  -36.773 1.00 55.07  ? 11  DA  D P     1 
ATOM   320  O  OP1   . DA  B 2 7   ? 17.523  14.573  -37.455 1.00 54.88  ? 11  DA  D OP1   1 
ATOM   321  O  OP2   . DA  B 2 7   ? 18.967  16.711  -37.248 1.00 54.62  ? 11  DA  D OP2   1 
ATOM   322  O  "O5'" . DA  B 2 7   ? 16.533  16.757  -36.752 1.00 54.70  ? 11  DA  D "O5'" 1 
ATOM   323  C  "C5'" . DA  B 2 7   ? 15.241  16.175  -36.520 1.00 52.95  ? 11  DA  D "C5'" 1 
ATOM   324  C  "C4'" . DA  B 2 7   ? 14.170  16.833  -37.392 1.00 51.58  ? 11  DA  D "C4'" 1 
ATOM   325  O  "O4'" . DA  B 2 7   ? 13.491  17.935  -36.732 1.00 50.30  ? 11  DA  D "O4'" 1 
ATOM   326  C  "C3'" . DA  B 2 7   ? 14.630  17.407  -38.723 1.00 50.77  ? 11  DA  D "C3'" 1 
ATOM   327  O  "O3'" . DA  B 2 7   ? 13.548  17.087  -39.629 1.00 50.75  ? 11  DA  D "O3'" 1 
ATOM   328  C  "C2'" . DA  B 2 7   ? 14.886  18.884  -38.378 1.00 50.33  ? 11  DA  D "C2'" 1 
ATOM   329  C  "C1'" . DA  B 2 7   ? 13.862  19.190  -37.290 1.00 49.84  ? 11  DA  D "C1'" 1 
ATOM   330  N  N9    . DA  B 2 7   ? 14.297  20.024  -36.148 1.00 48.23  ? 11  DA  D N9    1 
ATOM   331  C  C8    . DA  B 2 7   ? 15.573  20.242  -35.679 1.00 47.50  ? 11  DA  D C8    1 
ATOM   332  N  N7    . DA  B 2 7   ? 15.631  21.016  -34.620 1.00 46.74  ? 11  DA  D N7    1 
ATOM   333  C  C5    . DA  B 2 7   ? 14.303  21.325  -34.362 1.00 46.94  ? 11  DA  D C5    1 
ATOM   334  C  C6    . DA  B 2 7   ? 13.674  22.115  -33.366 1.00 46.88  ? 11  DA  D C6    1 
ATOM   335  N  N6    . DA  B 2 7   ? 14.354  22.757  -32.404 1.00 46.98  ? 11  DA  D N6    1 
ATOM   336  N  N1    . DA  B 2 7   ? 12.317  22.220  -33.385 1.00 46.27  ? 11  DA  D N1    1 
ATOM   337  C  C2    . DA  B 2 7   ? 11.638  21.573  -34.345 1.00 46.83  ? 11  DA  D C2    1 
ATOM   338  N  N3    . DA  B 2 7   ? 12.122  20.808  -35.335 1.00 47.12  ? 11  DA  D N3    1 
ATOM   339  C  C4    . DA  B 2 7   ? 13.470  20.722  -35.291 1.00 47.19  ? 11  DA  D C4    1 
ATOM   340  P  P     . DG  B 2 8   ? 13.252  17.706  -41.083 1.00 50.17  ? 12  DG  D P     1 
ATOM   341  O  OP1   . DG  B 2 8   ? 12.144  18.683  -40.894 1.00 49.74  ? 12  DG  D OP1   1 
ATOM   342  O  OP2   . DG  B 2 8   ? 13.062  16.580  -42.023 1.00 49.50  ? 12  DG  D OP2   1 
ATOM   343  O  "O5'" . DG  B 2 8   ? 14.613  18.455  -41.501 1.00 49.24  ? 12  DG  D "O5'" 1 
ATOM   344  C  "C5'" . DG  B 2 8   ? 14.631  19.518  -42.469 1.00 47.08  ? 12  DG  D "C5'" 1 
ATOM   345  C  "C4'" . DG  B 2 8   ? 13.649  20.601  -42.082 1.00 44.48  ? 12  DG  D "C4'" 1 
ATOM   346  O  "O4'" . DG  B 2 8   ? 13.855  20.861  -40.691 1.00 43.27  ? 12  DG  D "O4'" 1 
ATOM   347  C  "C3'" . DG  B 2 8   ? 13.828  21.964  -42.710 1.00 43.80  ? 12  DG  D "C3'" 1 
ATOM   348  O  "O3'" . DG  B 2 8   ? 13.129  21.981  -43.950 1.00 43.37  ? 12  DG  D "O3'" 1 
ATOM   349  C  "C2'" . DG  B 2 8   ? 13.200  22.895  -41.659 1.00 42.91  ? 12  DG  D "C2'" 1 
ATOM   350  C  "C1'" . DG  B 2 8   ? 13.117  22.018  -40.396 1.00 42.19  ? 12  DG  D "C1'" 1 
ATOM   351  N  N9    . DG  B 2 8   ? 13.734  22.599  -39.203 1.00 40.07  ? 12  DG  D N9    1 
ATOM   352  C  C8    . DG  B 2 8   ? 15.076  22.538  -38.879 1.00 39.51  ? 12  DG  D C8    1 
ATOM   353  N  N7    . DG  B 2 8   ? 15.378  23.144  -37.766 1.00 38.35  ? 12  DG  D N7    1 
ATOM   354  C  C5    . DG  B 2 8   ? 14.162  23.633  -37.324 1.00 38.47  ? 12  DG  D C5    1 
ATOM   355  C  C6    . DG  B 2 8   ? 13.892  24.379  -36.153 1.00 38.77  ? 12  DG  D C6    1 
ATOM   356  O  O6    . DG  B 2 8   ? 14.718  24.738  -35.295 1.00 38.82  ? 12  DG  D O6    1 
ATOM   357  N  N1    . DG  B 2 8   ? 12.523  24.706  -36.045 1.00 39.49  ? 12  DG  D N1    1 
ATOM   358  C  C2    . DG  B 2 8   ? 11.546  24.344  -36.977 1.00 39.31  ? 12  DG  D C2    1 
ATOM   359  N  N2    . DG  B 2 8   ? 10.281  24.740  -36.703 1.00 39.50  ? 12  DG  D N2    1 
ATOM   360  N  N3    . DG  B 2 8   ? 11.803  23.637  -38.088 1.00 38.83  ? 12  DG  D N3    1 
ATOM   361  C  C4    . DG  B 2 8   ? 13.129  23.315  -38.192 1.00 38.84  ? 12  DG  D C4    1 
ATOM   362  O  "O5'" . DG  C 1 7   ? 17.924  7.666   29.201  1.00 49.53  ? 4   DG  E "O5'" 1 
ATOM   363  C  "C5'" . DG  C 1 7   ? 18.728  6.539   29.597  1.00 49.28  ? 4   DG  E "C5'" 1 
ATOM   364  C  "C4'" . DG  C 1 7   ? 18.841  5.423   28.547  1.00 49.06  ? 4   DG  E "C4'" 1 
ATOM   365  O  "O4'" . DG  C 1 7   ? 18.144  4.220   28.969  1.00 49.02  ? 4   DG  E "O4'" 1 
ATOM   366  C  "C3'" . DG  C 1 7   ? 18.313  5.670   27.135  1.00 48.80  ? 4   DG  E "C3'" 1 
ATOM   367  O  "O3'" . DG  C 1 7   ? 19.207  5.024   26.217  1.00 48.63  ? 4   DG  E "O3'" 1 
ATOM   368  C  "C2'" . DG  C 1 7   ? 16.914  5.052   27.148  1.00 48.67  ? 4   DG  E "C2'" 1 
ATOM   369  C  "C1'" . DG  C 1 7   ? 16.851  4.203   28.415  1.00 48.39  ? 4   DG  E "C1'" 1 
ATOM   370  N  N9    . DG  C 1 7   ? 15.944  4.741   29.421  1.00 48.31  ? 4   DG  E N9    1 
ATOM   371  C  C8    . DG  C 1 7   ? 15.151  5.855   29.274  1.00 48.70  ? 4   DG  E C8    1 
ATOM   372  N  N7    . DG  C 1 7   ? 14.420  6.131   30.317  1.00 49.29  ? 4   DG  E N7    1 
ATOM   373  C  C5    . DG  C 1 7   ? 14.760  5.133   31.232  1.00 49.98  ? 4   DG  E C5    1 
ATOM   374  C  C6    . DG  C 1 7   ? 14.292  4.919   32.570  1.00 50.82  ? 4   DG  E C6    1 
ATOM   375  O  O6    . DG  C 1 7   ? 13.460  5.591   33.216  1.00 51.88  ? 4   DG  E O6    1 
ATOM   376  N  N1    . DG  C 1 7   ? 14.882  3.796   33.162  1.00 50.21  ? 4   DG  E N1    1 
ATOM   377  C  C2    . DG  C 1 7   ? 15.804  2.976   32.546  1.00 49.66  ? 4   DG  E C2    1 
ATOM   378  N  N2    . DG  C 1 7   ? 16.246  1.948   33.302  1.00 49.42  ? 4   DG  E N2    1 
ATOM   379  N  N3    . DG  C 1 7   ? 16.251  3.169   31.293  1.00 49.11  ? 4   DG  E N3    1 
ATOM   380  C  C4    . DG  C 1 7   ? 15.700  4.266   30.696  1.00 48.86  ? 4   DG  E C4    1 
ATOM   381  P  P     . DT  C 1 8   ? 18.910  4.779   24.647  1.00 49.33  ? 5   DT  E P     1 
ATOM   382  O  OP1   . DT  C 1 8   ? 20.210  4.532   23.968  1.00 48.92  ? 5   DT  E OP1   1 
ATOM   383  O  OP2   . DT  C 1 8   ? 18.006  5.828   24.124  1.00 49.26  ? 5   DT  E OP2   1 
ATOM   384  O  "O5'" . DT  C 1 8   ? 18.153  3.376   24.659  1.00 48.86  ? 5   DT  E "O5'" 1 
ATOM   385  C  "C5'" . DT  C 1 8   ? 18.955  2.191   24.695  1.00 48.04  ? 5   DT  E "C5'" 1 
ATOM   386  C  "C4'" . DT  C 1 8   ? 18.071  1.004   24.974  1.00 47.78  ? 5   DT  E "C4'" 1 
ATOM   387  O  "O4'" . DT  C 1 8   ? 17.365  1.253   26.213  1.00 48.51  ? 5   DT  E "O4'" 1 
ATOM   388  C  "C3'" . DT  C 1 8   ? 17.011  0.767   23.898  1.00 46.84  ? 5   DT  E "C3'" 1 
ATOM   389  O  "O3'" . DT  C 1 8   ? 17.104  -0.553  23.480  1.00 45.01  ? 5   DT  E "O3'" 1 
ATOM   390  C  "C2'" . DT  C 1 8   ? 15.692  0.965   24.618  1.00 48.19  ? 5   DT  E "C2'" 1 
ATOM   391  C  "C1'" . DT  C 1 8   ? 16.070  0.727   26.080  1.00 49.03  ? 5   DT  E "C1'" 1 
ATOM   392  N  N1    . DT  C 1 8   ? 15.154  1.440   27.006  1.00 50.37  ? 5   DT  E N1    1 
ATOM   393  C  C2    . DT  C 1 8   ? 15.182  1.207   28.379  1.00 50.76  ? 5   DT  E C2    1 
ATOM   394  O  O2    . DT  C 1 8   ? 15.936  0.438   28.954  1.00 49.96  ? 5   DT  E O2    1 
ATOM   395  N  N3    . DT  C 1 8   ? 14.250  1.945   29.070  1.00 52.02  ? 5   DT  E N3    1 
ATOM   396  C  C4    . DT  C 1 8   ? 13.334  2.859   28.543  1.00 51.99  ? 5   DT  E C4    1 
ATOM   397  O  O4    . DT  C 1 8   ? 12.554  3.467   29.269  1.00 52.68  ? 5   DT  E O4    1 
ATOM   398  C  C5    . DT  C 1 8   ? 13.373  3.041   27.104  1.00 51.50  ? 5   DT  E C5    1 
ATOM   399  C  C7    . DT  C 1 8   ? 12.459  3.986   26.380  1.00 51.67  ? 5   DT  E C7    1 
ATOM   400  C  C6    . DT  C 1 8   ? 14.267  2.328   26.421  1.00 50.53  ? 5   DT  E C6    1 
ATOM   401  P  P     . DC  C 1 9   ? 16.481  -1.051  22.110  1.00 43.62  ? 6   DC  E P     1 
ATOM   402  O  OP1   . DC  C 1 9   ? 17.625  -1.473  21.269  1.00 42.82  ? 6   DC  E OP1   1 
ATOM   403  O  OP2   . DC  C 1 9   ? 15.495  -0.096  21.578  1.00 43.00  ? 6   DC  E OP2   1 
ATOM   404  O  "O5'" . DC  C 1 9   ? 15.624  -2.328  22.571  1.00 44.58  ? 6   DC  E "O5'" 1 
ATOM   405  C  "C5'" . DC  C 1 9   ? 15.467  -2.721  23.944  1.00 44.62  ? 6   DC  E "C5'" 1 
ATOM   406  C  "C4'" . DC  C 1 9   ? 14.190  -3.512  24.195  1.00 44.15  ? 6   DC  E "C4'" 1 
ATOM   407  O  "O4'" . DC  C 1 9   ? 13.547  -3.055  25.414  1.00 45.57  ? 6   DC  E "O4'" 1 
ATOM   408  C  "C3'" . DC  C 1 9   ? 13.102  -3.524  23.125  1.00 43.90  ? 6   DC  E "C3'" 1 
ATOM   409  O  "O3'" . DC  C 1 9   ? 12.774  -4.903  23.013  1.00 41.72  ? 6   DC  E "O3'" 1 
ATOM   410  C  "C2'" . DC  C 1 9   ? 11.987  -2.676  23.751  1.00 44.94  ? 6   DC  E "C2'" 1 
ATOM   411  C  "C1'" . DC  C 1 9   ? 12.143  -3.092  25.215  1.00 46.61  ? 6   DC  E "C1'" 1 
ATOM   412  N  N1    . DC  C 1 9   ? 11.485  -2.290  26.331  1.00 47.64  ? 6   DC  E N1    1 
ATOM   413  C  C2    . DC  C 1 9   ? 10.867  -2.953  27.431  1.00 48.30  ? 6   DC  E C2    1 
ATOM   414  O  O2    . DC  C 1 9   ? 10.796  -4.184  27.539  1.00 48.85  ? 6   DC  E O2    1 
ATOM   415  N  N3    . DC  C 1 9   ? 10.314  -2.212  28.412  1.00 48.70  ? 6   DC  E N3    1 
ATOM   416  C  C4    . DC  C 1 9   ? 10.345  -0.883  28.360  1.00 48.58  ? 6   DC  E C4    1 
ATOM   417  N  N4    . DC  C 1 9   ? 9.770   -0.256  29.390  1.00 49.25  ? 6   DC  E N4    1 
ATOM   418  C  C5    . DC  C 1 9   ? 10.962  -0.183  27.272  1.00 48.25  ? 6   DC  E C5    1 
ATOM   419  C  C6    . DC  C 1 9   ? 11.514  -0.918  26.290  1.00 47.65  ? 6   DC  E C6    1 
ATOM   420  P  P     . DC  C 1 10  ? 11.873  -5.649  21.912  1.00 41.71  ? 7   DC  E P     1 
ATOM   421  O  OP1   . DC  C 1 10  ? 12.242  -7.068  22.078  1.00 40.85  ? 7   DC  E OP1   1 
ATOM   422  O  OP2   . DC  C 1 10  ? 12.014  -5.016  20.587  1.00 39.55  ? 7   DC  E OP2   1 
ATOM   423  O  "O5'" . DC  C 1 10  ? 10.360  -5.407  22.448  1.00 43.79  ? 7   DC  E "O5'" 1 
ATOM   424  C  "C5'" . DC  C 1 10  ? 9.751   -6.214  23.507  1.00 47.97  ? 7   DC  E "C5'" 1 
ATOM   425  C  "C4'" . DC  C 1 10  ? 8.349   -5.769  23.922  1.00 51.64  ? 7   DC  E "C4'" 1 
ATOM   426  O  "O4'" . DC  C 1 10  ? 8.371   -4.380  24.363  1.00 53.26  ? 7   DC  E "O4'" 1 
ATOM   427  C  "C3'" . DC  C 1 10  ? 7.265   -5.871  22.832  1.00 53.54  ? 7   DC  E "C3'" 1 
ATOM   428  O  "O3'" . DC  C 1 10  ? 6.192   -6.691  23.235  1.00 54.23  ? 7   DC  E "O3'" 1 
ATOM   429  C  "C2'" . DC  C 1 10  ? 6.709   -4.459  22.664  1.00 54.91  ? 7   DC  E "C2'" 1 
ATOM   430  C  "C1'" . DC  C 1 10  ? 7.163   -3.744  23.937  1.00 55.50  ? 7   DC  E "C1'" 1 
ATOM   431  N  N1    . DC  C 1 10  ? 7.276   -2.228  23.715  1.00 57.35  ? 7   DC  E N1    1 
ATOM   432  C  C2    . DC  C 1 10  ? 7.264   -1.304  24.789  1.00 58.05  ? 7   DC  E C2    1 
ATOM   433  O  O2    . DC  C 1 10  ? 7.177   -1.695  25.970  1.00 58.03  ? 7   DC  E O2    1 
ATOM   434  N  N3    . DC  C 1 10  ? 7.359   0.030   24.485  1.00 58.61  ? 7   DC  E N3    1 
ATOM   435  C  C4    . DC  C 1 10  ? 7.457   0.454   23.206  1.00 58.20  ? 7   DC  E C4    1 
ATOM   436  N  N4    . DC  C 1 10  ? 7.555   1.762   22.965  1.00 57.72  ? 7   DC  E N4    1 
ATOM   437  C  C5    . DC  C 1 10  ? 7.471   -0.456  22.107  1.00 58.37  ? 7   DC  E C5    1 
ATOM   438  C  C6    . DC  C 1 10  ? 7.370   -1.762  22.419  1.00 58.01  ? 7   DC  E C6    1 
ATOM   439  P  P     . DT  C 1 11  ? 5.118   -7.299  22.204  1.00 55.13  ? 8   DT  E P     1 
ATOM   440  O  OP1   . DT  C 1 11  ? 5.510   -8.723  22.108  1.00 54.04  ? 8   DT  E OP1   1 
ATOM   441  O  OP2   . DT  C 1 11  ? 4.987   -6.498  20.967  1.00 53.67  ? 8   DT  E OP2   1 
ATOM   442  O  "O5'" . DT  C 1 11  ? 3.709   -7.115  22.981  1.00 57.07  ? 8   DT  E "O5'" 1 
ATOM   443  C  "C5'" . DT  C 1 11  ? 3.493   -7.265  24.417  1.00 59.81  ? 8   DT  E "C5'" 1 
ATOM   444  C  "C4'" . DT  C 1 11  ? 2.591   -6.161  24.992  1.00 61.42  ? 8   DT  E "C4'" 1 
ATOM   445  O  "O4'" . DT  C 1 11  ? 3.137   -4.866  24.610  1.00 62.38  ? 8   DT  E "O4'" 1 
ATOM   446  C  "C3'" . DT  C 1 11  ? 1.093   -6.109  24.565  1.00 61.90  ? 8   DT  E "C3'" 1 
ATOM   447  O  "O3'" . DT  C 1 11  ? 0.163   -5.744  25.645  1.00 60.71  ? 8   DT  E "O3'" 1 
ATOM   448  C  "C2'" . DT  C 1 11  ? 1.103   -4.992  23.525  1.00 62.68  ? 8   DT  E "C2'" 1 
ATOM   449  C  "C1'" . DT  C 1 11  ? 1.968   -4.103  24.389  1.00 63.42  ? 8   DT  E "C1'" 1 
ATOM   450  N  N1    . DT  C 1 11  ? 2.215   -2.746  23.908  1.00 64.96  ? 8   DT  E N1    1 
ATOM   451  C  C2    . DT  C 1 11  ? 2.363   -1.814  24.914  1.00 65.95  ? 8   DT  E C2    1 
ATOM   452  O  O2    . DT  C 1 11  ? 2.305   -2.119  26.110  1.00 65.48  ? 8   DT  E O2    1 
ATOM   453  N  N3    . DT  C 1 11  ? 2.586   -0.528  24.447  1.00 66.38  ? 8   DT  E N3    1 
ATOM   454  C  C4    . DT  C 1 11  ? 2.670   -0.122  23.121  1.00 65.97  ? 8   DT  E C4    1 
ATOM   455  O  O4    . DT  C 1 11  ? 2.871   1.048   22.824  1.00 65.57  ? 8   DT  E O4    1 
ATOM   456  C  C5    . DT  C 1 11  ? 2.501   -1.166  22.128  1.00 66.06  ? 8   DT  E C5    1 
ATOM   457  C  C7    . DT  C 1 11  ? 2.573   -0.836  20.656  1.00 66.12  ? 8   DT  E C7    1 
ATOM   458  C  C6    . DT  C 1 11  ? 2.276   -2.422  22.564  1.00 65.33  ? 8   DT  E C6    1 
ATOM   459  P  P     . DT  C 1 12  ? -1.389  -5.311  25.439  1.00 60.15  ? 9   DT  E P     1 
ATOM   460  O  OP1   . DT  C 1 12  ? -2.071  -5.766  26.669  1.00 59.53  ? 9   DT  E OP1   1 
ATOM   461  O  OP2   . DT  C 1 12  ? -1.876  -5.757  24.120  1.00 59.13  ? 9   DT  E OP2   1 
ATOM   462  O  "O5'" . DT  C 1 12  ? -1.446  -3.707  25.414  1.00 60.15  ? 9   DT  E "O5'" 1 
ATOM   463  C  "C5'" . DT  C 1 12  ? -1.613  -3.024  26.685  1.00 60.76  ? 9   DT  E "C5'" 1 
ATOM   464  C  "C4'" . DT  C 1 12  ? -2.425  -1.719  26.719  1.00 60.27  ? 9   DT  E "C4'" 1 
ATOM   465  O  "O4'" . DT  C 1 12  ? -1.881  -0.710  25.814  1.00 61.49  ? 9   DT  E "O4'" 1 
ATOM   466  C  "C3'" . DT  C 1 12  ? -3.923  -1.776  26.407  1.00 59.26  ? 9   DT  E "C3'" 1 
ATOM   467  O  "O3'" . DT  C 1 12  ? -4.584  -0.868  27.292  1.00 56.66  ? 9   DT  E "O3'" 1 
ATOM   468  C  "C2'" . DT  C 1 12  ? -3.981  -1.288  24.956  1.00 60.56  ? 9   DT  E "C2'" 1 
ATOM   469  C  "C1'" . DT  C 1 12  ? -2.915  -0.199  24.977  1.00 61.05  ? 9   DT  E "C1'" 1 
ATOM   470  N  N1    . DT  C 1 12  ? -2.239  0.080   23.696  1.00 61.63  ? 9   DT  E N1    1 
ATOM   471  C  C2    . DT  C 1 12  ? -1.925  1.377   23.355  1.00 61.01  ? 9   DT  E C2    1 
ATOM   472  O  O2    . DT  C 1 12  ? -2.208  2.350   24.029  1.00 59.55  ? 9   DT  E O2    1 
ATOM   473  N  N3    . DT  C 1 12  ? -1.264  1.492   22.157  1.00 61.43  ? 9   DT  E N3    1 
ATOM   474  C  C4    . DT  C 1 12  ? -0.904  0.468   21.293  1.00 62.12  ? 9   DT  E C4    1 
ATOM   475  O  O4    . DT  C 1 12  ? -0.317  0.685   20.238  1.00 63.04  ? 9   DT  E O4    1 
ATOM   476  C  C5    . DT  C 1 12  ? -1.260  -0.863  21.714  1.00 62.55  ? 9   DT  E C5    1 
ATOM   477  C  C7    . DT  C 1 12  ? -0.929  -2.071  20.881  1.00 62.88  ? 9   DT  E C7    1 
ATOM   478  C  C6    . DT  C 1 12  ? -1.890  -0.984  22.888  1.00 62.48  ? 9   DT  E C6    1 
ATOM   479  P  P     . DA  C 1 13  ? -5.961  -0.122  26.971  1.00 54.19  ? 10  DA  E P     1 
ATOM   480  O  OP1   . DA  C 1 13  ? -6.734  0.024   28.233  1.00 54.54  ? 10  DA  E OP1   1 
ATOM   481  O  OP2   . DA  C 1 13  ? -6.556  -0.734  25.772  1.00 53.66  ? 10  DA  E OP2   1 
ATOM   482  O  "O5'" . DA  C 1 13  ? -5.601  1.364   26.533  1.00 53.57  ? 10  DA  E "O5'" 1 
ATOM   483  C  "C5'" . DA  C 1 13  ? -6.754  2.239   26.568  1.00 50.73  ? 10  DA  E "C5'" 1 
ATOM   484  C  "C4'" . DA  C 1 13  ? -6.474  3.667   26.162  1.00 47.57  ? 10  DA  E "C4'" 1 
ATOM   485  O  "O4'" . DA  C 1 13  ? -5.350  3.663   25.234  1.00 46.78  ? 10  DA  E "O4'" 1 
ATOM   486  C  "C3'" . DA  C 1 13  ? -7.666  4.315   25.458  1.00 46.08  ? 10  DA  E "C3'" 1 
ATOM   487  O  "O3'" . DA  C 1 13  ? -8.007  5.639   25.968  1.00 44.48  ? 10  DA  E "O3'" 1 
ATOM   488  C  "C2'" . DA  C 1 13  ? -7.228  4.322   23.988  1.00 45.38  ? 10  DA  E "C2'" 1 
ATOM   489  C  "C1'" . DA  C 1 13  ? -5.689  4.365   24.057  1.00 44.57  ? 10  DA  E "C1'" 1 
ATOM   490  N  N9    . DA  C 1 13  ? -5.090  3.675   22.925  1.00 42.18  ? 10  DA  E N9    1 
ATOM   491  C  C8    . DA  C 1 13  ? -5.286  2.340   22.659  1.00 42.17  ? 10  DA  E C8    1 
ATOM   492  N  N7    . DA  C 1 13  ? -4.685  1.909   21.592  1.00 40.53  ? 10  DA  E N7    1 
ATOM   493  C  C5    . DA  C 1 13  ? -4.069  3.046   21.107  1.00 39.38  ? 10  DA  E C5    1 
ATOM   494  C  C6    . DA  C 1 13  ? -3.269  3.224   19.986  1.00 38.75  ? 10  DA  E C6    1 
ATOM   495  N  N6    . DA  C 1 13  ? -3.024  2.196   19.193  1.00 37.60  ? 10  DA  E N6    1 
ATOM   496  N  N1    . DA  C 1 13  ? -2.769  4.466   19.731  1.00 40.04  ? 10  DA  E N1    1 
ATOM   497  C  C2    . DA  C 1 13  ? -3.064  5.467   20.588  1.00 38.83  ? 10  DA  E C2    1 
ATOM   498  N  N3    . DA  C 1 13  ? -3.817  5.407   21.681  1.00 38.87  ? 10  DA  E N3    1 
ATOM   499  C  C4    . DA  C 1 13  ? -4.298  4.160   21.896  1.00 40.10  ? 10  DA  E C4    1 
ATOM   500  P  P     . DG  C 1 14  ? -9.375  6.384   25.504  1.00 44.20  ? 11  DG  E P     1 
ATOM   501  O  OP1   . DG  C 1 14  ? -9.889  7.237   26.595  1.00 43.88  ? 11  DG  E OP1   1 
ATOM   502  O  OP2   . DG  C 1 14  ? -10.301 5.371   24.929  1.00 44.15  ? 11  DG  E OP2   1 
ATOM   503  O  "O5'" . DG  C 1 14  ? -8.882  7.368   24.332  1.00 41.44  ? 11  DG  E "O5'" 1 
ATOM   504  C  "C5'" . DG  C 1 14  ? -7.760  8.189   24.575  1.00 38.35  ? 11  DG  E "C5'" 1 
ATOM   505  C  "C4'" . DG  C 1 14  ? -7.465  9.036   23.357  1.00 35.86  ? 11  DG  E "C4'" 1 
ATOM   506  O  "O4'" . DG  C 1 14  ? -6.703  8.247   22.425  1.00 34.98  ? 11  DG  E "O4'" 1 
ATOM   507  C  "C3'" . DG  C 1 14  ? -8.677  9.542   22.595  1.00 34.43  ? 11  DG  E "C3'" 1 
ATOM   508  O  "O3'" . DG  C 1 14  ? -8.588  10.931  22.600  1.00 33.14  ? 11  DG  E "O3'" 1 
ATOM   509  C  "C2'" . DG  C 1 14  ? -8.548  8.927   21.203  1.00 32.83  ? 11  DG  E "C2'" 1 
ATOM   510  C  "C1'" . DG  C 1 14  ? -7.091  8.524   21.104  1.00 32.52  ? 11  DG  E "C1'" 1 
ATOM   511  N  N9    . DG  C 1 14  ? -6.855  7.290   20.362  1.00 29.99  ? 11  DG  E N9    1 
ATOM   512  C  C8    . DG  C 1 14  ? -7.410  6.055   20.640  1.00 29.64  ? 11  DG  E C8    1 
ATOM   513  N  N7    . DG  C 1 14  ? -7.030  5.119   19.820  1.00 28.50  ? 11  DG  E N7    1 
ATOM   514  C  C5    . DG  C 1 14  ? -6.151  5.771   18.949  1.00 27.90  ? 11  DG  E C5    1 
ATOM   515  C  C6    . DG  C 1 14  ? -5.415  5.264   17.847  1.00 26.65  ? 11  DG  E C6    1 
ATOM   516  O  O6    . DG  C 1 14  ? -5.412  4.095   17.419  1.00 27.70  ? 11  DG  E O6    1 
ATOM   517  N  N1    . DG  C 1 14  ? -4.659  6.255   17.199  1.00 24.59  ? 11  DG  E N1    1 
ATOM   518  C  C2    . DG  C 1 14  ? -4.599  7.566   17.609  1.00 24.39  ? 11  DG  E C2    1 
ATOM   519  N  N2    . DG  C 1 14  ? -3.816  8.378   16.888  1.00 23.06  ? 11  DG  E N2    1 
ATOM   520  N  N3    . DG  C 1 14  ? -5.266  8.046   18.657  1.00 26.12  ? 11  DG  E N3    1 
ATOM   521  C  C4    . DG  C 1 14  ? -6.027  7.105   19.271  1.00 27.92  ? 11  DG  E C4    1 
ATOM   522  P  P     . DC  C 1 15  ? -9.623  11.853  21.804  1.00 32.83  ? 12  DC  E P     1 
ATOM   523  O  OP1   . DC  C 1 15  ? -9.277  13.245  22.148  1.00 31.14  ? 12  DC  E OP1   1 
ATOM   524  O  OP2   . DC  C 1 15  ? -10.949 11.280  22.127  1.00 33.83  ? 12  DC  E OP2   1 
ATOM   525  O  "O5'" . DC  C 1 15  ? -9.320  11.714  20.231  1.00 31.82  ? 12  DC  E "O5'" 1 
ATOM   526  C  "C5'" . DC  C 1 15  ? -8.168  12.419  19.729  1.00 30.58  ? 12  DC  E "C5'" 1 
ATOM   527  C  "C4'" . DC  C 1 15  ? -7.820  12.001  18.333  1.00 30.38  ? 12  DC  E "C4'" 1 
ATOM   528  O  "O4'" . DC  C 1 15  ? -7.603  10.581  18.261  1.00 29.79  ? 12  DC  E "O4'" 1 
ATOM   529  C  "C3'" . DC  C 1 15  ? -8.917  12.223  17.307  1.00 29.97  ? 12  DC  E "C3'" 1 
ATOM   530  O  "O3'" . DC  C 1 15  ? -8.659  13.471  16.696  1.00 29.72  ? 12  DC  E "O3'" 1 
ATOM   531  C  "C2'" . DC  C 1 15  ? -8.668  11.138  16.272  1.00 28.94  ? 12  DC  E "C2'" 1 
ATOM   532  C  "C1'" . DC  C 1 15  ? -7.642  10.231  16.903  1.00 29.13  ? 12  DC  E "C1'" 1 
ATOM   533  N  N1    . DC  C 1 15  ? -8.030  8.794   16.858  1.00 29.67  ? 12  DC  E N1    1 
ATOM   534  C  C2    . DC  C 1 15  ? -7.487  7.949   15.871  1.00 28.95  ? 12  DC  E C2    1 
ATOM   535  O  O2    . DC  C 1 15  ? -6.683  8.399   15.016  1.00 28.45  ? 12  DC  E O2    1 
ATOM   536  N  N3    . DC  C 1 15  ? -7.873  6.649   15.880  1.00 28.27  ? 12  DC  E N3    1 
ATOM   537  C  C4    . DC  C 1 15  ? -8.742  6.231   16.820  1.00 28.94  ? 12  DC  E C4    1 
ATOM   538  N  N4    . DC  C 1 15  ? -9.080  4.955   16.821  1.00 29.46  ? 12  DC  E N4    1 
ATOM   539  C  C5    . DC  C 1 15  ? -9.313  7.058   17.826  1.00 28.83  ? 12  DC  E C5    1 
ATOM   540  C  C6    . DC  C 1 15  ? -8.920  8.331   17.796  1.00 28.95  ? 12  DC  E C6    1 
ATOM   541  P  P     . DC  C 1 16  ? -9.773  14.077  15.748  1.00 28.76  ? 13  DC  E P     1 
ATOM   542  O  OP1   . DC  C 1 16  ? -9.589  15.557  15.757  1.00 28.74  ? 13  DC  E OP1   1 
ATOM   543  O  OP2   . DC  C 1 16  ? -11.086 13.505  16.165  1.00 28.84  ? 13  DC  E OP2   1 
ATOM   544  O  "O5'" . DC  C 1 16  ? -9.374  13.442  14.305  1.00 27.53  ? 13  DC  E "O5'" 1 
ATOM   545  C  "C5'" . DC  C 1 16  ? -8.117  13.778  13.660  1.00 22.23  ? 13  DC  E "C5'" 1 
ATOM   546  C  "C4'" . DC  C 1 16  ? -8.128  13.223  12.271  1.00 20.45  ? 13  DC  E "C4'" 1 
ATOM   547  O  "O4'" . DC  C 1 16  ? -7.998  11.801  12.447  1.00 21.20  ? 13  DC  E "O4'" 1 
ATOM   548  C  "C3'" . DC  C 1 16  ? -9.447  13.489  11.516  1.00 18.94  ? 13  DC  E "C3'" 1 
ATOM   549  O  "O3'" . DC  C 1 16  ? -9.153  14.361  10.495  1.00 18.66  ? 13  DC  E "O3'" 1 
ATOM   550  C  "C2'" . DC  C 1 16  ? -9.906  12.155  10.954  1.00 17.56  ? 13  DC  E "C2'" 1 
ATOM   551  C  "C1'" . DC  C 1 16  ? -8.892  11.166  11.502  1.00 20.60  ? 13  DC  E "C1'" 1 
ATOM   552  N  N1    . DC  C 1 16  ? -9.458  9.959   12.198  1.00 20.69  ? 13  DC  E N1    1 
ATOM   553  C  C2    . DC  C 1 16  ? -9.056  8.699   11.733  1.00 19.65  ? 13  DC  E C2    1 
ATOM   554  O  O2    . DC  C 1 16  ? -8.310  8.660   10.738  1.00 20.09  ? 13  DC  E O2    1 
ATOM   555  N  N3    . DC  C 1 16  ? -9.539  7.581   12.359  1.00 17.94  ? 13  DC  E N3    1 
ATOM   556  C  C4    . DC  C 1 16  ? -10.370 7.725   13.417  1.00 17.78  ? 13  DC  E C4    1 
ATOM   557  N  N4    . DC  C 1 16  ? -10.844 6.615   14.023  1.00 16.52  ? 13  DC  E N4    1 
ATOM   558  C  C5    . DC  C 1 16  ? -10.769 9.010   13.911  1.00 17.07  ? 13  DC  E C5    1 
ATOM   559  C  C6    . DC  C 1 16  ? -10.300 10.090  13.283  1.00 18.90  ? 13  DC  E C6    1 
ATOM   560  O  "O5'" . DG  D 2 1   ? -9.442  -3.088  8.600   1.00 31.63  ? 5   DG  F "O5'" 1 
ATOM   561  C  "C5'" . DG  D 2 1   ? -8.360  -2.338  9.113   1.00 31.85  ? 5   DG  F "C5'" 1 
ATOM   562  C  "C4'" . DG  D 2 1   ? -7.809  -1.417  8.032   1.00 31.24  ? 5   DG  F "C4'" 1 
ATOM   563  O  "O4'" . DG  D 2 1   ? -8.405  -0.108  8.155   1.00 29.62  ? 5   DG  F "O4'" 1 
ATOM   564  C  "C3'" . DG  D 2 1   ? -6.318  -1.107  8.111   1.00 31.65  ? 5   DG  F "C3'" 1 
ATOM   565  O  "O3'" . DG  D 2 1   ? -5.846  -0.584  6.841   1.00 31.63  ? 5   DG  F "O3'" 1 
ATOM   566  C  "C2'" . DG  D 2 1   ? -6.299  -0.087  9.240   1.00 29.40  ? 5   DG  F "C2'" 1 
ATOM   567  C  "C1'" . DG  D 2 1   ? -7.557  0.715   8.937   1.00 28.10  ? 5   DG  F "C1'" 1 
ATOM   568  N  N9    . DG  D 2 1   ? -8.281  1.234   10.100  1.00 25.61  ? 5   DG  F N9    1 
ATOM   569  C  C8    . DG  D 2 1   ? -8.921  0.566   11.128  1.00 23.73  ? 5   DG  F C8    1 
ATOM   570  N  N7    . DG  D 2 1   ? -9.471  1.370   11.993  1.00 21.82  ? 5   DG  F N7    1 
ATOM   571  C  C5    . DG  D 2 1   ? -9.157  2.653   11.529  1.00 23.11  ? 5   DG  F C5    1 
ATOM   572  C  C6    . DG  D 2 1   ? -9.479  3.972   12.029  1.00 22.90  ? 5   DG  F C6    1 
ATOM   573  O  O6    . DG  D 2 1   ? -10.132 4.295   13.043  1.00 21.22  ? 5   DG  F O6    1 
ATOM   574  N  N1    . DG  D 2 1   ? -8.983  5.005   11.211  1.00 23.52  ? 5   DG  F N1    1 
ATOM   575  C  C2    . DG  D 2 1   ? -8.258  4.767   10.040  1.00 23.90  ? 5   DG  F C2    1 
ATOM   576  N  N2    . DG  D 2 1   ? -7.833  5.840   9.359   1.00 23.67  ? 5   DG  F N2    1 
ATOM   577  N  N3    . DG  D 2 1   ? -7.969  3.557   9.564   1.00 23.09  ? 5   DG  F N3    1 
ATOM   578  C  C4    . DG  D 2 1   ? -8.441  2.564   10.354  1.00 23.68  ? 5   DG  F C4    1 
ATOM   579  P  P     . DG  D 2 2   ? -4.288  -0.532  6.476   1.00 32.33  ? 6   DG  F P     1 
ATOM   580  O  OP1   . DG  D 2 2   ? -4.213  -0.258  5.019   1.00 30.94  ? 6   DG  F OP1   1 
ATOM   581  O  OP2   . DG  D 2 2   ? -3.620  -1.685  7.127   1.00 31.78  ? 6   DG  F OP2   1 
ATOM   582  O  "O5'" . DG  D 2 2   ? -3.724  0.738   7.258   1.00 31.99  ? 6   DG  F "O5'" 1 
ATOM   583  C  "C5'" . DG  D 2 2   ? -3.805  2.000   6.597   1.00 29.76  ? 6   DG  F "C5'" 1 
ATOM   584  C  "C4'" . DG  D 2 2   ? -3.608  3.122   7.587   1.00 26.86  ? 6   DG  F "C4'" 1 
ATOM   585  O  "O4'" . DG  D 2 2   ? -4.529  2.982   8.680   1.00 23.87  ? 6   DG  F "O4'" 1 
ATOM   586  C  "C3'" . DG  D 2 2   ? -2.212  3.095   8.167   1.00 26.68  ? 6   DG  F "C3'" 1 
ATOM   587  O  "O3'" . DG  D 2 2   ? -1.590  4.315   7.801   1.00 27.08  ? 6   DG  F "O3'" 1 
ATOM   588  C  "C2'" . DG  D 2 2   ? -2.434  2.880   9.669   1.00 24.94  ? 6   DG  F "C2'" 1 
ATOM   589  C  "C1'" . DG  D 2 2   ? -3.833  3.441   9.804   1.00 25.54  ? 6   DG  F "C1'" 1 
ATOM   590  N  N9    . DG  D 2 2   ? -4.606  3.070   10.991  1.00 26.86  ? 6   DG  F N9    1 
ATOM   591  C  C8    . DG  D 2 2   ? -4.882  1.825   11.498  1.00 25.50  ? 6   DG  F C8    1 
ATOM   592  N  N7    . DG  D 2 2   ? -5.626  1.895   12.568  1.00 27.59  ? 6   DG  F N7    1 
ATOM   593  C  C5    . DG  D 2 2   ? -5.849  3.266   12.801  1.00 28.26  ? 6   DG  F C5    1 
ATOM   594  C  C6    . DG  D 2 2   ? -6.587  4.001   13.800  1.00 27.85  ? 6   DG  F C6    1 
ATOM   595  O  O6    . DG  D 2 2   ? -7.237  3.568   14.751  1.00 29.73  ? 6   DG  F O6    1 
ATOM   596  N  N1    . DG  D 2 2   ? -6.567  5.399   13.657  1.00 25.41  ? 6   DG  F N1    1 
ATOM   597  C  C2    . DG  D 2 2   ? -5.890  6.017   12.634  1.00 25.49  ? 6   DG  F C2    1 
ATOM   598  N  N2    . DG  D 2 2   ? -5.929  7.343   12.617  1.00 24.02  ? 6   DG  F N2    1 
ATOM   599  N  N3    . DG  D 2 2   ? -5.212  5.370   11.683  1.00 27.76  ? 6   DG  F N3    1 
ATOM   600  C  C4    . DG  D 2 2   ? -5.230  3.998   11.816  1.00 27.89  ? 6   DG  F C4    1 
ATOM   601  P  P     . DC  D 2 3   ? -0.031  4.585   8.092   1.00 27.82  ? 7   DC  F P     1 
ATOM   602  O  OP1   . DC  D 2 3   ? 0.471   5.080   6.790   1.00 28.57  ? 7   DC  F OP1   1 
ATOM   603  O  OP2   . DC  D 2 3   ? 0.655   3.545   8.906   1.00 24.58  ? 7   DC  F OP2   1 
ATOM   604  O  "O5'" . DC  D 2 3   ? -0.067  5.774   9.132   1.00 26.29  ? 7   DC  F "O5'" 1 
ATOM   605  C  "C5'" . DC  D 2 3   ? -0.897  6.864   9.019   1.00 24.73  ? 7   DC  F "C5'" 1 
ATOM   606  C  "C4'" . DC  D 2 3   ? -0.787  7.512   10.374  1.00 24.99  ? 7   DC  F "C4'" 1 
ATOM   607  O  "O4'" . DC  D 2 3   ? -1.754  6.881   11.226  1.00 24.85  ? 7   DC  F "O4'" 1 
ATOM   608  C  "C3'" . DC  D 2 3   ? 0.571   7.339   11.053  1.00 25.98  ? 7   DC  F "C3'" 1 
ATOM   609  O  "O3'" . DC  D 2 3   ? 1.155   8.614   11.269  1.00 28.06  ? 7   DC  F "O3'" 1 
ATOM   610  C  "C2'" . DC  D 2 3   ? 0.242   6.726   12.406  1.00 25.63  ? 7   DC  F "C2'" 1 
ATOM   611  C  "C1'" . DC  D 2 3   ? -1.254  6.889   12.539  1.00 24.43  ? 7   DC  F "C1'" 1 
ATOM   612  N  N1    . DC  D 2 3   ? -1.932  5.822   13.328  1.00 24.00  ? 7   DC  F N1    1 
ATOM   613  C  C2    . DC  D 2 3   ? -2.504  6.199   14.551  1.00 23.75  ? 7   DC  F C2    1 
ATOM   614  O  O2    . DC  D 2 3   ? -2.426  7.349   14.894  1.00 24.41  ? 7   DC  F O2    1 
ATOM   615  N  N3    . DC  D 2 3   ? -3.149  5.320   15.332  1.00 23.39  ? 7   DC  F N3    1 
ATOM   616  C  C4    . DC  D 2 3   ? -3.199  4.055   14.917  1.00 25.02  ? 7   DC  F C4    1 
ATOM   617  N  N4    . DC  D 2 3   ? -3.865  3.213   15.721  1.00 24.62  ? 7   DC  F N4    1 
ATOM   618  C  C5    . DC  D 2 3   ? -2.597  3.618   13.665  1.00 24.34  ? 7   DC  F C5    1 
ATOM   619  C  C6    . DC  D 2 3   ? -1.988  4.525   12.896  1.00 22.47  ? 7   DC  F C6    1 
ATOM   620  P  P     . DT  D 2 4   ? 2.689   8.910   11.642  1.00 26.15  ? 8   DT  F P     1 
ATOM   621  O  OP1   . DT  D 2 4   ? 2.997   10.185  10.972  1.00 26.47  ? 8   DT  F OP1   1 
ATOM   622  O  OP2   . DT  D 2 4   ? 3.509   7.730   11.338  1.00 26.83  ? 8   DT  F OP2   1 
ATOM   623  O  "O5'" . DT  D 2 4   ? 2.686   9.119   13.226  1.00 27.59  ? 8   DT  F "O5'" 1 
ATOM   624  C  "C5'" . DT  D 2 4   ? 1.848   10.125  13.784  1.00 28.44  ? 8   DT  F "C5'" 1 
ATOM   625  C  "C4'" . DT  D 2 4   ? 1.571   9.875   15.245  1.00 28.06  ? 8   DT  F "C4'" 1 
ATOM   626  O  "O4'" . DT  D 2 4   ? 0.753   8.699   15.359  1.00 27.31  ? 8   DT  F "O4'" 1 
ATOM   627  C  "C3'" . DT  D 2 4   ? 2.796   9.631   16.122  1.00 28.71  ? 8   DT  F "C3'" 1 
ATOM   628  O  "O3'" . DT  D 2 4   ? 2.804   10.647  17.068  1.00 32.61  ? 8   DT  F "O3'" 1 
ATOM   629  C  "C2'" . DT  D 2 4   ? 2.450   8.373   16.874  1.00 27.38  ? 8   DT  F "C2'" 1 
ATOM   630  C  "C1'" . DT  D 2 4   ? 0.946   8.265   16.682  1.00 27.07  ? 8   DT  F "C1'" 1 
ATOM   631  N  N1    . DT  D 2 4   ? 0.494   6.863   16.811  1.00 27.36  ? 8   DT  F N1    1 
ATOM   632  C  C2    . DT  D 2 4   ? -0.318  6.455   17.876  1.00 27.91  ? 8   DT  F C2    1 
ATOM   633  O  O2    . DT  D 2 4   ? -0.737  7.192   18.756  1.00 27.65  ? 8   DT  F O2    1 
ATOM   634  N  N3    . DT  D 2 4   ? -0.630  5.099   17.877  1.00 27.35  ? 8   DT  F N3    1 
ATOM   635  C  C4    . DT  D 2 4   ? -0.212  4.135   16.954  1.00 26.67  ? 8   DT  F C4    1 
ATOM   636  O  O4    . DT  D 2 4   ? -0.533  2.949   17.011  1.00 26.24  ? 8   DT  F O4    1 
ATOM   637  C  C5    . DT  D 2 4   ? 0.634   4.617   15.885  1.00 27.52  ? 8   DT  F C5    1 
ATOM   638  C  C7    . DT  D 2 4   ? 1.122   3.637   14.819  1.00 25.48  ? 8   DT  F C7    1 
ATOM   639  C  C6    . DT  D 2 4   ? 0.939   5.945   15.876  1.00 26.66  ? 8   DT  F C6    1 
ATOM   640  P  P     . DA  D 2 5   ? 4.090   11.151  17.888  1.00 35.78  ? 9   DA  F P     1 
ATOM   641  O  OP1   . DA  D 2 5   ? 4.614   12.346  17.188  1.00 36.52  ? 9   DA  F OP1   1 
ATOM   642  O  OP2   . DA  D 2 5   ? 5.052   10.060  18.143  1.00 36.33  ? 9   DA  F OP2   1 
ATOM   643  O  "O5'" . DA  D 2 5   ? 3.444   11.533  19.303  1.00 37.70  ? 9   DA  F "O5'" 1 
ATOM   644  C  "C5'" . DA  D 2 5   ? 2.062   11.806  19.469  1.00 38.65  ? 9   DA  F "C5'" 1 
ATOM   645  C  "C4'" . DA  D 2 5   ? 1.514   11.333  20.808  1.00 40.06  ? 9   DA  F "C4'" 1 
ATOM   646  O  "O4'" . DA  D 2 5   ? 0.888   10.030  20.661  1.00 37.23  ? 9   DA  F "O4'" 1 
ATOM   647  C  "C3'" . DA  D 2 5   ? 2.490   11.219  21.974  1.00 42.60  ? 9   DA  F "C3'" 1 
ATOM   648  O  "O3'" . DA  D 2 5   ? 1.858   11.706  23.158  1.00 46.92  ? 9   DA  F "O3'" 1 
ATOM   649  C  "C2'" . DA  D 2 5   ? 2.723   9.714   22.070  1.00 40.92  ? 9   DA  F "C2'" 1 
ATOM   650  C  "C1'" . DA  D 2 5   ? 1.356   9.163   21.643  1.00 39.52  ? 9   DA  F "C1'" 1 
ATOM   651  N  N9    . DA  D 2 5   ? 1.473   7.821   21.093  1.00 39.19  ? 9   DA  F N9    1 
ATOM   652  C  C8    . DA  D 2 5   ? 2.299   7.381   20.085  1.00 39.03  ? 9   DA  F C8    1 
ATOM   653  N  N7    . DA  D 2 5   ? 2.194   6.086   19.853  1.00 39.07  ? 9   DA  F N7    1 
ATOM   654  C  C5    . DA  D 2 5   ? 1.242   5.645   20.780  1.00 39.79  ? 9   DA  F C5    1 
ATOM   655  C  C6    . DA  D 2 5   ? 0.646   4.374   21.076  1.00 39.48  ? 9   DA  F C6    1 
ATOM   656  N  N6    . DA  D 2 5   ? 0.933   3.220   20.447  1.00 39.03  ? 9   DA  F N6    1 
ATOM   657  N  N1    . DA  D 2 5   ? -0.262  4.299   22.075  1.00 38.66  ? 9   DA  F N1    1 
ATOM   658  C  C2    . DA  D 2 5   ? -0.564  5.429   22.733  1.00 39.58  ? 9   DA  F C2    1 
ATOM   659  N  N3    . DA  D 2 5   ? -0.090  6.672   22.542  1.00 39.52  ? 9   DA  F N3    1 
ATOM   660  C  C4    . DA  D 2 5   ? 0.806   6.714   21.546  1.00 39.33  ? 9   DA  F C4    1 
ATOM   661  P  P     . DC  D 2 6   ? 2.728   12.207  24.401  1.00 50.47  ? 10  DC  F P     1 
ATOM   662  O  OP1   . DC  D 2 6   ? 2.455   13.647  24.588  1.00 51.68  ? 10  DC  F OP1   1 
ATOM   663  O  OP2   . DC  D 2 6   ? 4.125   11.733  24.262  1.00 50.61  ? 10  DC  F OP2   1 
ATOM   664  O  "O5'" . DC  D 2 6   ? 2.069   11.444  25.627  1.00 51.65  ? 10  DC  F "O5'" 1 
ATOM   665  C  "C5'" . DC  D 2 6   ? 2.823   10.449  26.235  1.00 52.91  ? 10  DC  F "C5'" 1 
ATOM   666  C  "C4'" . DC  D 2 6   ? 2.061   9.170   26.047  1.00 53.46  ? 10  DC  F "C4'" 1 
ATOM   667  O  "O4'" . DC  D 2 6   ? 2.691   8.305   25.070  1.00 53.09  ? 10  DC  F "O4'" 1 
ATOM   668  C  "C3'" . DC  D 2 6   ? 2.024   8.376   27.333  1.00 54.16  ? 10  DC  F "C3'" 1 
ATOM   669  O  "O3'" . DC  D 2 6   ? 0.715   8.400   27.835  1.00 55.22  ? 10  DC  F "O3'" 1 
ATOM   670  C  "C2'" . DC  D 2 6   ? 2.437   6.977   26.905  1.00 53.25  ? 10  DC  F "C2'" 1 
ATOM   671  C  "C1'" . DC  D 2 6   ? 2.165   7.048   25.415  1.00 52.42  ? 10  DC  F "C1'" 1 
ATOM   672  N  N1    . DC  D 2 6   ? 2.760   5.968   24.611  1.00 50.34  ? 10  DC  F N1    1 
ATOM   673  C  C2    . DC  D 2 6   ? 2.207   4.675   24.650  1.00 49.41  ? 10  DC  F C2    1 
ATOM   674  O  O2    . DC  D 2 6   ? 1.231   4.424   25.373  1.00 47.00  ? 10  DC  F O2    1 
ATOM   675  N  N3    . DC  D 2 6   ? 2.764   3.707   23.868  1.00 49.90  ? 10  DC  F N3    1 
ATOM   676  C  C4    . DC  D 2 6   ? 3.815   3.987   23.084  1.00 50.03  ? 10  DC  F C4    1 
ATOM   677  N  N4    . DC  D 2 6   ? 4.332   2.992   22.351  1.00 49.13  ? 10  DC  F N4    1 
ATOM   678  C  C5    . DC  D 2 6   ? 4.391   5.299   23.039  1.00 50.56  ? 10  DC  F C5    1 
ATOM   679  C  C6    . DC  D 2 6   ? 3.833   6.244   23.812  1.00 50.64  ? 10  DC  F C6    1 
ATOM   680  P  P     . DA  D 2 7   ? 0.467   7.996   29.368  1.00 56.06  ? 11  DA  F P     1 
ATOM   681  O  OP1   . DA  D 2 7   ? -0.818  8.644   29.771  1.00 54.91  ? 11  DA  F OP1   1 
ATOM   682  O  OP2   . DA  D 2 7   ? 1.713   8.148   30.186  1.00 53.92  ? 11  DA  F OP2   1 
ATOM   683  O  "O5'" . DA  D 2 7   ? 0.225   6.440   29.051  1.00 55.03  ? 11  DA  F "O5'" 1 
ATOM   684  C  "C5'" . DA  D 2 7   ? -0.591  5.618   29.855  1.00 53.26  ? 11  DA  F "C5'" 1 
ATOM   685  C  "C4'" . DA  D 2 7   ? 0.272   4.559   30.510  1.00 51.63  ? 11  DA  F "C4'" 1 
ATOM   686  O  "O4'" . DA  D 2 7   ? 1.100   3.930   29.496  1.00 50.24  ? 11  DA  F "O4'" 1 
ATOM   687  C  "C3'" . DA  D 2 7   ? 1.225   5.047   31.591  1.00 50.61  ? 11  DA  F "C3'" 1 
ATOM   688  O  "O3'" . DA  D 2 7   ? 1.462   3.922   32.378  1.00 50.44  ? 11  DA  F "O3'" 1 
ATOM   689  C  "C2'" . DA  D 2 7   ? 2.494   5.305   30.794  1.00 50.46  ? 11  DA  F "C2'" 1 
ATOM   690  C  "C1'" . DA  D 2 7   ? 2.450   4.061   29.901  1.00 49.81  ? 11  DA  F "C1'" 1 
ATOM   691  N  N9    . DA  D 2 7   ? 3.341   4.035   28.742  1.00 47.90  ? 11  DA  F N9    1 
ATOM   692  C  C8    . DA  D 2 7   ? 4.120   5.043   28.242  1.00 47.12  ? 11  DA  F C8    1 
ATOM   693  N  N7    . DA  D 2 7   ? 4.832   4.695   27.198  1.00 46.45  ? 11  DA  F N7    1 
ATOM   694  C  C5    . DA  D 2 7   ? 4.502   3.366   27.008  1.00 46.68  ? 11  DA  F C5    1 
ATOM   695  C  C6    . DA  D 2 7   ? 4.917   2.407   26.065  1.00 47.01  ? 11  DA  F C6    1 
ATOM   696  N  N6    . DA  D 2 7   ? 5.790   2.688   25.101  1.00 47.25  ? 11  DA  F N6    1 
ATOM   697  N  N1    . DA  D 2 7   ? 4.398   1.156   26.138  1.00 46.74  ? 11  DA  F N1    1 
ATOM   698  C  C2    . DA  D 2 7   ? 3.520   0.879   27.114  1.00 46.87  ? 11  DA  F C2    1 
ATOM   699  N  N3    . DA  D 2 7   ? 3.055   1.702   28.055  1.00 47.09  ? 11  DA  F N3    1 
ATOM   700  C  C4    . DA  D 2 7   ? 3.588   2.938   27.946  1.00 47.14  ? 11  DA  F C4    1 
ATOM   701  P  P     . DG  D 2 8   ? 1.321   3.867   33.955  1.00 50.76  ? 12  DG  F P     1 
ATOM   702  O  OP1   . DG  D 2 8   ? -0.070  3.405   34.207  1.00 50.69  ? 12  DG  F OP1   1 
ATOM   703  O  OP2   . DG  D 2 8   ? 1.811   5.130   34.569  1.00 50.47  ? 12  DG  F OP2   1 
ATOM   704  O  "O5'" . DG  D 2 8   ? 2.404   2.733   34.310  1.00 49.29  ? 12  DG  F "O5'" 1 
ATOM   705  C  "C5'" . DG  D 2 8   ? 2.188   1.717   35.305  1.00 47.29  ? 12  DG  F "C5'" 1 
ATOM   706  C  "C4'" . DG  D 2 8   ? 2.651   0.345   34.812  1.00 45.08  ? 12  DG  F "C4'" 1 
ATOM   707  O  "O4'" . DG  D 2 8   ? 2.680   0.292   33.348  1.00 44.20  ? 12  DG  F "O4'" 1 
ATOM   708  C  "C3'" . DG  D 2 8   ? 4.029   -0.082  35.301  1.00 43.94  ? 12  DG  F "C3'" 1 
ATOM   709  O  "O3'" . DG  D 2 8   ? 3.863   -0.881  36.472  1.00 43.29  ? 12  DG  F "O3'" 1 
ATOM   710  C  "C2'" . DG  D 2 8   ? 4.634   -0.856  34.116  1.00 43.50  ? 12  DG  F "C2'" 1 
ATOM   711  C  "C1'" . DG  D 2 8   ? 3.854   -0.361  32.879  1.00 42.51  ? 12  DG  F "C1'" 1 
ATOM   712  N  N9    . DG  D 2 8   ? 4.584   0.529   31.945  1.00 40.55  ? 12  DG  F N9    1 
ATOM   713  C  C8    . DG  D 2 8   ? 4.683   1.908   31.968  1.00 39.91  ? 12  DG  F C8    1 
ATOM   714  N  N7    . DG  D 2 8   ? 5.392   2.435   31.006  1.00 38.49  ? 12  DG  F N7    1 
ATOM   715  C  C5    . DG  D 2 8   ? 5.791   1.328   30.278  1.00 38.50  ? 12  DG  F C5    1 
ATOM   716  C  C6    . DG  D 2 8   ? 6.589   1.254   29.112  1.00 38.16  ? 12  DG  F C6    1 
ATOM   717  O  O6    . DG  D 2 8   ? 7.094   2.221   28.525  1.00 38.45  ? 12  DG  F O6    1 
ATOM   718  N  N1    . DG  D 2 8   ? 6.774   -0.067  28.659  1.00 37.99  ? 12  DG  F N1    1 
ATOM   719  C  C2    . DG  D 2 8   ? 6.232   -1.166  29.297  1.00 37.95  ? 12  DG  F C2    1 
ATOM   720  N  N2    . DG  D 2 8   ? 6.471   -2.377  28.811  1.00 37.89  ? 12  DG  F N2    1 
ATOM   721  N  N3    . DG  D 2 8   ? 5.482   -1.102  30.386  1.00 39.11  ? 12  DG  F N3    1 
ATOM   722  C  C4    . DG  D 2 8   ? 5.304   0.163   30.833  1.00 39.29  ? 12  DG  F C4    1 
ATOM   723  N  N     . SER E 3 1   ? 41.288  -0.390  -40.052 1.00 74.59  ? 0   SER A N     1 
ATOM   724  C  CA    . SER E 3 1   ? 41.592  0.952   -39.571 1.00 72.78  ? 0   SER A CA    1 
ATOM   725  C  C     . SER E 3 1   ? 40.361  1.612   -38.960 1.00 66.94  ? 0   SER A C     1 
ATOM   726  O  O     . SER E 3 1   ? 39.258  1.509   -39.498 1.00 67.47  ? 0   SER A O     1 
ATOM   727  C  CB    . SER E 3 1   ? 42.143  1.816   -40.707 1.00 75.24  ? 0   SER A CB    1 
ATOM   728  O  OG    . SER E 3 1   ? 42.294  3.164   -40.296 1.00 76.19  ? 0   SER A OG    1 
ATOM   729  N  N     . MET E 3 2   ? 40.556  2.290   -37.834 1.00 55.12  ? 1   MET A N     1 
ATOM   730  C  CA    . MET E 3 2   ? 39.463  2.969   -37.149 1.00 45.53  ? 1   MET A CA    1 
ATOM   731  C  C     . MET E 3 2   ? 38.701  2.010   -36.240 1.00 40.15  ? 1   MET A C     1 
ATOM   732  O  O     . MET E 3 2   ? 37.772  1.331   -36.677 1.00 38.93  ? 1   MET A O     1 
ATOM   733  C  CB    . MET E 3 2   ? 38.507  3.603   -38.162 1.00 44.76  ? 1   MET A CB    1 
ATOM   734  C  CG    . MET E 3 2   ? 37.161  4.003   -37.579 1.00 43.50  ? 1   MET A CG    1 
ATOM   735  S  SD    . MET E 3 2   ? 37.022  5.779   -37.303 1.00 47.09  ? 1   MET A SD    1 
ATOM   736  C  CE    . MET E 3 2   ? 35.299  5.915   -36.834 1.00 44.56  ? 1   MET A CE    1 
ATOM   737  N  N     . ILE E 3 3   ? 39.101  1.960   -34.974 1.00 34.88  ? 2   ILE A N     1 
ATOM   738  C  CA    . ILE E 3 3   ? 38.457  1.086   -34.000 1.00 30.56  ? 2   ILE A CA    1 
ATOM   739  C  C     . ILE E 3 3   ? 37.782  1.894   -32.897 1.00 28.71  ? 2   ILE A C     1 
ATOM   740  O  O     . ILE E 3 3   ? 38.444  2.611   -32.146 1.00 27.88  ? 2   ILE A O     1 
ATOM   741  C  CB    . ILE E 3 3   ? 39.464  0.109   -33.365 1.00 29.90  ? 2   ILE A CB    1 
ATOM   742  C  CG1   . ILE E 3 3   ? 40.310  -0.563  -34.449 1.00 29.11  ? 2   ILE A CG1   1 
ATOM   743  C  CG2   . ILE E 3 3   ? 38.739  -0.932  -32.526 1.00 29.28  ? 2   ILE A CG2   1 
ATOM   744  C  CD1   . ILE E 3 3   ? 41.273  -1.601  -33.915 1.00 26.80  ? 2   ILE A CD1   1 
ATOM   745  N  N     . VAL E 3 4   ? 36.462  1.774   -32.805 1.00 27.07  ? 3   VAL A N     1 
ATOM   746  C  CA    . VAL E 3 4   ? 35.693  2.498   -31.792 1.00 25.71  ? 3   VAL A CA    1 
ATOM   747  C  C     . VAL E 3 4   ? 35.263  1.509   -30.731 1.00 25.12  ? 3   VAL A C     1 
ATOM   748  O  O     . VAL E 3 4   ? 34.779  0.433   -31.074 1.00 25.53  ? 3   VAL A O     1 
ATOM   749  C  CB    . VAL E 3 4   ? 34.422  3.130   -32.405 1.00 25.78  ? 3   VAL A CB    1 
ATOM   750  C  CG1   . VAL E 3 4   ? 33.559  3.737   -31.322 1.00 24.90  ? 3   VAL A CG1   1 
ATOM   751  C  CG2   . VAL E 3 4   ? 34.795  4.174   -33.488 1.00 24.39  ? 3   VAL A CG2   1 
ATOM   752  N  N     . LEU E 3 5   ? 35.433  1.867   -29.455 1.00 23.57  ? 4   LEU A N     1 
ATOM   753  C  CA    . LEU E 3 5   ? 35.083  0.993   -28.352 1.00 22.15  ? 4   LEU A CA    1 
ATOM   754  C  C     . LEU E 3 5   ? 33.984  1.705   -27.574 1.00 22.31  ? 4   LEU A C     1 
ATOM   755  O  O     . LEU E 3 5   ? 34.199  2.868   -27.110 1.00 22.80  ? 4   LEU A O     1 
ATOM   756  C  CB    . LEU E 3 5   ? 36.294  0.714   -27.437 1.00 21.57  ? 4   LEU A CB    1 
ATOM   757  C  CG    . LEU E 3 5   ? 36.076  -0.366  -26.320 1.00 20.99  ? 4   LEU A CG    1 
ATOM   758  C  CD1   . LEU E 3 5   ? 37.365  -1.176  -25.969 1.00 16.06  ? 4   LEU A CD1   1 
ATOM   759  C  CD2   . LEU E 3 5   ? 35.350  0.126   -25.030 1.00 18.44  ? 4   LEU A CD2   1 
ATOM   760  N  N     . PHE E 3 6   ? 32.841  1.017   -27.420 1.00 20.56  ? 5   PHE A N     1 
ATOM   761  C  CA    . PHE E 3 6   ? 31.654  1.584   -26.799 1.00 19.54  ? 5   PHE A CA    1 
ATOM   762  C  C     . PHE E 3 6   ? 31.260  0.874   -25.477 1.00 19.36  ? 5   PHE A C     1 
ATOM   763  O  O     . PHE E 3 6   ? 31.382  -0.336  -25.372 1.00 20.48  ? 5   PHE A O     1 
ATOM   764  C  CB    . PHE E 3 6   ? 30.506  1.514   -27.800 1.00 18.89  ? 5   PHE A CB    1 
ATOM   765  C  CG    . PHE E 3 6   ? 29.171  1.911   -27.223 1.00 19.88  ? 5   PHE A CG    1 
ATOM   766  C  CD1   . PHE E 3 6   ? 28.855  3.246   -27.008 1.00 18.29  ? 5   PHE A CD1   1 
ATOM   767  C  CD2   . PHE E 3 6   ? 28.217  0.929   -26.863 1.00 20.35  ? 5   PHE A CD2   1 
ATOM   768  C  CE1   . PHE E 3 6   ? 27.628  3.593   -26.491 1.00 18.59  ? 5   PHE A CE1   1 
ATOM   769  C  CE2   . PHE E 3 6   ? 26.983  1.279   -26.342 1.00 17.45  ? 5   PHE A CE2   1 
ATOM   770  C  CZ    . PHE E 3 6   ? 26.690  2.594   -26.148 1.00 18.18  ? 5   PHE A CZ    1 
ATOM   771  N  N     . VAL E 3 7   ? 30.752  1.622   -24.496 1.00 18.66  ? 6   VAL A N     1 
ATOM   772  C  CA    . VAL E 3 7   ? 30.545  1.127   -23.116 1.00 17.80  ? 6   VAL A CA    1 
ATOM   773  C  C     . VAL E 3 7   ? 29.196  1.566   -22.645 1.00 17.58  ? 6   VAL A C     1 
ATOM   774  O  O     . VAL E 3 7   ? 28.866  2.751   -22.684 1.00 17.81  ? 6   VAL A O     1 
ATOM   775  C  CB    . VAL E 3 7   ? 31.559  1.716   -22.107 1.00 17.37  ? 6   VAL A CB    1 
ATOM   776  C  CG1   . VAL E 3 7   ? 31.276  1.198   -20.668 1.00 15.59  ? 6   VAL A CG1   1 
ATOM   777  C  CG2   . VAL E 3 7   ? 32.955  1.355   -22.515 1.00 16.99  ? 6   VAL A CG2   1 
ATOM   778  N  N     . ASP E 3 8   ? 28.413  0.615   -22.196 1.00 17.04  ? 7   ASP A N     1 
ATOM   779  C  CA    . ASP E 3 8   ? 27.053  0.929   -21.743 1.00 17.56  ? 7   ASP A CA    1 
ATOM   780  C  C     . ASP E 3 8   ? 26.779  0.186   -20.432 1.00 15.92  ? 7   ASP A C     1 
ATOM   781  O  O     . ASP E 3 8   ? 26.946  -1.017  -20.393 1.00 16.29  ? 7   ASP A O     1 
ATOM   782  C  CB    . ASP E 3 8   ? 26.062  0.486   -22.842 1.00 18.02  ? 7   ASP A CB    1 
ATOM   783  C  CG    . ASP E 3 8   ? 24.619  0.848   -22.543 1.00 19.73  ? 7   ASP A CG    1 
ATOM   784  O  OD1   . ASP E 3 8   ? 23.857  0.068   -21.919 1.00 23.16  ? 7   ASP A OD1   1 
ATOM   785  O  OD2   . ASP E 3 8   ? 24.214  1.919   -23.003 1.00 23.86  ? 7   ASP A OD2   1 
ATOM   786  N  N     . PHE E 3 9   ? 26.387  0.895   -19.382 1.00 14.89  ? 8   PHE A N     1 
ATOM   787  C  CA    . PHE E 3 9   ? 26.180  0.297   -18.081 1.00 14.31  ? 8   PHE A CA    1 
ATOM   788  C  C     . PHE E 3 9   ? 24.854  -0.422  -18.126 1.00 15.39  ? 8   PHE A C     1 
ATOM   789  O  O     . PHE E 3 9   ? 23.902  0.048   -18.732 1.00 17.09  ? 8   PHE A O     1 
ATOM   790  C  CB    . PHE E 3 9   ? 26.205  1.310   -16.950 1.00 14.48  ? 8   PHE A CB    1 
ATOM   791  C  CG    . PHE E 3 9   ? 27.280  2.394   -17.075 1.00 13.81  ? 8   PHE A CG    1 
ATOM   792  C  CD1   . PHE E 3 9   ? 28.459  2.169   -17.697 1.00 13.05  ? 8   PHE A CD1   1 
ATOM   793  C  CD2   . PHE E 3 9   ? 27.069  3.639   -16.527 1.00 14.63  ? 8   PHE A CD2   1 
ATOM   794  C  CE1   . PHE E 3 9   ? 29.386  3.141   -17.789 1.00 14.40  ? 8   PHE A CE1   1 
ATOM   795  C  CE2   . PHE E 3 9   ? 28.034  4.633   -16.608 1.00 13.50  ? 8   PHE A CE2   1 
ATOM   796  C  CZ    . PHE E 3 9   ? 29.166  4.389   -17.238 1.00 13.93  ? 8   PHE A CZ    1 
ATOM   797  N  N     . ASP E 3 10  ? 24.805  -1.617  -17.582 1.00 15.33  ? 9   ASP A N     1 
ATOM   798  C  CA    . ASP E 3 10  ? 23.608  -2.427  -17.759 1.00 16.08  ? 9   ASP A CA    1 
ATOM   799  C  C     . ASP E 3 10  ? 22.625  -1.994  -16.725 1.00 15.29  ? 9   ASP A C     1 
ATOM   800  O  O     . ASP E 3 10  ? 23.022  -1.805  -15.575 1.00 15.47  ? 9   ASP A O     1 
ATOM   801  C  CB    . ASP E 3 10  ? 23.918  -3.921  -17.556 1.00 15.94  ? 9   ASP A CB    1 
ATOM   802  C  CG    . ASP E 3 10  ? 25.023  -4.397  -18.441 1.00 17.97  ? 9   ASP A CG    1 
ATOM   803  O  OD1   . ASP E 3 10  ? 24.821  -4.326  -19.682 1.00 21.63  ? 9   ASP A OD1   1 
ATOM   804  O  OD2   . ASP E 3 10  ? 26.085  -4.822  -17.919 1.00 19.72  ? 9   ASP A OD2   1 
ATOM   805  N  N     . TYR E 3 11  ? 21.357  -1.887  -17.135 1.00 15.26  ? 10  TYR A N     1 
ATOM   806  C  CA    . TYR E 3 11  ? 20.264  -1.460  -16.269 1.00 14.23  ? 10  TYR A CA    1 
ATOM   807  C  C     . TYR E 3 11  ? 20.891  -0.627  -15.188 1.00 13.27  ? 10  TYR A C     1 
ATOM   808  O  O     . TYR E 3 11  ? 21.103  -1.099  -14.071 1.00 14.28  ? 10  TYR A O     1 
ATOM   809  C  CB    . TYR E 3 11  ? 19.550  -2.668  -15.664 1.00 15.12  ? 10  TYR A CB    1 
ATOM   810  C  CG    . TYR E 3 11  ? 20.458  -3.587  -14.878 1.00 18.12  ? 10  TYR A CG    1 
ATOM   811  C  CD1   . TYR E 3 11  ? 20.436  -3.596  -13.490 1.00 18.70  ? 10  TYR A CD1   1 
ATOM   812  C  CD2   . TYR E 3 11  ? 21.336  -4.447  -15.525 1.00 21.16  ? 10  TYR A CD2   1 
ATOM   813  C  CE1   . TYR E 3 11  ? 21.264  -4.434  -12.768 1.00 17.85  ? 10  TYR A CE1   1 
ATOM   814  C  CE2   . TYR E 3 11  ? 22.168  -5.288  -14.812 1.00 22.34  ? 10  TYR A CE2   1 
ATOM   815  C  CZ    . TYR E 3 11  ? 22.128  -5.278  -13.434 1.00 22.68  ? 10  TYR A CZ    1 
ATOM   816  O  OH    . TYR E 3 11  ? 22.954  -6.115  -12.719 1.00 26.98  ? 10  TYR A OH    1 
ATOM   817  N  N     . PHE E 3 12  ? 21.312  0.579   -15.549 1.00 10.90  ? 11  PHE A N     1 
ATOM   818  C  CA    . PHE E 3 12  ? 22.206  1.365   -14.705 1.00 11.39  ? 11  PHE A CA    1 
ATOM   819  C  C     . PHE E 3 12  ? 21.612  1.713   -13.348 1.00 11.93  ? 11  PHE A C     1 
ATOM   820  O  O     . PHE E 3 12  ? 22.139  1.330   -12.303 1.00 11.32  ? 11  PHE A O     1 
ATOM   821  C  CB    . PHE E 3 12  ? 22.633  2.645   -15.429 1.00 11.54  ? 11  PHE A CB    1 
ATOM   822  C  CG    . PHE E 3 12  ? 23.667  3.444   -14.689 1.00 10.55  ? 11  PHE A CG    1 
ATOM   823  C  CD1   . PHE E 3 12  ? 24.679  2.811   -13.987 1.00 11.39  ? 11  PHE A CD1   1 
ATOM   824  C  CD2   . PHE E 3 12  ? 23.628  4.828   -14.696 1.00 7.68   ? 11  PHE A CD2   1 
ATOM   825  C  CE1   . PHE E 3 12  ? 25.632  3.543   -13.305 1.00 11.32  ? 11  PHE A CE1   1 
ATOM   826  C  CE2   . PHE E 3 12  ? 24.578  5.566   -14.016 1.00 7.15   ? 11  PHE A CE2   1 
ATOM   827  C  CZ    . PHE E 3 12  ? 25.581  4.923   -13.320 1.00 10.02  ? 11  PHE A CZ    1 
ATOM   828  N  N     . TYR E 3 13  ? 20.514  2.452   -13.383 1.00 12.35  ? 12  TYR A N     1 
ATOM   829  C  CA    . TYR E 3 13  ? 19.873  2.993   -12.170 1.00 12.13  ? 12  TYR A CA    1 
ATOM   830  C  C     . TYR E 3 13  ? 19.546  1.854   -11.184 1.00 13.50  ? 12  TYR A C     1 
ATOM   831  O  O     . TYR E 3 13  ? 19.792  2.001   -9.964  1.00 14.03  ? 12  TYR A O     1 
ATOM   832  C  CB    . TYR E 3 13  ? 18.634  3.802   -12.498 1.00 10.46  ? 12  TYR A CB    1 
ATOM   833  C  CG    . TYR E 3 13  ? 18.856  5.111   -13.317 1.00 13.94  ? 12  TYR A CG    1 
ATOM   834  C  CD1   . TYR E 3 13  ? 20.142  5.513   -13.760 1.00 14.77  ? 12  TYR A CD1   1 
ATOM   835  C  CD2   . TYR E 3 13  ? 17.766  5.893   -13.713 1.00 13.25  ? 12  TYR A CD2   1 
ATOM   836  C  CE1   . TYR E 3 13  ? 20.322  6.634   -14.498 1.00 15.06  ? 12  TYR A CE1   1 
ATOM   837  C  CE2   . TYR E 3 13  ? 17.926  7.004   -14.420 1.00 15.08  ? 12  TYR A CE2   1 
ATOM   838  C  CZ    . TYR E 3 13  ? 19.197  7.397   -14.833 1.00 18.21  ? 12  TYR A CZ    1 
ATOM   839  O  OH    . TYR E 3 13  ? 19.349  8.552   -15.572 1.00 19.34  ? 12  TYR A OH    1 
ATOM   840  N  N     . ALA E 3 14  ? 19.022  0.733   -11.725 1.00 13.60  ? 13  ALA A N     1 
ATOM   841  C  CA    . ALA E 3 14  ? 18.634  -0.406  -10.940 1.00 13.19  ? 13  ALA A CA    1 
ATOM   842  C  C     . ALA E 3 14  ? 19.909  -1.086  -10.469 1.00 13.34  ? 13  ALA A C     1 
ATOM   843  O  O     . ALA E 3 14  ? 19.970  -1.622  -9.362  1.00 13.20  ? 13  ALA A O     1 
ATOM   844  C  CB    . ALA E 3 14  ? 17.788  -1.375  -11.753 1.00 12.98  ? 13  ALA A CB    1 
ATOM   845  N  N     . GLN E 3 15  ? 20.952  -1.047  -11.281 1.00 13.22  ? 14  GLN A N     1 
ATOM   846  C  CA    . GLN E 3 15  ? 22.148  -1.758  -10.830 1.00 14.01  ? 14  GLN A CA    1 
ATOM   847  C  C     . GLN E 3 15  ? 22.753  -1.046  -9.630  1.00 13.94  ? 14  GLN A C     1 
ATOM   848  O  O     . GLN E 3 15  ? 23.125  -1.692  -8.637  1.00 13.21  ? 14  GLN A O     1 
ATOM   849  C  CB    . GLN E 3 15  ? 23.176  -1.977  -11.928 1.00 14.25  ? 14  GLN A CB    1 
ATOM   850  C  CG    . GLN E 3 15  ? 24.021  -3.205  -11.696 1.00 15.48  ? 14  GLN A CG    1 
ATOM   851  C  CD    . GLN E 3 15  ? 25.109  -3.403  -12.746 1.00 16.89  ? 14  GLN A CD    1 
ATOM   852  O  OE1   . GLN E 3 15  ? 25.004  -2.914  -13.885 1.00 20.77  ? 14  GLN A OE1   1 
ATOM   853  N  NE2   . GLN E 3 15  ? 26.148  -4.117  -12.381 1.00 14.44  ? 14  GLN A NE2   1 
ATOM   854  N  N     . VAL E 3 16  ? 22.845  0.275   -9.724  1.00 14.66  ? 15  VAL A N     1 
ATOM   855  C  CA    . VAL E 3 16  ? 23.313  1.111   -8.566  1.00 15.02  ? 15  VAL A CA    1 
ATOM   856  C  C     . VAL E 3 16  ? 22.482  0.870   -7.309  1.00 15.36  ? 15  VAL A C     1 
ATOM   857  O  O     . VAL E 3 16  ? 23.051  0.611   -6.243  1.00 15.38  ? 15  VAL A O     1 
ATOM   858  C  CB    . VAL E 3 16  ? 23.433  2.640   -8.878  1.00 14.91  ? 15  VAL A CB    1 
ATOM   859  C  CG1   . VAL E 3 16  ? 23.928  3.444   -7.598  1.00 14.67  ? 15  VAL A CG1   1 
ATOM   860  C  CG2   . VAL E 3 16  ? 24.347  2.890   -10.026 1.00 12.10  ? 15  VAL A CG2   1 
ATOM   861  N  N     . GLU E 3 17  ? 21.152  0.848   -7.416  1.00 16.09  ? 16  GLU A N     1 
ATOM   862  C  CA    . GLU E 3 17  ? 20.384  0.455   -6.220  1.00 16.64  ? 16  GLU A CA    1 
ATOM   863  C  C     . GLU E 3 17  ? 20.681  -0.962  -5.710  1.00 16.59  ? 16  GLU A C     1 
ATOM   864  O  O     . GLU E 3 17  ? 20.610  -1.233  -4.512  1.00 16.61  ? 16  GLU A O     1 
ATOM   865  C  CB    . GLU E 3 17  ? 18.894  0.638   -6.399  1.00 17.03  ? 16  GLU A CB    1 
ATOM   866  C  CG    . GLU E 3 17  ? 18.462  2.020   -6.819  1.00 20.82  ? 16  GLU A CG    1 
ATOM   867  C  CD    . GLU E 3 17  ? 18.406  3.038   -5.705  1.00 23.32  ? 16  GLU A CD    1 
ATOM   868  O  OE1   . GLU E 3 17  ? 18.696  2.680   -4.555  1.00 28.43  ? 16  GLU A OE1   1 
ATOM   869  O  OE2   . GLU E 3 17  ? 18.070  4.203   -5.978  1.00 25.33  ? 16  GLU A OE2   1 
ATOM   870  N  N     . GLU E 3 18  ? 21.030  -1.878  -6.609  1.00 17.53  ? 17  GLU A N     1 
ATOM   871  C  CA    . GLU E 3 18  ? 21.413  -3.238  -6.171  1.00 17.75  ? 17  GLU A CA    1 
ATOM   872  C  C     . GLU E 3 18  ? 22.733  -3.311  -5.404  1.00 17.41  ? 17  GLU A C     1 
ATOM   873  O  O     . GLU E 3 18  ? 22.847  -4.016  -4.406  1.00 18.31  ? 17  GLU A O     1 
ATOM   874  C  CB    . GLU E 3 18  ? 21.431  -4.189  -7.342  1.00 18.27  ? 17  GLU A CB    1 
ATOM   875  C  CG    . GLU E 3 18  ? 20.094  -4.892  -7.570  1.00 20.97  ? 17  GLU A CG    1 
ATOM   876  C  CD    . GLU E 3 18  ? 20.228  -6.095  -8.513  1.00 26.47  ? 17  GLU A CD    1 
ATOM   877  O  OE1   . GLU E 3 18  ? 20.406  -5.891  -9.762  1.00 25.81  ? 17  GLU A OE1   1 
ATOM   878  O  OE2   . GLU E 3 18  ? 20.153  -7.253  -7.982  1.00 29.80  ? 17  GLU A OE2   1 
ATOM   879  N  N     . VAL E 3 19  ? 23.715  -2.555  -5.854  1.00 17.28  ? 18  VAL A N     1 
ATOM   880  C  CA    . VAL E 3 19  ? 25.029  -2.558  -5.256  1.00 17.52  ? 18  VAL A CA    1 
ATOM   881  C  C     . VAL E 3 19  ? 24.868  -1.902  -3.904  1.00 19.08  ? 18  VAL A C     1 
ATOM   882  O  O     . VAL E 3 19  ? 25.374  -2.412  -2.927  1.00 19.69  ? 18  VAL A O     1 
ATOM   883  C  CB    . VAL E 3 19  ? 26.083  -1.770  -6.129  1.00 17.00  ? 18  VAL A CB    1 
ATOM   884  C  CG1   . VAL E 3 19  ? 27.276  -1.296  -5.267  1.00 13.99  ? 18  VAL A CG1   1 
ATOM   885  C  CG2   . VAL E 3 19  ? 26.532  -2.595  -7.309  1.00 13.91  ? 18  VAL A CG2   1 
ATOM   886  N  N     . LEU E 3 20  ? 24.130  -0.790  -3.850  1.00 20.09  ? 19  LEU A N     1 
ATOM   887  C  CA    . LEU E 3 20  ? 23.853  -0.118  -2.584  1.00 20.66  ? 19  LEU A CA    1 
ATOM   888  C  C     . LEU E 3 20  ? 23.024  -0.941  -1.658  1.00 21.02  ? 19  LEU A C     1 
ATOM   889  O  O     . LEU E 3 20  ? 23.166  -0.822  -0.444  1.00 21.52  ? 19  LEU A O     1 
ATOM   890  C  CB    . LEU E 3 20  ? 23.170  1.247   -2.808  1.00 21.00  ? 19  LEU A CB    1 
ATOM   891  C  CG    . LEU E 3 20  ? 23.990  2.565   -2.836  1.00 21.23  ? 19  LEU A CG    1 
ATOM   892  C  CD1   . LEU E 3 20  ? 25.522  2.461   -2.872  1.00 22.21  ? 19  LEU A CD1   1 
ATOM   893  C  CD2   . LEU E 3 20  ? 23.531  3.517   -3.909  1.00 19.54  ? 19  LEU A CD2   1 
ATOM   894  N  N     . ASN E 3 21  ? 22.153  -1.787  -2.183  1.00 21.83  ? 20  ASN A N     1 
ATOM   895  C  CA    . ASN E 3 21  ? 21.135  -2.428  -1.282  1.00 23.04  ? 20  ASN A CA    1 
ATOM   896  C  C     . ASN E 3 21  ? 21.197  -3.951  -1.360  1.00 23.96  ? 20  ASN A C     1 
ATOM   897  O  O     . ASN E 3 21  ? 20.360  -4.599  -2.045  1.00 25.14  ? 20  ASN A O     1 
ATOM   898  C  CB    . ASN E 3 21  ? 19.723  -1.904  -1.601  1.00 23.09  ? 20  ASN A CB    1 
ATOM   899  C  CG    . ASN E 3 21  ? 18.779  -1.872  -0.399  1.00 23.35  ? 20  ASN A CG    1 
ATOM   900  O  OD1   . ASN E 3 21  ? 18.900  -2.684  0.508   1.00 24.32  ? 20  ASN A OD1   1 
ATOM   901  N  ND2   . ASN E 3 21  ? 17.775  -0.944  -0.431  1.00 22.79  ? 20  ASN A ND2   1 
ATOM   902  N  N     . PRO E 3 22  ? 22.204  -4.544  -0.690  1.00 24.50  ? 21  PRO A N     1 
ATOM   903  C  CA    . PRO E 3 22  ? 22.409  -6.019  -0.798  1.00 25.12  ? 21  PRO A CA    1 
ATOM   904  C  C     . PRO E 3 22  ? 21.110  -6.870  -0.618  1.00 25.16  ? 21  PRO A C     1 
ATOM   905  O  O     . PRO E 3 22  ? 21.027  -7.936  -1.213  1.00 25.30  ? 21  PRO A O     1 
ATOM   906  C  CB    . PRO E 3 22  ? 23.434  -6.322  0.296   1.00 25.78  ? 21  PRO A CB    1 
ATOM   907  C  CG    . PRO E 3 22  ? 24.096  -4.946  0.614   1.00 25.77  ? 21  PRO A CG    1 
ATOM   908  C  CD    . PRO E 3 22  ? 23.130  -3.881  0.258   1.00 24.29  ? 21  PRO A CD    1 
ATOM   909  N  N     . SER E 3 23  ? 20.130  -6.366  0.157   1.00 25.27  ? 22  SER A N     1 
ATOM   910  C  CA    . SER E 3 23  ? 18.758  -6.936  0.349   1.00 25.58  ? 22  SER A CA    1 
ATOM   911  C  C     . SER E 3 23  ? 17.867  -7.071  -0.927  1.00 26.71  ? 22  SER A C     1 
ATOM   912  O  O     . SER E 3 23  ? 16.805  -7.729  -0.874  1.00 26.70  ? 22  SER A O     1 
ATOM   913  C  CB    . SER E 3 23  ? 17.980  -6.099  1.379   1.00 25.03  ? 22  SER A CB    1 
ATOM   914  O  OG    . SER E 3 23  ? 18.324  -6.411  2.726   1.00 22.43  ? 22  SER A OG    1 
ATOM   915  N  N     . LEU E 3 24  ? 18.301  -6.439  -2.035  1.00 27.34  ? 23  LEU A N     1 
ATOM   916  C  CA    . LEU E 3 24  ? 17.723  -6.583  -3.388  1.00 28.06  ? 23  LEU A CA    1 
ATOM   917  C  C     . LEU E 3 24  ? 18.480  -7.551  -4.333  1.00 29.51  ? 23  LEU A C     1 
ATOM   918  O  O     . LEU E 3 24  ? 18.460  -7.366  -5.571  1.00 29.96  ? 23  LEU A O     1 
ATOM   919  C  CB    . LEU E 3 24  ? 17.655  -5.222  -4.089  1.00 26.79  ? 23  LEU A CB    1 
ATOM   920  C  CG    . LEU E 3 24  ? 17.229  -3.944  -3.341  1.00 26.54  ? 23  LEU A CG    1 
ATOM   921  C  CD1   . LEU E 3 24  ? 17.323  -2.708  -4.271  1.00 23.87  ? 23  LEU A CD1   1 
ATOM   922  C  CD2   . LEU E 3 24  ? 15.810  -4.072  -2.727  1.00 23.69  ? 23  LEU A CD2   1 
ATOM   923  N  N     . LYS E 3 25  ? 19.156  -8.567  -3.794  1.00 30.49  ? 24  LYS A N     1 
ATOM   924  C  CA    . LYS E 3 25  ? 19.875  -9.490  -4.691  1.00 31.46  ? 24  LYS A CA    1 
ATOM   925  C  C     . LYS E 3 25  ? 18.844  -10.474 -5.186  1.00 31.79  ? 24  LYS A C     1 
ATOM   926  O  O     . LYS E 3 25  ? 17.947  -10.848 -4.428  1.00 32.68  ? 24  LYS A O     1 
ATOM   927  C  CB    . LYS E 3 25  ? 20.994  -10.252 -3.960  1.00 32.02  ? 24  LYS A CB    1 
ATOM   928  C  CG    . LYS E 3 25  ? 22.106  -10.916 -4.865  1.00 32.77  ? 24  LYS A CG    1 
ATOM   929  C  CD    . LYS E 3 25  ? 23.320  -10.010 -5.066  1.00 34.91  ? 24  LYS A CD    1 
ATOM   930  C  CE    . LYS E 3 25  ? 23.091  -8.947  -6.163  1.00 35.99  ? 24  LYS A CE    1 
ATOM   931  N  NZ    . LYS E 3 25  ? 24.295  -8.069  -6.331  1.00 37.48  ? 24  LYS A NZ    1 
ATOM   932  N  N     . GLY E 3 26  ? 18.933  -10.898 -6.444  1.00 31.74  ? 25  GLY A N     1 
ATOM   933  C  CA    . GLY E 3 26  ? 17.979  -11.903 -6.929  1.00 31.25  ? 25  GLY A CA    1 
ATOM   934  C  C     . GLY E 3 26  ? 16.789  -11.177 -7.496  1.00 31.27  ? 25  GLY A C     1 
ATOM   935  O  O     . GLY E 3 26  ? 16.754  -10.915 -8.722  1.00 32.12  ? 25  GLY A O     1 
ATOM   936  N  N     . LYS E 3 27  ? 15.806  -10.843 -6.659  1.00 30.18  ? 26  LYS A N     1 
ATOM   937  C  CA    . LYS E 3 27  ? 14.494  -10.313 -7.093  1.00 28.84  ? 26  LYS A CA    1 
ATOM   938  C  C     . LYS E 3 27  ? 14.461  -9.197  -8.161  1.00 27.33  ? 26  LYS A C     1 
ATOM   939  O  O     . LYS E 3 27  ? 15.503  -8.773  -8.663  1.00 27.89  ? 26  LYS A O     1 
ATOM   940  C  CB    . LYS E 3 27  ? 13.679  -9.872  -5.872  1.00 29.17  ? 26  LYS A CB    1 
ATOM   941  C  CG    . LYS E 3 27  ? 14.255  -10.330 -4.543  1.00 29.81  ? 26  LYS A CG    1 
ATOM   942  C  CD    . LYS E 3 27  ? 13.393  -9.868  -3.379  1.00 31.35  ? 26  LYS A CD    1 
ATOM   943  C  CE    . LYS E 3 27  ? 12.694  -11.040 -2.710  1.00 33.41  ? 26  LYS A CE    1 
ATOM   944  N  NZ    . LYS E 3 27  ? 11.362  -10.656 -2.167  1.00 33.10  ? 26  LYS A NZ    1 
ATOM   945  N  N     . PRO E 3 28  ? 13.249  -8.735  -8.495  1.00 25.59  ? 27  PRO A N     1 
ATOM   946  C  CA    . PRO E 3 28  ? 13.044  -7.681  -9.503  1.00 24.29  ? 27  PRO A CA    1 
ATOM   947  C  C     . PRO E 3 28  ? 12.959  -6.259  -8.949  1.00 22.82  ? 27  PRO A C     1 
ATOM   948  O  O     . PRO E 3 28  ? 12.312  -6.043  -7.896  1.00 22.73  ? 27  PRO A O     1 
ATOM   949  C  CB    . PRO E 3 28  ? 11.674  -8.034  -10.113 1.00 24.38  ? 27  PRO A CB    1 
ATOM   950  C  CG    . PRO E 3 28  ? 11.003  -8.859  -9.095  1.00 23.98  ? 27  PRO A CG    1 
ATOM   951  C  CD    . PRO E 3 28  ? 12.067  -9.612  -8.404  1.00 25.55  ? 27  PRO A CD    1 
ATOM   952  N  N     . VAL E 3 29  ? 13.493  -5.304  -9.721  1.00 20.24  ? 28  VAL A N     1 
ATOM   953  C  CA    . VAL E 3 29  ? 13.702  -3.966  -9.256  1.00 19.08  ? 28  VAL A CA    1 
ATOM   954  C  C     . VAL E 3 29  ? 13.339  -2.960  -10.326 1.00 18.76  ? 28  VAL A C     1 
ATOM   955  O  O     . VAL E 3 29  ? 13.896  -3.006  -11.439 1.00 18.61  ? 28  VAL A O     1 
ATOM   956  C  CB    . VAL E 3 29  ? 15.174  -3.743  -8.990  1.00 19.28  ? 28  VAL A CB    1 
ATOM   957  C  CG1   . VAL E 3 29  ? 15.438  -2.263  -8.583  1.00 18.71  ? 28  VAL A CG1   1 
ATOM   958  C  CG2   . VAL E 3 29  ? 15.685  -4.731  -7.916  1.00 19.39  ? 28  VAL A CG2   1 
ATOM   959  N  N     . VAL E 3 30  ? 12.488  -2.004  -9.949  1.00 17.95  ? 29  VAL A N     1 
ATOM   960  C  CA    . VAL E 3 30  ? 11.849  -1.065  -10.854 1.00 18.16  ? 29  VAL A CA    1 
ATOM   961  C  C     . VAL E 3 30  ? 12.114  0.300   -10.275 1.00 19.12  ? 29  VAL A C     1 
ATOM   962  O  O     . VAL E 3 30  ? 11.540  0.630   -9.230  1.00 20.16  ? 29  VAL A O     1 
ATOM   963  C  CB    . VAL E 3 30  ? 10.342  -1.252  -10.794 1.00 17.97  ? 29  VAL A CB    1 
ATOM   964  C  CG1   . VAL E 3 30  ? 9.615   -0.180  -11.519 1.00 16.47  ? 29  VAL A CG1   1 
ATOM   965  C  CG2   . VAL E 3 30  ? 9.952   -2.669  -11.290 1.00 19.22  ? 29  VAL A CG2   1 
ATOM   966  N  N     . VAL E 3 31  ? 12.980  1.096   -10.904 1.00 19.04  ? 30  VAL A N     1 
ATOM   967  C  CA    . VAL E 3 31  ? 13.223  2.457   -10.402 1.00 19.29  ? 30  VAL A CA    1 
ATOM   968  C  C     . VAL E 3 31  ? 12.195  3.401   -11.077 1.00 21.46  ? 30  VAL A C     1 
ATOM   969  O  O     . VAL E 3 31  ? 12.081  3.426   -12.331 1.00 22.88  ? 30  VAL A O     1 
ATOM   970  C  CB    . VAL E 3 31  ? 14.722  2.920   -10.644 1.00 18.17  ? 30  VAL A CB    1 
ATOM   971  C  CG1   . VAL E 3 31  ? 14.960  4.301   -10.149 1.00 17.32  ? 30  VAL A CG1   1 
ATOM   972  C  CG2   . VAL E 3 31  ? 15.727  1.980   -10.014 1.00 15.75  ? 30  VAL A CG2   1 
ATOM   973  N  N     . CYS E 3 32  ? 11.468  4.177   -10.276 1.00 23.09  ? 31  CYS A N     1 
ATOM   974  C  CA    . CYS E 3 32  ? 10.417  5.078   -10.783 1.00 25.63  ? 31  CYS A CA    1 
ATOM   975  C  C     . CYS E 3 32  ? 10.644  6.539   -10.505 1.00 25.69  ? 31  CYS A C     1 
ATOM   976  O  O     . CYS E 3 32  ? 11.277  6.895   -9.517  1.00 26.07  ? 31  CYS A O     1 
ATOM   977  C  CB    . CYS E 3 32  ? 9.074   4.743   -10.145 1.00 26.28  ? 31  CYS A CB    1 
ATOM   978  S  SG    . CYS E 3 32  ? 8.631   3.015   -10.243 1.00 33.64  ? 31  CYS A SG    1 
ATOM   979  N  N     . VAL E 3 33  ? 10.104  7.393   -11.371 1.00 27.03  ? 32  VAL A N     1 
ATOM   980  C  CA    . VAL E 3 33  ? 9.941   8.807   -11.046 1.00 28.66  ? 32  VAL A CA    1 
ATOM   981  C  C     . VAL E 3 33  ? 8.499   8.992   -10.525 1.00 30.29  ? 32  VAL A C     1 
ATOM   982  O  O     . VAL E 3 33  ? 7.547   8.861   -11.294 1.00 30.25  ? 32  VAL A O     1 
ATOM   983  C  CB    . VAL E 3 33  ? 10.157  9.707   -12.283 1.00 28.52  ? 32  VAL A CB    1 
ATOM   984  C  CG1   . VAL E 3 33  ? 10.252  11.125  -11.861 1.00 27.80  ? 32  VAL A CG1   1 
ATOM   985  C  CG2   . VAL E 3 33  ? 11.390  9.300   -13.068 1.00 28.29  ? 32  VAL A CG2   1 
ATOM   986  N  N     . PHE E 3 34  ? 8.335   9.253   -9.225  1.00 32.51  ? 33  PHE A N     1 
ATOM   987  C  CA    . PHE E 3 34  ? 7.006   9.527   -8.643  1.00 35.02  ? 33  PHE A CA    1 
ATOM   988  C  C     . PHE E 3 34  ? 6.591   11.002  -8.903  1.00 37.07  ? 33  PHE A C     1 
ATOM   989  O  O     . PHE E 3 34  ? 7.296   11.918  -8.494  1.00 37.90  ? 33  PHE A O     1 
ATOM   990  C  CB    . PHE E 3 34  ? 6.975   9.202   -7.124  1.00 34.96  ? 33  PHE A CB    1 
ATOM   991  C  CG    . PHE E 3 34  ? 7.162   7.715   -6.775  1.00 35.71  ? 33  PHE A CG    1 
ATOM   992  C  CD1   . PHE E 3 34  ? 6.134   6.790   -6.978  1.00 36.78  ? 33  PHE A CD1   1 
ATOM   993  C  CD2   . PHE E 3 34  ? 8.354   7.260   -6.201  1.00 36.74  ? 33  PHE A CD2   1 
ATOM   994  C  CE1   . PHE E 3 34  ? 6.299   5.417   -6.646  1.00 38.40  ? 33  PHE A CE1   1 
ATOM   995  C  CE2   . PHE E 3 34  ? 8.545   5.901   -5.852  1.00 37.29  ? 33  PHE A CE2   1 
ATOM   996  C  CZ    . PHE E 3 34  ? 7.514   4.971   -6.068  1.00 38.34  ? 33  PHE A CZ    1 
ATOM   997  N  N     . SER E 3 35  ? 5.464   11.213  -9.592  1.00 39.25  ? 34  SER A N     1 
ATOM   998  C  CA    . SER E 3 35  ? 4.837   12.543  -9.853  1.00 41.06  ? 34  SER A CA    1 
ATOM   999  C  C     . SER E 3 35  ? 4.673   13.516  -8.665  1.00 42.58  ? 34  SER A C     1 
ATOM   1000 O  O     . SER E 3 35  ? 4.845   14.732  -8.826  1.00 42.78  ? 34  SER A O     1 
ATOM   1001 C  CB    . SER E 3 35  ? 3.449   12.328  -10.520 1.00 41.23  ? 34  SER A CB    1 
ATOM   1002 O  OG    . SER E 3 35  ? 2.646   13.503  -10.595 1.00 40.23  ? 34  SER A OG    1 
ATOM   1003 N  N     . GLY E 3 36  ? 4.307   12.994  -7.490  1.00 44.21  ? 35  GLY A N     1 
ATOM   1004 C  CA    . GLY E 3 36  ? 3.976   13.843  -6.350  1.00 45.44  ? 35  GLY A CA    1 
ATOM   1005 C  C     . GLY E 3 36  ? 2.485   14.074  -6.268  1.00 46.97  ? 35  GLY A C     1 
ATOM   1006 O  O     . GLY E 3 36  ? 1.993   14.627  -5.269  1.00 47.45  ? 35  GLY A O     1 
ATOM   1007 N  N     . ARG E 3 37  ? 1.761   13.604  -7.282  1.00 47.86  ? 36  ARG A N     1 
ATOM   1008 C  CA    . ARG E 3 37  ? 0.303   13.712  -7.327  1.00 48.71  ? 36  ARG A CA    1 
ATOM   1009 C  C     . ARG E 3 37  ? -0.400  12.619  -6.518  1.00 48.90  ? 36  ARG A C     1 
ATOM   1010 O  O     . ARG E 3 37  ? -0.280  12.572  -5.293  1.00 48.83  ? 36  ARG A O     1 
ATOM   1011 C  CB    . ARG E 3 37  ? -0.189  13.689  -8.776  1.00 49.05  ? 36  ARG A CB    1 
ATOM   1012 C  CG    . ARG E 3 37  ? -1.505  14.416  -8.996  1.00 49.68  ? 36  ARG A CG    1 
ATOM   1013 C  CD    . ARG E 3 37  ? -1.697  14.782  -10.459 1.00 50.01  ? 36  ARG A CD    1 
ATOM   1014 N  NE    . ARG E 3 37  ? -1.448  16.199  -10.706 1.00 48.27  ? 36  ARG A NE    1 
ATOM   1015 C  CZ    . ARG E 3 37  ? -2.096  16.924  -11.611 1.00 45.74  ? 36  ARG A CZ    1 
ATOM   1016 N  NH1   . ARG E 3 37  ? -3.038  16.367  -12.360 1.00 44.14  ? 36  ARG A NH1   1 
ATOM   1017 N  NH2   . ARG E 3 37  ? -1.804  18.208  -11.768 1.00 44.16  ? 36  ARG A NH2   1 
ATOM   1018 N  N     . PHE E 3 38  ? -1.148  11.760  -7.207  1.00 49.26  ? 37  PHE A N     1 
ATOM   1019 C  CA    . PHE E 3 38  ? -1.931  10.708  -6.558  1.00 49.47  ? 37  PHE A CA    1 
ATOM   1020 C  C     . PHE E 3 38  ? -1.060  9.536   -6.115  1.00 49.55  ? 37  PHE A C     1 
ATOM   1021 O  O     . PHE E 3 38  ? 0.160   9.668   -6.014  1.00 49.66  ? 37  PHE A O     1 
ATOM   1022 C  CB    . PHE E 3 38  ? -3.041  10.215  -7.488  1.00 49.52  ? 37  PHE A CB    1 
ATOM   1023 C  CG    . PHE E 3 38  ? -2.653  10.198  -8.939  1.00 49.58  ? 37  PHE A CG    1 
ATOM   1024 C  CD1   . PHE E 3 38  ? -2.308  9.012   -9.564  1.00 48.88  ? 37  PHE A CD1   1 
ATOM   1025 C  CD2   . PHE E 3 38  ? -2.634  11.369  -9.678  1.00 50.07  ? 37  PHE A CD2   1 
ATOM   1026 C  CE1   . PHE E 3 38  ? -1.951  8.993   -10.899 1.00 49.15  ? 37  PHE A CE1   1 
ATOM   1027 C  CE2   . PHE E 3 38  ? -2.277  11.357  -11.013 1.00 49.17  ? 37  PHE A CE2   1 
ATOM   1028 C  CZ    . PHE E 3 38  ? -1.935  10.167  -11.624 1.00 49.15  ? 37  PHE A CZ    1 
ATOM   1029 N  N     . GLU E 3 39  ? -1.684  8.390   -5.848  1.00 49.41  ? 38  GLU A N     1 
ATOM   1030 C  CA    . GLU E 3 39  ? -0.934  7.235   -5.404  1.00 49.11  ? 38  GLU A CA    1 
ATOM   1031 C  C     . GLU E 3 39  ? -0.360  6.554   -6.650  1.00 48.47  ? 38  GLU A C     1 
ATOM   1032 O  O     . GLU E 3 39  ? -1.093  6.275   -7.616  1.00 48.44  ? 38  GLU A O     1 
ATOM   1033 C  CB    . GLU E 3 39  ? -1.803  6.284   -4.575  1.00 49.49  ? 38  GLU A CB    1 
ATOM   1034 C  CG    . GLU E 3 39  ? -1.008  5.443   -3.540  1.00 50.93  ? 38  GLU A CG    1 
ATOM   1035 C  CD    . GLU E 3 39  ? -0.898  6.128   -2.172  1.00 52.54  ? 38  GLU A CD    1 
ATOM   1036 O  OE1   . GLU E 3 39  ? -0.385  7.273   -2.113  1.00 53.02  ? 38  GLU A OE1   1 
ATOM   1037 O  OE2   . GLU E 3 39  ? -1.330  5.523   -1.156  1.00 53.10  ? 38  GLU A OE2   1 
ATOM   1038 N  N     . ASP E 3 40  ? 0.960   6.318   -6.628  1.00 47.15  ? 39  ASP A N     1 
ATOM   1039 C  CA    . ASP E 3 40  ? 1.698   5.744   -7.763  1.00 45.50  ? 39  ASP A CA    1 
ATOM   1040 C  C     . ASP E 3 40  ? 1.472   6.526   -9.089  1.00 44.18  ? 39  ASP A C     1 
ATOM   1041 O  O     . ASP E 3 40  ? 1.469   5.942   -10.196 1.00 44.21  ? 39  ASP A O     1 
ATOM   1042 C  CB    . ASP E 3 40  ? 1.426   4.236   -7.907  1.00 45.74  ? 39  ASP A CB    1 
ATOM   1043 C  CG    . ASP E 3 40  ? 1.615   3.452   -6.579  1.00 46.88  ? 39  ASP A CG    1 
ATOM   1044 O  OD1   . ASP E 3 40  ? 1.729   4.053   -5.484  1.00 48.00  ? 39  ASP A OD1   1 
ATOM   1045 O  OD2   . ASP E 3 40  ? 1.619   2.208   -6.627  1.00 47.61  ? 39  ASP A OD2   1 
ATOM   1046 N  N     . SER E 3 41  ? 1.275   7.844   -8.979  1.00 41.89  ? 40  SER A N     1 
ATOM   1047 C  CA    . SER E 3 41  ? 1.303   8.655   -10.182 1.00 40.30  ? 40  SER A CA    1 
ATOM   1048 C  C     . SER E 3 41  ? 2.755   8.727   -10.623 1.00 38.65  ? 40  SER A C     1 
ATOM   1049 O  O     . SER E 3 41  ? 3.654   9.025   -9.807  1.00 38.92  ? 40  SER A O     1 
ATOM   1050 C  CB    . SER E 3 41  ? 0.695   10.059  -9.996  1.00 40.73  ? 40  SER A CB    1 
ATOM   1051 O  OG    . SER E 3 41  ? 1.058   10.685  -8.781  1.00 42.41  ? 40  SER A OG    1 
ATOM   1052 N  N     . GLY E 3 42  ? 3.001   8.398   -11.886 1.00 35.89  ? 41  GLY A N     1 
ATOM   1053 C  CA    . GLY E 3 42  ? 4.358   8.510   -12.385 1.00 33.29  ? 41  GLY A CA    1 
ATOM   1054 C  C     . GLY E 3 42  ? 4.753   7.620   -13.533 1.00 31.01  ? 41  GLY A C     1 
ATOM   1055 O  O     . GLY E 3 42  ? 3.899   7.049   -14.201 1.00 31.12  ? 41  GLY A O     1 
ATOM   1056 N  N     . ALA E 3 43  ? 6.062   7.514   -13.749 1.00 28.78  ? 42  ALA A N     1 
ATOM   1057 C  CA    . ALA E 3 43  ? 6.616   6.645   -14.782 1.00 27.00  ? 42  ALA A CA    1 
ATOM   1058 C  C     . ALA E 3 43  ? 7.867   5.873   -14.319 1.00 25.45  ? 42  ALA A C     1 
ATOM   1059 O  O     . ALA E 3 43  ? 8.480   6.213   -13.317 1.00 25.70  ? 42  ALA A O     1 
ATOM   1060 C  CB    . ALA E 3 43  ? 6.931   7.459   -16.045 1.00 26.77  ? 42  ALA A CB    1 
ATOM   1061 N  N     . VAL E 3 44  ? 8.265   4.880   -15.115 1.00 23.15  ? 43  VAL A N     1 
ATOM   1062 C  CA    . VAL E 3 44  ? 9.390   4.034   -14.848 1.00 20.34  ? 43  VAL A CA    1 
ATOM   1063 C  C     . VAL E 3 44  ? 10.614  4.482   -15.626 1.00 19.73  ? 43  VAL A C     1 
ATOM   1064 O  O     . VAL E 3 44  ? 10.558  4.848   -16.820 1.00 18.96  ? 43  VAL A O     1 
ATOM   1065 C  CB    . VAL E 3 44  ? 9.004   2.631   -15.212 1.00 20.23  ? 43  VAL A CB    1 
ATOM   1066 C  CG1   . VAL E 3 44  ? 10.201  1.678   -15.171 1.00 20.79  ? 43  VAL A CG1   1 
ATOM   1067 C  CG2   . VAL E 3 44  ? 7.906   2.149   -14.232 1.00 20.11  ? 43  VAL A CG2   1 
ATOM   1068 N  N     . ALA E 3 45  ? 11.753  4.446   -14.960 1.00 18.86  ? 44  ALA A N     1 
ATOM   1069 C  CA    . ALA E 3 45  ? 12.920  4.952   -15.608 1.00 17.95  ? 44  ALA A CA    1 
ATOM   1070 C  C     . ALA E 3 45  ? 13.831  3.802   -16.009 1.00 18.10  ? 44  ALA A C     1 
ATOM   1071 O  O     . ALA E 3 45  ? 14.580  3.905   -16.970 1.00 19.56  ? 44  ALA A O     1 
ATOM   1072 C  CB    . ALA E 3 45  ? 13.608  5.963   -14.700 1.00 17.82  ? 44  ALA A CB    1 
ATOM   1073 N  N     . THR E 3 46  ? 13.746  2.680   -15.294 1.00 17.78  ? 45  THR A N     1 
ATOM   1074 C  CA    . THR E 3 46  ? 14.506  1.488   -15.644 1.00 16.66  ? 45  THR A CA    1 
ATOM   1075 C  C     . THR E 3 46  ? 14.162  0.312   -14.733 1.00 16.01  ? 45  THR A C     1 
ATOM   1076 O  O     . THR E 3 46  ? 13.551  0.455   -13.685 1.00 17.04  ? 45  THR A O     1 
ATOM   1077 C  CB    . THR E 3 46  ? 16.024  1.831   -15.807 1.00 17.06  ? 45  THR A CB    1 
ATOM   1078 O  OG1   . THR E 3 46  ? 16.836  0.671   -15.731 1.00 19.33  ? 45  THR A OG1   1 
ATOM   1079 C  CG2   . THR E 3 46  ? 16.490  2.779   -14.799 1.00 18.18  ? 45  THR A CG2   1 
ATOM   1080 N  N     . ALA E 3 47  ? 14.477  -0.876  -15.182 1.00 15.42  ? 46  ALA A N     1 
ATOM   1081 C  CA    . ALA E 3 47  ? 14.140  -2.083  -14.473 1.00 15.31  ? 46  ALA A CA    1 
ATOM   1082 C  C     . ALA E 3 47  ? 15.328  -3.010  -14.684 1.00 15.72  ? 46  ALA A C     1 
ATOM   1083 O  O     . ALA E 3 47  ? 16.047  -2.897  -15.727 1.00 14.82  ? 46  ALA A O     1 
ATOM   1084 C  CB    . ALA E 3 47  ? 12.923  -2.687  -15.092 1.00 16.16  ? 46  ALA A CB    1 
ATOM   1085 N  N     . ASN E 3 48  ? 15.586  -3.904  -13.727 1.00 15.31  ? 47  ASN A N     1 
ATOM   1086 C  CA    . ASN E 3 48  ? 16.691  -4.816  -13.961 1.00 15.89  ? 47  ASN A CA    1 
ATOM   1087 C  C     . ASN E 3 48  ? 16.217  -5.885  -14.915 1.00 17.56  ? 47  ASN A C     1 
ATOM   1088 O  O     . ASN E 3 48  ? 14.997  -5.947  -15.202 1.00 18.17  ? 47  ASN A O     1 
ATOM   1089 C  CB    . ASN E 3 48  ? 17.321  -5.356  -12.671 1.00 15.37  ? 47  ASN A CB    1 
ATOM   1090 C  CG    . ASN E 3 48  ? 16.353  -6.108  -11.770 1.00 15.99  ? 47  ASN A CG    1 
ATOM   1091 O  OD1   . ASN E 3 48  ? 15.184  -6.360  -12.120 1.00 18.07  ? 47  ASN A OD1   1 
ATOM   1092 N  ND2   . ASN E 3 48  ? 16.859  -6.526  -10.604 1.00 14.76  ? 47  ASN A ND2   1 
ATOM   1093 N  N     . TYR E 3 49  ? 17.145  -6.699  -15.442 1.00 19.01  ? 48  TYR A N     1 
ATOM   1094 C  CA    . TYR E 3 49  ? 16.766  -7.835  -16.341 1.00 20.38  ? 48  TYR A CA    1 
ATOM   1095 C  C     . TYR E 3 49  ? 15.611  -8.709  -15.824 1.00 20.87  ? 48  TYR A C     1 
ATOM   1096 O  O     . TYR E 3 49  ? 14.662  -9.043  -16.579 1.00 21.68  ? 48  TYR A O     1 
ATOM   1097 C  CB    . TYR E 3 49  ? 18.009  -8.608  -16.883 1.00 20.71  ? 48  TYR A CB    1 
ATOM   1098 C  CG    . TYR E 3 49  ? 18.611  -7.783  -18.023 1.00 22.00  ? 48  TYR A CG    1 
ATOM   1099 C  CD1   . TYR E 3 49  ? 19.240  -6.590  -17.738 1.00 22.85  ? 48  TYR A CD1   1 
ATOM   1100 C  CD2   . TYR E 3 49  ? 18.405  -8.121  -19.390 1.00 22.65  ? 48  TYR A CD2   1 
ATOM   1101 C  CE1   . TYR E 3 49  ? 19.729  -5.784  -18.717 1.00 23.82  ? 48  TYR A CE1   1 
ATOM   1102 C  CE2   . TYR E 3 49  ? 18.895  -7.300  -20.408 1.00 22.65  ? 48  TYR A CE2   1 
ATOM   1103 C  CZ    . TYR E 3 49  ? 19.580  -6.107  -20.040 1.00 23.92  ? 48  TYR A CZ    1 
ATOM   1104 O  OH    . TYR E 3 49  ? 20.127  -5.182  -20.947 1.00 22.44  ? 48  TYR A OH    1 
ATOM   1105 N  N     . GLU E 3 50  ? 15.654  -9.011  -14.524 1.00 20.72  ? 49  GLU A N     1 
ATOM   1106 C  CA    . GLU E 3 50  ? 14.582  -9.740  -13.849 1.00 20.71  ? 49  GLU A CA    1 
ATOM   1107 C  C     . GLU E 3 50  ? 13.224  -9.003  -13.963 1.00 20.47  ? 49  GLU A C     1 
ATOM   1108 O  O     . GLU E 3 50  ? 12.197  -9.606  -14.112 1.00 20.61  ? 49  GLU A O     1 
ATOM   1109 C  CB    . GLU E 3 50  ? 14.986  -9.944  -12.388 1.00 20.85  ? 49  GLU A CB    1 
ATOM   1110 C  CG    . GLU E 3 50  ? 14.037  -10.701 -11.570 1.00 23.45  ? 49  GLU A CG    1 
ATOM   1111 C  CD    . GLU E 3 50  ? 14.258  -12.201 -11.695 1.00 28.08  ? 49  GLU A CD    1 
ATOM   1112 O  OE1   . GLU E 3 50  ? 13.614  -12.986 -10.921 1.00 27.58  ? 49  GLU A OE1   1 
ATOM   1113 O  OE2   . GLU E 3 50  ? 15.098  -12.587 -12.573 1.00 31.34  ? 49  GLU A OE2   1 
ATOM   1114 N  N     . ALA E 3 51  ? 13.209  -7.683  -13.879 1.00 20.52  ? 50  ALA A N     1 
ATOM   1115 C  CA    . ALA E 3 51  ? 11.936  -6.991  -14.028 1.00 19.70  ? 50  ALA A CA    1 
ATOM   1116 C  C     . ALA E 3 51  ? 11.486  -7.000  -15.491 1.00 19.89  ? 50  ALA A C     1 
ATOM   1117 O  O     . ALA E 3 51  ? 10.299  -6.952  -15.746 1.00 20.80  ? 50  ALA A O     1 
ATOM   1118 C  CB    . ALA E 3 51  ? 12.016  -5.566  -13.471 1.00 18.06  ? 50  ALA A CB    1 
ATOM   1119 N  N     . ARG E 3 52  ? 12.432  -7.051  -16.442 1.00 20.08  ? 51  ARG A N     1 
ATOM   1120 C  CA    . ARG E 3 52  ? 12.149  -6.733  -17.851 1.00 19.83  ? 51  ARG A CA    1 
ATOM   1121 C  C     . ARG E 3 52  ? 11.625  -7.913  -18.639 1.00 19.72  ? 51  ARG A C     1 
ATOM   1122 O  O     . ARG E 3 52  ? 11.023  -7.732  -19.698 1.00 19.22  ? 51  ARG A O     1 
ATOM   1123 C  CB    . ARG E 3 52  ? 13.403  -6.252  -18.574 1.00 20.14  ? 51  ARG A CB    1 
ATOM   1124 C  CG    . ARG E 3 52  ? 13.893  -4.840  -18.295 1.00 21.47  ? 51  ARG A CG    1 
ATOM   1125 C  CD    . ARG E 3 52  ? 15.128  -4.620  -19.186 1.00 21.49  ? 51  ARG A CD    1 
ATOM   1126 N  NE    . ARG E 3 52  ? 16.016  -3.575  -18.698 1.00 21.65  ? 51  ARG A NE    1 
ATOM   1127 C  CZ    . ARG E 3 52  ? 17.100  -3.127  -19.358 1.00 20.37  ? 51  ARG A CZ    1 
ATOM   1128 N  NH1   . ARG E 3 52  ? 17.479  -3.646  -20.538 1.00 20.32  ? 51  ARG A NH1   1 
ATOM   1129 N  NH2   . ARG E 3 52  ? 17.812  -2.151  -18.821 1.00 17.67  ? 51  ARG A NH2   1 
ATOM   1130 N  N     . LYS E 3 53  ? 11.937  -9.116  -18.156 1.00 20.04  ? 52  LYS A N     1 
ATOM   1131 C  CA    . LYS E 3 53  ? 11.365  -10.336 -18.660 1.00 20.22  ? 52  LYS A CA    1 
ATOM   1132 C  C     . LYS E 3 53  ? 9.861   -10.290 -18.593 1.00 20.48  ? 52  LYS A C     1 
ATOM   1133 O  O     . LYS E 3 53  ? 9.208   -11.042 -19.293 1.00 21.05  ? 52  LYS A O     1 
ATOM   1134 C  CB    . LYS E 3 53  ? 11.844  -11.529 -17.853 1.00 20.65  ? 52  LYS A CB    1 
ATOM   1135 C  CG    . LYS E 3 53  ? 13.319  -11.871 -18.034 1.00 22.95  ? 52  LYS A CG    1 
ATOM   1136 C  CD    . LYS E 3 53  ? 13.786  -13.126 -17.221 1.00 24.44  ? 52  LYS A CD    1 
ATOM   1137 C  CE    . LYS E 3 53  ? 13.297  -13.086 -15.766 1.00 23.61  ? 52  LYS A CE    1 
ATOM   1138 N  NZ    . LYS E 3 53  ? 13.787  -14.230 -14.957 1.00 24.82  ? 52  LYS A NZ    1 
ATOM   1139 N  N     . PHE E 3 54  ? 9.299   -9.422  -17.757 1.00 21.07  ? 53  PHE A N     1 
ATOM   1140 C  CA    . PHE E 3 54  ? 7.839   -9.411  -17.577 1.00 21.41  ? 53  PHE A CA    1 
ATOM   1141 C  C     . PHE E 3 54  ? 7.195   -8.207  -18.158 1.00 21.68  ? 53  PHE A C     1 
ATOM   1142 O  O     . PHE E 3 54  ? 6.029   -7.936  -17.871 1.00 22.35  ? 53  PHE A O     1 
ATOM   1143 C  CB    . PHE E 3 54  ? 7.439   -9.514  -16.096 1.00 21.75  ? 53  PHE A CB    1 
ATOM   1144 C  CG    . PHE E 3 54  ? 7.736   -10.845 -15.494 1.00 20.12  ? 53  PHE A CG    1 
ATOM   1145 C  CD1   . PHE E 3 54  ? 6.915   -11.941 -15.762 1.00 20.24  ? 53  PHE A CD1   1 
ATOM   1146 C  CD2   . PHE E 3 54  ? 8.848   -10.992 -14.673 1.00 18.84  ? 53  PHE A CD2   1 
ATOM   1147 C  CE1   . PHE E 3 54  ? 7.177   -13.188 -15.202 1.00 20.88  ? 53  PHE A CE1   1 
ATOM   1148 C  CE2   . PHE E 3 54  ? 9.140   -12.195 -14.106 1.00 21.16  ? 53  PHE A CE2   1 
ATOM   1149 C  CZ    . PHE E 3 54  ? 8.303   -13.335 -14.370 1.00 22.83  ? 53  PHE A CZ    1 
ATOM   1150 N  N     . GLY E 3 55  ? 7.931   -7.482  -18.983 1.00 21.69  ? 54  GLY A N     1 
ATOM   1151 C  CA    . GLY E 3 55  ? 7.341   -6.373  -19.679 1.00 22.17  ? 54  GLY A CA    1 
ATOM   1152 C  C     . GLY E 3 55  ? 7.601   -5.063  -18.992 1.00 22.89  ? 54  GLY A C     1 
ATOM   1153 O  O     . GLY E 3 55  ? 7.623   -4.033  -19.657 1.00 23.35  ? 54  GLY A O     1 
ATOM   1154 N  N     . VAL E 3 56  ? 7.763   -5.067  -17.673 1.00 23.32  ? 55  VAL A N     1 
ATOM   1155 C  CA    . VAL E 3 56  ? 8.012   -3.821  -16.955 1.00 23.84  ? 55  VAL A CA    1 
ATOM   1156 C  C     . VAL E 3 56  ? 9.191   -3.099  -17.599 1.00 24.72  ? 55  VAL A C     1 
ATOM   1157 O  O     . VAL E 3 56  ? 10.321  -3.583  -17.538 1.00 25.26  ? 55  VAL A O     1 
ATOM   1158 C  CB    . VAL E 3 56  ? 8.320   -4.074  -15.469 1.00 23.22  ? 55  VAL A CB    1 
ATOM   1159 C  CG1   . VAL E 3 56  ? 9.191   -2.959  -14.911 1.00 22.01  ? 55  VAL A CG1   1 
ATOM   1160 C  CG2   . VAL E 3 56  ? 7.029   -4.200  -14.675 1.00 22.50  ? 55  VAL A CG2   1 
ATOM   1161 N  N     . LYS E 3 57  ? 8.937   -1.952  -18.225 1.00 25.48  ? 56  LYS A N     1 
ATOM   1162 C  CA    . LYS E 3 57  ? 10.009  -1.280  -18.970 1.00 25.95  ? 56  LYS A CA    1 
ATOM   1163 C  C     . LYS E 3 57  ? 10.070  0.225   -18.820 1.00 25.05  ? 56  LYS A C     1 
ATOM   1164 O  O     . LYS E 3 57  ? 9.171   0.837   -18.317 1.00 25.01  ? 56  LYS A O     1 
ATOM   1165 C  CB    . LYS E 3 57  ? 10.024  -1.720  -20.434 1.00 27.18  ? 56  LYS A CB    1 
ATOM   1166 C  CG    . LYS E 3 57  ? 8.871   -1.226  -21.327 1.00 29.88  ? 56  LYS A CG    1 
ATOM   1167 C  CD    . LYS E 3 57  ? 8.852   -2.041  -22.645 1.00 34.10  ? 56  LYS A CD    1 
ATOM   1168 C  CE    . LYS E 3 57  ? 8.094   -1.329  -23.767 1.00 38.27  ? 56  LYS A CE    1 
ATOM   1169 N  NZ    . LYS E 3 57  ? 7.996   -2.196  -25.007 1.00 41.45  ? 56  LYS A NZ    1 
ATOM   1170 N  N     . ALA E 3 58  ? 11.208  0.791   -19.166 1.00 25.27  ? 57  ALA A N     1 
ATOM   1171 C  CA    . ALA E 3 58  ? 11.386  2.236   -19.180 1.00 24.90  ? 57  ALA A CA    1 
ATOM   1172 C  C     . ALA E 3 58  ? 10.264  2.886   -19.961 1.00 24.96  ? 57  ALA A C     1 
ATOM   1173 O  O     . ALA E 3 58  ? 10.050  2.556   -21.132 1.00 25.18  ? 57  ALA A O     1 
ATOM   1174 C  CB    . ALA E 3 58  ? 12.727  2.597   -19.796 1.00 24.15  ? 57  ALA A CB    1 
ATOM   1175 N  N     . GLY E 3 59  ? 9.548   3.797   -19.304 1.00 25.04  ? 58  GLY A N     1 
ATOM   1176 C  CA    . GLY E 3 59  ? 8.590   4.655   -19.980 1.00 25.57  ? 58  GLY A CA    1 
ATOM   1177 C  C     . GLY E 3 59  ? 7.139   4.365   -19.664 1.00 26.33  ? 58  GLY A C     1 
ATOM   1178 O  O     . GLY E 3 59  ? 6.322   5.278   -19.652 1.00 27.79  ? 58  GLY A O     1 
ATOM   1179 N  N     . ILE E 3 60  ? 6.797   3.113   -19.388 1.00 25.82  ? 59  ILE A N     1 
ATOM   1180 C  CA    . ILE E 3 60  ? 5.416   2.797   -19.043 1.00 25.42  ? 59  ILE A CA    1 
ATOM   1181 C  C     . ILE E 3 60  ? 5.040   3.431   -17.695 1.00 25.66  ? 59  ILE A C     1 
ATOM   1182 O  O     . ILE E 3 60  ? 5.923   3.668   -16.868 1.00 25.24  ? 59  ILE A O     1 
ATOM   1183 C  CB    . ILE E 3 60  ? 5.149   1.253   -19.039 1.00 25.23  ? 59  ILE A CB    1 
ATOM   1184 C  CG1   . ILE E 3 60  ? 5.854   0.571   -17.837 1.00 24.75  ? 59  ILE A CG1   1 
ATOM   1185 C  CG2   . ILE E 3 60  ? 5.516   0.649   -20.419 1.00 24.10  ? 59  ILE A CG2   1 
ATOM   1186 C  CD1   . ILE E 3 60  ? 5.386   -0.896  -17.514 1.00 25.35  ? 59  ILE A CD1   1 
ATOM   1187 N  N     . PRO E 3 61  ? 3.730   3.712   -17.482 1.00 26.19  ? 60  PRO A N     1 
ATOM   1188 C  CA    . PRO E 3 61  ? 3.195   4.210   -16.195 1.00 26.62  ? 60  PRO A CA    1 
ATOM   1189 C  C     . PRO E 3 61  ? 3.438   3.259   -15.011 1.00 27.09  ? 60  PRO A C     1 
ATOM   1190 O  O     . PRO E 3 61  ? 3.452   2.046   -15.199 1.00 28.00  ? 60  PRO A O     1 
ATOM   1191 C  CB    . PRO E 3 61  ? 1.680   4.328   -16.472 1.00 26.53  ? 60  PRO A CB    1 
ATOM   1192 C  CG    . PRO E 3 61  ? 1.435   3.543   -17.717 1.00 26.11  ? 60  PRO A CG    1 
ATOM   1193 C  CD    . PRO E 3 61  ? 2.676   3.701   -18.522 1.00 25.61  ? 60  PRO A CD    1 
ATOM   1194 N  N     . ILE E 3 62  ? 3.610   3.794   -13.805 1.00 27.48  ? 61  ILE A N     1 
ATOM   1195 C  CA    . ILE E 3 62  ? 3.970   2.953   -12.643 1.00 27.77  ? 61  ILE A CA    1 
ATOM   1196 C  C     . ILE E 3 62  ? 2.821   2.080   -12.293 1.00 28.58  ? 61  ILE A C     1 
ATOM   1197 O  O     . ILE E 3 62  ? 3.024   0.917   -11.944 1.00 29.41  ? 61  ILE A O     1 
ATOM   1198 C  CB    . ILE E 3 62  ? 4.247   3.746   -11.346 1.00 27.29  ? 61  ILE A CB    1 
ATOM   1199 C  CG1   . ILE E 3 62  ? 5.306   4.816   -11.555 1.00 26.53  ? 61  ILE A CG1   1 
ATOM   1200 C  CG2   . ILE E 3 62  ? 4.642   2.783   -10.221 1.00 26.70  ? 61  ILE A CG2   1 
ATOM   1201 C  CD1   . ILE E 3 62  ? 5.505   5.740   -10.299 1.00 26.37  ? 61  ILE A CD1   1 
ATOM   1202 N  N     . VAL E 3 63  ? 1.626   2.675   -12.312 1.00 29.16  ? 62  VAL A N     1 
ATOM   1203 C  CA    . VAL E 3 63  ? 0.365   1.930   -12.248 1.00 30.19  ? 62  VAL A CA    1 
ATOM   1204 C  C     . VAL E 3 63  ? 0.365   0.650   -13.117 1.00 30.37  ? 62  VAL A C     1 
ATOM   1205 O  O     . VAL E 3 63  ? 0.048   -0.427  -12.604 1.00 30.49  ? 62  VAL A O     1 
ATOM   1206 C  CB    . VAL E 3 63  ? -0.851  2.806   -12.632 1.00 30.24  ? 62  VAL A CB    1 
ATOM   1207 C  CG1   . VAL E 3 63  ? -2.170  2.091   -12.229 1.00 30.45  ? 62  VAL A CG1   1 
ATOM   1208 C  CG2   . VAL E 3 63  ? -0.762  4.167   -11.973 1.00 31.17  ? 62  VAL A CG2   1 
ATOM   1209 N  N     . GLU E 3 64  ? 0.723   0.767   -14.407 1.00 30.52  ? 63  GLU A N     1 
ATOM   1210 C  CA    . GLU E 3 64  ? 0.851   -0.419  -15.290 1.00 31.01  ? 63  GLU A CA    1 
ATOM   1211 C  C     . GLU E 3 64  ? 1.903   -1.419  -14.791 1.00 30.64  ? 63  GLU A C     1 
ATOM   1212 O  O     . GLU E 3 64  ? 1.676   -2.639  -14.837 1.00 30.65  ? 63  GLU A O     1 
ATOM   1213 C  CB    . GLU E 3 64  ? 1.238   -0.048  -16.732 1.00 31.72  ? 63  GLU A CB    1 
ATOM   1214 C  CG    . GLU E 3 64  ? 0.101   0.182   -17.747 1.00 34.44  ? 63  GLU A CG    1 
ATOM   1215 C  CD    . GLU E 3 64  ? -0.994  -0.885  -17.737 1.00 36.23  ? 63  GLU A CD    1 
ATOM   1216 O  OE1   . GLU E 3 64  ? -2.109  -0.541  -18.212 1.00 37.28  ? 63  GLU A OE1   1 
ATOM   1217 O  OE2   . GLU E 3 64  ? -0.753  -2.037  -17.257 1.00 36.94  ? 63  GLU A OE2   1 
ATOM   1218 N  N     . ALA E 3 65  ? 3.053   -0.889  -14.343 1.00 29.69  ? 64  ALA A N     1 
ATOM   1219 C  CA    . ALA E 3 65  ? 4.157   -1.691  -13.818 1.00 28.67  ? 64  ALA A CA    1 
ATOM   1220 C  C     . ALA E 3 65  ? 3.637   -2.619  -12.759 1.00 28.01  ? 64  ALA A C     1 
ATOM   1221 O  O     . ALA E 3 65  ? 3.822   -3.839  -12.856 1.00 27.53  ? 64  ALA A O     1 
ATOM   1222 C  CB    . ALA E 3 65  ? 5.252   -0.801  -13.249 1.00 28.43  ? 64  ALA A CB    1 
ATOM   1223 N  N     . LYS E 3 66  ? 2.967   -2.018  -11.777 1.00 27.71  ? 65  LYS A N     1 
ATOM   1224 C  CA    . LYS E 3 66  ? 2.282   -2.710  -10.681 1.00 28.25  ? 65  LYS A CA    1 
ATOM   1225 C  C     . LYS E 3 66  ? 1.107   -3.646  -11.081 1.00 28.43  ? 65  LYS A C     1 
ATOM   1226 O  O     . LYS E 3 66  ? 0.726   -4.553  -10.309 1.00 28.19  ? 65  LYS A O     1 
ATOM   1227 C  CB    . LYS E 3 66  ? 1.803   -1.673  -9.662  1.00 28.13  ? 65  LYS A CB    1 
ATOM   1228 C  CG    . LYS E 3 66  ? 2.805   -1.414  -8.553  1.00 29.02  ? 65  LYS A CG    1 
ATOM   1229 C  CD    . LYS E 3 66  ? 2.694   -0.010  -8.034  1.00 29.96  ? 65  LYS A CD    1 
ATOM   1230 C  CE    . LYS E 3 66  ? 3.753   0.299   -6.999  1.00 31.50  ? 65  LYS A CE    1 
ATOM   1231 N  NZ    . LYS E 3 66  ? 3.352   -0.327  -5.692  1.00 33.34  ? 65  LYS A NZ    1 
ATOM   1232 N  N     . LYS E 3 67  ? 0.518   -3.427  -12.262 1.00 28.63  ? 66  LYS A N     1 
ATOM   1233 C  CA    . LYS E 3 67  ? -0.449  -4.407  -12.788 1.00 28.66  ? 66  LYS A CA    1 
ATOM   1234 C  C     . LYS E 3 67  ? 0.272   -5.727  -13.062 1.00 27.70  ? 66  LYS A C     1 
ATOM   1235 O  O     . LYS E 3 67  ? -0.195  -6.828  -12.656 1.00 27.78  ? 66  LYS A O     1 
ATOM   1236 C  CB    . LYS E 3 67  ? -1.141  -3.901  -14.060 1.00 29.05  ? 66  LYS A CB    1 
ATOM   1237 C  CG    . LYS E 3 67  ? -2.658  -3.720  -13.948 1.00 30.73  ? 66  LYS A CG    1 
ATOM   1238 C  CD    . LYS E 3 67  ? -3.093  -2.541  -14.836 1.00 33.98  ? 66  LYS A CD    1 
ATOM   1239 C  CE    . LYS E 3 67  ? -4.612  -2.327  -14.834 1.00 35.55  ? 66  LYS A CE    1 
ATOM   1240 N  NZ    . LYS E 3 67  ? -4.910  -0.903  -15.228 1.00 36.35  ? 66  LYS A NZ    1 
ATOM   1241 N  N     . ILE E 3 68  ? 1.399   -5.619  -13.763 1.00 25.74  ? 67  ILE A N     1 
ATOM   1242 C  CA    . ILE E 3 68  ? 2.195   -6.794  -14.038 1.00 24.69  ? 67  ILE A CA    1 
ATOM   1243 C  C     . ILE E 3 68  ? 2.844   -7.326  -12.740 1.00 24.39  ? 67  ILE A C     1 
ATOM   1244 O  O     . ILE E 3 68  ? 2.436   -8.367  -12.254 1.00 23.34  ? 67  ILE A O     1 
ATOM   1245 C  CB    . ILE E 3 68  ? 3.214   -6.536  -15.141 1.00 24.36  ? 67  ILE A CB    1 
ATOM   1246 C  CG1   . ILE E 3 68  ? 2.498   -6.096  -16.430 1.00 23.95  ? 67  ILE A CG1   1 
ATOM   1247 C  CG2   . ILE E 3 68  ? 4.042   -7.781  -15.365 1.00 23.67  ? 67  ILE A CG2   1 
ATOM   1248 C  CD1   . ILE E 3 68  ? 3.315   -5.095  -17.248 1.00 23.08  ? 67  ILE A CD1   1 
ATOM   1249 N  N     . LEU E 3 69  ? 3.835   -6.626  -12.206 1.00 24.16  ? 68  LEU A N     1 
ATOM   1250 C  CA    . LEU E 3 69  ? 4.494   -7.093  -10.993 1.00 24.06  ? 68  LEU A CA    1 
ATOM   1251 C  C     . LEU E 3 69  ? 4.051   -6.289  -9.779  1.00 24.76  ? 68  LEU A C     1 
ATOM   1252 O  O     . LEU E 3 69  ? 4.684   -5.291  -9.431  1.00 25.22  ? 68  LEU A O     1 
ATOM   1253 C  CB    . LEU E 3 69  ? 6.014   -7.019  -11.147 1.00 23.05  ? 68  LEU A CB    1 
ATOM   1254 C  CG    . LEU E 3 69  ? 6.622   -7.847  -12.280 1.00 21.07  ? 68  LEU A CG    1 
ATOM   1255 C  CD1   . LEU E 3 69  ? 7.913   -7.213  -12.776 1.00 19.14  ? 68  LEU A CD1   1 
ATOM   1256 C  CD2   . LEU E 3 69  ? 6.862   -9.280  -11.830 1.00 16.81  ? 68  LEU A CD2   1 
ATOM   1257 N  N     . PRO E 3 70  ? 2.970   -6.713  -9.128  1.00 24.77  ? 69  PRO A N     1 
ATOM   1258 C  CA    . PRO E 3 70  ? 2.512   -5.982  -7.954  1.00 25.18  ? 69  PRO A CA    1 
ATOM   1259 C  C     . PRO E 3 70  ? 3.578   -5.872  -6.866  1.00 25.73  ? 69  PRO A C     1 
ATOM   1260 O  O     . PRO E 3 70  ? 3.448   -4.986  -5.995  1.00 26.21  ? 69  PRO A O     1 
ATOM   1261 C  CB    . PRO E 3 70  ? 1.355   -6.851  -7.425  1.00 24.81  ? 69  PRO A CB    1 
ATOM   1262 C  CG    . PRO E 3 70  ? 1.653   -8.178  -7.939  1.00 24.33  ? 69  PRO A CG    1 
ATOM   1263 C  CD    . PRO E 3 70  ? 2.143   -7.902  -9.333  1.00 24.42  ? 69  PRO A CD    1 
ATOM   1264 N  N     . ASN E 3 71  ? 4.610   -6.741  -6.910  1.00 25.64  ? 70  ASN A N     1 
ATOM   1265 C  CA    . ASN E 3 71  ? 5.598   -6.807  -5.802  1.00 25.19  ? 70  ASN A CA    1 
ATOM   1266 C  C     . ASN E 3 71  ? 7.056   -6.969  -6.147  1.00 24.18  ? 70  ASN A C     1 
ATOM   1267 O  O     . ASN E 3 71  ? 7.828   -7.506  -5.349  1.00 25.55  ? 70  ASN A O     1 
ATOM   1268 C  CB    . ASN E 3 71  ? 5.214   -7.884  -4.800  1.00 25.48  ? 70  ASN A CB    1 
ATOM   1269 C  CG    . ASN E 3 71  ? 3.874   -7.628  -4.189  1.00 26.96  ? 70  ASN A CG    1 
ATOM   1270 O  OD1   . ASN E 3 71  ? 3.743   -6.824  -3.245  1.00 28.79  ? 70  ASN A OD1   1 
ATOM   1271 N  ND2   . ASN E 3 71  ? 2.846   -8.288  -4.732  1.00 27.22  ? 70  ASN A ND2   1 
ATOM   1272 N  N     . ALA E 3 72  ? 7.428   -6.531  -7.335  1.00 22.14  ? 71  ALA A N     1 
ATOM   1273 C  CA    . ALA E 3 72  ? 8.778   -6.111  -7.547  1.00 20.82  ? 71  ALA A CA    1 
ATOM   1274 C  C     . ALA E 3 72  ? 9.108   -5.129  -6.440  1.00 20.63  ? 71  ALA A C     1 
ATOM   1275 O  O     . ALA E 3 72  ? 8.224   -4.698  -5.673  1.00 21.39  ? 71  ALA A O     1 
ATOM   1276 C  CB    . ALA E 3 72  ? 8.910   -5.447  -8.876  1.00 20.03  ? 71  ALA A CB    1 
ATOM   1277 N  N     . VAL E 3 73  ? 10.379  -4.778  -6.316  1.00 19.69  ? 72  VAL A N     1 
ATOM   1278 C  CA    . VAL E 3 73  ? 10.732  -3.722  -5.376  1.00 18.43  ? 72  VAL A CA    1 
ATOM   1279 C  C     . VAL E 3 73  ? 10.600  -2.393  -6.096  1.00 17.49  ? 72  VAL A C     1 
ATOM   1280 O  O     . VAL E 3 73  ? 11.227  -2.220  -7.135  1.00 16.95  ? 72  VAL A O     1 
ATOM   1281 C  CB    . VAL E 3 73  ? 12.180  -3.923  -4.859  1.00 18.54  ? 72  VAL A CB    1 
ATOM   1282 C  CG1   . VAL E 3 73  ? 12.616  -2.746  -4.013  1.00 17.06  ? 72  VAL A CG1   1 
ATOM   1283 C  CG2   . VAL E 3 73  ? 12.288  -5.258  -4.106  1.00 17.90  ? 72  VAL A CG2   1 
ATOM   1284 N  N     . TYR E 3 74  ? 9.793   -1.465  -5.576  1.00 17.08  ? 73  TYR A N     1 
ATOM   1285 C  CA    . TYR E 3 74  ? 9.649   -0.133  -6.242  1.00 16.76  ? 73  TYR A CA    1 
ATOM   1286 C  C     . TYR E 3 74  ? 10.408  0.966   -5.518  1.00 17.45  ? 73  TYR A C     1 
ATOM   1287 O  O     . TYR E 3 74  ? 10.222  1.163   -4.296  1.00 17.69  ? 73  TYR A O     1 
ATOM   1288 C  CB    . TYR E 3 74  ? 8.186   0.258   -6.499  1.00 16.06  ? 73  TYR A CB    1 
ATOM   1289 C  CG    . TYR E 3 74  ? 7.513   -0.669  -7.492  1.00 15.63  ? 73  TYR A CG    1 
ATOM   1290 C  CD1   . TYR E 3 74  ? 7.478   -0.348  -8.816  1.00 17.04  ? 73  TYR A CD1   1 
ATOM   1291 C  CD2   . TYR E 3 74  ? 6.944   -1.883  -7.097  1.00 15.12  ? 73  TYR A CD2   1 
ATOM   1292 C  CE1   . TYR E 3 74  ? 6.879   -1.174  -9.765  1.00 17.08  ? 73  TYR A CE1   1 
ATOM   1293 C  CE2   . TYR E 3 74  ? 6.361   -2.724  -8.025  1.00 16.64  ? 73  TYR A CE2   1 
ATOM   1294 C  CZ    . TYR E 3 74  ? 6.342   -2.347  -9.377  1.00 17.35  ? 73  TYR A CZ    1 
ATOM   1295 O  OH    . TYR E 3 74  ? 5.816   -3.130  -10.366 1.00 17.88  ? 73  TYR A OH    1 
ATOM   1296 N  N     . LEU E 3 75  ? 11.258  1.682   -6.271  1.00 17.29  ? 74  LEU A N     1 
ATOM   1297 C  CA    . LEU E 3 75  ? 12.174  2.645   -5.683  1.00 16.89  ? 74  LEU A CA    1 
ATOM   1298 C  C     . LEU E 3 75  ? 12.128  3.997   -6.356  1.00 17.29  ? 74  LEU A C     1 
ATOM   1299 O  O     . LEU E 3 75  ? 12.107  4.053   -7.577  1.00 16.32  ? 74  LEU A O     1 
ATOM   1300 C  CB    . LEU E 3 75  ? 13.607  2.114   -5.785  1.00 16.42  ? 74  LEU A CB    1 
ATOM   1301 C  CG    . LEU E 3 75  ? 13.913  0.813   -5.049  1.00 17.20  ? 74  LEU A CG    1 
ATOM   1302 C  CD1   . LEU E 3 75  ? 15.377  0.342   -5.353  1.00 20.01  ? 74  LEU A CD1   1 
ATOM   1303 C  CD2   . LEU E 3 75  ? 13.608  0.915   -3.557  1.00 11.59  ? 74  LEU A CD2   1 
ATOM   1304 N  N     . PRO E 3 76  ? 12.227  5.092   -5.555  1.00 18.49  ? 75  PRO A N     1 
ATOM   1305 C  CA    . PRO E 3 76  ? 12.288  6.432   -6.152  1.00 19.47  ? 75  PRO A CA    1 
ATOM   1306 C  C     . PRO E 3 76  ? 13.632  6.657   -6.794  1.00 21.02  ? 75  PRO A C     1 
ATOM   1307 O  O     . PRO E 3 76  ? 14.651  6.280   -6.218  1.00 22.13  ? 75  PRO A O     1 
ATOM   1308 C  CB    . PRO E 3 76  ? 12.164  7.368   -4.944  1.00 19.61  ? 75  PRO A CB    1 
ATOM   1309 C  CG    . PRO E 3 76  ? 12.326  6.499   -3.670  1.00 18.14  ? 75  PRO A CG    1 
ATOM   1310 C  CD    . PRO E 3 76  ? 12.632  5.107   -4.126  1.00 18.12  ? 75  PRO A CD    1 
ATOM   1311 N  N     . MET E 3 77  ? 13.647  7.253   -7.978  1.00 22.29  ? 76  MET A N     1 
ATOM   1312 C  CA    . MET E 3 77  ? 14.879  7.624   -8.656  1.00 22.83  ? 76  MET A CA    1 
ATOM   1313 C  C     . MET E 3 77  ? 15.665  8.524   -7.729  1.00 22.50  ? 76  MET A C     1 
ATOM   1314 O  O     . MET E 3 77  ? 15.099  9.440   -7.114  1.00 23.66  ? 76  MET A O     1 
ATOM   1315 C  CB    . MET E 3 77  ? 14.509  8.396   -9.923  1.00 23.83  ? 76  MET A CB    1 
ATOM   1316 C  CG    . MET E 3 77  ? 15.464  8.249   -11.094 1.00 27.97  ? 76  MET A CG    1 
ATOM   1317 S  SD    . MET E 3 77  ? 15.090  9.529   -12.292 1.00 34.46  ? 76  MET A SD    1 
ATOM   1318 C  CE    . MET E 3 77  ? 15.174  8.579   -13.822 1.00 32.47  ? 76  MET A CE    1 
ATOM   1319 N  N     . ARG E 3 78  ? 16.958  8.278   -7.616  1.00 22.07  ? 77  ARG A N     1 
ATOM   1320 C  CA    . ARG E 3 78  ? 17.891  9.114   -6.841  1.00 21.42  ? 77  ARG A CA    1 
ATOM   1321 C  C     . ARG E 3 78  ? 18.951  9.581   -7.839  1.00 22.66  ? 77  ARG A C     1 
ATOM   1322 O  O     . ARG E 3 78  ? 20.112  9.097   -7.867  1.00 23.76  ? 77  ARG A O     1 
ATOM   1323 C  CB    . ARG E 3 78  ? 18.534  8.296   -5.718  1.00 20.75  ? 77  ARG A CB    1 
ATOM   1324 C  CG    . ARG E 3 78  ? 17.524  7.727   -4.738  1.00 19.82  ? 77  ARG A CG    1 
ATOM   1325 C  CD    . ARG E 3 78  ? 18.150  7.324   -3.411  1.00 19.38  ? 77  ARG A CD    1 
ATOM   1326 N  NE    . ARG E 3 78  ? 18.773  6.013   -3.498  1.00 19.43  ? 77  ARG A NE    1 
ATOM   1327 C  CZ    . ARG E 3 78  ? 19.268  5.345   -2.464  1.00 19.00  ? 77  ARG A CZ    1 
ATOM   1328 N  NH1   . ARG E 3 78  ? 19.213  5.851   -1.232  1.00 18.45  ? 77  ARG A NH1   1 
ATOM   1329 N  NH2   . ARG E 3 78  ? 19.806  4.150   -2.662  1.00 18.56  ? 77  ARG A NH2   1 
ATOM   1330 N  N     . LYS E 3 79  ? 18.546  10.500  -8.694  1.00 22.66  ? 78  LYS A N     1 
ATOM   1331 C  CA    . LYS E 3 79  ? 19.361  10.869  -9.835  1.00 23.27  ? 78  LYS A CA    1 
ATOM   1332 C  C     . LYS E 3 79  ? 20.809  11.205  -9.492  1.00 22.96  ? 78  LYS A C     1 
ATOM   1333 O  O     . LYS E 3 79  ? 21.721  10.923  -10.267 1.00 23.49  ? 78  LYS A O     1 
ATOM   1334 C  CB    . LYS E 3 79  ? 18.699  12.037  -10.571 1.00 24.11  ? 78  LYS A CB    1 
ATOM   1335 C  CG    . LYS E 3 79  ? 19.394  12.489  -11.829 1.00 26.60  ? 78  LYS A CG    1 
ATOM   1336 C  CD    . LYS E 3 79  ? 19.522  11.387  -12.842 1.00 28.37  ? 78  LYS A CD    1 
ATOM   1337 C  CE    . LYS E 3 79  ? 19.596  11.964  -14.239 1.00 29.27  ? 78  LYS A CE    1 
ATOM   1338 N  NZ    . LYS E 3 79  ? 18.392  12.751  -14.590 1.00 30.62  ? 78  LYS A NZ    1 
ATOM   1339 N  N     . GLU E 3 80  ? 21.038  11.782  -8.338  1.00 22.89  ? 79  GLU A N     1 
ATOM   1340 C  CA    . GLU E 3 80  ? 22.373  12.318  -8.069  1.00 23.97  ? 79  GLU A CA    1 
ATOM   1341 C  C     . GLU E 3 80  ? 23.261  11.222  -7.497  1.00 23.20  ? 79  GLU A C     1 
ATOM   1342 O  O     . GLU E 3 80  ? 24.484  11.364  -7.420  1.00 23.51  ? 79  GLU A O     1 
ATOM   1343 C  CB    . GLU E 3 80  ? 22.307  13.535  -7.138  1.00 24.27  ? 79  GLU A CB    1 
ATOM   1344 C  CG    . GLU E 3 80  ? 22.048  14.875  -7.901  1.00 30.49  ? 79  GLU A CG    1 
ATOM   1345 C  CD    . GLU E 3 80  ? 23.204  15.965  -7.813  1.00 38.16  ? 79  GLU A CD    1 
ATOM   1346 O  OE1   . GLU E 3 80  ? 22.843  17.176  -7.618  1.00 40.17  ? 79  GLU A OE1   1 
ATOM   1347 O  OE2   . GLU E 3 80  ? 24.437  15.626  -7.940  1.00 41.10  ? 79  GLU A OE2   1 
ATOM   1348 N  N     . VAL E 3 81  ? 22.645  10.122  -7.074  1.00 21.85  ? 80  VAL A N     1 
ATOM   1349 C  CA    . VAL E 3 81  ? 23.451  8.982   -6.732  1.00 19.87  ? 80  VAL A CA    1 
ATOM   1350 C  C     . VAL E 3 81  ? 23.949  8.344   -8.037  1.00 19.04  ? 80  VAL A C     1 
ATOM   1351 O  O     . VAL E 3 81  ? 25.131  8.304   -8.250  1.00 19.00  ? 80  VAL A O     1 
ATOM   1352 C  CB    . VAL E 3 81  ? 22.741  8.062   -5.743  1.00 20.10  ? 80  VAL A CB    1 
ATOM   1353 C  CG1   . VAL E 3 81  ? 23.452  6.697   -5.634  1.00 18.84  ? 80  VAL A CG1   1 
ATOM   1354 C  CG2   . VAL E 3 81  ? 22.629  8.791   -4.386  1.00 16.66  ? 80  VAL A CG2   1 
ATOM   1355 N  N     . TYR E 3 82  ? 23.096  7.970   -8.970  1.00 18.39  ? 81  TYR A N     1 
ATOM   1356 C  CA    . TYR E 3 82  ? 23.644  7.458   -10.267 1.00 18.00  ? 81  TYR A CA    1 
ATOM   1357 C  C     . TYR E 3 82  ? 24.607  8.450   -10.960 1.00 17.65  ? 81  TYR A C     1 
ATOM   1358 O  O     . TYR E 3 82  ? 25.583  8.057   -11.619 1.00 16.62  ? 81  TYR A O     1 
ATOM   1359 C  CB    . TYR E 3 82  ? 22.514  6.972   -11.194 1.00 17.36  ? 81  TYR A CB    1 
ATOM   1360 C  CG    . TYR E 3 82  ? 21.308  6.546   -10.366 1.00 18.04  ? 81  TYR A CG    1 
ATOM   1361 C  CD1   . TYR E 3 82  ? 21.458  5.665   -9.321  1.00 18.18  ? 81  TYR A CD1   1 
ATOM   1362 C  CD2   . TYR E 3 82  ? 20.032  7.043   -10.607 1.00 19.81  ? 81  TYR A CD2   1 
ATOM   1363 C  CE1   . TYR E 3 82  ? 20.390  5.277   -8.527  1.00 19.42  ? 81  TYR A CE1   1 
ATOM   1364 C  CE2   . TYR E 3 82  ? 18.949  6.646   -9.814  1.00 20.81  ? 81  TYR A CE2   1 
ATOM   1365 C  CZ    . TYR E 3 82  ? 19.159  5.748   -8.781  1.00 19.75  ? 81  TYR A CZ    1 
ATOM   1366 O  OH    . TYR E 3 82  ? 18.173  5.308   -7.978  1.00 20.11  ? 81  TYR A OH    1 
ATOM   1367 N  N     . GLN E 3 83  ? 24.353  9.744   -10.780 1.00 18.15  ? 82  GLN A N     1 
ATOM   1368 C  CA    . GLN E 3 83  ? 25.315  10.795  -11.306 1.00 18.54  ? 82  GLN A CA    1 
ATOM   1369 C  C     . GLN E 3 83  ? 26.712  10.716  -10.671 1.00 18.31  ? 82  GLN A C     1 
ATOM   1370 O  O     . GLN E 3 83  ? 27.715  10.848  -11.373 1.00 19.41  ? 82  GLN A O     1 
ATOM   1371 C  CB    . GLN E 3 83  ? 24.749  12.209  -11.271 1.00 17.72  ? 82  GLN A CB    1 
ATOM   1372 C  CG    . GLN E 3 83  ? 25.582  13.244  -11.988 1.00 22.14  ? 82  GLN A CG    1 
ATOM   1373 C  CD    . GLN E 3 83  ? 25.774  12.992  -13.493 1.00 25.47  ? 82  GLN A CD    1 
ATOM   1374 O  OE1   . GLN E 3 83  ? 24.803  13.001  -14.295 1.00 29.61  ? 82  GLN A OE1   1 
ATOM   1375 N  NE2   . GLN E 3 83  ? 27.029  12.765  -13.885 1.00 24.06  ? 82  GLN A NE2   1 
ATOM   1376 N  N     . GLN E 3 84  ? 26.802  10.437  -9.369  1.00 18.14  ? 83  GLN A N     1 
ATOM   1377 C  CA    . GLN E 3 84  ? 28.128  10.246  -8.774  1.00 17.78  ? 83  GLN A CA    1 
ATOM   1378 C  C     . GLN E 3 84  ? 28.808  8.979   -9.344  1.00 16.81  ? 83  GLN A C     1 
ATOM   1379 O  O     . GLN E 3 84  ? 29.964  9.004   -9.708  1.00 17.55  ? 83  GLN A O     1 
ATOM   1380 C  CB    . GLN E 3 84  ? 28.119  10.267  -7.230  1.00 17.35  ? 83  GLN A CB    1 
ATOM   1381 C  CG    . GLN E 3 84  ? 27.780  11.624  -6.546  1.00 19.32  ? 83  GLN A CG    1 
ATOM   1382 C  CD    . GLN E 3 84  ? 28.876  12.749  -6.648  1.00 22.21  ? 83  GLN A CD    1 
ATOM   1383 O  OE1   . GLN E 3 84  ? 28.541  13.940  -6.774  1.00 23.48  ? 83  GLN A OE1   1 
ATOM   1384 N  NE2   . GLN E 3 84  ? 30.168  12.370  -6.555  1.00 22.88  ? 83  GLN A NE2   1 
ATOM   1385 N  N     . VAL E 3 85  ? 28.067  7.901   -9.472  1.00 16.33  ? 84  VAL A N     1 
ATOM   1386 C  CA    . VAL E 3 85  ? 28.651  6.614   -9.829  1.00 16.18  ? 84  VAL A CA    1 
ATOM   1387 C  C     . VAL E 3 85  ? 29.026  6.792   -11.269 1.00 16.71  ? 84  VAL A C     1 
ATOM   1388 O  O     . VAL E 3 85  ? 30.164  6.566   -11.650 1.00 18.06  ? 84  VAL A O     1 
ATOM   1389 C  CB    . VAL E 3 85  ? 27.662  5.447   -9.556  1.00 16.09  ? 84  VAL A CB    1 
ATOM   1390 C  CG1   . VAL E 3 85  ? 28.037  4.158   -10.303 1.00 15.87  ? 84  VAL A CG1   1 
ATOM   1391 C  CG2   . VAL E 3 85  ? 27.566  5.185   -8.080  1.00 12.87  ? 84  VAL A CG2   1 
ATOM   1392 N  N     . SER E 3 86  ? 28.120  7.349   -12.051 1.00 16.94  ? 85  SER A N     1 
ATOM   1393 C  CA    . SER E 3 86  ? 28.445  7.600   -13.435 1.00 17.06  ? 85  SER A CA    1 
ATOM   1394 C  C     . SER E 3 86  ? 29.740  8.406   -13.719 1.00 17.30  ? 85  SER A C     1 
ATOM   1395 O  O     . SER E 3 86  ? 30.517  8.016   -14.553 1.00 18.03  ? 85  SER A O     1 
ATOM   1396 C  CB    . SER E 3 86  ? 27.249  8.161   -14.172 1.00 16.62  ? 85  SER A CB    1 
ATOM   1397 O  OG    . SER E 3 86  ? 27.674  8.399   -15.488 1.00 17.82  ? 85  SER A OG    1 
ATOM   1398 N  N     . SER E 3 87  ? 29.969  9.526   -13.056 1.00 18.14  ? 86  SER A N     1 
ATOM   1399 C  CA    . SER E 3 87  ? 31.176  10.316  -13.311 1.00 19.94  ? 86  SER A CA    1 
ATOM   1400 C  C     . SER E 3 87  ? 32.430  9.556   -12.853 1.00 20.22  ? 86  SER A C     1 
ATOM   1401 O  O     . SER E 3 87  ? 33.504  9.680   -13.401 1.00 20.42  ? 86  SER A O     1 
ATOM   1402 C  CB    . SER E 3 87  ? 31.121  11.691  -12.585 1.00 20.86  ? 86  SER A CB    1 
ATOM   1403 O  OG    . SER E 3 87  ? 29.895  12.438  -12.764 1.00 23.11  ? 86  SER A OG    1 
ATOM   1404 N  N     . ARG E 3 88  ? 32.305  8.765   -11.808 1.00 21.07  ? 87  ARG A N     1 
ATOM   1405 C  CA    . ARG E 3 88  ? 33.451  7.939   -11.415 1.00 21.45  ? 87  ARG A CA    1 
ATOM   1406 C  C     . ARG E 3 88  ? 33.843  6.903   -12.476 1.00 22.08  ? 87  ARG A C     1 
ATOM   1407 O  O     . ARG E 3 88  ? 35.019  6.628   -12.639 1.00 22.33  ? 87  ARG A O     1 
ATOM   1408 C  CB    . ARG E 3 88  ? 33.170  7.264   -10.094 1.00 21.10  ? 87  ARG A CB    1 
ATOM   1409 C  CG    . ARG E 3 88  ? 33.010  8.295   -8.996  1.00 19.94  ? 87  ARG A CG    1 
ATOM   1410 C  CD    . ARG E 3 88  ? 33.354  7.678   -7.713  1.00 19.16  ? 87  ARG A CD    1 
ATOM   1411 N  NE    . ARG E 3 88  ? 32.518  6.528   -7.414  1.00 19.74  ? 87  ARG A NE    1 
ATOM   1412 C  CZ    . ARG E 3 88  ? 31.448  6.576   -6.646  1.00 18.55  ? 87  ARG A CZ    1 
ATOM   1413 N  NH1   . ARG E 3 88  ? 31.044  7.706   -6.102  1.00 18.51  ? 87  ARG A NH1   1 
ATOM   1414 N  NH2   . ARG E 3 88  ? 30.793  5.475   -6.427  1.00 20.42  ? 87  ARG A NH2   1 
ATOM   1415 N  N     . ILE E 3 89  ? 32.863  6.317   -13.176 1.00 22.51  ? 88  ILE A N     1 
ATOM   1416 C  CA    . ILE E 3 89  ? 33.200  5.360   -14.220 1.00 22.55  ? 88  ILE A CA    1 
ATOM   1417 C  C     . ILE E 3 89  ? 33.712  6.103   -15.437 1.00 23.32  ? 88  ILE A C     1 
ATOM   1418 O  O     . ILE E 3 89  ? 34.646  5.648   -16.139 1.00 24.28  ? 88  ILE A O     1 
ATOM   1419 C  CB    . ILE E 3 89  ? 32.014  4.493   -14.627 1.00 22.34  ? 88  ILE A CB    1 
ATOM   1420 C  CG1   . ILE E 3 89  ? 31.461  3.698   -13.438 1.00 21.03  ? 88  ILE A CG1   1 
ATOM   1421 C  CG2   . ILE E 3 89  ? 32.406  3.613   -15.768 1.00 21.38  ? 88  ILE A CG2   1 
ATOM   1422 C  CD1   . ILE E 3 89  ? 30.265  2.815   -13.774 1.00 18.20  ? 88  ILE A CD1   1 
ATOM   1423 N  N     . MET E 3 90  ? 33.105  7.250   -15.688 1.00 23.15  ? 89  MET A N     1 
ATOM   1424 C  CA    . MET E 3 90  ? 33.487  8.044   -16.838 1.00 23.26  ? 89  MET A CA    1 
ATOM   1425 C  C     . MET E 3 90  ? 34.964  8.419   -16.740 1.00 22.97  ? 89  MET A C     1 
ATOM   1426 O  O     . MET E 3 90  ? 35.699  8.281   -17.696 1.00 23.82  ? 89  MET A O     1 
ATOM   1427 C  CB    . MET E 3 90  ? 32.569  9.264   -16.996 1.00 23.17  ? 89  MET A CB    1 
ATOM   1428 C  CG    . MET E 3 90  ? 31.155  8.938   -17.403 1.00 21.73  ? 89  MET A CG    1 
ATOM   1429 S  SD    . MET E 3 90  ? 31.051  7.864   -18.836 1.00 23.40  ? 89  MET A SD    1 
ATOM   1430 C  CE    . MET E 3 90  ? 29.269  7.844   -18.979 1.00 24.88  ? 89  MET A CE    1 
ATOM   1431 N  N     . ASN E 3 91  ? 35.412  8.817   -15.570 1.00 22.51  ? 90  ASN A N     1 
ATOM   1432 C  CA    . ASN E 3 91  ? 36.833  8.983   -15.323 1.00 22.78  ? 90  ASN A CA    1 
ATOM   1433 C  C     . ASN E 3 91  ? 37.739  7.748   -15.513 1.00 23.21  ? 90  ASN A C     1 
ATOM   1434 O  O     . ASN E 3 91  ? 38.816  7.854   -16.131 1.00 23.01  ? 90  ASN A O     1 
ATOM   1435 C  CB    . ASN E 3 91  ? 37.003  9.625   -13.960 1.00 22.80  ? 90  ASN A CB    1 
ATOM   1436 C  CG    . ASN E 3 91  ? 36.251  10.931  -13.891 1.00 24.64  ? 90  ASN A CG    1 
ATOM   1437 O  OD1   . ASN E 3 91  ? 36.191  11.696  -14.918 1.00 24.58  ? 90  ASN A OD1   1 
ATOM   1438 N  ND2   . ASN E 3 91  ? 35.609  11.188  -12.731 1.00 22.27  ? 90  ASN A ND2   1 
ATOM   1439 N  N     . LEU E 3 92  ? 37.327  6.592   -14.991 1.00 22.94  ? 91  LEU A N     1 
ATOM   1440 C  CA    . LEU E 3 92  ? 38.042  5.387   -15.282 1.00 24.08  ? 91  LEU A CA    1 
ATOM   1441 C  C     . LEU E 3 92  ? 38.115  5.184   -16.811 1.00 24.72  ? 91  LEU A C     1 
ATOM   1442 O  O     . LEU E 3 92  ? 39.184  4.912   -17.337 1.00 23.66  ? 91  LEU A O     1 
ATOM   1443 C  CB    . LEU E 3 92  ? 37.437  4.194   -14.573 1.00 24.01  ? 91  LEU A CB    1 
ATOM   1444 C  CG    . LEU E 3 92  ? 37.390  4.362   -13.047 1.00 24.72  ? 91  LEU A CG    1 
ATOM   1445 C  CD1   . LEU E 3 92  ? 36.538  3.225   -12.423 1.00 24.16  ? 91  LEU A CD1   1 
ATOM   1446 C  CD2   . LEU E 3 92  ? 38.816  4.566   -12.341 1.00 21.63  ? 91  LEU A CD2   1 
ATOM   1447 N  N     . LEU E 3 93  ? 36.997  5.407   -17.500 1.00 25.91  ? 92  LEU A N     1 
ATOM   1448 C  CA    . LEU E 3 93  ? 36.955  5.342   -18.962 1.00 27.08  ? 92  LEU A CA    1 
ATOM   1449 C  C     . LEU E 3 93  ? 37.977  6.240   -19.597 1.00 28.67  ? 92  LEU A C     1 
ATOM   1450 O  O     . LEU E 3 93  ? 38.740  5.799   -20.480 1.00 28.17  ? 92  LEU A O     1 
ATOM   1451 C  CB    . LEU E 3 93  ? 35.574  5.684   -19.509 1.00 25.83  ? 92  LEU A CB    1 
ATOM   1452 C  CG    . LEU E 3 93  ? 34.577  4.556   -19.358 1.00 24.92  ? 92  LEU A CG    1 
ATOM   1453 C  CD1   . LEU E 3 93  ? 33.373  4.760   -20.279 1.00 22.59  ? 92  LEU A CD1   1 
ATOM   1454 C  CD2   . LEU E 3 93  ? 35.279  3.201   -19.581 1.00 22.42  ? 92  LEU A CD2   1 
ATOM   1455 N  N     . ARG E 3 94  ? 37.983  7.492   -19.124 1.00 31.04  ? 93  ARG A N     1 
ATOM   1456 C  CA    . ARG E 3 94  ? 38.949  8.545   -19.568 1.00 33.20  ? 93  ARG A CA    1 
ATOM   1457 C  C     . ARG E 3 94  ? 40.430  8.163   -19.472 1.00 33.83  ? 93  ARG A C     1 
ATOM   1458 O  O     . ARG E 3 94  ? 41.251  8.829   -20.068 1.00 34.42  ? 93  ARG A O     1 
ATOM   1459 C  CB    . ARG E 3 94  ? 38.700  9.897   -18.850 1.00 33.23  ? 93  ARG A CB    1 
ATOM   1460 C  CG    . ARG E 3 94  ? 39.117  11.166  -19.665 1.00 34.74  ? 93  ARG A CG    1 
ATOM   1461 C  CD    . ARG E 3 94  ? 38.366  12.448  -19.214 1.00 36.30  ? 93  ARG A CD    1 
ATOM   1462 N  NE    . ARG E 3 94  ? 37.116  12.166  -18.487 1.00 38.49  ? 93  ARG A NE    1 
ATOM   1463 C  CZ    . ARG E 3 94  ? 35.928  12.729  -18.744 1.00 37.85  ? 93  ARG A CZ    1 
ATOM   1464 N  NH1   . ARG E 3 94  ? 35.796  13.627  -19.722 1.00 36.53  ? 93  ARG A NH1   1 
ATOM   1465 N  NH2   . ARG E 3 94  ? 34.861  12.398  -18.010 1.00 37.33  ? 93  ARG A NH2   1 
ATOM   1466 N  N     . GLU E 3 95  ? 40.783  7.104   -18.747 1.00 35.09  ? 94  GLU A N     1 
ATOM   1467 C  CA    . GLU E 3 95  ? 42.212  6.780   -18.588 1.00 36.52  ? 94  GLU A CA    1 
ATOM   1468 C  C     . GLU E 3 95  ? 42.713  5.983   -19.770 1.00 36.92  ? 94  GLU A C     1 
ATOM   1469 O  O     . GLU E 3 95  ? 43.891  6.106   -20.167 1.00 37.42  ? 94  GLU A O     1 
ATOM   1470 C  CB    . GLU E 3 95  ? 42.560  6.105   -17.240 1.00 36.63  ? 94  GLU A CB    1 
ATOM   1471 C  CG    . GLU E 3 95  ? 42.553  7.042   -15.970 1.00 39.25  ? 94  GLU A CG    1 
ATOM   1472 C  CD    . GLU E 3 95  ? 43.083  8.493   -16.215 1.00 42.02  ? 94  GLU A CD    1 
ATOM   1473 O  OE1   . GLU E 3 95  ? 44.223  8.837   -15.761 1.00 43.39  ? 94  GLU A OE1   1 
ATOM   1474 O  OE2   . GLU E 3 95  ? 42.349  9.299   -16.853 1.00 41.27  ? 94  GLU A OE2   1 
ATOM   1475 N  N     . TYR E 3 96  ? 41.800  5.227   -20.377 1.00 37.09  ? 95  TYR A N     1 
ATOM   1476 C  CA    . TYR E 3 96  ? 42.159  4.353   -21.501 1.00 37.02  ? 95  TYR A CA    1 
ATOM   1477 C  C     . TYR E 3 96  ? 42.279  5.043   -22.851 1.00 37.35  ? 95  TYR A C     1 
ATOM   1478 O  O     . TYR E 3 96  ? 43.062  4.595   -23.688 1.00 37.87  ? 95  TYR A O     1 
ATOM   1479 C  CB    . TYR E 3 96  ? 41.212  3.176   -21.603 1.00 36.31  ? 95  TYR A CB    1 
ATOM   1480 C  CG    . TYR E 3 96  ? 41.257  2.266   -20.421 1.00 36.05  ? 95  TYR A CG    1 
ATOM   1481 C  CD1   . TYR E 3 96  ? 42.014  1.089   -20.457 1.00 35.97  ? 95  TYR A CD1   1 
ATOM   1482 C  CD2   . TYR E 3 96  ? 40.533  2.552   -19.272 1.00 34.98  ? 95  TYR A CD2   1 
ATOM   1483 C  CE1   . TYR E 3 96  ? 42.049  0.234   -19.394 1.00 35.50  ? 95  TYR A CE1   1 
ATOM   1484 C  CE2   . TYR E 3 96  ? 40.565  1.700   -18.202 1.00 36.39  ? 95  TYR A CE2   1 
ATOM   1485 C  CZ    . TYR E 3 96  ? 41.331  0.548   -18.269 1.00 36.94  ? 95  TYR A CZ    1 
ATOM   1486 O  OH    . TYR E 3 96  ? 41.366  -0.306  -17.197 1.00 39.56  ? 95  TYR A OH    1 
ATOM   1487 N  N     . SER E 3 97  ? 41.490  6.094   -23.091 1.00 37.69  ? 96  SER A N     1 
ATOM   1488 C  CA    . SER E 3 97  ? 41.686  6.970   -24.282 1.00 37.44  ? 96  SER A CA    1 
ATOM   1489 C  C     . SER E 3 97  ? 41.125  8.373   -24.082 1.00 37.29  ? 96  SER A C     1 
ATOM   1490 O  O     . SER E 3 97  ? 39.984  8.513   -23.682 1.00 37.70  ? 96  SER A O     1 
ATOM   1491 C  CB    . SER E 3 97  ? 41.074  6.364   -25.548 1.00 37.27  ? 96  SER A CB    1 
ATOM   1492 O  OG    . SER E 3 97  ? 41.136  7.309   -26.613 1.00 36.33  ? 96  SER A OG    1 
ATOM   1493 N  N     . GLU E 3 98  ? 41.955  9.382   -24.364 1.00 37.36  ? 97  GLU A N     1 
ATOM   1494 C  CA    . GLU E 3 98  ? 41.605  10.831  -24.386 1.00 37.20  ? 97  GLU A CA    1 
ATOM   1495 C  C     . GLU E 3 98  ? 40.427  11.187  -25.288 1.00 36.11  ? 97  GLU A C     1 
ATOM   1496 O  O     . GLU E 3 98  ? 39.810  12.265  -25.153 1.00 36.47  ? 97  GLU A O     1 
ATOM   1497 C  CB    . GLU E 3 98  ? 42.801  11.668  -24.925 1.00 37.60  ? 97  GLU A CB    1 
ATOM   1498 C  CG    . GLU E 3 98  ? 44.081  11.630  -24.085 1.00 39.17  ? 97  GLU A CG    1 
ATOM   1499 C  CD    . GLU E 3 98  ? 44.723  10.280  -24.129 1.00 41.15  ? 97  GLU A CD    1 
ATOM   1500 O  OE1   . GLU E 3 98  ? 44.535  9.599   -25.161 1.00 43.02  ? 97  GLU A OE1   1 
ATOM   1501 O  OE2   . GLU E 3 98  ? 45.396  9.883   -23.144 1.00 42.65  ? 97  GLU A OE2   1 
ATOM   1502 N  N     . LYS E 3 99  ? 40.160  10.318  -26.253 1.00 34.43  ? 98  LYS A N     1 
ATOM   1503 C  CA    . LYS E 3 99  ? 39.159  10.614  -27.259 1.00 32.46  ? 98  LYS A CA    1 
ATOM   1504 C  C     . LYS E 3 99  ? 37.900  9.854   -26.845 1.00 30.91  ? 98  LYS A C     1 
ATOM   1505 O  O     . LYS E 3 99  ? 37.707  8.695   -27.237 1.00 30.98  ? 98  LYS A O     1 
ATOM   1506 C  CB    . LYS E 3 99  ? 39.652  10.205  -28.651 1.00 32.51  ? 98  LYS A CB    1 
ATOM   1507 C  CG    . LYS E 3 99  ? 41.071  10.694  -29.031 1.00 32.77  ? 98  LYS A CG    1 
ATOM   1508 C  CD    . LYS E 3 99  ? 41.366  10.295  -30.466 1.00 33.53  ? 98  LYS A CD    1 
ATOM   1509 C  CE    . LYS E 3 99  ? 42.715  10.814  -31.038 1.00 34.27  ? 98  LYS A CE    1 
ATOM   1510 N  NZ    . LYS E 3 99  ? 42.618  12.140  -31.753 1.00 32.67  ? 98  LYS A NZ    1 
ATOM   1511 N  N     . ILE E 3 100 ? 37.065  10.544  -26.063 1.00 28.26  ? 99  ILE A N     1 
ATOM   1512 C  CA    . ILE E 3 100 ? 35.878  10.001  -25.432 1.00 26.08  ? 99  ILE A CA    1 
ATOM   1513 C  C     . ILE E 3 100 ? 34.663  10.908  -25.679 1.00 25.52  ? 99  ILE A C     1 
ATOM   1514 O  O     . ILE E 3 100 ? 34.744  12.138  -25.491 1.00 25.86  ? 99  ILE A O     1 
ATOM   1515 C  CB    . ILE E 3 100 ? 36.113  9.834   -23.890 1.00 25.73  ? 99  ILE A CB    1 
ATOM   1516 C  CG1   . ILE E 3 100 ? 34.814  9.510   -23.148 1.00 24.59  ? 99  ILE A CG1   1 
ATOM   1517 C  CG2   . ILE E 3 100 ? 36.795  11.086  -23.290 1.00 23.74  ? 99  ILE A CG2   1 
ATOM   1518 C  CD1   . ILE E 3 100 ? 35.013  8.691   -21.790 1.00 22.21  ? 99  ILE A CD1   1 
ATOM   1519 N  N     . GLU E 3 101 ? 33.558  10.300  -26.106 1.00 23.45  ? 100 GLU A N     1 
ATOM   1520 C  CA    . GLU E 3 101 ? 32.289  10.996  -26.285 1.00 22.76  ? 100 GLU A CA    1 
ATOM   1521 C  C     . GLU E 3 101 ? 31.259  10.397  -25.330 1.00 22.64  ? 100 GLU A C     1 
ATOM   1522 O  O     . GLU E 3 101 ? 30.787  9.258   -25.486 1.00 22.38  ? 100 GLU A O     1 
ATOM   1523 C  CB    . GLU E 3 101 ? 31.847  10.899  -27.743 1.00 22.59  ? 100 GLU A CB    1 
ATOM   1524 C  CG    . GLU E 3 101 ? 30.375  11.108  -28.064 1.00 24.19  ? 100 GLU A CG    1 
ATOM   1525 C  CD    . GLU E 3 101 ? 30.168  11.381  -29.581 1.00 27.52  ? 100 GLU A CD    1 
ATOM   1526 O  OE1   . GLU E 3 101 ? 31.123  11.147  -30.381 1.00 27.78  ? 100 GLU A OE1   1 
ATOM   1527 O  OE2   . GLU E 3 101 ? 29.059  11.824  -29.994 1.00 29.76  ? 100 GLU A OE2   1 
ATOM   1528 N  N     . ILE E 3 102 ? 30.976  11.153  -24.293 1.00 22.64  ? 101 ILE A N     1 
ATOM   1529 C  CA    . ILE E 3 102 ? 30.005  10.757  -23.287 1.00 23.12  ? 101 ILE A CA    1 
ATOM   1530 C  C     . ILE E 3 102 ? 28.637  11.070  -23.893 1.00 23.35  ? 101 ILE A C     1 
ATOM   1531 O  O     . ILE E 3 102 ? 28.402  12.240  -24.284 1.00 24.22  ? 101 ILE A O     1 
ATOM   1532 C  CB    . ILE E 3 102 ? 30.227  11.600  -22.016 1.00 23.00  ? 101 ILE A CB    1 
ATOM   1533 C  CG1   . ILE E 3 102 ? 31.640  11.368  -21.479 1.00 22.39  ? 101 ILE A CG1   1 
ATOM   1534 C  CG2   . ILE E 3 102 ? 29.167  11.292  -20.975 1.00 23.52  ? 101 ILE A CG2   1 
ATOM   1535 C  CD1   . ILE E 3 102 ? 32.029  12.342  -20.430 1.00 22.57  ? 101 ILE A CD1   1 
ATOM   1536 N  N     . ALA E 3 103 ? 27.758  10.060  -24.007 1.00 22.12  ? 102 ALA A N     1 
ATOM   1537 C  CA    . ALA E 3 103 ? 26.477  10.231  -24.724 1.00 21.04  ? 102 ALA A CA    1 
ATOM   1538 C  C     . ALA E 3 103 ? 25.227  10.248  -23.843 1.00 21.46  ? 102 ALA A C     1 
ATOM   1539 O  O     . ALA E 3 103 ? 24.161  10.715  -24.269 1.00 22.96  ? 102 ALA A O     1 
ATOM   1540 C  CB    . ALA E 3 103 ? 26.328  9.205   -25.787 1.00 20.62  ? 102 ALA A CB    1 
ATOM   1541 N  N     . SER E 3 104 ? 25.322  9.737   -22.629 1.00 19.93  ? 103 SER A N     1 
ATOM   1542 C  CA    . SER E 3 104 ? 24.247  9.927   -21.732 1.00 19.53  ? 103 SER A CA    1 
ATOM   1543 C  C     . SER E 3 104 ? 24.807  9.557   -20.409 1.00 19.24  ? 103 SER A C     1 
ATOM   1544 O  O     . SER E 3 104 ? 25.982  9.237   -20.297 1.00 19.58  ? 103 SER A O     1 
ATOM   1545 C  CB    . SER E 3 104 ? 23.202  8.894   -22.030 1.00 20.09  ? 103 SER A CB    1 
ATOM   1546 O  OG    . SER E 3 104 ? 23.724  7.606   -21.678 1.00 22.29  ? 103 SER A OG    1 
ATOM   1547 N  N     . ILE E 3 105 ? 23.953  9.474   -19.411 1.00 18.10  ? 104 ILE A N     1 
ATOM   1548 C  CA    . ILE E 3 105 ? 24.456  9.164   -18.120 1.00 18.05  ? 104 ILE A CA    1 
ATOM   1549 C  C     . ILE E 3 105 ? 25.093  7.758   -18.028 1.00 18.79  ? 104 ILE A C     1 
ATOM   1550 O  O     . ILE E 3 105 ? 25.685  7.430   -16.993 1.00 18.94  ? 104 ILE A O     1 
ATOM   1551 C  CB    . ILE E 3 105 ? 23.347  9.278   -17.116 1.00 18.09  ? 104 ILE A CB    1 
ATOM   1552 C  CG1   . ILE E 3 105 ? 23.909  9.310   -15.684 1.00 19.22  ? 104 ILE A CG1   1 
ATOM   1553 C  CG2   . ILE E 3 105 ? 22.296  8.169   -17.334 1.00 16.86  ? 104 ILE A CG2   1 
ATOM   1554 C  CD1   . ILE E 3 105 ? 22.947  10.155  -14.750 1.00 21.51  ? 104 ILE A CD1   1 
ATOM   1555 N  N     . ASP E 3 106 ? 24.945  6.931   -19.074 1.00 18.79  ? 105 ASP A N     1 
ATOM   1556 C  CA    . ASP E 3 106 ? 25.460  5.548   -19.014 1.00 18.96  ? 105 ASP A CA    1 
ATOM   1557 C  C     . ASP E 3 106 ? 26.117  4.881   -20.286 1.00 18.61  ? 105 ASP A C     1 
ATOM   1558 O  O     . ASP E 3 106 ? 26.068  3.671   -20.454 1.00 18.23  ? 105 ASP A O     1 
ATOM   1559 C  CB    . ASP E 3 106 ? 24.400  4.636   -18.359 1.00 19.37  ? 105 ASP A CB    1 
ATOM   1560 C  CG    . ASP E 3 106 ? 23.294  4.156   -19.337 1.00 21.03  ? 105 ASP A CG    1 
ATOM   1561 O  OD1   . ASP E 3 106 ? 23.017  4.780   -20.365 1.00 20.76  ? 105 ASP A OD1   1 
ATOM   1562 O  OD2   . ASP E 3 106 ? 22.660  3.120   -19.044 1.00 27.04  ? 105 ASP A OD2   1 
ATOM   1563 N  N     . GLU E 3 107 ? 26.691  5.663   -21.184 1.00 18.54  ? 106 GLU A N     1 
ATOM   1564 C  CA    . GLU E 3 107 ? 27.279  5.109   -22.420 1.00 20.00  ? 106 GLU A CA    1 
ATOM   1565 C  C     . GLU E 3 107 ? 28.286  6.099   -22.820 1.00 19.98  ? 106 GLU A C     1 
ATOM   1566 O  O     . GLU E 3 107 ? 28.075  7.306   -22.619 1.00 20.89  ? 106 GLU A O     1 
ATOM   1567 C  CB    . GLU E 3 107 ? 26.326  4.903   -23.649 1.00 20.77  ? 106 GLU A CB    1 
ATOM   1568 C  CG    . GLU E 3 107 ? 24.821  5.493   -23.668 1.00 26.32  ? 106 GLU A CG    1 
ATOM   1569 C  CD    . GLU E 3 107 ? 24.059  5.268   -25.045 1.00 31.13  ? 106 GLU A CD    1 
ATOM   1570 O  OE1   . GLU E 3 107 ? 22.930  4.716   -25.079 1.00 34.02  ? 106 GLU A OE1   1 
ATOM   1571 O  OE2   . GLU E 3 107 ? 24.593  5.640   -26.117 1.00 34.78  ? 106 GLU A OE2   1 
ATOM   1572 N  N     . ALA E 3 108 ? 29.358  5.597   -23.418 1.00 19.11  ? 107 ALA A N     1 
ATOM   1573 C  CA    . ALA E 3 108 ? 30.459  6.403   -23.752 1.00 19.00  ? 107 ALA A CA    1 
ATOM   1574 C  C     . ALA E 3 108 ? 31.135  5.688   -24.868 1.00 18.86  ? 107 ALA A C     1 
ATOM   1575 O  O     . ALA E 3 108 ? 31.074  4.513   -24.870 1.00 18.80  ? 107 ALA A O     1 
ATOM   1576 C  CB    . ALA E 3 108 ? 31.378  6.548   -22.557 1.00 19.52  ? 107 ALA A CB    1 
ATOM   1577 N  N     . TYR E 3 109 ? 31.714  6.431   -25.826 1.00 19.19  ? 108 TYR A N     1 
ATOM   1578 C  CA    . TYR E 3 109 ? 32.361  5.884   -26.988 1.00 19.20  ? 108 TYR A CA    1 
ATOM   1579 C  C     . TYR E 3 109 ? 33.815  6.279   -26.893 1.00 19.94  ? 108 TYR A C     1 
ATOM   1580 O  O     . TYR E 3 109 ? 34.131  7.484   -26.723 1.00 19.73  ? 108 TYR A O     1 
ATOM   1581 C  CB    . TYR E 3 109 ? 31.813  6.516   -28.263 1.00 18.87  ? 108 TYR A CB    1 
ATOM   1582 C  CG    . TYR E 3 109 ? 30.390  6.202   -28.636 1.00 19.05  ? 108 TYR A CG    1 
ATOM   1583 C  CD1   . TYR E 3 109 ? 30.042  5.045   -29.348 1.00 17.78  ? 108 TYR A CD1   1 
ATOM   1584 C  CD2   . TYR E 3 109 ? 29.393  7.105   -28.347 1.00 20.92  ? 108 TYR A CD2   1 
ATOM   1585 C  CE1   . TYR E 3 109 ? 28.720  4.810   -29.712 1.00 19.22  ? 108 TYR A CE1   1 
ATOM   1586 C  CE2   . TYR E 3 109 ? 28.106  6.884   -28.721 1.00 21.72  ? 108 TYR A CE2   1 
ATOM   1587 C  CZ    . TYR E 3 109 ? 27.773  5.748   -29.389 1.00 21.51  ? 108 TYR A CZ    1 
ATOM   1588 O  OH    . TYR E 3 109 ? 26.435  5.613   -29.669 1.00 25.63  ? 108 TYR A OH    1 
ATOM   1589 N  N     . LEU E 3 110 ? 34.688  5.280   -27.010 1.00 20.34  ? 109 LEU A N     1 
ATOM   1590 C  CA    . LEU E 3 110 ? 36.126  5.494   -26.947 1.00 21.78  ? 109 LEU A CA    1 
ATOM   1591 C  C     . LEU E 3 110 ? 36.786  5.283   -28.313 1.00 23.11  ? 109 LEU A C     1 
ATOM   1592 O  O     . LEU E 3 110 ? 36.500  4.320   -29.012 1.00 24.47  ? 109 LEU A O     1 
ATOM   1593 C  CB    . LEU E 3 110 ? 36.750  4.537   -25.928 1.00 21.54  ? 109 LEU A CB    1 
ATOM   1594 C  CG    . LEU E 3 110 ? 36.860  4.974   -24.471 1.00 20.33  ? 109 LEU A CG    1 
ATOM   1595 C  CD1   . LEU E 3 110 ? 35.508  5.250   -23.873 1.00 18.44  ? 109 LEU A CD1   1 
ATOM   1596 C  CD2   . LEU E 3 110 ? 37.571  3.910   -23.676 1.00 21.82  ? 109 LEU A CD2   1 
ATOM   1597 N  N     . ASP E 3 111 ? 37.668  6.172   -28.728 1.00 24.28  ? 110 ASP A N     1 
ATOM   1598 C  CA    . ASP E 3 111 ? 38.301  5.928   -29.995 1.00 25.57  ? 110 ASP A CA    1 
ATOM   1599 C  C     . ASP E 3 111 ? 39.658  5.367   -29.640 1.00 26.15  ? 110 ASP A C     1 
ATOM   1600 O  O     . ASP E 3 111 ? 40.378  5.932   -28.844 1.00 26.33  ? 110 ASP A O     1 
ATOM   1601 C  CB    . ASP E 3 111 ? 38.336  7.200   -30.855 1.00 25.98  ? 110 ASP A CB    1 
ATOM   1602 C  CG    . ASP E 3 111 ? 38.918  6.958   -32.221 1.00 27.69  ? 110 ASP A CG    1 
ATOM   1603 O  OD1   . ASP E 3 111 ? 39.821  6.099   -32.311 1.00 28.64  ? 110 ASP A OD1   1 
ATOM   1604 O  OD2   . ASP E 3 111 ? 38.496  7.629   -33.201 1.00 29.27  ? 110 ASP A OD2   1 
ATOM   1605 N  N     . ILE E 3 112 ? 39.981  4.204   -30.170 1.00 27.44  ? 111 ILE A N     1 
ATOM   1606 C  CA    . ILE E 3 112 ? 41.136  3.485   -29.647 1.00 28.77  ? 111 ILE A CA    1 
ATOM   1607 C  C     . ILE E 3 112 ? 42.137  3.146   -30.738 1.00 30.27  ? 111 ILE A C     1 
ATOM   1608 O  O     . ILE E 3 112 ? 43.041  2.349   -30.545 1.00 30.88  ? 111 ILE A O     1 
ATOM   1609 C  CB    . ILE E 3 112 ? 40.729  2.244   -28.796 1.00 28.34  ? 111 ILE A CB    1 
ATOM   1610 C  CG1   . ILE E 3 112 ? 39.730  1.344   -29.535 1.00 27.27  ? 111 ILE A CG1   1 
ATOM   1611 C  CG2   . ILE E 3 112 ? 40.146  2.688   -27.443 1.00 27.36  ? 111 ILE A CG2   1 
ATOM   1612 C  CD1   . ILE E 3 112 ? 39.659  -0.045  -28.978 1.00 23.71  ? 111 ILE A CD1   1 
ATOM   1613 N  N     . SER E 3 113 ? 42.003  3.819   -31.867 1.00 31.71  ? 112 SER A N     1 
ATOM   1614 C  CA    . SER E 3 113 ? 42.832  3.534   -33.021 1.00 33.44  ? 112 SER A CA    1 
ATOM   1615 C  C     . SER E 3 113 ? 44.355  3.576   -32.743 1.00 35.04  ? 112 SER A C     1 
ATOM   1616 O  O     . SER E 3 113 ? 45.105  2.774   -33.309 1.00 35.17  ? 112 SER A O     1 
ATOM   1617 C  CB    . SER E 3 113 ? 42.423  4.458   -34.183 1.00 33.25  ? 112 SER A CB    1 
ATOM   1618 O  OG    . SER E 3 113 ? 41.001  4.483   -34.344 1.00 31.52  ? 112 SER A OG    1 
ATOM   1619 N  N     . ASP E 3 114 ? 44.800  4.504   -31.882 1.00 36.98  ? 113 ASP A N     1 
ATOM   1620 C  CA    . ASP E 3 114 ? 46.248  4.722   -31.627 1.00 38.63  ? 113 ASP A CA    1 
ATOM   1621 C  C     . ASP E 3 114 ? 46.723  3.821   -30.498 1.00 39.24  ? 113 ASP A C     1 
ATOM   1622 O  O     . ASP E 3 114 ? 47.915  3.750   -30.223 1.00 39.36  ? 113 ASP A O     1 
ATOM   1623 C  CB    . ASP E 3 114 ? 46.576  6.164   -31.171 1.00 39.07  ? 113 ASP A CB    1 
ATOM   1624 C  CG    . ASP E 3 114 ? 46.091  7.244   -32.121 1.00 40.64  ? 113 ASP A CG    1 
ATOM   1625 O  OD1   . ASP E 3 114 ? 46.515  7.278   -33.309 1.00 41.63  ? 113 ASP A OD1   1 
ATOM   1626 O  OD2   . ASP E 3 114 ? 45.317  8.109   -31.639 1.00 42.77  ? 113 ASP A OD2   1 
ATOM   1627 N  N     . LYS E 3 115 ? 45.782  3.174   -29.818 1.00 39.80  ? 114 LYS A N     1 
ATOM   1628 C  CA    . LYS E 3 115 ? 46.101  2.421   -28.618 1.00 40.24  ? 114 LYS A CA    1 
ATOM   1629 C  C     . LYS E 3 115 ? 46.100  0.892   -28.838 1.00 40.41  ? 114 LYS A C     1 
ATOM   1630 O  O     . LYS E 3 115 ? 46.550  0.145   -27.964 1.00 40.14  ? 114 LYS A O     1 
ATOM   1631 C  CB    . LYS E 3 115 ? 45.148  2.826   -27.478 1.00 40.33  ? 114 LYS A CB    1 
ATOM   1632 C  CG    . LYS E 3 115 ? 44.850  4.322   -27.391 1.00 40.84  ? 114 LYS A CG    1 
ATOM   1633 C  CD    . LYS E 3 115 ? 45.595  5.018   -26.244 1.00 41.08  ? 114 LYS A CD    1 
ATOM   1634 C  CE    . LYS E 3 115 ? 45.831  6.494   -26.566 1.00 42.43  ? 114 LYS A CE    1 
ATOM   1635 N  NZ    . LYS E 3 115 ? 46.466  7.285   -25.451 1.00 43.39  ? 114 LYS A NZ    1 
ATOM   1636 N  N     . VAL E 3 116 ? 45.582  0.428   -29.980 1.00 40.70  ? 115 VAL A N     1 
ATOM   1637 C  CA    . VAL E 3 116 ? 45.577  -1.019  -30.316 1.00 41.14  ? 115 VAL A CA    1 
ATOM   1638 C  C     . VAL E 3 116 ? 45.813  -1.266  -31.822 1.00 41.99  ? 115 VAL A C     1 
ATOM   1639 O  O     . VAL E 3 116 ? 45.510  -0.399  -32.650 1.00 42.07  ? 115 VAL A O     1 
ATOM   1640 C  CB    . VAL E 3 116 ? 44.268  -1.770  -29.834 1.00 40.73  ? 115 VAL A CB    1 
ATOM   1641 C  CG1   . VAL E 3 116 ? 43.997  -1.551  -28.359 1.00 39.58  ? 115 VAL A CG1   1 
ATOM   1642 C  CG2   . VAL E 3 116 ? 43.055  -1.407  -30.673 1.00 39.48  ? 115 VAL A CG2   1 
ATOM   1643 N  N     . ARG E 3 117 ? 46.339  -2.437  -32.181 1.00 42.85  ? 116 ARG A N     1 
ATOM   1644 C  CA    . ARG E 3 117 ? 46.659  -2.710  -33.599 1.00 43.57  ? 116 ARG A CA    1 
ATOM   1645 C  C     . ARG E 3 117 ? 45.436  -3.214  -34.384 1.00 43.31  ? 116 ARG A C     1 
ATOM   1646 O  O     . ARG E 3 117 ? 45.152  -2.726  -35.464 1.00 43.54  ? 116 ARG A O     1 
ATOM   1647 C  CB    . ARG E 3 117 ? 47.855  -3.665  -33.746 1.00 43.97  ? 116 ARG A CB    1 
ATOM   1648 C  CG    . ARG E 3 117 ? 48.715  -3.371  -34.987 1.00 45.26  ? 116 ARG A CG    1 
ATOM   1649 C  CD    . ARG E 3 117 ? 49.930  -4.301  -35.138 1.00 47.47  ? 116 ARG A CD    1 
ATOM   1650 N  NE    . ARG E 3 117 ? 50.755  -4.368  -33.923 1.00 49.63  ? 116 ARG A NE    1 
ATOM   1651 C  CZ    . ARG E 3 117 ? 51.574  -5.377  -33.608 1.00 50.82  ? 116 ARG A CZ    1 
ATOM   1652 N  NH1   . ARG E 3 117 ? 51.701  -6.427  -34.414 1.00 50.84  ? 116 ARG A NH1   1 
ATOM   1653 N  NH2   . ARG E 3 117 ? 52.271  -5.343  -32.476 1.00 51.39  ? 116 ARG A NH2   1 
ATOM   1654 N  N     . ASP E 3 118 ? 44.713  -4.177  -33.823 1.00 42.85  ? 117 ASP A N     1 
ATOM   1655 C  CA    . ASP E 3 118 ? 43.533  -4.725  -34.457 1.00 42.19  ? 117 ASP A CA    1 
ATOM   1656 C  C     . ASP E 3 118 ? 42.500  -5.053  -33.382 1.00 41.66  ? 117 ASP A C     1 
ATOM   1657 O  O     . ASP E 3 118 ? 42.657  -4.674  -32.216 1.00 41.32  ? 117 ASP A O     1 
ATOM   1658 C  CB    . ASP E 3 118 ? 43.885  -5.980  -35.279 1.00 42.26  ? 117 ASP A CB    1 
ATOM   1659 C  CG    . ASP E 3 118 ? 44.241  -7.191  -34.399 1.00 42.52  ? 117 ASP A CG    1 
ATOM   1660 O  OD1   . ASP E 3 118 ? 43.948  -8.339  -34.805 1.00 41.97  ? 117 ASP A OD1   1 
ATOM   1661 O  OD2   . ASP E 3 118 ? 44.807  -6.999  -33.301 1.00 42.76  ? 117 ASP A OD2   1 
ATOM   1662 N  N     . TYR E 3 119 ? 41.463  -5.779  -33.795 1.00 40.95  ? 118 TYR A N     1 
ATOM   1663 C  CA    . TYR E 3 119 ? 40.301  -6.072  -32.981 1.00 40.50  ? 118 TYR A CA    1 
ATOM   1664 C  C     . TYR E 3 119 ? 40.625  -6.969  -31.800 1.00 40.44  ? 118 TYR A C     1 
ATOM   1665 O  O     . TYR E 3 119 ? 39.973  -6.888  -30.765 1.00 39.80  ? 118 TYR A O     1 
ATOM   1666 C  CB    . TYR E 3 119 ? 39.208  -6.714  -33.836 1.00 40.26  ? 118 TYR A CB    1 
ATOM   1667 C  CG    . TYR E 3 119 ? 38.421  -5.753  -34.701 1.00 39.61  ? 118 TYR A CG    1 
ATOM   1668 C  CD1   . TYR E 3 119 ? 37.940  -4.559  -34.180 1.00 39.70  ? 118 TYR A CD1   1 
ATOM   1669 C  CD2   . TYR E 3 119 ? 38.108  -6.058  -36.035 1.00 39.30  ? 118 TYR A CD2   1 
ATOM   1670 C  CE1   . TYR E 3 119 ? 37.197  -3.666  -34.956 1.00 38.41  ? 118 TYR A CE1   1 
ATOM   1671 C  CE2   . TYR E 3 119 ? 37.349  -5.173  -36.814 1.00 38.52  ? 118 TYR A CE2   1 
ATOM   1672 C  CZ    . TYR E 3 119 ? 36.904  -3.974  -36.252 1.00 38.24  ? 118 TYR A CZ    1 
ATOM   1673 O  OH    . TYR E 3 119 ? 36.162  -3.076  -36.959 1.00 37.69  ? 118 TYR A OH    1 
ATOM   1674 N  N     . ARG E 3 120 ? 41.634  -7.826  -31.982 1.00 40.43  ? 119 ARG A N     1 
ATOM   1675 C  CA    . ARG E 3 120 ? 42.081  -8.777  -30.968 1.00 39.91  ? 119 ARG A CA    1 
ATOM   1676 C  C     . ARG E 3 120 ? 42.683  -8.057  -29.761 1.00 39.23  ? 119 ARG A C     1 
ATOM   1677 O  O     . ARG E 3 120 ? 42.561  -8.512  -28.639 1.00 39.37  ? 119 ARG A O     1 
ATOM   1678 C  CB    . ARG E 3 120 ? 43.108  -9.742  -31.574 1.00 40.04  ? 119 ARG A CB    1 
ATOM   1679 C  CG    . ARG E 3 120 ? 43.366  -11.020 -30.741 1.00 41.79  ? 119 ARG A CG    1 
ATOM   1680 C  CD    . ARG E 3 120 ? 44.711  -11.732 -31.032 1.00 42.20  ? 119 ARG A CD    1 
ATOM   1681 N  NE    . ARG E 3 120 ? 45.804  -10.783 -31.243 1.00 44.33  ? 119 ARG A NE    1 
ATOM   1682 C  CZ    . ARG E 3 120 ? 46.542  -10.210 -30.294 1.00 45.51  ? 119 ARG A CZ    1 
ATOM   1683 N  NH1   . ARG E 3 120 ? 46.350  -10.474 -29.005 1.00 45.82  ? 119 ARG A NH1   1 
ATOM   1684 N  NH2   . ARG E 3 120 ? 47.491  -9.357  -30.653 1.00 46.17  ? 119 ARG A NH2   1 
ATOM   1685 N  N     . GLU E 3 121 ? 43.358  -6.943  -29.991 1.00 38.64  ? 120 GLU A N     1 
ATOM   1686 C  CA    . GLU E 3 121 ? 43.936  -6.192  -28.891 1.00 37.94  ? 120 GLU A CA    1 
ATOM   1687 C  C     . GLU E 3 121 ? 42.865  -5.314  -28.262 1.00 36.80  ? 120 GLU A C     1 
ATOM   1688 O  O     . GLU E 3 121 ? 42.939  -5.011  -27.068 1.00 36.41  ? 120 GLU A O     1 
ATOM   1689 C  CB    . GLU E 3 121 ? 45.115  -5.348  -29.363 1.00 38.31  ? 120 GLU A CB    1 
ATOM   1690 C  CG    . GLU E 3 121 ? 46.409  -6.142  -29.551 1.00 39.91  ? 120 GLU A CG    1 
ATOM   1691 C  CD    . GLU E 3 121 ? 47.457  -5.402  -30.395 1.00 42.09  ? 120 GLU A CD    1 
ATOM   1692 O  OE1   . GLU E 3 121 ? 47.641  -4.167  -30.204 1.00 41.91  ? 120 GLU A OE1   1 
ATOM   1693 O  OE2   . GLU E 3 121 ? 48.111  -6.073  -31.239 1.00 43.57  ? 120 GLU A OE2   1 
ATOM   1694 N  N     . ALA E 3 122 ? 41.882  -4.924  -29.078 1.00 35.25  ? 121 ALA A N     1 
ATOM   1695 C  CA    . ALA E 3 122 ? 40.734  -4.147  -28.626 1.00 33.94  ? 121 ALA A CA    1 
ATOM   1696 C  C     . ALA E 3 122 ? 39.851  -4.920  -27.628 1.00 33.63  ? 121 ALA A C     1 
ATOM   1697 O  O     . ALA E 3 122 ? 39.440  -4.391  -26.585 1.00 33.11  ? 121 ALA A O     1 
ATOM   1698 C  CB    . ALA E 3 122 ? 39.921  -3.728  -29.794 1.00 33.24  ? 121 ALA A CB    1 
ATOM   1699 N  N     . TYR E 3 123 ? 39.563  -6.176  -27.965 1.00 32.89  ? 122 TYR A N     1 
ATOM   1700 C  CA    . TYR E 3 123 ? 38.591  -6.984  -27.242 1.00 32.25  ? 122 TYR A CA    1 
ATOM   1701 C  C     . TYR E 3 123 ? 39.180  -7.258  -25.845 1.00 32.26  ? 122 TYR A C     1 
ATOM   1702 O  O     . TYR E 3 123 ? 38.488  -7.267  -24.802 1.00 32.55  ? 122 TYR A O     1 
ATOM   1703 C  CB    . TYR E 3 123 ? 38.348  -8.258  -28.053 1.00 31.81  ? 122 TYR A CB    1 
ATOM   1704 C  CG    . TYR E 3 123 ? 37.484  -9.315  -27.406 1.00 31.34  ? 122 TYR A CG    1 
ATOM   1705 C  CD1   . TYR E 3 123 ? 36.236  -9.633  -27.922 1.00 31.24  ? 122 TYR A CD1   1 
ATOM   1706 C  CD2   . TYR E 3 123 ? 37.917  -9.991  -26.300 1.00 30.69  ? 122 TYR A CD2   1 
ATOM   1707 C  CE1   . TYR E 3 123 ? 35.449  -10.605 -27.347 1.00 30.79  ? 122 TYR A CE1   1 
ATOM   1708 C  CE2   . TYR E 3 123 ? 37.149  -10.943 -25.716 1.00 31.48  ? 122 TYR A CE2   1 
ATOM   1709 C  CZ    . TYR E 3 123 ? 35.917  -11.265 -26.233 1.00 31.14  ? 122 TYR A CZ    1 
ATOM   1710 O  OH    . TYR E 3 123 ? 35.175  -12.251 -25.605 1.00 30.58  ? 122 TYR A OH    1 
ATOM   1711 N  N     . ASN E 3 124 ? 40.488  -7.458  -25.846 1.00 31.39  ? 123 ASN A N     1 
ATOM   1712 C  CA    . ASN E 3 124 ? 41.263  -7.450  -24.633 1.00 30.57  ? 123 ASN A CA    1 
ATOM   1713 C  C     . ASN E 3 124 ? 41.211  -6.132  -23.832 1.00 29.60  ? 123 ASN A C     1 
ATOM   1714 O  O     . ASN E 3 124 ? 41.070  -6.169  -22.597 1.00 29.09  ? 123 ASN A O     1 
ATOM   1715 C  CB    . ASN E 3 124 ? 42.689  -7.812  -24.982 1.00 30.69  ? 123 ASN A CB    1 
ATOM   1716 C  CG    . ASN E 3 124 ? 42.847  -9.281  -25.173 1.00 32.33  ? 123 ASN A CG    1 
ATOM   1717 O  OD1   . ASN E 3 124 ? 42.986  -9.770  -26.320 1.00 32.51  ? 123 ASN A OD1   1 
ATOM   1718 N  ND2   . ASN E 3 124 ? 42.799  -10.032 -24.037 1.00 32.79  ? 123 ASN A ND2   1 
ATOM   1719 N  N     . LEU E 3 125 ? 41.360  -4.997  -24.534 1.00 27.90  ? 124 LEU A N     1 
ATOM   1720 C  CA    . LEU E 3 125 ? 41.226  -3.692  -23.908 1.00 26.77  ? 124 LEU A CA    1 
ATOM   1721 C  C     . LEU E 3 125 ? 39.832  -3.656  -23.318 1.00 25.76  ? 124 LEU A C     1 
ATOM   1722 O  O     . LEU E 3 125 ? 39.681  -3.263  -22.174 1.00 26.08  ? 124 LEU A O     1 
ATOM   1723 C  CB    . LEU E 3 125 ? 41.431  -2.538  -24.906 1.00 26.77  ? 124 LEU A CB    1 
ATOM   1724 C  CG    . LEU E 3 125 ? 41.532  -1.121  -24.307 1.00 27.43  ? 124 LEU A CG    1 
ATOM   1725 C  CD1   . LEU E 3 125 ? 42.626  -0.973  -23.217 1.00 27.33  ? 124 LEU A CD1   1 
ATOM   1726 C  CD2   . LEU E 3 125 ? 41.696  -0.047  -25.374 1.00 27.24  ? 124 LEU A CD2   1 
ATOM   1727 N  N     . GLY E 3 126 ? 38.852  -4.151  -24.076 1.00 24.42  ? 125 GLY A N     1 
ATOM   1728 C  CA    . GLY E 3 126 ? 37.485  -4.281  -23.637 1.00 23.78  ? 125 GLY A CA    1 
ATOM   1729 C  C     . GLY E 3 126 ? 37.384  -5.025  -22.322 1.00 24.54  ? 125 GLY A C     1 
ATOM   1730 O  O     . GLY E 3 126 ? 36.717  -4.548  -21.393 1.00 25.26  ? 125 GLY A O     1 
ATOM   1731 N  N     . LEU E 3 127 ? 38.049  -6.174  -22.211 1.00 24.00  ? 126 LEU A N     1 
ATOM   1732 C  CA    . LEU E 3 127 ? 37.957  -6.965  -20.989 1.00 23.90  ? 126 LEU A CA    1 
ATOM   1733 C  C     . LEU E 3 127 ? 38.601  -6.248  -19.809 1.00 23.75  ? 126 LEU A C     1 
ATOM   1734 O  O     . LEU E 3 127 ? 38.068  -6.233  -18.685 1.00 22.94  ? 126 LEU A O     1 
ATOM   1735 C  CB    . LEU E 3 127 ? 38.572  -8.371  -21.168 1.00 23.72  ? 126 LEU A CB    1 
ATOM   1736 C  CG    . LEU E 3 127 ? 37.765  -9.435  -21.924 1.00 22.93  ? 126 LEU A CG    1 
ATOM   1737 C  CD1   . LEU E 3 127 ? 38.669  -10.669 -22.272 1.00 21.65  ? 126 LEU A CD1   1 
ATOM   1738 C  CD2   . LEU E 3 127 ? 36.458  -9.868  -21.190 1.00 19.47  ? 126 LEU A CD2   1 
ATOM   1739 N  N     . GLU E 3 128 ? 39.746  -5.638  -20.069 1.00 23.97  ? 127 GLU A N     1 
ATOM   1740 C  CA    . GLU E 3 128 ? 40.333  -4.810  -19.045 1.00 24.95  ? 127 GLU A CA    1 
ATOM   1741 C  C     . GLU E 3 128 ? 39.367  -3.677  -18.578 1.00 25.11  ? 127 GLU A C     1 
ATOM   1742 O  O     . GLU E 3 128 ? 39.218  -3.474  -17.376 1.00 25.63  ? 127 GLU A O     1 
ATOM   1743 C  CB    . GLU E 3 128 ? 41.645  -4.221  -19.485 1.00 24.90  ? 127 GLU A CB    1 
ATOM   1744 C  CG    . GLU E 3 128 ? 42.386  -3.721  -18.280 1.00 29.08  ? 127 GLU A CG    1 
ATOM   1745 C  CD    . GLU E 3 128 ? 43.725  -3.125  -18.589 1.00 34.18  ? 127 GLU A CD    1 
ATOM   1746 O  OE1   . GLU E 3 128 ? 44.503  -3.790  -19.319 1.00 36.83  ? 127 GLU A OE1   1 
ATOM   1747 O  OE2   . GLU E 3 128 ? 43.988  -2.005  -18.078 1.00 35.88  ? 127 GLU A OE2   1 
ATOM   1748 N  N     . ILE E 3 129 ? 38.727  -2.948  -19.509 1.00 24.48  ? 128 ILE A N     1 
ATOM   1749 C  CA    . ILE E 3 129 ? 37.769  -1.923  -19.129 1.00 24.01  ? 128 ILE A CA    1 
ATOM   1750 C  C     . ILE E 3 129 ? 36.715  -2.487  -18.188 1.00 24.07  ? 128 ILE A C     1 
ATOM   1751 O  O     . ILE E 3 129 ? 36.528  -1.976  -17.087 1.00 24.61  ? 128 ILE A O     1 
ATOM   1752 C  CB    . ILE E 3 129 ? 37.089  -1.269  -20.368 1.00 24.40  ? 128 ILE A CB    1 
ATOM   1753 C  CG1   . ILE E 3 129 ? 38.013  -0.249  -20.998 1.00 24.00  ? 128 ILE A CG1   1 
ATOM   1754 C  CG2   . ILE E 3 129 ? 35.727  -0.605  -20.002 1.00 22.00  ? 128 ILE A CG2   1 
ATOM   1755 C  CD1   . ILE E 3 129 ? 37.438  0.276   -22.327 1.00 24.41  ? 128 ILE A CD1   1 
ATOM   1756 N  N     . LYS E 3 130 ? 36.053  -3.558  -18.622 1.00 23.82  ? 129 LYS A N     1 
ATOM   1757 C  CA    . LYS E 3 130 ? 34.961  -4.147  -17.869 1.00 23.77  ? 129 LYS A CA    1 
ATOM   1758 C  C     . LYS E 3 130 ? 35.346  -4.463  -16.428 1.00 23.50  ? 129 LYS A C     1 
ATOM   1759 O  O     . LYS E 3 130 ? 34.657  -4.073  -15.476 1.00 23.42  ? 129 LYS A O     1 
ATOM   1760 C  CB    . LYS E 3 130 ? 34.468  -5.438  -18.547 1.00 23.81  ? 129 LYS A CB    1 
ATOM   1761 C  CG    . LYS E 3 130 ? 33.557  -5.193  -19.744 1.00 23.60  ? 129 LYS A CG    1 
ATOM   1762 C  CD    . LYS E 3 130 ? 33.431  -6.432  -20.628 1.00 23.05  ? 129 LYS A CD    1 
ATOM   1763 C  CE    . LYS E 3 130 ? 32.693  -7.555  -19.934 1.00 24.22  ? 129 LYS A CE    1 
ATOM   1764 N  NZ    . LYS E 3 130 ? 31.320  -7.147  -19.614 1.00 26.61  ? 129 LYS A NZ    1 
ATOM   1765 N  N     . ASN E 3 131 ? 36.438  -5.199  -16.299 1.00 23.43  ? 130 ASN A N     1 
ATOM   1766 C  CA    . ASN E 3 131 ? 36.851  -5.742  -15.043 1.00 23.58  ? 130 ASN A CA    1 
ATOM   1767 C  C     . ASN E 3 131 ? 37.295  -4.667  -14.111 1.00 23.26  ? 130 ASN A C     1 
ATOM   1768 O  O     . ASN E 3 131 ? 37.028  -4.742  -12.913 1.00 23.32  ? 130 ASN A O     1 
ATOM   1769 C  CB    . ASN E 3 131 ? 37.991  -6.716  -15.272 1.00 24.24  ? 130 ASN A CB    1 
ATOM   1770 C  CG    . ASN E 3 131 ? 37.562  -7.913  -16.078 1.00 26.34  ? 130 ASN A CG    1 
ATOM   1771 O  OD1   . ASN E 3 131 ? 36.413  -8.393  -15.953 1.00 26.77  ? 130 ASN A OD1   1 
ATOM   1772 N  ND2   . ASN E 3 131 ? 38.478  -8.414  -16.924 1.00 28.26  ? 130 ASN A ND2   1 
ATOM   1773 N  N     . LYS E 3 132 ? 37.975  -3.669  -14.655 1.00 22.31  ? 131 LYS A N     1 
ATOM   1774 C  CA    . LYS E 3 132 ? 38.433  -2.579  -13.842 1.00 23.05  ? 131 LYS A CA    1 
ATOM   1775 C  C     . LYS E 3 132 ? 37.210  -1.830  -13.271 1.00 23.08  ? 131 LYS A C     1 
ATOM   1776 O  O     . LYS E 3 132 ? 37.203  -1.427  -12.086 1.00 23.70  ? 131 LYS A O     1 
ATOM   1777 C  CB    . LYS E 3 132 ? 39.335  -1.658  -14.678 1.00 23.92  ? 131 LYS A CB    1 
ATOM   1778 C  CG    . LYS E 3 132 ? 39.744  -0.334  -14.052 1.00 25.11  ? 131 LYS A CG    1 
ATOM   1779 C  CD    . LYS E 3 132 ? 40.600  -0.533  -12.783 1.00 28.36  ? 131 LYS A CD    1 
ATOM   1780 C  CE    . LYS E 3 132 ? 41.902  -1.311  -13.041 1.00 30.97  ? 131 LYS A CE    1 
ATOM   1781 N  NZ    . LYS E 3 132 ? 42.498  -1.881  -11.771 1.00 31.84  ? 131 LYS A NZ    1 
ATOM   1782 N  N     . ILE E 3 133 ? 36.168  -1.673  -14.084 1.00 22.25  ? 132 ILE A N     1 
ATOM   1783 C  CA    . ILE E 3 133 ? 34.981  -0.973  -13.633 1.00 21.45  ? 132 ILE A CA    1 
ATOM   1784 C  C     . ILE E 3 133 ? 34.241  -1.738  -12.581 1.00 22.70  ? 132 ILE A C     1 
ATOM   1785 O  O     . ILE E 3 133 ? 33.698  -1.109  -11.642 1.00 22.95  ? 132 ILE A O     1 
ATOM   1786 C  CB    . ILE E 3 133 ? 34.043  -0.680  -14.767 1.00 21.04  ? 132 ILE A CB    1 
ATOM   1787 C  CG1   . ILE E 3 133 ? 34.600  0.487   -15.607 1.00 18.83  ? 132 ILE A CG1   1 
ATOM   1788 C  CG2   . ILE E 3 133 ? 32.651  -0.405  -14.229 1.00 19.02  ? 132 ILE A CG2   1 
ATOM   1789 C  CD1   . ILE E 3 133 ? 34.120  0.444   -17.046 1.00 14.42  ? 132 ILE A CD1   1 
ATOM   1790 N  N     . LEU E 3 134 ? 34.212  -3.074  -12.733 1.00 23.34  ? 133 LEU A N     1 
ATOM   1791 C  CA    . LEU E 3 134 ? 33.467  -3.972  -11.817 1.00 24.67  ? 133 LEU A CA    1 
ATOM   1792 C  C     . LEU E 3 134 ? 34.197  -4.101  -10.469 1.00 26.11  ? 133 LEU A C     1 
ATOM   1793 O  O     . LEU E 3 134 ? 33.591  -4.290  -9.407  1.00 26.56  ? 133 LEU A O     1 
ATOM   1794 C  CB    . LEU E 3 134 ? 33.250  -5.346  -12.447 1.00 24.21  ? 133 LEU A CB    1 
ATOM   1795 C  CG    . LEU E 3 134 ? 32.607  -6.429  -11.576 1.00 24.26  ? 133 LEU A CG    1 
ATOM   1796 C  CD1   . LEU E 3 134 ? 31.056  -6.363  -11.614 1.00 20.90  ? 133 LEU A CD1   1 
ATOM   1797 C  CD2   . LEU E 3 134 ? 33.132  -7.833  -11.961 1.00 22.30  ? 133 LEU A CD2   1 
ATOM   1798 N  N     . GLU E 3 135 ? 35.510  -3.919  -10.534 1.00 27.58  ? 134 GLU A N     1 
ATOM   1799 C  CA    . GLU E 3 135 ? 36.420  -3.965  -9.402  1.00 28.34  ? 134 GLU A CA    1 
ATOM   1800 C  C     . GLU E 3 135 ? 36.154  -2.763  -8.533  1.00 28.18  ? 134 GLU A C     1 
ATOM   1801 O  O     . GLU E 3 135 ? 35.921  -2.886  -7.332  1.00 28.81  ? 134 GLU A O     1 
ATOM   1802 C  CB    . GLU E 3 135 ? 37.852  -3.866  -9.952  1.00 29.13  ? 134 GLU A CB    1 
ATOM   1803 C  CG    . GLU E 3 135 ? 38.952  -4.306  -8.985  1.00 32.10  ? 134 GLU A CG    1 
ATOM   1804 C  CD    . GLU E 3 135 ? 40.363  -4.140  -9.554  1.00 34.93  ? 134 GLU A CD    1 
ATOM   1805 O  OE1   . GLU E 3 135 ? 41.295  -4.033  -8.726  1.00 34.65  ? 134 GLU A OE1   1 
ATOM   1806 O  OE2   . GLU E 3 135 ? 40.536  -4.115  -10.807 1.00 36.13  ? 134 GLU A OE2   1 
ATOM   1807 N  N     . LYS E 3 136 ? 36.141  -1.594  -9.159  1.00 27.50  ? 135 LYS A N     1 
ATOM   1808 C  CA    . LYS E 3 136 ? 36.110  -0.338  -8.414  1.00 26.75  ? 135 LYS A CA    1 
ATOM   1809 C  C     . LYS E 3 136 ? 34.707  0.063   -8.018  1.00 26.14  ? 135 LYS A C     1 
ATOM   1810 O  O     . LYS E 3 136 ? 34.528  0.745   -6.993  1.00 26.70  ? 135 LYS A O     1 
ATOM   1811 C  CB    . LYS E 3 136 ? 36.740  0.792   -9.238  1.00 26.68  ? 135 LYS A CB    1 
ATOM   1812 C  CG    . LYS E 3 136 ? 38.161  0.538   -9.620  1.00 27.29  ? 135 LYS A CG    1 
ATOM   1813 C  CD    . LYS E 3 136 ? 39.093  1.348   -8.743  1.00 29.66  ? 135 LYS A CD    1 
ATOM   1814 C  CE    . LYS E 3 136 ? 40.549  1.241   -9.217  1.00 29.56  ? 135 LYS A CE    1 
ATOM   1815 N  NZ    . LYS E 3 136 ? 41.459  1.132   -8.019  1.00 31.05  ? 135 LYS A NZ    1 
ATOM   1816 N  N     . GLU E 3 137 ? 33.713  -0.306  -8.831  1.00 25.02  ? 136 GLU A N     1 
ATOM   1817 C  CA    . GLU E 3 137 ? 32.330  0.104   -8.548  1.00 24.22  ? 136 GLU A CA    1 
ATOM   1818 C  C     . GLU E 3 137 ? 31.350  -1.064  -8.467  1.00 22.99  ? 136 GLU A C     1 
ATOM   1819 O  O     . GLU E 3 137 ? 30.165  -0.895  -8.300  1.00 22.49  ? 136 GLU A O     1 
ATOM   1820 C  CB    . GLU E 3 137 ? 31.850  1.092   -9.606  1.00 24.60  ? 136 GLU A CB    1 
ATOM   1821 C  CG    . GLU E 3 137 ? 32.756  2.255   -9.860  1.00 26.78  ? 136 GLU A CG    1 
ATOM   1822 C  CD    . GLU E 3 137 ? 32.694  3.327   -8.777  1.00 30.37  ? 136 GLU A CD    1 
ATOM   1823 O  OE1   . GLU E 3 137 ? 31.686  3.385   -8.056  1.00 30.86  ? 136 GLU A OE1   1 
ATOM   1824 O  OE2   . GLU E 3 137 ? 33.660  4.121   -8.659  1.00 33.54  ? 136 GLU A OE2   1 
ATOM   1825 N  N     . LYS E 3 138 ? 31.837  -2.274  -8.621  1.00 23.11  ? 137 LYS A N     1 
ATOM   1826 C  CA    . LYS E 3 138 ? 30.939  -3.426  -8.536  1.00 22.58  ? 137 LYS A CA    1 
ATOM   1827 C  C     . LYS E 3 138 ? 29.747  -3.310  -9.518  1.00 21.34  ? 137 LYS A C     1 
ATOM   1828 O  O     . LYS E 3 138 ? 28.703  -3.907  -9.257  1.00 22.39  ? 137 LYS A O     1 
ATOM   1829 C  CB    . LYS E 3 138 ? 30.513  -3.612  -7.072  1.00 23.19  ? 137 LYS A CB    1 
ATOM   1830 C  CG    . LYS E 3 138 ? 29.977  -4.986  -6.709  1.00 26.32  ? 137 LYS A CG    1 
ATOM   1831 C  CD    . LYS E 3 138 ? 29.734  -5.126  -5.205  1.00 28.68  ? 137 LYS A CD    1 
ATOM   1832 C  CE    . LYS E 3 138 ? 28.651  -6.184  -4.921  1.00 32.74  ? 137 LYS A CE    1 
ATOM   1833 N  NZ    . LYS E 3 138 ? 27.420  -6.208  -5.881  1.00 31.12  ? 137 LYS A NZ    1 
ATOM   1834 N  N     . ILE E 3 139 ? 29.928  -2.570  -10.637 1.00 18.74  ? 138 ILE A N     1 
ATOM   1835 C  CA    . ILE E 3 139 ? 28.934  -2.415  -11.700 1.00 17.18  ? 138 ILE A CA    1 
ATOM   1836 C  C     . ILE E 3 139 ? 29.311  -3.117  -13.018 1.00 17.00  ? 138 ILE A C     1 
ATOM   1837 O  O     . ILE E 3 139 ? 30.440  -2.964  -13.511 1.00 16.51  ? 138 ILE A O     1 
ATOM   1838 C  CB    . ILE E 3 139 ? 28.733  -0.916  -12.063 1.00 16.82  ? 138 ILE A CB    1 
ATOM   1839 C  CG1   . ILE E 3 139 ? 27.952  -0.149  -11.002 1.00 16.88  ? 138 ILE A CG1   1 
ATOM   1840 C  CG2   . ILE E 3 139 ? 28.076  -0.737  -13.419 1.00 15.60  ? 138 ILE A CG2   1 
ATOM   1841 C  CD1   . ILE E 3 139 ? 26.491  -0.581  -10.868 1.00 19.19  ? 138 ILE A CD1   1 
ATOM   1842 N  N     . THR E 3 140 ? 28.377  -3.858  -13.600 1.00 16.66  ? 139 THR A N     1 
ATOM   1843 C  CA    . THR E 3 140 ? 28.684  -4.615  -14.820 1.00 18.36  ? 139 THR A CA    1 
ATOM   1844 C  C     . THR E 3 140 ? 28.362  -3.783  -16.050 1.00 18.86  ? 139 THR A C     1 
ATOM   1845 O  O     . THR E 3 140 ? 27.280  -3.159  -16.102 1.00 19.24  ? 139 THR A O     1 
ATOM   1846 C  CB    . THR E 3 140 ? 27.913  -5.999  -14.949 1.00 18.80  ? 139 THR A CB    1 
ATOM   1847 O  OG1   . THR E 3 140 ? 26.509  -5.802  -15.271 1.00 18.87  ? 139 THR A OG1   1 
ATOM   1848 C  CG2   . THR E 3 140 ? 28.089  -6.829  -13.708 1.00 16.93  ? 139 THR A CG2   1 
ATOM   1849 N  N     . VAL E 3 141 ? 29.304  -3.726  -16.997 1.00 18.53  ? 140 VAL A N     1 
ATOM   1850 C  CA    . VAL E 3 141 ? 29.041  -2.992  -18.233 1.00 19.25  ? 140 VAL A CA    1 
ATOM   1851 C  C     . VAL E 3 141 ? 29.065  -3.907  -19.399 1.00 20.02  ? 140 VAL A C     1 
ATOM   1852 O  O     . VAL E 3 141 ? 29.369  -5.099  -19.239 1.00 19.85  ? 140 VAL A O     1 
ATOM   1853 C  CB    . VAL E 3 141 ? 29.957  -1.785  -18.439 1.00 19.30  ? 140 VAL A CB    1 
ATOM   1854 C  CG1   . VAL E 3 141 ? 29.981  -0.949  -17.114 1.00 18.47  ? 140 VAL A CG1   1 
ATOM   1855 C  CG2   . VAL E 3 141 ? 31.384  -2.229  -18.884 1.00 18.64  ? 140 VAL A CG2   1 
ATOM   1856 N  N     . THR E 3 142 ? 28.691  -3.369  -20.565 1.00 21.22  ? 141 THR A N     1 
ATOM   1857 C  CA    . THR E 3 142 ? 28.830  -4.129  -21.799 1.00 21.79  ? 141 THR A CA    1 
ATOM   1858 C  C     . THR E 3 142 ? 29.629  -3.384  -22.785 1.00 22.89  ? 141 THR A C     1 
ATOM   1859 O  O     . THR E 3 142 ? 29.420  -2.180  -22.983 1.00 24.28  ? 141 THR A O     1 
ATOM   1860 C  CB    . THR E 3 142 ? 27.521  -4.540  -22.412 1.00 21.89  ? 141 THR A CB    1 
ATOM   1861 O  OG1   . THR E 3 142 ? 26.680  -5.127  -21.389 1.00 21.46  ? 141 THR A OG1   1 
ATOM   1862 C  CG2   . THR E 3 142 ? 27.812  -5.573  -23.524 1.00 22.06  ? 141 THR A CG2   1 
ATOM   1863 N  N     . VAL E 3 143 ? 30.564  -4.099  -23.404 1.00 23.40  ? 142 VAL A N     1 
ATOM   1864 C  CA    . VAL E 3 143 ? 31.505  -3.486  -24.310 1.00 23.54  ? 142 VAL A CA    1 
ATOM   1865 C  C     . VAL E 3 143 ? 31.299  -3.909  -25.753 1.00 24.08  ? 142 VAL A C     1 
ATOM   1866 O  O     . VAL E 3 143 ? 31.140  -5.104  -26.063 1.00 24.08  ? 142 VAL A O     1 
ATOM   1867 C  CB    . VAL E 3 143 ? 32.934  -3.790  -23.868 1.00 23.72  ? 142 VAL A CB    1 
ATOM   1868 C  CG1   . VAL E 3 143 ? 33.917  -3.424  -24.960 1.00 23.14  ? 142 VAL A CG1   1 
ATOM   1869 C  CG2   . VAL E 3 143 ? 33.243  -3.027  -22.551 1.00 21.93  ? 142 VAL A CG2   1 
ATOM   1870 N  N     . GLY E 3 144 ? 31.301  -2.904  -26.621 1.00 24.15  ? 143 GLY A N     1 
ATOM   1871 C  CA    . GLY E 3 144 ? 30.991  -3.053  -28.020 1.00 24.31  ? 143 GLY A CA    1 
ATOM   1872 C  C     . GLY E 3 144 ? 32.185  -2.473  -28.742 1.00 25.13  ? 143 GLY A C     1 
ATOM   1873 O  O     . GLY E 3 144 ? 32.742  -1.419  -28.322 1.00 25.68  ? 143 GLY A O     1 
ATOM   1874 N  N     . ILE E 3 145 ? 32.599  -3.183  -29.790 1.00 24.35  ? 144 ILE A N     1 
ATOM   1875 C  CA    . ILE E 3 145 ? 33.772  -2.852  -30.541 1.00 24.15  ? 144 ILE A CA    1 
ATOM   1876 C  C     . ILE E 3 145 ? 33.463  -3.030  -32.033 1.00 24.79  ? 144 ILE A C     1 
ATOM   1877 O  O     . ILE E 3 145 ? 33.040  -4.122  -32.469 1.00 23.78  ? 144 ILE A O     1 
ATOM   1878 C  CB    . ILE E 3 145 ? 34.906  -3.777  -30.104 1.00 24.42  ? 144 ILE A CB    1 
ATOM   1879 C  CG1   . ILE E 3 145 ? 35.376  -3.397  -28.698 1.00 23.97  ? 144 ILE A CG1   1 
ATOM   1880 C  CG2   . ILE E 3 145 ? 36.078  -3.747  -31.073 1.00 23.69  ? 144 ILE A CG2   1 
ATOM   1881 C  CD1   . ILE E 3 145 ? 36.810  -3.811  -28.437 1.00 23.38  ? 144 ILE A CD1   1 
ATOM   1882 N  N     . SER E 3 146 ? 33.663  -1.942  -32.793 1.00 25.38  ? 145 SER A N     1 
ATOM   1883 C  CA    . SER E 3 146 ? 33.469  -1.915  -34.226 1.00 26.49  ? 145 SER A CA    1 
ATOM   1884 C  C     . SER E 3 146 ? 34.236  -0.806  -34.977 1.00 27.46  ? 145 SER A C     1 
ATOM   1885 O  O     . SER E 3 146 ? 35.014  -0.038  -34.375 1.00 27.75  ? 145 SER A O     1 
ATOM   1886 C  CB    . SER E 3 146 ? 31.980  -1.819  -34.554 1.00 26.63  ? 145 SER A CB    1 
ATOM   1887 O  OG    . SER E 3 146 ? 31.743  -2.122  -35.939 1.00 26.93  ? 145 SER A OG    1 
ATOM   1888 N  N     . LYS E 3 147 ? 33.985  -0.725  -36.291 1.00 27.59  ? 146 LYS A N     1 
ATOM   1889 C  CA    . LYS E 3 147 ? 34.674  0.201   -37.165 1.00 28.46  ? 146 LYS A CA    1 
ATOM   1890 C  C     . LYS E 3 147 ? 34.184  1.653   -37.093 1.00 28.49  ? 146 LYS A C     1 
ATOM   1891 O  O     . LYS E 3 147 ? 34.870  2.526   -37.594 1.00 28.65  ? 146 LYS A O     1 
ATOM   1892 C  CB    . LYS E 3 147 ? 34.690  -0.314  -38.626 1.00 28.85  ? 146 LYS A CB    1 
ATOM   1893 C  CG    . LYS E 3 147 ? 33.450  0.030   -39.459 1.00 29.72  ? 146 LYS A CG    1 
ATOM   1894 C  CD    . LYS E 3 147 ? 33.247  -0.940  -40.630 1.00 30.66  ? 146 LYS A CD    1 
ATOM   1895 C  CE    . LYS E 3 147 ? 33.725  -0.371  -41.954 1.00 31.13  ? 146 LYS A CE    1 
ATOM   1896 N  NZ    . LYS E 3 147 ? 33.195  -1.176  -43.092 1.00 31.40  ? 146 LYS A NZ    1 
ATOM   1897 N  N     . ASN E 3 148 ? 33.029  1.906   -36.467 1.00 28.67  ? 147 ASN A N     1 
ATOM   1898 C  CA    . ASN E 3 148 ? 32.450  3.257   -36.315 1.00 28.63  ? 147 ASN A CA    1 
ATOM   1899 C  C     . ASN E 3 148 ? 31.534  3.363   -35.080 1.00 28.42  ? 147 ASN A C     1 
ATOM   1900 O  O     . ASN E 3 148 ? 31.133  2.330   -34.549 1.00 28.26  ? 147 ASN A O     1 
ATOM   1901 C  CB    . ASN E 3 148 ? 31.636  3.585   -37.553 1.00 28.90  ? 147 ASN A CB    1 
ATOM   1902 C  CG    . ASN E 3 148 ? 30.455  2.632   -37.742 1.00 30.29  ? 147 ASN A CG    1 
ATOM   1903 O  OD1   . ASN E 3 148 ? 29.684  2.381   -36.809 1.00 32.55  ? 147 ASN A OD1   1 
ATOM   1904 N  ND2   . ASN E 3 148 ? 30.300  2.104   -38.957 1.00 30.24  ? 147 ASN A ND2   1 
ATOM   1905 N  N     . LYS E 3 149 ? 31.148  4.575   -34.654 1.00 28.21  ? 148 LYS A N     1 
ATOM   1906 C  CA    . LYS E 3 149 ? 30.228  4.731   -33.481 1.00 28.28  ? 148 LYS A CA    1 
ATOM   1907 C  C     . LYS E 3 149 ? 28.976  3.871   -33.491 1.00 28.41  ? 148 LYS A C     1 
ATOM   1908 O  O     . LYS E 3 149 ? 28.581  3.262   -32.466 1.00 28.39  ? 148 LYS A O     1 
ATOM   1909 C  CB    . LYS E 3 149 ? 29.774  6.163   -33.263 1.00 28.06  ? 148 LYS A CB    1 
ATOM   1910 C  CG    . LYS E 3 149 ? 30.783  7.007   -32.548 1.00 29.44  ? 148 LYS A CG    1 
ATOM   1911 C  CD    . LYS E 3 149 ? 30.279  8.418   -32.264 1.00 30.08  ? 148 LYS A CD    1 
ATOM   1912 C  CE    . LYS E 3 149 ? 30.193  9.301   -33.509 1.00 30.13  ? 148 LYS A CE    1 
ATOM   1913 N  NZ    . LYS E 3 149 ? 29.873  10.721  -33.045 1.00 29.57  ? 148 LYS A NZ    1 
ATOM   1914 N  N     . VAL E 3 150 ? 28.319  3.844   -34.633 1.00 28.09  ? 149 VAL A N     1 
ATOM   1915 C  CA    . VAL E 3 150 ? 27.010  3.224   -34.666 1.00 28.17  ? 149 VAL A CA    1 
ATOM   1916 C  C     . VAL E 3 150 ? 27.094  1.711   -34.517 1.00 28.09  ? 149 VAL A C     1 
ATOM   1917 O  O     . VAL E 3 150 ? 26.259  1.108   -33.846 1.00 29.08  ? 149 VAL A O     1 
ATOM   1918 C  CB    . VAL E 3 150 ? 26.260  3.595   -35.928 1.00 28.19  ? 149 VAL A CB    1 
ATOM   1919 C  CG1   . VAL E 3 150 ? 25.074  2.665   -36.104 1.00 27.76  ? 149 VAL A CG1   1 
ATOM   1920 C  CG2   . VAL E 3 150 ? 25.847  5.069   -35.855 1.00 27.92  ? 149 VAL A CG2   1 
ATOM   1921 N  N     . PHE E 3 151 ? 28.107  1.096   -35.109 1.00 26.93  ? 150 PHE A N     1 
ATOM   1922 C  CA    . PHE E 3 151 ? 28.229  -0.355  -34.997 1.00 26.00  ? 150 PHE A CA    1 
ATOM   1923 C  C     . PHE E 3 151 ? 28.918  -0.781  -33.698 1.00 25.54  ? 150 PHE A C     1 
ATOM   1924 O  O     . PHE E 3 151 ? 28.905  -1.972  -33.312 1.00 25.76  ? 150 PHE A O     1 
ATOM   1925 C  CB    . PHE E 3 151 ? 28.882  -0.963  -36.258 1.00 25.82  ? 150 PHE A CB    1 
ATOM   1926 C  CG    . PHE E 3 151 ? 27.974  -0.962  -37.473 1.00 25.67  ? 150 PHE A CG    1 
ATOM   1927 C  CD1   . PHE E 3 151 ? 27.104  -2.021  -37.709 1.00 26.08  ? 150 PHE A CD1   1 
ATOM   1928 C  CD2   . PHE E 3 151 ? 27.984  0.109   -38.365 1.00 25.96  ? 150 PHE A CD2   1 
ATOM   1929 C  CE1   . PHE E 3 151 ? 26.252  -2.016  -38.823 1.00 28.14  ? 150 PHE A CE1   1 
ATOM   1930 C  CE2   . PHE E 3 151 ? 27.155  0.126   -39.474 1.00 27.38  ? 150 PHE A CE2   1 
ATOM   1931 C  CZ    . PHE E 3 151 ? 26.285  -0.947  -39.716 1.00 28.59  ? 150 PHE A CZ    1 
ATOM   1932 N  N     . ALA E 3 152 ? 29.520  0.185   -33.015 1.00 24.80  ? 151 ALA A N     1 
ATOM   1933 C  CA    . ALA E 3 152 ? 30.019  -0.058  -31.660 1.00 24.65  ? 151 ALA A CA    1 
ATOM   1934 C  C     . ALA E 3 152 ? 28.799  -0.277  -30.749 1.00 24.80  ? 151 ALA A C     1 
ATOM   1935 O  O     . ALA E 3 152 ? 28.723  -1.265  -30.017 1.00 24.76  ? 151 ALA A O     1 
ATOM   1936 C  CB    . ALA E 3 152 ? 30.916  1.097   -31.182 1.00 23.62  ? 151 ALA A CB    1 
ATOM   1937 N  N     . LYS E 3 153 ? 27.829  0.630   -30.878 1.00 25.25  ? 152 LYS A N     1 
ATOM   1938 C  CA    . LYS E 3 153 ? 26.566  0.632   -30.126 1.00 25.57  ? 152 LYS A CA    1 
ATOM   1939 C  C     . LYS E 3 153 ? 25.782  -0.642  -30.399 1.00 25.84  ? 152 LYS A C     1 
ATOM   1940 O  O     . LYS E 3 153 ? 25.235  -1.255  -29.500 1.00 26.69  ? 152 LYS A O     1 
ATOM   1941 C  CB    . LYS E 3 153 ? 25.729  1.843   -30.545 1.00 25.42  ? 152 LYS A CB    1 
ATOM   1942 C  CG    . LYS E 3 153 ? 25.059  2.601   -29.399 1.00 26.09  ? 152 LYS A CG    1 
ATOM   1943 C  CD    . LYS E 3 153 ? 23.834  1.855   -28.890 1.00 28.65  ? 152 LYS A CD    1 
ATOM   1944 C  CE    . LYS E 3 153 ? 23.252  2.520   -27.671 1.00 26.68  ? 152 LYS A CE    1 
ATOM   1945 N  NZ    . LYS E 3 153 ? 22.829  3.873   -27.969 1.00 27.52  ? 152 LYS A NZ    1 
ATOM   1946 N  N     . ILE E 3 154 ? 25.745  -1.045  -31.654 1.00 25.79  ? 153 ILE A N     1 
ATOM   1947 C  CA    . ILE E 3 154 ? 24.913  -2.141  -32.058 1.00 25.72  ? 153 ILE A CA    1 
ATOM   1948 C  C     . ILE E 3 154 ? 25.511  -3.411  -31.457 1.00 25.85  ? 153 ILE A C     1 
ATOM   1949 O  O     . ILE E 3 154 ? 24.787  -4.239  -30.922 1.00 26.13  ? 153 ILE A O     1 
ATOM   1950 C  CB    . ILE E 3 154 ? 24.837  -2.195  -33.609 1.00 25.54  ? 153 ILE A CB    1 
ATOM   1951 C  CG1   . ILE E 3 154 ? 24.396  -0.826  -34.128 1.00 24.84  ? 153 ILE A CG1   1 
ATOM   1952 C  CG2   . ILE E 3 154 ? 23.896  -3.319  -34.073 1.00 26.04  ? 153 ILE A CG2   1 
ATOM   1953 C  CD1   . ILE E 3 154 ? 23.850  -0.793  -35.583 1.00 25.23  ? 153 ILE A CD1   1 
ATOM   1954 N  N     . ALA E 3 155 ? 26.839  -3.526  -31.531 1.00 25.74  ? 154 ALA A N     1 
ATOM   1955 C  CA    . ALA E 3 155 ? 27.577  -4.638  -30.952 1.00 25.40  ? 154 ALA A CA    1 
ATOM   1956 C  C     . ALA E 3 155 ? 27.310  -4.808  -29.473 1.00 26.20  ? 154 ALA A C     1 
ATOM   1957 O  O     . ALA E 3 155 ? 27.210  -5.937  -29.008 1.00 27.23  ? 154 ALA A O     1 
ATOM   1958 C  CB    . ALA E 3 155 ? 29.046  -4.468  -31.191 1.00 25.06  ? 154 ALA A CB    1 
ATOM   1959 N  N     . ALA E 3 156 ? 27.208  -3.711  -28.728 1.00 26.42  ? 155 ALA A N     1 
ATOM   1960 C  CA    . ALA E 3 156 ? 26.847  -3.792  -27.301 1.00 26.99  ? 155 ALA A CA    1 
ATOM   1961 C  C     . ALA E 3 156 ? 25.393  -4.221  -27.056 1.00 27.55  ? 155 ALA A C     1 
ATOM   1962 O  O     . ALA E 3 156 ? 25.078  -4.878  -26.059 1.00 26.98  ? 155 ALA A O     1 
ATOM   1963 C  CB    . ALA E 3 156 ? 27.119  -2.453  -26.599 1.00 26.72  ? 155 ALA A CB    1 
ATOM   1964 N  N     . ASP E 3 157 ? 24.498  -3.822  -27.950 1.00 28.99  ? 156 ASP A N     1 
ATOM   1965 C  CA    . ASP E 3 157 ? 23.113  -4.263  -27.853 1.00 30.37  ? 156 ASP A CA    1 
ATOM   1966 C  C     . ASP E 3 157 ? 22.982  -5.772  -28.008 1.00 31.26  ? 156 ASP A C     1 
ATOM   1967 O  O     . ASP E 3 157 ? 22.131  -6.399  -27.346 1.00 32.25  ? 156 ASP A O     1 
ATOM   1968 C  CB    . ASP E 3 157 ? 22.255  -3.589  -28.896 1.00 30.68  ? 156 ASP A CB    1 
ATOM   1969 C  CG    . ASP E 3 157 ? 22.067  -2.137  -28.627 1.00 31.58  ? 156 ASP A CG    1 
ATOM   1970 O  OD1   . ASP E 3 157 ? 22.111  -1.700  -27.442 1.00 34.00  ? 156 ASP A OD1   1 
ATOM   1971 O  OD2   . ASP E 3 157 ? 21.850  -1.435  -29.619 1.00 32.91  ? 156 ASP A OD2   1 
ATOM   1972 N  N     . MET E 3 158 ? 23.835  -6.371  -28.830 1.00 30.87  ? 157 MET A N     1 
ATOM   1973 C  CA    . MET E 3 158 ? 23.714  -7.811  -29.025 1.00 31.26  ? 157 MET A CA    1 
ATOM   1974 C  C     . MET E 3 158 ? 24.277  -8.617  -27.858 1.00 30.58  ? 157 MET A C     1 
ATOM   1975 O  O     . MET E 3 158 ? 23.877  -9.783  -27.647 1.00 31.43  ? 157 MET A O     1 
ATOM   1976 C  CB    . MET E 3 158 ? 24.308  -8.243  -30.384 1.00 32.02  ? 157 MET A CB    1 
ATOM   1977 C  CG    . MET E 3 158 ? 24.136  -7.143  -31.466 1.00 34.19  ? 157 MET A CG    1 
ATOM   1978 S  SD    . MET E 3 158 ? 24.318  -7.589  -33.190 1.00 39.31  ? 157 MET A SD    1 
ATOM   1979 C  CE    . MET E 3 158 ? 25.956  -8.334  -33.122 1.00 38.19  ? 157 MET A CE    1 
ATOM   1980 N  N     . ALA E 3 159 ? 25.177  -8.026  -27.078 1.00 29.56  ? 158 ALA A N     1 
ATOM   1981 C  CA    . ALA E 3 159 ? 25.754  -8.769  -25.950 1.00 28.91  ? 158 ALA A CA    1 
ATOM   1982 C  C     . ALA E 3 159 ? 25.331  -8.324  -24.548 1.00 28.74  ? 158 ALA A C     1 
ATOM   1983 O  O     . ALA E 3 159 ? 25.909  -8.813  -23.566 1.00 28.43  ? 158 ALA A O     1 
ATOM   1984 C  CB    . ALA E 3 159 ? 27.238  -8.790  -26.052 1.00 28.80  ? 158 ALA A CB    1 
ATOM   1985 N  N     . LYS E 3 160 ? 24.372  -7.383  -24.455 1.00 28.71  ? 159 LYS A N     1 
ATOM   1986 C  CA    . LYS E 3 160 ? 23.828  -6.890  -23.148 1.00 28.48  ? 159 LYS A CA    1 
ATOM   1987 C  C     . LYS E 3 160 ? 23.005  -7.963  -22.451 1.00 28.16  ? 159 LYS A C     1 
ATOM   1988 O  O     . LYS E 3 160 ? 22.101  -8.527  -23.068 1.00 28.96  ? 159 LYS A O     1 
ATOM   1989 C  CB    . LYS E 3 160 ? 22.997  -5.586  -23.260 1.00 28.17  ? 159 LYS A CB    1 
ATOM   1990 C  CG    . LYS E 3 160 ? 21.636  -5.704  -23.945 1.00 30.47  ? 159 LYS A CG    1 
ATOM   1991 C  CD    . LYS E 3 160 ? 20.680  -4.536  -23.650 1.00 32.00  ? 159 LYS A CD    1 
ATOM   1992 C  CE    . LYS E 3 160 ? 21.252  -3.209  -24.055 1.00 33.32  ? 159 LYS A CE    1 
ATOM   1993 N  NZ    . LYS E 3 160 ? 20.243  -2.394  -24.800 1.00 34.42  ? 159 LYS A NZ    1 
ATOM   1994 N  N     . PRO E 3 161 ? 23.273  -8.213  -21.155 1.00 27.41  ? 160 PRO A N     1 
ATOM   1995 C  CA    . PRO E 3 161 ? 24.152  -7.441  -20.254 1.00 27.03  ? 160 PRO A CA    1 
ATOM   1996 C  C     . PRO E 3 161 ? 25.495  -8.105  -20.010 1.00 26.80  ? 160 PRO A C     1 
ATOM   1997 O  O     . PRO E 3 161 ? 25.705  -9.216  -20.463 1.00 27.37  ? 160 PRO A O     1 
ATOM   1998 C  CB    . PRO E 3 161 ? 23.360  -7.437  -18.957 1.00 27.24  ? 160 PRO A CB    1 
ATOM   1999 C  CG    . PRO E 3 161 ? 22.732  -8.892  -18.949 1.00 27.30  ? 160 PRO A CG    1 
ATOM   2000 C  CD    . PRO E 3 161 ? 22.456  -9.199  -20.421 1.00 27.09  ? 160 PRO A CD    1 
ATOM   2001 N  N     . ASN E 3 162 ? 26.340  -7.445  -19.221 1.00 26.70  ? 161 ASN A N     1 
ATOM   2002 C  CA    . ASN E 3 162 ? 27.612  -8.013  -18.801 1.00 27.40  ? 161 ASN A CA    1 
ATOM   2003 C  C     . ASN E 3 162 ? 28.169  -8.899  -19.894 1.00 27.95  ? 161 ASN A C     1 
ATOM   2004 O  O     . ASN E 3 162 ? 27.776  -10.057 -20.032 1.00 29.01  ? 161 ASN A O     1 
ATOM   2005 C  CB    . ASN E 3 162 ? 27.445  -8.810  -17.507 1.00 27.53  ? 161 ASN A CB    1 
ATOM   2006 C  CG    . ASN E 3 162 ? 28.723  -9.508  -17.084 1.00 28.60  ? 161 ASN A CG    1 
ATOM   2007 O  OD1   . ASN E 3 162 ? 29.824  -9.017  -17.333 1.00 30.65  ? 161 ASN A OD1   1 
ATOM   2008 N  ND2   . ASN E 3 162 ? 28.582  -10.660 -16.439 1.00 28.29  ? 161 ASN A ND2   1 
ATOM   2009 N  N     . GLY E 3 163 ? 29.080  -8.344  -20.681 1.00 28.25  ? 162 GLY A N     1 
ATOM   2010 C  CA    . GLY E 3 163 ? 29.574  -9.043  -21.842 1.00 27.93  ? 162 GLY A CA    1 
ATOM   2011 C  C     . GLY E 3 163 ? 30.282  -8.111  -22.789 1.00 27.60  ? 162 GLY A C     1 
ATOM   2012 O  O     . GLY E 3 163 ? 30.602  -6.978  -22.443 1.00 27.79  ? 162 GLY A O     1 
ATOM   2013 N  N     . ILE E 3 164 ? 30.558  -8.621  -23.978 1.00 27.10  ? 163 ILE A N     1 
ATOM   2014 C  CA    . ILE E 3 164 ? 31.483  -7.981  -24.882 1.00 26.47  ? 163 ILE A CA    1 
ATOM   2015 C  C     . ILE E 3 164 ? 31.275  -8.599  -26.246 1.00 26.93  ? 163 ILE A C     1 
ATOM   2016 O  O     . ILE E 3 164 ? 31.147  -9.824  -26.335 1.00 26.42  ? 163 ILE A O     1 
ATOM   2017 C  CB    . ILE E 3 164 ? 32.925  -8.213  -24.419 1.00 25.92  ? 163 ILE A CB    1 
ATOM   2018 C  CG1   . ILE E 3 164 ? 33.924  -7.510  -25.365 1.00 25.21  ? 163 ILE A CG1   1 
ATOM   2019 C  CG2   . ILE E 3 164 ? 33.174  -9.700  -24.278 1.00 25.27  ? 163 ILE A CG2   1 
ATOM   2020 C  CD1   . ILE E 3 164 ? 35.333  -7.397  -24.810 1.00 22.91  ? 163 ILE A CD1   1 
ATOM   2021 N  N     . LYS E 3 165 ? 31.234  -7.755  -27.289 1.00 27.34  ? 164 LYS A N     1 
ATOM   2022 C  CA    . LYS E 3 165 ? 31.029  -8.228  -28.673 1.00 28.17  ? 164 LYS A CA    1 
ATOM   2023 C  C     . LYS E 3 165 ? 31.648  -7.343  -29.741 1.00 28.32  ? 164 LYS A C     1 
ATOM   2024 O  O     . LYS E 3 165 ? 31.358  -6.137  -29.812 1.00 28.52  ? 164 LYS A O     1 
ATOM   2025 C  CB    . LYS E 3 165 ? 29.541  -8.371  -28.983 1.00 28.93  ? 164 LYS A CB    1 
ATOM   2026 C  CG    . LYS E 3 165 ? 29.187  -8.538  -30.486 1.00 29.71  ? 164 LYS A CG    1 
ATOM   2027 C  CD    . LYS E 3 165 ? 29.102  -9.983  -30.887 1.00 31.93  ? 164 LYS A CD    1 
ATOM   2028 C  CE    . LYS E 3 165 ? 29.131  -10.080 -32.387 1.00 33.24  ? 164 LYS A CE    1 
ATOM   2029 N  NZ    . LYS E 3 165 ? 30.035  -11.184 -32.849 1.00 34.00  ? 164 LYS A NZ    1 
ATOM   2030 N  N     . VAL E 3 166 ? 32.475  -7.966  -30.577 1.00 28.06  ? 165 VAL A N     1 
ATOM   2031 C  CA    . VAL E 3 166 ? 33.124  -7.350  -31.732 1.00 27.96  ? 165 VAL A CA    1 
ATOM   2032 C  C     . VAL E 3 166 ? 32.265  -7.520  -32.995 1.00 27.83  ? 165 VAL A C     1 
ATOM   2033 O  O     . VAL E 3 166 ? 31.632  -8.542  -33.194 1.00 27.51  ? 165 VAL A O     1 
ATOM   2034 C  CB    . VAL E 3 166 ? 34.462  -8.091  -32.026 1.00 28.38  ? 165 VAL A CB    1 
ATOM   2035 C  CG1   . VAL E 3 166 ? 35.075  -7.681  -33.419 1.00 26.75  ? 165 VAL A CG1   1 
ATOM   2036 C  CG2   . VAL E 3 166 ? 35.454  -7.924  -30.863 1.00 28.51  ? 165 VAL A CG2   1 
ATOM   2037 N  N     . ILE E 3 167 ? 32.248  -6.512  -33.840 1.00 27.63  ? 166 ILE A N     1 
ATOM   2038 C  CA    . ILE E 3 167 ? 31.646  -6.647  -35.135 1.00 28.60  ? 166 ILE A CA    1 
ATOM   2039 C  C     . ILE E 3 167 ? 32.670  -6.246  -36.223 1.00 29.94  ? 166 ILE A C     1 
ATOM   2040 O  O     . ILE E 3 167 ? 32.865  -5.052  -36.497 1.00 30.40  ? 166 ILE A O     1 
ATOM   2041 C  CB    . ILE E 3 167 ? 30.327  -5.818  -35.251 1.00 28.23  ? 166 ILE A CB    1 
ATOM   2042 C  CG1   . ILE E 3 167 ? 29.268  -6.342  -34.268 1.00 27.26  ? 166 ILE A CG1   1 
ATOM   2043 C  CG2   . ILE E 3 167 ? 29.800  -5.838  -36.702 1.00 27.49  ? 166 ILE A CG2   1 
ATOM   2044 C  CD1   . ILE E 3 167 ? 27.907  -5.663  -34.318 1.00 24.49  ? 166 ILE A CD1   1 
ATOM   2045 N  N     . ASP E 3 168 ? 33.326  -7.231  -36.827 1.00 30.88  ? 167 ASP A N     1 
ATOM   2046 C  CA    . ASP E 3 168 ? 34.330  -6.943  -37.845 1.00 32.75  ? 167 ASP A CA    1 
ATOM   2047 C  C     . ASP E 3 168 ? 33.710  -6.454  -39.175 1.00 33.65  ? 167 ASP A C     1 
ATOM   2048 O  O     . ASP E 3 168 ? 32.518  -6.668  -39.415 1.00 34.00  ? 167 ASP A O     1 
ATOM   2049 C  CB    . ASP E 3 168 ? 35.321  -8.121  -38.044 1.00 32.92  ? 167 ASP A CB    1 
ATOM   2050 C  CG    . ASP E 3 168 ? 34.649  -9.417  -38.462 1.00 33.17  ? 167 ASP A CG    1 
ATOM   2051 O  OD1   . ASP E 3 168 ? 33.574  -9.353  -39.112 1.00 34.60  ? 167 ASP A OD1   1 
ATOM   2052 O  OD2   . ASP E 3 168 ? 35.216  -10.503 -38.153 1.00 31.70  ? 167 ASP A OD2   1 
ATOM   2053 N  N     . ASP E 3 169 ? 34.516  -5.814  -40.029 1.00 34.72  ? 168 ASP A N     1 
ATOM   2054 C  CA    . ASP E 3 169 ? 34.025  -5.238  -41.301 1.00 35.53  ? 168 ASP A CA    1 
ATOM   2055 C  C     . ASP E 3 169 ? 33.050  -6.152  -42.050 1.00 35.97  ? 168 ASP A C     1 
ATOM   2056 O  O     . ASP E 3 169 ? 32.110  -5.658  -42.664 1.00 36.12  ? 168 ASP A O     1 
ATOM   2057 C  CB    . ASP E 3 169 ? 35.181  -4.879  -42.247 1.00 35.80  ? 168 ASP A CB    1 
ATOM   2058 C  CG    . ASP E 3 169 ? 36.248  -4.008  -41.598 1.00 36.21  ? 168 ASP A CG    1 
ATOM   2059 O  OD1   . ASP E 3 169 ? 35.936  -2.880  -41.168 1.00 35.76  ? 168 ASP A OD1   1 
ATOM   2060 O  OD2   . ASP E 3 169 ? 37.421  -4.449  -41.566 1.00 38.11  ? 168 ASP A OD2   1 
ATOM   2061 N  N     . GLU E 3 170 ? 33.300  -7.466  -42.019 1.00 36.54  ? 169 GLU A N     1 
ATOM   2062 C  CA    . GLU E 3 170 ? 32.401  -8.448  -42.629 1.00 37.34  ? 169 GLU A CA    1 
ATOM   2063 C  C     . GLU E 3 170 ? 31.006  -8.424  -42.003 1.00 37.47  ? 169 GLU A C     1 
ATOM   2064 O  O     . GLU E 3 170 ? 30.026  -8.230  -42.727 1.00 37.29  ? 169 GLU A O     1 
ATOM   2065 C  CB    . GLU E 3 170 ? 32.978  -9.873  -42.576 1.00 37.53  ? 169 GLU A CB    1 
ATOM   2066 C  CG    . GLU E 3 170 ? 32.059  -10.959 -43.205 1.00 39.47  ? 169 GLU A CG    1 
ATOM   2067 C  CD    . GLU E 3 170 ? 31.834  -10.814 -44.744 1.00 42.08  ? 169 GLU A CD    1 
ATOM   2068 O  OE1   . GLU E 3 170 ? 32.620  -11.375 -45.545 1.00 41.86  ? 169 GLU A OE1   1 
ATOM   2069 O  OE2   . GLU E 3 170 ? 30.842  -10.164 -45.162 1.00 43.59  ? 169 GLU A OE2   1 
ATOM   2070 N  N     . GLU E 3 171 ? 30.909  -8.611  -40.675 1.00 37.44  ? 170 GLU A N     1 
ATOM   2071 C  CA    . GLU E 3 171 ? 29.582  -8.692  -40.019 1.00 37.23  ? 170 GLU A CA    1 
ATOM   2072 C  C     . GLU E 3 171 ? 28.742  -7.428  -40.146 1.00 36.69  ? 170 GLU A C     1 
ATOM   2073 O  O     . GLU E 3 171 ? 27.510  -7.499  -40.183 1.00 36.59  ? 170 GLU A O     1 
ATOM   2074 C  CB    . GLU E 3 171 ? 29.621  -9.152  -38.559 1.00 37.49  ? 170 GLU A CB    1 
ATOM   2075 C  CG    . GLU E 3 171 ? 28.198  -9.233  -38.002 1.00 38.56  ? 170 GLU A CG    1 
ATOM   2076 C  CD    . GLU E 3 171 ? 28.074  -9.915  -36.679 1.00 41.05  ? 170 GLU A CD    1 
ATOM   2077 O  OE1   . GLU E 3 171 ? 28.861  -9.619  -35.754 1.00 42.49  ? 170 GLU A OE1   1 
ATOM   2078 O  OE2   . GLU E 3 171 ? 27.150  -10.744 -36.547 1.00 43.35  ? 170 GLU A OE2   1 
ATOM   2079 N  N     . VAL E 3 172 ? 29.409  -6.283  -40.224 1.00 36.15  ? 171 VAL A N     1 
ATOM   2080 C  CA    . VAL E 3 172 ? 28.779  -5.056  -40.672 1.00 36.17  ? 171 VAL A CA    1 
ATOM   2081 C  C     . VAL E 3 172 ? 27.909  -5.301  -41.909 1.00 36.65  ? 171 VAL A C     1 
ATOM   2082 O  O     . VAL E 3 172 ? 26.773  -4.820  -41.974 1.00 36.42  ? 171 VAL A O     1 
ATOM   2083 C  CB    . VAL E 3 172 ? 29.842  -3.993  -40.989 1.00 36.12  ? 171 VAL A CB    1 
ATOM   2084 C  CG1   . VAL E 3 172 ? 29.206  -2.722  -41.554 1.00 35.71  ? 171 VAL A CG1   1 
ATOM   2085 C  CG2   . VAL E 3 172 ? 30.656  -3.679  -39.734 1.00 35.50  ? 171 VAL A CG2   1 
ATOM   2086 N  N     . LYS E 3 173 ? 28.435  -6.066  -42.869 1.00 37.28  ? 172 LYS A N     1 
ATOM   2087 C  CA    . LYS E 3 173 ? 27.719  -6.367  -44.103 1.00 38.16  ? 172 LYS A CA    1 
ATOM   2088 C  C     . LYS E 3 173 ? 26.443  -7.182  -43.868 1.00 38.44  ? 172 LYS A C     1 
ATOM   2089 O  O     . LYS E 3 173 ? 25.393  -6.858  -44.442 1.00 38.44  ? 172 LYS A O     1 
ATOM   2090 C  CB    . LYS E 3 173 ? 28.632  -7.087  -45.120 1.00 38.67  ? 172 LYS A CB    1 
ATOM   2091 C  CG    . LYS E 3 173 ? 29.380  -6.197  -46.115 1.00 38.79  ? 172 LYS A CG    1 
ATOM   2092 C  CD    . LYS E 3 173 ? 30.472  -5.380  -45.440 1.00 39.45  ? 172 LYS A CD    1 
ATOM   2093 C  CE    . LYS E 3 173 ? 31.125  -4.439  -46.438 1.00 39.28  ? 172 LYS A CE    1 
ATOM   2094 N  NZ    . LYS E 3 173 ? 31.873  -5.195  -47.435 1.00 38.74  ? 172 LYS A NZ    1 
ATOM   2095 N  N     . ARG E 3 174 ? 26.532  -8.237  -43.052 1.00 38.63  ? 173 ARG A N     1 
ATOM   2096 C  CA    . ARG E 3 174 ? 25.357  -9.056  -42.750 1.00 39.33  ? 173 ARG A CA    1 
ATOM   2097 C  C     . ARG E 3 174 ? 24.281  -8.207  -42.097 1.00 39.43  ? 173 ARG A C     1 
ATOM   2098 O  O     . ARG E 3 174 ? 23.113  -8.286  -42.469 1.00 39.46  ? 173 ARG A O     1 
ATOM   2099 C  CB    . ARG E 3 174 ? 25.680  -10.243 -41.834 1.00 39.65  ? 173 ARG A CB    1 
ATOM   2100 C  CG    . ARG E 3 174 ? 24.519  -11.270 -41.739 1.00 41.00  ? 173 ARG A CG    1 
ATOM   2101 C  CD    . ARG E 3 174 ? 24.686  -12.267 -40.581 1.00 42.98  ? 173 ARG A CD    1 
ATOM   2102 N  NE    . ARG E 3 174 ? 24.515  -11.610 -39.281 1.00 43.58  ? 173 ARG A NE    1 
ATOM   2103 C  CZ    . ARG E 3 174 ? 23.362  -11.517 -38.621 1.00 43.77  ? 173 ARG A CZ    1 
ATOM   2104 N  NH1   . ARG E 3 174 ? 22.255  -12.071 -39.114 1.00 44.15  ? 173 ARG A NH1   1 
ATOM   2105 N  NH2   . ARG E 3 174 ? 23.313  -10.860 -37.460 1.00 43.67  ? 173 ARG A NH2   1 
ATOM   2106 N  N     . LEU E 3 175 ? 24.688  -7.402  -41.122 1.00 39.54  ? 174 LEU A N     1 
ATOM   2107 C  CA    . LEU E 3 175 ? 23.773  -6.526  -40.406 1.00 39.78  ? 174 LEU A CA    1 
ATOM   2108 C  C     . LEU E 3 175 ? 23.178  -5.447  -41.317 1.00 40.08  ? 174 LEU A C     1 
ATOM   2109 O  O     . LEU E 3 175 ? 22.005  -5.085  -41.180 1.00 39.82  ? 174 LEU A O     1 
ATOM   2110 C  CB    . LEU E 3 175 ? 24.458  -5.911  -39.172 1.00 39.71  ? 174 LEU A CB    1 
ATOM   2111 C  CG    . LEU E 3 175 ? 24.992  -6.905  -38.119 1.00 39.10  ? 174 LEU A CG    1 
ATOM   2112 C  CD1   . LEU E 3 175 ? 26.006  -6.230  -37.223 1.00 38.39  ? 174 LEU A CD1   1 
ATOM   2113 C  CD2   . LEU E 3 175 ? 23.895  -7.604  -37.293 1.00 37.44  ? 174 LEU A CD2   1 
ATOM   2114 N  N     . ILE E 3 176 ? 23.967  -4.941  -42.255 1.00 40.38  ? 175 ILE A N     1 
ATOM   2115 C  CA    . ILE E 3 176 ? 23.383  -4.073  -43.276 1.00 41.29  ? 175 ILE A CA    1 
ATOM   2116 C  C     . ILE E 3 176 ? 22.238  -4.789  -44.036 1.00 42.15  ? 175 ILE A C     1 
ATOM   2117 O  O     . ILE E 3 176 ? 21.196  -4.178  -44.292 1.00 41.99  ? 175 ILE A O     1 
ATOM   2118 C  CB    . ILE E 3 176 ? 24.460  -3.456  -44.215 1.00 41.09  ? 175 ILE A CB    1 
ATOM   2119 C  CG1   . ILE E 3 176 ? 25.179  -2.315  -43.482 1.00 39.88  ? 175 ILE A CG1   1 
ATOM   2120 C  CG2   . ILE E 3 176 ? 23.844  -2.961  -45.527 1.00 40.87  ? 175 ILE A CG2   1 
ATOM   2121 C  CD1   . ILE E 3 176 ? 26.534  -1.939  -44.039 1.00 36.63  ? 175 ILE A CD1   1 
ATOM   2122 N  N     . ARG E 3 177 ? 22.429  -6.084  -44.337 1.00 43.26  ? 176 ARG A N     1 
ATOM   2123 C  CA    . ARG E 3 177 ? 21.424  -6.939  -45.021 1.00 44.32  ? 176 ARG A CA    1 
ATOM   2124 C  C     . ARG E 3 177 ? 20.266  -7.432  -44.127 1.00 45.25  ? 176 ARG A C     1 
ATOM   2125 O  O     . ARG E 3 177 ? 19.099  -7.143  -44.397 1.00 45.06  ? 176 ARG A O     1 
ATOM   2126 C  CB    . ARG E 3 177 ? 22.104  -8.148  -45.703 1.00 43.98  ? 176 ARG A CB    1 
ATOM   2127 C  CG    . ARG E 3 177 ? 22.690  -7.858  -47.090 1.00 43.29  ? 176 ARG A CG    1 
ATOM   2128 C  CD    . ARG E 3 177 ? 23.507  -9.016  -47.654 1.00 41.63  ? 176 ARG A CD    1 
ATOM   2129 N  NE    . ARG E 3 177 ? 24.920  -8.978  -47.259 1.00 41.42  ? 176 ARG A NE    1 
ATOM   2130 C  CZ    . ARG E 3 177 ? 25.539  -9.882  -46.489 1.00 40.41  ? 176 ARG A CZ    1 
ATOM   2131 N  NH1   . ARG E 3 177 ? 24.895  -10.941 -46.005 1.00 39.73  ? 176 ARG A NH1   1 
ATOM   2132 N  NH2   . ARG E 3 177 ? 26.823  -9.730  -46.200 1.00 38.97  ? 176 ARG A NH2   1 
ATOM   2133 N  N     . GLU E 3 178 ? 20.605  -8.152  -43.058 1.00 46.29  ? 177 GLU A N     1 
ATOM   2134 C  CA    . GLU E 3 178 ? 19.643  -8.976  -42.318 1.00 47.55  ? 177 GLU A CA    1 
ATOM   2135 C  C     . GLU E 3 178 ? 19.250  -8.551  -40.888 1.00 47.96  ? 177 GLU A C     1 
ATOM   2136 O  O     . GLU E 3 178 ? 18.502  -9.280  -40.221 1.00 47.97  ? 177 GLU A O     1 
ATOM   2137 C  CB    . GLU E 3 178 ? 20.146  -10.420 -42.279 1.00 47.78  ? 177 GLU A CB    1 
ATOM   2138 C  CG    . GLU E 3 178 ? 19.598  -11.311 -43.376 1.00 48.98  ? 177 GLU A CG    1 
ATOM   2139 C  CD    . GLU E 3 178 ? 19.872  -12.787 -43.101 1.00 50.76  ? 177 GLU A CD    1 
ATOM   2140 O  OE1   . GLU E 3 178 ? 20.476  -13.081 -42.033 1.00 51.38  ? 177 GLU A OE1   1 
ATOM   2141 O  OE2   . GLU E 3 178 ? 19.483  -13.641 -43.943 1.00 50.45  ? 177 GLU A OE2   1 
ATOM   2142 N  N     . LEU E 3 179 ? 19.746  -7.399  -40.420 1.00 48.38  ? 178 LEU A N     1 
ATOM   2143 C  CA    . LEU E 3 179 ? 19.420  -6.884  -39.071 1.00 48.25  ? 178 LEU A CA    1 
ATOM   2144 C  C     . LEU E 3 179 ? 18.160  -6.028  -39.133 1.00 48.49  ? 178 LEU A C     1 
ATOM   2145 O  O     . LEU E 3 179 ? 17.944  -5.293  -40.121 1.00 48.25  ? 178 LEU A O     1 
ATOM   2146 C  CB    . LEU E 3 179 ? 20.573  -6.048  -38.480 1.00 48.10  ? 178 LEU A CB    1 
ATOM   2147 C  CG    . LEU E 3 179 ? 20.271  -5.070  -37.324 1.00 47.40  ? 178 LEU A CG    1 
ATOM   2148 C  CD1   . LEU E 3 179 ? 20.732  -5.600  -35.969 1.00 46.13  ? 178 LEU A CD1   1 
ATOM   2149 C  CD2   . LEU E 3 179 ? 20.898  -3.724  -37.595 1.00 47.00  ? 178 LEU A CD2   1 
ATOM   2150 N  N     . ASP E 3 180 ? 17.352  -6.114  -38.069 1.00 48.22  ? 179 ASP A N     1 
ATOM   2151 C  CA    . ASP E 3 180 ? 16.094  -5.391  -38.000 1.00 48.26  ? 179 ASP A CA    1 
ATOM   2152 C  C     . ASP E 3 180 ? 16.324  -3.880  -37.849 1.00 48.04  ? 179 ASP A C     1 
ATOM   2153 O  O     . ASP E 3 180 ? 17.154  -3.438  -37.044 1.00 48.10  ? 179 ASP A O     1 
ATOM   2154 C  CB    . ASP E 3 180 ? 15.228  -5.945  -36.873 1.00 48.47  ? 179 ASP A CB    1 
ATOM   2155 C  CG    . ASP E 3 180 ? 13.774  -5.517  -36.989 1.00 49.53  ? 179 ASP A CG    1 
ATOM   2156 O  OD1   . ASP E 3 180 ? 13.500  -4.369  -37.442 1.00 49.95  ? 179 ASP A OD1   1 
ATOM   2157 O  OD2   . ASP E 3 180 ? 12.907  -6.342  -36.614 1.00 50.72  ? 179 ASP A OD2   1 
ATOM   2158 N  N     . ILE E 3 181 ? 15.587  -3.099  -38.636 1.00 47.50  ? 180 ILE A N     1 
ATOM   2159 C  CA    . ILE E 3 181 ? 15.844  -1.667  -38.751 1.00 46.83  ? 180 ILE A CA    1 
ATOM   2160 C  C     . ILE E 3 181 ? 15.702  -0.907  -37.415 1.00 46.66  ? 180 ILE A C     1 
ATOM   2161 O  O     . ILE E 3 181 ? 16.573  -0.107  -37.068 1.00 46.73  ? 180 ILE A O     1 
ATOM   2162 C  CB    . ILE E 3 181 ? 14.985  -1.029  -39.861 1.00 46.59  ? 180 ILE A CB    1 
ATOM   2163 C  CG1   . ILE E 3 181 ? 15.406  0.419   -40.106 1.00 46.71  ? 180 ILE A CG1   1 
ATOM   2164 C  CG2   . ILE E 3 181 ? 13.507  -1.099  -39.529 1.00 46.43  ? 180 ILE A CG2   1 
ATOM   2165 C  CD1   . ILE E 3 181 ? 16.055  0.653   -41.455 1.00 45.35  ? 180 ILE A CD1   1 
ATOM   2166 N  N     . ALA E 3 182 ? 14.628  -1.173  -36.662 1.00 46.27  ? 181 ALA A N     1 
ATOM   2167 C  CA    . ALA E 3 182 ? 14.397  -0.528  -35.339 1.00 45.61  ? 181 ALA A CA    1 
ATOM   2168 C  C     . ALA E 3 182 ? 15.578  -0.698  -34.397 1.00 45.16  ? 181 ALA A C     1 
ATOM   2169 O  O     . ALA E 3 182 ? 15.777  0.112   -33.484 1.00 46.10  ? 181 ALA A O     1 
ATOM   2170 C  CB    . ALA E 3 182 ? 13.110  -1.036  -34.673 1.00 45.37  ? 181 ALA A CB    1 
ATOM   2171 N  N     . ASP E 3 183 ? 16.384  -1.726  -34.617 1.00 43.98  ? 182 ASP A N     1 
ATOM   2172 C  CA    . ASP E 3 183 ? 17.597  -1.838  -33.841 1.00 43.60  ? 182 ASP A CA    1 
ATOM   2173 C  C     . ASP E 3 183 ? 18.792  -0.970  -34.318 1.00 43.13  ? 182 ASP A C     1 
ATOM   2174 O  O     . ASP E 3 183 ? 19.957  -1.305  -34.069 1.00 43.59  ? 182 ASP A O     1 
ATOM   2175 C  CB    . ASP E 3 183 ? 17.959  -3.306  -33.654 1.00 43.77  ? 182 ASP A CB    1 
ATOM   2176 C  CG    . ASP E 3 183 ? 16.892  -4.053  -32.876 1.00 44.48  ? 182 ASP A CG    1 
ATOM   2177 O  OD1   . ASP E 3 183 ? 15.763  -3.501  -32.757 1.00 46.45  ? 182 ASP A OD1   1 
ATOM   2178 O  OD2   . ASP E 3 183 ? 17.165  -5.175  -32.400 1.00 44.26  ? 182 ASP A OD2   1 
ATOM   2179 N  N     . VAL E 3 184 ? 18.503  0.154   -34.965 1.00 41.83  ? 183 VAL A N     1 
ATOM   2180 C  CA    . VAL E 3 184 ? 19.548  1.072   -35.367 1.00 40.92  ? 183 VAL A CA    1 
ATOM   2181 C  C     . VAL E 3 184 ? 19.543  2.258   -34.406 1.00 41.10  ? 183 VAL A C     1 
ATOM   2182 O  O     . VAL E 3 184 ? 18.525  2.915   -34.259 1.00 41.57  ? 183 VAL A O     1 
ATOM   2183 C  CB    . VAL E 3 184 ? 19.339  1.563   -36.836 1.00 40.55  ? 183 VAL A CB    1 
ATOM   2184 C  CG1   . VAL E 3 184 ? 20.219  2.763   -37.171 1.00 38.44  ? 183 VAL A CG1   1 
ATOM   2185 C  CG2   . VAL E 3 184 ? 19.615  0.436   -37.803 1.00 40.38  ? 183 VAL A CG2   1 
ATOM   2186 N  N     . PRO E 3 185 ? 20.679  2.544   -33.751 1.00 41.17  ? 184 PRO A N     1 
ATOM   2187 C  CA    . PRO E 3 185 ? 20.790  3.704   -32.846 1.00 41.30  ? 184 PRO A CA    1 
ATOM   2188 C  C     . PRO E 3 185 ? 20.213  4.979   -33.441 1.00 41.55  ? 184 PRO A C     1 
ATOM   2189 O  O     . PRO E 3 185 ? 20.477  5.295   -34.613 1.00 41.04  ? 184 PRO A O     1 
ATOM   2190 C  CB    . PRO E 3 185 ? 22.293  3.842   -32.648 1.00 41.32  ? 184 PRO A CB    1 
ATOM   2191 C  CG    . PRO E 3 185 ? 22.770  2.397   -32.711 1.00 41.04  ? 184 PRO A CG    1 
ATOM   2192 C  CD    . PRO E 3 185 ? 21.903  1.719   -33.740 1.00 40.87  ? 184 PRO A CD    1 
ATOM   2193 N  N     . GLY E 3 186 ? 19.423  5.687   -32.618 1.00 42.14  ? 185 GLY A N     1 
ATOM   2194 C  CA    . GLY E 3 186 ? 18.613  6.840   -33.047 1.00 42.62  ? 185 GLY A CA    1 
ATOM   2195 C  C     . GLY E 3 186 ? 17.291  6.479   -33.725 1.00 43.17  ? 185 GLY A C     1 
ATOM   2196 O  O     . GLY E 3 186 ? 16.691  7.324   -34.387 1.00 43.10  ? 185 GLY A O     1 
ATOM   2197 N  N     . ILE E 3 187 ? 16.853  5.222   -33.565 1.00 43.89  ? 186 ILE A N     1 
ATOM   2198 C  CA    . ILE E 3 187 ? 15.636  4.666   -34.180 1.00 44.29  ? 186 ILE A CA    1 
ATOM   2199 C  C     . ILE E 3 187 ? 14.975  3.787   -33.123 1.00 45.49  ? 186 ILE A C     1 
ATOM   2200 O  O     . ILE E 3 187 ? 15.517  2.765   -32.708 1.00 45.05  ? 186 ILE A O     1 
ATOM   2201 C  CB    . ILE E 3 187 ? 15.945  3.764   -35.415 1.00 43.89  ? 186 ILE A CB    1 
ATOM   2202 C  CG1   . ILE E 3 187 ? 16.794  4.493   -36.477 1.00 43.29  ? 186 ILE A CG1   1 
ATOM   2203 C  CG2   . ILE E 3 187 ? 14.649  3.146   -36.005 1.00 43.29  ? 186 ILE A CG2   1 
ATOM   2204 C  CD1   . ILE E 3 187 ? 16.007  5.229   -37.569 1.00 41.56  ? 186 ILE A CD1   1 
ATOM   2205 N  N     . GLY E 3 188 ? 13.807  4.213   -32.672 1.00 47.33  ? 187 GLY A N     1 
ATOM   2206 C  CA    . GLY E 3 188 ? 13.026  3.470   -31.692 1.00 49.58  ? 187 GLY A CA    1 
ATOM   2207 C  C     . GLY E 3 188 ? 11.704  3.099   -32.351 1.00 51.02  ? 187 GLY A C     1 
ATOM   2208 O  O     . GLY E 3 188 ? 11.706  2.622   -33.491 1.00 50.84  ? 187 GLY A O     1 
ATOM   2209 N  N     . ASN E 3 189 ? 10.592  3.353   -31.642 1.00 52.28  ? 188 ASN A N     1 
ATOM   2210 C  CA    . ASN E 3 189 ? 9.233   2.999   -32.081 1.00 53.61  ? 188 ASN A CA    1 
ATOM   2211 C  C     . ASN E 3 189 ? 8.697   3.879   -33.234 1.00 54.26  ? 188 ASN A C     1 
ATOM   2212 O  O     . ASN E 3 189 ? 8.444   3.377   -34.324 1.00 54.11  ? 188 ASN A O     1 
ATOM   2213 C  CB    . ASN E 3 189 ? 8.244   2.980   -30.880 1.00 53.91  ? 188 ASN A CB    1 
ATOM   2214 C  CG    . ASN E 3 189 ? 8.220   1.620   -30.114 1.00 54.54  ? 188 ASN A CG    1 
ATOM   2215 O  OD1   . ASN E 3 189 ? 7.723   0.604   -30.621 1.00 55.22  ? 188 ASN A OD1   1 
ATOM   2216 N  ND2   . ASN E 3 189 ? 8.726   1.624   -28.883 1.00 54.01  ? 188 ASN A ND2   1 
ATOM   2217 N  N     . ILE E 3 190 ? 8.568   5.182   -32.992 1.00 55.21  ? 189 ILE A N     1 
ATOM   2218 C  CA    . ILE E 3 190 ? 7.860   6.108   -33.896 1.00 56.33  ? 189 ILE A CA    1 
ATOM   2219 C  C     . ILE E 3 190 ? 8.360   6.117   -35.358 1.00 56.99  ? 189 ILE A C     1 
ATOM   2220 O  O     . ILE E 3 190 ? 7.580   6.342   -36.292 1.00 56.49  ? 189 ILE A O     1 
ATOM   2221 C  CB    . ILE E 3 190 ? 7.798   7.570   -33.288 1.00 56.51  ? 189 ILE A CB    1 
ATOM   2222 C  CG1   . ILE E 3 190 ? 6.920   7.588   -32.023 1.00 56.41  ? 189 ILE A CG1   1 
ATOM   2223 C  CG2   . ILE E 3 190 ? 7.317   8.631   -34.329 1.00 56.73  ? 189 ILE A CG2   1 
ATOM   2224 C  CD1   . ILE E 3 190 ? 6.930   8.905   -31.234 1.00 57.06  ? 189 ILE A CD1   1 
ATOM   2225 N  N     . THR E 3 191 ? 9.655   5.868   -35.542 1.00 58.02  ? 190 THR A N     1 
ATOM   2226 C  CA    . THR E 3 191 ? 10.267  5.890   -36.882 1.00 58.99  ? 190 THR A CA    1 
ATOM   2227 C  C     . THR E 3 191 ? 10.331  4.499   -37.530 1.00 59.51  ? 190 THR A C     1 
ATOM   2228 O  O     . THR E 3 191 ? 10.369  4.383   -38.765 1.00 59.44  ? 190 THR A O     1 
ATOM   2229 C  CB    . THR E 3 191 ? 11.651  6.587   -36.863 1.00 59.00  ? 190 THR A CB    1 
ATOM   2230 O  OG1   . THR E 3 191 ? 11.467  7.986   -36.601 1.00 58.80  ? 190 THR A OG1   1 
ATOM   2231 C  CG2   . THR E 3 191 ? 12.397  6.413   -38.188 1.00 59.23  ? 190 THR A CG2   1 
ATOM   2232 N  N     . ALA E 3 192 ? 10.341  3.451   -36.701 1.00 60.19  ? 191 ALA A N     1 
ATOM   2233 C  CA    . ALA E 3 192 ? 10.106  2.100   -37.201 1.00 60.72  ? 191 ALA A CA    1 
ATOM   2234 C  C     . ALA E 3 192 ? 8.751   2.127   -37.910 1.00 61.12  ? 191 ALA A C     1 
ATOM   2235 O  O     . ALA E 3 192 ? 8.684   1.878   -39.112 1.00 61.14  ? 191 ALA A O     1 
ATOM   2236 C  CB    . ALA E 3 192 ? 10.132  1.073   -36.072 1.00 60.74  ? 191 ALA A CB    1 
ATOM   2237 N  N     . GLU E 3 193 ? 7.699   2.500   -37.171 1.00 61.45  ? 192 GLU A N     1 
ATOM   2238 C  CA    . GLU E 3 193 ? 6.330   2.642   -37.705 1.00 61.57  ? 192 GLU A CA    1 
ATOM   2239 C  C     . GLU E 3 193 ? 6.221   3.595   -38.888 1.00 61.41  ? 192 GLU A C     1 
ATOM   2240 O  O     . GLU E 3 193 ? 5.309   3.478   -39.697 1.00 61.21  ? 192 GLU A O     1 
ATOM   2241 C  CB    . GLU E 3 193 ? 5.366   3.122   -36.616 1.00 61.73  ? 192 GLU A CB    1 
ATOM   2242 C  CG    . GLU E 3 193 ? 3.896   2.892   -36.955 1.00 61.43  ? 192 GLU A CG    1 
ATOM   2243 C  CD    . GLU E 3 193 ? 3.385   1.592   -36.396 1.00 61.25  ? 192 GLU A CD    1 
ATOM   2244 O  OE1   . GLU E 3 193 ? 3.191   1.529   -35.167 1.00 60.47  ? 192 GLU A OE1   1 
ATOM   2245 O  OE2   . GLU E 3 193 ? 3.170   0.641   -37.176 1.00 61.08  ? 192 GLU A OE2   1 
ATOM   2246 N  N     . LYS E 3 194 ? 7.135   4.553   -38.965 1.00 61.45  ? 193 LYS A N     1 
ATOM   2247 C  CA    . LYS E 3 194 ? 7.156   5.494   -40.070 1.00 61.64  ? 193 LYS A CA    1 
ATOM   2248 C  C     . LYS E 3 194 ? 7.636   4.798   -41.351 1.00 61.74  ? 193 LYS A C     1 
ATOM   2249 O  O     . LYS E 3 194 ? 7.446   5.309   -42.466 1.00 61.99  ? 193 LYS A O     1 
ATOM   2250 C  CB    . LYS E 3 194 ? 8.034   6.697   -39.714 1.00 61.59  ? 193 LYS A CB    1 
ATOM   2251 C  CG    . LYS E 3 194 ? 7.317   7.819   -38.940 1.00 61.80  ? 193 LYS A CG    1 
ATOM   2252 C  CD    . LYS E 3 194 ? 6.429   8.688   -39.866 1.00 62.93  ? 193 LYS A CD    1 
ATOM   2253 C  CE    . LYS E 3 194 ? 7.245   9.773   -40.621 1.00 63.30  ? 193 LYS A CE    1 
ATOM   2254 N  NZ    . LYS E 3 194 ? 6.729   10.086  -41.989 1.00 62.87  ? 193 LYS A NZ    1 
ATOM   2255 N  N     . LEU E 3 195 ? 8.223   3.616   -41.167 1.00 61.65  ? 194 LEU A N     1 
ATOM   2256 C  CA    . LEU E 3 195 ? 8.795   2.810   -42.238 1.00 61.64  ? 194 LEU A CA    1 
ATOM   2257 C  C     . LEU E 3 195 ? 8.212   1.389   -42.288 1.00 61.50  ? 194 LEU A C     1 
ATOM   2258 O  O     . LEU E 3 195 ? 8.327   0.701   -43.306 1.00 61.36  ? 194 LEU A O     1 
ATOM   2259 C  CB    . LEU E 3 195 ? 10.313  2.752   -42.063 1.00 61.67  ? 194 LEU A CB    1 
ATOM   2260 C  CG    . LEU E 3 195 ? 11.049  4.053   -42.397 1.00 61.93  ? 194 LEU A CG    1 
ATOM   2261 C  CD1   . LEU E 3 195 ? 12.501  4.031   -41.936 1.00 62.16  ? 194 LEU A CD1   1 
ATOM   2262 C  CD2   . LEU E 3 195 ? 10.961  4.336   -43.889 1.00 62.00  ? 194 LEU A CD2   1 
ATOM   2263 N  N     . LYS E 3 196 ? 7.595   0.974   -41.177 1.00 61.38  ? 195 LYS A N     1 
ATOM   2264 C  CA    . LYS E 3 196 ? 6.898   -0.322  -41.020 1.00 61.16  ? 195 LYS A CA    1 
ATOM   2265 C  C     . LYS E 3 196 ? 5.769   -0.487  -42.037 1.00 60.65  ? 195 LYS A C     1 
ATOM   2266 O  O     . LYS E 3 196 ? 5.448   -1.605  -42.451 1.00 60.65  ? 195 LYS A O     1 
ATOM   2267 C  CB    . LYS E 3 196 ? 6.334   -0.440  -39.592 1.00 61.20  ? 195 LYS A CB    1 
ATOM   2268 C  CG    . LYS E 3 196 ? 5.758   -1.799  -39.173 1.00 61.46  ? 195 LYS A CG    1 
ATOM   2269 C  CD    . LYS E 3 196 ? 5.239   -1.701  -37.737 1.00 61.76  ? 195 LYS A CD    1 
ATOM   2270 C  CE    . LYS E 3 196 ? 5.196   -3.037  -37.022 1.00 61.77  ? 195 LYS A CE    1 
ATOM   2271 N  NZ    . LYS E 3 196 ? 4.103   -3.906  -37.514 1.00 61.97  ? 195 LYS A NZ    1 
ATOM   2272 N  N     . LYS E 3 197 ? 5.171   0.640   -42.409 1.00 59.84  ? 196 LYS A N     1 
ATOM   2273 C  CA    . LYS E 3 197 ? 4.152   0.701   -43.445 1.00 59.15  ? 196 LYS A CA    1 
ATOM   2274 C  C     . LYS E 3 197 ? 4.818   0.725   -44.806 1.00 58.39  ? 196 LYS A C     1 
ATOM   2275 O  O     . LYS E 3 197 ? 4.278   0.169   -45.765 1.00 58.33  ? 196 LYS A O     1 
ATOM   2276 C  CB    . LYS E 3 197 ? 3.316   1.978   -43.283 1.00 59.33  ? 196 LYS A CB    1 
ATOM   2277 C  CG    . LYS E 3 197 ? 2.227   1.910   -42.220 1.00 59.31  ? 196 LYS A CG    1 
ATOM   2278 C  CD    . LYS E 3 197 ? 2.693   1.240   -40.932 1.00 58.67  ? 196 LYS A CD    1 
ATOM   2279 C  CE    . LYS E 3 197 ? 1.635   1.338   -39.865 1.00 58.82  ? 196 LYS A CE    1 
ATOM   2280 N  NZ    . LYS E 3 197 ? 1.320   2.764   -39.565 1.00 58.37  ? 196 LYS A NZ    1 
ATOM   2281 N  N     . LEU E 3 198 ? 5.998   1.356   -44.859 1.00 57.34  ? 197 LEU A N     1 
ATOM   2282 C  CA    . LEU E 3 198 ? 6.692   1.708   -46.110 1.00 56.02  ? 197 LEU A CA    1 
ATOM   2283 C  C     . LEU E 3 198 ? 7.347   0.565   -46.885 1.00 55.04  ? 197 LEU A C     1 
ATOM   2284 O  O     . LEU E 3 198 ? 7.668   0.725   -48.066 1.00 54.89  ? 197 LEU A O     1 
ATOM   2285 C  CB    . LEU E 3 198 ? 7.719   2.824   -45.869 1.00 55.92  ? 197 LEU A CB    1 
ATOM   2286 C  CG    . LEU E 3 198 ? 7.380   4.167   -46.520 1.00 55.46  ? 197 LEU A CG    1 
ATOM   2287 C  CD1   . LEU E 3 198 ? 8.601   5.067   -46.503 1.00 55.35  ? 197 LEU A CD1   1 
ATOM   2288 C  CD2   . LEU E 3 198 ? 6.858   3.994   -47.957 1.00 54.52  ? 197 LEU A CD2   1 
ATOM   2289 N  N     . GLY E 3 199 ? 7.537   -0.572  -46.222 1.00 53.90  ? 198 GLY A N     1 
ATOM   2290 C  CA    . GLY E 3 199 ? 8.125   -1.752  -46.853 1.00 52.47  ? 198 GLY A CA    1 
ATOM   2291 C  C     . GLY E 3 199 ? 9.566   -1.949  -46.425 1.00 51.46  ? 198 GLY A C     1 
ATOM   2292 O  O     . GLY E 3 199 ? 10.185  -2.973  -46.739 1.00 51.29  ? 198 GLY A O     1 
ATOM   2293 N  N     . ILE E 3 200 ? 10.099  -0.960  -45.708 1.00 50.45  ? 199 ILE A N     1 
ATOM   2294 C  CA    . ILE E 3 200 ? 11.473  -1.014  -45.226 1.00 49.31  ? 199 ILE A CA    1 
ATOM   2295 C  C     . ILE E 3 200 ? 11.505  -1.727  -43.891 1.00 49.00  ? 199 ILE A C     1 
ATOM   2296 O  O     . ILE E 3 200 ? 10.927  -1.254  -42.915 1.00 49.15  ? 199 ILE A O     1 
ATOM   2297 C  CB    . ILE E 3 200 ? 12.123  0.387   -45.122 1.00 48.90  ? 199 ILE A CB    1 
ATOM   2298 C  CG1   . ILE E 3 200 ? 11.921  1.165   -46.423 1.00 48.26  ? 199 ILE A CG1   1 
ATOM   2299 C  CG2   . ILE E 3 200 ? 13.607  0.253   -44.836 1.00 48.59  ? 199 ILE A CG2   1 
ATOM   2300 C  CD1   . ILE E 3 200 ? 12.555  2.529   -46.454 1.00 47.19  ? 199 ILE A CD1   1 
ATOM   2301 N  N     . ASN E 3 201 ? 12.160  -2.882  -43.867 1.00 48.62  ? 200 ASN A N     1 
ATOM   2302 C  CA    . ASN E 3 201 ? 12.309  -3.679  -42.639 1.00 48.33  ? 200 ASN A CA    1 
ATOM   2303 C  C     . ASN E 3 201 ? 13.763  -3.855  -42.184 1.00 47.80  ? 200 ASN A C     1 
ATOM   2304 O  O     . ASN E 3 201 ? 14.024  -4.148  -41.013 1.00 47.97  ? 200 ASN A O     1 
ATOM   2305 C  CB    . ASN E 3 201 ? 11.580  -5.044  -42.717 1.00 48.44  ? 200 ASN A CB    1 
ATOM   2306 C  CG    . ASN E 3 201 ? 11.117  -5.420  -44.130 1.00 49.13  ? 200 ASN A CG    1 
ATOM   2307 O  OD1   . ASN E 3 201 ? 10.127  -6.133  -44.280 1.00 49.97  ? 200 ASN A OD1   1 
ATOM   2308 N  ND2   . ASN E 3 201 ? 11.835  -4.965  -45.160 1.00 49.39  ? 200 ASN A ND2   1 
ATOM   2309 N  N     . LYS E 3 202 ? 14.697  -3.664  -43.114 1.00 47.10  ? 201 LYS A N     1 
ATOM   2310 C  CA    . LYS E 3 202 ? 16.126  -3.660  -42.815 1.00 46.31  ? 201 LYS A CA    1 
ATOM   2311 C  C     . LYS E 3 202 ? 16.756  -2.407  -43.432 1.00 45.79  ? 201 LYS A C     1 
ATOM   2312 O  O     . LYS E 3 202 ? 16.176  -1.809  -44.348 1.00 45.57  ? 201 LYS A O     1 
ATOM   2313 C  CB    . LYS E 3 202 ? 16.802  -4.921  -43.368 1.00 46.32  ? 201 LYS A CB    1 
ATOM   2314 C  CG    . LYS E 3 202 ? 16.027  -6.237  -43.183 1.00 46.86  ? 201 LYS A CG    1 
ATOM   2315 C  CD    . LYS E 3 202 ? 15.802  -6.555  -41.724 1.00 47.74  ? 201 LYS A CD    1 
ATOM   2316 C  CE    . LYS E 3 202 ? 15.154  -7.904  -41.514 1.00 48.99  ? 201 LYS A CE    1 
ATOM   2317 N  NZ    . LYS E 3 202 ? 15.079  -8.155  -40.053 1.00 48.80  ? 201 LYS A NZ    1 
ATOM   2318 N  N     . LEU E 3 203 ? 17.938  -2.018  -42.940 1.00 45.13  ? 202 LEU A N     1 
ATOM   2319 C  CA    . LEU E 3 203 ? 18.686  -0.868  -43.494 1.00 44.25  ? 202 LEU A CA    1 
ATOM   2320 C  C     . LEU E 3 203 ? 18.789  -0.857  -45.027 1.00 44.05  ? 202 LEU A C     1 
ATOM   2321 O  O     . LEU E 3 203 ? 18.733  0.205   -45.645 1.00 43.45  ? 202 LEU A O     1 
ATOM   2322 C  CB    . LEU E 3 203 ? 20.109  -0.779  -42.916 1.00 43.90  ? 202 LEU A CB    1 
ATOM   2323 C  CG    . LEU E 3 203 ? 20.531  -0.149  -41.585 1.00 42.62  ? 202 LEU A CG    1 
ATOM   2324 C  CD1   . LEU E 3 203 ? 22.044  -0.117  -41.530 1.00 41.04  ? 202 LEU A CD1   1 
ATOM   2325 C  CD2   . LEU E 3 203 ? 20.011  1.252   -41.376 1.00 41.48  ? 202 LEU A CD2   1 
ATOM   2326 N  N     . VAL E 3 204 ? 18.953  -2.030  -45.632 1.00 44.12  ? 203 VAL A N     1 
ATOM   2327 C  CA    . VAL E 3 204 ? 19.169  -2.126  -47.087 1.00 44.44  ? 203 VAL A CA    1 
ATOM   2328 C  C     . VAL E 3 204 ? 17.974  -1.574  -47.893 1.00 44.56  ? 203 VAL A C     1 
ATOM   2329 O  O     . VAL E 3 204 ? 18.150  -0.773  -48.814 1.00 44.29  ? 203 VAL A O     1 
ATOM   2330 C  CB    . VAL E 3 204 ? 19.595  -3.569  -47.525 1.00 44.32  ? 203 VAL A CB    1 
ATOM   2331 C  CG1   . VAL E 3 204 ? 18.576  -4.613  -47.077 1.00 44.52  ? 203 VAL A CG1   1 
ATOM   2332 C  CG2   . VAL E 3 204 ? 19.851  -3.648  -49.023 1.00 43.81  ? 203 VAL A CG2   1 
ATOM   2333 N  N     . ASP E 3 205 ? 16.779  -2.018  -47.515 1.00 44.95  ? 204 ASP A N     1 
ATOM   2334 C  CA    . ASP E 3 205 ? 15.550  -1.577  -48.153 1.00 45.20  ? 204 ASP A CA    1 
ATOM   2335 C  C     . ASP E 3 205 ? 15.601  -0.085  -48.442 1.00 45.30  ? 204 ASP A C     1 
ATOM   2336 O  O     . ASP E 3 205 ? 15.021  0.381   -49.423 1.00 45.25  ? 204 ASP A O     1 
ATOM   2337 C  CB    . ASP E 3 205 ? 14.343  -1.901  -47.271 1.00 45.43  ? 204 ASP A CB    1 
ATOM   2338 C  CG    . ASP E 3 205 ? 14.165  -3.390  -47.052 1.00 46.08  ? 204 ASP A CG    1 
ATOM   2339 O  OD1   . ASP E 3 205 ? 15.110  -4.036  -46.551 1.00 46.41  ? 204 ASP A OD1   1 
ATOM   2340 O  OD2   . ASP E 3 205 ? 13.081  -3.916  -47.381 1.00 47.06  ? 204 ASP A OD2   1 
ATOM   2341 N  N     . THR E 3 206 ? 16.295  0.668   -47.593 1.00 45.53  ? 205 THR A N     1 
ATOM   2342 C  CA    . THR E 3 206 ? 16.401  2.109   -47.822 1.00 45.82  ? 205 THR A CA    1 
ATOM   2343 C  C     . THR E 3 206 ? 17.106  2.442   -49.129 1.00 46.17  ? 205 THR A C     1 
ATOM   2344 O  O     . THR E 3 206 ? 16.928  3.528   -49.655 1.00 46.35  ? 205 THR A O     1 
ATOM   2345 C  CB    . THR E 3 206 ? 17.114  2.832   -46.691 1.00 45.63  ? 205 THR A CB    1 
ATOM   2346 O  OG1   . THR E 3 206 ? 18.471  2.383   -46.632 1.00 44.78  ? 205 THR A OG1   1 
ATOM   2347 C  CG2   . THR E 3 206 ? 16.423  2.548   -45.377 1.00 45.48  ? 205 THR A CG2   1 
ATOM   2348 N  N     . LEU E 3 207 ? 17.911  1.521   -49.641 1.00 46.51  ? 206 LEU A N     1 
ATOM   2349 C  CA    . LEU E 3 207 ? 18.574  1.735   -50.918 1.00 47.35  ? 206 LEU A CA    1 
ATOM   2350 C  C     . LEU E 3 207 ? 17.666  1.290   -52.058 1.00 47.82  ? 206 LEU A C     1 
ATOM   2351 O  O     . LEU E 3 207 ? 17.823  1.711   -53.207 1.00 47.60  ? 206 LEU A O     1 
ATOM   2352 C  CB    . LEU E 3 207 ? 19.899  0.973   -50.969 1.00 47.26  ? 206 LEU A CB    1 
ATOM   2353 C  CG    . LEU E 3 207 ? 21.017  1.451   -50.042 1.00 46.61  ? 206 LEU A CG    1 
ATOM   2354 C  CD1   . LEU E 3 207 ? 22.249  0.588   -50.224 1.00 46.15  ? 206 LEU A CD1   1 
ATOM   2355 C  CD2   . LEU E 3 207 ? 21.357  2.919   -50.278 1.00 45.52  ? 206 LEU A CD2   1 
ATOM   2356 N  N     . SER E 3 208 ? 16.717  0.431   -51.704 1.00 48.40  ? 207 SER A N     1 
ATOM   2357 C  CA    . SER E 3 208 ? 15.719  -0.095  -52.617 1.00 48.75  ? 207 SER A CA    1 
ATOM   2358 C  C     . SER E 3 208 ? 14.457  0.800   -52.700 1.00 49.35  ? 207 SER A C     1 
ATOM   2359 O  O     . SER E 3 208 ? 13.385  0.350   -53.120 1.00 49.46  ? 207 SER A O     1 
ATOM   2360 C  CB    . SER E 3 208 ? 15.405  -1.537  -52.200 1.00 48.49  ? 207 SER A CB    1 
ATOM   2361 O  OG    . SER E 3 208 ? 14.033  -1.751  -51.956 1.00 47.88  ? 207 SER A OG    1 
ATOM   2362 N  N     . ILE E 3 209 ? 14.604  2.072   -52.319 1.00 49.85  ? 208 ILE A N     1 
ATOM   2363 C  CA    . ILE E 3 209 ? 13.513  3.053   -52.342 1.00 50.37  ? 208 ILE A CA    1 
ATOM   2364 C  C     . ILE E 3 209 ? 14.059  4.436   -52.683 1.00 50.81  ? 208 ILE A C     1 
ATOM   2365 O  O     . ILE E 3 209 ? 15.197  4.768   -52.356 1.00 50.78  ? 208 ILE A O     1 
ATOM   2366 C  CB    . ILE E 3 209 ? 12.702  3.078   -50.992 1.00 50.58  ? 208 ILE A CB    1 
ATOM   2367 C  CG1   . ILE E 3 209 ? 11.403  3.879   -51.132 1.00 50.69  ? 208 ILE A CG1   1 
ATOM   2368 C  CG2   . ILE E 3 209 ? 13.553  3.601   -49.800 1.00 50.27  ? 208 ILE A CG2   1 
ATOM   2369 C  CD1   . ILE E 3 209 ? 10.407  3.636   -50.018 1.00 51.31  ? 208 ILE A CD1   1 
ATOM   2370 N  N     . GLU E 3 210 ? 13.232  5.232   -53.345 1.00 51.46  ? 209 GLU A N     1 
ATOM   2371 C  CA    . GLU E 3 210 ? 13.573  6.592   -53.757 1.00 52.08  ? 209 GLU A CA    1 
ATOM   2372 C  C     . GLU E 3 210 ? 13.970  7.488   -52.580 1.00 52.50  ? 209 GLU A C     1 
ATOM   2373 O  O     . GLU E 3 210 ? 13.521  7.272   -51.454 1.00 52.35  ? 209 GLU A O     1 
ATOM   2374 C  CB    . GLU E 3 210 ? 12.381  7.190   -54.493 1.00 51.87  ? 209 GLU A CB    1 
ATOM   2375 C  CG    . GLU E 3 210 ? 12.682  8.358   -55.391 1.00 51.19  ? 209 GLU A CG    1 
ATOM   2376 C  CD    . GLU E 3 210 ? 11.505  8.659   -56.280 1.00 50.57  ? 209 GLU A CD    1 
ATOM   2377 O  OE1   . GLU E 3 210 ? 10.451  8.020   -56.085 1.00 50.60  ? 209 GLU A OE1   1 
ATOM   2378 O  OE2   . GLU E 3 210 ? 11.620  9.519   -57.175 1.00 50.28  ? 209 GLU A OE2   1 
ATOM   2379 N  N     . PHE E 3 211 ? 14.804  8.490   -52.867 1.00 53.22  ? 210 PHE A N     1 
ATOM   2380 C  CA    . PHE E 3 211 ? 15.407  9.363   -51.852 1.00 54.08  ? 210 PHE A CA    1 
ATOM   2381 C  C     . PHE E 3 211 ? 14.413  10.355  -51.227 1.00 54.39  ? 210 PHE A C     1 
ATOM   2382 O  O     . PHE E 3 211 ? 14.394  10.511  -50.007 1.00 54.18  ? 210 PHE A O     1 
ATOM   2383 C  CB    . PHE E 3 211 ? 16.657  10.085  -52.412 1.00 54.11  ? 210 PHE A CB    1 
ATOM   2384 C  CG    . PHE E 3 211 ? 17.331  11.042  -51.433 1.00 54.63  ? 210 PHE A CG    1 
ATOM   2385 C  CD1   . PHE E 3 211 ? 17.263  10.838  -50.041 1.00 54.23  ? 210 PHE A CD1   1 
ATOM   2386 C  CD2   . PHE E 3 211 ? 18.072  12.130  -51.917 1.00 54.90  ? 210 PHE A CD2   1 
ATOM   2387 C  CE1   . PHE E 3 211 ? 17.883  11.719  -49.150 1.00 54.12  ? 210 PHE A CE1   1 
ATOM   2388 C  CE2   . PHE E 3 211 ? 18.711  13.016  -51.033 1.00 54.93  ? 210 PHE A CE2   1 
ATOM   2389 C  CZ    . PHE E 3 211 ? 18.612  12.812  -49.648 1.00 54.78  ? 210 PHE A CZ    1 
ATOM   2390 N  N     . ASP E 3 212 ? 13.601  11.013  -52.058 1.00 54.95  ? 211 ASP A N     1 
ATOM   2391 C  CA    . ASP E 3 212 ? 12.655  12.033  -51.582 1.00 55.25  ? 211 ASP A CA    1 
ATOM   2392 C  C     . ASP E 3 212 ? 11.480  11.417  -50.829 1.00 55.18  ? 211 ASP A C     1 
ATOM   2393 O  O     . ASP E 3 212 ? 10.983  12.004  -49.873 1.00 54.91  ? 211 ASP A O     1 
ATOM   2394 C  CB    . ASP E 3 212 ? 12.153  12.910  -52.737 1.00 55.39  ? 211 ASP A CB    1 
ATOM   2395 C  CG    . ASP E 3 212 ? 13.259  13.756  -53.363 1.00 56.29  ? 211 ASP A CG    1 
ATOM   2396 O  OD1   . ASP E 3 212 ? 14.431  13.643  -52.946 1.00 57.62  ? 211 ASP A OD1   1 
ATOM   2397 O  OD2   . ASP E 3 212 ? 12.960  14.538  -54.290 1.00 56.93  ? 211 ASP A OD2   1 
ATOM   2398 N  N     . LYS E 3 213 ? 11.048  10.237  -51.281 1.00 55.28  ? 212 LYS A N     1 
ATOM   2399 C  CA    . LYS E 3 213 ? 9.989   9.451   -50.632 1.00 55.13  ? 212 LYS A CA    1 
ATOM   2400 C  C     . LYS E 3 213 ? 10.423  9.033   -49.233 1.00 54.81  ? 212 LYS A C     1 
ATOM   2401 O  O     . LYS E 3 213 ? 9.613   8.560   -48.452 1.00 54.55  ? 212 LYS A O     1 
ATOM   2402 C  CB    . LYS E 3 213 ? 9.673   8.198   -51.462 1.00 55.24  ? 212 LYS A CB    1 
ATOM   2403 C  CG    . LYS E 3 213 ? 8.197   7.786   -51.525 1.00 55.59  ? 212 LYS A CG    1 
ATOM   2404 C  CD    . LYS E 3 213 ? 7.495   8.401   -52.745 1.00 56.28  ? 212 LYS A CD    1 
ATOM   2405 C  CE    . LYS E 3 213 ? 6.346   7.527   -53.263 1.00 56.09  ? 212 LYS A CE    1 
ATOM   2406 N  NZ    . LYS E 3 213 ? 5.417   8.295   -54.140 1.00 55.67  ? 212 LYS A NZ    1 
ATOM   2407 N  N     . LEU E 3 214 ? 11.716  9.196   -48.951 1.00 54.76  ? 213 LEU A N     1 
ATOM   2408 C  CA    . LEU E 3 214 ? 12.292  9.019   -47.617 1.00 54.63  ? 213 LEU A CA    1 
ATOM   2409 C  C     . LEU E 3 214 ? 12.538  10.395  -46.947 1.00 54.56  ? 213 LEU A C     1 
ATOM   2410 O  O     . LEU E 3 214 ? 12.025  10.657  -45.863 1.00 54.69  ? 213 LEU A O     1 
ATOM   2411 C  CB    . LEU E 3 214 ? 13.572  8.158   -47.688 1.00 54.53  ? 213 LEU A CB    1 
ATOM   2412 C  CG    . LEU E 3 214 ? 14.158  7.484   -46.428 1.00 54.54  ? 213 LEU A CG    1 
ATOM   2413 C  CD1   . LEU E 3 214 ? 13.272  6.359   -45.879 1.00 54.22  ? 213 LEU A CD1   1 
ATOM   2414 C  CD2   . LEU E 3 214 ? 15.566  6.951   -46.687 1.00 53.73  ? 213 LEU A CD2   1 
ATOM   2415 N  N     . LYS E 3 215 ? 13.303  11.268  -47.604 1.00 54.67  ? 214 LYS A N     1 
ATOM   2416 C  CA    . LYS E 3 215 ? 13.499  12.670  -47.180 1.00 54.82  ? 214 LYS A CA    1 
ATOM   2417 C  C     . LYS E 3 215 ? 12.220  13.309  -46.621 1.00 54.93  ? 214 LYS A C     1 
ATOM   2418 O  O     . LYS E 3 215 ? 12.178  13.733  -45.456 1.00 54.86  ? 214 LYS A O     1 
ATOM   2419 C  CB    . LYS E 3 215 ? 14.038  13.523  -48.352 1.00 54.77  ? 214 LYS A CB    1 
ATOM   2420 C  CG    . LYS E 3 215 ? 14.364  14.972  -47.988 1.00 54.70  ? 214 LYS A CG    1 
ATOM   2421 C  CD    . LYS E 3 215 ? 15.275  15.651  -49.010 1.00 55.66  ? 214 LYS A CD    1 
ATOM   2422 C  CE    . LYS E 3 215 ? 14.501  16.677  -49.863 1.00 56.28  ? 214 LYS A CE    1 
ATOM   2423 N  NZ    . LYS E 3 215 ? 15.374  17.701  -50.490 1.00 56.26  ? 214 LYS A NZ    1 
ATOM   2424 N  N     . GLY E 3 216 ? 11.191  13.370  -47.465 1.00 54.80  ? 215 GLY A N     1 
ATOM   2425 C  CA    . GLY E 3 216 ? 9.895   13.926  -47.097 1.00 54.91  ? 215 GLY A CA    1 
ATOM   2426 C  C     . GLY E 3 216 ? 9.322   13.350  -45.810 1.00 55.09  ? 215 GLY A C     1 
ATOM   2427 O  O     . GLY E 3 216 ? 8.780   14.105  -44.980 1.00 55.25  ? 215 GLY A O     1 
ATOM   2428 N  N     . MET E 3 217 ? 9.433   12.036  -45.643 1.00 54.73  ? 216 MET A N     1 
ATOM   2429 C  CA    . MET E 3 217 ? 8.887   11.360  -44.472 1.00 54.38  ? 216 MET A CA    1 
ATOM   2430 C  C     . MET E 3 217 ? 9.700   11.646  -43.213 1.00 53.88  ? 216 MET A C     1 
ATOM   2431 O  O     . MET E 3 217 ? 9.645   12.746  -42.663 1.00 54.11  ? 216 MET A O     1 
ATOM   2432 C  CB    . MET E 3 217 ? 8.810   9.851   -44.714 1.00 54.61  ? 216 MET A CB    1 
ATOM   2433 C  CG    . MET E 3 217 ? 8.021   9.461   -45.953 1.00 55.79  ? 216 MET A CG    1 
ATOM   2434 S  SD    . MET E 3 217 ? 6.430   10.303  -46.059 1.00 58.27  ? 216 MET A SD    1 
ATOM   2435 C  CE    . MET E 3 217 ? 5.443   9.302   -44.949 1.00 58.68  ? 216 MET A CE    1 
ATOM   2436 N  N     . ILE E 3 218 ? 10.449  10.646  -42.761 1.00 52.91  ? 217 ILE A N     1 
ATOM   2437 C  CA    . ILE E 3 218 ? 11.242  10.767  -41.526 1.00 51.72  ? 217 ILE A CA    1 
ATOM   2438 C  C     . ILE E 3 218 ? 12.164  11.994  -41.472 1.00 51.02  ? 217 ILE A C     1 
ATOM   2439 O  O     . ILE E 3 218 ? 12.730  12.309  -40.425 1.00 51.13  ? 217 ILE A O     1 
ATOM   2440 C  CB    . ILE E 3 218 ? 12.060  9.471   -41.228 1.00 51.61  ? 217 ILE A CB    1 
ATOM   2441 C  CG1   . ILE E 3 218 ? 12.828  8.998   -42.472 1.00 51.50  ? 217 ILE A CG1   1 
ATOM   2442 C  CG2   . ILE E 3 218 ? 11.148  8.352   -40.710 1.00 51.46  ? 217 ILE A CG2   1 
ATOM   2443 C  CD1   . ILE E 3 218 ? 13.564  7.648   -42.279 1.00 50.44  ? 217 ILE A CD1   1 
ATOM   2444 N  N     . GLY E 3 219 ? 12.328  12.679  -42.596 1.00 50.27  ? 218 GLY A N     1 
ATOM   2445 C  CA    . GLY E 3 219 ? 13.083  13.915  -42.611 1.00 49.68  ? 218 GLY A CA    1 
ATOM   2446 C  C     . GLY E 3 219 ? 14.478  13.763  -43.170 1.00 49.38  ? 218 GLY A C     1 
ATOM   2447 O  O     . GLY E 3 219 ? 15.117  12.718  -42.972 1.00 48.82  ? 218 GLY A O     1 
ATOM   2448 N  N     . GLU E 3 220 ? 14.950  14.819  -43.850 1.00 49.06  ? 219 GLU A N     1 
ATOM   2449 C  CA    . GLU E 3 220 ? 16.224  14.790  -44.582 1.00 48.97  ? 219 GLU A CA    1 
ATOM   2450 C  C     . GLU E 3 220 ? 17.420  14.329  -43.761 1.00 48.63  ? 219 GLU A C     1 
ATOM   2451 O  O     . GLU E 3 220 ? 18.221  13.508  -44.224 1.00 48.80  ? 219 GLU A O     1 
ATOM   2452 C  CB    . GLU E 3 220 ? 16.557  16.134  -45.218 1.00 49.24  ? 219 GLU A CB    1 
ATOM   2453 C  CG    . GLU E 3 220 ? 17.707  16.030  -46.212 1.00 50.39  ? 219 GLU A CG    1 
ATOM   2454 C  CD    . GLU E 3 220 ? 18.001  17.339  -46.902 1.00 51.80  ? 219 GLU A CD    1 
ATOM   2455 O  OE1   . GLU E 3 220 ? 18.620  18.214  -46.248 1.00 52.28  ? 219 GLU A OE1   1 
ATOM   2456 O  OE2   . GLU E 3 220 ? 17.625  17.485  -48.096 1.00 52.12  ? 219 GLU A OE2   1 
ATOM   2457 N  N     . ALA E 3 221 ? 17.546  14.862  -42.552 1.00 47.88  ? 220 ALA A N     1 
ATOM   2458 C  CA    . ALA E 3 221 ? 18.641  14.486  -41.697 1.00 46.86  ? 220 ALA A CA    1 
ATOM   2459 C  C     . ALA E 3 221 ? 18.618  12.969  -41.493 1.00 46.17  ? 220 ALA A C     1 
ATOM   2460 O  O     . ALA E 3 221 ? 19.622  12.305  -41.740 1.00 46.64  ? 220 ALA A O     1 
ATOM   2461 C  CB    . ALA E 3 221 ? 18.571  15.241  -40.372 1.00 46.99  ? 220 ALA A CB    1 
ATOM   2462 N  N     . LYS E 3 222 ? 17.475  12.415  -41.092 1.00 45.00  ? 221 LYS A N     1 
ATOM   2463 C  CA    . LYS E 3 222 ? 17.414  10.989  -40.747 1.00 43.90  ? 221 LYS A CA    1 
ATOM   2464 C  C     . LYS E 3 222 ? 17.567  10.072  -41.955 1.00 43.06  ? 221 LYS A C     1 
ATOM   2465 O  O     . LYS E 3 222 ? 18.144  8.975   -41.863 1.00 42.79  ? 221 LYS A O     1 
ATOM   2466 C  CB    . LYS E 3 222 ? 16.150  10.660  -39.942 1.00 43.78  ? 221 LYS A CB    1 
ATOM   2467 C  CG    . LYS E 3 222 ? 16.487  10.167  -38.543 1.00 44.38  ? 221 LYS A CG    1 
ATOM   2468 C  CD    . LYS E 3 222 ? 15.330  10.300  -37.555 1.00 44.86  ? 221 LYS A CD    1 
ATOM   2469 C  CE    . LYS E 3 222 ? 15.545  11.510  -36.603 1.00 44.54  ? 221 LYS A CE    1 
ATOM   2470 N  NZ    . LYS E 3 222 ? 14.608  11.469  -35.424 1.00 44.50  ? 221 LYS A NZ    1 
ATOM   2471 N  N     . ALA E 3 223 ? 17.053  10.534  -43.087 1.00 42.12  ? 222 ALA A N     1 
ATOM   2472 C  CA    . ALA E 3 223 ? 17.162  9.795   -44.326 1.00 41.25  ? 222 ALA A CA    1 
ATOM   2473 C  C     . ALA E 3 223 ? 18.614  9.682   -44.767 1.00 40.77  ? 222 ALA A C     1 
ATOM   2474 O  O     . ALA E 3 223 ? 19.030  8.601   -45.175 1.00 40.51  ? 222 ALA A O     1 
ATOM   2475 C  CB    . ALA E 3 223 ? 16.334  10.435  -45.396 1.00 41.10  ? 222 ALA A CB    1 
ATOM   2476 N  N     . LYS E 3 224 ? 19.373  10.786  -44.675 1.00 40.49  ? 223 LYS A N     1 
ATOM   2477 C  CA    . LYS E 3 224 ? 20.783  10.835  -45.129 1.00 39.88  ? 223 LYS A CA    1 
ATOM   2478 C  C     . LYS E 3 224 ? 21.563  9.827   -44.305 1.00 39.11  ? 223 LYS A C     1 
ATOM   2479 O  O     . LYS E 3 224 ? 22.350  9.034   -44.832 1.00 39.64  ? 223 LYS A O     1 
ATOM   2480 C  CB    . LYS E 3 224 ? 21.429  12.207  -44.868 1.00 39.79  ? 223 LYS A CB    1 
ATOM   2481 C  CG    . LYS E 3 224 ? 20.944  13.391  -45.654 1.00 41.09  ? 223 LYS A CG    1 
ATOM   2482 C  CD    . LYS E 3 224 ? 21.857  13.713  -46.852 1.00 44.44  ? 223 LYS A CD    1 
ATOM   2483 C  CE    . LYS E 3 224 ? 23.313  14.048  -46.452 1.00 45.45  ? 223 LYS A CE    1 
ATOM   2484 N  NZ    . LYS E 3 224 ? 24.217  13.945  -47.658 1.00 45.02  ? 223 LYS A NZ    1 
ATOM   2485 N  N     . TYR E 3 225 ? 21.324  9.864   -43.000 1.00 37.94  ? 224 TYR A N     1 
ATOM   2486 C  CA    . TYR E 3 225 ? 22.147  9.149   -42.039 1.00 36.74  ? 224 TYR A CA    1 
ATOM   2487 C  C     . TYR E 3 225 ? 21.965  7.659   -42.224 1.00 36.25  ? 224 TYR A C     1 
ATOM   2488 O  O     . TYR E 3 225 ? 22.949  6.932   -42.264 1.00 36.43  ? 224 TYR A O     1 
ATOM   2489 C  CB    . TYR E 3 225 ? 21.817  9.632   -40.617 1.00 36.35  ? 224 TYR A CB    1 
ATOM   2490 C  CG    . TYR E 3 225 ? 22.016  8.652   -39.474 1.00 35.19  ? 224 TYR A CG    1 
ATOM   2491 C  CD1   . TYR E 3 225 ? 23.211  8.613   -38.767 1.00 34.63  ? 224 TYR A CD1   1 
ATOM   2492 C  CD2   . TYR E 3 225 ? 20.981  7.813   -39.064 1.00 34.88  ? 224 TYR A CD2   1 
ATOM   2493 C  CE1   . TYR E 3 225 ? 23.386  7.747   -37.694 1.00 35.49  ? 224 TYR A CE1   1 
ATOM   2494 C  CE2   . TYR E 3 225 ? 21.140  6.921   -38.000 1.00 35.69  ? 224 TYR A CE2   1 
ATOM   2495 C  CZ    . TYR E 3 225 ? 22.337  6.896   -37.311 1.00 35.76  ? 224 TYR A CZ    1 
ATOM   2496 O  OH    . TYR E 3 225 ? 22.497  6.029   -36.253 1.00 35.46  ? 224 TYR A OH    1 
ATOM   2497 N  N     . LEU E 3 226 ? 20.721  7.206   -42.359 1.00 35.64  ? 225 LEU A N     1 
ATOM   2498 C  CA    . LEU E 3 226 ? 20.462  5.777   -42.558 1.00 35.36  ? 225 LEU A CA    1 
ATOM   2499 C  C     . LEU E 3 226 ? 21.076  5.313   -43.886 1.00 35.62  ? 225 LEU A C     1 
ATOM   2500 O  O     . LEU E 3 226 ? 21.720  4.255   -43.962 1.00 35.69  ? 225 LEU A O     1 
ATOM   2501 C  CB    . LEU E 3 226 ? 18.956  5.482   -42.555 1.00 34.88  ? 225 LEU A CB    1 
ATOM   2502 C  CG    . LEU E 3 226 ? 18.184  5.517   -41.240 1.00 34.30  ? 225 LEU A CG    1 
ATOM   2503 C  CD1   . LEU E 3 226 ? 16.695  5.634   -41.549 1.00 33.48  ? 225 LEU A CD1   1 
ATOM   2504 C  CD2   . LEU E 3 226 ? 18.484  4.264   -40.422 1.00 32.37  ? 225 LEU A CD2   1 
ATOM   2505 N  N     . ILE E 3 227 ? 20.878  6.114   -44.934 1.00 35.62  ? 226 ILE A N     1 
ATOM   2506 C  CA    . ILE E 3 227 ? 21.446  5.796   -46.237 1.00 35.62  ? 226 ILE A CA    1 
ATOM   2507 C  C     . ILE E 3 227 ? 22.954  5.612   -46.089 1.00 35.89  ? 226 ILE A C     1 
ATOM   2508 O  O     . ILE E 3 227 ? 23.531  4.733   -46.726 1.00 35.88  ? 226 ILE A O     1 
ATOM   2509 C  CB    . ILE E 3 227 ? 21.093  6.862   -47.295 1.00 35.21  ? 226 ILE A CB    1 
ATOM   2510 C  CG1   . ILE E 3 227 ? 19.744  6.509   -47.959 1.00 34.68  ? 226 ILE A CG1   1 
ATOM   2511 C  CG2   . ILE E 3 227 ? 22.211  6.996   -48.320 1.00 34.37  ? 226 ILE A CG2   1 
ATOM   2512 C  CD1   . ILE E 3 227 ? 18.860  7.737   -48.380 1.00 31.91  ? 226 ILE A CD1   1 
ATOM   2513 N  N     . SER E 3 228 ? 23.580  6.417   -45.230 1.00 35.63  ? 227 SER A N     1 
ATOM   2514 C  CA    . SER E 3 228 ? 25.016  6.294   -45.036 1.00 35.89  ? 227 SER A CA    1 
ATOM   2515 C  C     . SER E 3 228 ? 25.392  4.974   -44.351 1.00 35.98  ? 227 SER A C     1 
ATOM   2516 O  O     . SER E 3 228 ? 26.466  4.398   -44.622 1.00 36.30  ? 227 SER A O     1 
ATOM   2517 C  CB    . SER E 3 228 ? 25.578  7.484   -44.268 1.00 36.00  ? 227 SER A CB    1 
ATOM   2518 O  OG    . SER E 3 228 ? 26.995  7.413   -44.240 1.00 36.20  ? 227 SER A OG    1 
ATOM   2519 N  N     . LEU E 3 229 ? 24.511  4.485   -43.483 1.00 35.30  ? 228 LEU A N     1 
ATOM   2520 C  CA    . LEU E 3 229 ? 24.726  3.182   -42.877 1.00 34.96  ? 228 LEU A CA    1 
ATOM   2521 C  C     . LEU E 3 229 ? 24.488  2.051   -43.883 1.00 34.65  ? 228 LEU A C     1 
ATOM   2522 O  O     . LEU E 3 229 ? 25.258  1.099   -43.950 1.00 34.90  ? 228 LEU A O     1 
ATOM   2523 C  CB    . LEU E 3 229 ? 23.867  2.999   -41.622 1.00 34.91  ? 228 LEU A CB    1 
ATOM   2524 C  CG    . LEU E 3 229 ? 24.218  3.745   -40.336 1.00 34.48  ? 228 LEU A CG    1 
ATOM   2525 C  CD1   . LEU E 3 229 ? 23.476  3.055   -39.226 1.00 35.40  ? 228 LEU A CD1   1 
ATOM   2526 C  CD2   . LEU E 3 229 ? 25.692  3.731   -40.021 1.00 33.90  ? 228 LEU A CD2   1 
ATOM   2527 N  N     . ALA E 3 230 ? 23.425  2.152   -44.662 1.00 34.13  ? 229 ALA A N     1 
ATOM   2528 C  CA    . ALA E 3 230 ? 23.212  1.212   -45.744 1.00 34.13  ? 229 ALA A CA    1 
ATOM   2529 C  C     . ALA E 3 230 ? 24.442  1.056   -46.646 1.00 33.82  ? 229 ALA A C     1 
ATOM   2530 O  O     . ALA E 3 230 ? 24.893  -0.063  -46.876 1.00 33.80  ? 229 ALA A O     1 
ATOM   2531 C  CB    . ALA E 3 230 ? 21.987  1.598   -46.559 1.00 34.06  ? 229 ALA A CB    1 
ATOM   2532 N  N     . ARG E 3 231 ? 24.991  2.170   -47.130 1.00 33.64  ? 230 ARG A N     1 
ATOM   2533 C  CA    . ARG E 3 231 ? 26.130  2.150   -48.054 1.00 33.98  ? 230 ARG A CA    1 
ATOM   2534 C  C     . ARG E 3 231 ? 27.435  1.752   -47.372 1.00 34.60  ? 230 ARG A C     1 
ATOM   2535 O  O     . ARG E 3 231 ? 28.495  1.736   -48.009 1.00 34.13  ? 230 ARG A O     1 
ATOM   2536 C  CB    . ARG E 3 231 ? 26.303  3.501   -48.782 1.00 33.91  ? 230 ARG A CB    1 
ATOM   2537 C  CG    . ARG E 3 231 ? 25.269  3.806   -49.865 1.00 33.30  ? 230 ARG A CG    1 
ATOM   2538 C  CD    . ARG E 3 231 ? 25.718  4.946   -50.787 1.00 35.30  ? 230 ARG A CD    1 
ATOM   2539 N  NE    . ARG E 3 231 ? 25.427  4.662   -52.215 1.00 36.55  ? 230 ARG A NE    1 
ATOM   2540 C  CZ    . ARG E 3 231 ? 24.515  5.305   -52.944 1.00 36.69  ? 230 ARG A CZ    1 
ATOM   2541 N  NH1   . ARG E 3 231 ? 23.795  6.304   -52.443 1.00 36.22  ? 230 ARG A NH1   1 
ATOM   2542 N  NH2   . ARG E 3 231 ? 24.329  4.966   -54.199 1.00 38.52  ? 230 ARG A NH2   1 
ATOM   2543 N  N     . ASP E 3 232 ? 27.340  1.411   -46.083 1.00 35.63  ? 231 ASP A N     1 
ATOM   2544 C  CA    . ASP E 3 232 ? 28.488  1.228   -45.198 1.00 36.15  ? 231 ASP A CA    1 
ATOM   2545 C  C     . ASP E 3 232 ? 29.503  2.334   -45.308 1.00 36.34  ? 231 ASP A C     1 
ATOM   2546 O  O     . ASP E 3 232 ? 30.694  2.069   -45.460 1.00 35.36  ? 231 ASP A O     1 
ATOM   2547 C  CB    . ASP E 3 232 ? 29.222  -0.087  -45.434 1.00 37.09  ? 231 ASP A CB    1 
ATOM   2548 C  CG    . ASP E 3 232 ? 30.284  -0.334  -44.372 1.00 38.71  ? 231 ASP A CG    1 
ATOM   2549 O  OD1   . ASP E 3 232 ? 29.936  -0.227  -43.179 1.00 40.42  ? 231 ASP A OD1   1 
ATOM   2550 O  OD2   . ASP E 3 232 ? 31.461  -0.591  -44.712 1.00 40.84  ? 231 ASP A OD2   1 
ATOM   2551 N  N     . GLU E 3 233 ? 29.038  3.576   -45.206 1.00 37.40  ? 232 GLU A N     1 
ATOM   2552 C  CA    . GLU E 3 233 ? 29.942  4.724   -45.329 1.00 38.34  ? 232 GLU A CA    1 
ATOM   2553 C  C     . GLU E 3 233 ? 30.012  5.665   -44.136 1.00 38.42  ? 232 GLU A C     1 
ATOM   2554 O  O     . GLU E 3 233 ? 30.681  6.683   -44.211 1.00 38.83  ? 232 GLU A O     1 
ATOM   2555 C  CB    . GLU E 3 233 ? 29.649  5.495   -46.606 1.00 38.05  ? 232 GLU A CB    1 
ATOM   2556 C  CG    . GLU E 3 233 ? 30.184  4.783   -47.793 1.00 38.77  ? 232 GLU A CG    1 
ATOM   2557 C  CD    . GLU E 3 233 ? 29.809  5.458   -49.082 1.00 39.34  ? 232 GLU A CD    1 
ATOM   2558 O  OE1   . GLU E 3 233 ? 28.660  5.948   -49.181 1.00 40.17  ? 232 GLU A OE1   1 
ATOM   2559 O  OE2   . GLU E 3 233 ? 30.666  5.482   -49.989 1.00 38.74  ? 232 GLU A OE2   1 
ATOM   2560 N  N     . TYR E 3 234 ? 29.342  5.311   -43.041 1.00 38.86  ? 233 TYR A N     1 
ATOM   2561 C  CA    . TYR E 3 234 ? 29.339  6.126   -41.811 1.00 38.64  ? 233 TYR A CA    1 
ATOM   2562 C  C     . TYR E 3 234 ? 30.739  6.238   -41.219 1.00 38.83  ? 233 TYR A C     1 
ATOM   2563 O  O     . TYR E 3 234 ? 31.454  5.253   -41.089 1.00 38.87  ? 233 TYR A O     1 
ATOM   2564 C  CB    . TYR E 3 234 ? 28.367  5.533   -40.791 1.00 38.32  ? 233 TYR A CB    1 
ATOM   2565 C  CG    . TYR E 3 234 ? 28.131  6.388   -39.555 1.00 38.29  ? 233 TYR A CG    1 
ATOM   2566 C  CD1   . TYR E 3 234 ? 27.145  7.378   -39.531 1.00 37.85  ? 233 TYR A CD1   1 
ATOM   2567 C  CD2   . TYR E 3 234 ? 28.897  6.200   -38.402 1.00 37.78  ? 233 TYR A CD2   1 
ATOM   2568 C  CE1   . TYR E 3 234 ? 26.940  8.163   -38.378 1.00 37.74  ? 233 TYR A CE1   1 
ATOM   2569 C  CE2   . TYR E 3 234 ? 28.703  6.975   -37.265 1.00 37.16  ? 233 TYR A CE2   1 
ATOM   2570 C  CZ    . TYR E 3 234 ? 27.722  7.937   -37.246 1.00 36.99  ? 233 TYR A CZ    1 
ATOM   2571 O  OH    . TYR E 3 234 ? 27.564  8.687   -36.098 1.00 35.25  ? 233 TYR A OH    1 
ATOM   2572 N  N     . ASN E 3 235 ? 31.140  7.452   -40.877 1.00 39.40  ? 234 ASN A N     1 
ATOM   2573 C  CA    . ASN E 3 235 ? 32.468  7.654   -40.326 1.00 40.05  ? 234 ASN A CA    1 
ATOM   2574 C  C     . ASN E 3 235 ? 32.491  8.817   -39.357 1.00 40.23  ? 234 ASN A C     1 
ATOM   2575 O  O     . ASN E 3 235 ? 33.477  9.549   -39.281 1.00 40.57  ? 234 ASN A O     1 
ATOM   2576 C  CB    . ASN E 3 235 ? 33.485  7.884   -41.446 1.00 40.57  ? 234 ASN A CB    1 
ATOM   2577 C  CG    . ASN E 3 235 ? 34.883  8.138   -40.920 1.00 41.21  ? 234 ASN A CG    1 
ATOM   2578 O  OD1   . ASN E 3 235 ? 35.592  9.020   -41.408 1.00 42.24  ? 234 ASN A OD1   1 
ATOM   2579 N  ND2   . ASN E 3 235 ? 35.289  7.365   -39.920 1.00 40.51  ? 234 ASN A ND2   1 
ATOM   2580 N  N     . GLU E 3 236 ? 31.404  8.994   -38.613 1.00 40.26  ? 235 GLU A N     1 
ATOM   2581 C  CA    . GLU E 3 236 ? 31.360  10.124  -37.680 1.00 40.18  ? 235 GLU A CA    1 
ATOM   2582 C  C     . GLU E 3 236 ? 32.384  9.995   -36.557 1.00 39.15  ? 235 GLU A C     1 
ATOM   2583 O  O     . GLU E 3 236 ? 32.468  8.962   -35.921 1.00 39.53  ? 235 GLU A O     1 
ATOM   2584 C  CB    . GLU E 3 236 ? 29.942  10.434  -37.179 1.00 40.46  ? 235 GLU A CB    1 
ATOM   2585 C  CG    . GLU E 3 236 ? 29.102  11.295  -38.154 1.00 42.60  ? 235 GLU A CG    1 
ATOM   2586 C  CD    . GLU E 3 236 ? 29.665  12.712  -38.345 1.00 45.80  ? 235 GLU A CD    1 
ATOM   2587 O  OE1   . GLU E 3 236 ? 29.747  13.466  -37.347 1.00 46.10  ? 235 GLU A OE1   1 
ATOM   2588 O  OE2   . GLU E 3 236 ? 30.034  13.069  -39.497 1.00 48.13  ? 235 GLU A OE2   1 
ATOM   2589 N  N     . PRO E 3 237 ? 33.221  11.026  -36.390 1.00 38.41  ? 236 PRO A N     1 
ATOM   2590 C  CA    . PRO E 3 237 ? 34.269  11.107  -35.390 1.00 37.78  ? 236 PRO A CA    1 
ATOM   2591 C  C     . PRO E 3 237 ? 33.721  11.080  -33.984 1.00 37.69  ? 236 PRO A C     1 
ATOM   2592 O  O     . PRO E 3 237 ? 32.547  11.390  -33.780 1.00 37.75  ? 236 PRO A O     1 
ATOM   2593 C  CB    . PRO E 3 237 ? 34.883  12.485  -35.650 1.00 37.70  ? 236 PRO A CB    1 
ATOM   2594 C  CG    . PRO E 3 237 ? 33.890  13.205  -36.483 1.00 37.69  ? 236 PRO A CG    1 
ATOM   2595 C  CD    . PRO E 3 237 ? 33.292  12.157  -37.324 1.00 37.99  ? 236 PRO A CD    1 
ATOM   2596 N  N     . ILE E 3 238 ? 34.578  10.742  -33.022 1.00 37.61  ? 237 ILE A N     1 
ATOM   2597 C  CA    . ILE E 3 238 ? 34.205  10.749  -31.609 1.00 37.35  ? 237 ILE A CA    1 
ATOM   2598 C  C     . ILE E 3 238 ? 34.568  12.048  -30.923 1.00 37.59  ? 237 ILE A C     1 
ATOM   2599 O  O     . ILE E 3 238 ? 35.708  12.261  -30.557 1.00 37.78  ? 237 ILE A O     1 
ATOM   2600 C  CB    . ILE E 3 238 ? 34.849  9.587   -30.849 1.00 37.13  ? 237 ILE A CB    1 
ATOM   2601 C  CG1   . ILE E 3 238 ? 33.996  8.313   -30.987 1.00 35.96  ? 237 ILE A CG1   1 
ATOM   2602 C  CG2   . ILE E 3 238 ? 34.938  9.929   -29.382 1.00 37.71  ? 237 ILE A CG2   1 
ATOM   2603 C  CD1   . ILE E 3 238 ? 34.276  7.510   -32.163 1.00 32.04  ? 237 ILE A CD1   1 
ATOM   2604 N  N     . ARG E 3 239 ? 33.582  12.916  -30.749 1.00 38.27  ? 238 ARG A N     1 
ATOM   2605 C  CA    . ARG E 3 239 ? 33.832  14.245  -30.190 1.00 38.92  ? 238 ARG A CA    1 
ATOM   2606 C  C     . ARG E 3 239 ? 33.102  14.487  -28.869 1.00 38.65  ? 238 ARG A C     1 
ATOM   2607 O  O     . ARG E 3 239 ? 32.057  13.873  -28.588 1.00 38.41  ? 238 ARG A O     1 
ATOM   2608 C  CB    . ARG E 3 239 ? 33.568  15.377  -31.218 1.00 39.70  ? 238 ARG A CB    1 
ATOM   2609 C  CG    . ARG E 3 239 ? 32.317  15.231  -32.112 1.00 41.63  ? 238 ARG A CG    1 
ATOM   2610 C  CD    . ARG E 3 239 ? 32.084  16.481  -33.008 1.00 44.35  ? 238 ARG A CD    1 
ATOM   2611 N  NE    . ARG E 3 239 ? 32.883  16.505  -34.249 1.00 46.49  ? 238 ARG A NE    1 
ATOM   2612 C  CZ    . ARG E 3 239 ? 33.846  17.388  -34.537 1.00 47.34  ? 238 ARG A CZ    1 
ATOM   2613 N  NH1   . ARG E 3 239 ? 34.497  17.318  -35.694 1.00 46.86  ? 238 ARG A NH1   1 
ATOM   2614 N  NH2   . ARG E 3 239 ? 34.170  18.346  -33.675 1.00 48.49  ? 238 ARG A NH2   1 
ATOM   2615 N  N     . THR E 3 240 ? 33.708  15.361  -28.060 1.00 38.52  ? 239 THR A N     1 
ATOM   2616 C  CA    . THR E 3 240 ? 33.248  15.707  -26.727 1.00 38.17  ? 239 THR A CA    1 
ATOM   2617 C  C     . THR E 3 240 ? 31.907  16.357  -26.896 1.00 38.41  ? 239 THR A C     1 
ATOM   2618 O  O     . THR E 3 240 ? 31.808  17.431  -27.515 1.00 38.85  ? 239 THR A O     1 
ATOM   2619 C  CB    . THR E 3 240 ? 34.153  16.775  -26.072 1.00 38.25  ? 239 THR A CB    1 
ATOM   2620 O  OG1   . THR E 3 240 ? 35.532  16.538  -26.387 1.00 38.56  ? 239 THR A OG1   1 
ATOM   2621 C  CG2   . THR E 3 240 ? 33.965  16.800  -24.560 1.00 38.11  ? 239 THR A CG2   1 
ATOM   2622 N  N     . ARG E 3 241 ? 30.875  15.716  -26.360 1.00 38.33  ? 240 ARG A N     1 
ATOM   2623 C  CA    . ARG E 3 241 ? 29.562  16.316  -26.350 1.00 38.47  ? 240 ARG A CA    1 
ATOM   2624 C  C     . ARG E 3 241 ? 29.561  17.449  -25.337 1.00 38.42  ? 240 ARG A C     1 
ATOM   2625 O  O     . ARG E 3 241 ? 30.077  17.280  -24.226 1.00 38.86  ? 240 ARG A O     1 
ATOM   2626 C  CB    . ARG E 3 241 ? 28.473  15.277  -26.071 1.00 38.20  ? 240 ARG A CB    1 
ATOM   2627 C  CG    . ARG E 3 241 ? 28.109  14.544  -27.357 1.00 39.02  ? 240 ARG A CG    1 
ATOM   2628 C  CD    . ARG E 3 241 ? 26.857  13.690  -27.219 1.00 39.56  ? 240 ARG A CD    1 
ATOM   2629 N  NE    . ARG E 3 241 ? 26.893  12.554  -28.149 1.00 40.37  ? 240 ARG A NE    1 
ATOM   2630 C  CZ    . ARG E 3 241 ? 25.875  11.720  -28.369 1.00 40.23  ? 240 ARG A CZ    1 
ATOM   2631 N  NH1   . ARG E 3 241 ? 24.711  11.892  -27.732 1.00 40.77  ? 240 ARG A NH1   1 
ATOM   2632 N  NH2   . ARG E 3 241 ? 26.016  10.708  -29.217 1.00 40.21  ? 240 ARG A NH2   1 
ATOM   2633 N  N     . VAL E 3 242 ? 29.031  18.603  -25.756 1.00 38.19  ? 241 VAL A N     1 
ATOM   2634 C  CA    . VAL E 3 242 ? 28.882  19.786  -24.904 1.00 37.82  ? 241 VAL A CA    1 
ATOM   2635 C  C     . VAL E 3 242 ? 27.392  20.008  -24.736 1.00 37.88  ? 241 VAL A C     1 
ATOM   2636 O  O     . VAL E 3 242 ? 26.609  20.011  -25.722 1.00 37.96  ? 241 VAL A O     1 
ATOM   2637 C  CB    . VAL E 3 242 ? 29.453  21.089  -25.537 1.00 37.95  ? 241 VAL A CB    1 
ATOM   2638 C  CG1   . VAL E 3 242 ? 30.062  21.985  -24.462 1.00 37.02  ? 241 VAL A CG1   1 
ATOM   2639 C  CG2   . VAL E 3 242 ? 30.443  20.778  -26.637 1.00 37.68  ? 241 VAL A CG2   1 
ATOM   2640 N  N     . ARG E 3 243 ? 27.033  20.202  -23.474 1.00 37.62  ? 242 ARG A N     1 
ATOM   2641 C  CA    . ARG E 3 243 ? 25.671  20.355  -23.008 1.00 37.23  ? 242 ARG A CA    1 
ATOM   2642 C  C     . ARG E 3 243 ? 25.201  21.751  -23.427 1.00 36.56  ? 242 ARG A C     1 
ATOM   2643 O  O     . ARG E 3 243 ? 25.821  22.745  -23.031 1.00 36.53  ? 242 ARG A O     1 
ATOM   2644 C  CB    . ARG E 3 243 ? 25.682  20.172  -21.483 1.00 37.55  ? 242 ARG A CB    1 
ATOM   2645 C  CG    . ARG E 3 243 ? 24.325  20.099  -20.837 1.00 39.05  ? 242 ARG A CG    1 
ATOM   2646 C  CD    . ARG E 3 243 ? 24.195  18.882  -19.890 1.00 42.46  ? 242 ARG A CD    1 
ATOM   2647 N  NE    . ARG E 3 243 ? 24.296  17.597  -20.620 1.00 45.24  ? 242 ARG A NE    1 
ATOM   2648 C  CZ    . ARG E 3 243 ? 23.750  17.358  -21.818 1.00 45.61  ? 242 ARG A CZ    1 
ATOM   2649 N  NH1   . ARG E 3 243 ? 23.048  18.310  -22.415 1.00 47.09  ? 242 ARG A NH1   1 
ATOM   2650 N  NH2   . ARG E 3 243 ? 23.901  16.189  -22.434 1.00 43.91  ? 242 ARG A NH2   1 
ATOM   2651 N  N     . LYS E 3 244 ? 24.148  21.803  -24.257 1.00 35.77  ? 243 LYS A N     1 
ATOM   2652 C  CA    . LYS E 3 244 ? 23.638  23.043  -24.905 1.00 35.09  ? 243 LYS A CA    1 
ATOM   2653 C  C     . LYS E 3 244 ? 22.521  23.776  -24.138 1.00 34.65  ? 243 LYS A C     1 
ATOM   2654 O  O     . LYS E 3 244 ? 22.400  24.986  -24.204 1.00 34.59  ? 243 LYS A O     1 
ATOM   2655 C  CB    . LYS E 3 244 ? 23.142  22.770  -26.335 1.00 34.76  ? 243 LYS A CB    1 
ATOM   2656 C  CG    . LYS E 3 244 ? 24.185  22.993  -27.413 1.00 35.93  ? 243 LYS A CG    1 
ATOM   2657 C  CD    . LYS E 3 244 ? 24.684  21.655  -27.979 1.00 38.62  ? 243 LYS A CD    1 
ATOM   2658 C  CE    . LYS E 3 244 ? 26.048  21.763  -28.704 1.00 39.88  ? 243 LYS A CE    1 
ATOM   2659 N  NZ    . LYS E 3 244 ? 27.207  21.615  -27.742 1.00 41.39  ? 243 LYS A NZ    1 
ATOM   2660 N  N     . SER E 3 245 ? 21.681  23.022  -23.442 1.00 34.44  ? 244 SER A N     1 
ATOM   2661 C  CA    . SER E 3 245 ? 20.692  23.601  -22.569 1.00 33.20  ? 244 SER A CA    1 
ATOM   2662 C  C     . SER E 3 245 ? 20.566  22.692  -21.383 1.00 32.88  ? 244 SER A C     1 
ATOM   2663 O  O     . SER E 3 245 ? 20.548  21.483  -21.512 1.00 33.52  ? 244 SER A O     1 
ATOM   2664 C  CB    . SER E 3 245 ? 19.352  23.704  -23.251 1.00 32.87  ? 244 SER A CB    1 
ATOM   2665 O  OG    . SER E 3 245 ? 18.826  22.415  -23.419 1.00 33.58  ? 244 SER A OG    1 
ATOM   2666 N  N     . ILE E 3 246 ? 20.482  23.329  -20.234 1.00 32.34  ? 245 ILE A N     1 
ATOM   2667 C  CA    . ILE E 3 246 ? 20.212  22.755  -18.950 1.00 31.61  ? 245 ILE A CA    1 
ATOM   2668 C  C     . ILE E 3 246 ? 18.876  23.381  -18.431 1.00 31.48  ? 245 ILE A C     1 
ATOM   2669 O  O     . ILE E 3 246 ? 18.667  24.583  -18.514 1.00 30.74  ? 245 ILE A O     1 
ATOM   2670 C  CB    . ILE E 3 246 ? 21.397  23.089  -18.039 1.00 31.34  ? 245 ILE A CB    1 
ATOM   2671 C  CG1   . ILE E 3 246 ? 22.670  22.560  -18.700 1.00 31.06  ? 245 ILE A CG1   1 
ATOM   2672 C  CG2   . ILE E 3 246 ? 21.273  22.423  -16.688 1.00 31.92  ? 245 ILE A CG2   1 
ATOM   2673 C  CD1   . ILE E 3 246 ? 23.921  23.152  -18.132 1.00 30.01  ? 245 ILE A CD1   1 
ATOM   2674 N  N     . GLY E 3 247 ? 17.971  22.528  -17.933 1.00 31.71  ? 246 GLY A N     1 
ATOM   2675 C  CA    . GLY E 3 247 ? 16.628  22.930  -17.501 1.00 31.25  ? 246 GLY A CA    1 
ATOM   2676 C  C     . GLY E 3 247 ? 16.089  22.075  -16.355 1.00 30.70  ? 246 GLY A C     1 
ATOM   2677 O  O     . GLY E 3 247 ? 16.721  21.101  -15.961 1.00 31.12  ? 246 GLY A O     1 
ATOM   2678 N  N     . ARG E 3 248 ? 14.924  22.453  -15.827 1.00 29.52  ? 247 ARG A N     1 
ATOM   2679 C  CA    . ARG E 3 248 ? 14.172  21.651  -14.856 1.00 28.95  ? 247 ARG A CA    1 
ATOM   2680 C  C     . ARG E 3 248 ? 12.678  21.749  -15.157 1.00 28.25  ? 247 ARG A C     1 
ATOM   2681 O  O     . ARG E 3 248 ? 12.198  22.774  -15.637 1.00 28.94  ? 247 ARG A O     1 
ATOM   2682 C  CB    . ARG E 3 248 ? 14.456  22.170  -13.443 1.00 28.95  ? 247 ARG A CB    1 
ATOM   2683 C  CG    . ARG E 3 248 ? 13.609  21.595  -12.355 1.00 31.09  ? 247 ARG A CG    1 
ATOM   2684 C  CD    . ARG E 3 248 ? 14.128  20.208  -11.894 1.00 34.87  ? 247 ARG A CD    1 
ATOM   2685 N  NE    . ARG E 3 248 ? 13.416  19.761  -10.709 1.00 35.65  ? 247 ARG A NE    1 
ATOM   2686 C  CZ    . ARG E 3 248 ? 13.135  18.489  -10.456 1.00 37.06  ? 247 ARG A CZ    1 
ATOM   2687 N  NH1   . ARG E 3 248 ? 13.538  17.556  -11.312 1.00 37.34  ? 247 ARG A NH1   1 
ATOM   2688 N  NH2   . ARG E 3 248 ? 12.436  18.147  -9.352  1.00 38.68  ? 247 ARG A NH2   1 
ATOM   2689 N  N     . ILE E 3 249 ? 11.916  20.719  -14.845 1.00 27.84  ? 248 ILE A N     1 
ATOM   2690 C  CA    . ILE E 3 249 ? 10.496  20.730  -15.127 1.00 27.46  ? 248 ILE A CA    1 
ATOM   2691 C  C     . ILE E 3 249 ? 9.828   19.988  -13.971 1.00 27.85  ? 248 ILE A C     1 
ATOM   2692 O  O     . ILE E 3 249 ? 10.242  18.882  -13.607 1.00 27.86  ? 248 ILE A O     1 
ATOM   2693 C  CB    . ILE E 3 249 ? 10.263  20.116  -16.524 1.00 27.13  ? 248 ILE A CB    1 
ATOM   2694 C  CG1   . ILE E 3 249 ? 9.374   21.001  -17.382 1.00 27.19  ? 248 ILE A CG1   1 
ATOM   2695 C  CG2   . ILE E 3 249 ? 9.721   18.735  -16.461 1.00 29.96  ? 248 ILE A CG2   1 
ATOM   2696 C  CD1   . ILE E 3 249 ? 7.940   20.874  -17.047 1.00 26.54  ? 248 ILE A CD1   1 
ATOM   2697 N  N     . VAL E 3 250 ? 8.832   20.598  -13.344 1.00 28.24  ? 249 VAL A N     1 
ATOM   2698 C  CA    . VAL E 3 250 ? 8.198   19.954  -12.183 1.00 28.64  ? 249 VAL A CA    1 
ATOM   2699 C  C     . VAL E 3 250 ? 6.694   19.906  -12.352 1.00 28.75  ? 249 VAL A C     1 
ATOM   2700 O  O     . VAL E 3 250 ? 6.131   20.861  -12.852 1.00 28.35  ? 249 VAL A O     1 
ATOM   2701 C  CB    . VAL E 3 250 ? 8.541   20.682  -10.845 1.00 29.00  ? 249 VAL A CB    1 
ATOM   2702 C  CG1   . VAL E 3 250 ? 9.990   21.155  -10.832 1.00 29.18  ? 249 VAL A CG1   1 
ATOM   2703 C  CG2   . VAL E 3 250 ? 7.580   21.830  -10.571 1.00 29.14  ? 249 VAL A CG2   1 
ATOM   2704 N  N     . THR E 3 251 ? 6.059   18.798  -11.944 1.00 29.39  ? 250 THR A N     1 
ATOM   2705 C  CA    . THR E 3 251 ? 4.605   18.654  -11.928 1.00 30.04  ? 250 THR A CA    1 
ATOM   2706 C  C     . THR E 3 251 ? 4.066   19.365  -10.696 1.00 31.28  ? 250 THR A C     1 
ATOM   2707 O  O     . THR E 3 251 ? 4.697   19.322  -9.618  1.00 31.20  ? 250 THR A O     1 
ATOM   2708 C  CB    . THR E 3 251 ? 4.213   17.164  -11.877 1.00 30.72  ? 250 THR A CB    1 
ATOM   2709 O  OG1   . THR E 3 251 ? 4.694   16.499  -13.060 1.00 32.30  ? 250 THR A OG1   1 
ATOM   2710 C  CG2   . THR E 3 251 ? 2.678   16.940  -11.748 1.00 29.08  ? 250 THR A CG2   1 
ATOM   2711 N  N     . MET E 3 252 ? 2.920   20.026  -10.871 1.00 32.44  ? 251 MET A N     1 
ATOM   2712 C  CA    . MET E 3 252 ? 2.245   20.817  -9.838  1.00 35.05  ? 251 MET A CA    1 
ATOM   2713 C  C     . MET E 3 252 ? 1.228   19.932  -9.122  1.00 36.47  ? 251 MET A C     1 
ATOM   2714 O  O     . MET E 3 252 ? 1.089   18.786  -9.511  1.00 37.27  ? 251 MET A O     1 
ATOM   2715 C  CB    . MET E 3 252 ? 1.494   21.981  -10.498 1.00 35.03  ? 251 MET A CB    1 
ATOM   2716 C  CG    . MET E 3 252 ? 2.397   23.060  -11.085 1.00 35.88  ? 251 MET A CG    1 
ATOM   2717 S  SD    . MET E 3 252 ? 1.432   24.349  -11.846 1.00 36.33  ? 251 MET A SD    1 
ATOM   2718 C  CE    . MET E 3 252 ? 1.042   23.597  -13.409 1.00 36.15  ? 251 MET A CE    1 
ATOM   2719 N  N     . LYS E 3 253 ? 0.546   20.462  -8.112  1.00 38.24  ? 252 LYS A N     1 
ATOM   2720 C  CA    . LYS E 3 253 ? -0.458  19.697  -7.383  1.00 40.29  ? 252 LYS A CA    1 
ATOM   2721 C  C     . LYS E 3 253 ? -1.727  19.534  -8.214  1.00 41.05  ? 252 LYS A C     1 
ATOM   2722 O  O     . LYS E 3 253 ? -1.906  18.528  -8.900  1.00 41.47  ? 252 LYS A O     1 
ATOM   2723 C  CB    . LYS E 3 253 ? -0.785  20.374  -6.050  1.00 40.25  ? 252 LYS A CB    1 
ATOM   2724 C  CG    . LYS E 3 253 ? 0.399   20.487  -5.105  1.00 42.07  ? 252 LYS A CG    1 
ATOM   2725 C  CD    . LYS E 3 253 ? 1.469   19.458  -5.433  1.00 44.48  ? 252 LYS A CD    1 
ATOM   2726 C  CE    . LYS E 3 253 ? 1.807   18.607  -4.220  1.00 45.18  ? 252 LYS A CE    1 
ATOM   2727 N  NZ    . LYS E 3 253 ? 3.086   17.866  -4.400  1.00 45.71  ? 252 LYS A NZ    1 
ATOM   2728 N  N     . ARG E 3 254 ? -2.602  20.532  -8.149  1.00 41.76  ? 253 ARG A N     1 
ATOM   2729 C  CA    . ARG E 3 254 ? -3.845  20.512  -8.911  1.00 42.57  ? 253 ARG A CA    1 
ATOM   2730 C  C     . ARG E 3 254 ? -3.721  21.373  -10.164 1.00 43.05  ? 253 ARG A C     1 
ATOM   2731 O  O     . ARG E 3 254 ? -3.884  22.592  -10.110 1.00 43.02  ? 253 ARG A O     1 
ATOM   2732 C  CB    . ARG E 3 254 ? -5.011  21.001  -8.050  1.00 42.50  ? 253 ARG A CB    1 
ATOM   2733 C  CG    . ARG E 3 254 ? -4.878  22.442  -7.586  1.00 44.22  ? 253 ARG A CG    1 
ATOM   2734 C  CD    . ARG E 3 254 ? -6.232  23.129  -7.522  1.00 45.93  ? 253 ARG A CD    1 
ATOM   2735 N  NE    . ARG E 3 254 ? -6.407  24.095  -8.603  1.00 46.20  ? 253 ARG A NE    1 
ATOM   2736 C  CZ    . ARG E 3 254 ? -6.446  25.412  -8.429  1.00 45.74  ? 253 ARG A CZ    1 
ATOM   2737 N  NH1   . ARG E 3 254 ? -6.321  25.926  -7.214  1.00 45.85  ? 253 ARG A NH1   1 
ATOM   2738 N  NH2   . ARG E 3 254 ? -6.609  26.215  -9.471  1.00 45.04  ? 253 ARG A NH2   1 
ATOM   2739 N  N     . ASN E 3 255 ? -3.430  20.731  -11.291 1.00 43.33  ? 254 ASN A N     1 
ATOM   2740 C  CA    . ASN E 3 255 ? -3.253  21.450  -12.567 1.00 44.03  ? 254 ASN A CA    1 
ATOM   2741 C  C     . ASN E 3 255 ? -4.354  22.481  -12.880 1.00 43.71  ? 254 ASN A C     1 
ATOM   2742 O  O     . ASN E 3 255 ? -5.537  22.172  -12.778 1.00 43.36  ? 254 ASN A O     1 
ATOM   2743 C  CB    . ASN E 3 255 ? -2.994  20.507  -13.755 1.00 44.47  ? 254 ASN A CB    1 
ATOM   2744 C  CG    . ASN E 3 255 ? -4.093  19.479  -13.975 1.00 45.71  ? 254 ASN A CG    1 
ATOM   2745 O  OD1   . ASN E 3 255 ? -4.038  18.716  -14.955 1.00 45.83  ? 254 ASN A OD1   1 
ATOM   2746 N  ND2   . ASN E 3 255 ? -5.095  19.443  -13.076 1.00 46.10  ? 254 ASN A ND2   1 
ATOM   2747 N  N     . SER E 3 256 ? -3.920  23.687  -13.267 1.00 43.78  ? 255 SER A N     1 
ATOM   2748 C  CA    . SER E 3 256 ? -4.736  24.915  -13.324 1.00 43.73  ? 255 SER A CA    1 
ATOM   2749 C  C     . SER E 3 256 ? -4.252  25.901  -14.385 1.00 43.58  ? 255 SER A C     1 
ATOM   2750 O  O     . SER E 3 256 ? -3.174  25.720  -14.940 1.00 43.52  ? 255 SER A O     1 
ATOM   2751 C  CB    . SER E 3 256 ? -4.581  25.661  -12.006 1.00 43.86  ? 255 SER A CB    1 
ATOM   2752 O  OG    . SER E 3 256 ? -3.312  26.314  -11.948 1.00 43.82  ? 255 SER A OG    1 
ATOM   2753 N  N     . ARG E 3 257 ? -5.027  26.972  -14.609 1.00 43.36  ? 256 ARG A N     1 
ATOM   2754 C  CA    . ARG E 3 257 ? -4.564  28.108  -15.413 1.00 42.81  ? 256 ARG A CA    1 
ATOM   2755 C  C     . ARG E 3 257 ? -4.576  29.494  -14.742 1.00 42.86  ? 256 ARG A C     1 
ATOM   2756 O  O     . ARG E 3 257 ? -4.718  30.495  -15.430 1.00 42.70  ? 256 ARG A O     1 
ATOM   2757 C  CB    . ARG E 3 257 ? -5.201  28.157  -16.822 1.00 42.71  ? 256 ARG A CB    1 
ATOM   2758 C  CG    . ARG E 3 257 ? -6.711  28.215  -16.935 1.00 41.85  ? 256 ARG A CG    1 
ATOM   2759 C  CD    . ARG E 3 257 ? -7.144  28.164  -18.412 1.00 41.19  ? 256 ARG A CD    1 
ATOM   2760 N  NE    . ARG E 3 257 ? -6.971  29.458  -19.085 1.00 40.24  ? 256 ARG A NE    1 
ATOM   2761 C  CZ    . ARG E 3 257 ? -6.122  29.708  -20.079 1.00 39.09  ? 256 ARG A CZ    1 
ATOM   2762 N  NH1   . ARG E 3 257 ? -5.342  28.757  -20.581 1.00 39.33  ? 256 ARG A NH1   1 
ATOM   2763 N  NH2   . ARG E 3 257 ? -6.057  30.921  -20.587 1.00 37.52  ? 256 ARG A NH2   1 
ATOM   2764 N  N     . ASN E 3 258 ? -4.365  29.538  -13.420 1.00 42.76  ? 257 ASN A N     1 
ATOM   2765 C  CA    . ASN E 3 258 ? -4.160  30.795  -12.659 1.00 42.40  ? 257 ASN A CA    1 
ATOM   2766 C  C     . ASN E 3 258 ? -2.683  31.141  -12.360 1.00 41.77  ? 257 ASN A C     1 
ATOM   2767 O  O     . ASN E 3 258 ? -2.033  30.517  -11.520 1.00 42.11  ? 257 ASN A O     1 
ATOM   2768 C  CB    . ASN E 3 258 ? -4.971  30.730  -11.352 1.00 42.70  ? 257 ASN A CB    1 
ATOM   2769 C  CG    . ASN E 3 258 ? -4.489  31.711  -10.290 1.00 42.83  ? 257 ASN A CG    1 
ATOM   2770 O  OD1   . ASN E 3 258 ? -3.328  31.677  -9.852  1.00 42.64  ? 257 ASN A OD1   1 
ATOM   2771 N  ND2   . ASN E 3 258 ? -5.399  32.561  -9.839  1.00 42.59  ? 257 ASN A ND2   1 
ATOM   2772 N  N     . LEU E 3 259 ? -2.166  32.147  -13.045 1.00 41.08  ? 258 LEU A N     1 
ATOM   2773 C  CA    . LEU E 3 259 ? -0.795  32.647  -12.842 1.00 40.19  ? 258 LEU A CA    1 
ATOM   2774 C  C     . LEU E 3 259 ? -0.238  32.798  -11.409 1.00 39.96  ? 258 LEU A C     1 
ATOM   2775 O  O     . LEU E 3 259 ? 0.951   32.603  -11.185 1.00 39.60  ? 258 LEU A O     1 
ATOM   2776 C  CB    . LEU E 3 259 ? -0.651  33.976  -13.558 1.00 39.62  ? 258 LEU A CB    1 
ATOM   2777 C  CG    . LEU E 3 259 ? 0.330   33.899  -14.712 1.00 39.53  ? 258 LEU A CG    1 
ATOM   2778 C  CD1   . LEU E 3 259 ? 0.122   35.110  -15.634 1.00 41.27  ? 258 LEU A CD1   1 
ATOM   2779 C  CD2   . LEU E 3 259 ? 1.738   33.896  -14.154 1.00 37.83  ? 258 LEU A CD2   1 
ATOM   2780 N  N     . GLU E 3 260 ? -1.081  33.152  -10.444 1.00 39.81  ? 259 GLU A N     1 
ATOM   2781 C  CA    . GLU E 3 260 ? -0.586  33.418  -9.099  1.00 39.50  ? 259 GLU A CA    1 
ATOM   2782 C  C     . GLU E 3 260 ? -0.264  32.155  -8.342  1.00 38.98  ? 259 GLU A C     1 
ATOM   2783 O  O     . GLU E 3 260 ? 0.625   32.162  -7.487  1.00 39.22  ? 259 GLU A O     1 
ATOM   2784 C  CB    . GLU E 3 260 ? -1.557  34.310  -8.285  1.00 39.86  ? 259 GLU A CB    1 
ATOM   2785 C  CG    . GLU E 3 260 ? -1.430  35.803  -8.567  1.00 40.15  ? 259 GLU A CG    1 
ATOM   2786 C  CD    . GLU E 3 260 ? -0.059  36.197  -9.093  1.00 41.15  ? 259 GLU A CD    1 
ATOM   2787 O  OE1   . GLU E 3 260 ? 0.924   36.202  -8.309  1.00 41.72  ? 259 GLU A OE1   1 
ATOM   2788 O  OE2   . GLU E 3 260 ? 0.023   36.512  -10.301 1.00 41.78  ? 259 GLU A OE2   1 
ATOM   2789 N  N     . GLU E 3 261 ? -0.997  31.085  -8.641  1.00 38.29  ? 260 GLU A N     1 
ATOM   2790 C  CA    . GLU E 3 261 ? -0.727  29.785  -8.032  1.00 37.68  ? 260 GLU A CA    1 
ATOM   2791 C  C     . GLU E 3 261 ? 0.346   28.991  -8.818  1.00 36.86  ? 260 GLU A C     1 
ATOM   2792 O  O     . GLU E 3 261 ? 1.116   28.244  -8.212  1.00 37.42  ? 260 GLU A O     1 
ATOM   2793 C  CB    . GLU E 3 261 ? -2.018  28.972  -7.861  1.00 37.68  ? 260 GLU A CB    1 
ATOM   2794 C  CG    . GLU E 3 261 ? -2.451  28.248  -9.136  1.00 38.50  ? 260 GLU A CG    1 
ATOM   2795 C  CD    . GLU E 3 261 ? -3.813  27.558  -9.040  1.00 39.14  ? 260 GLU A CD    1 
ATOM   2796 O  OE1   . GLU E 3 261 ? -4.661  27.807  -9.935  1.00 39.52  ? 260 GLU A OE1   1 
ATOM   2797 O  OE2   . GLU E 3 261 ? -4.040  26.764  -8.087  1.00 37.66  ? 260 GLU A OE2   1 
ATOM   2798 N  N     . ILE E 3 262 ? 0.388   29.128  -10.143 1.00 35.34  ? 261 ILE A N     1 
ATOM   2799 C  CA    . ILE E 3 262 ? 1.458   28.518  -10.953 1.00 34.45  ? 261 ILE A CA    1 
ATOM   2800 C  C     . ILE E 3 262 ? 2.837   29.100  -10.630 1.00 34.27  ? 261 ILE A C     1 
ATOM   2801 O  O     . ILE E 3 262 ? 3.828   28.385  -10.556 1.00 34.36  ? 261 ILE A O     1 
ATOM   2802 C  CB    . ILE E 3 262 ? 1.225   28.788  -12.443 1.00 34.30  ? 261 ILE A CB    1 
ATOM   2803 C  CG1   . ILE E 3 262 ? 0.002   28.037  -12.952 1.00 33.83  ? 261 ILE A CG1   1 
ATOM   2804 C  CG2   . ILE E 3 262 ? 2.488   28.509  -13.278 1.00 33.30  ? 261 ILE A CG2   1 
ATOM   2805 C  CD1   . ILE E 3 262 ? -0.463  28.608  -14.281 1.00 33.14  ? 261 ILE A CD1   1 
ATOM   2806 N  N     . LYS E 3 263 ? 2.886   30.417  -10.466 1.00 33.94  ? 262 LYS A N     1 
ATOM   2807 C  CA    . LYS E 3 263 ? 4.115   31.172  -10.176 1.00 33.34  ? 262 LYS A CA    1 
ATOM   2808 C  C     . LYS E 3 263 ? 5.207   30.439  -9.322  1.00 33.09  ? 262 LYS A C     1 
ATOM   2809 O  O     . LYS E 3 263 ? 6.355   30.389  -9.740  1.00 33.34  ? 262 LYS A O     1 
ATOM   2810 C  CB    . LYS E 3 263 ? 3.723   32.566  -9.603  1.00 33.33  ? 262 LYS A CB    1 
ATOM   2811 C  CG    . LYS E 3 263 ? 4.575   33.813  -9.994  1.00 32.14  ? 262 LYS A CG    1 
ATOM   2812 C  CD    . LYS E 3 263 ? 4.159   35.047  -9.118  1.00 31.67  ? 262 LYS A CD    1 
ATOM   2813 C  CE    . LYS E 3 263 ? 5.197   36.197  -9.091  1.00 31.15  ? 262 LYS A CE    1 
ATOM   2814 N  NZ    . LYS E 3 263 ? 5.111   37.050  -7.858  1.00 29.56  ? 262 LYS A NZ    1 
ATOM   2815 N  N     . PRO E 3 264 ? 4.868   29.863  -8.142  1.00 33.06  ? 263 PRO A N     1 
ATOM   2816 C  CA    . PRO E 3 264 ? 5.967   29.330  -7.262  1.00 32.70  ? 263 PRO A CA    1 
ATOM   2817 C  C     . PRO E 3 264 ? 6.684   28.044  -7.713  1.00 32.32  ? 263 PRO A C     1 
ATOM   2818 O  O     . PRO E 3 264 ? 7.843   27.792  -7.345  1.00 32.97  ? 263 PRO A O     1 
ATOM   2819 C  CB    . PRO E 3 264 ? 5.266   29.109  -5.907  1.00 32.38  ? 263 PRO A CB    1 
ATOM   2820 C  CG    . PRO E 3 264 ? 4.068   29.944  -5.946  1.00 32.24  ? 263 PRO A CG    1 
ATOM   2821 C  CD    . PRO E 3 264 ? 3.602   29.962  -7.392  1.00 32.93  ? 263 PRO A CD    1 
ATOM   2822 N  N     . TYR E 3 265 ? 5.988   27.229  -8.494  1.00 31.54  ? 264 TYR A N     1 
ATOM   2823 C  CA    . TYR E 3 265 ? 6.589   26.112  -9.203  1.00 30.20  ? 264 TYR A CA    1 
ATOM   2824 C  C     . TYR E 3 265 ? 7.616   26.658  -10.169 1.00 29.46  ? 264 TYR A C     1 
ATOM   2825 O  O     . TYR E 3 265 ? 8.799   26.235  -10.157 1.00 29.78  ? 264 TYR A O     1 
ATOM   2826 C  CB    . TYR E 3 265 ? 5.496   25.356  -9.975  1.00 30.78  ? 264 TYR A CB    1 
ATOM   2827 C  CG    . TYR E 3 265 ? 4.377   24.842  -9.100  1.00 29.95  ? 264 TYR A CG    1 
ATOM   2828 C  CD1   . TYR E 3 265 ? 4.592   23.790  -8.232  1.00 31.44  ? 264 TYR A CD1   1 
ATOM   2829 C  CD2   . TYR E 3 265 ? 3.133   25.417  -9.129  1.00 29.88  ? 264 TYR A CD2   1 
ATOM   2830 C  CE1   . TYR E 3 265 ? 3.574   23.293  -7.418  1.00 32.35  ? 264 TYR A CE1   1 
ATOM   2831 C  CE2   . TYR E 3 265 ? 2.116   24.946  -8.318  1.00 32.05  ? 264 TYR A CE2   1 
ATOM   2832 C  CZ    . TYR E 3 265 ? 2.352   23.877  -7.455  1.00 32.41  ? 264 TYR A CZ    1 
ATOM   2833 O  OH    . TYR E 3 265 ? 1.354   23.391  -6.637  1.00 34.43  ? 264 TYR A OH    1 
ATOM   2834 N  N     . LEU E 3 266 ? 7.174   27.628  -10.976 1.00 27.90  ? 265 LEU A N     1 
ATOM   2835 C  CA    . LEU E 3 266 ? 7.993   28.195  -12.011 1.00 26.57  ? 265 LEU A CA    1 
ATOM   2836 C  C     . LEU E 3 266 ? 9.323   28.584  -11.420 1.00 26.62  ? 265 LEU A C     1 
ATOM   2837 O  O     . LEU E 3 266 ? 10.368  28.276  -12.009 1.00 26.30  ? 265 LEU A O     1 
ATOM   2838 C  CB    . LEU E 3 266 ? 7.312   29.393  -12.672 1.00 26.49  ? 265 LEU A CB    1 
ATOM   2839 C  CG    . LEU E 3 266 ? 8.045   30.154  -13.811 1.00 24.58  ? 265 LEU A CG    1 
ATOM   2840 C  CD1   . LEU E 3 266 ? 8.831   29.209  -14.747 1.00 23.02  ? 265 LEU A CD1   1 
ATOM   2841 C  CD2   . LEU E 3 266 ? 7.013   30.894  -14.599 1.00 20.70  ? 265 LEU A CD2   1 
ATOM   2842 N  N     . PHE E 3 267 ? 9.286   29.181  -10.227 1.00 26.75  ? 266 PHE A N     1 
ATOM   2843 C  CA    . PHE E 3 267 ? 10.506  29.732  -9.590  1.00 27.14  ? 266 PHE A CA    1 
ATOM   2844 C  C     . PHE E 3 267 ? 11.425  28.664  -9.053  1.00 27.19  ? 266 PHE A C     1 
ATOM   2845 O  O     . PHE E 3 267 ? 12.644  28.845  -8.985  1.00 26.90  ? 266 PHE A O     1 
ATOM   2846 C  CB    . PHE E 3 267 ? 10.174  30.748  -8.478  1.00 27.32  ? 266 PHE A CB    1 
ATOM   2847 C  CG    . PHE E 3 267 ? 9.513   32.032  -8.983  1.00 26.23  ? 266 PHE A CG    1 
ATOM   2848 C  CD1   . PHE E 3 267 ? 9.580   32.399  -10.328 1.00 25.34  ? 266 PHE A CD1   1 
ATOM   2849 C  CD2   . PHE E 3 267 ? 8.845   32.880  -8.092  1.00 27.22  ? 266 PHE A CD2   1 
ATOM   2850 C  CE1   . PHE E 3 267 ? 8.949   33.583  -10.807 1.00 25.45  ? 266 PHE A CE1   1 
ATOM   2851 C  CE2   . PHE E 3 267 ? 8.224   34.068  -8.531  1.00 26.35  ? 266 PHE A CE2   1 
ATOM   2852 C  CZ    . PHE E 3 267 ? 8.279   34.418  -9.895  1.00 26.69  ? 266 PHE A CZ    1 
ATOM   2853 N  N     . ARG E 3 268 ? 10.847  27.530  -8.677  1.00 27.80  ? 267 ARG A N     1 
ATOM   2854 C  CA    . ARG E 3 268 ? 11.713  26.437  -8.197  0.50 27.62  ? 267 ARG A CA    1 
ATOM   2855 C  C     . ARG E 3 268 ? 12.525  25.780  -9.315  1.00 27.43  ? 267 ARG A C     1 
ATOM   2856 O  O     . ARG E 3 268 ? 13.688  25.434  -9.137  1.00 28.39  ? 267 ARG A O     1 
ATOM   2857 C  CB    . ARG E 3 268 ? 10.943  25.381  -7.407  0.50 27.71  ? 267 ARG A CB    1 
ATOM   2858 C  CG    . ARG E 3 268 ? 11.768  24.824  -6.281  0.50 27.53  ? 267 ARG A CG    1 
ATOM   2859 C  CD    . ARG E 3 268 ? 11.445  25.607  -5.034  0.50 29.48  ? 267 ARG A CD    1 
ATOM   2860 N  NE    . ARG E 3 268 ? 10.717  26.825  -5.372  0.50 30.09  ? 267 ARG A NE    1 
ATOM   2861 C  CZ    . ARG E 3 268 ? 10.289  27.708  -4.477  0.50 31.02  ? 267 ARG A CZ    1 
ATOM   2862 N  NH1   . ARG E 3 268 ? 10.507  27.502  -3.178  0.50 30.59  ? 267 ARG A NH1   1 
ATOM   2863 N  NH2   . ARG E 3 268 ? 9.645   28.795  -4.880  0.50 29.48  ? 267 ARG A NH2   1 
ATOM   2864 N  N     . ALA E 3 269 ? 11.904  25.585  -10.465 1.00 26.90  ? 268 ALA A N     1 
ATOM   2865 C  CA    . ALA E 3 269 ? 12.608  25.085  -11.617 1.00 25.70  ? 268 ALA A CA    1 
ATOM   2866 C  C     . ALA E 3 269 ? 13.799  26.026  -11.927 1.00 25.74  ? 268 ALA A C     1 
ATOM   2867 O  O     . ALA E 3 269 ? 14.922  25.582  -12.304 1.00 25.10  ? 268 ALA A O     1 
ATOM   2868 C  CB    . ALA E 3 269 ? 11.635  24.980  -12.775 1.00 25.49  ? 268 ALA A CB    1 
ATOM   2869 N  N     . ILE E 3 270 ? 13.582  27.318  -11.682 1.00 25.62  ? 269 ILE A N     1 
ATOM   2870 C  CA    . ILE E 3 270 ? 14.644  28.306  -11.905 1.00 26.15  ? 269 ILE A CA    1 
ATOM   2871 C  C     . ILE E 3 270 ? 15.886  28.150  -10.987 1.00 27.85  ? 269 ILE A C     1 
ATOM   2872 O  O     . ILE E 3 270 ? 17.050  28.143  -11.496 1.00 29.21  ? 269 ILE A O     1 
ATOM   2873 C  CB    . ILE E 3 270 ? 14.107  29.723  -11.880 1.00 25.46  ? 269 ILE A CB    1 
ATOM   2874 C  CG1   . ILE E 3 270 ? 13.217  29.983  -13.116 1.00 23.72  ? 269 ILE A CG1   1 
ATOM   2875 C  CG2   . ILE E 3 270 ? 15.266  30.683  -11.797 1.00 25.63  ? 269 ILE A CG2   1 
ATOM   2876 C  CD1   . ILE E 3 270 ? 11.978  30.878  -12.854 1.00 19.34  ? 269 ILE A CD1   1 
ATOM   2877 N  N     . GLU E 3 271 ? 15.648  28.021  -9.672  1.00 28.81  ? 270 GLU A N     1 
ATOM   2878 C  CA    . GLU E 3 271 ? 16.690  27.754  -8.643  1.00 29.79  ? 270 GLU A CA    1 
ATOM   2879 C  C     . GLU E 3 271 ? 17.469  26.517  -8.992  1.00 30.19  ? 270 GLU A C     1 
ATOM   2880 O  O     . GLU E 3 271 ? 18.708  26.505  -8.956  1.00 30.49  ? 270 GLU A O     1 
ATOM   2881 C  CB    . GLU E 3 271 ? 16.080  27.535  -7.243  1.00 30.07  ? 270 GLU A CB    1 
ATOM   2882 C  CG    . GLU E 3 271 ? 15.285  28.723  -6.655  1.00 31.26  ? 270 GLU A CG    1 
ATOM   2883 C  CD    . GLU E 3 271 ? 16.177  29.858  -6.137  1.00 34.43  ? 270 GLU A CD    1 
ATOM   2884 O  OE1   . GLU E 3 271 ? 16.191  30.121  -4.898  1.00 36.41  ? 270 GLU A OE1   1 
ATOM   2885 O  OE2   . GLU E 3 271 ? 16.875  30.488  -6.960  1.00 34.27  ? 270 GLU A OE2   1 
ATOM   2886 N  N     . GLU E 3 272 ? 16.748  25.470  -9.358  1.00 30.58  ? 271 GLU A N     1 
ATOM   2887 C  CA    . GLU E 3 272 ? 17.429  24.221  -9.598  1.00 31.70  ? 271 GLU A CA    1 
ATOM   2888 C  C     . GLU E 3 272 ? 18.199  24.242  -10.916 1.00 32.39  ? 271 GLU A C     1 
ATOM   2889 O  O     . GLU E 3 272 ? 19.283  23.579  -11.031 1.00 32.90  ? 271 GLU A O     1 
ATOM   2890 C  CB    . GLU E 3 272 ? 16.452  23.063  -9.592  1.00 32.34  ? 271 GLU A CB    1 
ATOM   2891 C  CG    . GLU E 3 272 ? 17.100  21.740  -9.157  1.00 34.83  ? 271 GLU A CG    1 
ATOM   2892 C  CD    . GLU E 3 272 ? 16.737  21.347  -7.729  1.00 36.48  ? 271 GLU A CD    1 
ATOM   2893 O  OE1   . GLU E 3 272 ? 16.390  20.156  -7.565  1.00 38.34  ? 271 GLU A OE1   1 
ATOM   2894 O  OE2   . GLU E 3 272 ? 16.765  22.217  -6.804  1.00 37.10  ? 271 GLU A OE2   1 
ATOM   2895 N  N     . SER E 3 273 ? 17.648  24.960  -11.915 1.00 31.98  ? 272 SER A N     1 
ATOM   2896 C  CA    . SER E 3 273 ? 18.373  25.147  -13.168 1.00 31.49  ? 272 SER A CA    1 
ATOM   2897 C  C     . SER E 3 273 ? 19.583  26.006  -12.889 1.00 32.40  ? 272 SER A C     1 
ATOM   2898 O  O     . SER E 3 273 ? 20.635  25.784  -13.448 1.00 33.14  ? 272 SER A O     1 
ATOM   2899 C  CB    . SER E 3 273 ? 17.490  25.745  -14.248 1.00 31.20  ? 272 SER A CB    1 
ATOM   2900 O  OG    . SER E 3 273 ? 16.505  24.790  -14.662 1.00 30.47  ? 272 SER A OG    1 
ATOM   2901 N  N     . TYR E 3 274 ? 19.495  26.952  -11.964 1.00 33.48  ? 273 TYR A N     1 
ATOM   2902 C  CA    . TYR E 3 274 ? 20.717  27.741  -11.709 1.00 34.56  ? 273 TYR A CA    1 
ATOM   2903 C  C     . TYR E 3 274 ? 21.766  26.940  -10.978 1.00 35.79  ? 273 TYR A C     1 
ATOM   2904 O  O     . TYR E 3 274 ? 22.925  26.876  -11.415 1.00 36.69  ? 273 TYR A O     1 
ATOM   2905 C  CB    . TYR E 3 274 ? 20.432  29.116  -11.068 1.00 33.84  ? 273 TYR A CB    1 
ATOM   2906 C  CG    . TYR E 3 274 ? 20.260  30.144  -12.137 1.00 32.73  ? 273 TYR A CG    1 
ATOM   2907 C  CD1   . TYR E 3 274 ? 21.353  30.899  -12.596 1.00 33.00  ? 273 TYR A CD1   1 
ATOM   2908 C  CD2   . TYR E 3 274 ? 19.029  30.314  -12.762 1.00 31.91  ? 273 TYR A CD2   1 
ATOM   2909 C  CE1   . TYR E 3 274 ? 21.200  31.845  -13.622 1.00 31.11  ? 273 TYR A CE1   1 
ATOM   2910 C  CE2   . TYR E 3 274 ? 18.872  31.242  -13.782 1.00 31.14  ? 273 TYR A CE2   1 
ATOM   2911 C  CZ    . TYR E 3 274 ? 19.957  31.998  -14.195 1.00 30.62  ? 273 TYR A CZ    1 
ATOM   2912 O  OH    . TYR E 3 274 ? 19.784  32.899  -15.207 1.00 31.66  ? 273 TYR A OH    1 
ATOM   2913 N  N     . TYR E 3 275 ? 21.340  26.334  -9.870  1.00 37.32  ? 274 TYR A N     1 
ATOM   2914 C  CA    . TYR E 3 275 ? 21.990  25.176  -9.260  1.00 38.79  ? 274 TYR A CA    1 
ATOM   2915 C  C     . TYR E 3 275 ? 22.816  24.431  -10.321 1.00 39.07  ? 274 TYR A C     1 
ATOM   2916 O  O     . TYR E 3 275 ? 24.036  24.340  -10.209 1.00 39.67  ? 274 TYR A O     1 
ATOM   2917 C  CB    . TYR E 3 275 ? 20.875  24.274  -8.720  1.00 39.54  ? 274 TYR A CB    1 
ATOM   2918 C  CG    . TYR E 3 275 ? 21.212  23.217  -7.661  1.00 42.26  ? 274 TYR A CG    1 
ATOM   2919 C  CD1   . TYR E 3 275 ? 21.307  23.564  -6.311  1.00 43.66  ? 274 TYR A CD1   1 
ATOM   2920 C  CD2   . TYR E 3 275 ? 21.352  21.857  -8.010  1.00 43.97  ? 274 TYR A CD2   1 
ATOM   2921 C  CE1   . TYR E 3 275 ? 21.579  22.607  -5.337  1.00 45.63  ? 274 TYR A CE1   1 
ATOM   2922 C  CE2   . TYR E 3 275 ? 21.628  20.876  -7.027  1.00 45.11  ? 274 TYR A CE2   1 
ATOM   2923 C  CZ    . TYR E 3 275 ? 21.741  21.269  -5.689  1.00 45.94  ? 274 TYR A CZ    1 
ATOM   2924 O  OH    . TYR E 3 275 ? 22.011  20.351  -4.695  1.00 47.04  ? 274 TYR A OH    1 
ATOM   2925 N  N     . LYS E 3 276 ? 22.151  23.956  -11.375 1.00 39.20  ? 275 LYS A N     1 
ATOM   2926 C  CA    . LYS E 3 276 ? 22.796  23.104  -12.359 1.00 39.52  ? 275 LYS A CA    1 
ATOM   2927 C  C     . LYS E 3 276 ? 23.855  23.849  -13.165 1.00 39.73  ? 275 LYS A C     1 
ATOM   2928 O  O     . LYS E 3 276 ? 25.020  23.450  -13.179 1.00 40.08  ? 275 LYS A O     1 
ATOM   2929 C  CB    . LYS E 3 276 ? 21.752  22.418  -13.264 1.00 39.85  ? 275 LYS A CB    1 
ATOM   2930 C  CG    . LYS E 3 276 ? 21.504  20.931  -12.941 1.00 40.68  ? 275 LYS A CG    1 
ATOM   2931 C  CD    . LYS E 3 276 ? 20.483  20.240  -13.878 1.00 42.14  ? 275 LYS A CD    1 
ATOM   2932 C  CE    . LYS E 3 276 ? 19.242  19.756  -13.068 1.00 43.09  ? 275 LYS A CE    1 
ATOM   2933 N  NZ    . LYS E 3 276 ? 18.213  18.993  -13.853 1.00 40.86  ? 275 LYS A NZ    1 
ATOM   2934 N  N     . LEU E 3 277 ? 23.450  24.910  -13.855 1.00 39.57  ? 276 LEU A N     1 
ATOM   2935 C  CA    . LEU E 3 277 ? 24.371  25.664  -14.701 1.00 39.12  ? 276 LEU A CA    1 
ATOM   2936 C  C     . LEU E 3 277 ? 25.820  25.477  -14.257 1.00 39.25  ? 276 LEU A C     1 
ATOM   2937 O  O     . LEU E 3 277 ? 26.670  25.040  -15.033 1.00 38.73  ? 276 LEU A O     1 
ATOM   2938 C  CB    . LEU E 3 277 ? 24.007  27.150  -14.697 1.00 38.83  ? 276 LEU A CB    1 
ATOM   2939 C  CG    . LEU E 3 277 ? 22.668  27.521  -15.337 1.00 37.65  ? 276 LEU A CG    1 
ATOM   2940 C  CD1   . LEU E 3 277 ? 22.187  28.873  -14.831 1.00 37.82  ? 276 LEU A CD1   1 
ATOM   2941 C  CD2   . LEU E 3 277 ? 22.778  27.521  -16.854 1.00 35.65  ? 276 LEU A CD2   1 
ATOM   2942 N  N     . ASP E 3 278 ? 26.098  25.815  -13.002 1.00 40.04  ? 277 ASP A N     1 
ATOM   2943 C  CA    . ASP E 3 278 ? 27.442  25.675  -12.453 1.00 40.26  ? 277 ASP A CA    1 
ATOM   2944 C  C     . ASP E 3 278 ? 28.411  26.689  -13.056 1.00 39.49  ? 277 ASP A C     1 
ATOM   2945 O  O     . ASP E 3 278 ? 29.317  26.326  -13.807 1.00 40.27  ? 277 ASP A O     1 
ATOM   2946 C  CB    . ASP E 3 278 ? 27.964  24.253  -12.675 1.00 40.57  ? 277 ASP A CB    1 
ATOM   2947 C  CG    . ASP E 3 278 ? 29.162  23.930  -11.803 1.00 41.92  ? 277 ASP A CG    1 
ATOM   2948 O  OD1   . ASP E 3 278 ? 29.413  24.678  -10.834 1.00 41.95  ? 277 ASP A OD1   1 
ATOM   2949 O  OD2   . ASP E 3 278 ? 29.852  22.929  -12.086 1.00 44.91  ? 277 ASP A OD2   1 
ATOM   2950 N  N     . LYS E 3 279 ? 28.214  27.959  -12.720 1.00 38.34  ? 278 LYS A N     1 
ATOM   2951 C  CA    . LYS E 3 279 ? 29.100  29.049  -13.204 1.00 37.26  ? 278 LYS A CA    1 
ATOM   2952 C  C     . LYS E 3 279 ? 28.946  29.374  -14.695 1.00 36.32  ? 278 LYS A C     1 
ATOM   2953 O  O     . LYS E 3 279 ? 29.723  30.189  -15.260 1.00 37.27  ? 278 LYS A O     1 
ATOM   2954 C  CB    . LYS E 3 279 ? 30.582  28.804  -12.842 1.00 37.08  ? 278 LYS A CB    1 
ATOM   2955 C  CG    . LYS E 3 279 ? 30.904  28.795  -11.317 1.00 38.33  ? 278 LYS A CG    1 
ATOM   2956 C  CD    . LYS E 3 279 ? 29.883  29.580  -10.404 1.00 39.87  ? 278 LYS A CD    1 
ATOM   2957 C  CE    . LYS E 3 279 ? 30.462  29.799  -8.989  1.00 39.77  ? 278 LYS A CE    1 
ATOM   2958 N  NZ    . LYS E 3 279 ? 30.232  31.195  -8.499  1.00 40.04  ? 278 LYS A NZ    1 
ATOM   2959 N  N     . ARG E 3 280 ? 27.942  28.753  -15.310 1.00 34.16  ? 279 ARG A N     1 
ATOM   2960 C  CA    . ARG E 3 280 ? 27.532  29.029  -16.670 1.00 32.55  ? 279 ARG A CA    1 
ATOM   2961 C  C     . ARG E 3 280 ? 26.332  29.953  -16.713 1.00 31.71  ? 279 ARG A C     1 
ATOM   2962 O  O     . ARG E 3 280 ? 25.338  29.733  -15.958 1.00 31.61  ? 279 ARG A O     1 
ATOM   2963 C  CB    . ARG E 3 280 ? 27.164  27.736  -17.367 1.00 32.78  ? 279 ARG A CB    1 
ATOM   2964 C  CG    . ARG E 3 280 ? 28.344  27.102  -18.004 1.00 33.25  ? 279 ARG A CG    1 
ATOM   2965 C  CD    . ARG E 3 280 ? 27.901  25.999  -18.884 1.00 34.35  ? 279 ARG A CD    1 
ATOM   2966 N  NE    . ARG E 3 280 ? 27.361  24.950  -18.053 1.00 36.04  ? 279 ARG A NE    1 
ATOM   2967 C  CZ    . ARG E 3 280 ? 27.591  23.664  -18.251 1.00 35.30  ? 279 ARG A CZ    1 
ATOM   2968 N  NH1   . ARG E 3 280 ? 28.364  23.251  -19.254 1.00 34.37  ? 279 ARG A NH1   1 
ATOM   2969 N  NH2   . ARG E 3 280 ? 27.061  22.811  -17.430 1.00 36.26  ? 279 ARG A NH2   1 
ATOM   2970 N  N     . ILE E 3 281 ? 26.422  30.953  -17.616 1.00 29.91  ? 280 ILE A N     1 
ATOM   2971 C  CA    . ILE E 3 281 ? 25.446  32.067  -17.755 1.00 27.97  ? 280 ILE A CA    1 
ATOM   2972 C  C     . ILE E 3 281 ? 24.805  31.892  -19.132 1.00 26.53  ? 280 ILE A C     1 
ATOM   2973 O  O     . ILE E 3 281 ? 25.497  32.008  -20.154 1.00 27.99  ? 280 ILE A O     1 
ATOM   2974 C  CB    . ILE E 3 281 ? 26.158  33.513  -17.724 1.00 28.16  ? 280 ILE A CB    1 
ATOM   2975 C  CG1   . ILE E 3 281 ? 27.253  33.665  -16.646 1.00 29.20  ? 280 ILE A CG1   1 
ATOM   2976 C  CG2   . ILE E 3 281 ? 25.198  34.633  -17.637 1.00 26.61  ? 280 ILE A CG2   1 
ATOM   2977 C  CD1   . ILE E 3 281 ? 26.763  33.507  -15.227 1.00 31.94  ? 280 ILE A CD1   1 
ATOM   2978 N  N     . PRO E 3 282 ? 23.495  31.625  -19.200 1.00 24.63  ? 281 PRO A N     1 
ATOM   2979 C  CA    . PRO E 3 282 ? 22.926  31.429  -20.545 1.00 23.13  ? 281 PRO A CA    1 
ATOM   2980 C  C     . PRO E 3 282 ? 22.399  32.778  -21.092 1.00 22.13  ? 281 PRO A C     1 
ATOM   2981 O  O     . PRO E 3 282 ? 22.150  33.706  -20.281 1.00 21.65  ? 281 PRO A O     1 
ATOM   2982 C  CB    . PRO E 3 282 ? 21.752  30.483  -20.255 1.00 23.33  ? 281 PRO A CB    1 
ATOM   2983 C  CG    . PRO E 3 282 ? 21.242  30.994  -18.930 1.00 22.92  ? 281 PRO A CG    1 
ATOM   2984 C  CD    . PRO E 3 282 ? 22.447  31.541  -18.158 1.00 23.97  ? 281 PRO A CD    1 
ATOM   2985 N  N     . LYS E 3 283 ? 22.214  32.898  -22.421 1.00 20.43  ? 282 LYS A N     1 
ATOM   2986 C  CA    . LYS E 3 283 ? 21.567  34.118  -22.992 1.00 19.08  ? 282 LYS A CA    1 
ATOM   2987 C  C     . LYS E 3 283 ? 20.071  33.968  -23.332 1.00 18.02  ? 282 LYS A C     1 
ATOM   2988 O  O     . LYS E 3 283 ? 19.387  34.911  -23.761 1.00 17.22  ? 282 LYS A O     1 
ATOM   2989 C  CB    . LYS E 3 283 ? 22.379  34.664  -24.167 1.00 20.03  ? 282 LYS A CB    1 
ATOM   2990 C  CG    . LYS E 3 283 ? 23.946  34.744  -23.876 1.00 19.89  ? 282 LYS A CG    1 
ATOM   2991 C  CD    . LYS E 3 283 ? 24.711  35.396  -25.008 1.00 19.37  ? 282 LYS A CD    1 
ATOM   2992 C  CE    . LYS E 3 283 ? 24.214  34.902  -26.312 1.00 22.72  ? 282 LYS A CE    1 
ATOM   2993 N  NZ    . LYS E 3 283 ? 24.468  33.410  -26.333 1.00 28.29  ? 282 LYS A NZ    1 
ATOM   2994 N  N     . ALA E 3 284 ? 19.545  32.792  -23.011 1.00 16.55  ? 283 ALA A N     1 
ATOM   2995 C  CA    . ALA E 3 284 ? 18.295  32.342  -23.545 1.00 15.14  ? 283 ALA A CA    1 
ATOM   2996 C  C     . ALA E 3 284 ? 17.572  31.548  -22.477 1.00 14.48  ? 283 ALA A C     1 
ATOM   2997 O  O     . ALA E 3 284 ? 18.162  30.766  -21.725 1.00 14.10  ? 283 ALA A O     1 
ATOM   2998 C  CB    . ALA E 3 284 ? 18.569  31.468  -24.776 1.00 14.52  ? 283 ALA A CB    1 
ATOM   2999 N  N     . ILE E 3 285 ? 16.274  31.758  -22.438 1.00 13.68  ? 284 ILE A N     1 
ATOM   3000 C  CA    . ILE E 3 285 ? 15.399  31.103  -21.498 1.00 13.42  ? 284 ILE A CA    1 
ATOM   3001 C  C     . ILE E 3 285 ? 14.113  30.740  -22.200 1.00 13.30  ? 284 ILE A C     1 
ATOM   3002 O  O     . ILE E 3 285 ? 13.547  31.540  -22.929 1.00 12.84  ? 284 ILE A O     1 
ATOM   3003 C  CB    . ILE E 3 285 ? 15.116  32.014  -20.235 1.00 13.04  ? 284 ILE A CB    1 
ATOM   3004 C  CG1   . ILE E 3 285 ? 14.046  31.421  -19.318 1.00 13.00  ? 284 ILE A CG1   1 
ATOM   3005 C  CG2   . ILE E 3 285 ? 14.796  33.405  -20.633 1.00 13.36  ? 284 ILE A CG2   1 
ATOM   3006 C  CD1   . ILE E 3 285 ? 13.498  32.455  -18.241 1.00 15.39  ? 284 ILE A CD1   1 
ATOM   3007 N  N     . HIS E 3 286 ? 13.642  29.533  -21.945 1.00 13.71  ? 285 HIS A N     1 
ATOM   3008 C  CA    . HIS E 3 286 ? 12.359  29.128  -22.429 1.00 14.94  ? 285 HIS A CA    1 
ATOM   3009 C  C     . HIS E 3 286 ? 11.535  28.653  -21.246 1.00 15.48  ? 285 HIS A C     1 
ATOM   3010 O  O     . HIS E 3 286 ? 12.037  27.881  -20.386 1.00 15.18  ? 285 HIS A O     1 
ATOM   3011 C  CB    . HIS E 3 286 ? 12.532  28.010  -23.476 1.00 15.89  ? 285 HIS A CB    1 
ATOM   3012 C  CG    . HIS E 3 286 ? 13.404  28.385  -24.630 1.00 18.19  ? 285 HIS A CG    1 
ATOM   3013 N  ND1   . HIS E 3 286 ? 12.888  28.815  -25.832 1.00 20.64  ? 285 HIS A ND1   1 
ATOM   3014 C  CD2   . HIS E 3 286 ? 14.751  28.415  -24.767 1.00 20.85  ? 285 HIS A CD2   1 
ATOM   3015 C  CE1   . HIS E 3 286 ? 13.871  29.067  -26.675 1.00 22.76  ? 285 HIS A CE1   1 
ATOM   3016 N  NE2   . HIS E 3 286 ? 15.015  28.851  -26.049 1.00 24.53  ? 285 HIS A NE2   1 
ATOM   3017 N  N     . VAL E 3 287 ? 10.289  29.136  -21.179 1.00 15.78  ? 286 VAL A N     1 
ATOM   3018 C  CA    . VAL E 3 287 ? 9.303   28.619  -20.227 1.00 15.79  ? 286 VAL A CA    1 
ATOM   3019 C  C     . VAL E 3 287 ? 8.509   27.526  -20.889 1.00 17.40  ? 286 VAL A C     1 
ATOM   3020 O  O     . VAL E 3 287 ? 7.889   27.765  -21.918 1.00 17.14  ? 286 VAL A O     1 
ATOM   3021 C  CB    . VAL E 3 287 ? 8.347   29.655  -19.714 1.00 14.87  ? 286 VAL A CB    1 
ATOM   3022 C  CG1   . VAL E 3 287 ? 7.223   28.977  -18.889 1.00 14.30  ? 286 VAL A CG1   1 
ATOM   3023 C  CG2   . VAL E 3 287 ? 9.082   30.574  -18.846 1.00 14.73  ? 286 VAL A CG2   1 
ATOM   3024 N  N     . VAL E 3 288 ? 8.521   26.334  -20.285 1.00 18.98  ? 287 VAL A N     1 
ATOM   3025 C  CA    . VAL E 3 288 ? 7.955   25.162  -20.904 1.00 21.09  ? 287 VAL A CA    1 
ATOM   3026 C  C     . VAL E 3 288 ? 6.704   24.827  -20.093 1.00 22.27  ? 287 VAL A C     1 
ATOM   3027 O  O     . VAL E 3 288 ? 6.775   24.747  -18.876 1.00 22.19  ? 287 VAL A O     1 
ATOM   3028 C  CB    . VAL E 3 288 ? 8.962   23.975  -20.847 1.00 21.27  ? 287 VAL A CB    1 
ATOM   3029 C  CG1   . VAL E 3 288 ? 8.409   22.768  -21.537 1.00 24.11  ? 287 VAL A CG1   1 
ATOM   3030 C  CG2   . VAL E 3 288 ? 10.305  24.309  -21.483 1.00 23.70  ? 287 VAL A CG2   1 
ATOM   3031 N  N     . ALA E 3 289 ? 5.558   24.637  -20.745 1.00 24.05  ? 288 ALA A N     1 
ATOM   3032 C  CA    . ALA E 3 289 ? 4.336   24.244  -20.017 1.00 25.63  ? 288 ALA A CA    1 
ATOM   3033 C  C     . ALA E 3 289 ? 3.791   22.928  -20.561 1.00 27.04  ? 288 ALA A C     1 
ATOM   3034 O  O     . ALA E 3 289 ? 3.645   22.733  -21.804 1.00 27.80  ? 288 ALA A O     1 
ATOM   3035 C  CB    . ALA E 3 289 ? 3.290   25.318  -20.103 1.00 25.33  ? 288 ALA A CB    1 
ATOM   3036 N  N     . VAL E 3 290 ? 3.528   21.995  -19.662 1.00 27.71  ? 289 VAL A N     1 
ATOM   3037 C  CA    . VAL E 3 290 ? 2.771   20.826  -20.094 1.00 28.96  ? 289 VAL A CA    1 
ATOM   3038 C  C     . VAL E 3 290 ? 1.318   21.004  -19.687 1.00 29.79  ? 289 VAL A C     1 
ATOM   3039 O  O     . VAL E 3 290 ? 0.978   21.254  -18.522 1.00 29.17  ? 289 VAL A O     1 
ATOM   3040 C  CB    . VAL E 3 290 ? 3.365   19.496  -19.596 1.00 29.01  ? 289 VAL A CB    1 
ATOM   3041 C  CG1   . VAL E 3 290 ? 2.724   18.278  -20.327 1.00 28.91  ? 289 VAL A CG1   1 
ATOM   3042 C  CG2   . VAL E 3 290 ? 4.889   19.491  -19.743 1.00 28.86  ? 289 VAL A CG2   1 
ATOM   3043 N  N     . THR E 3 291 ? 0.437   20.862  -20.672 1.00 31.80  ? 290 THR A N     1 
ATOM   3044 C  CA    . THR E 3 291 ? -0.986  21.117  -20.478 1.00 34.24  ? 290 THR A CA    1 
ATOM   3045 C  C     . THR E 3 291 ? -1.765  19.951  -19.867 1.00 35.52  ? 290 THR A C     1 
ATOM   3046 O  O     . THR E 3 291 ? -1.244  18.850  -19.694 1.00 34.94  ? 290 THR A O     1 
ATOM   3047 C  CB    . THR E 3 291 ? -1.665  21.525  -21.802 1.00 34.70  ? 290 THR A CB    1 
ATOM   3048 O  OG1   . THR E 3 291 ? -1.476  20.493  -22.777 1.00 35.02  ? 290 THR A OG1   1 
ATOM   3049 C  CG2   . THR E 3 291 ? -1.075  22.825  -22.325 1.00 34.46  ? 290 THR A CG2   1 
ATOM   3050 N  N     . GLU E 3 292 ? -3.025  20.229  -19.550 1.00 37.21  ? 291 GLU A N     1 
ATOM   3051 C  CA    . GLU E 3 292 ? -3.959  19.263  -18.978 1.00 39.21  ? 291 GLU A CA    1 
ATOM   3052 C  C     . GLU E 3 292 ? -4.055  17.986  -19.823 1.00 39.93  ? 291 GLU A C     1 
ATOM   3053 O  O     . GLU E 3 292 ? -4.230  16.898  -19.280 1.00 39.37  ? 291 GLU A O     1 
ATOM   3054 C  CB    . GLU E 3 292 ? -5.354  19.891  -18.825 1.00 39.61  ? 291 GLU A CB    1 
ATOM   3055 C  CG    . GLU E 3 292 ? -5.978  20.451  -20.136 1.00 40.24  ? 291 GLU A CG    1 
ATOM   3056 C  CD    . GLU E 3 292 ? -7.496  20.647  -20.054 1.00 41.51  ? 291 GLU A CD    1 
ATOM   3057 O  OE1   . GLU E 3 292 ? -8.000  21.565  -20.752 1.00 41.02  ? 291 GLU A OE1   1 
ATOM   3058 O  OE2   . GLU E 3 292 ? -8.187  19.878  -19.307 1.00 42.58  ? 291 GLU A OE2   1 
ATOM   3059 N  N     . ASP E 3 293 ? -3.939  18.133  -21.139 1.00 41.39  ? 292 ASP A N     1 
ATOM   3060 C  CA    . ASP E 3 293 ? -4.009  16.995  -22.046 1.00 43.30  ? 292 ASP A CA    1 
ATOM   3061 C  C     . ASP E 3 293 ? -2.617  16.463  -22.369 1.00 43.54  ? 292 ASP A C     1 
ATOM   3062 O  O     . ASP E 3 293 ? -2.472  15.405  -22.983 1.00 43.34  ? 292 ASP A O     1 
ATOM   3063 C  CB    . ASP E 3 293 ? -4.736  17.382  -23.336 1.00 43.92  ? 292 ASP A CB    1 
ATOM   3064 C  CG    . ASP E 3 293 ? -4.188  18.652  -23.955 1.00 45.30  ? 292 ASP A CG    1 
ATOM   3065 O  OD1   . ASP E 3 293 ? -4.883  19.249  -24.805 1.00 47.56  ? 292 ASP A OD1   1 
ATOM   3066 O  OD2   . ASP E 3 293 ? -3.063  19.055  -23.591 1.00 46.71  ? 292 ASP A OD2   1 
ATOM   3067 N  N     . LEU E 3 294 ? -1.595  17.203  -21.953 1.00 44.10  ? 293 LEU A N     1 
ATOM   3068 C  CA    . LEU E 3 294 ? -0.212  16.808  -22.197 1.00 44.29  ? 293 LEU A CA    1 
ATOM   3069 C  C     . LEU E 3 294 ? 0.205   17.121  -23.630 1.00 44.57  ? 293 LEU A C     1 
ATOM   3070 O  O     . LEU E 3 294 ? 0.542   16.221  -24.399 1.00 44.95  ? 293 LEU A O     1 
ATOM   3071 C  CB    . LEU E 3 294 ? -0.022  15.318  -21.906 1.00 43.75  ? 293 LEU A CB    1 
ATOM   3072 C  CG    . LEU E 3 294 ? -0.246  14.876  -20.459 1.00 42.90  ? 293 LEU A CG    1 
ATOM   3073 C  CD1   . LEU E 3 294 ? 0.108   13.407  -20.285 1.00 41.36  ? 293 LEU A CD1   1 
ATOM   3074 C  CD2   . LEU E 3 294 ? 0.557   15.742  -19.501 1.00 40.24  ? 293 LEU A CD2   1 
ATOM   3075 N  N     . ASP E 3 295 ? 0.181   18.402  -23.982 1.00 44.47  ? 294 ASP A N     1 
ATOM   3076 C  CA    . ASP E 3 295 ? 0.555   18.836  -25.323 1.00 44.90  ? 294 ASP A CA    1 
ATOM   3077 C  C     . ASP E 3 295 ? 1.604   19.941  -25.273 1.00 44.18  ? 294 ASP A C     1 
ATOM   3078 O  O     . ASP E 3 295 ? 1.412   21.018  -25.838 1.00 44.57  ? 294 ASP A O     1 
ATOM   3079 C  CB    . ASP E 3 295 ? -0.676  19.313  -26.095 1.00 45.87  ? 294 ASP A CB    1 
ATOM   3080 C  CG    . ASP E 3 295 ? -0.340  19.775  -27.499 1.00 47.66  ? 294 ASP A CG    1 
ATOM   3081 O  OD1   . ASP E 3 295 ? 0.548   19.165  -28.130 1.00 50.49  ? 294 ASP A OD1   1 
ATOM   3082 O  OD2   . ASP E 3 295 ? -0.964  20.748  -27.972 1.00 48.58  ? 294 ASP A OD2   1 
ATOM   3083 N  N     . ILE E 3 296 ? 2.714   19.668  -24.595 1.00 42.91  ? 295 ILE A N     1 
ATOM   3084 C  CA    . ILE E 3 296 ? 3.833   20.671  -24.469 1.00 41.32  ? 295 ILE A CA    1 
ATOM   3085 C  C     . ILE E 3 296 ? 3.797   22.039  -25.238 1.00 39.98  ? 295 ILE A C     1 
ATOM   3086 O  O     . ILE E 3 296 ? 3.846   22.071  -26.469 1.00 40.08  ? 295 ILE A O     1 
ATOM   3087 C  CB    . ILE E 3 296 ? 5.220   19.974  -24.668 1.00 41.08  ? 295 ILE A CB    1 
ATOM   3088 C  CG1   . ILE E 3 296 ? 5.253   18.634  -23.900 1.00 41.63  ? 295 ILE A CG1   1 
ATOM   3089 C  CG2   . ILE E 3 296 ? 6.342   20.914  -24.219 1.00 40.82  ? 295 ILE A CG2   1 
ATOM   3090 C  CD1   . ILE E 3 296 ? 6.551   17.804  -23.977 1.00 41.07  ? 295 ILE A CD1   1 
ATOM   3091 N  N     . VAL E 3 297 ? 3.751   23.155  -24.490 1.00 38.38  ? 296 VAL A N     1 
ATOM   3092 C  CA    . VAL E 3 297 ? 3.766   24.534  -25.072 1.00 36.77  ? 296 VAL A CA    1 
ATOM   3093 C  C     . VAL E 3 297 ? 4.893   25.506  -24.566 1.00 35.13  ? 296 VAL A C     1 
ATOM   3094 O  O     . VAL E 3 297 ? 4.971   25.852  -23.383 1.00 34.89  ? 296 VAL A O     1 
ATOM   3095 C  CB    . VAL E 3 297 ? 2.404   25.226  -24.897 1.00 36.92  ? 296 VAL A CB    1 
ATOM   3096 C  CG1   . VAL E 3 297 ? 2.316   26.449  -25.793 1.00 37.44  ? 296 VAL A CG1   1 
ATOM   3097 C  CG2   . VAL E 3 297 ? 1.287   24.291  -25.250 1.00 37.32  ? 296 VAL A CG2   1 
ATOM   3098 N  N     . SER E 3 298 ? 5.725   25.982  -25.482 1.00 33.11  ? 297 SER A N     1 
ATOM   3099 C  CA    . SER E 3 298 ? 6.960   26.668  -25.099 1.00 31.24  ? 297 SER A CA    1 
ATOM   3100 C  C     . SER E 3 298 ? 7.135   28.102  -25.656 1.00 29.19  ? 297 SER A C     1 
ATOM   3101 O  O     . SER E 3 298 ? 6.902   28.342  -26.826 1.00 28.79  ? 297 SER A O     1 
ATOM   3102 C  CB    . SER E 3 298 ? 8.148   25.796  -25.480 1.00 31.28  ? 297 SER A CB    1 
ATOM   3103 O  OG    . SER E 3 298 ? 9.378   26.361  -25.077 1.00 33.06  ? 297 SER A OG    1 
ATOM   3104 N  N     . ARG E 3 299 ? 7.534   29.028  -24.783 1.00 26.96  ? 298 ARG A N     1 
ATOM   3105 C  CA    . ARG E 3 299 ? 7.831   30.424  -25.145 1.00 25.44  ? 298 ARG A CA    1 
ATOM   3106 C  C     . ARG E 3 299 ? 9.168   30.796  -24.560 1.00 23.72  ? 298 ARG A C     1 
ATOM   3107 O  O     . ARG E 3 299 ? 9.421   30.581  -23.373 1.00 23.45  ? 298 ARG A O     1 
ATOM   3108 C  CB    . ARG E 3 299 ? 6.826   31.394  -24.550 1.00 25.42  ? 298 ARG A CB    1 
ATOM   3109 C  CG    . ARG E 3 299 ? 5.451   31.225  -25.034 1.00 28.15  ? 298 ARG A CG    1 
ATOM   3110 C  CD    . ARG E 3 299 ? 5.289   32.031  -26.274 1.00 30.50  ? 298 ARG A CD    1 
ATOM   3111 N  NE    . ARG E 3 299 ? 3.917   31.953  -26.694 1.00 34.47  ? 298 ARG A NE    1 
ATOM   3112 C  CZ    . ARG E 3 299 ? 3.485   31.098  -27.604 1.00 35.63  ? 298 ARG A CZ    1 
ATOM   3113 N  NH1   . ARG E 3 299 ? 4.352   30.273  -28.195 1.00 35.94  ? 298 ARG A NH1   1 
ATOM   3114 N  NH2   . ARG E 3 299 ? 2.193   31.084  -27.926 1.00 35.87  ? 298 ARG A NH2   1 
ATOM   3115 N  N     . GLY E 3 300 ? 10.018  31.380  -25.379 1.00 21.59  ? 299 GLY A N     1 
ATOM   3116 C  CA    . GLY E 3 300 ? 11.292  31.780  -24.882 1.00 20.28  ? 299 GLY A CA    1 
ATOM   3117 C  C     . GLY E 3 300 ? 11.618  33.185  -25.301 1.00 19.99  ? 299 GLY A C     1 
ATOM   3118 O  O     . GLY E 3 300 ? 10.749  33.928  -25.743 1.00 19.38  ? 299 GLY A O     1 
ATOM   3119 N  N     . ARG E 3 301 ? 12.893  33.531  -25.109 1.00 19.54  ? 300 ARG A N     1 
ATOM   3120 C  CA    . ARG E 3 301 ? 13.433  34.863  -25.358 1.00 20.07  ? 300 ARG A CA    1 
ATOM   3121 C  C     . ARG E 3 301 ? 14.964  34.885  -25.213 1.00 19.71  ? 300 ARG A C     1 
ATOM   3122 O  O     . ARG E 3 301 ? 15.516  34.489  -24.187 1.00 19.20  ? 300 ARG A O     1 
ATOM   3123 C  CB    . ARG E 3 301 ? 12.799  35.884  -24.412 1.00 20.56  ? 300 ARG A CB    1 
ATOM   3124 C  CG    . ARG E 3 301 ? 13.593  37.173  -24.268 1.00 21.59  ? 300 ARG A CG    1 
ATOM   3125 C  CD    . ARG E 3 301 ? 12.683  38.350  -23.959 1.00 21.39  ? 300 ARG A CD    1 
ATOM   3126 N  NE    . ARG E 3 301 ? 13.365  39.629  -24.134 1.00 24.73  ? 300 ARG A NE    1 
ATOM   3127 C  CZ    . ARG E 3 301 ? 13.055  40.738  -23.470 1.00 26.04  ? 300 ARG A CZ    1 
ATOM   3128 N  NH1   . ARG E 3 301 ? 12.070  40.728  -22.582 1.00 24.44  ? 300 ARG A NH1   1 
ATOM   3129 N  NH2   . ARG E 3 301 ? 13.729  41.858  -23.694 1.00 27.60  ? 300 ARG A NH2   1 
ATOM   3130 N  N     . THR E 3 302 ? 15.625  35.357  -26.265 1.00 19.43  ? 301 THR A N     1 
ATOM   3131 C  CA    . THR E 3 302 ? 17.075  35.485  -26.374 1.00 18.75  ? 301 THR A CA    1 
ATOM   3132 C  C     . THR E 3 302 ? 17.489  36.936  -26.077 1.00 18.39  ? 301 THR A C     1 
ATOM   3133 O  O     . THR E 3 302 ? 16.836  37.880  -26.511 1.00 18.29  ? 301 THR A O     1 
ATOM   3134 C  CB    . THR E 3 302 ? 17.571  35.038  -27.816 1.00 19.17  ? 301 THR A CB    1 
ATOM   3135 O  OG1   . THR E 3 302 ? 17.087  33.708  -28.093 1.00 18.51  ? 301 THR A OG1   1 
ATOM   3136 C  CG2   . THR E 3 302 ? 19.120  35.066  -27.923 1.00 17.59  ? 301 THR A CG2   1 
ATOM   3137 N  N     . PHE E 3 303 ? 18.575  37.108  -25.323 1.00 18.20  ? 302 PHE A N     1 
ATOM   3138 C  CA    . PHE E 3 303 ? 19.075  38.429  -24.924 1.00 17.47  ? 302 PHE A CA    1 
ATOM   3139 C  C     . PHE E 3 303 ? 20.467  38.579  -25.456 1.00 17.93  ? 302 PHE A C     1 
ATOM   3140 O  O     . PHE E 3 303 ? 21.165  37.563  -25.623 1.00 17.97  ? 302 PHE A O     1 
ATOM   3141 C  CB    . PHE E 3 303 ? 19.155  38.540  -23.403 1.00 17.15  ? 302 PHE A CB    1 
ATOM   3142 C  CG    . PHE E 3 303 ? 17.832  38.563  -22.723 1.00 15.37  ? 302 PHE A CG    1 
ATOM   3143 C  CD1   . PHE E 3 303 ? 17.195  37.378  -22.368 1.00 14.74  ? 302 PHE A CD1   1 
ATOM   3144 C  CD2   . PHE E 3 303 ? 17.253  39.764  -22.397 1.00 15.34  ? 302 PHE A CD2   1 
ATOM   3145 C  CE1   . PHE E 3 303 ? 15.956  37.383  -21.722 1.00 16.87  ? 302 PHE A CE1   1 
ATOM   3146 C  CE2   . PHE E 3 303 ? 16.013  39.800  -21.748 1.00 17.94  ? 302 PHE A CE2   1 
ATOM   3147 C  CZ    . PHE E 3 303 ? 15.352  38.579  -21.393 1.00 17.03  ? 302 PHE A CZ    1 
ATOM   3148 N  N     . PRO E 3 304 ? 20.914  39.826  -25.688 1.00 18.06  ? 303 PRO A N     1 
ATOM   3149 C  CA    . PRO E 3 304 ? 22.284  39.959  -26.224 1.00 18.92  ? 303 PRO A CA    1 
ATOM   3150 C  C     . PRO E 3 304 ? 23.354  39.866  -25.141 1.00 19.87  ? 303 PRO A C     1 
ATOM   3151 O  O     . PRO E 3 304 ? 24.522  40.125  -25.429 1.00 21.11  ? 303 PRO A O     1 
ATOM   3152 C  CB    . PRO E 3 304 ? 22.307  41.367  -26.854 1.00 18.26  ? 303 PRO A CB    1 
ATOM   3153 C  CG    . PRO E 3 304 ? 21.230  42.128  -26.184 1.00 17.66  ? 303 PRO A CG    1 
ATOM   3154 C  CD    . PRO E 3 304 ? 20.217  41.120  -25.583 1.00 17.76  ? 303 PRO A CD    1 
ATOM   3155 N  N     . HIS E 3 305 ? 22.953  39.541  -23.914 1.00 19.46  ? 304 HIS A N     1 
ATOM   3156 C  CA    . HIS E 3 305 ? 23.859  39.492  -22.757 1.00 19.43  ? 304 HIS A CA    1 
ATOM   3157 C  C     . HIS E 3 305 ? 23.374  38.323  -21.918 1.00 19.73  ? 304 HIS A C     1 
ATOM   3158 O  O     . HIS E 3 305 ? 22.293  37.793  -22.152 1.00 20.87  ? 304 HIS A O     1 
ATOM   3159 C  CB    . HIS E 3 305 ? 23.740  40.782  -21.924 1.00 18.72  ? 304 HIS A CB    1 
ATOM   3160 C  CG    . HIS E 3 305 ? 22.388  40.944  -21.298 1.00 15.91  ? 304 HIS A CG    1 
ATOM   3161 N  ND1   . HIS E 3 305 ? 21.525  41.958  -21.633 1.00 15.13  ? 304 HIS A ND1   1 
ATOM   3162 C  CD2   . HIS E 3 305 ? 21.725  40.173  -20.409 1.00 14.26  ? 304 HIS A CD2   1 
ATOM   3163 C  CE1   . HIS E 3 305 ? 20.387  41.810  -20.977 1.00 14.42  ? 304 HIS A CE1   1 
ATOM   3164 N  NE2   . HIS E 3 305 ? 20.485  40.731  -20.222 1.00 13.26  ? 304 HIS A NE2   1 
ATOM   3165 N  N     . GLY E 3 306 ? 24.109  37.940  -20.902 1.00 19.53  ? 305 GLY A N     1 
ATOM   3166 C  CA    . GLY E 3 306 ? 23.677  36.790  -20.128 1.00 19.66  ? 305 GLY A CA    1 
ATOM   3167 C  C     . GLY E 3 306 ? 22.572  37.098  -19.161 1.00 19.88  ? 305 GLY A C     1 
ATOM   3168 O  O     . GLY E 3 306 ? 22.441  38.248  -18.739 1.00 21.50  ? 305 GLY A O     1 
ATOM   3169 N  N     . ILE E 3 307 ? 21.811  36.079  -18.764 1.00 19.74  ? 306 ILE A N     1 
ATOM   3170 C  CA    . ILE E 3 307 ? 20.628  36.244  -17.908 1.00 19.23  ? 306 ILE A CA    1 
ATOM   3171 C  C     . ILE E 3 307 ? 20.915  36.035  -16.401 1.00 20.05  ? 306 ILE A C     1 
ATOM   3172 O  O     . ILE E 3 307 ? 21.160  34.908  -15.940 1.00 19.70  ? 306 ILE A O     1 
ATOM   3173 C  CB    . ILE E 3 307 ? 19.535  35.208  -18.318 1.00 19.29  ? 306 ILE A CB    1 
ATOM   3174 C  CG1   . ILE E 3 307 ? 19.286  35.269  -19.840 1.00 18.92  ? 306 ILE A CG1   1 
ATOM   3175 C  CG2   . ILE E 3 307 ? 18.234  35.310  -17.390 1.00 17.11  ? 306 ILE A CG2   1 
ATOM   3176 C  CD1   . ILE E 3 307 ? 18.138  34.442  -20.328 1.00 18.41  ? 306 ILE A CD1   1 
ATOM   3177 N  N     . SER E 3 308 ? 20.845  37.105  -15.613 1.00 20.42  ? 307 SER A N     1 
ATOM   3178 C  CA    . SER E 3 308 ? 20.988  36.929  -14.159 1.00 20.60  ? 307 SER A CA    1 
ATOM   3179 C  C     . SER E 3 308 ? 19.841  36.103  -13.637 1.00 21.64  ? 307 SER A C     1 
ATOM   3180 O  O     . SER E 3 308 ? 18.742  36.223  -14.172 1.00 21.80  ? 307 SER A O     1 
ATOM   3181 C  CB    . SER E 3 308 ? 20.996  38.270  -13.415 1.00 19.47  ? 307 SER A CB    1 
ATOM   3182 O  OG    . SER E 3 308 ? 19.676  38.655  -13.106 1.00 17.13  ? 307 SER A OG    1 
ATOM   3183 N  N     . LYS E 3 309 ? 20.072  35.359  -12.540 1.00 22.89  ? 308 LYS A N     1 
ATOM   3184 C  CA    . LYS E 3 309 ? 19.004  34.559  -11.875 1.00 24.05  ? 308 LYS A CA    1 
ATOM   3185 C  C     . LYS E 3 309 ? 17.732  35.339  -11.576 1.00 24.47  ? 308 LYS A C     1 
ATOM   3186 O  O     . LYS E 3 309 ? 16.614  34.785  -11.676 1.00 25.34  ? 308 LYS A O     1 
ATOM   3187 C  CB    . LYS E 3 309 ? 19.470  33.845  -10.588 1.00 24.34  ? 308 LYS A CB    1 
ATOM   3188 C  CG    . LYS E 3 309 ? 18.327  32.916  -9.956  1.00 26.88  ? 308 LYS A CG    1 
ATOM   3189 C  CD    . LYS E 3 309 ? 18.778  31.997  -8.808  1.00 27.30  ? 308 LYS A CD    1 
ATOM   3190 C  CE    . LYS E 3 309 ? 19.104  32.833  -7.585  1.00 30.24  ? 308 LYS A CE    1 
ATOM   3191 N  NZ    . LYS E 3 309 ? 18.586  32.237  -6.315  1.00 32.03  ? 308 LYS A NZ    1 
ATOM   3192 N  N     . GLU E 3 310 ? 17.878  36.606  -11.206 1.00 23.71  ? 309 GLU A N     1 
ATOM   3193 C  CA    . GLU E 3 310 ? 16.718  37.416  -10.940 1.00 24.07  ? 309 GLU A CA    1 
ATOM   3194 C  C     . GLU E 3 310 ? 15.940  37.732  -12.230 1.00 23.88  ? 309 GLU A C     1 
ATOM   3195 O  O     . GLU E 3 310 ? 14.735  37.501  -12.301 1.00 24.40  ? 309 GLU A O     1 
ATOM   3196 C  CB    . GLU E 3 310 ? 17.140  38.655  -10.186 1.00 24.83  ? 309 GLU A CB    1 
ATOM   3197 C  CG    . GLU E 3 310 ? 18.172  38.293  -9.065  1.00 26.71  ? 309 GLU A CG    1 
ATOM   3198 C  CD    . GLU E 3 310 ? 19.626  38.203  -9.608  1.00 28.20  ? 309 GLU A CD    1 
ATOM   3199 O  OE1   . GLU E 3 310 ? 19.971  37.243  -10.353 1.00 29.01  ? 309 GLU A OE1   1 
ATOM   3200 O  OE2   . GLU E 3 310 ? 20.424  39.108  -9.276  1.00 28.17  ? 309 GLU A OE2   1 
ATOM   3201 N  N     . THR E 3 311 ? 16.631  38.184  -13.271 1.00 23.27  ? 310 THR A N     1 
ATOM   3202 C  CA    . THR E 3 311 ? 16.011  38.430  -14.598 1.00 21.97  ? 310 THR A CA    1 
ATOM   3203 C  C     . THR E 3 311 ? 15.313  37.193  -15.151 1.00 21.42  ? 310 THR A C     1 
ATOM   3204 O  O     . THR E 3 311 ? 14.368  37.265  -15.937 1.00 20.65  ? 310 THR A O     1 
ATOM   3205 C  CB    . THR E 3 311 ? 17.090  38.838  -15.615 1.00 21.37  ? 310 THR A CB    1 
ATOM   3206 O  OG1   . THR E 3 311 ? 17.961  39.797  -15.006 1.00 21.45  ? 310 THR A OG1   1 
ATOM   3207 C  CG2   . THR E 3 311 ? 16.455  39.415  -16.868 1.00 19.62  ? 310 THR A CG2   1 
ATOM   3208 N  N     . ALA E 3 312 ? 15.843  36.055  -14.747 1.00 21.57  ? 311 ALA A N     1 
ATOM   3209 C  CA    . ALA E 3 312 ? 15.261  34.761  -15.075 1.00 21.78  ? 311 ALA A CA    1 
ATOM   3210 C  C     . ALA E 3 312 ? 13.892  34.676  -14.404 1.00 21.08  ? 311 ALA A C     1 
ATOM   3211 O  O     . ALA E 3 312 ? 12.890  34.366  -15.039 1.00 20.42  ? 311 ALA A O     1 
ATOM   3212 C  CB    . ALA E 3 312 ? 16.210  33.632  -14.615 1.00 22.18  ? 311 ALA A CB    1 
ATOM   3213 N  N     . TYR E 3 313 ? 13.854  35.055  -13.139 1.00 21.56  ? 312 TYR A N     1 
ATOM   3214 C  CA    . TYR E 3 313 ? 12.581  35.228  -12.394 1.00 22.38  ? 312 TYR A CA    1 
ATOM   3215 C  C     . TYR E 3 313 ? 11.493  36.095  -13.112 1.00 21.64  ? 312 TYR A C     1 
ATOM   3216 O  O     . TYR E 3 313 ? 10.440  35.580  -13.533 1.00 21.50  ? 312 TYR A O     1 
ATOM   3217 C  CB    . TYR E 3 313 ? 12.886  35.771  -10.977 1.00 22.93  ? 312 TYR A CB    1 
ATOM   3218 C  CG    . TYR E 3 313 ? 13.259  34.749  -9.886  1.00 24.89  ? 312 TYR A CG    1 
ATOM   3219 C  CD1   . TYR E 3 313 ? 13.010  35.043  -8.542  1.00 27.00  ? 312 TYR A CD1   1 
ATOM   3220 C  CD2   . TYR E 3 313 ? 13.841  33.513  -10.181 1.00 25.76  ? 312 TYR A CD2   1 
ATOM   3221 C  CE1   . TYR E 3 313 ? 13.325  34.128  -7.507  1.00 27.75  ? 312 TYR A CE1   1 
ATOM   3222 C  CE2   . TYR E 3 313 ? 14.159  32.590  -9.143  1.00 28.34  ? 312 TYR A CE2   1 
ATOM   3223 C  CZ    . TYR E 3 313 ? 13.884  32.915  -7.804  1.00 28.84  ? 312 TYR A CZ    1 
ATOM   3224 O  OH    . TYR E 3 313 ? 14.176  32.049  -6.739  1.00 30.17  ? 312 TYR A OH    1 
ATOM   3225 N  N     . SER E 3 314 ? 11.742  37.395  -13.274 1.00 21.22  ? 313 SER A N     1 
ATOM   3226 C  CA    . SER E 3 314 ? 10.734  38.278  -13.878 1.00 20.93  ? 313 SER A CA    1 
ATOM   3227 C  C     . SER E 3 314 ? 10.434  37.907  -15.336 1.00 20.72  ? 313 SER A C     1 
ATOM   3228 O  O     . SER E 3 314 ? 9.267   37.729  -15.717 1.00 21.22  ? 313 SER A O     1 
ATOM   3229 C  CB    . SER E 3 314 ? 11.137  39.735  -13.744 1.00 20.94  ? 313 SER A CB    1 
ATOM   3230 O  OG    . SER E 3 314 ? 11.767  40.171  -14.919 1.00 22.72  ? 313 SER A OG    1 
ATOM   3231 N  N     . GLU E 3 315 ? 11.485  37.729  -16.132 1.00 20.20  ? 314 GLU A N     1 
ATOM   3232 C  CA    . GLU E 3 315 ? 11.333  37.294  -17.531 1.00 20.44  ? 314 GLU A CA    1 
ATOM   3233 C  C     . GLU E 3 315 ? 10.449  36.023  -17.741 1.00 19.47  ? 314 GLU A C     1 
ATOM   3234 O  O     . GLU E 3 315 ? 9.659   35.955  -18.684 1.00 18.54  ? 314 GLU A O     1 
ATOM   3235 C  CB    . GLU E 3 315 ? 12.729  37.113  -18.155 1.00 20.61  ? 314 GLU A CB    1 
ATOM   3236 C  CG    . GLU E 3 315 ? 12.760  37.318  -19.609 1.00 23.53  ? 314 GLU A CG    1 
ATOM   3237 C  CD    . GLU E 3 315 ? 12.339  38.702  -20.055 1.00 27.76  ? 314 GLU A CD    1 
ATOM   3238 O  OE1   . GLU E 3 315 ? 11.697  38.746  -21.136 1.00 30.27  ? 314 GLU A OE1   1 
ATOM   3239 O  OE2   . GLU E 3 315 ? 12.627  39.731  -19.363 1.00 29.07  ? 314 GLU A OE2   1 
ATOM   3240 N  N     . SER E 3 316 ? 10.620  35.024  -16.884 1.00 19.16  ? 315 SER A N     1 
ATOM   3241 C  CA    . SER E 3 316 ? 9.766   33.815  -16.878 1.00 20.34  ? 315 SER A CA    1 
ATOM   3242 C  C     . SER E 3 316 ? 8.253   34.077  -16.810 1.00 20.88  ? 315 SER A C     1 
ATOM   3243 O  O     . SER E 3 316 ? 7.460   33.379  -17.465 1.00 19.85  ? 315 SER A O     1 
ATOM   3244 C  CB    . SER E 3 316 ? 10.107  32.969  -15.666 1.00 20.07  ? 315 SER A CB    1 
ATOM   3245 O  OG    . SER E 3 316 ? 11.444  32.519  -15.771 1.00 21.23  ? 315 SER A OG    1 
ATOM   3246 N  N     . VAL E 3 317 ? 7.864   35.064  -15.992 1.00 21.83  ? 316 VAL A N     1 
ATOM   3247 C  CA    . VAL E 3 317 ? 6.445   35.373  -15.750 1.00 22.51  ? 316 VAL A CA    1 
ATOM   3248 C  C     . VAL E 3 317 ? 5.868   35.929  -17.052 1.00 23.03  ? 316 VAL A C     1 
ATOM   3249 O  O     . VAL E 3 317 ? 4.741   35.596  -17.448 1.00 23.31  ? 316 VAL A O     1 
ATOM   3250 C  CB    . VAL E 3 317 ? 6.271   36.358  -14.586 1.00 22.44  ? 316 VAL A CB    1 
ATOM   3251 C  CG1   . VAL E 3 317 ? 4.817   36.477  -14.202 1.00 21.45  ? 316 VAL A CG1   1 
ATOM   3252 C  CG2   . VAL E 3 317 ? 7.140   35.923  -13.380 1.00 22.46  ? 316 VAL A CG2   1 
ATOM   3253 N  N     . LYS E 3 318 ? 6.681   36.692  -17.766 1.00 23.24  ? 317 LYS A N     1 
ATOM   3254 C  CA    . LYS E 3 318 ? 6.213   37.293  -19.001 1.00 23.76  ? 317 LYS A CA    1 
ATOM   3255 C  C     . LYS E 3 318 ? 5.961   36.204  -20.022 1.00 23.39  ? 317 LYS A C     1 
ATOM   3256 O  O     . LYS E 3 318 ? 4.897   36.127  -20.634 1.00 23.65  ? 317 LYS A O     1 
ATOM   3257 C  CB    . LYS E 3 318 ? 7.161   38.405  -19.478 1.00 24.21  ? 317 LYS A CB    1 
ATOM   3258 C  CG    . LYS E 3 318 ? 7.172   39.583  -18.513 1.00 25.22  ? 317 LYS A CG    1 
ATOM   3259 C  CD    . LYS E 3 318 ? 8.161   40.657  -18.861 1.00 29.53  ? 317 LYS A CD    1 
ATOM   3260 C  CE    . LYS E 3 318 ? 8.237   41.688  -17.704 1.00 30.99  ? 317 LYS A CE    1 
ATOM   3261 N  NZ    . LYS E 3 318 ? 9.575   42.386  -17.632 1.00 31.66  ? 317 LYS A NZ    1 
ATOM   3262 N  N     . LEU E 3 319 ? 6.907   35.300  -20.138 1.00 23.45  ? 318 LEU A N     1 
ATOM   3263 C  CA    . LEU E 3 319 ? 6.710   34.118  -20.982 1.00 22.87  ? 318 LEU A CA    1 
ATOM   3264 C  C     . LEU E 3 319 ? 5.592   33.197  -20.480 1.00 23.54  ? 318 LEU A C     1 
ATOM   3265 O  O     . LEU E 3 319 ? 4.837   32.670  -21.275 1.00 23.56  ? 318 LEU A O     1 
ATOM   3266 C  CB    . LEU E 3 319 ? 8.033   33.391  -21.164 1.00 22.06  ? 318 LEU A CB    1 
ATOM   3267 C  CG    . LEU E 3 319 ? 9.150   34.228  -21.827 1.00 19.15  ? 318 LEU A CG    1 
ATOM   3268 C  CD1   . LEU E 3 319 ? 10.494  33.623  -21.483 1.00 15.20  ? 318 LEU A CD1   1 
ATOM   3269 C  CD2   . LEU E 3 319 ? 9.002   34.340  -23.351 1.00 15.01  ? 318 LEU A CD2   1 
ATOM   3270 N  N     . LEU E 3 320 ? 5.451   33.029  -19.169 1.00 24.61  ? 319 LEU A N     1 
ATOM   3271 C  CA    . LEU E 3 320 ? 4.305   32.296  -18.669 1.00 26.18  ? 319 LEU A CA    1 
ATOM   3272 C  C     . LEU E 3 320 ? 3.054   32.997  -19.121 1.00 27.65  ? 319 LEU A C     1 
ATOM   3273 O  O     . LEU E 3 320 ? 2.140   32.357  -19.614 1.00 28.81  ? 319 LEU A O     1 
ATOM   3274 C  CB    . LEU E 3 320 ? 4.264   32.228  -17.148 1.00 26.28  ? 319 LEU A CB    1 
ATOM   3275 C  CG    . LEU E 3 320 ? 3.022   31.539  -16.550 1.00 24.84  ? 319 LEU A CG    1 
ATOM   3276 C  CD1   . LEU E 3 320 ? 2.516   30.371  -17.374 1.00 24.46  ? 319 LEU A CD1   1 
ATOM   3277 C  CD2   . LEU E 3 320 ? 3.354   31.030  -15.163 1.00 22.58  ? 319 LEU A CD2   1 
ATOM   3278 N  N     . GLN E 3 321 ? 3.016   34.314  -18.944 1.00 28.64  ? 320 GLN A N     1 
ATOM   3279 C  CA    . GLN E 3 321 ? 1.852   35.091  -19.299 1.00 29.29  ? 320 GLN A CA    1 
ATOM   3280 C  C     . GLN E 3 321 ? 1.464   34.895  -20.741 1.00 30.11  ? 320 GLN A C     1 
ATOM   3281 O  O     . GLN E 3 321 ? 0.311   34.702  -21.056 1.00 31.30  ? 320 GLN A O     1 
ATOM   3282 C  CB    . GLN E 3 321 ? 2.119   36.538  -19.031 1.00 29.22  ? 320 GLN A CB    1 
ATOM   3283 C  CG    . GLN E 3 321 ? 2.036   36.909  -17.555 1.00 28.84  ? 320 GLN A CG    1 
ATOM   3284 C  CD    . GLN E 3 321 ? 2.328   38.376  -17.342 1.00 28.65  ? 320 GLN A CD    1 
ATOM   3285 O  OE1   . GLN E 3 321 ? 3.202   38.946  -18.009 1.00 30.70  ? 320 GLN A OE1   1 
ATOM   3286 N  NE2   . GLN E 3 321 ? 1.611   39.001  -16.428 1.00 26.88  ? 320 GLN A NE2   1 
ATOM   3287 N  N     . LYS E 3 322 ? 2.428   34.888  -21.625 1.00 31.31  ? 321 LYS A N     1 
ATOM   3288 C  CA    . LYS E 3 322 ? 2.130   34.741  -23.039 1.00 32.50  ? 321 LYS A CA    1 
ATOM   3289 C  C     . LYS E 3 322 ? 1.350   33.445  -23.390 1.00 33.19  ? 321 LYS A C     1 
ATOM   3290 O  O     . LYS E 3 322 ? 0.336   33.494  -24.111 1.00 33.12  ? 321 LYS A O     1 
ATOM   3291 C  CB    . LYS E 3 322 ? 3.441   34.831  -23.807 1.00 32.55  ? 321 LYS A CB    1 
ATOM   3292 C  CG    . LYS E 3 322 ? 3.342   35.526  -25.159 1.00 33.17  ? 321 LYS A CG    1 
ATOM   3293 C  CD    . LYS E 3 322 ? 4.734   35.923  -25.603 1.00 35.04  ? 321 LYS A CD    1 
ATOM   3294 C  CE    . LYS E 3 322 ? 5.337   36.829  -24.520 1.00 35.00  ? 321 LYS A CE    1 
ATOM   3295 N  NZ    . LYS E 3 322 ? 6.734   37.193  -24.736 1.00 36.09  ? 321 LYS A NZ    1 
ATOM   3296 N  N     . ILE E 3 323 ? 1.845   32.304  -22.881 1.00 33.87  ? 322 ILE A N     1 
ATOM   3297 C  CA    . ILE E 3 323 ? 1.187   30.977  -22.951 1.00 33.96  ? 322 ILE A CA    1 
ATOM   3298 C  C     . ILE E 3 323 ? -0.241  30.968  -22.421 1.00 35.38  ? 322 ILE A C     1 
ATOM   3299 O  O     . ILE E 3 323 ? -1.170  30.519  -23.101 1.00 35.65  ? 322 ILE A O     1 
ATOM   3300 C  CB    . ILE E 3 323 ? 1.982   29.959  -22.106 1.00 33.42  ? 322 ILE A CB    1 
ATOM   3301 C  CG1   . ILE E 3 323 ? 3.027   29.246  -22.961 1.00 32.45  ? 322 ILE A CG1   1 
ATOM   3302 C  CG2   . ILE E 3 323 ? 1.066   28.924  -21.484 1.00 32.61  ? 322 ILE A CG2   1 
ATOM   3303 C  CD1   . ILE E 3 323 ? 4.225   28.844  -22.192 1.00 29.25  ? 322 ILE A CD1   1 
ATOM   3304 N  N     . LEU E 3 324 ? -0.402  31.426  -21.181 1.00 36.69  ? 323 LEU A N     1 
ATOM   3305 C  CA    . LEU E 3 324 ? -1.703  31.560  -20.586 1.00 38.70  ? 323 LEU A CA    1 
ATOM   3306 C  C     . LEU E 3 324 ? -2.707  32.198  -21.537 1.00 40.31  ? 323 LEU A C     1 
ATOM   3307 O  O     . LEU E 3 324 ? -3.904  31.945  -21.415 1.00 40.59  ? 323 LEU A O     1 
ATOM   3308 C  CB    . LEU E 3 324 ? -1.600  32.371  -19.300 1.00 38.49  ? 323 LEU A CB    1 
ATOM   3309 C  CG    . LEU E 3 324 ? -1.798  31.490  -18.066 1.00 38.11  ? 323 LEU A CG    1 
ATOM   3310 C  CD1   . LEU E 3 324 ? -0.822  30.335  -18.029 1.00 37.12  ? 323 LEU A CD1   1 
ATOM   3311 C  CD2   . LEU E 3 324 ? -1.717  32.295  -16.788 1.00 37.26  ? 323 LEU A CD2   1 
ATOM   3312 N  N     . GLU E 3 325 ? -2.219  32.999  -22.492 1.00 41.87  ? 324 GLU A N     1 
ATOM   3313 C  CA    . GLU E 3 325 ? -3.086  33.661  -23.462 1.00 43.49  ? 324 GLU A CA    1 
ATOM   3314 C  C     . GLU E 3 325 ? -2.976  33.275  -24.948 1.00 44.82  ? 324 GLU A C     1 
ATOM   3315 O  O     . GLU E 3 325 ? -3.508  33.983  -25.805 1.00 45.06  ? 324 GLU A O     1 
ATOM   3316 C  CB    . GLU E 3 325 ? -2.994  35.181  -23.308 1.00 43.86  ? 324 GLU A CB    1 
ATOM   3317 C  CG    . GLU E 3 325 ? -4.311  35.800  -22.848 1.00 44.16  ? 324 GLU A CG    1 
ATOM   3318 C  CD    . GLU E 3 325 ? -4.137  37.200  -22.321 1.00 45.35  ? 324 GLU A CD    1 
ATOM   3319 O  OE1   . GLU E 3 325 ? -4.625  38.162  -22.987 1.00 45.48  ? 324 GLU A OE1   1 
ATOM   3320 O  OE2   . GLU E 3 325 ? -3.507  37.324  -21.240 1.00 44.15  ? 324 GLU A OE2   1 
ATOM   3321 N  N     . GLU E 3 326 ? -2.306  32.182  -25.290 1.00 46.17  ? 325 GLU A N     1 
ATOM   3322 C  CA    . GLU E 3 326 ? -2.339  31.768  -26.703 1.00 47.12  ? 325 GLU A CA    1 
ATOM   3323 C  C     . GLU E 3 326 ? -2.779  30.337  -26.822 1.00 47.48  ? 325 GLU A C     1 
ATOM   3324 O  O     . GLU E 3 326 ? -3.412  29.965  -27.810 1.00 48.19  ? 325 GLU A O     1 
ATOM   3325 C  CB    . GLU E 3 326 ? -1.030  32.055  -27.453 1.00 47.23  ? 325 GLU A CB    1 
ATOM   3326 C  CG    . GLU E 3 326 ? -0.986  33.459  -28.033 1.00 47.74  ? 325 GLU A CG    1 
ATOM   3327 C  CD    . GLU E 3 326 ? 0.415   34.110  -28.008 1.00 49.62  ? 325 GLU A CD    1 
ATOM   3328 O  OE1   . GLU E 3 326 ? 1.405   33.469  -28.429 1.00 49.20  ? 325 GLU A OE1   1 
ATOM   3329 O  OE2   . GLU E 3 326 ? 0.519   35.290  -27.589 1.00 50.41  ? 325 GLU A OE2   1 
ATOM   3330 N  N     . ASP E 3 327 ? -2.472  29.546  -25.802 1.00 47.66  ? 326 ASP A N     1 
ATOM   3331 C  CA    . ASP E 3 327 ? -3.062  28.215  -25.646 1.00 47.68  ? 326 ASP A CA    1 
ATOM   3332 C  C     . ASP E 3 327 ? -4.123  28.317  -24.539 1.00 47.80  ? 326 ASP A C     1 
ATOM   3333 O  O     . ASP E 3 327 ? -4.012  29.164  -23.631 1.00 48.28  ? 326 ASP A O     1 
ATOM   3334 C  CB    . ASP E 3 327 ? -1.988  27.167  -25.316 1.00 47.44  ? 326 ASP A CB    1 
ATOM   3335 C  CG    . ASP E 3 327 ? -2.397  25.734  -25.713 1.00 47.23  ? 326 ASP A CG    1 
ATOM   3336 O  OD1   . ASP E 3 327 ? -3.505  25.267  -25.373 1.00 46.64  ? 326 ASP A OD1   1 
ATOM   3337 O  OD2   . ASP E 3 327 ? -1.584  25.059  -26.367 1.00 47.53  ? 326 ASP A OD2   1 
ATOM   3338 N  N     . GLU E 3 328 ? -5.138  27.458  -24.613 1.00 47.24  ? 327 GLU A N     1 
ATOM   3339 C  CA    . GLU E 3 328 ? -6.356  27.647  -23.846 1.00 46.73  ? 327 GLU A CA    1 
ATOM   3340 C  C     . GLU E 3 328 ? -6.432  26.702  -22.653 1.00 46.16  ? 327 GLU A C     1 
ATOM   3341 O  O     . GLU E 3 328 ? -7.173  26.938  -21.689 1.00 46.31  ? 327 GLU A O     1 
ATOM   3342 C  CB    . GLU E 3 328 ? -7.570  27.412  -24.747 1.00 47.25  ? 327 GLU A CB    1 
ATOM   3343 C  CG    . GLU E 3 328 ? -7.609  28.198  -26.066 1.00 48.51  ? 327 GLU A CG    1 
ATOM   3344 C  CD    . GLU E 3 328 ? -7.156  27.375  -27.287 1.00 50.71  ? 327 GLU A CD    1 
ATOM   3345 O  OE1   . GLU E 3 328 ? -7.964  27.209  -28.235 1.00 51.05  ? 327 GLU A OE1   1 
ATOM   3346 O  OE2   . GLU E 3 328 ? -5.994  26.899  -27.306 1.00 51.48  ? 327 GLU A OE2   1 
ATOM   3347 N  N     . ARG E 3 329 ? -5.651  25.633  -22.725 1.00 45.07  ? 328 ARG A N     1 
ATOM   3348 C  CA    . ARG E 3 329 ? -5.797  24.497  -21.825 1.00 43.93  ? 328 ARG A CA    1 
ATOM   3349 C  C     . ARG E 3 329 ? -5.142  24.773  -20.472 1.00 43.09  ? 328 ARG A C     1 
ATOM   3350 O  O     . ARG E 3 329 ? -4.297  25.661  -20.372 1.00 43.49  ? 328 ARG A O     1 
ATOM   3351 C  CB    . ARG E 3 329 ? -5.188  23.280  -22.498 1.00 43.71  ? 328 ARG A CB    1 
ATOM   3352 C  CG    . ARG E 3 329 ? -5.627  23.167  -23.934 1.00 44.05  ? 328 ARG A CG    1 
ATOM   3353 C  CD    . ARG E 3 329 ? -4.866  22.093  -24.665 1.00 46.35  ? 328 ARG A CD    1 
ATOM   3354 N  NE    . ARG E 3 329 ? -3.556  22.533  -25.153 1.00 48.02  ? 328 ARG A NE    1 
ATOM   3355 C  CZ    . ARG E 3 329 ? -2.653  21.720  -25.711 1.00 48.66  ? 328 ARG A CZ    1 
ATOM   3356 N  NH1   . ARG E 3 329 ? -2.907  20.420  -25.856 1.00 48.83  ? 328 ARG A NH1   1 
ATOM   3357 N  NH2   . ARG E 3 329 ? -1.486  22.204  -26.124 1.00 48.87  ? 328 ARG A NH2   1 
ATOM   3358 N  N     . LYS E 3 330 ? -5.552  24.036  -19.440 1.00 41.66  ? 329 LYS A N     1 
ATOM   3359 C  CA    . LYS E 3 330 ? -4.971  24.139  -18.088 1.00 40.40  ? 329 LYS A CA    1 
ATOM   3360 C  C     . LYS E 3 330 ? -3.471  23.796  -18.102 1.00 39.33  ? 329 LYS A C     1 
ATOM   3361 O  O     . LYS E 3 330 ? -2.936  23.429  -19.140 1.00 39.65  ? 329 LYS A O     1 
ATOM   3362 C  CB    . LYS E 3 330 ? -5.741  23.232  -17.098 1.00 40.48  ? 329 LYS A CB    1 
ATOM   3363 C  CG    . LYS E 3 330 ? -7.232  23.603  -16.957 1.00 40.02  ? 329 LYS A CG    1 
ATOM   3364 C  CD    . LYS E 3 330 ? -8.025  22.698  -16.002 1.00 38.58  ? 329 LYS A CD    1 
ATOM   3365 C  CE    . LYS E 3 330 ? -9.290  23.415  -15.502 1.00 37.37  ? 329 LYS A CE    1 
ATOM   3366 N  NZ    . LYS E 3 330 ? -10.483 22.551  -15.561 1.00 35.53  ? 329 LYS A NZ    1 
ATOM   3367 N  N     . ILE E 3 331 ? -2.778  23.926  -16.978 1.00 37.45  ? 330 ILE A N     1 
ATOM   3368 C  CA    . ILE E 3 331 ? -1.357  23.601  -16.990 1.00 35.94  ? 330 ILE A CA    1 
ATOM   3369 C  C     . ILE E 3 331 ? -1.002  22.620  -15.876 1.00 35.40  ? 330 ILE A C     1 
ATOM   3370 O  O     . ILE E 3 331 ? -1.246  22.893  -14.701 1.00 35.24  ? 330 ILE A O     1 
ATOM   3371 C  CB    . ILE E 3 331 ? -0.430  24.892  -17.033 1.00 35.91  ? 330 ILE A CB    1 
ATOM   3372 C  CG1   . ILE E 3 331 ? -0.649  25.673  -18.340 1.00 35.52  ? 330 ILE A CG1   1 
ATOM   3373 C  CG2   . ILE E 3 331 ? 1.082   24.559  -16.926 1.00 34.05  ? 330 ILE A CG2   1 
ATOM   3374 C  CD1   . ILE E 3 331 ? 0.073   27.053  -18.402 1.00 33.76  ? 330 ILE A CD1   1 
ATOM   3375 N  N     . ARG E 3 332 ? -0.412  21.482  -16.256 1.00 34.47  ? 331 ARG A N     1 
ATOM   3376 C  CA    . ARG E 3 332 ? -0.012  20.453  -15.283 1.00 33.54  ? 331 ARG A CA    1 
ATOM   3377 C  C     . ARG E 3 332 ? 1.467   20.458  -14.865 1.00 32.67  ? 331 ARG A C     1 
ATOM   3378 O  O     . ARG E 3 332 ? 1.781   20.147  -13.715 1.00 32.83  ? 331 ARG A O     1 
ATOM   3379 C  CB    . ARG E 3 332 ? -0.411  19.067  -15.784 1.00 33.92  ? 331 ARG A CB    1 
ATOM   3380 C  CG    . ARG E 3 332 ? 0.131   17.934  -14.932 1.00 35.43  ? 331 ARG A CG    1 
ATOM   3381 C  CD    . ARG E 3 332 ? -0.244  16.600  -15.525 1.00 39.64  ? 331 ARG A CD    1 
ATOM   3382 N  NE    . ARG E 3 332 ? -0.258  15.512  -14.545 1.00 41.55  ? 331 ARG A NE    1 
ATOM   3383 C  CZ    . ARG E 3 332 ? -0.903  14.362  -14.721 1.00 42.66  ? 331 ARG A CZ    1 
ATOM   3384 N  NH1   . ARG E 3 332 ? -1.608  14.165  -15.844 1.00 42.57  ? 331 ARG A NH1   1 
ATOM   3385 N  NH2   . ARG E 3 332 ? -0.848  13.412  -13.777 1.00 42.36  ? 331 ARG A NH2   1 
ATOM   3386 N  N     . ARG E 3 333 ? 2.378   20.767  -15.794 1.00 31.36  ? 332 ARG A N     1 
ATOM   3387 C  CA    . ARG E 3 333 ? 3.796   20.829  -15.451 1.00 29.33  ? 332 ARG A CA    1 
ATOM   3388 C  C     . ARG E 3 333 ? 4.309   22.223  -15.828 1.00 27.94  ? 332 ARG A C     1 
ATOM   3389 O  O     . ARG E 3 333 ? 3.749   22.934  -16.698 1.00 28.02  ? 332 ARG A O     1 
ATOM   3390 C  CB    . ARG E 3 333 ? 4.577   19.702  -16.137 1.00 29.95  ? 332 ARG A CB    1 
ATOM   3391 C  CG    . ARG E 3 333 ? 4.557   18.360  -15.375 1.00 32.27  ? 332 ARG A CG    1 
ATOM   3392 C  CD    . ARG E 3 333 ? 4.294   17.069  -16.232 1.00 35.52  ? 332 ARG A CD    1 
ATOM   3393 N  NE    . ARG E 3 333 ? 5.517   16.421  -16.744 1.00 38.68  ? 332 ARG A NE    1 
ATOM   3394 C  CZ    . ARG E 3 333 ? 5.564   15.439  -17.664 1.00 39.56  ? 332 ARG A CZ    1 
ATOM   3395 N  NH1   . ARG E 3 333 ? 4.453   14.938  -18.211 1.00 39.91  ? 332 ARG A NH1   1 
ATOM   3396 N  NH2   . ARG E 3 333 ? 6.735   14.957  -18.057 1.00 39.11  ? 332 ARG A NH2   1 
ATOM   3397 N  N     . ILE E 3 334 ? 5.347   22.645  -15.139 1.00 24.96  ? 333 ILE A N     1 
ATOM   3398 C  CA    . ILE E 3 334 ? 5.874   23.915  -15.409 1.00 22.99  ? 333 ILE A CA    1 
ATOM   3399 C  C     . ILE E 3 334 ? 7.376   23.871  -15.315 1.00 22.90  ? 333 ILE A C     1 
ATOM   3400 O  O     . ILE E 3 334 ? 7.898   23.277  -14.395 1.00 22.25  ? 333 ILE A O     1 
ATOM   3401 C  CB    . ILE E 3 334 ? 5.225   25.040  -14.504 1.00 22.20  ? 333 ILE A CB    1 
ATOM   3402 C  CG1   . ILE E 3 334 ? 5.489   26.413  -15.122 1.00 19.63  ? 333 ILE A CG1   1 
ATOM   3403 C  CG2   . ILE E 3 334 ? 5.707   25.007  -13.095 1.00 20.38  ? 333 ILE A CG2   1 
ATOM   3404 C  CD1   . ILE E 3 334 ? 4.960   26.542  -16.502 1.00 11.48  ? 333 ILE A CD1   1 
ATOM   3405 N  N     . GLY E 3 335 ? 8.069   24.503  -16.266 1.00 22.61  ? 334 GLY A N     1 
ATOM   3406 C  CA    . GLY E 3 335 ? 9.494   24.596  -16.124 1.00 23.35  ? 334 GLY A CA    1 
ATOM   3407 C  C     . GLY E 3 335 ? 10.207  25.657  -16.929 1.00 24.09  ? 334 GLY A C     1 
ATOM   3408 O  O     . GLY E 3 335 ? 9.593   26.474  -17.631 1.00 24.11  ? 334 GLY A O     1 
ATOM   3409 N  N     . VAL E 3 336 ? 11.533  25.593  -16.849 1.00 23.51  ? 335 VAL A N     1 
ATOM   3410 C  CA    . VAL E 3 336 ? 12.365  26.516  -17.545 1.00 22.71  ? 335 VAL A CA    1 
ATOM   3411 C  C     . VAL E 3 336 ? 13.572  25.795  -18.148 1.00 22.31  ? 335 VAL A C     1 
ATOM   3412 O  O     . VAL E 3 336 ? 14.101  24.846  -17.577 1.00 20.85  ? 335 VAL A O     1 
ATOM   3413 C  CB    . VAL E 3 336 ? 12.824  27.631  -16.609 1.00 22.58  ? 335 VAL A CB    1 
ATOM   3414 C  CG1   . VAL E 3 336 ? 13.144  27.074  -15.246 1.00 22.03  ? 335 VAL A CG1   1 
ATOM   3415 C  CG2   . VAL E 3 336 ? 14.035  28.295  -17.198 1.00 22.76  ? 335 VAL A CG2   1 
ATOM   3416 N  N     . ARG E 3 337 ? 14.004  26.265  -19.311 1.00 22.24  ? 336 ARG A N     1 
ATOM   3417 C  CA    . ARG E 3 337 ? 15.250  25.785  -19.877 1.00 22.51  ? 336 ARG A CA    1 
ATOM   3418 C  C     . ARG E 3 337 ? 16.168  26.940  -20.291 1.00 21.35  ? 336 ARG A C     1 
ATOM   3419 O  O     . ARG E 3 337 ? 15.765  27.971  -20.843 1.00 20.10  ? 336 ARG A O     1 
ATOM   3420 C  CB    . ARG E 3 337 ? 15.003  24.716  -20.962 1.00 23.93  ? 336 ARG A CB    1 
ATOM   3421 C  CG    . ARG E 3 337 ? 16.223  24.078  -21.643 1.00 26.63  ? 336 ARG A CG    1 
ATOM   3422 C  CD    . ARG E 3 337 ? 15.946  22.611  -22.121 1.00 30.69  ? 336 ARG A CD    1 
ATOM   3423 N  NE    . ARG E 3 337 ? 16.472  21.602  -21.184 1.00 33.30  ? 336 ARG A NE    1 
ATOM   3424 C  CZ    . ARG E 3 337 ? 15.761  21.021  -20.205 1.00 35.07  ? 336 ARG A CZ    1 
ATOM   3425 N  NH1   . ARG E 3 337 ? 14.459  21.297  -20.019 1.00 36.84  ? 336 ARG A NH1   1 
ATOM   3426 N  NH2   . ARG E 3 337 ? 16.356  20.156  -19.396 1.00 34.07  ? 336 ARG A NH2   1 
ATOM   3427 N  N     . PHE E 3 338 ? 17.426  26.770  -19.967 1.00 20.66  ? 337 PHE A N     1 
ATOM   3428 C  CA    . PHE E 3 338 ? 18.352  27.803  -20.261 1.00 20.87  ? 337 PHE A CA    1 
ATOM   3429 C  C     . PHE E 3 338 ? 19.308  27.342  -21.295 1.00 20.97  ? 337 PHE A C     1 
ATOM   3430 O  O     . PHE E 3 338 ? 19.796  26.218  -21.187 1.00 22.04  ? 337 PHE A O     1 
ATOM   3431 C  CB    . PHE E 3 338 ? 19.095  28.142  -19.008 1.00 20.86  ? 337 PHE A CB    1 
ATOM   3432 C  CG    . PHE E 3 338 ? 18.271  28.875  -18.034 1.00 20.33  ? 337 PHE A CG    1 
ATOM   3433 C  CD1   . PHE E 3 338 ? 17.996  30.229  -18.239 1.00 18.20  ? 337 PHE A CD1   1 
ATOM   3434 C  CD2   . PHE E 3 338 ? 17.754  28.213  -16.929 1.00 19.38  ? 337 PHE A CD2   1 
ATOM   3435 C  CE1   . PHE E 3 338 ? 17.245  30.923  -17.361 1.00 19.92  ? 337 PHE A CE1   1 
ATOM   3436 C  CE2   . PHE E 3 338 ? 16.976  28.895  -16.030 1.00 19.70  ? 337 PHE A CE2   1 
ATOM   3437 C  CZ    . PHE E 3 338 ? 16.716  30.258  -16.245 1.00 21.78  ? 337 PHE A CZ    1 
ATOM   3438 N  N     . SER E 3 339 ? 19.613  28.209  -22.255 1.00 20.66  ? 338 SER A N     1 
ATOM   3439 C  CA    . SER E 3 339 ? 20.534  27.851  -23.334 1.00 21.27  ? 338 SER A CA    1 
ATOM   3440 C  C     . SER E 3 339 ? 21.417  29.018  -23.900 1.00 22.41  ? 338 SER A C     1 
ATOM   3441 O  O     . SER E 3 339 ? 21.398  30.149  -23.390 1.00 22.07  ? 338 SER A O     1 
ATOM   3442 C  CB    . SER E 3 339 ? 19.774  27.119  -24.437 1.00 20.41  ? 338 SER A CB    1 
ATOM   3443 O  OG    . SER E 3 339 ? 19.025  28.014  -25.222 1.00 19.57  ? 338 SER A OG    1 
ATOM   3444 N  N     . LYS E 3 340 ? 22.204  28.694  -24.924 1.00 23.74  ? 339 LYS A N     1 
ATOM   3445 C  CA    . LYS E 3 340 ? 23.229  29.576  -25.500 1.00 25.38  ? 339 LYS A CA    1 
ATOM   3446 C  C     . LYS E 3 340 ? 24.143  30.223  -24.451 1.00 25.85  ? 339 LYS A C     1 
ATOM   3447 O  O     . LYS E 3 340 ? 24.186  31.453  -24.332 1.00 26.64  ? 339 LYS A O     1 
ATOM   3448 C  CB    . LYS E 3 340 ? 22.601  30.633  -26.440 1.00 25.37  ? 339 LYS A CB    1 
ATOM   3449 C  CG    . LYS E 3 340 ? 21.625  30.024  -27.468 1.00 26.88  ? 339 LYS A CG    1 
ATOM   3450 C  CD    . LYS E 3 340 ? 20.495  30.990  -27.816 1.00 28.22  ? 339 LYS A CD    1 
ATOM   3451 C  CE    . LYS E 3 340 ? 19.260  30.264  -28.401 1.00 30.96  ? 339 LYS A CE    1 
ATOM   3452 N  NZ    . LYS E 3 340 ? 18.803  28.997  -27.668 1.00 30.24  ? 339 LYS A NZ    1 
ATOM   3453 N  N     . PHE E 3 341 ? 24.887  29.408  -23.721 1.00 26.82  ? 340 PHE A N     1 
ATOM   3454 C  CA    . PHE E 3 341 ? 25.787  29.903  -22.638 1.00 28.70  ? 340 PHE A CA    1 
ATOM   3455 C  C     . PHE E 3 341 ? 26.937  30.777  -23.166 1.00 30.02  ? 340 PHE A C     1 
ATOM   3456 O  O     . PHE E 3 341 ? 27.359  30.631  -24.319 1.00 29.91  ? 340 PHE A O     1 
ATOM   3457 C  CB    . PHE E 3 341 ? 26.331  28.739  -21.769 1.00 28.22  ? 340 PHE A CB    1 
ATOM   3458 C  CG    . PHE E 3 341 ? 25.297  27.695  -21.435 1.00 28.60  ? 340 PHE A CG    1 
ATOM   3459 C  CD1   . PHE E 3 341 ? 24.349  27.915  -20.448 1.00 29.23  ? 340 PHE A CD1   1 
ATOM   3460 C  CD2   . PHE E 3 341 ? 25.259  26.488  -22.122 1.00 30.70  ? 340 PHE A CD2   1 
ATOM   3461 C  CE1   . PHE E 3 341 ? 23.383  26.955  -20.160 1.00 30.52  ? 340 PHE A CE1   1 
ATOM   3462 C  CE2   . PHE E 3 341 ? 24.308  25.501  -21.814 1.00 30.25  ? 340 PHE A CE2   1 
ATOM   3463 C  CZ    . PHE E 3 341 ? 23.357  25.750  -20.837 1.00 30.80  ? 340 PHE A CZ    1 
ATOM   3464 N  N     . ILE E 3 342 ? 27.426  31.685  -22.320 1.00 31.96  ? 341 ILE A N     1 
ATOM   3465 C  CA    . ILE E 3 342 ? 28.400  32.714  -22.740 1.00 33.86  ? 341 ILE A CA    1 
ATOM   3466 C  C     . ILE E 3 342 ? 29.650  32.153  -23.449 1.00 34.81  ? 341 ILE A C     1 
ATOM   3467 O  O     . ILE E 3 342 ? 30.162  31.082  -23.108 1.00 35.98  ? 341 ILE A O     1 
ATOM   3468 C  CB    . ILE E 3 342 ? 28.812  33.652  -21.553 1.00 33.92  ? 341 ILE A CB    1 
ATOM   3469 C  CG1   . ILE E 3 342 ? 27.589  34.423  -21.043 1.00 34.70  ? 341 ILE A CG1   1 
ATOM   3470 C  CG2   . ILE E 3 342 ? 29.959  34.589  -21.966 1.00 33.98  ? 341 ILE A CG2   1 
ATOM   3471 C  CD1   . ILE E 3 342 ? 27.896  35.762  -20.397 1.00 34.84  ? 341 ILE A CD1   1 
ATOM   3472 O  OXT   . ILE E 3 342 ? 30.178  32.746  -24.399 1.00 35.86  ? 341 ILE A OXT   1 
ATOM   3473 N  N     . MET F 3 2   ? -4.654  34.696  30.260  1.00 37.70  ? 1   MET B N     1 
ATOM   3474 C  CA    . MET F 3 2   ? -4.384  33.835  29.102  1.00 36.14  ? 1   MET B CA    1 
ATOM   3475 C  C     . MET F 3 2   ? -5.665  33.594  28.302  1.00 34.47  ? 1   MET B C     1 
ATOM   3476 O  O     . MET F 3 2   ? -6.740  33.342  28.874  1.00 34.29  ? 1   MET B O     1 
ATOM   3477 C  CB    . MET F 3 2   ? -3.754  32.512  29.540  1.00 37.31  ? 1   MET B CB    1 
ATOM   3478 C  CG    . MET F 3 2   ? -3.364  31.616  28.410  1.00 39.31  ? 1   MET B CG    1 
ATOM   3479 S  SD    . MET F 3 2   ? -2.534  30.091  28.929  1.00 47.23  ? 1   MET B SD    1 
ATOM   3480 C  CE    . MET F 3 2   ? -3.879  28.954  29.329  1.00 43.81  ? 1   MET B CE    1 
ATOM   3481 N  N     . ILE F 3 3   ? -5.524  33.671  26.977  1.00 32.05  ? 2   ILE B N     1 
ATOM   3482 C  CA    . ILE F 3 3   ? -6.642  33.565  26.031  1.00 29.81  ? 2   ILE B CA    1 
ATOM   3483 C  C     . ILE F 3 3   ? -6.236  32.653  24.890  1.00 28.74  ? 2   ILE B C     1 
ATOM   3484 O  O     . ILE F 3 3   ? -5.422  33.021  24.038  1.00 29.08  ? 2   ILE B O     1 
ATOM   3485 C  CB    . ILE F 3 3   ? -6.953  34.923  25.409  1.00 29.20  ? 2   ILE B CB    1 
ATOM   3486 C  CG1   . ILE F 3 3   ? -7.503  35.893  26.449  1.00 27.90  ? 2   ILE B CG1   1 
ATOM   3487 C  CG2   . ILE F 3 3   ? -7.898  34.758  24.281  1.00 29.00  ? 2   ILE B CG2   1 
ATOM   3488 C  CD1   . ILE F 3 3   ? -7.743  37.262  25.909  1.00 25.11  ? 2   ILE B CD1   1 
ATOM   3489 N  N     . VAL F 3 4   ? -6.798  31.464  24.871  1.00 27.19  ? 3   VAL B N     1 
ATOM   3490 C  CA    . VAL F 3 4   ? -6.492  30.494  23.826  1.00 25.70  ? 3   VAL B CA    1 
ATOM   3491 C  C     . VAL F 3 4   ? -7.581  30.434  22.762  1.00 24.75  ? 3   VAL B C     1 
ATOM   3492 O  O     . VAL F 3 4   ? -8.757  30.472  23.077  1.00 25.03  ? 3   VAL B O     1 
ATOM   3493 C  CB    . VAL F 3 4   ? -6.365  29.107  24.455  1.00 26.03  ? 3   VAL B CB    1 
ATOM   3494 C  CG1   . VAL F 3 4   ? -6.224  28.023  23.395  1.00 24.64  ? 3   VAL B CG1   1 
ATOM   3495 C  CG2   . VAL F 3 4   ? -5.205  29.105  25.502  1.00 24.21  ? 3   VAL B CG2   1 
ATOM   3496 N  N     . LEU F 3 5   ? -7.171  30.326  21.504  1.00 23.44  ? 4   LEU B N     1 
ATOM   3497 C  CA    . LEU F 3 5   ? -8.076  30.169  20.393  1.00 21.72  ? 4   LEU B CA    1 
ATOM   3498 C  C     . LEU F 3 5   ? -7.714  28.865  19.677  1.00 21.37  ? 4   LEU B C     1 
ATOM   3499 O  O     . LEU F 3 5   ? -6.553  28.615  19.345  1.00 20.22  ? 4   LEU B O     1 
ATOM   3500 C  CB    . LEU F 3 5   ? -7.975  31.367  19.443  1.00 21.42  ? 4   LEU B CB    1 
ATOM   3501 C  CG    . LEU F 3 5   ? -9.055  31.544  18.347  1.00 20.79  ? 4   LEU B CG    1 
ATOM   3502 C  CD1   . LEU F 3 5   ? -9.307  33.020  17.904  1.00 16.65  ? 4   LEU B CD1   1 
ATOM   3503 C  CD2   . LEU F 3 5   ? -8.823  30.598  17.131  1.00 19.33  ? 4   LEU B CD2   1 
ATOM   3504 N  N     . PHE F 3 6   ? -8.733  28.042  19.423  1.00 20.57  ? 5   PHE B N     1 
ATOM   3505 C  CA    . PHE F 3 6   ? -8.516  26.715  18.892  1.00 19.13  ? 5   PHE B CA    1 
ATOM   3506 C  C     . PHE F 3 6   ? -9.338  26.604  17.605  1.00 18.73  ? 5   PHE B C     1 
ATOM   3507 O  O     . PHE F 3 6   ? -10.461 27.067  17.548  1.00 20.12  ? 5   PHE B O     1 
ATOM   3508 C  CB    . PHE F 3 6   ? -8.898  25.710  19.962  1.00 18.64  ? 5   PHE B CB    1 
ATOM   3509 C  CG    . PHE F 3 6   ? -9.094  24.314  19.439  1.00 19.76  ? 5   PHE B CG    1 
ATOM   3510 C  CD1   . PHE F 3 6   ? -8.000  23.471  19.237  1.00 18.16  ? 5   PHE B CD1   1 
ATOM   3511 C  CD2   . PHE F 3 6   ? -10.373 23.859  19.116  1.00 19.84  ? 5   PHE B CD2   1 
ATOM   3512 C  CE1   . PHE F 3 6   ? -8.151  22.232  18.766  1.00 18.61  ? 5   PHE B CE1   1 
ATOM   3513 C  CE2   . PHE F 3 6   ? -10.540 22.584  18.612  1.00 19.66  ? 5   PHE B CE2   1 
ATOM   3514 C  CZ    . PHE F 3 6   ? -9.425  21.761  18.453  1.00 19.84  ? 5   PHE B CZ    1 
ATOM   3515 N  N     . VAL F 3 7   ? -8.764  26.062  16.549  1.00 17.78  ? 6   VAL B N     1 
ATOM   3516 C  CA    . VAL F 3 7   ? -9.448  26.007  15.243  1.00 16.96  ? 6   VAL B CA    1 
ATOM   3517 C  C     . VAL F 3 7   ? -9.512  24.553  14.875  1.00 16.85  ? 6   VAL B C     1 
ATOM   3518 O  O     . VAL F 3 7   ? -8.522  23.879  14.932  1.00 17.91  ? 6   VAL B O     1 
ATOM   3519 C  CB    . VAL F 3 7   ? -8.620  26.746  14.150  1.00 16.56  ? 6   VAL B CB    1 
ATOM   3520 C  CG1   . VAL F 3 7   ? -9.280  26.679  12.826  1.00 16.08  ? 6   VAL B CG1   1 
ATOM   3521 C  CG2   . VAL F 3 7   ? -8.450  28.169  14.510  1.00 17.15  ? 6   VAL B CG2   1 
ATOM   3522 N  N     . ASP F 3 8   ? -10.673 24.051  14.531  1.00 17.45  ? 7   ASP B N     1 
ATOM   3523 C  CA    . ASP F 3 8   ? -10.857 22.615  14.201  1.00 17.71  ? 7   ASP B CA    1 
ATOM   3524 C  C     . ASP F 3 8   ? -11.486 22.677  12.839  1.00 17.19  ? 7   ASP B C     1 
ATOM   3525 O  O     . ASP F 3 8   ? -12.446 23.458  12.679  1.00 17.71  ? 7   ASP B O     1 
ATOM   3526 C  CB    . ASP F 3 8   ? -11.856 21.901  15.160  1.00 17.07  ? 7   ASP B CB    1 
ATOM   3527 C  CG    . ASP F 3 8   ? -11.941 20.427  14.867  1.00 19.34  ? 7   ASP B CG    1 
ATOM   3528 O  OD1   . ASP F 3 8   ? -12.932 19.886  14.279  1.00 22.02  ? 7   ASP B OD1   1 
ATOM   3529 O  OD2   . ASP F 3 8   ? -10.949 19.760  15.189  1.00 22.20  ? 7   ASP B OD2   1 
ATOM   3530 N  N     . PHE F 3 9   ? -10.975 21.927  11.856  1.00 15.87  ? 8   PHE B N     1 
ATOM   3531 C  CA    . PHE F 3 9   ? -11.588 22.026  10.543  1.00 14.67  ? 8   PHE B CA    1 
ATOM   3532 C  C     . PHE F 3 9   ? -12.739 21.000  10.512  1.00 15.12  ? 8   PHE B C     1 
ATOM   3533 O  O     . PHE F 3 9   ? -12.597 19.915  11.049  1.00 16.18  ? 8   PHE B O     1 
ATOM   3534 C  CB    . PHE F 3 9   ? -10.595 21.769  9.432   1.00 14.66  ? 8   PHE B CB    1 
ATOM   3535 C  CG    . PHE F 3 9   ? -9.257  22.456  9.592   1.00 13.08  ? 8   PHE B CG    1 
ATOM   3536 C  CD1   . PHE F 3 9   ? -9.124  23.670  10.240  1.00 12.77  ? 8   PHE B CD1   1 
ATOM   3537 C  CD2   . PHE F 3 9   ? -8.139  21.930  8.975   1.00 13.28  ? 8   PHE B CD2   1 
ATOM   3538 C  CE1   . PHE F 3 9   ? -7.883  24.327  10.354  1.00 10.74  ? 8   PHE B CE1   1 
ATOM   3539 C  CE2   . PHE F 3 9   ? -6.886  22.602  9.055   1.00 12.21  ? 8   PHE B CE2   1 
ATOM   3540 C  CZ    . PHE F 3 9   ? -6.764  23.775  9.760   1.00 11.05  ? 8   PHE B CZ    1 
ATOM   3541 N  N     . ASP F 3 10  ? -13.867 21.385  9.926   1.00 14.66  ? 9   ASP B N     1 
ATOM   3542 C  CA    . ASP F 3 10  ? -15.080 20.578  9.984   1.00 14.23  ? 9   ASP B CA    1 
ATOM   3543 C  C     . ASP F 3 10  ? -15.019 19.326  9.117   1.00 13.91  ? 9   ASP B C     1 
ATOM   3544 O  O     . ASP F 3 10  ? -14.722 19.396  7.925   1.00 12.57  ? 9   ASP B O     1 
ATOM   3545 C  CB    . ASP F 3 10  ? -16.298 21.420  9.595   1.00 15.00  ? 9   ASP B CB    1 
ATOM   3546 C  CG    . ASP F 3 10  ? -16.602 22.507  10.607  1.00 17.23  ? 9   ASP B CG    1 
ATOM   3547 O  OD1   . ASP F 3 10  ? -16.629 22.203  11.818  1.00 17.29  ? 9   ASP B OD1   1 
ATOM   3548 O  OD2   . ASP F 3 10  ? -16.813 23.666  10.192  1.00 19.76  ? 9   ASP B OD2   1 
ATOM   3549 N  N     . TYR F 3 11  ? -15.311 18.181  9.727   1.00 13.72  ? 10  TYR B N     1 
ATOM   3550 C  CA    . TYR F 3 11  ? -15.405 16.926  8.989   1.00 13.30  ? 10  TYR B CA    1 
ATOM   3551 C  C     . TYR F 3 11  ? -14.401 16.937  7.807   1.00 12.59  ? 10  TYR B C     1 
ATOM   3552 O  O     . TYR F 3 11  ? -14.765 16.803  6.603   1.00 11.54  ? 10  TYR B O     1 
ATOM   3553 C  CB    . TYR F 3 11  ? -16.880 16.662  8.612   1.00 14.61  ? 10  TYR B CB    1 
ATOM   3554 C  CG    . TYR F 3 11  ? -17.498 17.694  7.667   1.00 16.47  ? 10  TYR B CG    1 
ATOM   3555 C  CD1   . TYR F 3 11  ? -17.571 17.435  6.306   1.00 17.58  ? 10  TYR B CD1   1 
ATOM   3556 C  CD2   . TYR F 3 11  ? -17.983 18.921  8.127   1.00 18.85  ? 10  TYR B CD2   1 
ATOM   3557 C  CE1   . TYR F 3 11  ? -18.089 18.351  5.417   1.00 19.45  ? 10  TYR B CE1   1 
ATOM   3558 C  CE2   . TYR F 3 11  ? -18.506 19.870  7.234   1.00 19.69  ? 10  TYR B CE2   1 
ATOM   3559 C  CZ    . TYR F 3 11  ? -18.554 19.558  5.872   1.00 21.28  ? 10  TYR B CZ    1 
ATOM   3560 O  OH    . TYR F 3 11  ? -19.072 20.408  4.923   1.00 24.77  ? 10  TYR B OH    1 
ATOM   3561 N  N     . PHE F 3 12  ? -13.118 17.046  8.185   1.00 10.87  ? 11  PHE B N     1 
ATOM   3562 C  CA    . PHE F 3 12  ? -12.099 17.609  7.299   1.00 10.43  ? 11  PHE B CA    1 
ATOM   3563 C  C     . PHE F 3 12  ? -11.907 16.878  5.981   1.00 10.46  ? 11  PHE B C     1 
ATOM   3564 O  O     . PHE F 3 12  ? -12.164 17.429  4.918   1.00 11.09  ? 11  PHE B O     1 
ATOM   3565 C  CB    . PHE F 3 12  ? -10.787 17.853  8.052   1.00 11.23  ? 11  PHE B CB    1 
ATOM   3566 C  CG    . PHE F 3 12  ? -9.741  18.431  7.201   1.00 10.32  ? 11  PHE B CG    1 
ATOM   3567 C  CD1   . PHE F 3 12  ? -9.991  19.573  6.485   1.00 12.56  ? 11  PHE B CD1   1 
ATOM   3568 C  CD2   . PHE F 3 12  ? -8.523  17.866  7.095   1.00 10.15  ? 11  PHE B CD2   1 
ATOM   3569 C  CE1   . PHE F 3 12  ? -9.022  20.089  5.609   1.00 11.95  ? 11  PHE B CE1   1 
ATOM   3570 C  CE2   . PHE F 3 12  ? -7.550  18.440  6.218   1.00 10.89  ? 11  PHE B CE2   1 
ATOM   3571 C  CZ    . PHE F 3 12  ? -7.821  19.514  5.528   1.00 10.81  ? 11  PHE B CZ    1 
ATOM   3572 N  N     . TYR F 3 13  ? -11.531 15.623  6.034   1.00 11.00  ? 12  TYR B N     1 
ATOM   3573 C  CA    . TYR F 3 13  ? -11.452 14.773  4.842   1.00 11.72  ? 12  TYR B CA    1 
ATOM   3574 C  C     . TYR F 3 13  ? -12.665 14.851  3.975   1.00 12.18  ? 12  TYR B C     1 
ATOM   3575 O  O     . TYR F 3 13  ? -12.554 14.955  2.740   1.00 12.38  ? 12  TYR B O     1 
ATOM   3576 C  CB    . TYR F 3 13  ? -11.240 13.316  5.225   1.00 11.22  ? 12  TYR B CB    1 
ATOM   3577 C  CG    . TYR F 3 13  ? -9.961  13.095  5.972   1.00 11.98  ? 12  TYR B CG    1 
ATOM   3578 C  CD1   . TYR F 3 13  ? -9.066  14.153  6.220   1.00 14.96  ? 12  TYR B CD1   1 
ATOM   3579 C  CD2   . TYR F 3 13  ? -9.615  11.825  6.408   1.00 13.27  ? 12  TYR B CD2   1 
ATOM   3580 C  CE1   . TYR F 3 13  ? -7.870  13.928  6.923   1.00 17.08  ? 12  TYR B CE1   1 
ATOM   3581 C  CE2   . TYR F 3 13  ? -8.444  11.608  7.104   1.00 15.21  ? 12  TYR B CE2   1 
ATOM   3582 C  CZ    . TYR F 3 13  ? -7.581  12.648  7.351   1.00 16.39  ? 12  TYR B CZ    1 
ATOM   3583 O  OH    . TYR F 3 13  ? -6.431  12.373  8.052   1.00 18.38  ? 12  TYR B OH    1 
ATOM   3584 N  N     . ALA F 3 14  ? -13.839 14.855  4.602   1.00 13.17  ? 13  ALA B N     1 
ATOM   3585 C  CA    . ALA F 3 14  ? -15.045 14.815  3.764   1.00 13.31  ? 13  ALA B CA    1 
ATOM   3586 C  C     . ALA F 3 14  ? -15.300 16.228  3.277   1.00 13.61  ? 13  ALA B C     1 
ATOM   3587 O  O     . ALA F 3 14  ? -15.758 16.407  2.149   1.00 15.22  ? 13  ALA B O     1 
ATOM   3588 C  CB    . ALA F 3 14  ? -16.232 14.227  4.505   1.00 13.08  ? 13  ALA B CB    1 
ATOM   3589 N  N     . GLN F 3 15  ? -14.931 17.231  4.070   1.00 12.62  ? 14  GLN B N     1 
ATOM   3590 C  CA    . GLN F 3 15  ? -15.106 18.562  3.608   1.00 13.12  ? 14  GLN B CA    1 
ATOM   3591 C  C     . GLN F 3 15  ? -14.329 18.862  2.354   1.00 13.01  ? 14  GLN B C     1 
ATOM   3592 O  O     . GLN F 3 15  ? -14.819 19.622  1.552   1.00 11.82  ? 14  GLN B O     1 
ATOM   3593 C  CB    . GLN F 3 15  ? -14.771 19.632  4.629   1.00 13.94  ? 14  GLN B CB    1 
ATOM   3594 C  CG    . GLN F 3 15  ? -15.223 21.052  4.107   1.00 16.45  ? 14  GLN B CG    1 
ATOM   3595 C  CD    . GLN F 3 15  ? -15.518 22.030  5.233   1.00 17.58  ? 14  GLN B CD    1 
ATOM   3596 O  OE1   . GLN F 3 15  ? -15.146 21.800  6.403   1.00 20.37  ? 14  GLN B OE1   1 
ATOM   3597 N  NE2   . GLN F 3 15  ? -16.148 23.125  4.894   1.00 14.42  ? 14  GLN B NE2   1 
ATOM   3598 N  N     . VAL F 3 16  ? -13.128 18.300  2.221   1.00 14.09  ? 15  VAL B N     1 
ATOM   3599 C  CA    . VAL F 3 16  ? -12.224 18.601  1.086   1.00 15.69  ? 15  VAL B CA    1 
ATOM   3600 C  C     . VAL F 3 16  ? -12.755 17.963  -0.195  1.00 16.51  ? 15  VAL B C     1 
ATOM   3601 O  O     . VAL F 3 16  ? -12.973 18.636  -1.212  1.00 16.67  ? 15  VAL B O     1 
ATOM   3602 C  CB    . VAL F 3 16  ? -10.708 18.162  1.338   1.00 16.03  ? 15  VAL B CB    1 
ATOM   3603 C  CG1   . VAL F 3 16  ? -9.947  18.133  0.066   1.00 15.34  ? 15  VAL B CG1   1 
ATOM   3604 C  CG2   . VAL F 3 16  ? -9.994  19.113  2.333   1.00 16.10  ? 15  VAL B CG2   1 
ATOM   3605 N  N     . GLU F 3 17  ? -13.017 16.663  -0.116  1.00 17.22  ? 16  GLU B N     1 
ATOM   3606 C  CA    . GLU F 3 17  ? -13.750 15.989  -1.157  1.00 17.44  ? 16  GLU B CA    1 
ATOM   3607 C  C     . GLU F 3 17  ? -14.966 16.811  -1.624  1.00 18.25  ? 16  GLU B C     1 
ATOM   3608 O  O     . GLU F 3 17  ? -15.124 16.982  -2.844  1.00 19.66  ? 16  GLU B O     1 
ATOM   3609 C  CB    . GLU F 3 17  ? -14.132 14.576  -0.713  1.00 17.48  ? 16  GLU B CB    1 
ATOM   3610 C  CG    . GLU F 3 17  ? -12.948 13.709  -0.360  1.00 19.15  ? 16  GLU B CG    1 
ATOM   3611 C  CD    . GLU F 3 17  ? -12.095 13.413  -1.565  1.00 23.69  ? 16  GLU B CD    1 
ATOM   3612 O  OE1   . GLU F 3 17  ? -12.406 13.909  -2.685  1.00 26.87  ? 16  GLU B OE1   1 
ATOM   3613 O  OE2   . GLU F 3 17  ? -11.102 12.677  -1.403  1.00 26.53  ? 16  GLU B OE2   1 
ATOM   3614 N  N     . GLU F 3 18  ? -15.785 17.355  -0.703  1.00 18.25  ? 17  GLU B N     1 
ATOM   3615 C  CA    . GLU F 3 18  ? -16.885 18.329  -1.054  1.00 18.17  ? 17  GLU B CA    1 
ATOM   3616 C  C     . GLU F 3 18  ? -16.503 19.655  -1.733  1.00 18.27  ? 17  GLU B C     1 
ATOM   3617 O  O     . GLU F 3 18  ? -17.299 20.195  -2.526  1.00 19.12  ? 17  GLU B O     1 
ATOM   3618 C  CB    . GLU F 3 18  ? -17.728 18.690  0.179   1.00 19.24  ? 17  GLU B CB    1 
ATOM   3619 C  CG    . GLU F 3 18  ? -18.765 17.628  0.683   1.00 21.15  ? 17  GLU B CG    1 
ATOM   3620 C  CD    . GLU F 3 18  ? -19.398 18.017  2.018   1.00 25.46  ? 17  GLU B CD    1 
ATOM   3621 O  OE1   . GLU F 3 18  ? -19.304 19.228  2.386   1.00 24.89  ? 17  GLU B OE1   1 
ATOM   3622 O  OE2   . GLU F 3 18  ? -19.974 17.112  2.711   1.00 26.41  ? 17  GLU B OE2   1 
ATOM   3623 N  N     . VAL F 3 19  ? -15.313 20.200  -1.464  1.00 17.66  ? 18  VAL B N     1 
ATOM   3624 C  CA    . VAL F 3 19  ? -14.911 21.412  -2.177  1.00 17.01  ? 18  VAL B CA    1 
ATOM   3625 C  C     . VAL F 3 19  ? -14.411 21.051  -3.560  1.00 18.74  ? 18  VAL B C     1 
ATOM   3626 O  O     . VAL F 3 19  ? -14.408 21.882  -4.502  1.00 19.84  ? 18  VAL B O     1 
ATOM   3627 C  CB    . VAL F 3 19  ? -13.828 22.190  -1.403  1.00 16.81  ? 18  VAL B CB    1 
ATOM   3628 C  CG1   . VAL F 3 19  ? -13.158 23.347  -2.289  1.00 12.80  ? 18  VAL B CG1   1 
ATOM   3629 C  CG2   . VAL F 3 19  ? -14.395 22.689  -0.069  1.00 13.91  ? 18  VAL B CG2   1 
ATOM   3630 N  N     . LEU F 3 20  ? -13.993 19.794  -3.687  1.00 20.15  ? 19  LEU B N     1 
ATOM   3631 C  CA    . LEU F 3 20  ? -13.362 19.267  -4.907  1.00 20.81  ? 19  LEU B CA    1 
ATOM   3632 C  C     . LEU F 3 20  ? -14.380 18.765  -5.880  1.00 21.04  ? 19  LEU B C     1 
ATOM   3633 O  O     . LEU F 3 20  ? -14.105 18.645  -7.055  1.00 21.50  ? 19  LEU B O     1 
ATOM   3634 C  CB    . LEU F 3 20  ? -12.400 18.123  -4.541  1.00 20.49  ? 19  LEU B CB    1 
ATOM   3635 C  CG    . LEU F 3 20  ? -10.936 18.553  -4.577  1.00 21.77  ? 19  LEU B CG    1 
ATOM   3636 C  CD1   . LEU F 3 20  ? -10.758 20.070  -4.220  1.00 23.85  ? 19  LEU B CD1   1 
ATOM   3637 C  CD2   . LEU F 3 20  ? -10.067 17.616  -3.725  1.00 20.23  ? 19  LEU B CD2   1 
ATOM   3638 N  N     . ASN F 3 21  ? -15.525 18.371  -5.355  1.00 22.12  ? 20  ASN B N     1 
ATOM   3639 C  CA    . ASN F 3 21  ? -16.668 17.984  -6.157  1.00 23.61  ? 20  ASN B CA    1 
ATOM   3640 C  C     . ASN F 3 21  ? -17.896 18.596  -5.448  1.00 24.74  ? 20  ASN B C     1 
ATOM   3641 O  O     . ASN F 3 21  ? -18.558 17.971  -4.586  1.00 25.35  ? 20  ASN B O     1 
ATOM   3642 C  CB    . ASN F 3 21  ? -16.743 16.459  -6.318  1.00 23.59  ? 20  ASN B CB    1 
ATOM   3643 C  CG    . ASN F 3 21  ? -17.981 15.997  -7.109  1.00 24.57  ? 20  ASN B CG    1 
ATOM   3644 O  OD1   . ASN F 3 21  ? -18.831 16.805  -7.534  1.00 24.64  ? 20  ASN B OD1   1 
ATOM   3645 N  ND2   . ASN F 3 21  ? -18.089 14.680  -7.309  1.00 25.45  ? 20  ASN B ND2   1 
ATOM   3646 N  N     . PRO F 3 22  ? -18.183 19.857  -5.783  1.00 25.33  ? 21  PRO B N     1 
ATOM   3647 C  CA    . PRO F 3 22  ? -19.307 20.557  -5.160  1.00 25.57  ? 21  PRO B CA    1 
ATOM   3648 C  C     . PRO F 3 22  ? -20.677 19.850  -5.347  1.00 25.82  ? 21  PRO B C     1 
ATOM   3649 O  O     . PRO F 3 22  ? -21.636 20.217  -4.685  1.00 26.28  ? 21  PRO B O     1 
ATOM   3650 C  CB    . PRO F 3 22  ? -19.304 21.922  -5.858  1.00 25.64  ? 21  PRO B CB    1 
ATOM   3651 C  CG    . PRO F 3 22  ? -17.897 22.058  -6.446  1.00 25.79  ? 21  PRO B CG    1 
ATOM   3652 C  CD    . PRO F 3 22  ? -17.474 20.668  -6.793  1.00 25.07  ? 21  PRO B CD    1 
ATOM   3653 N  N     . SER F 3 23  ? -20.792 18.855  -6.220  1.00 25.77  ? 22  SER B N     1 
ATOM   3654 C  CA    . SER F 3 23  ? -22.070 18.123  -6.286  1.00 25.85  ? 22  SER B CA    1 
ATOM   3655 C  C     . SER F 3 23  ? -22.277 17.229  -5.049  1.00 26.48  ? 22  SER B C     1 
ATOM   3656 O  O     . SER F 3 23  ? -23.344 16.643  -4.856  1.00 27.11  ? 22  SER B O     1 
ATOM   3657 C  CB    . SER F 3 23  ? -22.155 17.275  -7.547  1.00 25.40  ? 22  SER B CB    1 
ATOM   3658 O  OG    . SER F 3 23  ? -21.670 15.977  -7.289  1.00 23.36  ? 22  SER B OG    1 
ATOM   3659 N  N     . LEU F 3 24  ? -21.261 17.114  -4.218  1.00 26.84  ? 23  LEU B N     1 
ATOM   3660 C  CA    . LEU F 3 24  ? -21.395 16.299  -3.016  1.00 27.47  ? 23  LEU B CA    1 
ATOM   3661 C  C     . LEU F 3 24  ? -22.084 17.048  -1.841  1.00 28.31  ? 23  LEU B C     1 
ATOM   3662 O  O     . LEU F 3 24  ? -22.537 16.413  -0.883  1.00 28.36  ? 23  LEU B O     1 
ATOM   3663 C  CB    . LEU F 3 24  ? -20.038 15.694  -2.596  1.00 26.24  ? 23  LEU B CB    1 
ATOM   3664 C  CG    . LEU F 3 24  ? -19.332 14.692  -3.527  1.00 25.57  ? 23  LEU B CG    1 
ATOM   3665 C  CD1   . LEU F 3 24  ? -18.074 14.148  -2.844  1.00 22.50  ? 23  LEU B CD1   1 
ATOM   3666 C  CD2   . LEU F 3 24  ? -20.251 13.524  -4.036  1.00 22.96  ? 23  LEU B CD2   1 
ATOM   3667 N  N     . LYS F 3 25  ? -22.206 18.374  -1.908  1.00 29.51  ? 24  LYS B N     1 
ATOM   3668 C  CA    . LYS F 3 25  ? -22.720 19.084  -0.720  1.00 31.03  ? 24  LYS B CA    1 
ATOM   3669 C  C     . LYS F 3 25  ? -24.195 18.832  -0.457  1.00 31.35  ? 24  LYS B C     1 
ATOM   3670 O  O     . LYS F 3 25  ? -25.029 18.867  -1.372  1.00 32.58  ? 24  LYS B O     1 
ATOM   3671 C  CB    . LYS F 3 25  ? -22.488 20.590  -0.793  1.00 31.83  ? 24  LYS B CB    1 
ATOM   3672 C  CG    . LYS F 3 25  ? -21.071 21.061  -0.523  1.00 32.98  ? 24  LYS B CG    1 
ATOM   3673 C  CD    . LYS F 3 25  ? -20.683 22.063  -1.630  1.00 34.85  ? 24  LYS B CD    1 
ATOM   3674 C  CE    . LYS F 3 25  ? -19.333 22.730  -1.413  1.00 35.61  ? 24  LYS B CE    1 
ATOM   3675 N  NZ    . LYS F 3 25  ? -19.334 24.006  -2.210  1.00 37.72  ? 24  LYS B NZ    1 
ATOM   3676 N  N     . GLY F 3 26  ? -24.512 18.593  0.799   1.00 30.97  ? 25  GLY B N     1 
ATOM   3677 C  CA    . GLY F 3 26  ? -25.876 18.307  1.192   1.00 31.61  ? 25  GLY B CA    1 
ATOM   3678 C  C     . GLY F 3 26  ? -26.131 16.803  1.258   1.00 31.50  ? 25  GLY B C     1 
ATOM   3679 O  O     . GLY F 3 26  ? -27.086 16.355  1.924   1.00 31.77  ? 25  GLY B O     1 
ATOM   3680 N  N     . LYS F 3 27  ? -25.262 16.052  0.572   1.00 30.30  ? 26  LYS B N     1 
ATOM   3681 C  CA    . LYS F 3 27  ? -25.339 14.589  0.453   1.00 28.86  ? 26  LYS B CA    1 
ATOM   3682 C  C     . LYS F 3 27  ? -24.415 13.891  1.424   1.00 27.01  ? 26  LYS B C     1 
ATOM   3683 O  O     . LYS F 3 27  ? -23.450 14.485  1.897   1.00 26.71  ? 26  LYS B O     1 
ATOM   3684 C  CB    . LYS F 3 27  ? -25.036 14.166  -1.005  1.00 29.59  ? 26  LYS B CB    1 
ATOM   3685 C  CG    . LYS F 3 27  ? -26.269 14.401  -1.981  1.00 29.70  ? 26  LYS B CG    1 
ATOM   3686 C  CD    . LYS F 3 27  ? -25.854 14.625  -3.430  1.00 31.75  ? 26  LYS B CD    1 
ATOM   3687 C  CE    . LYS F 3 27  ? -27.045 14.429  -4.431  1.00 33.48  ? 26  LYS B CE    1 
ATOM   3688 N  NZ    . LYS F 3 27  ? -27.857 15.643  -4.761  1.00 31.81  ? 26  LYS B NZ    1 
ATOM   3689 N  N     . PRO F 3 28  ? -24.712 12.622  1.749   1.00 25.34  ? 27  PRO B N     1 
ATOM   3690 C  CA    . PRO F 3 28  ? -23.833 11.961  2.719   1.00 23.71  ? 27  PRO B CA    1 
ATOM   3691 C  C     . PRO F 3 28  ? -22.516 11.445  2.083   1.00 22.60  ? 27  PRO B C     1 
ATOM   3692 O  O     . PRO F 3 28  ? -22.532 10.816  0.980   1.00 22.60  ? 27  PRO B O     1 
ATOM   3693 C  CB    . PRO F 3 28  ? -24.682 10.813  3.229   1.00 23.76  ? 27  PRO B CB    1 
ATOM   3694 C  CG    . PRO F 3 28  ? -26.085 11.193  2.871   1.00 24.42  ? 27  PRO B CG    1 
ATOM   3695 C  CD    . PRO F 3 28  ? -25.949 11.860  1.556   1.00 24.89  ? 27  PRO B CD    1 
ATOM   3696 N  N     . VAL F 3 29  ? -21.409 11.723  2.780   1.00 20.04  ? 28  VAL B N     1 
ATOM   3697 C  CA    . VAL F 3 29  ? -20.085 11.447  2.288   1.00 19.03  ? 28  VAL B CA    1 
ATOM   3698 C  C     . VAL F 3 29  ? -19.257 10.733  3.366   1.00 18.37  ? 28  VAL B C     1 
ATOM   3699 O  O     . VAL F 3 29  ? -19.064 11.290  4.452   1.00 16.64  ? 28  VAL B O     1 
ATOM   3700 C  CB    . VAL F 3 29  ? -19.308 12.774  1.903   1.00 18.98  ? 28  VAL B CB    1 
ATOM   3701 C  CG1   . VAL F 3 29  ? -17.938 12.452  1.348   1.00 16.96  ? 28  VAL B CG1   1 
ATOM   3702 C  CG2   . VAL F 3 29  ? -20.114 13.619  0.923   1.00 18.95  ? 28  VAL B CG2   1 
ATOM   3703 N  N     . VAL F 3 30  ? -18.745 9.545   3.004   1.00 17.72  ? 29  VAL B N     1 
ATOM   3704 C  CA    . VAL F 3 30  ? -17.972 8.687   3.852   1.00 18.02  ? 29  VAL B CA    1 
ATOM   3705 C  C     . VAL F 3 30  ? -16.621 8.490   3.208   1.00 19.47  ? 29  VAL B C     1 
ATOM   3706 O  O     . VAL F 3 30  ? -16.508 7.894   2.116   1.00 21.28  ? 29  VAL B O     1 
ATOM   3707 C  CB    . VAL F 3 30  ? -18.672 7.311   4.027   1.00 18.51  ? 29  VAL B CB    1 
ATOM   3708 C  CG1   . VAL F 3 30  ? -18.037 6.532   5.141   1.00 18.00  ? 29  VAL B CG1   1 
ATOM   3709 C  CG2   . VAL F 3 30  ? -20.187 7.470   4.329   1.00 18.21  ? 29  VAL B CG2   1 
ATOM   3710 N  N     . VAL F 3 31  ? -15.567 8.997   3.844   1.00 19.66  ? 30  VAL B N     1 
ATOM   3711 C  CA    . VAL F 3 31  ? -14.192 8.836   3.292   1.00 19.43  ? 30  VAL B CA    1 
ATOM   3712 C  C     . VAL F 3 31  ? -13.506 7.561   3.838   1.00 21.45  ? 30  VAL B C     1 
ATOM   3713 O  O     . VAL F 3 31  ? -13.380 7.369   5.074   1.00 22.08  ? 30  VAL B O     1 
ATOM   3714 C  CB    . VAL F 3 31  ? -13.363 10.091  3.594   1.00 18.53  ? 30  VAL B CB    1 
ATOM   3715 C  CG1   . VAL F 3 31  ? -11.899 9.857   3.265   1.00 17.02  ? 30  VAL B CG1   1 
ATOM   3716 C  CG2   . VAL F 3 31  ? -13.992 11.346  2.842   1.00 15.76  ? 30  VAL B CG2   1 
ATOM   3717 N  N     . CYS F 3 32  ? -13.068 6.676   2.959   1.00 22.98  ? 31  CYS B N     1 
ATOM   3718 C  CA    . CYS F 3 32  ? -12.651 5.384   3.475   1.00 25.80  ? 31  CYS B CA    1 
ATOM   3719 C  C     . CYS F 3 32  ? -11.181 5.003   3.359   1.00 25.33  ? 31  CYS B C     1 
ATOM   3720 O  O     . CYS F 3 32  ? -10.478 5.486   2.506   1.00 25.34  ? 31  CYS B O     1 
ATOM   3721 C  CB    . CYS F 3 32  ? -13.537 4.266   2.894   1.00 26.47  ? 31  CYS B CB    1 
ATOM   3722 S  SG    . CYS F 3 32  ? -15.257 4.448   3.306   1.00 34.94  ? 31  CYS B SG    1 
ATOM   3723 N  N     . VAL F 3 33  ? -10.748 4.101   4.232   1.00 26.65  ? 32  VAL B N     1 
ATOM   3724 C  CA    . VAL F 3 33  ? -9.507  3.368   4.043   1.00 28.14  ? 32  VAL B CA    1 
ATOM   3725 C  C     . VAL F 3 33  ? -9.817  1.932   3.589   1.00 29.84  ? 32  VAL B C     1 
ATOM   3726 O  O     . VAL F 3 33  ? -10.215 1.091   4.394   1.00 29.79  ? 32  VAL B O     1 
ATOM   3727 C  CB    . VAL F 3 33  ? -8.598  3.347   5.330   1.00 28.12  ? 32  VAL B CB    1 
ATOM   3728 C  CG1   . VAL F 3 33  ? -7.171  3.248   4.907   1.00 28.67  ? 32  VAL B CG1   1 
ATOM   3729 C  CG2   . VAL F 3 33  ? -8.752  4.578   6.189   1.00 26.35  ? 32  VAL B CG2   1 
ATOM   3730 N  N     . PHE F 3 34  ? -9.678  1.661   2.287   1.00 32.57  ? 33  PHE B N     1 
ATOM   3731 C  CA    . PHE F 3 34  ? -9.763  0.277   1.763   1.00 34.98  ? 33  PHE B CA    1 
ATOM   3732 C  C     . PHE F 3 34  ? -8.387  -0.416  1.863   1.00 37.16  ? 33  PHE B C     1 
ATOM   3733 O  O     . PHE F 3 34  ? -7.402  0.069   1.269   1.00 37.67  ? 33  PHE B O     1 
ATOM   3734 C  CB    . PHE F 3 34  ? -10.288 0.255   0.317   1.00 34.84  ? 33  PHE B CB    1 
ATOM   3735 C  CG    . PHE F 3 34  ? -11.617 0.968   0.134   1.00 35.36  ? 33  PHE B CG    1 
ATOM   3736 C  CD1   . PHE F 3 34  ? -12.814 0.280   0.289   1.00 36.05  ? 33  PHE B CD1   1 
ATOM   3737 C  CD2   . PHE F 3 34  ? -11.659 2.317   -0.203  1.00 36.28  ? 33  PHE B CD2   1 
ATOM   3738 C  CE1   . PHE F 3 34  ? -14.060 0.921   0.124   1.00 37.49  ? 33  PHE B CE1   1 
ATOM   3739 C  CE2   . PHE F 3 34  ? -12.887 2.985   -0.365  1.00 37.51  ? 33  PHE B CE2   1 
ATOM   3740 C  CZ    . PHE F 3 34  ? -14.097 2.286   -0.201  1.00 37.76  ? 33  PHE B CZ    1 
ATOM   3741 N  N     . SER F 3 35  ? -8.299  -1.511  2.640   1.00 39.31  ? 34  SER B N     1 
ATOM   3742 C  CA    . SER F 3 35  ? -7.001  -2.218  2.869   1.00 40.73  ? 34  SER B CA    1 
ATOM   3743 C  C     . SER F 3 35  ? -6.525  -3.028  1.651   1.00 42.39  ? 34  SER B C     1 
ATOM   3744 O  O     . SER F 3 35  ? -5.324  -3.327  1.497   1.00 42.19  ? 34  SER B O     1 
ATOM   3745 C  CB    . SER F 3 35  ? -7.092  -3.152  4.066   1.00 40.53  ? 34  SER B CB    1 
ATOM   3746 O  OG    . SER F 3 35  ? -8.034  -4.176  3.836   1.00 39.47  ? 34  SER B OG    1 
ATOM   3747 N  N     . GLY F 3 36  ? -7.486  -3.400  0.808   1.00 43.91  ? 35  GLY B N     1 
ATOM   3748 C  CA    . GLY F 3 36  ? -7.190  -4.108  -0.410  1.00 45.83  ? 35  GLY B CA    1 
ATOM   3749 C  C     . GLY F 3 36  ? -6.823  -5.551  -0.137  1.00 47.39  ? 35  GLY B C     1 
ATOM   3750 O  O     . GLY F 3 36  ? -5.767  -6.044  -0.619  1.00 47.51  ? 35  GLY B O     1 
ATOM   3751 N  N     . ARG F 3 37  ? -7.720  -6.239  0.573   1.00 48.25  ? 36  ARG B N     1 
ATOM   3752 C  CA    . ARG F 3 37  ? -7.816  -7.696  0.609   1.00 48.74  ? 36  ARG B CA    1 
ATOM   3753 C  C     . ARG F 3 37  ? -9.023  -8.038  -0.266  1.00 49.12  ? 36  ARG B C     1 
ATOM   3754 O  O     . ARG F 3 37  ? -8.984  -7.808  -1.474  1.00 49.38  ? 36  ARG B O     1 
ATOM   3755 C  CB    . ARG F 3 37  ? -8.029  -8.193  2.037   1.00 48.61  ? 36  ARG B CB    1 
ATOM   3756 C  CG    . ARG F 3 37  ? -7.891  -7.113  3.098   1.00 49.37  ? 36  ARG B CG    1 
ATOM   3757 C  CD    . ARG F 3 37  ? -7.818  -7.714  4.492   1.00 49.05  ? 36  ARG B CD    1 
ATOM   3758 N  NE    . ARG F 3 37  ? -7.651  -9.164  4.453   1.00 47.49  ? 36  ARG B NE    1 
ATOM   3759 C  CZ    . ARG F 3 37  ? -7.428  -9.919  5.524   1.00 45.80  ? 36  ARG B CZ    1 
ATOM   3760 N  NH1   . ARG F 3 37  ? -7.344  -9.362  6.725   1.00 43.66  ? 36  ARG B NH1   1 
ATOM   3761 N  NH2   . ARG F 3 37  ? -7.288  -11.231 5.396   1.00 44.79  ? 36  ARG B NH2   1 
ATOM   3762 N  N     . PHE F 3 38  ? -10.106 -8.548  0.324   1.00 49.47  ? 37  PHE B N     1 
ATOM   3763 C  CA    . PHE F 3 38  ? -11.408 -8.523  -0.398  1.00 49.72  ? 37  PHE B CA    1 
ATOM   3764 C  C     . PHE F 3 38  ? -11.844 -7.053  -0.544  1.00 49.72  ? 37  PHE B C     1 
ATOM   3765 O  O     . PHE F 3 38  ? -11.195 -6.154  0.001   1.00 49.89  ? 37  PHE B O     1 
ATOM   3766 C  CB    . PHE F 3 38  ? -12.500 -9.360  0.298   1.00 49.82  ? 37  PHE B CB    1 
ATOM   3767 C  CG    . PHE F 3 38  ? -12.589 -9.127  1.772   1.00 49.51  ? 37  PHE B CG    1 
ATOM   3768 C  CD1   . PHE F 3 38  ? -13.472 -8.190  2.282   1.00 49.32  ? 37  PHE B CD1   1 
ATOM   3769 C  CD2   . PHE F 3 38  ? -11.767 -9.842  2.655   1.00 49.98  ? 37  PHE B CD2   1 
ATOM   3770 C  CE1   . PHE F 3 38  ? -13.543 -7.952  3.676   1.00 50.57  ? 37  PHE B CE1   1 
ATOM   3771 C  CE2   . PHE F 3 38  ? -11.822 -9.630  4.041   1.00 49.55  ? 37  PHE B CE2   1 
ATOM   3772 C  CZ    . PHE F 3 38  ? -12.706 -8.680  4.561   1.00 50.11  ? 37  PHE B CZ    1 
ATOM   3773 N  N     . GLU F 3 39  ? -12.914 -6.795  -1.290  1.00 49.60  ? 38  GLU B N     1 
ATOM   3774 C  CA    . GLU F 3 39  ? -13.350 -5.410  -1.515  1.00 49.09  ? 38  GLU B CA    1 
ATOM   3775 C  C     . GLU F 3 39  ? -14.272 -4.996  -0.382  1.00 48.26  ? 38  GLU B C     1 
ATOM   3776 O  O     . GLU F 3 39  ? -14.921 -5.860  0.231   1.00 48.72  ? 38  GLU B O     1 
ATOM   3777 C  CB    . GLU F 3 39  ? -14.007 -5.256  -2.891  1.00 49.45  ? 38  GLU B CB    1 
ATOM   3778 C  CG    . GLU F 3 39  ? -12.967 -5.226  -4.023  1.00 50.71  ? 38  GLU B CG    1 
ATOM   3779 C  CD    . GLU F 3 39  ? -13.486 -5.713  -5.374  1.00 52.10  ? 38  GLU B CD    1 
ATOM   3780 O  OE1   . GLU F 3 39  ? -12.627 -6.073  -6.214  1.00 51.90  ? 38  GLU B OE1   1 
ATOM   3781 O  OE2   . GLU F 3 39  ? -14.727 -5.742  -5.599  1.00 52.52  ? 38  GLU B OE2   1 
ATOM   3782 N  N     . ASP F 3 40  ? -14.285 -3.711  -0.058  1.00 46.68  ? 39  ASP B N     1 
ATOM   3783 C  CA    . ASP F 3 40  ? -15.032 -3.241  1.095   1.00 45.28  ? 39  ASP B CA    1 
ATOM   3784 C  C     . ASP F 3 40  ? -14.220 -3.416  2.377   1.00 43.58  ? 39  ASP B C     1 
ATOM   3785 O  O     . ASP F 3 40  ? -14.438 -2.695  3.351   1.00 43.38  ? 39  ASP B O     1 
ATOM   3786 C  CB    . ASP F 3 40  ? -16.364 -3.984  1.209   1.00 45.50  ? 39  ASP B CB    1 
ATOM   3787 C  CG    . ASP F 3 40  ? -17.524 -3.192  0.637   1.00 46.99  ? 39  ASP B CG    1 
ATOM   3788 O  OD1   . ASP F 3 40  ? -18.668 -3.689  0.689   1.00 47.53  ? 39  ASP B OD1   1 
ATOM   3789 O  OD2   . ASP F 3 40  ? -17.291 -2.073  0.134   1.00 48.75  ? 39  ASP B OD2   1 
ATOM   3790 N  N     . SER F 3 41  ? -13.285 -4.367  2.387   1.00 41.61  ? 40  SER B N     1 
ATOM   3791 C  CA    . SER F 3 41  ? -12.466 -4.572  3.590   1.00 40.00  ? 40  SER B CA    1 
ATOM   3792 C  C     . SER F 3 41  ? -11.892 -3.214  4.032   1.00 37.94  ? 40  SER B C     1 
ATOM   3793 O  O     . SER F 3 41  ? -11.237 -2.509  3.237   1.00 38.84  ? 40  SER B O     1 
ATOM   3794 C  CB    . SER F 3 41  ? -11.333 -5.548  3.331   1.00 40.48  ? 40  SER B CB    1 
ATOM   3795 O  OG    . SER F 3 41  ? -10.107 -4.868  3.095   1.00 42.10  ? 40  SER B OG    1 
ATOM   3796 N  N     . GLY F 3 42  ? -12.159 -2.806  5.259   1.00 34.80  ? 41  GLY B N     1 
ATOM   3797 C  CA    . GLY F 3 42  ? -11.637 -1.519  5.658   1.00 32.04  ? 41  GLY B CA    1 
ATOM   3798 C  C     . GLY F 3 42  ? -12.405 -0.741  6.695   1.00 30.04  ? 41  GLY B C     1 
ATOM   3799 O  O     . GLY F 3 42  ? -13.205 -1.288  7.462   1.00 29.81  ? 41  GLY B O     1 
ATOM   3800 N  N     . ALA F 3 43  ? -12.114 0.548   6.742   1.00 28.24  ? 42  ALA B N     1 
ATOM   3801 C  CA    . ALA F 3 43  ? -12.630 1.403   7.801   1.00 26.60  ? 42  ALA B CA    1 
ATOM   3802 C  C     . ALA F 3 43  ? -12.910 2.815   7.336   1.00 24.41  ? 42  ALA B C     1 
ATOM   3803 O  O     . ALA F 3 43  ? -12.244 3.353   6.432   1.00 25.73  ? 42  ALA B O     1 
ATOM   3804 C  CB    . ALA F 3 43  ? -11.649 1.422   8.996   1.00 27.06  ? 42  ALA B CB    1 
ATOM   3805 N  N     . VAL F 3 44  ? -13.883 3.412   7.979   1.00 21.05  ? 43  VAL B N     1 
ATOM   3806 C  CA    . VAL F 3 44  ? -14.225 4.797   7.789   1.00 18.59  ? 43  VAL B CA    1 
ATOM   3807 C  C     . VAL F 3 44  ? -13.209 5.680   8.530   1.00 17.94  ? 43  VAL B C     1 
ATOM   3808 O  O     . VAL F 3 44  ? -12.914 5.538   9.759   1.00 16.97  ? 43  VAL B O     1 
ATOM   3809 C  CB    . VAL F 3 44  ? -15.662 5.052   8.343   1.00 18.35  ? 43  VAL B CB    1 
ATOM   3810 C  CG1   . VAL F 3 44  ? -16.012 6.495   8.356   1.00 17.62  ? 43  VAL B CG1   1 
ATOM   3811 C  CG2   . VAL F 3 44  ? -16.672 4.219   7.571   1.00 18.71  ? 43  VAL B CG2   1 
ATOM   3812 N  N     . ALA F 3 45  ? -12.710 6.641   7.807   1.00 16.97  ? 44  ALA B N     1 
ATOM   3813 C  CA    . ALA F 3 45  ? -11.787 7.601   8.412   1.00 16.60  ? 44  ALA B CA    1 
ATOM   3814 C  C     . ALA F 3 45  ? -12.567 8.873   8.859   1.00 15.85  ? 44  ALA B C     1 
ATOM   3815 O  O     . ALA F 3 45  ? -12.252 9.542   9.839   1.00 15.26  ? 44  ALA B O     1 
ATOM   3816 C  CB    . ALA F 3 45  ? -10.665 7.934   7.379   1.00 15.96  ? 44  ALA B CB    1 
ATOM   3817 N  N     . THR F 3 46  ? -13.598 9.200   8.106   1.00 15.68  ? 45  THR B N     1 
ATOM   3818 C  CA    . THR F 3 46  ? -14.358 10.413  8.383   1.00 15.45  ? 45  THR B CA    1 
ATOM   3819 C  C     . THR F 3 46  ? -15.663 10.474  7.586   1.00 14.70  ? 45  THR B C     1 
ATOM   3820 O  O     . THR F 3 46  ? -15.748 10.023  6.412   1.00 15.17  ? 45  THR B O     1 
ATOM   3821 C  CB    . THR F 3 46  ? -13.492 11.694  8.149   1.00 15.55  ? 45  THR B CB    1 
ATOM   3822 O  OG1   . THR F 3 46  ? -14.354 12.822  8.041   1.00 17.93  ? 45  THR B OG1   1 
ATOM   3823 C  CG2   . THR F 3 46  ? -12.857 11.622  6.869   1.00 16.96  ? 45  THR B CG2   1 
ATOM   3824 N  N     . ALA F 3 47  ? -16.648 11.084  8.211   1.00 13.46  ? 46  ALA B N     1 
ATOM   3825 C  CA    . ALA F 3 47  ? -17.991 11.199  7.696   1.00 13.86  ? 46  ALA B CA    1 
ATOM   3826 C  C     . ALA F 3 47  ? -18.534 12.629  7.840   1.00 14.76  ? 46  ALA B C     1 
ATOM   3827 O  O     . ALA F 3 47  ? -18.352 13.273  8.903   1.00 14.89  ? 46  ALA B O     1 
ATOM   3828 C  CB    . ALA F 3 47  ? -18.910 10.215  8.443   1.00 14.54  ? 46  ALA B CB    1 
ATOM   3829 N  N     . ASN F 3 48  ? -19.232 13.136  6.808   1.00 14.79  ? 47  ASN B N     1 
ATOM   3830 C  CA    . ASN F 3 48  ? -19.822 14.466  6.926   1.00 14.94  ? 47  ASN B CA    1 
ATOM   3831 C  C     . ASN F 3 48  ? -21.054 14.354  7.823   1.00 16.57  ? 47  ASN B C     1 
ATOM   3832 O  O     . ASN F 3 48  ? -21.454 13.234  8.200   1.00 16.78  ? 47  ASN B O     1 
ATOM   3833 C  CB    . ASN F 3 48  ? -20.114 15.113  5.578   1.00 14.08  ? 47  ASN B CB    1 
ATOM   3834 C  CG    . ASN F 3 48  ? -21.287 14.476  4.825   1.00 14.02  ? 47  ASN B CG    1 
ATOM   3835 O  OD1   . ASN F 3 48  ? -22.022 13.636  5.329   1.00 16.40  ? 47  ASN B OD1   1 
ATOM   3836 N  ND2   . ASN F 3 48  ? -21.449 14.884  3.605   1.00 13.95  ? 47  ASN B ND2   1 
ATOM   3837 N  N     . TYR F 3 49  ? -21.651 15.484  8.175   1.00 17.41  ? 48  TYR B N     1 
ATOM   3838 C  CA    . TYR F 3 49  ? -22.704 15.441  9.160   1.00 18.66  ? 48  TYR B CA    1 
ATOM   3839 C  C     . TYR F 3 49  ? -23.929 14.688  8.731   1.00 18.73  ? 48  TYR B C     1 
ATOM   3840 O  O     . TYR F 3 49  ? -24.604 14.062  9.573   1.00 18.76  ? 48  TYR B O     1 
ATOM   3841 C  CB    . TYR F 3 49  ? -23.025 16.833  9.689   1.00 18.34  ? 48  TYR B CB    1 
ATOM   3842 C  CG    . TYR F 3 49  ? -21.999 17.131  10.713  1.00 20.38  ? 48  TYR B CG    1 
ATOM   3843 C  CD1   . TYR F 3 49  ? -20.752 17.599  10.336  1.00 23.19  ? 48  TYR B CD1   1 
ATOM   3844 C  CD2   . TYR F 3 49  ? -22.228 16.888  12.071  1.00 21.27  ? 48  TYR B CD2   1 
ATOM   3845 C  CE1   . TYR F 3 49  ? -19.754 17.847  11.285  1.00 23.80  ? 48  TYR B CE1   1 
ATOM   3846 C  CE2   . TYR F 3 49  ? -21.250 17.136  13.002  1.00 21.88  ? 48  TYR B CE2   1 
ATOM   3847 C  CZ    . TYR F 3 49  ? -20.018 17.618  12.601  1.00 21.83  ? 48  TYR B CZ    1 
ATOM   3848 O  OH    . TYR F 3 49  ? -19.026 17.892  13.499  1.00 20.76  ? 48  TYR B OH    1 
ATOM   3849 N  N     . GLU F 3 50  ? -24.179 14.725  7.429   1.00 18.53  ? 49  GLU B N     1 
ATOM   3850 C  CA    . GLU F 3 50  ? -25.314 14.028  6.831   1.00 18.75  ? 49  GLU B CA    1 
ATOM   3851 C  C     . GLU F 3 50  ? -25.066 12.567  7.023   1.00 18.40  ? 49  GLU B C     1 
ATOM   3852 O  O     . GLU F 3 50  ? -25.980 11.801  7.289   1.00 18.09  ? 49  GLU B O     1 
ATOM   3853 C  CB    . GLU F 3 50  ? -25.470 14.337  5.312   1.00 18.95  ? 49  GLU B CB    1 
ATOM   3854 C  CG    . GLU F 3 50  ? -25.897 15.796  4.973   1.00 20.22  ? 49  GLU B CG    1 
ATOM   3855 C  CD    . GLU F 3 50  ? -24.782 16.813  5.285   1.00 26.28  ? 49  GLU B CD    1 
ATOM   3856 O  OE1   . GLU F 3 50  ? -23.631 16.363  5.568   1.00 27.02  ? 49  GLU B OE1   1 
ATOM   3857 O  OE2   . GLU F 3 50  ? -25.044 18.067  5.252   1.00 30.08  ? 49  GLU B OE2   1 
ATOM   3858 N  N     . ALA F 3 51  ? -23.807 12.160  6.888   1.00 18.97  ? 50  ALA B N     1 
ATOM   3859 C  CA    . ALA F 3 51  ? -23.493 10.762  7.209   1.00 18.80  ? 50  ALA B CA    1 
ATOM   3860 C  C     . ALA F 3 51  ? -23.582 10.471  8.708   1.00 18.09  ? 50  ALA B C     1 
ATOM   3861 O  O     . ALA F 3 51  ? -24.208 9.503   9.074   1.00 19.65  ? 50  ALA B O     1 
ATOM   3862 C  CB    . ALA F 3 51  ? -22.170 10.293  6.602   1.00 18.00  ? 50  ALA B CB    1 
ATOM   3863 N  N     . ARG F 3 52  ? -22.964 11.283  9.558   1.00 17.98  ? 51  ARG B N     1 
ATOM   3864 C  CA    . ARG F 3 52  ? -23.009 11.023  10.997  1.00 18.77  ? 51  ARG B CA    1 
ATOM   3865 C  C     . ARG F 3 52  ? -24.414 10.620  11.457  1.00 18.78  ? 51  ARG B C     1 
ATOM   3866 O  O     . ARG F 3 52  ? -24.601 9.604   12.126  1.00 18.95  ? 51  ARG B O     1 
ATOM   3867 C  CB    . ARG F 3 52  ? -22.531 12.248  11.779  1.00 18.63  ? 51  ARG B CB    1 
ATOM   3868 C  CG    . ARG F 3 52  ? -21.335 12.952  11.157  1.00 18.95  ? 51  ARG B CG    1 
ATOM   3869 C  CD    . ARG F 3 52  ? -20.298 13.311  12.209  1.00 19.90  ? 51  ARG B CD    1 
ATOM   3870 N  NE    . ARG F 3 52  ? -18.982 13.545  11.621  1.00 19.12  ? 51  ARG B NE    1 
ATOM   3871 C  CZ    . ARG F 3 52  ? -18.077 14.378  12.124  1.00 18.77  ? 51  ARG B CZ    1 
ATOM   3872 N  NH1   . ARG F 3 52  ? -18.343 15.061  13.230  1.00 18.48  ? 51  ARG B NH1   1 
ATOM   3873 N  NH2   . ARG F 3 52  ? -16.905 14.530  11.522  1.00 14.64  ? 51  ARG B NH2   1 
ATOM   3874 N  N     . LYS F 3 53  ? -25.390 11.440  11.085  1.00 19.12  ? 52  LYS B N     1 
ATOM   3875 C  CA    . LYS F 3 53  ? -26.817 11.258  11.429  1.00 20.67  ? 52  LYS B CA    1 
ATOM   3876 C  C     . LYS F 3 53  ? -27.311 9.814   11.409  1.00 21.07  ? 52  LYS B C     1 
ATOM   3877 O  O     . LYS F 3 53  ? -28.157 9.430   12.235  1.00 21.42  ? 52  LYS B O     1 
ATOM   3878 C  CB    . LYS F 3 53  ? -27.733 12.093  10.503  1.00 20.85  ? 52  LYS B CB    1 
ATOM   3879 C  CG    . LYS F 3 53  ? -27.721 13.598  10.837  1.00 22.03  ? 52  LYS B CG    1 
ATOM   3880 C  CD    . LYS F 3 53  ? -28.759 14.417  10.076  1.00 25.04  ? 52  LYS B CD    1 
ATOM   3881 C  CE    . LYS F 3 53  ? -28.756 14.170  8.561   1.00 24.51  ? 52  LYS B CE    1 
ATOM   3882 N  NZ    . LYS F 3 53  ? -29.463 15.298  7.881   1.00 26.15  ? 52  LYS B NZ    1 
ATOM   3883 N  N     . PHE F 3 54  ? -26.812 9.026   10.458  1.00 21.15  ? 53  PHE B N     1 
ATOM   3884 C  CA    . PHE F 3 54  ? -27.254 7.640   10.316  1.00 20.87  ? 53  PHE B CA    1 
ATOM   3885 C  C     . PHE F 3 54  ? -26.261 6.686   10.978  1.00 21.48  ? 53  PHE B C     1 
ATOM   3886 O  O     . PHE F 3 54  ? -26.376 5.462   10.872  1.00 21.86  ? 53  PHE B O     1 
ATOM   3887 C  CB    . PHE F 3 54  ? -27.505 7.301   8.846   1.00 20.87  ? 53  PHE B CB    1 
ATOM   3888 C  CG    . PHE F 3 54  ? -28.634 8.089   8.256   1.00 19.54  ? 53  PHE B CG    1 
ATOM   3889 C  CD1   . PHE F 3 54  ? -29.962 7.611   8.362   1.00 20.59  ? 53  PHE B CD1   1 
ATOM   3890 C  CD2   . PHE F 3 54  ? -28.393 9.313   7.661   1.00 16.72  ? 53  PHE B CD2   1 
ATOM   3891 C  CE1   . PHE F 3 54  ? -31.031 8.339   7.881   1.00 19.62  ? 53  PHE B CE1   1 
ATOM   3892 C  CE2   . PHE F 3 54  ? -29.423 10.074  7.179   1.00 19.83  ? 53  PHE B CE2   1 
ATOM   3893 C  CZ    . PHE F 3 54  ? -30.779 9.595   7.275   1.00 22.50  ? 53  PHE B CZ    1 
ATOM   3894 N  N     . GLY F 3 55  ? -25.278 7.236   11.676  1.00 21.89  ? 54  GLY B N     1 
ATOM   3895 C  CA    . GLY F 3 55  ? -24.415 6.397   12.511  1.00 21.95  ? 54  GLY B CA    1 
ATOM   3896 C  C     . GLY F 3 55  ? -23.068 6.070   11.915  1.00 21.94  ? 54  GLY B C     1 
ATOM   3897 O  O     . GLY F 3 55  ? -22.222 5.470   12.567  1.00 22.16  ? 54  GLY B O     1 
ATOM   3898 N  N     . VAL F 3 56  ? -22.849 6.464   10.675  1.00 22.41  ? 55  VAL B N     1 
ATOM   3899 C  CA    . VAL F 3 56  ? -21.514 6.274   10.083  1.00 22.00  ? 55  VAL B CA    1 
ATOM   3900 C  C     . VAL F 3 56  ? -20.588 7.195   10.809  1.00 22.67  ? 55  VAL B C     1 
ATOM   3901 O  O     . VAL F 3 56  ? -20.869 8.370   10.949  1.00 22.95  ? 55  VAL B O     1 
ATOM   3902 C  CB    . VAL F 3 56  ? -21.516 6.490   8.525   1.00 21.44  ? 55  VAL B CB    1 
ATOM   3903 C  CG1   . VAL F 3 56  ? -20.122 6.344   7.922   1.00 19.13  ? 55  VAL B CG1   1 
ATOM   3904 C  CG2   . VAL F 3 56  ? -22.439 5.440   7.925   1.00 21.07  ? 55  VAL B CG2   1 
ATOM   3905 N  N     . LYS F 3 57  ? -19.491 6.655   11.323  1.00 24.18  ? 56  LYS B N     1 
ATOM   3906 C  CA    . LYS F 3 57  ? -18.539 7.472   12.073  1.00 25.13  ? 56  LYS B CA    1 
ATOM   3907 C  C     . LYS F 3 57  ? -17.131 6.949   11.866  1.00 24.38  ? 56  LYS B C     1 
ATOM   3908 O  O     . LYS F 3 57  ? -16.952 5.799   11.467  1.00 24.47  ? 56  LYS B O     1 
ATOM   3909 C  CB    . LYS F 3 57  ? -18.912 7.484   13.570  1.00 26.26  ? 56  LYS B CB    1 
ATOM   3910 C  CG    . LYS F 3 57  ? -19.225 6.081   14.129  1.00 29.56  ? 56  LYS B CG    1 
ATOM   3911 C  CD    . LYS F 3 57  ? -20.046 6.132   15.454  1.00 34.76  ? 56  LYS B CD    1 
ATOM   3912 C  CE    . LYS F 3 57  ? -19.144 6.246   16.654  1.00 38.72  ? 56  LYS B CE    1 
ATOM   3913 N  NZ    . LYS F 3 57  ? -18.192 5.065   16.755  1.00 42.80  ? 56  LYS B NZ    1 
ATOM   3914 N  N     . ALA F 3 58  ? -16.142 7.798   12.158  1.00 23.99  ? 57  ALA B N     1 
ATOM   3915 C  CA    . ALA F 3 58  ? -14.735 7.439   12.031  1.00 23.81  ? 57  ALA B CA    1 
ATOM   3916 C  C     . ALA F 3 58  ? -14.488 6.181   12.859  1.00 23.44  ? 57  ALA B C     1 
ATOM   3917 O  O     . ALA F 3 58  ? -14.887 6.097   13.990  1.00 23.03  ? 57  ALA B O     1 
ATOM   3918 C  CB    . ALA F 3 58  ? -13.843 8.577   12.466  1.00 22.80  ? 57  ALA B CB    1 
ATOM   3919 N  N     . GLY F 3 59  ? -13.885 5.172   12.255  1.00 24.19  ? 58  GLY B N     1 
ATOM   3920 C  CA    . GLY F 3 59  ? -13.560 3.968   13.003  1.00 24.03  ? 58  GLY B CA    1 
ATOM   3921 C  C     . GLY F 3 59  ? -14.303 2.728   12.603  1.00 24.37  ? 58  GLY B C     1 
ATOM   3922 O  O     . GLY F 3 59  ? -13.713 1.646   12.559  1.00 25.06  ? 58  GLY B O     1 
ATOM   3923 N  N     . ILE F 3 60  ? -15.595 2.844   12.287  1.00 24.44  ? 59  ILE B N     1 
ATOM   3924 C  CA    . ILE F 3 60  ? -16.373 1.616   12.022  1.00 24.10  ? 59  ILE B CA    1 
ATOM   3925 C  C     . ILE F 3 60  ? -15.937 0.929   10.745  1.00 24.28  ? 59  ILE B C     1 
ATOM   3926 O  O     . ILE F 3 60  ? -15.346 1.584   9.872   1.00 25.01  ? 59  ILE B O     1 
ATOM   3927 C  CB    . ILE F 3 60  ? -17.888 1.853   12.097  1.00 24.38  ? 59  ILE B CB    1 
ATOM   3928 C  CG1   . ILE F 3 60  ? -18.438 2.580   10.860  1.00 23.66  ? 59  ILE B CG1   1 
ATOM   3929 C  CG2   . ILE F 3 60  ? -18.202 2.571   13.442  1.00 23.57  ? 59  ILE B CG2   1 
ATOM   3930 C  CD1   . ILE F 3 60  ? -20.015 2.574   10.786  1.00 25.49  ? 59  ILE B CD1   1 
ATOM   3931 N  N     . PRO F 3 61  ? -16.165 -0.399  10.633  1.00 24.13  ? 60  PRO B N     1 
ATOM   3932 C  CA    . PRO F 3 61  ? -15.920 -1.035  9.334   1.00 23.52  ? 60  PRO B CA    1 
ATOM   3933 C  C     . PRO F 3 61  ? -16.835 -0.494  8.230   1.00 23.77  ? 60  PRO B C     1 
ATOM   3934 O  O     . PRO F 3 61  ? -18.009 -0.122  8.481   1.00 23.59  ? 60  PRO B O     1 
ATOM   3935 C  CB    . PRO F 3 61  ? -16.211 -2.509  9.603   1.00 23.26  ? 60  PRO B CB    1 
ATOM   3936 C  CG    . PRO F 3 61  ? -16.142 -2.674  11.042  1.00 23.30  ? 60  PRO B CG    1 
ATOM   3937 C  CD    . PRO F 3 61  ? -16.470 -1.390  11.685  1.00 24.01  ? 60  PRO B CD    1 
ATOM   3938 N  N     . ILE F 3 62  ? -16.305 -0.444  7.016   1.00 24.25  ? 61  ILE B N     1 
ATOM   3939 C  CA    . ILE F 3 62  ? -17.081 -0.014  5.857   1.00 25.15  ? 61  ILE B CA    1 
ATOM   3940 C  C     . ILE F 3 62  ? -18.278 -0.944  5.714   1.00 26.15  ? 61  ILE B C     1 
ATOM   3941 O  O     . ILE F 3 62  ? -19.389 -0.500  5.530   1.00 26.50  ? 61  ILE B O     1 
ATOM   3942 C  CB    . ILE F 3 62  ? -16.243 -0.051  4.570   1.00 25.05  ? 61  ILE B CB    1 
ATOM   3943 C  CG1   . ILE F 3 62  ? -15.086 0.955   4.630   1.00 24.77  ? 61  ILE B CG1   1 
ATOM   3944 C  CG2   . ILE F 3 62  ? -17.099 0.198   3.363   1.00 24.60  ? 61  ILE B CG2   1 
ATOM   3945 C  CD1   . ILE F 3 62  ? -13.924 0.638   3.643   1.00 22.25  ? 61  ILE B CD1   1 
ATOM   3946 N  N     . VAL F 3 63  ? -18.043 -2.242  5.832   1.00 27.39  ? 62  VAL B N     1 
ATOM   3947 C  CA    . VAL F 3 63  ? -19.098 -3.226  5.708   1.00 28.83  ? 62  VAL B CA    1 
ATOM   3948 C  C     . VAL F 3 63  ? -20.268 -2.934  6.653   1.00 28.95  ? 62  VAL B C     1 
ATOM   3949 O  O     . VAL F 3 63  ? -21.401 -3.277  6.341   1.00 29.38  ? 62  VAL B O     1 
ATOM   3950 C  CB    . VAL F 3 63  ? -18.529 -4.688  5.867   1.00 29.69  ? 62  VAL B CB    1 
ATOM   3951 C  CG1   . VAL F 3 63  ? -19.574 -5.679  6.447   1.00 29.77  ? 62  VAL B CG1   1 
ATOM   3952 C  CG2   . VAL F 3 63  ? -17.947 -5.187  4.505   1.00 29.59  ? 62  VAL B CG2   1 
ATOM   3953 N  N     . GLU F 3 64  ? -19.985 -2.267  7.771   1.00 28.80  ? 63  GLU B N     1 
ATOM   3954 C  CA    . GLU F 3 64  ? -21.007 -1.771  8.699   1.00 29.18  ? 63  GLU B CA    1 
ATOM   3955 C  C     . GLU F 3 64  ? -21.681 -0.431  8.333   1.00 28.36  ? 63  GLU B C     1 
ATOM   3956 O  O     . GLU F 3 64  ? -22.914 -0.337  8.388   1.00 26.98  ? 63  GLU B O     1 
ATOM   3957 C  CB    . GLU F 3 64  ? -20.420 -1.664  10.096  1.00 30.16  ? 63  GLU B CB    1 
ATOM   3958 C  CG    . GLU F 3 64  ? -20.432 -2.990  10.819  1.00 33.82  ? 63  GLU B CG    1 
ATOM   3959 C  CD    . GLU F 3 64  ? -21.714 -3.205  11.594  1.00 35.37  ? 63  GLU B CD    1 
ATOM   3960 O  OE1   . GLU F 3 64  ? -21.785 -4.215  12.310  1.00 36.02  ? 63  GLU B OE1   1 
ATOM   3961 O  OE2   . GLU F 3 64  ? -22.615 -2.337  11.512  1.00 36.18  ? 63  GLU B OE2   1 
ATOM   3962 N  N     . ALA F 3 65  ? -20.867 0.594   8.016   1.00 27.38  ? 64  ALA B N     1 
ATOM   3963 C  CA    . ALA F 3 65  ? -21.353 1.805   7.368   1.00 26.63  ? 64  ALA B CA    1 
ATOM   3964 C  C     . ALA F 3 65  ? -22.379 1.453   6.273   1.00 26.34  ? 64  ALA B C     1 
ATOM   3965 O  O     . ALA F 3 65  ? -23.494 2.021   6.227   1.00 25.15  ? 64  ALA B O     1 
ATOM   3966 C  CB    . ALA F 3 65  ? -20.188 2.650   6.783   1.00 26.10  ? 64  ALA B CB    1 
ATOM   3967 N  N     . LYS F 3 66  ? -22.014 0.500   5.423   1.00 26.09  ? 65  LYS B N     1 
ATOM   3968 C  CA    . LYS F 3 66  ? -22.851 0.147   4.294   1.00 27.11  ? 65  LYS B CA    1 
ATOM   3969 C  C     . LYS F 3 66  ? -24.155 -0.534  4.733   1.00 27.19  ? 65  LYS B C     1 
ATOM   3970 O  O     . LYS F 3 66  ? -25.147 -0.424  4.013   1.00 27.08  ? 65  LYS B O     1 
ATOM   3971 C  CB    . LYS F 3 66  ? -22.105 -0.736  3.266   1.00 27.82  ? 65  LYS B CB    1 
ATOM   3972 C  CG    . LYS F 3 66  ? -20.879 -0.120  2.560   1.00 28.67  ? 65  LYS B CG    1 
ATOM   3973 C  CD    . LYS F 3 66  ? -21.280 0.578   1.279   1.00 29.84  ? 65  LYS B CD    1 
ATOM   3974 C  CE    . LYS F 3 66  ? -20.105 0.754   0.303   1.00 30.95  ? 65  LYS B CE    1 
ATOM   3975 N  NZ    . LYS F 3 66  ? -20.573 0.763   -1.160  1.00 31.16  ? 65  LYS B NZ    1 
ATOM   3976 N  N     . LYS F 3 67  ? -24.157 -1.243  5.881   1.00 27.26  ? 66  LYS B N     1 
ATOM   3977 C  CA    . LYS F 3 67  ? -25.417 -1.847  6.414   1.00 27.32  ? 66  LYS B CA    1 
ATOM   3978 C  C     . LYS F 3 67  ? -26.388 -0.770  6.846   1.00 26.16  ? 66  LYS B C     1 
ATOM   3979 O  O     . LYS F 3 67  ? -27.622 -0.878  6.585   1.00 26.95  ? 66  LYS B O     1 
ATOM   3980 C  CB    . LYS F 3 67  ? -25.204 -2.825  7.595   1.00 28.26  ? 66  LYS B CB    1 
ATOM   3981 C  CG    . LYS F 3 67  ? -24.512 -4.183  7.271   1.00 30.36  ? 66  LYS B CG    1 
ATOM   3982 C  CD    . LYS F 3 67  ? -24.330 -5.003  8.580   1.00 33.57  ? 66  LYS B CD    1 
ATOM   3983 C  CE    . LYS F 3 67  ? -23.453 -6.233  8.419   1.00 34.69  ? 66  LYS B CE    1 
ATOM   3984 N  NZ    . LYS F 3 67  ? -22.004 -5.849  8.581   1.00 36.35  ? 66  LYS B NZ    1 
ATOM   3985 N  N     . ILE F 3 68  ? -25.837 0.255   7.495   1.00 23.95  ? 67  ILE B N     1 
ATOM   3986 C  CA    . ILE F 3 68  ? -26.622 1.388   7.981   1.00 22.64  ? 67  ILE B CA    1 
ATOM   3987 C  C     . ILE F 3 68  ? -26.790 2.543   7.014   1.00 21.80  ? 67  ILE B C     1 
ATOM   3988 O  O     . ILE F 3 68  ? -27.724 3.301   7.144   1.00 22.17  ? 67  ILE B O     1 
ATOM   3989 C  CB    . ILE F 3 68  ? -26.139 1.923   9.380   1.00 22.85  ? 67  ILE B CB    1 
ATOM   3990 C  CG1   . ILE F 3 68  ? -24.707 2.442   9.339   1.00 22.25  ? 67  ILE B CG1   1 
ATOM   3991 C  CG2   . ILE F 3 68  ? -26.283 0.812   10.477  1.00 22.67  ? 67  ILE B CG2   1 
ATOM   3992 C  CD1   . ILE F 3 68  ? -24.278 3.098   10.635  1.00 21.31  ? 67  ILE B CD1   1 
ATOM   3993 N  N     . LEU F 3 69  ? -25.909 2.719   6.047   1.00 20.88  ? 68  LEU B N     1 
ATOM   3994 C  CA    . LEU F 3 69  ? -26.067 3.864   5.171   1.00 20.85  ? 68  LEU B CA    1 
ATOM   3995 C  C     . LEU F 3 69  ? -25.628 3.481   3.797   1.00 21.22  ? 68  LEU B C     1 
ATOM   3996 O  O     . LEU F 3 69  ? -24.684 4.024   3.315   1.00 20.66  ? 68  LEU B O     1 
ATOM   3997 C  CB    . LEU F 3 69  ? -25.236 5.058   5.660   1.00 20.05  ? 68  LEU B CB    1 
ATOM   3998 C  CG    . LEU F 3 69  ? -25.651 6.548   5.587   1.00 19.67  ? 68  LEU B CG    1 
ATOM   3999 C  CD1   . LEU F 3 69  ? -24.434 7.483   5.494   1.00 17.95  ? 68  LEU B CD1   1 
ATOM   4000 C  CD2   . LEU F 3 69  ? -26.565 6.889   4.526   1.00 17.29  ? 68  LEU B CD2   1 
ATOM   4001 N  N     . PRO F 3 70  ? -26.286 2.493   3.159   1.00 21.99  ? 69  PRO B N     1 
ATOM   4002 C  CA    . PRO F 3 70  ? -25.631 2.071   1.869   1.00 21.91  ? 69  PRO B CA    1 
ATOM   4003 C  C     . PRO F 3 70  ? -25.586 3.226   0.842   1.00 22.44  ? 69  PRO B C     1 
ATOM   4004 O  O     . PRO F 3 70  ? -24.734 3.217   -0.058  1.00 22.92  ? 69  PRO B O     1 
ATOM   4005 C  CB    . PRO F 3 70  ? -26.519 0.939   1.360   1.00 21.63  ? 69  PRO B CB    1 
ATOM   4006 C  CG    . PRO F 3 70  ? -27.901 1.226   1.980   1.00 21.36  ? 69  PRO B CG    1 
ATOM   4007 C  CD    . PRO F 3 70  ? -27.626 1.909   3.343   1.00 21.48  ? 69  PRO B CD    1 
ATOM   4008 N  N     . ASN F 3 71  ? -26.459 4.224   1.018   1.00 22.33  ? 70  ASN B N     1 
ATOM   4009 C  CA    . ASN F 3 71  ? -26.659 5.259   0.013   1.00 23.26  ? 70  ASN B CA    1 
ATOM   4010 C  C     . ASN F 3 71  ? -25.542 6.306   -0.193  1.00 22.82  ? 70  ASN B C     1 
ATOM   4011 O  O     . ASN F 3 71  ? -25.236 6.724   -1.316  1.00 25.24  ? 70  ASN B O     1 
ATOM   4012 C  CB    . ASN F 3 71  ? -28.007 5.922   0.168   1.00 23.16  ? 70  ASN B CB    1 
ATOM   4013 C  CG    . ASN F 3 71  ? -28.400 6.750   -1.040  1.00 22.98  ? 70  ASN B CG    1 
ATOM   4014 O  OD1   . ASN F 3 71  ? -29.374 7.486   -0.989  1.00 23.11  ? 70  ASN B OD1   1 
ATOM   4015 N  ND2   . ASN F 3 71  ? -27.639 6.659   -2.107  1.00 21.02  ? 70  ASN B ND2   1 
ATOM   4016 N  N     . ALA F 3 72  ? -24.959 6.736   0.922   1.00 20.80  ? 71  ALA B N     1 
ATOM   4017 C  CA    . ALA F 3 72  ? -23.960 7.800   0.926   1.00 19.89  ? 71  ALA B CA    1 
ATOM   4018 C  C     . ALA F 3 72  ? -22.865 7.598   -0.116  1.00 19.56  ? 71  ALA B C     1 
ATOM   4019 O  O     . ALA F 3 72  ? -22.809 6.567   -0.787  1.00 19.19  ? 71  ALA B O     1 
ATOM   4020 C  CB    . ALA F 3 72  ? -23.350 7.946   2.315   1.00 19.01  ? 71  ALA B CB    1 
ATOM   4021 N  N     . VAL F 3 73  ? -21.996 8.596   -0.241  1.00 19.45  ? 72  VAL B N     1 
ATOM   4022 C  CA    . VAL F 3 73  ? -20.887 8.543   -1.185  1.00 18.61  ? 72  VAL B CA    1 
ATOM   4023 C  C     . VAL F 3 73  ? -19.615 8.051   -0.503  1.00 18.49  ? 72  VAL B C     1 
ATOM   4024 O  O     . VAL F 3 73  ? -19.109 8.684   0.424   1.00 18.57  ? 72  VAL B O     1 
ATOM   4025 C  CB    . VAL F 3 73  ? -20.619 9.920   -1.820  1.00 18.69  ? 72  VAL B CB    1 
ATOM   4026 C  CG1   . VAL F 3 73  ? -19.303 9.904   -2.583  1.00 17.58  ? 72  VAL B CG1   1 
ATOM   4027 C  CG2   . VAL F 3 73  ? -21.769 10.316  -2.733  1.00 17.12  ? 72  VAL B CG2   1 
ATOM   4028 N  N     . TYR F 3 74  ? -19.107 6.916   -0.969  1.00 18.04  ? 73  TYR B N     1 
ATOM   4029 C  CA    . TYR F 3 74  ? -17.895 6.311   -0.401  1.00 16.73  ? 73  TYR B CA    1 
ATOM   4030 C  C     . TYR F 3 74  ? -16.671 6.588   -1.313  1.00 16.88  ? 73  TYR B C     1 
ATOM   4031 O  O     . TYR F 3 74  ? -16.579 6.129   -2.450  1.00 16.22  ? 73  TYR B O     1 
ATOM   4032 C  CB    . TYR F 3 74  ? -18.117 4.803   -0.264  1.00 16.53  ? 73  TYR B CB    1 
ATOM   4033 C  CG    . TYR F 3 74  ? -19.178 4.463   0.770   1.00 16.73  ? 73  TYR B CG    1 
ATOM   4034 C  CD1   . TYR F 3 74  ? -18.803 4.204   2.100   1.00 17.90  ? 73  TYR B CD1   1 
ATOM   4035 C  CD2   . TYR F 3 74  ? -20.531 4.488   0.460   1.00 13.24  ? 73  TYR B CD2   1 
ATOM   4036 C  CE1   . TYR F 3 74  ? -19.763 3.945   3.090   1.00 17.45  ? 73  TYR B CE1   1 
ATOM   4037 C  CE2   . TYR F 3 74  ? -21.505 4.225   1.449   1.00 15.12  ? 73  TYR B CE2   1 
ATOM   4038 C  CZ    . TYR F 3 74  ? -21.105 3.949   2.764   1.00 16.62  ? 73  TYR B CZ    1 
ATOM   4039 O  OH    . TYR F 3 74  ? -22.014 3.641   3.780   1.00 17.98  ? 73  TYR B OH    1 
ATOM   4040 N  N     . LEU F 3 75  ? -15.740 7.355   -0.783  1.00 17.12  ? 74  LEU B N     1 
ATOM   4041 C  CA    . LEU F 3 75  ? -14.574 7.771   -1.498  1.00 17.50  ? 74  LEU B CA    1 
ATOM   4042 C  C     . LEU F 3 75  ? -13.346 7.227   -0.822  1.00 18.40  ? 74  LEU B C     1 
ATOM   4043 O  O     . LEU F 3 75  ? -13.268 7.204   0.398   1.00 18.75  ? 74  LEU B O     1 
ATOM   4044 C  CB    . LEU F 3 75  ? -14.484 9.279   -1.435  1.00 17.55  ? 74  LEU B CB    1 
ATOM   4045 C  CG    . LEU F 3 75  ? -15.596 9.909   -2.243  1.00 17.87  ? 74  LEU B CG    1 
ATOM   4046 C  CD1   . LEU F 3 75  ? -15.635 11.329  -1.736  1.00 19.72  ? 74  LEU B CD1   1 
ATOM   4047 C  CD2   . LEU F 3 75  ? -15.327 9.731   -3.815  1.00 10.61  ? 74  LEU B CD2   1 
ATOM   4048 N  N     . PRO F 3 76  ? -12.359 6.806   -1.625  1.00 19.51  ? 75  PRO B N     1 
ATOM   4049 C  CA    . PRO F 3 76  ? -11.105 6.407   -1.029  1.00 20.28  ? 75  PRO B CA    1 
ATOM   4050 C  C     . PRO F 3 76  ? -10.402 7.629   -0.451  1.00 21.25  ? 75  PRO B C     1 
ATOM   4051 O  O     . PRO F 3 76  ? -10.525 8.716   -0.999  1.00 21.27  ? 75  PRO B O     1 
ATOM   4052 C  CB    . PRO F 3 76  ? -10.297 5.868   -2.238  1.00 20.19  ? 75  PRO B CB    1 
ATOM   4053 C  CG    . PRO F 3 76  ? -10.824 6.578   -3.384  1.00 19.15  ? 75  PRO B CG    1 
ATOM   4054 C  CD    . PRO F 3 76  ? -12.325 6.682   -3.102  1.00 18.67  ? 75  PRO B CD    1 
ATOM   4055 N  N     . MET F 3 77  ? -9.707  7.397   0.658   1.00 22.19  ? 76  MET B N     1 
ATOM   4056 C  CA    . MET F 3 77  ? -8.868  8.345   1.354   1.00 24.17  ? 76  MET B CA    1 
ATOM   4057 C  C     . MET F 3 77  ? -7.746  8.920   0.499   1.00 24.21  ? 76  MET B C     1 
ATOM   4058 O  O     . MET F 3 77  ? -6.903  8.202   0.016   1.00 24.38  ? 76  MET B O     1 
ATOM   4059 C  CB    . MET F 3 77  ? -8.173  7.610   2.489   1.00 25.08  ? 76  MET B CB    1 
ATOM   4060 C  CG    . MET F 3 77  ? -6.993  8.368   2.979   1.00 27.95  ? 76  MET B CG    1 
ATOM   4061 S  SD    . MET F 3 77  ? -7.390  9.098   4.557   1.00 34.26  ? 76  MET B SD    1 
ATOM   4062 C  CE    . MET F 3 77  ? -6.935  7.784   5.682   1.00 32.86  ? 76  MET B CE    1 
ATOM   4063 N  N     . ARG F 3 78  ? -7.768  10.236  0.316   1.00 24.34  ? 77  ARG B N     1 
ATOM   4064 C  CA    . ARG F 3 78  ? -6.711  10.933  -0.405  1.00 23.56  ? 77  ARG B CA    1 
ATOM   4065 C  C     . ARG F 3 78  ? -5.913  11.752  0.598   1.00 23.56  ? 77  ARG B C     1 
ATOM   4066 O  O     . ARG F 3 78  ? -6.123  12.956  0.741   1.00 25.21  ? 77  ARG B O     1 
ATOM   4067 C  CB    . ARG F 3 78  ? -7.302  11.842  -1.483  1.00 23.25  ? 77  ARG B CB    1 
ATOM   4068 C  CG    . ARG F 3 78  ? -8.047  11.100  -2.580  1.00 22.16  ? 77  ARG B CG    1 
ATOM   4069 C  CD    . ARG F 3 78  ? -8.060  11.896  -3.875  1.00 20.80  ? 77  ARG B CD    1 
ATOM   4070 N  NE    . ARG F 3 78  ? -9.252  12.731  -3.992  1.00 21.24  ? 77  ARG B NE    1 
ATOM   4071 C  CZ    . ARG F 3 78  ? -9.540  13.477  -5.053  1.00 20.81  ? 77  ARG B CZ    1 
ATOM   4072 N  NH1   . ARG F 3 78  ? -8.721  13.495  -6.096  1.00 21.99  ? 77  ARG B NH1   1 
ATOM   4073 N  NH2   . ARG F 3 78  ? -10.648 14.205  -5.073  1.00 18.92  ? 77  ARG B NH2   1 
ATOM   4074 N  N     . LYS F 3 79  ? -5.005  11.085  1.302   1.00 22.98  ? 78  LYS B N     1 
ATOM   4075 C  CA    . LYS F 3 79  ? -4.305  11.698  2.419   1.00 24.12  ? 78  LYS B CA    1 
ATOM   4076 C  C     . LYS F 3 79  ? -3.380  12.894  2.102   1.00 24.68  ? 78  LYS B C     1 
ATOM   4077 O  O     . LYS F 3 79  ? -3.254  13.802  2.931   1.00 25.34  ? 78  LYS B O     1 
ATOM   4078 C  CB    . LYS F 3 79  ? -3.550  10.593  3.183   1.00 24.36  ? 78  LYS B CB    1 
ATOM   4079 C  CG    . LYS F 3 79  ? -2.797  10.996  4.473   1.00 26.10  ? 78  LYS B CG    1 
ATOM   4080 C  CD    . LYS F 3 79  ? -3.692  11.192  5.687   1.00 28.23  ? 78  LYS B CD    1 
ATOM   4081 C  CE    . LYS F 3 79  ? -3.005  10.724  7.002   1.00 30.74  ? 78  LYS B CE    1 
ATOM   4082 N  NZ    . LYS F 3 79  ? -2.809  9.218   7.128   1.00 32.22  ? 78  LYS B NZ    1 
ATOM   4083 N  N     . GLU F 3 80  ? -2.768  12.913  0.915   1.00 24.96  ? 79  GLU B N     1 
ATOM   4084 C  CA    . GLU F 3 80  ? -1.793  13.948  0.543   1.00 25.40  ? 79  GLU B CA    1 
ATOM   4085 C  C     . GLU F 3 80  ? -2.436  15.211  0.016   1.00 24.75  ? 79  GLU B C     1 
ATOM   4086 O  O     . GLU F 3 80  ? -1.763  16.246  -0.188  1.00 25.98  ? 79  GLU B O     1 
ATOM   4087 C  CB    . GLU F 3 80  ? -0.810  13.423  -0.513  1.00 26.12  ? 79  GLU B CB    1 
ATOM   4088 C  CG    . GLU F 3 80  ? 0.508   12.920  0.068   1.00 30.87  ? 79  GLU B CG    1 
ATOM   4089 C  CD    . GLU F 3 80  ? 1.461   14.065  0.478   1.00 37.93  ? 79  GLU B CD    1 
ATOM   4090 O  OE1   . GLU F 3 80  ? 1.651   14.267  1.711   1.00 40.38  ? 79  GLU B OE1   1 
ATOM   4091 O  OE2   . GLU F 3 80  ? 2.025   14.759  -0.421  1.00 41.34  ? 79  GLU B OE2   1 
ATOM   4092 N  N     . VAL F 3 81  ? -3.735  15.120  -0.222  1.00 23.29  ? 80  VAL B N     1 
ATOM   4093 C  CA    . VAL F 3 81  ? -4.516  16.246  -0.741  1.00 20.85  ? 80  VAL B CA    1 
ATOM   4094 C  C     . VAL F 3 81  ? -5.031  16.997  0.508   1.00 19.70  ? 80  VAL B C     1 
ATOM   4095 O  O     . VAL F 3 81  ? -4.895  18.221  0.646   1.00 19.18  ? 80  VAL B O     1 
ATOM   4096 C  CB    . VAL F 3 81  ? -5.682  15.751  -1.646  1.00 20.36  ? 80  VAL B CB    1 
ATOM   4097 C  CG1   . VAL F 3 81  ? -6.626  16.859  -1.903  1.00 19.98  ? 80  VAL B CG1   1 
ATOM   4098 C  CG2   . VAL F 3 81  ? -5.156  15.147  -2.979  1.00 18.01  ? 80  VAL B CG2   1 
ATOM   4099 N  N     . TYR F 3 82  ? -5.613  16.236  1.412   1.00 18.61  ? 81  TYR B N     1 
ATOM   4100 C  CA    . TYR F 3 82  ? -5.951  16.706  2.753   1.00 18.15  ? 81  TYR B CA    1 
ATOM   4101 C  C     . TYR F 3 82  ? -4.712  17.392  3.418   1.00 18.23  ? 81  TYR B C     1 
ATOM   4102 O  O     . TYR F 3 82  ? -4.810  18.513  3.944   1.00 18.65  ? 81  TYR B O     1 
ATOM   4103 C  CB    . TYR F 3 82  ? -6.451  15.506  3.567   1.00 18.35  ? 81  TYR B CB    1 
ATOM   4104 C  CG    . TYR F 3 82  ? -7.423  14.562  2.825   1.00 17.90  ? 81  TYR B CG    1 
ATOM   4105 C  CD1   . TYR F 3 82  ? -8.171  14.992  1.735   1.00 18.84  ? 81  TYR B CD1   1 
ATOM   4106 C  CD2   . TYR F 3 82  ? -7.634  13.275  3.278   1.00 19.78  ? 81  TYR B CD2   1 
ATOM   4107 C  CE1   . TYR F 3 82  ? -9.088  14.142  1.106   1.00 20.33  ? 81  TYR B CE1   1 
ATOM   4108 C  CE2   . TYR F 3 82  ? -8.544  12.415  2.666   1.00 20.60  ? 81  TYR B CE2   1 
ATOM   4109 C  CZ    . TYR F 3 82  ? -9.263  12.845  1.578   1.00 20.90  ? 81  TYR B CZ    1 
ATOM   4110 O  OH    . TYR F 3 82  ? -10.148 11.974  0.953   1.00 22.23  ? 81  TYR B OH    1 
ATOM   4111 N  N     . GLN F 3 83  ? -3.536  16.765  3.357   1.00 18.13  ? 82  GLN B N     1 
ATOM   4112 C  CA    . GLN F 3 83  ? -2.276  17.422  3.835   1.00 17.74  ? 82  GLN B CA    1 
ATOM   4113 C  C     . GLN F 3 83  ? -1.918  18.739  3.128   1.00 17.41  ? 82  GLN B C     1 
ATOM   4114 O  O     . GLN F 3 83  ? -1.624  19.708  3.787   1.00 18.04  ? 82  GLN B O     1 
ATOM   4115 C  CB    . GLN F 3 83  ? -1.095  16.476  3.794   1.00 16.82  ? 82  GLN B CB    1 
ATOM   4116 C  CG    . GLN F 3 83  ? 0.078   16.974  4.553   1.00 20.53  ? 82  GLN B CG    1 
ATOM   4117 C  CD    . GLN F 3 83  ? -0.198  17.146  6.089   1.00 24.09  ? 82  GLN B CD    1 
ATOM   4118 O  OE1   . GLN F 3 83  ? -0.460  16.153  6.812   1.00 26.03  ? 82  GLN B OE1   1 
ATOM   4119 N  NE2   . GLN F 3 83  ? -0.122  18.409  6.578   1.00 22.81  ? 82  GLN B NE2   1 
ATOM   4120 N  N     . GLN F 3 84  ? -1.949  18.783  1.799   1.00 17.29  ? 83  GLN B N     1 
ATOM   4121 C  CA    . GLN F 3 84  ? -1.719  20.040  1.072   1.00 17.34  ? 83  GLN B CA    1 
ATOM   4122 C  C     . GLN F 3 84  ? -2.585  21.218  1.604   1.00 17.84  ? 83  GLN B C     1 
ATOM   4123 O  O     . GLN F 3 84  ? -2.084  22.339  1.904   1.00 19.53  ? 83  GLN B O     1 
ATOM   4124 C  CB    . GLN F 3 84  ? -1.976  19.839  -0.422  1.00 16.65  ? 83  GLN B CB    1 
ATOM   4125 C  CG    . GLN F 3 84  ? -0.946  19.002  -1.133  1.00 17.82  ? 83  GLN B CG    1 
ATOM   4126 C  CD    . GLN F 3 84  ? -1.413  18.487  -2.516  1.00 21.79  ? 83  GLN B CD    1 
ATOM   4127 O  OE1   . GLN F 3 84  ? -2.256  19.103  -3.216  1.00 22.25  ? 83  GLN B OE1   1 
ATOM   4128 N  NE2   . GLN F 3 84  ? -0.859  17.334  -2.916  1.00 23.39  ? 83  GLN B NE2   1 
ATOM   4129 N  N     . VAL F 3 85  ? -3.879  20.955  1.710   1.00 17.25  ? 84  VAL B N     1 
ATOM   4130 C  CA    . VAL F 3 85  ? -4.845  21.932  2.126   1.00 16.92  ? 84  VAL B CA    1 
ATOM   4131 C  C     . VAL F 3 85  ? -4.675  22.272  3.560   1.00 17.47  ? 84  VAL B C     1 
ATOM   4132 O  O     . VAL F 3 85  ? -4.823  23.434  3.889   1.00 18.10  ? 84  VAL B O     1 
ATOM   4133 C  CB    . VAL F 3 85  ? -6.243  21.396  1.948   1.00 17.22  ? 84  VAL B CB    1 
ATOM   4134 C  CG1   . VAL F 3 85  ? -7.255  22.410  2.493   1.00 15.15  ? 84  VAL B CG1   1 
ATOM   4135 C  CG2   . VAL F 3 85  ? -6.448  21.060  0.416   1.00 14.83  ? 84  VAL B CG2   1 
ATOM   4136 N  N     . SER F 3 86  ? -4.389  21.258  4.398   1.00 17.76  ? 85  SER B N     1 
ATOM   4137 C  CA    . SER F 3 86  ? -4.118  21.432  5.831   1.00 17.83  ? 85  SER B CA    1 
ATOM   4138 C  C     . SER F 3 86  ? -2.972  22.383  6.082   1.00 18.56  ? 85  SER B C     1 
ATOM   4139 O  O     . SER F 3 86  ? -3.035  23.218  6.977   1.00 19.00  ? 85  SER B O     1 
ATOM   4140 C  CB    . SER F 3 86  ? -3.781  20.110  6.530   1.00 17.37  ? 85  SER B CB    1 
ATOM   4141 O  OG    . SER F 3 86  ? -3.525  20.361  7.917   1.00 17.05  ? 85  SER B OG    1 
ATOM   4142 N  N     . SER F 3 87  ? -1.920  22.238  5.290   1.00 19.66  ? 86  SER B N     1 
ATOM   4143 C  CA    . SER F 3 87  ? -0.747  23.103  5.395   1.00 21.30  ? 86  SER B CA    1 
ATOM   4144 C  C     . SER F 3 87  ? -1.130  24.520  5.066   1.00 21.87  ? 86  SER B C     1 
ATOM   4145 O  O     . SER F 3 87  ? -0.829  25.427  5.848   1.00 23.01  ? 86  SER B O     1 
ATOM   4146 C  CB    . SER F 3 87  ? 0.362   22.650  4.447   1.00 21.02  ? 86  SER B CB    1 
ATOM   4147 O  OG    . SER F 3 87  ? 0.693   21.323  4.806   1.00 24.01  ? 86  SER B OG    1 
ATOM   4148 N  N     . ARG F 3 88  ? -1.779  24.715  3.913   1.00 21.55  ? 87  ARG B N     1 
ATOM   4149 C  CA    . ARG F 3 88  ? -2.106  26.066  3.504   1.00 21.78  ? 87  ARG B CA    1 
ATOM   4150 C  C     . ARG F 3 88  ? -2.956  26.732  4.571   1.00 22.28  ? 87  ARG B C     1 
ATOM   4151 O  O     . ARG F 3 88  ? -2.791  27.888  4.867   1.00 23.16  ? 87  ARG B O     1 
ATOM   4152 C  CB    . ARG F 3 88  ? -2.863  26.060  2.209   1.00 21.46  ? 87  ARG B CB    1 
ATOM   4153 C  CG    . ARG F 3 88  ? -2.042  25.712  1.026   1.00 21.00  ? 87  ARG B CG    1 
ATOM   4154 C  CD    . ARG F 3 88  ? -2.682  26.233  -0.233  1.00 19.74  ? 87  ARG B CD    1 
ATOM   4155 N  NE    . ARG F 3 88  ? -3.838  25.415  -0.608  1.00 21.62  ? 87  ARG B NE    1 
ATOM   4156 C  CZ    . ARG F 3 88  ? -3.733  24.287  -1.304  1.00 22.19  ? 87  ARG B CZ    1 
ATOM   4157 N  NH1   . ARG F 3 88  ? -2.523  23.861  -1.670  1.00 22.13  ? 87  ARG B NH1   1 
ATOM   4158 N  NH2   . ARG F 3 88  ? -4.823  23.587  -1.632  1.00 22.62  ? 87  ARG B NH2   1 
ATOM   4159 N  N     . ILE F 3 89  ? -3.865  25.980  5.167   1.00 22.56  ? 88  ILE B N     1 
ATOM   4160 C  CA    . ILE F 3 89  ? -4.629  26.526  6.255   1.00 22.61  ? 88  ILE B CA    1 
ATOM   4161 C  C     . ILE F 3 89  ? -3.750  26.869  7.446   1.00 23.16  ? 88  ILE B C     1 
ATOM   4162 O  O     . ILE F 3 89  ? -3.889  27.951  8.025   1.00 23.79  ? 88  ILE B O     1 
ATOM   4163 C  CB    . ILE F 3 89  ? -5.746  25.592  6.672   1.00 22.13  ? 88  ILE B CB    1 
ATOM   4164 C  CG1   . ILE F 3 89  ? -6.727  25.497  5.493   1.00 21.60  ? 88  ILE B CG1   1 
ATOM   4165 C  CG2   . ILE F 3 89  ? -6.334  26.125  7.941   1.00 20.13  ? 88  ILE B CG2   1 
ATOM   4166 C  CD1   . ILE F 3 89  ? -7.942  24.574  5.654   1.00 20.12  ? 88  ILE B CD1   1 
ATOM   4167 N  N     . MET F 3 90  ? -2.855  25.951  7.807   1.00 23.51  ? 89  MET B N     1 
ATOM   4168 C  CA    . MET F 3 90  ? -1.984  26.143  8.982   1.00 23.65  ? 89  MET B CA    1 
ATOM   4169 C  C     . MET F 3 90  ? -1.098  27.402  8.847   1.00 22.93  ? 89  MET B C     1 
ATOM   4170 O  O     . MET F 3 90  ? -0.887  28.108  9.805   1.00 22.76  ? 89  MET B O     1 
ATOM   4171 C  CB    . MET F 3 90  ? -1.139  24.874  9.243   1.00 23.94  ? 89  MET B CB    1 
ATOM   4172 C  CG    . MET F 3 90  ? -1.908  23.650  9.765   1.00 23.22  ? 89  MET B CG    1 
ATOM   4173 S  SD    . MET F 3 90  ? -2.982  23.923  11.210  1.00 27.13  ? 89  MET B SD    1 
ATOM   4174 C  CE    . MET F 3 90  ? -3.954  22.415  11.118  1.00 23.70  ? 89  MET B CE    1 
ATOM   4175 N  N     . ASN F 3 91  ? -0.603  27.663  7.647   1.00 22.97  ? 90  ASN B N     1 
ATOM   4176 C  CA    . ASN F 3 91  ? 0.088   28.933  7.311   1.00 24.22  ? 90  ASN B CA    1 
ATOM   4177 C  C     . ASN F 3 91  ? -0.759  30.212  7.488   1.00 24.53  ? 90  ASN B C     1 
ATOM   4178 O  O     . ASN F 3 91  ? -0.248  31.230  7.995   1.00 24.98  ? 90  ASN B O     1 
ATOM   4179 C  CB    . ASN F 3 91  ? 0.648   28.905  5.869   1.00 24.07  ? 90  ASN B CB    1 
ATOM   4180 C  CG    . ASN F 3 91  ? 1.599   27.743  5.634   1.00 25.52  ? 90  ASN B CG    1 
ATOM   4181 O  OD1   . ASN F 3 91  ? 1.822   26.892  6.514   1.00 27.85  ? 90  ASN B OD1   1 
ATOM   4182 N  ND2   . ASN F 3 91  ? 2.183   27.705  4.456   1.00 25.11  ? 90  ASN B ND2   1 
ATOM   4183 N  N     . LEU F 3 92  ? -2.023  30.178  7.038   1.00 24.43  ? 91  LEU B N     1 
ATOM   4184 C  CA    . LEU F 3 92  ? -2.943  31.258  7.349   1.00 25.02  ? 91  LEU B CA    1 
ATOM   4185 C  C     . LEU F 3 92  ? -2.938  31.534  8.871   1.00 26.20  ? 91  LEU B C     1 
ATOM   4186 O  O     . LEU F 3 92  ? -2.759  32.686  9.279   1.00 26.31  ? 91  LEU B O     1 
ATOM   4187 C  CB    . LEU F 3 92  ? -4.345  30.993  6.813   1.00 23.88  ? 91  LEU B CB    1 
ATOM   4188 C  CG    . LEU F 3 92  ? -4.539  30.878  5.294   1.00 24.40  ? 91  LEU B CG    1 
ATOM   4189 C  CD1   . LEU F 3 92  ? -6.008  30.513  4.965   1.00 24.49  ? 91  LEU B CD1   1 
ATOM   4190 C  CD2   . LEU F 3 92  ? -4.096  32.135  4.459   1.00 22.23  ? 91  LEU B CD2   1 
ATOM   4191 N  N     . LEU F 3 93  ? -3.090  30.486  9.696   1.00 27.19  ? 92  LEU B N     1 
ATOM   4192 C  CA    . LEU F 3 93  ? -3.072  30.639  11.173  1.00 28.01  ? 92  LEU B CA    1 
ATOM   4193 C  C     . LEU F 3 93  ? -1.787  31.223  11.693  1.00 29.47  ? 92  LEU B C     1 
ATOM   4194 O  O     . LEU F 3 93  ? -1.817  31.904  12.730  1.00 29.27  ? 92  LEU B O     1 
ATOM   4195 C  CB    . LEU F 3 93  ? -3.319  29.304  11.895  1.00 26.89  ? 92  LEU B CB    1 
ATOM   4196 C  CG    . LEU F 3 93  ? -4.642  28.726  11.457  1.00 25.95  ? 92  LEU B CG    1 
ATOM   4197 C  CD1   . LEU F 3 93  ? -4.763  27.318  11.928  1.00 25.31  ? 92  LEU B CD1   1 
ATOM   4198 C  CD2   . LEU F 3 93  ? -5.813  29.619  11.968  1.00 23.40  ? 92  LEU B CD2   1 
ATOM   4199 N  N     . ARG F 3 94  ? -0.667  30.934  11.001  1.00 31.33  ? 93  ARG B N     1 
ATOM   4200 C  CA    . ARG F 3 94  ? 0.653   31.551  11.357  1.00 33.15  ? 93  ARG B CA    1 
ATOM   4201 C  C     . ARG F 3 94  ? 0.702   33.064  11.200  1.00 33.63  ? 93  ARG B C     1 
ATOM   4202 O  O     . ARG F 3 94  ? 1.277   33.729  12.063  1.00 33.68  ? 93  ARG B O     1 
ATOM   4203 C  CB    . ARG F 3 94  ? 1.848   30.882  10.665  1.00 33.04  ? 93  ARG B CB    1 
ATOM   4204 C  CG    . ARG F 3 94  ? 2.335   29.662  11.448  1.00 35.05  ? 93  ARG B CG    1 
ATOM   4205 C  CD    . ARG F 3 94  ? 3.682   29.095  10.997  1.00 36.90  ? 93  ARG B CD    1 
ATOM   4206 N  NE    . ARG F 3 94  ? 3.566   27.963  10.075  1.00 37.61  ? 93  ARG B NE    1 
ATOM   4207 C  CZ    . ARG F 3 94  ? 3.161   26.735  10.405  1.00 37.75  ? 93  ARG B CZ    1 
ATOM   4208 N  NH1   . ARG F 3 94  ? 2.785   26.461  11.646  1.00 38.25  ? 93  ARG B NH1   1 
ATOM   4209 N  NH2   . ARG F 3 94  ? 3.127   25.769  9.484   1.00 37.20  ? 93  ARG B NH2   1 
ATOM   4210 N  N     . GLU F 3 95  ? 0.088   33.591  10.128  1.00 34.43  ? 94  GLU B N     1 
ATOM   4211 C  CA    . GLU F 3 95  ? -0.149  35.049  9.967   1.00 35.67  ? 94  GLU B CA    1 
ATOM   4212 C  C     . GLU F 3 95  ? -0.663  35.666  11.276  1.00 36.29  ? 94  GLU B C     1 
ATOM   4213 O  O     . GLU F 3 95  ? 0.013   36.508  11.856  1.00 36.79  ? 94  GLU B O     1 
ATOM   4214 C  CB    . GLU F 3 95  ? -1.101  35.385  8.797   1.00 35.32  ? 94  GLU B CB    1 
ATOM   4215 C  CG    . GLU F 3 95  ? -0.765  34.708  7.457   1.00 38.32  ? 94  GLU B CG    1 
ATOM   4216 C  CD    . GLU F 3 95  ? -0.909  35.625  6.197   1.00 41.42  ? 94  GLU B CD    1 
ATOM   4217 O  OE1   . GLU F 3 95  ? 0.024   36.451  5.934   1.00 42.87  ? 94  GLU B OE1   1 
ATOM   4218 O  OE2   . GLU F 3 95  ? -1.930  35.497  5.447   1.00 39.54  ? 94  GLU B OE2   1 
ATOM   4219 N  N     . TYR F 3 96  ? -1.820  35.183  11.751  1.00 36.71  ? 95  TYR B N     1 
ATOM   4220 C  CA    . TYR F 3 96  ? -2.535  35.643  12.979  1.00 36.80  ? 95  TYR B CA    1 
ATOM   4221 C  C     . TYR F 3 96  ? -1.795  35.555  14.339  1.00 36.83  ? 95  TYR B C     1 
ATOM   4222 O  O     . TYR F 3 96  ? -2.007  36.402  15.220  1.00 37.02  ? 95  TYR B O     1 
ATOM   4223 C  CB    . TYR F 3 96  ? -3.932  34.970  13.080  1.00 36.32  ? 95  TYR B CB    1 
ATOM   4224 C  CG    . TYR F 3 96  ? -4.932  35.433  12.009  1.00 36.67  ? 95  TYR B CG    1 
ATOM   4225 C  CD1   . TYR F 3 96  ? -5.842  36.487  12.259  1.00 35.89  ? 95  TYR B CD1   1 
ATOM   4226 C  CD2   . TYR F 3 96  ? -4.962  34.828  10.749  1.00 36.08  ? 95  TYR B CD2   1 
ATOM   4227 C  CE1   . TYR F 3 96  ? -6.752  36.912  11.290  1.00 36.23  ? 95  TYR B CE1   1 
ATOM   4228 C  CE2   . TYR F 3 96  ? -5.857  35.249  9.775   1.00 37.19  ? 95  TYR B CE2   1 
ATOM   4229 C  CZ    . TYR F 3 96  ? -6.754  36.293  10.049  1.00 37.58  ? 95  TYR B CZ    1 
ATOM   4230 O  OH    . TYR F 3 96  ? -7.635  36.696  9.062   1.00 38.91  ? 95  TYR B OH    1 
ATOM   4231 N  N     . SER F 3 97  ? -0.951  34.536  14.517  1.00 36.74  ? 96  SER B N     1 
ATOM   4232 C  CA    . SER F 3 97  ? -0.112  34.422  15.718  1.00 36.10  ? 96  SER B CA    1 
ATOM   4233 C  C     . SER F 3 97  ? 1.014   33.392  15.555  1.00 36.68  ? 96  SER B C     1 
ATOM   4234 O  O     . SER F 3 97  ? 0.756   32.293  15.048  1.00 36.34  ? 96  SER B O     1 
ATOM   4235 C  CB    . SER F 3 97  ? -0.954  34.065  16.927  1.00 35.59  ? 96  SER B CB    1 
ATOM   4236 O  OG    . SER F 3 97  ? -0.139  33.737  18.036  1.00 33.43  ? 96  SER B OG    1 
ATOM   4237 N  N     . GLU F 3 98  ? 2.238   33.774  15.992  1.00 37.15  ? 97  GLU B N     1 
ATOM   4238 C  CA    . GLU F 3 98  ? 3.474   32.926  16.013  1.00 36.97  ? 97  GLU B CA    1 
ATOM   4239 C  C     . GLU F 3 98  ? 3.356   31.752  16.992  1.00 36.30  ? 97  GLU B C     1 
ATOM   4240 O  O     . GLU F 3 98  ? 3.821   30.629  16.689  1.00 37.42  ? 97  GLU B O     1 
ATOM   4241 C  CB    . GLU F 3 98  ? 4.733   33.723  16.419  1.00 37.46  ? 97  GLU B CB    1 
ATOM   4242 C  CG    . GLU F 3 98  ? 4.791   35.247  16.045  1.00 39.41  ? 97  GLU B CG    1 
ATOM   4243 C  CD    . GLU F 3 98  ? 3.840   36.168  16.849  1.00 41.14  ? 97  GLU B CD    1 
ATOM   4244 O  OE1   . GLU F 3 98  ? 3.541   35.881  18.024  1.00 42.33  ? 97  GLU B OE1   1 
ATOM   4245 O  OE2   . GLU F 3 98  ? 3.401   37.201  16.295  1.00 42.10  ? 97  GLU B OE2   1 
ATOM   4246 N  N     . LYS F 3 99  ? 2.758   32.019  18.157  1.00 34.13  ? 98  LYS B N     1 
ATOM   4247 C  CA    . LYS F 3 99  ? 2.449   30.987  19.172  1.00 32.37  ? 98  LYS B CA    1 
ATOM   4248 C  C     . LYS F 3 99  ? 1.304   30.026  18.763  1.00 30.85  ? 98  LYS B C     1 
ATOM   4249 O  O     . LYS F 3 99  ? 0.133   30.249  19.083  1.00 30.75  ? 98  LYS B O     1 
ATOM   4250 C  CB    . LYS F 3 99  ? 2.101   31.655  20.509  1.00 32.48  ? 98  LYS B CB    1 
ATOM   4251 C  CG    . LYS F 3 99  ? 3.269   32.277  21.238  1.00 32.87  ? 98  LYS B CG    1 
ATOM   4252 C  CD    . LYS F 3 99  ? 2.825   32.877  22.567  1.00 33.58  ? 98  LYS B CD    1 
ATOM   4253 C  CE    . LYS F 3 99  ? 3.764   34.032  23.024  1.00 33.31  ? 98  LYS B CE    1 
ATOM   4254 N  NZ    . LYS F 3 99  ? 4.811   33.513  23.926  1.00 31.30  ? 98  LYS B NZ    1 
ATOM   4255 N  N     . ILE F 3 100 ? 1.667   28.952  18.065  1.00 28.73  ? 99  ILE B N     1 
ATOM   4256 C  CA    . ILE F 3 100 ? 0.723   28.016  17.489  1.00 25.44  ? 99  ILE B CA    1 
ATOM   4257 C  C     . ILE F 3 100 ? 1.191   26.586  17.726  1.00 24.31  ? 99  ILE B C     1 
ATOM   4258 O  O     . ILE F 3 100 ? 2.379   26.282  17.695  1.00 23.72  ? 99  ILE B O     1 
ATOM   4259 C  CB    . ILE F 3 100 ? 0.599   28.267  15.951  1.00 25.46  ? 99  ILE B CB    1 
ATOM   4260 C  CG1   . ILE F 3 100 ? -0.265  27.196  15.277  1.00 24.78  ? 99  ILE B CG1   1 
ATOM   4261 C  CG2   . ILE F 3 100 ? 1.945   28.306  15.312  1.00 23.42  ? 99  ILE B CG2   1 
ATOM   4262 C  CD1   . ILE F 3 100 ? -0.751  27.586  13.941  1.00 22.69  ? 99  ILE B CD1   1 
ATOM   4263 N  N     . GLU F 3 101 ? 0.229   25.705  17.917  1.00 23.09  ? 100 GLU B N     1 
ATOM   4264 C  CA    . GLU F 3 101 ? 0.467   24.339  18.253  1.00 22.22  ? 100 GLU B CA    1 
ATOM   4265 C  C     . GLU F 3 101 ? -0.510  23.557  17.392  1.00 22.81  ? 100 GLU B C     1 
ATOM   4266 O  O     . GLU F 3 101 ? -1.710  23.501  17.695  1.00 23.54  ? 100 GLU B O     1 
ATOM   4267 C  CB    . GLU F 3 101 ? 0.189   24.168  19.733  1.00 21.55  ? 100 GLU B CB    1 
ATOM   4268 C  CG    . GLU F 3 101 ? -0.014  22.719  20.173  1.00 24.35  ? 100 GLU B CG    1 
ATOM   4269 C  CD    . GLU F 3 101 ? 0.230   22.427  21.663  1.00 25.36  ? 100 GLU B CD    1 
ATOM   4270 O  OE1   . GLU F 3 101 ? 0.207   23.333  22.524  1.00 24.43  ? 100 GLU B OE1   1 
ATOM   4271 O  OE2   . GLU F 3 101 ? 0.421   21.235  21.963  1.00 28.42  ? 100 GLU B OE2   1 
ATOM   4272 N  N     . ILE F 3 102 ? -0.010  23.063  16.254  1.00 23.21  ? 101 ILE B N     1 
ATOM   4273 C  CA    . ILE F 3 102 ? -0.682  22.103  15.383  1.00 22.86  ? 101 ILE B CA    1 
ATOM   4274 C  C     . ILE F 3 102 ? -0.816  20.831  16.204  1.00 23.17  ? 101 ILE B C     1 
ATOM   4275 O  O     . ILE F 3 102 ? 0.189   20.317  16.710  1.00 25.22  ? 101 ILE B O     1 
ATOM   4276 C  CB    . ILE F 3 102 ? 0.182   21.796  14.104  1.00 23.17  ? 101 ILE B CB    1 
ATOM   4277 C  CG1   . ILE F 3 102 ? 0.373   23.042  13.260  1.00 23.13  ? 101 ILE B CG1   1 
ATOM   4278 C  CG2   . ILE F 3 102 ? -0.485  20.707  13.155  1.00 23.36  ? 101 ILE B CG2   1 
ATOM   4279 C  CD1   . ILE F 3 102 ? 1.330   23.950  13.744  1.00 24.69  ? 101 ILE B CD1   1 
ATOM   4280 N  N     . ALA F 3 103 ? -2.033  20.326  16.367  1.00 22.15  ? 102 ALA B N     1 
ATOM   4281 C  CA    . ALA F 3 103 ? -2.254  19.191  17.255  1.00 21.37  ? 102 ALA B CA    1 
ATOM   4282 C  C     . ALA F 3 103 ? -2.559  17.963  16.402  1.00 21.33  ? 102 ALA B C     1 
ATOM   4283 O  O     . ALA F 3 103 ? -2.440  16.817  16.867  1.00 22.40  ? 102 ALA B O     1 
ATOM   4284 C  CB    . ALA F 3 103 ? -3.385  19.483  18.215  1.00 20.10  ? 102 ALA B CB    1 
ATOM   4285 N  N     . SER F 3 104 ? -2.975  18.182  15.166  1.00 19.97  ? 103 SER B N     1 
ATOM   4286 C  CA    . SER F 3 104 ? -3.294  17.070  14.287  1.00 19.31  ? 103 SER B CA    1 
ATOM   4287 C  C     . SER F 3 104 ? -3.316  17.597  12.874  1.00 19.21  ? 103 SER B C     1 
ATOM   4288 O  O     . SER F 3 104 ? -2.779  18.671  12.603  1.00 20.37  ? 103 SER B O     1 
ATOM   4289 C  CB    . SER F 3 104 ? -4.652  16.469  14.650  1.00 19.41  ? 103 SER B CB    1 
ATOM   4290 O  OG    . SER F 3 104 ? -5.712  17.277  14.170  1.00 22.54  ? 103 SER B OG    1 
ATOM   4291 N  N     . ILE F 3 105 ? -3.937  16.860  11.964  1.00 18.32  ? 104 ILE B N     1 
ATOM   4292 C  CA    . ILE F 3 105 ? -4.041  17.379  10.632  1.00 18.13  ? 104 ILE B CA    1 
ATOM   4293 C  C     . ILE F 3 105 ? -5.167  18.415  10.506  1.00 18.53  ? 104 ILE B C     1 
ATOM   4294 O  O     . ILE F 3 105 ? -5.118  19.247  9.603   1.00 19.06  ? 104 ILE B O     1 
ATOM   4295 C  CB    . ILE F 3 105 ? -4.165  16.251  9.628   1.00 17.78  ? 104 ILE B CB    1 
ATOM   4296 C  CG1   . ILE F 3 105 ? -3.920  16.781  8.222   1.00 17.86  ? 104 ILE B CG1   1 
ATOM   4297 C  CG2   . ILE F 3 105 ? -5.501  15.478  9.853   1.00 17.64  ? 104 ILE B CG2   1 
ATOM   4298 C  CD1   . ILE F 3 105 ? -3.724  15.680  7.186   1.00 19.31  ? 104 ILE B CD1   1 
ATOM   4299 N  N     . ASP F 3 106 ? -6.141  18.396  11.418  1.00 18.54  ? 105 ASP B N     1 
ATOM   4300 C  CA    . ASP F 3 106 ? -7.269  19.323  11.292  1.00 19.59  ? 105 ASP B CA    1 
ATOM   4301 C  C     . ASP F 3 106 ? -7.511  20.339  12.459  1.00 19.57  ? 105 ASP B C     1 
ATOM   4302 O  O     . ASP F 3 106 ? -8.653  20.801  12.642  1.00 20.38  ? 105 ASP B O     1 
ATOM   4303 C  CB    . ASP F 3 106 ? -8.592  18.572  10.906  1.00 20.06  ? 105 ASP B CB    1 
ATOM   4304 C  CG    . ASP F 3 106 ? -9.153  17.703  12.046  1.00 21.72  ? 105 ASP B CG    1 
ATOM   4305 O  OD1   . ASP F 3 106 ? -8.666  17.851  13.175  1.00 23.57  ? 105 ASP B OD1   1 
ATOM   4306 O  OD2   . ASP F 3 106 ? -10.084 16.858  11.829  1.00 26.70  ? 105 ASP B OD2   1 
ATOM   4307 N  N     . GLU F 3 107 ? -6.463  20.737  13.181  1.00 19.12  ? 106 GLU B N     1 
ATOM   4308 C  CA    . GLU F 3 107 ? -6.635  21.576  14.364  1.00 20.08  ? 106 GLU B CA    1 
ATOM   4309 C  C     . GLU F 3 107 ? -5.323  22.148  14.862  1.00 19.58  ? 106 GLU B C     1 
ATOM   4310 O  O     . GLU F 3 107 ? -4.261  21.622  14.569  1.00 20.00  ? 106 GLU B O     1 
ATOM   4311 C  CB    . GLU F 3 107 ? -7.388  20.819  15.519  1.00 21.40  ? 106 GLU B CB    1 
ATOM   4312 C  CG    . GLU F 3 107 ? -6.640  19.589  16.081  1.00 25.07  ? 106 GLU B CG    1 
ATOM   4313 C  CD    . GLU F 3 107 ? -7.362  18.853  17.159  1.00 29.23  ? 106 GLU B CD    1 
ATOM   4314 O  OE1   . GLU F 3 107 ? -6.767  18.641  18.228  1.00 30.16  ? 106 GLU B OE1   1 
ATOM   4315 O  OE2   . GLU F 3 107 ? -8.519  18.457  16.946  1.00 33.63  ? 106 GLU B OE2   1 
ATOM   4316 N  N     . ALA F 3 108 ? -5.405  23.245  15.613  1.00 19.44  ? 107 ALA B N     1 
ATOM   4317 C  CA    . ALA F 3 108 ? -4.217  24.042  15.974  1.00 19.17  ? 107 ALA B CA    1 
ATOM   4318 C  C     . ALA F 3 108 ? -4.666  24.946  17.092  1.00 19.14  ? 107 ALA B C     1 
ATOM   4319 O  O     . ALA F 3 108 ? -5.806  25.445  17.058  1.00 19.08  ? 107 ALA B O     1 
ATOM   4320 C  CB    . ALA F 3 108 ? -3.750  24.929  14.768  1.00 18.90  ? 107 ALA B CB    1 
ATOM   4321 N  N     . TYR F 3 109 ? -3.787  25.184  18.052  1.00 18.71  ? 108 TYR B N     1 
ATOM   4322 C  CA    . TYR F 3 109 ? -4.110  26.132  19.084  1.00 19.11  ? 108 TYR B CA    1 
ATOM   4323 C  C     . TYR F 3 109 ? -3.226  27.315  18.887  1.00 19.61  ? 108 TYR B C     1 
ATOM   4324 O  O     . TYR F 3 109 ? -2.038  27.177  18.810  1.00 19.35  ? 108 TYR B O     1 
ATOM   4325 C  CB    . TYR F 3 109 ? -3.890  25.607  20.520  1.00 18.48  ? 108 TYR B CB    1 
ATOM   4326 C  CG    . TYR F 3 109 ? -4.555  24.303  20.872  1.00 19.20  ? 108 TYR B CG    1 
ATOM   4327 C  CD1   . TYR F 3 109 ? -5.632  24.281  21.742  1.00 19.37  ? 108 TYR B CD1   1 
ATOM   4328 C  CD2   . TYR F 3 109 ? -4.096  23.080  20.356  1.00 21.43  ? 108 TYR B CD2   1 
ATOM   4329 C  CE1   . TYR F 3 109 ? -6.247  23.086  22.110  1.00 21.89  ? 108 TYR B CE1   1 
ATOM   4330 C  CE2   . TYR F 3 109 ? -4.735  21.856  20.724  1.00 22.64  ? 108 TYR B CE2   1 
ATOM   4331 C  CZ    . TYR F 3 109 ? -5.800  21.901  21.598  1.00 22.59  ? 108 TYR B CZ    1 
ATOM   4332 O  OH    . TYR F 3 109 ? -6.458  20.789  21.974  1.00 26.82  ? 108 TYR B OH    1 
ATOM   4333 N  N     . LEU F 3 110 ? -3.864  28.477  18.865  1.00 20.62  ? 109 LEU B N     1 
ATOM   4334 C  CA    . LEU F 3 110 ? -3.267  29.763  18.838  1.00 21.30  ? 109 LEU B CA    1 
ATOM   4335 C  C     . LEU F 3 110 ? -3.386  30.404  20.234  1.00 22.47  ? 109 LEU B C     1 
ATOM   4336 O  O     . LEU F 3 110 ? -4.490  30.525  20.792  1.00 22.65  ? 109 LEU B O     1 
ATOM   4337 C  CB    . LEU F 3 110 ? -3.998  30.583  17.772  1.00 20.60  ? 109 LEU B CB    1 
ATOM   4338 C  CG    . LEU F 3 110 ? -3.749  30.236  16.293  1.00 20.48  ? 109 LEU B CG    1 
ATOM   4339 C  CD1   . LEU F 3 110 ? -4.594  29.107  15.738  1.00 17.22  ? 109 LEU B CD1   1 
ATOM   4340 C  CD2   . LEU F 3 110 ? -4.062  31.493  15.493  1.00 21.98  ? 109 LEU B CD2   1 
ATOM   4341 N  N     . ASP F 3 111 ? -2.265  30.806  20.819  1.00 23.71  ? 110 ASP B N     1 
ATOM   4342 C  CA    . ASP F 3 111 ? -2.341  31.609  22.051  1.00 25.96  ? 110 ASP B CA    1 
ATOM   4343 C  C     . ASP F 3 111 ? -2.358  33.082  21.680  1.00 26.48  ? 110 ASP B C     1 
ATOM   4344 O  O     . ASP F 3 111 ? -1.416  33.567  21.091  1.00 27.73  ? 110 ASP B O     1 
ATOM   4345 C  CB    . ASP F 3 111 ? -1.177  31.326  23.003  1.00 26.15  ? 110 ASP B CB    1 
ATOM   4346 C  CG    . ASP F 3 111 ? -1.160  32.267  24.251  1.00 28.14  ? 110 ASP B CG    1 
ATOM   4347 O  OD1   . ASP F 3 111 ? -1.880  33.297  24.309  1.00 28.55  ? 110 ASP B OD1   1 
ATOM   4348 O  OD2   . ASP F 3 111 ? -0.396  31.950  25.193  1.00 29.74  ? 110 ASP B OD2   1 
ATOM   4349 N  N     . ILE F 3 112 ? -3.404  33.797  22.033  1.00 27.05  ? 111 ILE B N     1 
ATOM   4350 C  CA    . ILE F 3 112 ? -3.540  35.149  21.537  1.00 28.49  ? 111 ILE B CA    1 
ATOM   4351 C  C     . ILE F 3 112 ? -3.563  36.226  22.662  1.00 30.18  ? 111 ILE B C     1 
ATOM   4352 O  O     . ILE F 3 112 ? -4.228  37.263  22.523  1.00 30.46  ? 111 ILE B O     1 
ATOM   4353 C  CB    . ILE F 3 112 ? -4.794  35.270  20.605  1.00 28.09  ? 111 ILE B CB    1 
ATOM   4354 C  CG1   . ILE F 3 112 ? -6.076  34.877  21.344  1.00 27.46  ? 111 ILE B CG1   1 
ATOM   4355 C  CG2   . ILE F 3 112 ? -4.634  34.427  19.328  1.00 27.90  ? 111 ILE B CG2   1 
ATOM   4356 C  CD1   . ILE F 3 112 ? -7.366  35.425  20.729  1.00 25.59  ? 111 ILE B CD1   1 
ATOM   4357 N  N     . SER F 3 113 ? -2.834  36.002  23.759  1.00 31.91  ? 112 SER B N     1 
ATOM   4358 C  CA    . SER F 3 113 ? -2.869  36.950  24.878  1.00 33.65  ? 112 SER B CA    1 
ATOM   4359 C  C     . SER F 3 113 ? -2.250  38.321  24.528  1.00 35.32  ? 112 SER B C     1 
ATOM   4360 O  O     . SER F 3 113 ? -2.663  39.338  25.090  1.00 35.86  ? 112 SER B O     1 
ATOM   4361 C  CB    . SER F 3 113 ? -2.257  36.354  26.150  1.00 33.36  ? 112 SER B CB    1 
ATOM   4362 O  OG    . SER F 3 113 ? -2.789  35.073  26.426  1.00 32.12  ? 112 SER B OG    1 
ATOM   4363 N  N     . ASP F 3 114 ? -1.302  38.342  23.582  1.00 37.06  ? 113 ASP B N     1 
ATOM   4364 C  CA    . ASP F 3 114 ? -0.650  39.587  23.111  1.00 38.77  ? 113 ASP B CA    1 
ATOM   4365 C  C     . ASP F 3 114 ? -1.420  40.331  22.005  1.00 39.44  ? 113 ASP B C     1 
ATOM   4366 O  O     . ASP F 3 114 ? -1.266  41.540  21.818  1.00 39.39  ? 113 ASP B O     1 
ATOM   4367 C  CB    . ASP F 3 114 ? 0.747   39.305  22.535  1.00 39.08  ? 113 ASP B CB    1 
ATOM   4368 C  CG    . ASP F 3 114 ? 1.705   38.705  23.536  1.00 40.52  ? 113 ASP B CG    1 
ATOM   4369 O  OD1   . ASP F 3 114 ? 1.556   38.935  24.745  1.00 42.11  ? 113 ASP B OD1   1 
ATOM   4370 O  OD2   . ASP F 3 114 ? 2.639   37.992  23.103  1.00 43.22  ? 113 ASP B OD2   1 
ATOM   4371 N  N     . LYS F 3 115 ? -2.208  39.607  21.229  1.00 40.14  ? 114 LYS B N     1 
ATOM   4372 C  CA    . LYS F 3 115 ? -2.704  40.197  20.004  1.00 40.37  ? 114 LYS B CA    1 
ATOM   4373 C  C     . LYS F 3 115 ? -4.096  40.807  20.187  1.00 40.53  ? 114 LYS B C     1 
ATOM   4374 O  O     . LYS F 3 115 ? -4.516  41.644  19.387  1.00 40.72  ? 114 LYS B O     1 
ATOM   4375 C  CB    . LYS F 3 115 ? -2.589  39.194  18.842  1.00 40.48  ? 114 LYS B CB    1 
ATOM   4376 C  CG    . LYS F 3 115 ? -1.106  38.825  18.487  1.00 40.62  ? 114 LYS B CG    1 
ATOM   4377 C  CD    . LYS F 3 115 ? -0.581  39.521  17.203  1.00 40.63  ? 114 LYS B CD    1 
ATOM   4378 C  CE    . LYS F 3 115 ? -0.140  40.970  17.433  1.00 42.07  ? 114 LYS B CE    1 
ATOM   4379 N  NZ    . LYS F 3 115 ? 0.022   41.748  16.159  1.00 42.58  ? 114 LYS B NZ    1 
ATOM   4380 N  N     . VAL F 3 116 ? -4.798  40.397  21.243  1.00 40.72  ? 115 VAL B N     1 
ATOM   4381 C  CA    . VAL F 3 116 ? -6.075  41.005  21.641  1.00 41.21  ? 115 VAL B CA    1 
ATOM   4382 C  C     . VAL F 3 116 ? -6.178  41.005  23.141  1.00 42.08  ? 115 VAL B C     1 
ATOM   4383 O  O     . VAL F 3 116 ? -5.541  40.197  23.811  1.00 42.54  ? 115 VAL B O     1 
ATOM   4384 C  CB    . VAL F 3 116 ? -7.329  40.270  21.095  1.00 40.95  ? 115 VAL B CB    1 
ATOM   4385 C  CG1   . VAL F 3 116 ? -7.204  39.986  19.600  1.00 40.65  ? 115 VAL B CG1   1 
ATOM   4386 C  CG2   . VAL F 3 116 ? -7.652  39.008  21.903  1.00 39.65  ? 115 VAL B CG2   1 
ATOM   4387 N  N     . ARG F 3 117 ? -7.040  41.854  23.671  1.00 42.96  ? 116 ARG B N     1 
ATOM   4388 C  CA    . ARG F 3 117 ? -7.034  42.096  25.100  1.00 43.73  ? 116 ARG B CA    1 
ATOM   4389 C  C     . ARG F 3 117 ? -8.188  41.571  25.952  1.00 43.49  ? 116 ARG B C     1 
ATOM   4390 O  O     . ARG F 3 117 ? -8.145  41.716  27.176  1.00 43.92  ? 116 ARG B O     1 
ATOM   4391 C  CB    . ARG F 3 117 ? -6.853  43.587  25.340  1.00 44.46  ? 116 ARG B CB    1 
ATOM   4392 C  CG    . ARG F 3 117 ? -5.449  44.132  25.020  1.00 45.51  ? 116 ARG B CG    1 
ATOM   4393 C  CD    . ARG F 3 117 ? -5.251  45.462  25.755  1.00 47.89  ? 116 ARG B CD    1 
ATOM   4394 N  NE    . ARG F 3 117 ? -6.449  46.308  25.712  1.00 49.87  ? 116 ARG B NE    1 
ATOM   4395 C  CZ    . ARG F 3 117 ? -7.548  46.118  26.451  1.00 51.19  ? 116 ARG B CZ    1 
ATOM   4396 N  NH1   . ARG F 3 117 ? -7.626  45.094  27.307  1.00 51.19  ? 116 ARG B NH1   1 
ATOM   4397 N  NH2   . ARG F 3 117 ? -8.581  46.955  26.335  1.00 51.83  ? 116 ARG B NH2   1 
ATOM   4398 N  N     . ASP F 3 118 ? -9.200  40.964  25.329  1.00 43.00  ? 117 ASP B N     1 
ATOM   4399 C  CA    . ASP F 3 118 ? -10.308 40.310  26.062  1.00 42.57  ? 117 ASP B CA    1 
ATOM   4400 C  C     . ASP F 3 118 ? -11.223 39.514  25.120  1.00 41.95  ? 117 ASP B C     1 
ATOM   4401 O  O     . ASP F 3 118 ? -11.139 39.676  23.920  1.00 42.10  ? 117 ASP B O     1 
ATOM   4402 C  CB    . ASP F 3 118 ? -11.139 41.331  26.851  1.00 42.56  ? 117 ASP B CB    1 
ATOM   4403 C  CG    . ASP F 3 118 ? -12.046 42.144  25.959  1.00 43.01  ? 117 ASP B CG    1 
ATOM   4404 O  OD1   . ASP F 3 118 ? -11.571 42.623  24.902  1.00 42.29  ? 117 ASP B OD1   1 
ATOM   4405 O  OD2   . ASP F 3 118 ? -13.242 42.280  26.310  1.00 44.25  ? 117 ASP B OD2   1 
ATOM   4406 N  N     . TYR F 3 119 ? -12.115 38.697  25.681  1.00 41.44  ? 118 TYR B N     1 
ATOM   4407 C  CA    . TYR F 3 119 ? -12.901 37.713  24.917  1.00 40.98  ? 118 TYR B CA    1 
ATOM   4408 C  C     . TYR F 3 119 ? -13.666 38.265  23.703  1.00 40.89  ? 118 TYR B C     1 
ATOM   4409 O  O     . TYR F 3 119 ? -13.692 37.670  22.619  1.00 40.28  ? 118 TYR B O     1 
ATOM   4410 C  CB    . TYR F 3 119 ? -13.826 36.925  25.856  1.00 40.56  ? 118 TYR B CB    1 
ATOM   4411 C  CG    . TYR F 3 119 ? -13.082 35.846  26.614  1.00 40.04  ? 118 TYR B CG    1 
ATOM   4412 C  CD1   . TYR F 3 119 ? -12.135 35.051  25.970  1.00 40.12  ? 118 TYR B CD1   1 
ATOM   4413 C  CD2   . TYR F 3 119 ? -13.302 35.630  27.966  1.00 40.00  ? 118 TYR B CD2   1 
ATOM   4414 C  CE1   . TYR F 3 119 ? -11.441 34.063  26.639  1.00 38.59  ? 118 TYR B CE1   1 
ATOM   4415 C  CE2   . TYR F 3 119 ? -12.602 34.635  28.657  1.00 39.67  ? 118 TYR B CE2   1 
ATOM   4416 C  CZ    . TYR F 3 119 ? -11.673 33.855  27.971  1.00 39.01  ? 118 TYR B CZ    1 
ATOM   4417 O  OH    . TYR F 3 119 ? -10.961 32.880  28.626  1.00 38.57  ? 118 TYR B OH    1 
ATOM   4418 N  N     . ARG F 3 120 ? -14.272 39.424  23.905  1.00 40.87  ? 119 ARG B N     1 
ATOM   4419 C  CA    . ARG F 3 120 ? -15.023 40.121  22.874  1.00 40.50  ? 119 ARG B CA    1 
ATOM   4420 C  C     . ARG F 3 120 ? -14.152 40.323  21.608  1.00 39.60  ? 119 ARG B C     1 
ATOM   4421 O  O     . ARG F 3 120 ? -14.616 40.140  20.480  1.00 39.01  ? 119 ARG B O     1 
ATOM   4422 C  CB    . ARG F 3 120 ? -15.478 41.470  23.457  1.00 40.87  ? 119 ARG B CB    1 
ATOM   4423 C  CG    . ARG F 3 120 ? -16.879 41.948  23.096  1.00 42.30  ? 119 ARG B CG    1 
ATOM   4424 C  CD    . ARG F 3 120 ? -17.019 43.464  23.347  1.00 42.47  ? 119 ARG B CD    1 
ATOM   4425 N  NE    . ARG F 3 120 ? -15.934 44.141  22.652  1.00 44.51  ? 119 ARG B NE    1 
ATOM   4426 C  CZ    . ARG F 3 120 ? -15.927 44.462  21.358  1.00 45.97  ? 119 ARG B CZ    1 
ATOM   4427 N  NH1   . ARG F 3 120 ? -16.985 44.214  20.585  1.00 45.84  ? 119 ARG B NH1   1 
ATOM   4428 N  NH2   . ARG F 3 120 ? -14.854 45.058  20.836  1.00 46.58  ? 119 ARG B NH2   1 
ATOM   4429 N  N     . GLU F 3 121 ? -12.889 40.703  21.797  1.00 38.74  ? 120 GLU B N     1 
ATOM   4430 C  CA    . GLU F 3 121 ? -12.053 41.022  20.650  1.00 37.64  ? 120 GLU B CA    1 
ATOM   4431 C  C     . GLU F 3 121 ? -11.423 39.757  20.129  1.00 36.58  ? 120 GLU B C     1 
ATOM   4432 O  O     . GLU F 3 121 ? -11.188 39.642  18.926  1.00 36.57  ? 120 GLU B O     1 
ATOM   4433 C  CB    . GLU F 3 121 ? -11.039 42.114  20.967  1.00 38.19  ? 120 GLU B CB    1 
ATOM   4434 C  CG    . GLU F 3 121 ? -11.695 43.510  21.006  1.00 39.74  ? 120 GLU B CG    1 
ATOM   4435 C  CD    . GLU F 3 121 ? -10.768 44.610  21.525  1.00 42.10  ? 120 GLU B CD    1 
ATOM   4436 O  OE1   . GLU F 3 121 ? -9.725  44.271  22.132  1.00 43.51  ? 120 GLU B OE1   1 
ATOM   4437 O  OE2   . GLU F 3 121 ? -11.079 45.820  21.332  1.00 43.59  ? 120 GLU B OE2   1 
ATOM   4438 N  N     . ALA F 3 122 ? -11.218 38.778  21.014  1.00 35.07  ? 121 ALA B N     1 
ATOM   4439 C  CA    . ALA F 3 122 ? -10.880 37.393  20.578  1.00 33.73  ? 121 ALA B CA    1 
ATOM   4440 C  C     . ALA F 3 122 ? -11.918 36.805  19.605  1.00 32.53  ? 121 ALA B C     1 
ATOM   4441 O  O     . ALA F 3 122 ? -11.570 36.099  18.655  1.00 32.01  ? 121 ALA B O     1 
ATOM   4442 C  CB    . ALA F 3 122 ? -10.687 36.465  21.784  1.00 33.59  ? 121 ALA B CB    1 
ATOM   4443 N  N     . TYR F 3 123 ? -13.181 37.128  19.860  1.00 31.61  ? 122 TYR B N     1 
ATOM   4444 C  CA    . TYR F 3 123 ? -14.306 36.703  19.048  1.00 30.89  ? 122 TYR B CA    1 
ATOM   4445 C  C     . TYR F 3 123 ? -14.147 37.312  17.670  1.00 30.48  ? 122 TYR B C     1 
ATOM   4446 O  O     . TYR F 3 123 ? -13.972 36.592  16.678  1.00 30.75  ? 122 TYR B O     1 
ATOM   4447 C  CB    . TYR F 3 123 ? -15.609 37.110  19.716  1.00 30.17  ? 122 TYR B CB    1 
ATOM   4448 C  CG    . TYR F 3 123 ? -16.860 36.403  19.221  1.00 31.40  ? 122 TYR B CG    1 
ATOM   4449 C  CD1   . TYR F 3 123 ? -17.435 35.351  19.946  1.00 31.22  ? 122 TYR B CD1   1 
ATOM   4450 C  CD2   . TYR F 3 123 ? -17.510 36.818  18.042  1.00 31.60  ? 122 TYR B CD2   1 
ATOM   4451 C  CE1   . TYR F 3 123 ? -18.602 34.722  19.490  1.00 31.22  ? 122 TYR B CE1   1 
ATOM   4452 C  CE2   . TYR F 3 123 ? -18.669 36.201  17.587  1.00 30.70  ? 122 TYR B CE2   1 
ATOM   4453 C  CZ    . TYR F 3 123 ? -19.216 35.160  18.302  1.00 31.13  ? 122 TYR B CZ    1 
ATOM   4454 O  OH    . TYR F 3 123 ? -20.367 34.542  17.823  1.00 30.41  ? 122 TYR B OH    1 
ATOM   4455 N  N     . ASN F 3 124 ? -14.145 38.634  17.615  1.00 29.79  ? 123 ASN B N     1 
ATOM   4456 C  CA    . ASN F 3 124 ? -13.994 39.346  16.359  1.00 29.56  ? 123 ASN B CA    1 
ATOM   4457 C  C     . ASN F 3 124 ? -12.836 38.725  15.529  1.00 29.14  ? 123 ASN B C     1 
ATOM   4458 O  O     . ASN F 3 124 ? -13.034 38.292  14.374  1.00 29.03  ? 123 ASN B O     1 
ATOM   4459 C  CB    . ASN F 3 124 ? -13.788 40.842  16.638  1.00 29.88  ? 123 ASN B CB    1 
ATOM   4460 C  CG    . ASN F 3 124 ? -13.386 41.646  15.387  1.00 30.67  ? 123 ASN B CG    1 
ATOM   4461 O  OD1   . ASN F 3 124 ? -14.229 41.994  14.557  1.00 32.31  ? 123 ASN B OD1   1 
ATOM   4462 N  ND2   . ASN F 3 124 ? -12.115 41.982  15.289  1.00 29.93  ? 123 ASN B ND2   1 
ATOM   4463 N  N     . LEU F 3 125 ? -11.648 38.656  16.137  1.00 27.88  ? 124 LEU B N     1 
ATOM   4464 C  CA    . LEU F 3 125 ? -10.541 37.873  15.588  1.00 27.22  ? 124 LEU B CA    1 
ATOM   4465 C  C     . LEU F 3 125 ? -11.032 36.537  15.029  1.00 26.44  ? 124 LEU B C     1 
ATOM   4466 O  O     . LEU F 3 125 ? -10.808 36.229  13.853  1.00 26.44  ? 124 LEU B O     1 
ATOM   4467 C  CB    . LEU F 3 125 ? -9.459  37.620  16.636  1.00 26.72  ? 124 LEU B CB    1 
ATOM   4468 C  CG    . LEU F 3 125 ? -8.110  37.596  15.957  1.00 27.51  ? 124 LEU B CG    1 
ATOM   4469 C  CD1   . LEU F 3 125 ? -7.993  38.824  15.084  1.00 29.07  ? 124 LEU B CD1   1 
ATOM   4470 C  CD2   . LEU F 3 125 ? -6.996  37.595  16.988  1.00 28.63  ? 124 LEU B CD2   1 
ATOM   4471 N  N     . GLY F 3 126 ? -11.762 35.795  15.862  1.00 25.46  ? 125 GLY B N     1 
ATOM   4472 C  CA    . GLY F 3 126 ? -12.157 34.426  15.546  1.00 24.75  ? 125 GLY B CA    1 
ATOM   4473 C  C     . GLY F 3 126 ? -12.898 34.418  14.259  1.00 24.31  ? 125 GLY B C     1 
ATOM   4474 O  O     . GLY F 3 126 ? -12.876 33.434  13.499  1.00 23.91  ? 125 GLY B O     1 
ATOM   4475 N  N     . LEU F 3 127 ? -13.566 35.534  14.009  1.00 23.95  ? 126 LEU B N     1 
ATOM   4476 C  CA    . LEU F 3 127 ? -14.447 35.551  12.873  1.00 24.21  ? 126 LEU B CA    1 
ATOM   4477 C  C     . LEU F 3 127 ? -13.676 35.863  11.638  1.00 24.68  ? 126 LEU B C     1 
ATOM   4478 O  O     . LEU F 3 127 ? -14.040 35.368  10.571  1.00 25.10  ? 126 LEU B O     1 
ATOM   4479 C  CB    . LEU F 3 127 ? -15.624 36.474  13.067  1.00 24.22  ? 126 LEU B CB    1 
ATOM   4480 C  CG    . LEU F 3 127 ? -16.516 36.007  14.210  1.00 23.14  ? 126 LEU B CG    1 
ATOM   4481 C  CD1   . LEU F 3 127 ? -17.164 37.235  14.838  1.00 23.00  ? 126 LEU B CD1   1 
ATOM   4482 C  CD2   . LEU F 3 127 ? -17.532 35.004  13.743  1.00 21.50  ? 126 LEU B CD2   1 
ATOM   4483 N  N     . GLU F 3 128 ? -12.591 36.632  11.791  1.00 24.67  ? 127 GLU B N     1 
ATOM   4484 C  CA    . GLU F 3 128 ? -11.705 36.979  10.676  1.00 24.72  ? 127 GLU B CA    1 
ATOM   4485 C  C     . GLU F 3 128 ? -10.974 35.761  10.154  1.00 24.10  ? 127 GLU B C     1 
ATOM   4486 O  O     . GLU F 3 128 ? -10.613 35.661  8.985   1.00 23.69  ? 127 GLU B O     1 
ATOM   4487 C  CB    . GLU F 3 128 ? -10.675 37.987  11.129  1.00 25.46  ? 127 GLU B CB    1 
ATOM   4488 C  CG    . GLU F 3 128 ? -11.102 39.420  11.170  1.00 27.57  ? 127 GLU B CG    1 
ATOM   4489 C  CD    . GLU F 3 128 ? -9.911  40.279  11.511  1.00 33.50  ? 127 GLU B CD    1 
ATOM   4490 O  OE1   . GLU F 3 128 ? -9.617  40.405  12.718  1.00 36.30  ? 127 GLU B OE1   1 
ATOM   4491 O  OE2   . GLU F 3 128 ? -9.237  40.797  10.581  1.00 35.07  ? 127 GLU B OE2   1 
ATOM   4492 N  N     . ILE F 3 129 ? -10.750 34.826  11.058  1.00 24.72  ? 128 ILE B N     1 
ATOM   4493 C  CA    . ILE F 3 129 ? -10.039 33.610  10.725  1.00 24.34  ? 128 ILE B CA    1 
ATOM   4494 C  C     . ILE F 3 129 ? -10.986 32.770  9.892   1.00 24.05  ? 128 ILE B C     1 
ATOM   4495 O  O     . ILE F 3 129 ? -10.700 32.505  8.715   1.00 24.69  ? 128 ILE B O     1 
ATOM   4496 C  CB    . ILE F 3 129 ? -9.507  32.934  12.004  1.00 24.48  ? 128 ILE B CB    1 
ATOM   4497 C  CG1   . ILE F 3 129 ? -8.446  33.841  12.661  1.00 24.37  ? 128 ILE B CG1   1 
ATOM   4498 C  CG2   . ILE F 3 129 ? -8.944  31.515  11.698  1.00 23.79  ? 128 ILE B CG2   1 
ATOM   4499 C  CD1   . ILE F 3 129 ? -8.030  33.383  14.074  1.00 22.37  ? 128 ILE B CD1   1 
ATOM   4500 N  N     . LYS F 3 130 ? -12.136 32.415  10.468  1.00 23.32  ? 129 LYS B N     1 
ATOM   4501 C  CA    . LYS F 3 130 ? -13.223 31.769  9.690   1.00 23.12  ? 129 LYS B CA    1 
ATOM   4502 C  C     . LYS F 3 130 ? -13.452 32.295  8.268   1.00 23.06  ? 129 LYS B C     1 
ATOM   4503 O  O     . LYS F 3 130 ? -13.452 31.514  7.297   1.00 22.95  ? 129 LYS B O     1 
ATOM   4504 C  CB    . LYS F 3 130 ? -14.517 31.750  10.461  1.00 22.47  ? 129 LYS B CB    1 
ATOM   4505 C  CG    . LYS F 3 130 ? -14.427 30.768  11.644  1.00 23.13  ? 129 LYS B CG    1 
ATOM   4506 C  CD    . LYS F 3 130 ? -15.480 31.021  12.689  1.00 23.14  ? 129 LYS B CD    1 
ATOM   4507 C  CE    . LYS F 3 130 ? -16.802 30.847  12.042  1.00 23.81  ? 129 LYS B CE    1 
ATOM   4508 N  NZ    . LYS F 3 130 ? -16.928 29.428  11.642  1.00 25.83  ? 129 LYS B NZ    1 
ATOM   4509 N  N     . ASN F 3 131 ? -13.641 33.603  8.157   1.00 23.06  ? 130 ASN B N     1 
ATOM   4510 C  CA    . ASN F 3 131 ? -13.868 34.253  6.875   1.00 23.63  ? 130 ASN B CA    1 
ATOM   4511 C  C     . ASN F 3 131 ? -12.684 34.040  5.983   1.00 23.27  ? 130 ASN B C     1 
ATOM   4512 O  O     . ASN F 3 131 ? -12.827 33.575  4.851   1.00 23.15  ? 130 ASN B O     1 
ATOM   4513 C  CB    . ASN F 3 131 ? -14.043 35.766  7.053   1.00 24.12  ? 130 ASN B CB    1 
ATOM   4514 C  CG    . ASN F 3 131 ? -15.454 36.144  7.320   1.00 26.20  ? 130 ASN B CG    1 
ATOM   4515 O  OD1   . ASN F 3 131 ? -16.247 36.349  6.408   1.00 27.82  ? 130 ASN B OD1   1 
ATOM   4516 N  ND2   . ASN F 3 131 ? -15.788 36.262  8.590   1.00 29.41  ? 130 ASN B ND2   1 
ATOM   4517 N  N     . LYS F 3 132 ? -11.513 34.356  6.528   1.00 22.66  ? 131 LYS B N     1 
ATOM   4518 C  CA    . LYS F 3 132 ? -10.278 34.223  5.799   1.00 23.08  ? 131 LYS B CA    1 
ATOM   4519 C  C     . LYS F 3 132 ? -10.116 32.806  5.205   1.00 23.01  ? 131 LYS B C     1 
ATOM   4520 O  O     . LYS F 3 132 ? -9.785  32.660  3.999   1.00 23.34  ? 131 LYS B O     1 
ATOM   4521 C  CB    . LYS F 3 132 ? -9.083  34.638  6.683   1.00 23.45  ? 131 LYS B CB    1 
ATOM   4522 C  CG    . LYS F 3 132 ? -7.775  34.586  5.966   1.00 25.04  ? 131 LYS B CG    1 
ATOM   4523 C  CD    . LYS F 3 132 ? -7.805  35.521  4.753   1.00 28.72  ? 131 LYS B CD    1 
ATOM   4524 C  CE    . LYS F 3 132 ? -7.333  36.937  5.129   1.00 31.42  ? 131 LYS B CE    1 
ATOM   4525 N  NZ    . LYS F 3 132 ? -8.097  38.043  4.412   1.00 32.87  ? 131 LYS B NZ    1 
ATOM   4526 N  N     . ILE F 3 133 ? -10.399 31.787  6.028   1.00 21.84  ? 132 ILE B N     1 
ATOM   4527 C  CA    . ILE F 3 133 ? -10.231 30.398  5.636   1.00 21.46  ? 132 ILE B CA    1 
ATOM   4528 C  C     . ILE F 3 133 ? -11.254 29.992  4.562   1.00 22.66  ? 132 ILE B C     1 
ATOM   4529 O  O     . ILE F 3 133 ? -10.972 29.190  3.640   1.00 22.37  ? 132 ILE B O     1 
ATOM   4530 C  CB    . ILE F 3 133 ? -10.272 29.460  6.893   1.00 20.99  ? 132 ILE B CB    1 
ATOM   4531 C  CG1   . ILE F 3 133 ? -9.053  29.723  7.792   1.00 19.88  ? 132 ILE B CG1   1 
ATOM   4532 C  CG2   . ILE F 3 133 ? -10.315 28.025  6.502   1.00 19.40  ? 132 ILE B CG2   1 
ATOM   4533 C  CD1   . ILE F 3 133 ? -9.015  28.926  9.086   1.00 17.29  ? 132 ILE B CD1   1 
ATOM   4534 N  N     . LEU F 3 134 ? -12.449 30.567  4.663   1.00 23.80  ? 133 LEU B N     1 
ATOM   4535 C  CA    . LEU F 3 134 ? -13.478 30.286  3.679   1.00 24.69  ? 133 LEU B CA    1 
ATOM   4536 C  C     . LEU F 3 134 ? -13.158 31.085  2.408   1.00 26.12  ? 133 LEU B C     1 
ATOM   4537 O  O     . LEU F 3 134 ? -13.399 30.620  1.286   1.00 27.17  ? 133 LEU B O     1 
ATOM   4538 C  CB    . LEU F 3 134 ? -14.823 30.632  4.268   1.00 24.42  ? 133 LEU B CB    1 
ATOM   4539 C  CG    . LEU F 3 134 ? -16.046 30.632  3.369   1.00 23.46  ? 133 LEU B CG    1 
ATOM   4540 C  CD1   . LEU F 3 134 ? -16.588 29.225  3.250   1.00 21.57  ? 133 LEU B CD1   1 
ATOM   4541 C  CD2   . LEU F 3 134 ? -16.998 31.493  4.072   1.00 22.36  ? 133 LEU B CD2   1 
ATOM   4542 N  N     . GLU F 3 135 ? -12.572 32.272  2.594   1.00 27.29  ? 134 GLU B N     1 
ATOM   4543 C  CA    . GLU F 3 135 ? -12.078 33.118  1.525   1.00 27.59  ? 134 GLU B CA    1 
ATOM   4544 C  C     . GLU F 3 135 ? -11.078 32.322  0.713   1.00 27.86  ? 134 GLU B C     1 
ATOM   4545 O  O     . GLU F 3 135 ? -11.254 32.179  -0.493  1.00 28.57  ? 134 GLU B O     1 
ATOM   4546 C  CB    . GLU F 3 135 ? -11.411 34.366  2.120   1.00 27.88  ? 134 GLU B CB    1 
ATOM   4547 C  CG    . GLU F 3 135 ? -11.754 35.707  1.442   1.00 31.56  ? 134 GLU B CG    1 
ATOM   4548 C  CD    . GLU F 3 135 ? -12.299 36.808  2.435   1.00 34.84  ? 134 GLU B CD    1 
ATOM   4549 O  OE1   . GLU F 3 135 ? -11.634 37.146  3.473   1.00 35.15  ? 134 GLU B OE1   1 
ATOM   4550 O  OE2   . GLU F 3 135 ? -13.407 37.348  2.162   1.00 35.89  ? 134 GLU B OE2   1 
ATOM   4551 N  N     . LYS F 3 136 ? -10.041 31.766  1.347   1.00 27.46  ? 135 LYS B N     1 
ATOM   4552 C  CA    . LYS F 3 136 ? -8.981  31.113  0.536   1.00 27.08  ? 135 LYS B CA    1 
ATOM   4553 C  C     . LYS F 3 136 ? -9.345  29.689  0.148   1.00 26.56  ? 135 LYS B C     1 
ATOM   4554 O  O     . LYS F 3 136 ? -9.096  29.273  -0.975  1.00 27.33  ? 135 LYS B O     1 
ATOM   4555 C  CB    . LYS F 3 136 ? -7.581  31.100  1.199   1.00 26.66  ? 135 LYS B CB    1 
ATOM   4556 C  CG    . LYS F 3 136 ? -7.045  32.443  1.712   1.00 27.79  ? 135 LYS B CG    1 
ATOM   4557 C  CD    . LYS F 3 136 ? -6.477  33.360  0.632   1.00 29.20  ? 135 LYS B CD    1 
ATOM   4558 C  CE    . LYS F 3 136 ? -6.607  34.801  1.090   1.00 29.38  ? 135 LYS B CE    1 
ATOM   4559 N  NZ    . LYS F 3 136 ? -6.923  35.704  -0.062  1.00 30.77  ? 135 LYS B NZ    1 
ATOM   4560 N  N     . GLU F 3 137 ? -9.885  28.923  1.075   1.00 25.09  ? 136 GLU B N     1 
ATOM   4561 C  CA    . GLU F 3 137 ? -9.903  27.503  0.842   1.00 24.65  ? 136 GLU B CA    1 
ATOM   4562 C  C     . GLU F 3 137 ? -11.304 26.921  0.739   1.00 24.08  ? 136 GLU B C     1 
ATOM   4563 O  O     . GLU F 3 137 ? -11.459 25.726  0.472   1.00 24.19  ? 136 GLU B O     1 
ATOM   4564 C  CB    . GLU F 3 137 ? -9.108  26.791  1.922   1.00 24.82  ? 136 GLU B CB    1 
ATOM   4565 C  CG    . GLU F 3 137 ? -7.669  27.220  2.017   1.00 27.06  ? 136 GLU B CG    1 
ATOM   4566 C  CD    . GLU F 3 137 ? -6.767  26.655  0.922   1.00 30.96  ? 136 GLU B CD    1 
ATOM   4567 O  OE1   . GLU F 3 137 ? -7.146  25.690  0.189   1.00 32.07  ? 136 GLU B OE1   1 
ATOM   4568 O  OE2   . GLU F 3 137 ? -5.651  27.197  0.809   1.00 33.94  ? 136 GLU B OE2   1 
ATOM   4569 N  N     . LYS F 3 138 ? -12.312 27.769  0.936   1.00 23.21  ? 137 LYS B N     1 
ATOM   4570 C  CA    . LYS F 3 138 ? -13.694 27.373  0.816   1.00 22.66  ? 137 LYS B CA    1 
ATOM   4571 C  C     . LYS F 3 138 ? -13.942 26.225  1.788   1.00 21.45  ? 137 LYS B C     1 
ATOM   4572 O  O     . LYS F 3 138 ? -14.736 25.336  1.517   1.00 21.87  ? 137 LYS B O     1 
ATOM   4573 C  CB    . LYS F 3 138 ? -14.027 26.968  -0.635  1.00 23.09  ? 137 LYS B CB    1 
ATOM   4574 C  CG    . LYS F 3 138 ? -14.157 28.141  -1.610  1.00 26.13  ? 137 LYS B CG    1 
ATOM   4575 C  CD    . LYS F 3 138 ? -15.341 29.063  -1.199  1.00 31.08  ? 137 LYS B CD    1 
ATOM   4576 C  CE    . LYS F 3 138 ? -15.134 30.520  -1.683  1.00 32.87  ? 137 LYS B CE    1 
ATOM   4577 N  NZ    . LYS F 3 138 ? -15.823 31.442  -0.773  1.00 31.41  ? 137 LYS B NZ    1 
ATOM   4578 N  N     . ILE F 3 139 ? -13.235 26.270  2.908   1.00 19.62  ? 138 ILE B N     1 
ATOM   4579 C  CA    . ILE F 3 139 ? -13.291 25.265  3.936   1.00 18.04  ? 138 ILE B CA    1 
ATOM   4580 C  C     . ILE F 3 139 ? -13.814 25.933  5.176   1.00 18.08  ? 138 ILE B C     1 
ATOM   4581 O  O     . ILE F 3 139 ? -13.237 26.926  5.622   1.00 18.17  ? 138 ILE B O     1 
ATOM   4582 C  CB    . ILE F 3 139 ? -11.852 24.763  4.215   1.00 17.42  ? 138 ILE B CB    1 
ATOM   4583 C  CG1   . ILE F 3 139 ? -11.427 23.654  3.225   1.00 15.40  ? 138 ILE B CG1   1 
ATOM   4584 C  CG2   . ILE F 3 139 ? -11.656 24.385  5.671   1.00 16.10  ? 138 ILE B CG2   1 
ATOM   4585 C  CD1   . ILE F 3 139 ? -12.119 22.356  3.459   1.00 17.45  ? 138 ILE B CD1   1 
ATOM   4586 N  N     . THR F 3 140 ? -14.882 25.379  5.756   1.00 18.21  ? 139 THR B N     1 
ATOM   4587 C  CA    . THR F 3 140 ? -15.462 25.925  6.991   1.00 18.03  ? 139 THR B CA    1 
ATOM   4588 C  C     . THR F 3 140 ? -14.728 25.309  8.179   1.00 18.11  ? 139 THR B C     1 
ATOM   4589 O  O     . THR F 3 140 ? -14.296 24.141  8.111   1.00 18.40  ? 139 THR B O     1 
ATOM   4590 C  CB    . THR F 3 140 ? -17.012 25.676  7.072   1.00 18.28  ? 139 THR B CB    1 
ATOM   4591 O  OG1   . THR F 3 140 ? -17.298 24.312  7.359   1.00 18.98  ? 139 THR B OG1   1 
ATOM   4592 C  CG2   . THR F 3 140 ? -17.674 25.959  5.739   1.00 17.81  ? 139 THR B CG2   1 
ATOM   4593 N  N     . VAL F 3 141 ? -14.519 26.116  9.221   1.00 18.10  ? 140 VAL B N     1 
ATOM   4594 C  CA    . VAL F 3 141 ? -13.984 25.680  10.508  1.00 17.89  ? 140 VAL B CA    1 
ATOM   4595 C  C     . VAL F 3 141 ? -14.809 26.209  11.698  1.00 18.45  ? 140 VAL B C     1 
ATOM   4596 O  O     . VAL F 3 141 ? -15.618 27.087  11.546  1.00 17.89  ? 140 VAL B O     1 
ATOM   4597 C  CB    . VAL F 3 141 ? -12.592 26.197  10.719  1.00 18.22  ? 140 VAL B CB    1 
ATOM   4598 C  CG1   . VAL F 3 141 ? -11.738 26.026  9.433   1.00 17.48  ? 140 VAL B CG1   1 
ATOM   4599 C  CG2   . VAL F 3 141 ? -12.657 27.685  11.218  1.00 17.22  ? 140 VAL B CG2   1 
ATOM   4600 N  N     . THR F 3 142 ? -14.572 25.649  12.876  1.00 19.26  ? 141 THR B N     1 
ATOM   4601 C  CA    . THR F 3 142 ? -15.189 26.033  14.099  1.00 20.53  ? 141 THR B CA    1 
ATOM   4602 C  C     . THR F 3 142 ? -14.073 26.555  15.017  1.00 22.17  ? 141 THR B C     1 
ATOM   4603 O  O     . THR F 3 142 ? -13.026 25.911  15.188  1.00 22.91  ? 141 THR B O     1 
ATOM   4604 C  CB    . THR F 3 142 ? -15.795 24.785  14.771  1.00 20.75  ? 141 THR B CB    1 
ATOM   4605 O  OG1   . THR F 3 142 ? -16.897 24.286  13.989  1.00 21.72  ? 141 THR B OG1   1 
ATOM   4606 C  CG2   . THR F 3 142 ? -16.315 25.103  16.176  1.00 21.44  ? 141 THR B CG2   1 
ATOM   4607 N  N     . VAL F 3 143 ? -14.294 27.699  15.638  1.00 22.45  ? 142 VAL B N     1 
ATOM   4608 C  CA    . VAL F 3 143 ? -13.347 28.220  16.592  1.00 22.79  ? 142 VAL B CA    1 
ATOM   4609 C  C     . VAL F 3 143 ? -13.882 28.051  18.014  1.00 23.20  ? 142 VAL B C     1 
ATOM   4610 O  O     . VAL F 3 143 ? -15.081 28.105  18.257  1.00 22.87  ? 142 VAL B O     1 
ATOM   4611 C  CB    . VAL F 3 143 ? -13.170 29.699  16.347  1.00 23.20  ? 142 VAL B CB    1 
ATOM   4612 C  CG1   . VAL F 3 143 ? -12.207 30.330  17.402  1.00 22.91  ? 142 VAL B CG1   1 
ATOM   4613 C  CG2   . VAL F 3 143 ? -12.747 29.929  14.912  1.00 21.62  ? 142 VAL B CG2   1 
ATOM   4614 N  N     . GLY F 3 144 ? -12.970 27.847  18.944  1.00 23.43  ? 143 GLY B N     1 
ATOM   4615 C  CA    . GLY F 3 144 ? -13.264 27.752  20.358  1.00 23.24  ? 143 GLY B CA    1 
ATOM   4616 C  C     . GLY F 3 144 ? -12.295 28.678  21.042  1.00 23.17  ? 143 GLY B C     1 
ATOM   4617 O  O     . GLY F 3 144 ? -11.148 28.708  20.687  1.00 23.53  ? 143 GLY B O     1 
ATOM   4618 N  N     . ILE F 3 145 ? -12.767 29.469  21.984  1.00 23.41  ? 144 ILE B N     1 
ATOM   4619 C  CA    . ILE F 3 145 ? -11.936 30.433  22.674  1.00 23.85  ? 144 ILE B CA    1 
ATOM   4620 C  C     . ILE F 3 145 ? -12.175 30.328  24.177  1.00 24.32  ? 144 ILE B C     1 
ATOM   4621 O  O     . ILE F 3 145 ? -13.318 30.315  24.616  1.00 23.56  ? 144 ILE B O     1 
ATOM   4622 C  CB    . ILE F 3 145 ? -12.302 31.844  22.255  1.00 24.01  ? 144 ILE B CB    1 
ATOM   4623 C  CG1   . ILE F 3 145 ? -11.872 32.109  20.801  1.00 23.23  ? 144 ILE B CG1   1 
ATOM   4624 C  CG2   . ILE F 3 145 ? -11.770 32.853  23.280  1.00 23.96  ? 144 ILE B CG2   1 
ATOM   4625 C  CD1   . ILE F 3 145 ? -12.543 33.259  20.148  1.00 20.42  ? 144 ILE B CD1   1 
ATOM   4626 N  N     . SER F 3 146 ? -11.094 30.277  24.950  1.00 25.00  ? 145 SER B N     1 
ATOM   4627 C  CA    . SER F 3 146 ? -11.200 30.193  26.401  1.00 26.32  ? 145 SER B CA    1 
ATOM   4628 C  C     . SER F 3 146 ? -9.920  30.625  27.118  1.00 26.73  ? 145 SER B C     1 
ATOM   4629 O  O     . SER F 3 146 ? -9.135  31.419  26.600  1.00 26.23  ? 145 SER B O     1 
ATOM   4630 C  CB    . SER F 3 146 ? -11.583 28.773  26.827  1.00 26.75  ? 145 SER B CB    1 
ATOM   4631 O  OG    . SER F 3 146 ? -12.131 28.763  28.133  1.00 27.87  ? 145 SER B OG    1 
ATOM   4632 N  N     . LYS F 3 147 ? -9.732  30.087  28.318  1.00 27.43  ? 146 LYS B N     1 
ATOM   4633 C  CA    . LYS F 3 147 ? -8.583  30.409  29.186  1.00 28.61  ? 146 LYS B CA    1 
ATOM   4634 C  C     . LYS F 3 147 ? -7.493  29.341  29.109  1.00 28.50  ? 146 LYS B C     1 
ATOM   4635 O  O     . LYS F 3 147 ? -6.440  29.506  29.714  1.00 28.45  ? 146 LYS B O     1 
ATOM   4636 C  CB    . LYS F 3 147 ? -9.063  30.553  30.649  1.00 29.08  ? 146 LYS B CB    1 
ATOM   4637 C  CG    . LYS F 3 147 ? -9.140  29.200  31.434  1.00 30.14  ? 146 LYS B CG    1 
ATOM   4638 C  CD    . LYS F 3 147 ? -10.333 29.132  32.386  1.00 31.62  ? 146 LYS B CD    1 
ATOM   4639 C  CE    . LYS F 3 147 ? -9.961  28.425  33.680  1.00 31.97  ? 146 LYS B CE    1 
ATOM   4640 N  NZ    . LYS F 3 147 ? -9.538  29.392  34.800  1.00 32.59  ? 146 LYS B NZ    1 
ATOM   4641 N  N     . ASN F 3 148 ? -7.753  28.242  28.386  1.00 28.59  ? 147 ASN B N     1 
ATOM   4642 C  CA    . ASN F 3 148 ? -6.771  27.167  28.226  1.00 28.66  ? 147 ASN B CA    1 
ATOM   4643 C  C     . ASN F 3 148 ? -7.029  26.277  27.023  1.00 28.64  ? 147 ASN B C     1 
ATOM   4644 O  O     . ASN F 3 148 ? -8.171  26.156  26.593  1.00 29.31  ? 147 ASN B O     1 
ATOM   4645 C  CB    . ASN F 3 148 ? -6.717  26.328  29.498  1.00 29.00  ? 147 ASN B CB    1 
ATOM   4646 C  CG    . ASN F 3 148 ? -8.018  25.599  29.764  1.00 29.91  ? 147 ASN B CG    1 
ATOM   4647 O  OD1   . ASN F 3 148 ? -8.538  24.869  28.897  1.00 32.44  ? 147 ASN B OD1   1 
ATOM   4648 N  ND2   . ASN F 3 148 ? -8.546  25.773  30.967  1.00 29.48  ? 147 ASN B ND2   1 
ATOM   4649 N  N     . LYS F 3 149 ? -5.979  25.644  26.488  1.00 28.43  ? 148 LYS B N     1 
ATOM   4650 C  CA    . LYS F 3 149 ? -6.117  24.654  25.419  1.00 28.03  ? 148 LYS B CA    1 
ATOM   4651 C  C     . LYS F 3 149 ? -7.408  23.804  25.550  1.00 28.57  ? 148 LYS B C     1 
ATOM   4652 O  O     . LYS F 3 149 ? -8.173  23.717  24.599  1.00 28.83  ? 148 LYS B O     1 
ATOM   4653 C  CB    . LYS F 3 149 ? -4.929  23.705  25.424  1.00 28.33  ? 148 LYS B CB    1 
ATOM   4654 C  CG    . LYS F 3 149 ? -3.540  24.307  25.058  1.00 29.66  ? 148 LYS B CG    1 
ATOM   4655 C  CD    . LYS F 3 149 ? -2.580  23.284  24.377  1.00 29.31  ? 148 LYS B CD    1 
ATOM   4656 C  CE    . LYS F 3 149 ? -1.798  22.422  25.365  1.00 30.45  ? 148 LYS B CE    1 
ATOM   4657 N  NZ    . LYS F 3 149 ? -0.401  22.069  24.884  1.00 30.39  ? 148 LYS B NZ    1 
ATOM   4658 N  N     . VAL F 3 150 ? -7.664  23.204  26.725  1.00 28.01  ? 149 VAL B N     1 
ATOM   4659 C  CA    . VAL F 3 150 ? -8.729  22.208  26.852  1.00 27.13  ? 149 VAL B CA    1 
ATOM   4660 C  C     . VAL F 3 150 ? -10.095 22.812  26.591  1.00 27.30  ? 149 VAL B C     1 
ATOM   4661 O  O     . VAL F 3 150 ? -10.859 22.313  25.741  1.00 28.17  ? 149 VAL B O     1 
ATOM   4662 C  CB    . VAL F 3 150 ? -8.749  21.539  28.233  1.00 26.95  ? 149 VAL B CB    1 
ATOM   4663 C  CG1   . VAL F 3 150 ? -9.943  20.633  28.335  1.00 26.19  ? 149 VAL B CG1   1 
ATOM   4664 C  CG2   . VAL F 3 150 ? -7.458  20.744  28.452  1.00 26.99  ? 149 VAL B CG2   1 
ATOM   4665 N  N     . PHE F 3 151 ? -10.405 23.881  27.320  1.00 26.17  ? 150 PHE B N     1 
ATOM   4666 C  CA    . PHE F 3 151 ? -11.705 24.485  27.242  1.00 24.95  ? 150 PHE B CA    1 
ATOM   4667 C  C     . PHE F 3 151 ? -11.873 25.250  25.955  1.00 24.40  ? 150 PHE B C     1 
ATOM   4668 O  O     . PHE F 3 151 ? -12.976 25.321  25.456  1.00 23.97  ? 150 PHE B O     1 
ATOM   4669 C  CB    . PHE F 3 151 ? -11.976 25.364  28.453  1.00 25.07  ? 150 PHE B CB    1 
ATOM   4670 C  CG    . PHE F 3 151 ? -12.257 24.596  29.722  1.00 25.62  ? 150 PHE B CG    1 
ATOM   4671 C  CD1   . PHE F 3 151 ? -13.544 24.102  29.990  1.00 25.57  ? 150 PHE B CD1   1 
ATOM   4672 C  CD2   . PHE F 3 151 ? -11.241 24.406  30.680  1.00 26.67  ? 150 PHE B CD2   1 
ATOM   4673 C  CE1   . PHE F 3 151 ? -13.818 23.407  31.210  1.00 28.30  ? 150 PHE B CE1   1 
ATOM   4674 C  CE2   . PHE F 3 151 ? -11.486 23.711  31.891  1.00 27.60  ? 150 PHE B CE2   1 
ATOM   4675 C  CZ    . PHE F 3 151 ? -12.788 23.210  32.163  1.00 28.75  ? 150 PHE B CZ    1 
ATOM   4676 N  N     . ALA F 3 152 ? -10.791 25.797  25.390  1.00 24.30  ? 151 ALA B N     1 
ATOM   4677 C  CA    . ALA F 3 152 ? -10.803 26.180  23.930  1.00 24.07  ? 151 ALA B CA    1 
ATOM   4678 C  C     . ALA F 3 152 ? -11.403 25.099  22.996  1.00 24.25  ? 151 ALA B C     1 
ATOM   4679 O  O     . ALA F 3 152 ? -12.242 25.390  22.089  1.00 22.71  ? 151 ALA B O     1 
ATOM   4680 C  CB    . ALA F 3 152 ? -9.470  26.522  23.452  1.00 22.45  ? 151 ALA B CB    1 
ATOM   4681 N  N     . LYS F 3 153 ? -10.925 23.868  23.214  1.00 24.57  ? 152 LYS B N     1 
ATOM   4682 C  CA    . LYS F 3 153 ? -11.307 22.727  22.401  1.00 24.60  ? 152 LYS B CA    1 
ATOM   4683 C  C     . LYS F 3 153 ? -12.764 22.406  22.693  1.00 25.09  ? 152 LYS B C     1 
ATOM   4684 O  O     . LYS F 3 153 ? -13.596 22.330  21.763  1.00 24.41  ? 152 LYS B O     1 
ATOM   4685 C  CB    . LYS F 3 153 ? -10.418 21.548  22.717  1.00 24.30  ? 152 LYS B CB    1 
ATOM   4686 C  CG    . LYS F 3 153 ? -10.522 20.420  21.677  1.00 26.06  ? 152 LYS B CG    1 
ATOM   4687 C  CD    . LYS F 3 153 ? -9.168  19.703  21.497  1.00 27.85  ? 152 LYS B CD    1 
ATOM   4688 C  CE    . LYS F 3 153 ? -9.205  18.793  20.335  1.00 26.58  ? 152 LYS B CE    1 
ATOM   4689 N  NZ    . LYS F 3 153 ? -10.205 17.778  20.634  1.00 28.61  ? 152 LYS B NZ    1 
ATOM   4690 N  N     . ILE F 3 154 ? -13.088 22.292  23.988  1.00 24.70  ? 153 ILE B N     1 
ATOM   4691 C  CA    . ILE F 3 154 ? -14.471 22.010  24.362  1.00 25.15  ? 153 ILE B CA    1 
ATOM   4692 C  C     . ILE F 3 154 ? -15.445 23.005  23.687  1.00 25.33  ? 153 ILE B C     1 
ATOM   4693 O  O     . ILE F 3 154 ? -16.509 22.608  23.172  1.00 25.74  ? 153 ILE B O     1 
ATOM   4694 C  CB    . ILE F 3 154 ? -14.671 21.897  25.887  1.00 24.90  ? 153 ILE B CB    1 
ATOM   4695 C  CG1   . ILE F 3 154 ? -13.783 20.806  26.449  1.00 24.27  ? 153 ILE B CG1   1 
ATOM   4696 C  CG2   . ILE F 3 154 ? -16.053 21.466  26.189  1.00 26.19  ? 153 ILE B CG2   1 
ATOM   4697 C  CD1   . ILE F 3 154 ? -13.881 20.680  27.891  1.00 25.54  ? 153 ILE B CD1   1 
ATOM   4698 N  N     . ALA F 3 155 ? -15.052 24.271  23.646  1.00 25.32  ? 154 ALA B N     1 
ATOM   4699 C  CA    . ALA F 3 155 ? -15.847 25.293  22.966  1.00 25.83  ? 154 ALA B CA    1 
ATOM   4700 C  C     . ALA F 3 155 ? -15.971 25.013  21.472  1.00 25.87  ? 154 ALA B C     1 
ATOM   4701 O  O     . ALA F 3 155 ? -17.044 25.174  20.930  1.00 27.02  ? 154 ALA B O     1 
ATOM   4702 C  CB    . ALA F 3 155 ? -15.271 26.683  23.194  1.00 25.48  ? 154 ALA B CB    1 
ATOM   4703 N  N     . ALA F 3 156 ? -14.897 24.616  20.805  1.00 25.83  ? 155 ALA B N     1 
ATOM   4704 C  CA    . ALA F 3 156 ? -15.034 24.039  19.463  1.00 26.53  ? 155 ALA B CA    1 
ATOM   4705 C  C     . ALA F 3 156 ? -16.038 22.857  19.448  1.00 27.30  ? 155 ALA B C     1 
ATOM   4706 O  O     . ALA F 3 156 ? -16.953 22.835  18.641  1.00 27.71  ? 155 ALA B O     1 
ATOM   4707 C  CB    . ALA F 3 156 ? -13.713 23.621  18.898  1.00 24.85  ? 155 ALA B CB    1 
ATOM   4708 N  N     . ASP F 3 157 ? -15.895 21.893  20.345  1.00 28.36  ? 156 ASP B N     1 
ATOM   4709 C  CA    . ASP F 3 157 ? -16.760 20.735  20.266  1.00 29.80  ? 156 ASP B CA    1 
ATOM   4710 C  C     . ASP F 3 157 ? -18.213 21.150  20.379  1.00 30.58  ? 156 ASP B C     1 
ATOM   4711 O  O     . ASP F 3 157 ? -19.066 20.646  19.637  1.00 31.82  ? 156 ASP B O     1 
ATOM   4712 C  CB    . ASP F 3 157 ? -16.395 19.678  21.302  1.00 30.01  ? 156 ASP B CB    1 
ATOM   4713 C  CG    . ASP F 3 157 ? -15.034 18.964  20.986  1.00 31.36  ? 156 ASP B CG    1 
ATOM   4714 O  OD1   . ASP F 3 157 ? -14.535 18.977  19.826  1.00 33.52  ? 156 ASP B OD1   1 
ATOM   4715 O  OD2   . ASP F 3 157 ? -14.458 18.371  21.918  1.00 33.02  ? 156 ASP B OD2   1 
ATOM   4716 N  N     . MET F 3 158 ? -18.491 22.133  21.224  1.00 30.48  ? 157 MET B N     1 
ATOM   4717 C  CA    . MET F 3 158 ? -19.883 22.532  21.457  1.00 30.81  ? 157 MET B CA    1 
ATOM   4718 C  C     . MET F 3 158 ? -20.520 23.283  20.296  1.00 30.43  ? 157 MET B C     1 
ATOM   4719 O  O     . MET F 3 158 ? -21.745 23.312  20.178  1.00 31.26  ? 157 MET B O     1 
ATOM   4720 C  CB    . MET F 3 158 ? -20.024 23.310  22.777  1.00 31.20  ? 157 MET B CB    1 
ATOM   4721 C  CG    . MET F 3 158 ? -19.546 22.489  24.001  1.00 32.88  ? 157 MET B CG    1 
ATOM   4722 S  SD    . MET F 3 158 ? -19.666 23.277  25.625  1.00 39.07  ? 157 MET B SD    1 
ATOM   4723 C  CE    . MET F 3 158 ? -19.938 25.018  25.209  1.00 37.98  ? 157 MET B CE    1 
ATOM   4724 N  N     . ALA F 3 159 ? -19.703 23.840  19.405  1.00 29.54  ? 158 ALA B N     1 
ATOM   4725 C  CA    . ALA F 3 159 ? -20.200 24.748  18.396  1.00 28.38  ? 158 ALA B CA    1 
ATOM   4726 C  C     . ALA F 3 159 ? -20.058 24.234  16.978  1.00 28.34  ? 158 ALA B C     1 
ATOM   4727 O  O     . ALA F 3 159 ? -20.490 24.933  16.055  1.00 28.12  ? 158 ALA B O     1 
ATOM   4728 C  CB    . ALA F 3 159 ? -19.532 26.101  18.537  1.00 28.10  ? 158 ALA B CB    1 
ATOM   4729 N  N     . LYS F 3 160 ? -19.480 23.034  16.798  1.00 28.13  ? 159 LYS B N     1 
ATOM   4730 C  CA    . LYS F 3 160 ? -19.306 22.464  15.444  1.00 27.99  ? 159 LYS B CA    1 
ATOM   4731 C  C     . LYS F 3 160 ? -20.584 21.916  14.856  1.00 27.68  ? 159 LYS B C     1 
ATOM   4732 O  O     . LYS F 3 160 ? -21.302 21.213  15.536  1.00 28.88  ? 159 LYS B O     1 
ATOM   4733 C  CB    . LYS F 3 160 ? -18.188 21.431  15.357  1.00 27.92  ? 159 LYS B CB    1 
ATOM   4734 C  CG    . LYS F 3 160 ? -18.287 20.164  16.199  1.00 30.45  ? 159 LYS B CG    1 
ATOM   4735 C  CD    . LYS F 3 160 ? -17.009 19.251  15.978  1.00 31.80  ? 159 LYS B CD    1 
ATOM   4736 C  CE    . LYS F 3 160 ? -17.056 17.905  16.758  1.00 34.28  ? 159 LYS B CE    1 
ATOM   4737 N  NZ    . LYS F 3 160 ? -16.368 17.961  18.120  1.00 34.39  ? 159 LYS B NZ    1 
ATOM   4738 N  N     . PRO F 3 161 ? -20.844 22.171  13.555  1.00 27.31  ? 160 PRO B N     1 
ATOM   4739 C  CA    . PRO F 3 161 ? -19.944 22.811  12.559  1.00 26.30  ? 160 PRO B CA    1 
ATOM   4740 C  C     . PRO F 3 161 ? -20.110 24.273  12.323  1.00 25.63  ? 160 PRO B C     1 
ATOM   4741 O  O     . PRO F 3 161 ? -21.147 24.835  12.552  1.00 25.23  ? 160 PRO B O     1 
ATOM   4742 C  CB    . PRO F 3 161 ? -20.318 22.116  11.270  1.00 26.83  ? 160 PRO B CB    1 
ATOM   4743 C  CG    . PRO F 3 161 ? -21.786 21.757  11.448  1.00 26.12  ? 160 PRO B CG    1 
ATOM   4744 C  CD    . PRO F 3 161 ? -21.925 21.409  12.907  1.00 26.66  ? 160 PRO B CD    1 
ATOM   4745 N  N     . ASN F 3 162 ? -19.055 24.885  11.827  1.00 26.43  ? 161 ASN B N     1 
ATOM   4746 C  CA    . ASN F 3 162 ? -19.149 26.221  11.268  1.00 26.67  ? 161 ASN B CA    1 
ATOM   4747 C  C     . ASN F 3 162 ? -19.671 27.213  12.306  1.00 27.17  ? 161 ASN B C     1 
ATOM   4748 O  O     . ASN F 3 162 ? -20.501 28.061  12.037  1.00 28.20  ? 161 ASN B O     1 
ATOM   4749 C  CB    . ASN F 3 162 ? -20.031 26.134  10.014  1.00 26.68  ? 161 ASN B CB    1 
ATOM   4750 C  CG    . ASN F 3 162 ? -19.921 27.347  9.133   1.00 28.22  ? 161 ASN B CG    1 
ATOM   4751 O  OD1   . ASN F 3 162 ? -19.064 28.234  9.331   1.00 29.28  ? 161 ASN B OD1   1 
ATOM   4752 N  ND2   . ASN F 3 162 ? -20.802 27.405  8.141   1.00 29.03  ? 161 ASN B ND2   1 
ATOM   4753 N  N     . GLY F 3 163 ? -19.195 27.066  13.530  1.00 27.47  ? 162 GLY B N     1 
ATOM   4754 C  CA    . GLY F 3 163 ? -19.416 28.046  14.557  1.00 27.21  ? 162 GLY B CA    1 
ATOM   4755 C  C     . GLY F 3 163 ? -18.159 28.623  15.164  1.00 27.01  ? 162 GLY B C     1 
ATOM   4756 O  O     . GLY F 3 163 ? -17.065 28.432  14.646  1.00 27.42  ? 162 GLY B O     1 
ATOM   4757 N  N     . ILE F 3 164 ? -18.376 29.325  16.276  1.00 26.63  ? 163 ILE B N     1 
ATOM   4758 C  CA    . ILE F 3 164 ? -17.417 30.080  17.068  1.00 25.80  ? 163 ILE B CA    1 
ATOM   4759 C  C     . ILE F 3 164 ? -18.113 30.297  18.432  1.00 26.48  ? 163 ILE B C     1 
ATOM   4760 O  O     . ILE F 3 164 ? -19.284 30.675  18.478  1.00 26.30  ? 163 ILE B O     1 
ATOM   4761 C  CB    . ILE F 3 164 ? -17.099 31.431  16.444  1.00 25.40  ? 163 ILE B CB    1 
ATOM   4762 C  CG1   . ILE F 3 164 ? -16.241 32.276  17.372  1.00 24.53  ? 163 ILE B CG1   1 
ATOM   4763 C  CG2   . ILE F 3 164 ? -18.350 32.205  16.168  1.00 25.39  ? 163 ILE B CG2   1 
ATOM   4764 C  CD1   . ILE F 3 164 ? -15.532 33.408  16.655  1.00 23.40  ? 163 ILE B CD1   1 
ATOM   4765 N  N     . LYS F 3 165 ? -17.386 30.043  19.524  1.00 27.02  ? 164 LYS B N     1 
ATOM   4766 C  CA    . LYS F 3 165 ? -17.901 30.083  20.882  1.00 28.06  ? 164 LYS B CA    1 
ATOM   4767 C  C     . LYS F 3 165 ? -16.780 30.411  21.897  1.00 28.43  ? 164 LYS B C     1 
ATOM   4768 O  O     . LYS F 3 165 ? -15.637 29.901  21.806  1.00 29.17  ? 164 LYS B O     1 
ATOM   4769 C  CB    . LYS F 3 165 ? -18.590 28.749  21.211  1.00 28.71  ? 164 LYS B CB    1 
ATOM   4770 C  CG    . LYS F 3 165 ? -18.938 28.473  22.684  1.00 30.13  ? 164 LYS B CG    1 
ATOM   4771 C  CD    . LYS F 3 165 ? -20.414 28.826  23.000  1.00 33.01  ? 164 LYS B CD    1 
ATOM   4772 C  CE    . LYS F 3 165 ? -20.755 28.719  24.522  1.00 33.36  ? 164 LYS B CE    1 
ATOM   4773 N  NZ    . LYS F 3 165 ? -22.225 28.755  24.796  1.00 34.63  ? 164 LYS B NZ    1 
ATOM   4774 N  N     . VAL F 3 166 ? -17.130 31.270  22.846  1.00 27.89  ? 165 VAL B N     1 
ATOM   4775 C  CA    . VAL F 3 166 ? -16.304 31.684  23.964  1.00 27.65  ? 165 VAL B CA    1 
ATOM   4776 C  C     . VAL F 3 166 ? -16.868 31.052  25.241  1.00 27.70  ? 165 VAL B C     1 
ATOM   4777 O  O     . VAL F 3 166 ? -18.058 31.196  25.522  1.00 27.18  ? 165 VAL B O     1 
ATOM   4778 C  CB    . VAL F 3 166 ? -16.412 33.207  24.134  1.00 27.83  ? 165 VAL B CB    1 
ATOM   4779 C  CG1   . VAL F 3 166 ? -15.721 33.676  25.399  1.00 26.46  ? 165 VAL B CG1   1 
ATOM   4780 C  CG2   . VAL F 3 166 ? -15.849 33.904  22.908  1.00 29.02  ? 165 VAL B CG2   1 
ATOM   4781 N  N     . ILE F 3 167 ? -16.020 30.368  26.007  1.00 27.58  ? 166 ILE B N     1 
ATOM   4782 C  CA    . ILE F 3 167 ? -16.389 29.817  27.293  1.00 28.13  ? 166 ILE B CA    1 
ATOM   4783 C  C     . ILE F 3 167 ? -15.599 30.601  28.346  1.00 29.77  ? 166 ILE B C     1 
ATOM   4784 O  O     . ILE F 3 167 ? -14.385 30.432  28.473  1.00 29.59  ? 166 ILE B O     1 
ATOM   4785 C  CB    . ILE F 3 167 ? -16.023 28.338  27.379  1.00 27.76  ? 166 ILE B CB    1 
ATOM   4786 C  CG1   . ILE F 3 167 ? -17.008 27.499  26.585  1.00 27.69  ? 166 ILE B CG1   1 
ATOM   4787 C  CG2   . ILE F 3 167 ? -16.008 27.860  28.815  1.00 26.55  ? 166 ILE B CG2   1 
ATOM   4788 C  CD1   . ILE F 3 167 ? -16.645 26.030  26.510  1.00 26.29  ? 166 ILE B CD1   1 
ATOM   4789 N  N     . ASP F 3 168 ? -16.284 31.464  29.095  1.00 31.48  ? 167 ASP B N     1 
ATOM   4790 C  CA    . ASP F 3 168 ? -15.607 32.318  30.079  1.00 33.27  ? 167 ASP B CA    1 
ATOM   4791 C  C     . ASP F 3 168 ? -15.398 31.649  31.454  1.00 34.14  ? 167 ASP B C     1 
ATOM   4792 O  O     . ASP F 3 168 ? -15.788 30.504  31.676  1.00 34.74  ? 167 ASP B O     1 
ATOM   4793 C  CB    . ASP F 3 168 ? -16.303 33.694  30.195  1.00 33.26  ? 167 ASP B CB    1 
ATOM   4794 C  CG    . ASP F 3 168 ? -17.660 33.601  30.813  1.00 33.29  ? 167 ASP B CG    1 
ATOM   4795 O  OD1   . ASP F 3 168 ? -17.805 32.846  31.796  1.00 35.74  ? 167 ASP B OD1   1 
ATOM   4796 O  OD2   . ASP F 3 168 ? -18.582 34.283  30.332  1.00 31.87  ? 167 ASP B OD2   1 
ATOM   4797 N  N     . ASP F 3 169 ? -14.775 32.370  32.370  1.00 35.28  ? 168 ASP B N     1 
ATOM   4798 C  CA    . ASP F 3 169 ? -14.456 31.833  33.693  1.00 36.37  ? 168 ASP B CA    1 
ATOM   4799 C  C     . ASP F 3 169 ? -15.688 31.231  34.380  1.00 37.19  ? 168 ASP B C     1 
ATOM   4800 O  O     . ASP F 3 169 ? -15.663 30.074  34.841  1.00 37.73  ? 168 ASP B O     1 
ATOM   4801 C  CB    . ASP F 3 169 ? -13.821 32.933  34.541  1.00 36.36  ? 168 ASP B CB    1 
ATOM   4802 C  CG    . ASP F 3 169 ? -12.549 33.513  33.893  1.00 36.74  ? 168 ASP B CG    1 
ATOM   4803 O  OD1   . ASP F 3 169 ? -12.419 33.498  32.652  1.00 35.13  ? 168 ASP B OD1   1 
ATOM   4804 O  OD2   . ASP F 3 169 ? -11.669 34.006  34.636  1.00 39.10  ? 168 ASP B OD2   1 
ATOM   4805 N  N     . GLU F 3 170 ? -16.776 31.993  34.414  1.00 37.54  ? 169 GLU B N     1 
ATOM   4806 C  CA    . GLU F 3 170 ? -17.988 31.476  35.006  1.00 38.48  ? 169 GLU B CA    1 
ATOM   4807 C  C     . GLU F 3 170 ? -18.386 30.207  34.268  1.00 38.59  ? 169 GLU B C     1 
ATOM   4808 O  O     . GLU F 3 170 ? -18.688 29.183  34.893  1.00 39.47  ? 169 GLU B O     1 
ATOM   4809 C  CB    . GLU F 3 170 ? -19.134 32.489  34.948  1.00 38.70  ? 169 GLU B CB    1 
ATOM   4810 C  CG    . GLU F 3 170 ? -18.794 33.910  35.329  1.00 40.12  ? 169 GLU B CG    1 
ATOM   4811 C  CD    . GLU F 3 170 ? -19.448 34.901  34.359  1.00 42.30  ? 169 GLU B CD    1 
ATOM   4812 O  OE1   . GLU F 3 170 ? -19.842 34.491  33.237  1.00 42.02  ? 169 GLU B OE1   1 
ATOM   4813 O  OE2   . GLU F 3 170 ? -19.572 36.092  34.712  1.00 43.70  ? 169 GLU B OE2   1 
ATOM   4814 N  N     . GLU F 3 171 ? -18.386 30.276  32.938  1.00 38.32  ? 170 GLU B N     1 
ATOM   4815 C  CA    . GLU F 3 171 ? -18.742 29.139  32.105  1.00 37.97  ? 170 GLU B CA    1 
ATOM   4816 C  C     . GLU F 3 171 ? -17.787 27.950  32.312  1.00 37.46  ? 170 GLU B C     1 
ATOM   4817 O  O     . GLU F 3 171 ? -18.196 26.790  32.203  1.00 37.58  ? 170 GLU B O     1 
ATOM   4818 C  CB    . GLU F 3 171 ? -18.821 29.591  30.643  1.00 38.49  ? 170 GLU B CB    1 
ATOM   4819 C  CG    . GLU F 3 171 ? -19.042 28.519  29.566  1.00 39.23  ? 170 GLU B CG    1 
ATOM   4820 C  CD    . GLU F 3 171 ? -20.441 27.938  29.478  1.00 41.65  ? 170 GLU B CD    1 
ATOM   4821 O  OE1   . GLU F 3 171 ? -21.085 27.766  30.538  1.00 43.33  ? 170 GLU B OE1   1 
ATOM   4822 O  OE2   . GLU F 3 171 ? -20.883 27.598  28.342  1.00 42.41  ? 170 GLU B OE2   1 
ATOM   4823 N  N     . VAL F 3 172 ? -16.532 28.225  32.648  1.00 36.96  ? 171 VAL B N     1 
ATOM   4824 C  CA    . VAL F 3 172 ? -15.594 27.145  32.951  1.00 36.73  ? 171 VAL B CA    1 
ATOM   4825 C  C     . VAL F 3 172 ? -16.037 26.401  34.196  1.00 36.77  ? 171 VAL B C     1 
ATOM   4826 O  O     . VAL F 3 172 ? -16.186 25.182  34.164  1.00 35.65  ? 171 VAL B O     1 
ATOM   4827 C  CB    . VAL F 3 172 ? -14.168 27.657  33.110  1.00 36.72  ? 171 VAL B CB    1 
ATOM   4828 C  CG1   . VAL F 3 172 ? -13.251 26.551  33.637  1.00 36.75  ? 171 VAL B CG1   1 
ATOM   4829 C  CG2   . VAL F 3 172 ? -13.680 28.174  31.792  1.00 35.14  ? 171 VAL B CG2   1 
ATOM   4830 N  N     . LYS F 3 173 ? -16.271 27.153  35.276  1.00 37.62  ? 172 LYS B N     1 
ATOM   4831 C  CA    . LYS F 3 173 ? -16.912 26.625  36.499  1.00 38.57  ? 172 LYS B CA    1 
ATOM   4832 C  C     . LYS F 3 173 ? -18.142 25.704  36.220  1.00 38.81  ? 172 LYS B C     1 
ATOM   4833 O  O     . LYS F 3 173 ? -18.117 24.504  36.538  1.00 38.98  ? 172 LYS B O     1 
ATOM   4834 C  CB    . LYS F 3 173 ? -17.270 27.771  37.474  1.00 38.68  ? 172 LYS B CB    1 
ATOM   4835 C  CG    . LYS F 3 173 ? -16.018 28.441  38.082  1.00 39.27  ? 172 LYS B CG    1 
ATOM   4836 C  CD    . LYS F 3 173 ? -16.286 29.056  39.436  1.00 39.59  ? 172 LYS B CD    1 
ATOM   4837 C  CE    . LYS F 3 173 ? -16.550 27.972  40.500  1.00 39.76  ? 172 LYS B CE    1 
ATOM   4838 N  NZ    . LYS F 3 173 ? -17.591 28.330  41.531  1.00 38.53  ? 172 LYS B NZ    1 
ATOM   4839 N  N     . ARG F 3 174 ? -19.183 26.253  35.601  1.00 38.70  ? 173 ARG B N     1 
ATOM   4840 C  CA    . ARG F 3 174 ? -20.371 25.487  35.257  1.00 39.38  ? 173 ARG B CA    1 
ATOM   4841 C  C     . ARG F 3 174 ? -20.112 24.099  34.601  1.00 39.68  ? 173 ARG B C     1 
ATOM   4842 O  O     . ARG F 3 174 ? -20.797 23.138  34.931  1.00 39.87  ? 173 ARG B O     1 
ATOM   4843 C  CB    . ARG F 3 174 ? -21.285 26.355  34.391  1.00 39.78  ? 173 ARG B CB    1 
ATOM   4844 C  CG    . ARG F 3 174 ? -22.700 25.825  34.197  1.00 41.55  ? 173 ARG B CG    1 
ATOM   4845 C  CD    . ARG F 3 174 ? -23.531 26.692  33.215  1.00 43.28  ? 173 ARG B CD    1 
ATOM   4846 N  NE    . ARG F 3 174 ? -23.057 26.655  31.810  1.00 43.68  ? 173 ARG B NE    1 
ATOM   4847 C  CZ    . ARG F 3 174 ? -23.065 25.592  31.002  1.00 43.36  ? 173 ARG B CZ    1 
ATOM   4848 N  NH1   . ARG F 3 174 ? -23.479 24.410  31.421  1.00 43.23  ? 173 ARG B NH1   1 
ATOM   4849 N  NH2   . ARG F 3 174 ? -22.606 25.706  29.764  1.00 44.01  ? 173 ARG B NH2   1 
ATOM   4850 N  N     . LEU F 3 175 ? -19.136 23.986  33.691  1.00 39.82  ? 174 LEU B N     1 
ATOM   4851 C  CA    . LEU F 3 175 ? -18.872 22.700  32.996  1.00 40.10  ? 174 LEU B CA    1 
ATOM   4852 C  C     . LEU F 3 175 ? -18.048 21.658  33.805  1.00 40.31  ? 174 LEU B C     1 
ATOM   4853 O  O     . LEU F 3 175 ? -18.206 20.447  33.632  1.00 39.96  ? 174 LEU B O     1 
ATOM   4854 C  CB    . LEU F 3 175 ? -18.271 22.911  31.582  1.00 40.05  ? 174 LEU B CB    1 
ATOM   4855 C  CG    . LEU F 3 175 ? -18.930 23.885  30.577  1.00 39.79  ? 174 LEU B CG    1 
ATOM   4856 C  CD1   . LEU F 3 175 ? -17.931 24.385  29.527  1.00 39.03  ? 174 LEU B CD1   1 
ATOM   4857 C  CD2   . LEU F 3 175 ? -20.187 23.345  29.896  1.00 37.89  ? 174 LEU B CD2   1 
ATOM   4858 N  N     . ILE F 3 176 ? -17.160 22.108  34.677  1.00 40.90  ? 175 ILE B N     1 
ATOM   4859 C  CA    . ILE F 3 176 ? -16.580 21.162  35.640  1.00 41.52  ? 175 ILE B CA    1 
ATOM   4860 C  C     . ILE F 3 176 ? -17.731 20.475  36.394  1.00 42.41  ? 175 ILE B C     1 
ATOM   4861 O  O     . ILE F 3 176 ? -17.706 19.264  36.600  1.00 43.04  ? 175 ILE B O     1 
ATOM   4862 C  CB    . ILE F 3 176 ? -15.600 21.834  36.623  1.00 41.04  ? 175 ILE B CB    1 
ATOM   4863 C  CG1   . ILE F 3 176 ? -14.467 22.499  35.848  1.00 39.37  ? 175 ILE B CG1   1 
ATOM   4864 C  CG2   . ILE F 3 176 ? -15.030 20.814  37.588  1.00 40.64  ? 175 ILE B CG2   1 
ATOM   4865 C  CD1   . ILE F 3 176 ? -13.685 23.460  36.660  1.00 36.57  ? 175 ILE B CD1   1 
ATOM   4866 N  N     . ARG F 3 177 ? -18.751 21.233  36.781  1.00 43.00  ? 176 ARG B N     1 
ATOM   4867 C  CA    . ARG F 3 177 ? -19.907 20.609  37.402  1.00 44.13  ? 176 ARG B CA    1 
ATOM   4868 C  C     . ARG F 3 177 ? -20.712 19.770  36.386  1.00 45.42  ? 176 ARG B C     1 
ATOM   4869 O  O     . ARG F 3 177 ? -20.935 18.572  36.599  1.00 45.62  ? 176 ARG B O     1 
ATOM   4870 C  CB    . ARG F 3 177 ? -20.793 21.657  38.099  1.00 43.79  ? 176 ARG B CB    1 
ATOM   4871 C  CG    . ARG F 3 177 ? -20.337 21.991  39.481  1.00 43.44  ? 176 ARG B CG    1 
ATOM   4872 C  CD    . ARG F 3 177 ? -21.166 23.073  40.103  1.00 42.52  ? 176 ARG B CD    1 
ATOM   4873 N  NE    . ARG F 3 177 ? -20.643 24.407  39.834  1.00 42.35  ? 176 ARG B NE    1 
ATOM   4874 C  CZ    . ARG F 3 177 ? -21.279 25.325  39.109  1.00 41.32  ? 176 ARG B CZ    1 
ATOM   4875 N  NH1   . ARG F 3 177 ? -22.475 25.067  38.575  1.00 40.32  ? 176 ARG B NH1   1 
ATOM   4876 N  NH2   . ARG F 3 177 ? -20.728 26.515  38.933  1.00 40.62  ? 176 ARG B NH2   1 
ATOM   4877 N  N     . GLU F 3 178 ? -21.071 20.394  35.261  1.00 46.44  ? 177 GLU B N     1 
ATOM   4878 C  CA    . GLU F 3 178 ? -22.206 19.976  34.447  1.00 47.77  ? 177 GLU B CA    1 
ATOM   4879 C  C     . GLU F 3 178 ? -21.855 19.221  33.149  1.00 47.91  ? 177 GLU B C     1 
ATOM   4880 O  O     . GLU F 3 178 ? -22.685 18.485  32.611  1.00 48.19  ? 177 GLU B O     1 
ATOM   4881 C  CB    . GLU F 3 178 ? -23.048 21.216  34.111  1.00 48.17  ? 177 GLU B CB    1 
ATOM   4882 C  CG    . GLU F 3 178 ? -24.535 21.051  34.299  1.00 49.61  ? 177 GLU B CG    1 
ATOM   4883 C  CD    . GLU F 3 178 ? -24.989 21.469  35.688  1.00 51.19  ? 177 GLU B CD    1 
ATOM   4884 O  OE1   . GLU F 3 178 ? -25.481 22.615  35.847  1.00 51.98  ? 177 GLU B OE1   1 
ATOM   4885 O  OE2   . GLU F 3 178 ? -24.850 20.652  36.623  1.00 51.80  ? 177 GLU B OE2   1 
ATOM   4886 N  N     . LEU F 3 179 ? -20.642 19.418  32.640  1.00 48.07  ? 178 LEU B N     1 
ATOM   4887 C  CA    . LEU F 3 179 ? -20.190 18.724  31.430  1.00 47.63  ? 178 LEU B CA    1 
ATOM   4888 C  C     . LEU F 3 179 ? -19.798 17.279  31.693  1.00 47.71  ? 178 LEU B C     1 
ATOM   4889 O  O     . LEU F 3 179 ? -19.125 16.962  32.675  1.00 47.99  ? 178 LEU B O     1 
ATOM   4890 C  CB    . LEU F 3 179 ? -19.013 19.457  30.762  1.00 47.62  ? 178 LEU B CB    1 
ATOM   4891 C  CG    . LEU F 3 179 ? -18.422 18.802  29.501  1.00 46.98  ? 178 LEU B CG    1 
ATOM   4892 C  CD1   . LEU F 3 179 ? -18.999 19.385  28.222  1.00 45.86  ? 178 LEU B CD1   1 
ATOM   4893 C  CD2   . LEU F 3 179 ? -16.921 18.948  29.523  1.00 46.83  ? 178 LEU B CD2   1 
ATOM   4894 N  N     . ASP F 3 180 ? -20.186 16.439  30.743  1.00 47.74  ? 179 ASP B N     1 
ATOM   4895 C  CA    . ASP F 3 180 ? -20.011 15.013  30.751  1.00 47.53  ? 179 ASP B CA    1 
ATOM   4896 C  C     . ASP F 3 180 ? -18.568 14.634  30.592  1.00 47.49  ? 179 ASP B C     1 
ATOM   4897 O  O     . ASP F 3 180 ? -17.999 14.827  29.518  1.00 47.82  ? 179 ASP B O     1 
ATOM   4898 C  CB    . ASP F 3 180 ? -20.781 14.449  29.563  1.00 48.05  ? 179 ASP B CB    1 
ATOM   4899 C  CG    . ASP F 3 180 ? -21.010 12.960  29.669  1.00 49.37  ? 179 ASP B CG    1 
ATOM   4900 O  OD1   . ASP F 3 180 ? -20.076 12.231  30.089  1.00 50.34  ? 179 ASP B OD1   1 
ATOM   4901 O  OD2   . ASP F 3 180 ? -22.131 12.520  29.317  1.00 51.06  ? 179 ASP B OD2   1 
ATOM   4902 N  N     . ILE F 3 181 ? -17.982 14.038  31.623  1.00 47.13  ? 180 ILE B N     1 
ATOM   4903 C  CA    . ILE F 3 181 ? -16.603 13.567  31.548  1.00 46.05  ? 180 ILE B CA    1 
ATOM   4904 C  C     . ILE F 3 181 ? -16.200 13.096  30.145  1.00 45.50  ? 180 ILE B C     1 
ATOM   4905 O  O     . ILE F 3 181 ? -15.156 13.498  29.631  1.00 45.27  ? 180 ILE B O     1 
ATOM   4906 C  CB    . ILE F 3 181 ? -16.344 12.426  32.551  1.00 45.71  ? 180 ILE B CB    1 
ATOM   4907 C  CG1   . ILE F 3 181 ? -14.888 12.448  33.020  1.00 45.73  ? 180 ILE B CG1   1 
ATOM   4908 C  CG2   . ILE F 3 181 ? -16.688 11.081  31.928  1.00 45.30  ? 180 ILE B CG2   1 
ATOM   4909 C  CD1   . ILE F 3 181 ? -14.501 13.716  33.749  1.00 44.50  ? 180 ILE B CD1   1 
ATOM   4910 N  N     . ALA F 3 182 ? -17.019 12.243  29.533  1.00 44.99  ? 181 ALA B N     1 
ATOM   4911 C  CA    . ALA F 3 182 ? -16.676 11.656  28.210  1.00 44.48  ? 181 ALA B CA    1 
ATOM   4912 C  C     . ALA F 3 182 ? -16.527 12.690  27.100  1.00 43.80  ? 181 ALA B C     1 
ATOM   4913 O  O     . ALA F 3 182 ? -15.904 12.406  26.078  1.00 44.55  ? 181 ALA B O     1 
ATOM   4914 C  CB    . ALA F 3 182 ? -17.674 10.589  27.794  1.00 44.34  ? 181 ALA B CB    1 
ATOM   4915 N  N     . ASP F 3 183 ? -17.103 13.870  27.308  1.00 42.75  ? 182 ASP B N     1 
ATOM   4916 C  CA    . ASP F 3 183 ? -16.900 15.004  26.425  1.00 42.55  ? 182 ASP B CA    1 
ATOM   4917 C  C     . ASP F 3 183 ? -15.616 15.794  26.754  1.00 42.12  ? 182 ASP B C     1 
ATOM   4918 O  O     . ASP F 3 183 ? -15.512 16.961  26.397  1.00 42.87  ? 182 ASP B O     1 
ATOM   4919 C  CB    . ASP F 3 183 ? -18.107 15.966  26.465  1.00 42.84  ? 182 ASP B CB    1 
ATOM   4920 C  CG    . ASP F 3 183 ? -19.370 15.387  25.822  1.00 43.29  ? 182 ASP B CG    1 
ATOM   4921 O  OD1   . ASP F 3 183 ? -19.279 14.392  25.081  1.00 44.39  ? 182 ASP B OD1   1 
ATOM   4922 O  OD2   . ASP F 3 183 ? -20.474 15.940  26.063  1.00 43.46  ? 182 ASP B OD2   1 
ATOM   4923 N  N     . VAL F 3 184 ? -14.639 15.173  27.407  1.00 40.91  ? 183 VAL B N     1 
ATOM   4924 C  CA    . VAL F 3 184 ? -13.400 15.865  27.736  1.00 39.85  ? 183 VAL B CA    1 
ATOM   4925 C  C     . VAL F 3 184 ? -12.229 15.494  26.789  1.00 39.97  ? 183 VAL B C     1 
ATOM   4926 O  O     . VAL F 3 184 ? -11.863 14.321  26.689  1.00 39.81  ? 183 VAL B O     1 
ATOM   4927 C  CB    . VAL F 3 184 ? -13.005 15.570  29.188  1.00 39.75  ? 183 VAL B CB    1 
ATOM   4928 C  CG1   . VAL F 3 184 ? -11.669 16.221  29.529  1.00 38.17  ? 183 VAL B CG1   1 
ATOM   4929 C  CG2   . VAL F 3 184 ? -14.120 16.029  30.135  1.00 39.83  ? 183 VAL B CG2   1 
ATOM   4930 N  N     . PRO F 3 185 ? -11.619 16.497  26.117  1.00 39.93  ? 184 PRO B N     1 
ATOM   4931 C  CA    . PRO F 3 185 ? -10.503 16.296  25.174  1.00 40.39  ? 184 PRO B CA    1 
ATOM   4932 C  C     . PRO F 3 185 ? -9.458  15.348  25.725  1.00 40.49  ? 184 PRO B C     1 
ATOM   4933 O  O     . PRO F 3 185 ? -9.044  15.555  26.844  1.00 40.71  ? 184 PRO B O     1 
ATOM   4934 C  CB    . PRO F 3 185 ? -9.900  17.698  25.072  1.00 40.65  ? 184 PRO B CB    1 
ATOM   4935 C  CG    . PRO F 3 185 ? -11.073 18.592  25.230  1.00 39.70  ? 184 PRO B CG    1 
ATOM   4936 C  CD    . PRO F 3 185 ? -11.965 17.922  26.238  1.00 39.66  ? 184 PRO B CD    1 
ATOM   4937 N  N     . GLY F 3 186 ? -9.041  14.340  24.945  1.00 40.97  ? 185 GLY B N     1 
ATOM   4938 C  CA    . GLY F 3 186 ? -8.184  13.222  25.443  1.00 41.92  ? 185 GLY B CA    1 
ATOM   4939 C  C     . GLY F 3 186 ? -8.928  12.050  26.113  1.00 42.17  ? 185 GLY B C     1 
ATOM   4940 O  O     . GLY F 3 186 ? -8.345  11.023  26.456  1.00 41.62  ? 185 GLY B O     1 
ATOM   4941 N  N     . ILE F 3 187 ? -10.232 12.219  26.296  1.00 43.02  ? 186 ILE B N     1 
ATOM   4942 C  CA    . ILE F 3 187 ? -11.072 11.218  26.944  1.00 43.48  ? 186 ILE B CA    1 
ATOM   4943 C  C     . ILE F 3 187 ? -12.049 10.601  25.945  1.00 44.32  ? 186 ILE B C     1 
ATOM   4944 O  O     . ILE F 3 187 ? -13.023 11.228  25.509  1.00 44.02  ? 186 ILE B O     1 
ATOM   4945 C  CB    . ILE F 3 187 ? -11.791 11.785  28.209  1.00 43.01  ? 186 ILE B CB    1 
ATOM   4946 C  CG1   . ILE F 3 187 ? -10.767 12.278  29.250  1.00 42.88  ? 186 ILE B CG1   1 
ATOM   4947 C  CG2   . ILE F 3 187 ? -12.773 10.745  28.813  1.00 42.87  ? 186 ILE B CG2   1 
ATOM   4948 C  CD1   . ILE F 3 187 ? -9.552  11.344  29.527  1.00 41.18  ? 186 ILE B CD1   1 
ATOM   4949 N  N     . GLY F 3 188 ? -11.757 9.352   25.607  1.00 46.03  ? 187 GLY B N     1 
ATOM   4950 C  CA    . GLY F 3 188 ? -12.509 8.586   24.620  1.00 48.52  ? 187 GLY B CA    1 
ATOM   4951 C  C     . GLY F 3 188 ? -13.529 7.626   25.222  1.00 49.89  ? 187 GLY B C     1 
ATOM   4952 O  O     . GLY F 3 188 ? -14.034 7.856   26.314  1.00 49.59  ? 187 GLY B O     1 
ATOM   4953 N  N     . ASN F 3 189 ? -13.817 6.554   24.485  1.00 51.55  ? 188 ASN B N     1 
ATOM   4954 C  CA    . ASN F 3 189 ? -14.862 5.580   24.827  1.00 53.10  ? 188 ASN B CA    1 
ATOM   4955 C  C     . ASN F 3 189 ? -14.484 4.712   26.029  1.00 53.79  ? 188 ASN B C     1 
ATOM   4956 O  O     . ASN F 3 189 ? -15.229 4.656   26.999  1.00 54.06  ? 188 ASN B O     1 
ATOM   4957 C  CB    . ASN F 3 189 ? -15.205 4.720   23.583  1.00 53.61  ? 188 ASN B CB    1 
ATOM   4958 C  CG    . ASN F 3 189 ? -16.212 3.567   23.880  1.00 54.99  ? 188 ASN B CG    1 
ATOM   4959 O  OD1   . ASN F 3 189 ? -15.947 2.396   23.546  1.00 55.55  ? 188 ASN B OD1   1 
ATOM   4960 N  ND2   . ASN F 3 189 ? -17.375 3.904   24.481  1.00 55.29  ? 188 ASN B ND2   1 
ATOM   4961 N  N     . ILE F 3 190 ? -13.320 4.062   25.958  1.00 54.76  ? 189 ILE B N     1 
ATOM   4962 C  CA    . ILE F 3 190 ? -12.841 3.160   26.995  1.00 55.71  ? 189 ILE B CA    1 
ATOM   4963 C  C     . ILE F 3 190 ? -12.793 3.840   28.370  1.00 56.59  ? 189 ILE B C     1 
ATOM   4964 O  O     . ILE F 3 190 ? -13.411 3.358   29.330  1.00 56.74  ? 189 ILE B O     1 
ATOM   4965 C  CB    . ILE F 3 190 ? -11.429 2.601   26.667  1.00 55.79  ? 189 ILE B CB    1 
ATOM   4966 C  CG1   . ILE F 3 190 ? -11.456 1.647   25.466  1.00 56.06  ? 189 ILE B CG1   1 
ATOM   4967 C  CG2   . ILE F 3 190 ? -10.838 1.891   27.894  1.00 56.04  ? 189 ILE B CG2   1 
ATOM   4968 C  CD1   . ILE F 3 190 ? -11.241 2.296   24.100  1.00 56.69  ? 189 ILE B CD1   1 
ATOM   4969 N  N     . THR F 3 191 ? -12.066 4.958   28.447  1.00 57.25  ? 190 THR B N     1 
ATOM   4970 C  CA    . THR F 3 191 ? -11.873 5.700   29.685  1.00 57.85  ? 190 THR B CA    1 
ATOM   4971 C  C     . THR F 3 191 ? -13.216 6.121   30.279  1.00 58.38  ? 190 THR B C     1 
ATOM   4972 O  O     . THR F 3 191 ? -13.417 6.023   31.494  1.00 58.33  ? 190 THR B O     1 
ATOM   4973 C  CB    . THR F 3 191 ? -10.885 6.896   29.467  1.00 57.91  ? 190 THR B CB    1 
ATOM   4974 O  OG1   . THR F 3 191 ? -9.535  6.416   29.531  1.00 57.65  ? 190 THR B OG1   1 
ATOM   4975 C  CG2   . THR F 3 191 ? -11.056 7.993   30.508  1.00 58.37  ? 190 THR B CG2   1 
ATOM   4976 N  N     . ALA F 3 192 ? -14.133 6.549   29.408  1.00 59.14  ? 191 ALA B N     1 
ATOM   4977 C  CA    . ALA F 3 192 ? -15.489 6.956   29.797  1.00 59.99  ? 191 ALA B CA    1 
ATOM   4978 C  C     . ALA F 3 192 ? -16.325 5.793   30.377  1.00 60.64  ? 191 ALA B C     1 
ATOM   4979 O  O     . ALA F 3 192 ? -17.123 5.985   31.312  1.00 60.67  ? 191 ALA B O     1 
ATOM   4980 C  CB    . ALA F 3 192 ? -16.203 7.581   28.615  1.00 59.83  ? 191 ALA B CB    1 
ATOM   4981 N  N     . GLU F 3 193 ? -16.146 4.607   29.789  1.00 61.14  ? 192 GLU B N     1 
ATOM   4982 C  CA    . GLU F 3 193 ? -16.675 3.338   30.305  1.00 61.36  ? 192 GLU B CA    1 
ATOM   4983 C  C     . GLU F 3 193 ? -16.071 2.997   31.683  1.00 61.28  ? 192 GLU B C     1 
ATOM   4984 O  O     . GLU F 3 193 ? -16.731 2.371   32.521  1.00 61.37  ? 192 GLU B O     1 
ATOM   4985 C  CB    . GLU F 3 193 ? -16.367 2.221   29.294  1.00 61.49  ? 192 GLU B CB    1 
ATOM   4986 C  CG    . GLU F 3 193 ? -16.228 0.810   29.873  1.00 61.84  ? 192 GLU B CG    1 
ATOM   4987 C  CD    . GLU F 3 193 ? -17.553 0.042   29.879  1.00 61.78  ? 192 GLU B CD    1 
ATOM   4988 O  OE1   . GLU F 3 193 ? -18.112 -0.151  28.776  1.00 60.79  ? 192 GLU B OE1   1 
ATOM   4989 O  OE2   . GLU F 3 193 ? -18.015 -0.372  30.976  1.00 61.11  ? 192 GLU B OE2   1 
ATOM   4990 N  N     . LYS F 3 194 ? -14.823 3.413   31.894  1.00 61.12  ? 193 LYS B N     1 
ATOM   4991 C  CA    . LYS F 3 194 ? -14.076 3.099   33.105  1.00 61.05  ? 193 LYS B CA    1 
ATOM   4992 C  C     . LYS F 3 194 ? -14.396 4.059   34.223  1.00 61.17  ? 193 LYS B C     1 
ATOM   4993 O  O     . LYS F 3 194 ? -14.393 3.688   35.396  1.00 61.49  ? 193 LYS B O     1 
ATOM   4994 C  CB    . LYS F 3 194 ? -12.582 3.127   32.832  1.00 60.95  ? 193 LYS B CB    1 
ATOM   4995 C  CG    . LYS F 3 194 ? -11.984 1.788   32.493  1.00 61.53  ? 193 LYS B CG    1 
ATOM   4996 C  CD    . LYS F 3 194 ? -12.064 0.851   33.697  1.00 62.70  ? 193 LYS B CD    1 
ATOM   4997 C  CE    . LYS F 3 194 ? -10.842 -0.041  33.799  1.00 63.21  ? 193 LYS B CE    1 
ATOM   4998 N  NZ    . LYS F 3 194 ? -11.021 -1.048  34.865  1.00 63.29  ? 193 LYS B NZ    1 
ATOM   4999 N  N     . LEU F 3 195 ? -14.679 5.297   33.857  1.00 61.11  ? 194 LEU B N     1 
ATOM   5000 C  CA    . LEU F 3 195 ? -15.020 6.297   34.847  1.00 61.34  ? 194 LEU B CA    1 
ATOM   5001 C  C     . LEU F 3 195 ? -16.489 6.163   35.287  1.00 61.30  ? 194 LEU B C     1 
ATOM   5002 O  O     . LEU F 3 195 ? -16.826 6.427   36.443  1.00 61.23  ? 194 LEU B O     1 
ATOM   5003 C  CB    . LEU F 3 195 ? -14.662 7.708   34.339  1.00 61.37  ? 194 LEU B CB    1 
ATOM   5004 C  CG    . LEU F 3 195 ? -13.149 8.068   34.297  1.00 61.70  ? 194 LEU B CG    1 
ATOM   5005 C  CD1   . LEU F 3 195 ? -12.905 9.435   33.669  1.00 61.50  ? 194 LEU B CD1   1 
ATOM   5006 C  CD2   . LEU F 3 195 ? -12.454 8.010   35.676  1.00 61.38  ? 194 LEU B CD2   1 
ATOM   5007 N  N     . LYS F 3 196 ? -17.341 5.730   34.356  1.00 61.36  ? 195 LYS B N     1 
ATOM   5008 C  CA    . LYS F 3 196 ? -18.766 5.451   34.606  1.00 60.94  ? 195 LYS B CA    1 
ATOM   5009 C  C     . LYS F 3 196 ? -18.918 4.374   35.680  1.00 60.41  ? 195 LYS B C     1 
ATOM   5010 O  O     . LYS F 3 196 ? -19.727 4.514   36.603  1.00 60.45  ? 195 LYS B O     1 
ATOM   5011 C  CB    . LYS F 3 196 ? -19.457 5.017   33.304  1.00 61.06  ? 195 LYS B CB    1 
ATOM   5012 C  CG    . LYS F 3 196 ? -20.965 4.749   33.407  1.00 61.94  ? 195 LYS B CG    1 
ATOM   5013 C  CD    . LYS F 3 196 ? -21.300 3.249   33.593  1.00 62.09  ? 195 LYS B CD    1 
ATOM   5014 C  CE    . LYS F 3 196 ? -22.766 2.967   33.266  1.00 62.19  ? 195 LYS B CE    1 
ATOM   5015 N  NZ    . LYS F 3 196 ? -23.372 1.843   34.068  1.00 62.22  ? 195 LYS B NZ    1 
ATOM   5016 N  N     . LYS F 3 197 ? -18.133 3.308   35.552  1.00 59.59  ? 196 LYS B N     1 
ATOM   5017 C  CA    . LYS F 3 197 ? -18.132 2.234   36.541  1.00 58.83  ? 196 LYS B CA    1 
ATOM   5018 C  C     . LYS F 3 197 ? -17.496 2.620   37.890  1.00 58.09  ? 196 LYS B C     1 
ATOM   5019 O  O     . LYS F 3 197 ? -17.632 1.871   38.853  1.00 57.99  ? 196 LYS B O     1 
ATOM   5020 C  CB    . LYS F 3 197 ? -17.499 0.957   35.961  1.00 58.85  ? 196 LYS B CB    1 
ATOM   5021 C  CG    . LYS F 3 197 ? -18.519 -0.030  35.406  1.00 58.89  ? 196 LYS B CG    1 
ATOM   5022 C  CD    . LYS F 3 197 ? -19.009 -0.995  36.496  1.00 58.97  ? 196 LYS B CD    1 
ATOM   5023 C  CE    . LYS F 3 197 ? -20.467 -1.432  36.317  1.00 58.66  ? 196 LYS B CE    1 
ATOM   5024 N  NZ    . LYS F 3 197 ? -20.807 -1.797  34.914  1.00 58.34  ? 196 LYS B NZ    1 
ATOM   5025 N  N     . LEU F 3 198 ? -16.821 3.780   37.960  1.00 56.96  ? 197 LEU B N     1 
ATOM   5026 C  CA    . LEU F 3 198 ? -16.266 4.303   39.241  1.00 55.44  ? 197 LEU B CA    1 
ATOM   5027 C  C     . LEU F 3 198 ? -17.066 5.472   39.840  1.00 54.56  ? 197 LEU B C     1 
ATOM   5028 O  O     . LEU F 3 198 ? -16.590 6.137   40.767  1.00 54.63  ? 197 LEU B O     1 
ATOM   5029 C  CB    . LEU F 3 198 ? -14.792 4.725   39.117  1.00 55.04  ? 197 LEU B CB    1 
ATOM   5030 C  CG    . LEU F 3 198 ? -13.687 3.737   38.746  1.00 54.81  ? 197 LEU B CG    1 
ATOM   5031 C  CD1   . LEU F 3 198 ? -12.419 4.509   38.397  1.00 55.12  ? 197 LEU B CD1   1 
ATOM   5032 C  CD2   . LEU F 3 198 ? -13.400 2.705   39.814  1.00 53.67  ? 197 LEU B CD2   1 
ATOM   5033 N  N     . GLY F 3 199 ? -18.264 5.724   39.313  1.00 53.32  ? 198 GLY B N     1 
ATOM   5034 C  CA    . GLY F 3 199 ? -19.129 6.801   39.810  1.00 51.90  ? 198 GLY B CA    1 
ATOM   5035 C  C     . GLY F 3 199 ? -18.884 8.190   39.235  1.00 50.93  ? 198 GLY B C     1 
ATOM   5036 O  O     . GLY F 3 199 ? -19.608 9.136   39.559  1.00 50.65  ? 198 GLY B O     1 
ATOM   5037 N  N     . ILE F 3 200 ? -17.882 8.307   38.363  1.00 50.00  ? 199 ILE B N     1 
ATOM   5038 C  CA    . ILE F 3 200 ? -17.446 9.595   37.842  1.00 48.92  ? 199 ILE B CA    1 
ATOM   5039 C  C     . ILE F 3 200 ? -18.112 9.920   36.514  1.00 48.74  ? 199 ILE B C     1 
ATOM   5040 O  O     . ILE F 3 200 ? -17.666 9.479   35.465  1.00 49.15  ? 199 ILE B O     1 
ATOM   5041 C  CB    . ILE F 3 200 ? -15.900 9.656   37.722  1.00 48.77  ? 199 ILE B CB    1 
ATOM   5042 C  CG1   . ILE F 3 200 ? -15.251 9.398   39.092  1.00 48.09  ? 199 ILE B CG1   1 
ATOM   5043 C  CG2   . ILE F 3 200 ? -15.445 11.007  37.163  1.00 48.25  ? 199 ILE B CG2   1 
ATOM   5044 C  CD1   . ILE F 3 200 ? -13.720 9.226   39.060  1.00 46.73  ? 199 ILE B CD1   1 
ATOM   5045 N  N     . ASN F 3 201 ? -19.177 10.711  36.564  1.00 48.36  ? 200 ASN B N     1 
ATOM   5046 C  CA    . ASN F 3 201 ? -19.915 11.121  35.364  1.00 47.97  ? 200 ASN B CA    1 
ATOM   5047 C  C     . ASN F 3 201 ? -19.560 12.529  34.848  1.00 47.46  ? 200 ASN B C     1 
ATOM   5048 O  O     . ASN F 3 201 ? -19.726 12.825  33.655  1.00 47.19  ? 200 ASN B O     1 
ATOM   5049 C  CB    . ASN F 3 201 ? -21.417 11.070  35.646  1.00 48.34  ? 200 ASN B CB    1 
ATOM   5050 C  CG    . ASN F 3 201 ? -21.888 9.685   36.031  1.00 49.46  ? 200 ASN B CG    1 
ATOM   5051 O  OD1   . ASN F 3 201 ? -22.109 8.840   35.164  1.00 51.21  ? 200 ASN B OD1   1 
ATOM   5052 N  ND2   . ASN F 3 201 ? -22.042 9.439   37.339  1.00 49.45  ? 200 ASN B ND2   1 
ATOM   5053 N  N     . LYS F 3 202 ? -19.123 13.398  35.767  1.00 46.81  ? 201 LYS B N     1 
ATOM   5054 C  CA    . LYS F 3 202 ? -18.662 14.756  35.454  1.00 45.93  ? 201 LYS B CA    1 
ATOM   5055 C  C     . LYS F 3 202 ? -17.194 14.934  35.891  1.00 45.21  ? 201 LYS B C     1 
ATOM   5056 O  O     . LYS F 3 202 ? -16.654 14.115  36.641  1.00 45.11  ? 201 LYS B O     1 
ATOM   5057 C  CB    . LYS F 3 202 ? -19.574 15.804  36.118  1.00 46.25  ? 201 LYS B CB    1 
ATOM   5058 C  CG    . LYS F 3 202 ? -21.092 15.610  35.882  1.00 47.04  ? 201 LYS B CG    1 
ATOM   5059 C  CD    . LYS F 3 202 ? -21.525 16.124  34.517  1.00 47.79  ? 201 LYS B CD    1 
ATOM   5060 C  CE    . LYS F 3 202 ? -22.218 15.031  33.686  1.00 49.40  ? 201 LYS B CE    1 
ATOM   5061 N  NZ    . LYS F 3 202 ? -23.700 14.868  33.932  1.00 50.07  ? 201 LYS B NZ    1 
ATOM   5062 N  N     . LEU F 3 203 ? -16.539 15.979  35.394  1.00 44.45  ? 202 LEU B N     1 
ATOM   5063 C  CA    . LEU F 3 203 ? -15.164 16.283  35.793  1.00 43.62  ? 202 LEU B CA    1 
ATOM   5064 C  C     . LEU F 3 203 ? -15.044 16.426  37.311  1.00 43.44  ? 202 LEU B C     1 
ATOM   5065 O  O     . LEU F 3 203 ? -14.064 16.012  37.906  1.00 42.70  ? 202 LEU B O     1 
ATOM   5066 C  CB    . LEU F 3 203 ? -14.669 17.573  35.121  1.00 43.37  ? 202 LEU B CB    1 
ATOM   5067 C  CG    . LEU F 3 203 ? -13.676 17.490  33.959  1.00 41.91  ? 202 LEU B CG    1 
ATOM   5068 C  CD1   . LEU F 3 203 ? -13.371 18.892  33.379  1.00 40.69  ? 202 LEU B CD1   1 
ATOM   5069 C  CD2   . LEU F 3 203 ? -12.433 16.806  34.393  1.00 40.16  ? 202 LEU B CD2   1 
ATOM   5070 N  N     . VAL F 3 204 ? -16.058 17.031  37.912  1.00 43.59  ? 203 VAL B N     1 
ATOM   5071 C  CA    . VAL F 3 204 ? -16.096 17.247  39.351  1.00 44.36  ? 203 VAL B CA    1 
ATOM   5072 C  C     . VAL F 3 204 ? -15.931 15.962  40.188  1.00 44.52  ? 203 VAL B C     1 
ATOM   5073 O  O     . VAL F 3 204 ? -15.091 15.894  41.085  1.00 44.25  ? 203 VAL B O     1 
ATOM   5074 C  CB    . VAL F 3 204 ? -17.359 18.062  39.735  1.00 44.23  ? 203 VAL B CB    1 
ATOM   5075 C  CG1   . VAL F 3 204 ? -18.258 17.277  40.657  1.00 44.64  ? 203 VAL B CG1   1 
ATOM   5076 C  CG2   . VAL F 3 204 ? -16.948 19.393  40.334  1.00 43.68  ? 203 VAL B CG2   1 
ATOM   5077 N  N     . ASP F 3 205 ? -16.706 14.941  39.841  1.00 44.89  ? 204 ASP B N     1 
ATOM   5078 C  CA    . ASP F 3 205 ? -16.679 13.654  40.514  1.00 45.25  ? 204 ASP B CA    1 
ATOM   5079 C  C     . ASP F 3 205 ? -15.267 13.065  40.673  1.00 45.47  ? 204 ASP B C     1 
ATOM   5080 O  O     . ASP F 3 205 ? -15.039 12.169  41.496  1.00 46.02  ? 204 ASP B O     1 
ATOM   5081 C  CB    . ASP F 3 205 ? -17.609 12.686  39.774  1.00 45.50  ? 204 ASP B CB    1 
ATOM   5082 C  CG    . ASP F 3 205 ? -19.024 13.261  39.569  1.00 46.09  ? 204 ASP B CG    1 
ATOM   5083 O  OD1   . ASP F 3 205 ? -19.431 14.190  40.315  1.00 45.10  ? 204 ASP B OD1   1 
ATOM   5084 O  OD2   . ASP F 3 205 ? -19.733 12.773  38.651  1.00 47.65  ? 204 ASP B OD2   1 
ATOM   5085 N  N     . THR F 3 206 ? -14.301 13.586  39.930  1.00 45.36  ? 205 THR B N     1 
ATOM   5086 C  CA    . THR F 3 206 ? -12.938 13.110  40.092  1.00 45.34  ? 205 THR B CA    1 
ATOM   5087 C  C     . THR F 3 206 ? -12.350 13.558  41.423  1.00 45.85  ? 205 THR B C     1 
ATOM   5088 O  O     . THR F 3 206 ? -11.348 13.016  41.880  1.00 45.82  ? 205 THR B O     1 
ATOM   5089 C  CB    . THR F 3 206 ? -12.021 13.479  38.904  1.00 45.27  ? 205 THR B CB    1 
ATOM   5090 O  OG1   . THR F 3 206 ? -11.643 14.862  38.962  1.00 44.58  ? 205 THR B OG1   1 
ATOM   5091 C  CG2   . THR F 3 206 ? -12.710 13.159  37.564  1.00 44.72  ? 205 THR B CG2   1 
ATOM   5092 N  N     . LEU F 3 207 ? -12.979 14.533  42.062  1.00 46.10  ? 206 LEU B N     1 
ATOM   5093 C  CA    . LEU F 3 207 ? -12.507 14.939  43.377  1.00 46.66  ? 206 LEU B CA    1 
ATOM   5094 C  C     . LEU F 3 207 ? -13.152 14.178  44.542  1.00 47.07  ? 206 LEU B C     1 
ATOM   5095 O  O     . LEU F 3 207 ? -12.604 14.159  45.634  1.00 46.89  ? 206 LEU B O     1 
ATOM   5096 C  CB    . LEU F 3 207 ? -12.558 16.468  43.546  1.00 46.49  ? 206 LEU B CB    1 
ATOM   5097 C  CG    . LEU F 3 207 ? -11.670 17.222  42.529  1.00 46.19  ? 206 LEU B CG    1 
ATOM   5098 C  CD1   . LEU F 3 207 ? -11.719 18.728  42.726  1.00 46.40  ? 206 LEU B CD1   1 
ATOM   5099 C  CD2   . LEU F 3 207 ? -10.243 16.748  42.554  1.00 44.22  ? 206 LEU B CD2   1 
ATOM   5100 N  N     . SER F 3 208 ? -14.280 13.525  44.281  1.00 47.86  ? 207 SER B N     1 
ATOM   5101 C  CA    . SER F 3 208 ? -14.956 12.726  45.298  1.00 48.47  ? 207 SER B CA    1 
ATOM   5102 C  C     . SER F 3 208 ? -14.477 11.273  45.298  1.00 49.10  ? 207 SER B C     1 
ATOM   5103 O  O     . SER F 3 208 ? -15.270 10.350  45.488  1.00 49.60  ? 207 SER B O     1 
ATOM   5104 C  CB    . SER F 3 208 ? -16.473 12.778  45.099  1.00 48.19  ? 207 SER B CB    1 
ATOM   5105 O  OG    . SER F 3 208 ? -16.959 14.102  45.234  1.00 48.19  ? 207 SER B OG    1 
ATOM   5106 N  N     . ILE F 3 209 ? -13.179 11.077  45.087  1.00 49.74  ? 208 ILE B N     1 
ATOM   5107 C  CA    . ILE F 3 209 ? -12.590 9.751   45.091  1.00 50.27  ? 208 ILE B CA    1 
ATOM   5108 C  C     . ILE F 3 209 ? -11.100 9.900   45.348  1.00 50.66  ? 208 ILE B C     1 
ATOM   5109 O  O     . ILE F 3 209 ? -10.478 10.897  44.956  1.00 50.28  ? 208 ILE B O     1 
ATOM   5110 C  CB    . ILE F 3 209 ? -12.889 8.982   43.765  1.00 50.49  ? 208 ILE B CB    1 
ATOM   5111 C  CG1   . ILE F 3 209 ? -13.394 7.572   44.078  1.00 50.99  ? 208 ILE B CG1   1 
ATOM   5112 C  CG2   . ILE F 3 209 ? -11.694 9.001   42.794  1.00 49.97  ? 208 ILE B CG2   1 
ATOM   5113 C  CD1   . ILE F 3 209 ? -14.475 7.085   43.114  1.00 51.70  ? 208 ILE B CD1   1 
ATOM   5114 N  N     . GLU F 3 210 ? -10.555 8.914   46.051  1.00 51.31  ? 209 GLU B N     1 
ATOM   5115 C  CA    . GLU F 3 210 ? -9.160  8.901   46.455  1.00 51.75  ? 209 GLU B CA    1 
ATOM   5116 C  C     . GLU F 3 210 ? -8.308  8.789   45.210  1.00 52.18  ? 209 GLU B C     1 
ATOM   5117 O  O     . GLU F 3 210 ? -8.617  8.014   44.312  1.00 52.27  ? 209 GLU B O     1 
ATOM   5118 C  CB    . GLU F 3 210 ? -8.935  7.729   47.387  1.00 51.44  ? 209 GLU B CB    1 
ATOM   5119 C  CG    . GLU F 3 210 ? -7.534  7.560   47.866  1.00 51.03  ? 209 GLU B CG    1 
ATOM   5120 C  CD    . GLU F 3 210 ? -7.219  6.104   48.049  1.00 50.51  ? 209 GLU B CD    1 
ATOM   5121 O  OE1   . GLU F 3 210 ? -7.447  5.326   47.100  1.00 50.32  ? 209 GLU B OE1   1 
ATOM   5122 O  OE2   . GLU F 3 210 ? -6.765  5.728   49.136  1.00 49.88  ? 209 GLU B OE2   1 
ATOM   5123 N  N     . PHE F 3 211 ? -7.247  9.583   45.156  1.00 52.80  ? 210 PHE B N     1 
ATOM   5124 C  CA    . PHE F 3 211 ? -6.462  9.751   43.943  1.00 53.41  ? 210 PHE B CA    1 
ATOM   5125 C  C     . PHE F 3 211 ? -5.874  8.451   43.390  1.00 53.83  ? 210 PHE B C     1 
ATOM   5126 O  O     . PHE F 3 211 ? -5.699  8.299   42.187  1.00 53.30  ? 210 PHE B O     1 
ATOM   5127 C  CB    . PHE F 3 211 ? -5.359  10.784  44.163  1.00 53.31  ? 210 PHE B CB    1 
ATOM   5128 C  CG    . PHE F 3 211 ? -4.357  10.844  43.042  1.00 54.28  ? 210 PHE B CG    1 
ATOM   5129 C  CD1   . PHE F 3 211 ? -4.752  11.213  41.747  1.00 53.91  ? 210 PHE B CD1   1 
ATOM   5130 C  CD2   . PHE F 3 211 ? -3.021  10.530  43.270  1.00 54.81  ? 210 PHE B CD2   1 
ATOM   5131 C  CE1   . PHE F 3 211 ? -3.843  11.276  40.701  1.00 53.70  ? 210 PHE B CE1   1 
ATOM   5132 C  CE2   . PHE F 3 211 ? -2.090  10.588  42.214  1.00 55.27  ? 210 PHE B CE2   1 
ATOM   5133 C  CZ    . PHE F 3 211 ? -2.514  10.962  40.926  1.00 54.62  ? 210 PHE B CZ    1 
ATOM   5134 N  N     . ASP F 3 212 ? -5.589  7.512   44.277  1.00 54.62  ? 211 ASP B N     1 
ATOM   5135 C  CA    . ASP F 3 212 ? -4.810  6.346   43.899  1.00 55.07  ? 211 ASP B CA    1 
ATOM   5136 C  C     . ASP F 3 212 ? -5.639  5.236   43.284  1.00 54.96  ? 211 ASP B C     1 
ATOM   5137 O  O     . ASP F 3 212 ? -5.107  4.433   42.521  1.00 55.05  ? 211 ASP B O     1 
ATOM   5138 C  CB    . ASP F 3 212 ? -3.975  5.853   45.078  1.00 55.35  ? 211 ASP B CB    1 
ATOM   5139 C  CG    . ASP F 3 212 ? -2.984  6.911   45.567  1.00 56.68  ? 211 ASP B CG    1 
ATOM   5140 O  OD1   . ASP F 3 212 ? -3.222  8.116   45.317  1.00 58.70  ? 211 ASP B OD1   1 
ATOM   5141 O  OD2   . ASP F 3 212 ? -1.962  6.548   46.198  1.00 57.75  ? 211 ASP B OD2   1 
ATOM   5142 N  N     . LYS F 3 213 ? -6.930  5.186   43.603  1.00 54.79  ? 212 LYS B N     1 
ATOM   5143 C  CA    . LYS F 3 213 ? -7.835  4.282   42.881  1.00 54.68  ? 212 LYS B CA    1 
ATOM   5144 C  C     . LYS F 3 213 ? -8.230  4.862   41.514  1.00 54.29  ? 212 LYS B C     1 
ATOM   5145 O  O     . LYS F 3 213 ? -8.744  4.145   40.659  1.00 53.74  ? 212 LYS B O     1 
ATOM   5146 C  CB    . LYS F 3 213 ? -9.068  3.918   43.704  1.00 54.55  ? 212 LYS B CB    1 
ATOM   5147 C  CG    . LYS F 3 213 ? -8.750  3.455   45.111  1.00 55.90  ? 212 LYS B CG    1 
ATOM   5148 C  CD    . LYS F 3 213 ? -8.280  2.007   45.214  1.00 56.72  ? 212 LYS B CD    1 
ATOM   5149 C  CE    . LYS F 3 213 ? -8.024  1.644   46.686  1.00 56.41  ? 212 LYS B CE    1 
ATOM   5150 N  NZ    . LYS F 3 213 ? -7.903  0.170   46.881  1.00 56.49  ? 212 LYS B NZ    1 
ATOM   5151 N  N     . LEU F 3 214 ? -7.997  6.162   41.334  1.00 54.24  ? 213 LEU B N     1 
ATOM   5152 C  CA    . LEU F 3 214 ? -8.108  6.801   40.031  1.00 54.24  ? 213 LEU B CA    1 
ATOM   5153 C  C     . LEU F 3 214 ? -6.830  6.530   39.240  1.00 54.23  ? 213 LEU B C     1 
ATOM   5154 O  O     . LEU F 3 214 ? -6.883  5.990   38.129  1.00 54.35  ? 213 LEU B O     1 
ATOM   5155 C  CB    . LEU F 3 214 ? -8.372  8.309   40.167  1.00 54.20  ? 213 LEU B CB    1 
ATOM   5156 C  CG    . LEU F 3 214 ? -8.661  9.089   38.870  1.00 53.93  ? 213 LEU B CG    1 
ATOM   5157 C  CD1   . LEU F 3 214 ? -9.864  8.524   38.105  1.00 53.45  ? 213 LEU B CD1   1 
ATOM   5158 C  CD2   . LEU F 3 214 ? -8.810  10.597  39.104  1.00 53.22  ? 213 LEU B CD2   1 
ATOM   5159 N  N     . LYS F 3 215 ? -5.699  6.925   39.828  1.00 54.36  ? 214 LYS B N     1 
ATOM   5160 C  CA    . LYS F 3 215 ? -4.343  6.538   39.411  1.00 54.50  ? 214 LYS B CA    1 
ATOM   5161 C  C     . LYS F 3 215 ? -4.280  5.127   38.811  1.00 54.72  ? 214 LYS B C     1 
ATOM   5162 O  O     . LYS F 3 215 ? -3.690  4.925   37.738  1.00 54.83  ? 214 LYS B O     1 
ATOM   5163 C  CB    . LYS F 3 215 ? -3.403  6.619   40.625  1.00 54.51  ? 214 LYS B CB    1 
ATOM   5164 C  CG    . LYS F 3 215 ? -1.925  6.349   40.358  1.00 54.98  ? 214 LYS B CG    1 
ATOM   5165 C  CD    . LYS F 3 215 ? -1.232  5.810   41.612  1.00 55.40  ? 214 LYS B CD    1 
ATOM   5166 C  CE    . LYS F 3 215 ? 0.243   5.563   41.371  1.00 56.33  ? 214 LYS B CE    1 
ATOM   5167 N  NZ    . LYS F 3 215 ? 0.971   6.818   40.988  1.00 57.09  ? 214 LYS B NZ    1 
ATOM   5168 N  N     . GLY F 3 216 ? -4.887  4.165   39.515  1.00 54.51  ? 215 GLY B N     1 
ATOM   5169 C  CA    . GLY F 3 216 ? -4.857  2.756   39.131  1.00 54.26  ? 215 GLY B CA    1 
ATOM   5170 C  C     . GLY F 3 216 ? -5.870  2.289   38.089  1.00 54.35  ? 215 GLY B C     1 
ATOM   5171 O  O     . GLY F 3 216 ? -5.811  1.139   37.651  1.00 54.79  ? 215 GLY B O     1 
ATOM   5172 N  N     . MET F 3 217 ? -6.816  3.140   37.694  1.00 54.01  ? 216 MET B N     1 
ATOM   5173 C  CA    . MET F 3 217 ? -7.765  2.752   36.645  1.00 53.54  ? 216 MET B CA    1 
ATOM   5174 C  C     . MET F 3 217 ? -7.490  3.373   35.313  1.00 52.94  ? 216 MET B C     1 
ATOM   5175 O  O     . MET F 3 217 ? -7.592  2.703   34.288  1.00 53.17  ? 216 MET B O     1 
ATOM   5176 C  CB    . MET F 3 217 ? -9.208  3.010   37.037  1.00 53.93  ? 216 MET B CB    1 
ATOM   5177 C  CG    . MET F 3 217 ? -9.881  1.750   37.507  1.00 55.54  ? 216 MET B CG    1 
ATOM   5178 S  SD    . MET F 3 217 ? -9.104  1.150   39.039  1.00 58.87  ? 216 MET B SD    1 
ATOM   5179 C  CE    . MET F 3 217 ? -9.905  -0.462  39.252  1.00 59.09  ? 216 MET B CE    1 
ATOM   5180 N  N     . ILE F 3 218 ? -7.146  4.657   35.329  1.00 51.95  ? 217 ILE B N     1 
ATOM   5181 C  CA    . ILE F 3 218 ? -6.844  5.369   34.094  1.00 50.79  ? 217 ILE B CA    1 
ATOM   5182 C  C     . ILE F 3 218 ? -5.346  5.769   33.955  1.00 50.26  ? 217 ILE B C     1 
ATOM   5183 O  O     . ILE F 3 218 ? -4.944  6.403   32.965  1.00 49.93  ? 217 ILE B O     1 
ATOM   5184 C  CB    . ILE F 3 218 ? -7.886  6.526   33.801  1.00 50.68  ? 217 ILE B CB    1 
ATOM   5185 C  CG1   . ILE F 3 218 ? -7.883  7.600   34.900  1.00 50.51  ? 217 ILE B CG1   1 
ATOM   5186 C  CG2   . ILE F 3 218 ? -9.292  5.944   33.591  1.00 50.27  ? 217 ILE B CG2   1 
ATOM   5187 C  CD1   . ILE F 3 218 ? -8.823  8.770   34.650  1.00 48.62  ? 217 ILE B CD1   1 
ATOM   5188 N  N     . GLY F 3 219 ? -4.519  5.369   34.918  1.00 49.49  ? 218 GLY B N     1 
ATOM   5189 C  CA    . GLY F 3 219 ? -3.103  5.752   34.896  1.00 48.90  ? 218 GLY B CA    1 
ATOM   5190 C  C     . GLY F 3 219 ? -2.881  7.124   35.529  1.00 48.58  ? 218 GLY B C     1 
ATOM   5191 O  O     . GLY F 3 219 ? -3.831  7.851   35.812  1.00 48.45  ? 218 GLY B O     1 
ATOM   5192 N  N     . GLU F 3 220 ? -1.623  7.490   35.731  1.00 48.42  ? 219 GLU B N     1 
ATOM   5193 C  CA    . GLU F 3 220 ? -1.303  8.706   36.460  1.00 48.31  ? 219 GLU B CA    1 
ATOM   5194 C  C     . GLU F 3 220 ? -1.437  9.956   35.608  1.00 47.74  ? 219 GLU B C     1 
ATOM   5195 O  O     . GLU F 3 220 ? -2.042  10.952  36.039  1.00 47.84  ? 219 GLU B O     1 
ATOM   5196 C  CB    . GLU F 3 220 ? 0.104   8.637   37.053  1.00 48.77  ? 219 GLU B CB    1 
ATOM   5197 C  CG    . GLU F 3 220 ? 0.448   9.856   37.928  1.00 50.37  ? 219 GLU B CG    1 
ATOM   5198 C  CD    . GLU F 3 220 ? 1.775   9.724   38.660  1.00 51.91  ? 219 GLU B CD    1 
ATOM   5199 O  OE1   . GLU F 3 220 ? 2.818   9.892   37.978  1.00 53.07  ? 219 GLU B OE1   1 
ATOM   5200 O  OE2   . GLU F 3 220 ? 1.769   9.490   39.905  1.00 51.60  ? 219 GLU B OE2   1 
ATOM   5201 N  N     . ALA F 3 221 ? -0.856  9.904   34.413  1.00 46.76  ? 220 ALA B N     1 
ATOM   5202 C  CA    . ALA F 3 221 ? -0.817  11.047  33.520  1.00 45.74  ? 220 ALA B CA    1 
ATOM   5203 C  C     . ALA F 3 221 ? -2.214  11.604  33.318  1.00 45.09  ? 220 ALA B C     1 
ATOM   5204 O  O     . ALA F 3 221 ? -2.396  12.812  33.195  1.00 45.33  ? 220 ALA B O     1 
ATOM   5205 C  CB    . ALA F 3 221 ? -0.226  10.652  32.205  1.00 45.57  ? 220 ALA B CB    1 
ATOM   5206 N  N     . LYS F 3 222 ? -3.199  10.714  33.326  1.00 44.10  ? 221 LYS B N     1 
ATOM   5207 C  CA    . LYS F 3 222 ? -4.578  11.066  32.988  1.00 43.17  ? 221 LYS B CA    1 
ATOM   5208 C  C     . LYS F 3 222 ? -5.344  11.538  34.222  1.00 42.05  ? 221 LYS B C     1 
ATOM   5209 O  O     . LYS F 3 222 ? -5.854  12.661  34.249  1.00 41.40  ? 221 LYS B O     1 
ATOM   5210 C  CB    . LYS F 3 222 ? -5.262  9.856   32.372  1.00 43.46  ? 221 LYS B CB    1 
ATOM   5211 C  CG    . LYS F 3 222 ? -5.950  10.105  31.086  1.00 43.94  ? 221 LYS B CG    1 
ATOM   5212 C  CD    . LYS F 3 222 ? -6.970  8.974   30.853  1.00 45.12  ? 221 LYS B CD    1 
ATOM   5213 C  CE    . LYS F 3 222 ? -6.564  8.021   29.745  1.00 45.11  ? 221 LYS B CE    1 
ATOM   5214 N  NZ    . LYS F 3 222 ? -6.876  8.601   28.412  1.00 44.94  ? 221 LYS B NZ    1 
ATOM   5215 N  N     . ALA F 3 223 ? -5.425  10.669  35.232  1.00 40.93  ? 222 ALA B N     1 
ATOM   5216 C  CA    . ALA F 3 223 ? -5.899  11.041  36.563  1.00 40.07  ? 222 ALA B CA    1 
ATOM   5217 C  C     . ALA F 3 223 ? -5.440  12.452  36.984  1.00 39.28  ? 222 ALA B C     1 
ATOM   5218 O  O     . ALA F 3 223 ? -6.254  13.318  37.325  1.00 38.32  ? 222 ALA B O     1 
ATOM   5219 C  CB    . ALA F 3 223 ? -5.421  10.032  37.567  1.00 40.42  ? 222 ALA B CB    1 
ATOM   5220 N  N     . LYS F 3 224 ? -4.130  12.669  36.924  1.00 38.74  ? 223 LYS B N     1 
ATOM   5221 C  CA    . LYS F 3 224 ? -3.534  13.959  37.249  1.00 38.48  ? 223 LYS B CA    1 
ATOM   5222 C  C     . LYS F 3 224 ? -3.956  15.057  36.227  1.00 37.57  ? 223 LYS B C     1 
ATOM   5223 O  O     . LYS F 3 224 ? -3.850  16.251  36.480  1.00 37.48  ? 223 LYS B O     1 
ATOM   5224 C  CB    . LYS F 3 224 ? -2.016  13.767  37.403  1.00 38.67  ? 223 LYS B CB    1 
ATOM   5225 C  CG    . LYS F 3 224 ? -1.231  14.990  37.692  1.00 40.76  ? 223 LYS B CG    1 
ATOM   5226 C  CD    . LYS F 3 224 ? -0.118  14.774  38.717  1.00 43.35  ? 223 LYS B CD    1 
ATOM   5227 C  CE    . LYS F 3 224 ? 0.826   16.013  38.711  1.00 44.83  ? 223 LYS B CE    1 
ATOM   5228 N  NZ    . LYS F 3 224 ? 1.128   16.654  40.041  1.00 44.67  ? 223 LYS B NZ    1 
ATOM   5229 N  N     . TYR F 3 225 ? -4.480  14.641  35.080  1.00 36.83  ? 224 TYR B N     1 
ATOM   5230 C  CA    . TYR F 3 225 ? -4.877  15.577  34.047  1.00 35.55  ? 224 TYR B CA    1 
ATOM   5231 C  C     . TYR F 3 225 ? -6.287  15.982  34.390  1.00 34.99  ? 224 TYR B C     1 
ATOM   5232 O  O     . TYR F 3 225 ? -6.615  17.160  34.459  1.00 35.23  ? 224 TYR B O     1 
ATOM   5233 C  CB    . TYR F 3 225 ? -4.752  14.910  32.677  1.00 35.32  ? 224 TYR B CB    1 
ATOM   5234 C  CG    . TYR F 3 225 ? -5.492  15.564  31.532  1.00 34.57  ? 224 TYR B CG    1 
ATOM   5235 C  CD1   . TYR F 3 225 ? -5.001  16.694  30.914  1.00 34.44  ? 224 TYR B CD1   1 
ATOM   5236 C  CD2   . TYR F 3 225 ? -6.660  15.021  31.050  1.00 35.26  ? 224 TYR B CD2   1 
ATOM   5237 C  CE1   . TYR F 3 225 ? -5.670  17.280  29.868  1.00 34.43  ? 224 TYR B CE1   1 
ATOM   5238 C  CE2   . TYR F 3 225 ? -7.337  15.591  29.990  1.00 35.94  ? 224 TYR B CE2   1 
ATOM   5239 C  CZ    . TYR F 3 225 ? -6.836  16.722  29.412  1.00 35.21  ? 224 TYR B CZ    1 
ATOM   5240 O  OH    . TYR F 3 225 ? -7.510  17.301  28.371  1.00 36.40  ? 224 TYR B OH    1 
ATOM   5241 N  N     . LEU F 3 226 ? -7.114  14.996  34.670  1.00 34.29  ? 225 LEU B N     1 
ATOM   5242 C  CA    . LEU F 3 226 ? -8.489  15.279  34.961  1.00 34.11  ? 225 LEU B CA    1 
ATOM   5243 C  C     . LEU F 3 226 ? -8.619  16.081  36.263  1.00 34.27  ? 225 LEU B C     1 
ATOM   5244 O  O     . LEU F 3 226 ? -9.542  16.887  36.380  1.00 34.67  ? 225 LEU B O     1 
ATOM   5245 C  CB    . LEU F 3 226 ? -9.330  13.992  35.003  1.00 33.81  ? 225 LEU B CB    1 
ATOM   5246 C  CG    . LEU F 3 226 ? -9.640  13.240  33.713  1.00 33.35  ? 225 LEU B CG    1 
ATOM   5247 C  CD1   . LEU F 3 226 ? -10.100 11.810  34.003  1.00 31.71  ? 225 LEU B CD1   1 
ATOM   5248 C  CD2   . LEU F 3 226 ? -10.657 14.002  32.843  1.00 31.93  ? 225 LEU B CD2   1 
ATOM   5249 N  N     . ILE F 3 227 ? -7.713  15.889  37.222  1.00 33.84  ? 226 ILE B N     1 
ATOM   5250 C  CA    . ILE F 3 227 ? -7.782  16.679  38.461  1.00 34.20  ? 226 ILE B CA    1 
ATOM   5251 C  C     . ILE F 3 227 ? -7.494  18.178  38.263  1.00 34.54  ? 226 ILE B C     1 
ATOM   5252 O  O     . ILE F 3 227 ? -8.289  19.023  38.690  1.00 35.12  ? 226 ILE B O     1 
ATOM   5253 C  CB    . ILE F 3 227 ? -6.909  16.093  39.595  1.00 34.06  ? 226 ILE B CB    1 
ATOM   5254 C  CG1   . ILE F 3 227 ? -7.391  14.710  39.990  1.00 32.97  ? 226 ILE B CG1   1 
ATOM   5255 C  CG2   . ILE F 3 227 ? -6.906  17.007  40.832  1.00 33.26  ? 226 ILE B CG2   1 
ATOM   5256 C  CD1   . ILE F 3 227 ? -6.255  13.872  40.508  1.00 32.19  ? 226 ILE B CD1   1 
ATOM   5257 N  N     . SER F 3 228 ? -6.378  18.505  37.626  1.00 34.55  ? 227 SER B N     1 
ATOM   5258 C  CA    . SER F 3 228 ? -6.041  19.903  37.283  1.00 35.05  ? 227 SER B CA    1 
ATOM   5259 C  C     . SER F 3 228 ? -7.162  20.627  36.598  1.00 35.20  ? 227 SER B C     1 
ATOM   5260 O  O     . SER F 3 228 ? -7.417  21.798  36.877  1.00 35.43  ? 227 SER B O     1 
ATOM   5261 C  CB    . SER F 3 228 ? -4.868  19.963  36.335  1.00 34.74  ? 227 SER B CB    1 
ATOM   5262 O  OG    . SER F 3 228 ? -4.075  18.810  36.494  1.00 35.50  ? 227 SER B OG    1 
ATOM   5263 N  N     . LEU F 3 229 ? -7.818  19.928  35.681  1.00 34.97  ? 228 LEU B N     1 
ATOM   5264 C  CA    . LEU F 3 229 ? -8.984  20.485  35.032  1.00 34.70  ? 228 LEU B CA    1 
ATOM   5265 C  C     . LEU F 3 229 ? -10.067 20.702  36.041  1.00 34.26  ? 228 LEU B C     1 
ATOM   5266 O  O     . LEU F 3 229 ? -10.775 21.710  35.979  1.00 34.01  ? 228 LEU B O     1 
ATOM   5267 C  CB    . LEU F 3 229 ? -9.536  19.527  33.977  1.00 34.57  ? 228 LEU B CB    1 
ATOM   5268 C  CG    . LEU F 3 229 ? -8.846  19.529  32.643  1.00 34.81  ? 228 LEU B CG    1 
ATOM   5269 C  CD1   . LEU F 3 229 ? -9.539  18.447  31.807  1.00 35.64  ? 228 LEU B CD1   1 
ATOM   5270 C  CD2   . LEU F 3 229 ? -8.933  20.921  32.013  1.00 34.05  ? 228 LEU B CD2   1 
ATOM   5271 N  N     . ALA F 3 230 ? -10.234 19.720  36.933  1.00 34.27  ? 229 ALA B N     1 
ATOM   5272 C  CA    . ALA F 3 230 ? -11.367 19.737  37.865  1.00 34.27  ? 229 ALA B CA    1 
ATOM   5273 C  C     . ALA F 3 230 ? -11.138 20.855  38.837  1.00 33.78  ? 229 ALA B C     1 
ATOM   5274 O  O     . ALA F 3 230 ? -12.068 21.564  39.159  1.00 33.80  ? 229 ALA B O     1 
ATOM   5275 C  CB    . ALA F 3 230 ? -11.559 18.403  38.592  1.00 34.54  ? 229 ALA B CB    1 
ATOM   5276 N  N     . ARG F 3 231 ? -9.888  21.042  39.246  1.00 33.60  ? 230 ARG B N     1 
ATOM   5277 C  CA    . ARG F 3 231 ? -9.550  22.104  40.185  1.00 34.25  ? 230 ARG B CA    1 
ATOM   5278 C  C     . ARG F 3 231 ? -9.512  23.468  39.517  1.00 34.96  ? 230 ARG B C     1 
ATOM   5279 O  O     . ARG F 3 231 ? -9.161  24.468  40.157  1.00 34.25  ? 230 ARG B O     1 
ATOM   5280 C  CB    . ARG F 3 231 ? -8.238  21.778  40.906  1.00 34.24  ? 230 ARG B CB    1 
ATOM   5281 C  CG    . ARG F 3 231 ? -8.452  20.712  42.004  1.00 33.91  ? 230 ARG B CG    1 
ATOM   5282 C  CD    . ARG F 3 231 ? -7.161  20.080  42.516  1.00 35.39  ? 230 ARG B CD    1 
ATOM   5283 N  NE    . ARG F 3 231 ? -6.279  21.026  43.200  1.00 36.49  ? 230 ARG B NE    1 
ATOM   5284 C  CZ    . ARG F 3 231 ? -6.477  21.507  44.426  1.00 36.57  ? 230 ARG B CZ    1 
ATOM   5285 N  NH1   . ARG F 3 231 ? -7.544  21.141  45.140  1.00 34.03  ? 230 ARG B NH1   1 
ATOM   5286 N  NH2   . ARG F 3 231 ? -5.603  22.369  44.931  1.00 37.21  ? 230 ARG B NH2   1 
ATOM   5287 N  N     . ASP F 3 232 ? -9.892  23.499  38.225  1.00 35.82  ? 231 ASP B N     1 
ATOM   5288 C  CA    . ASP F 3 232 ? -9.814  24.711  37.394  1.00 36.32  ? 231 ASP B CA    1 
ATOM   5289 C  C     . ASP F 3 232 ? -8.366  25.288  37.431  1.00 36.19  ? 231 ASP B C     1 
ATOM   5290 O  O     . ASP F 3 232 ? -8.155  26.485  37.489  1.00 35.89  ? 231 ASP B O     1 
ATOM   5291 C  CB    . ASP F 3 232 ? -10.924 25.709  37.827  1.00 37.28  ? 231 ASP B CB    1 
ATOM   5292 C  CG    . ASP F 3 232 ? -10.847 27.067  37.120  1.00 38.67  ? 231 ASP B CG    1 
ATOM   5293 O  OD1   . ASP F 3 232 ? -10.874 27.105  35.890  1.00 41.27  ? 231 ASP B OD1   1 
ATOM   5294 O  OD2   . ASP F 3 232 ? -10.776 28.106  37.801  1.00 40.67  ? 231 ASP B OD2   1 
ATOM   5295 N  N     . GLU F 3 233 ? -7.377  24.401  37.390  1.00 36.57  ? 232 GLU B N     1 
ATOM   5296 C  CA    . GLU F 3 233 ? -5.973  24.781  37.456  1.00 37.46  ? 232 GLU B CA    1 
ATOM   5297 C  C     . GLU F 3 233 ? -5.172  24.416  36.195  1.00 38.01  ? 232 GLU B C     1 
ATOM   5298 O  O     . GLU F 3 233 ? -3.980  24.743  36.102  1.00 38.45  ? 232 GLU B O     1 
ATOM   5299 C  CB    . GLU F 3 233 ? -5.317  24.131  38.674  1.00 37.34  ? 232 GLU B CB    1 
ATOM   5300 C  CG    . GLU F 3 233 ? -5.743  24.756  40.021  1.00 39.00  ? 232 GLU B CG    1 
ATOM   5301 C  CD    . GLU F 3 233 ? -5.181  24.019  41.237  1.00 39.76  ? 232 GLU B CD    1 
ATOM   5302 O  OE1   . GLU F 3 233 ? -5.009  22.792  41.181  1.00 41.67  ? 232 GLU B OE1   1 
ATOM   5303 O  OE2   . GLU F 3 233 ? -4.912  24.662  42.263  1.00 39.49  ? 232 GLU B OE2   1 
ATOM   5304 N  N     . TYR F 3 234 ? -5.793  23.726  35.233  1.00 38.46  ? 233 TYR B N     1 
ATOM   5305 C  CA    . TYR F 3 234 ? -5.032  23.245  34.070  1.00 38.42  ? 233 TYR B CA    1 
ATOM   5306 C  C     . TYR F 3 234 ? -4.440  24.436  33.322  1.00 38.75  ? 233 TYR B C     1 
ATOM   5307 O  O     . TYR F 3 234 ? -5.128  25.425  33.047  1.00 38.83  ? 233 TYR B O     1 
ATOM   5308 C  CB    . TYR F 3 234 ? -5.863  22.352  33.150  1.00 37.84  ? 233 TYR B CB    1 
ATOM   5309 C  CG    . TYR F 3 234 ? -5.138  21.994  31.862  1.00 37.60  ? 233 TYR B CG    1 
ATOM   5310 C  CD1   . TYR F 3 234 ? -4.422  20.816  31.746  1.00 36.70  ? 233 TYR B CD1   1 
ATOM   5311 C  CD2   . TYR F 3 234 ? -5.167  22.857  30.758  1.00 37.06  ? 233 TYR B CD2   1 
ATOM   5312 C  CE1   . TYR F 3 234 ? -3.762  20.499  30.579  1.00 36.49  ? 233 TYR B CE1   1 
ATOM   5313 C  CE2   . TYR F 3 234 ? -4.523  22.560  29.596  1.00 36.59  ? 233 TYR B CE2   1 
ATOM   5314 C  CZ    . TYR F 3 234 ? -3.828  21.379  29.495  1.00 36.69  ? 233 TYR B CZ    1 
ATOM   5315 O  OH    . TYR F 3 234 ? -3.175  21.101  28.310  1.00 35.03  ? 233 TYR B OH    1 
ATOM   5316 N  N     . ASN F 3 235 ? -3.138  24.399  33.074  1.00 39.28  ? 234 ASN B N     1 
ATOM   5317 C  CA    . ASN F 3 235 ? -2.470  25.580  32.545  1.00 39.87  ? 234 ASN B CA    1 
ATOM   5318 C  C     . ASN F 3 235 ? -1.247  25.268  31.705  1.00 39.76  ? 234 ASN B C     1 
ATOM   5319 O  O     . ASN F 3 235 ? -0.180  25.851  31.903  1.00 40.17  ? 234 ASN B O     1 
ATOM   5320 C  CB    . ASN F 3 235 ? -2.091  26.531  33.683  1.00 40.20  ? 234 ASN B CB    1 
ATOM   5321 C  CG    . ASN F 3 235 ? -2.503  27.964  33.407  1.00 41.12  ? 234 ASN B CG    1 
ATOM   5322 O  OD1   . ASN F 3 235 ? -2.566  28.392  32.254  1.00 41.51  ? 234 ASN B OD1   1 
ATOM   5323 N  ND2   . ASN F 3 235 ? -2.786  28.713  34.466  1.00 42.91  ? 234 ASN B ND2   1 
ATOM   5324 N  N     . GLU F 3 236 ? -1.405  24.353  30.759  1.00 39.57  ? 235 GLU B N     1 
ATOM   5325 C  CA    . GLU F 3 236 ? -0.309  24.045  29.826  1.00 39.45  ? 235 GLU B CA    1 
ATOM   5326 C  C     . GLU F 3 236 ? -0.007  25.100  28.757  1.00 38.53  ? 235 GLU B C     1 
ATOM   5327 O  O     . GLU F 3 236 ? -0.895  25.700  28.204  1.00 38.53  ? 235 GLU B O     1 
ATOM   5328 C  CB    . GLU F 3 236 ? -0.561  22.694  29.171  1.00 39.88  ? 235 GLU B CB    1 
ATOM   5329 C  CG    . GLU F 3 236 ? -0.442  21.530  30.126  1.00 42.23  ? 235 GLU B CG    1 
ATOM   5330 C  CD    . GLU F 3 236 ? 0.884   21.536  30.879  1.00 46.67  ? 235 GLU B CD    1 
ATOM   5331 O  OE1   . GLU F 3 236 ? 1.955   21.562  30.206  1.00 47.75  ? 235 GLU B OE1   1 
ATOM   5332 O  OE2   . GLU F 3 236 ? 0.854   21.514  32.146  1.00 48.91  ? 235 GLU B OE2   1 
ATOM   5333 N  N     . PRO F 3 237 ? 1.270   25.332  28.454  1.00 38.32  ? 236 PRO B N     1 
ATOM   5334 C  CA    . PRO F 3 237 ? 1.470   26.312  27.387  1.00 37.52  ? 236 PRO B CA    1 
ATOM   5335 C  C     . PRO F 3 237 ? 1.242   25.751  26.005  1.00 37.13  ? 236 PRO B C     1 
ATOM   5336 O  O     . PRO F 3 237 ? 1.303   24.544  25.770  1.00 36.20  ? 236 PRO B O     1 
ATOM   5337 C  CB    . PRO F 3 237 ? 2.936   26.703  27.526  1.00 37.29  ? 236 PRO B CB    1 
ATOM   5338 C  CG    . PRO F 3 237 ? 3.496   25.811  28.563  1.00 37.67  ? 236 PRO B CG    1 
ATOM   5339 C  CD    . PRO F 3 237 ? 2.535   24.786  28.957  1.00 37.63  ? 236 PRO B CD    1 
ATOM   5340 N  N     . ILE F 3 238 ? 0.963   26.666  25.096  1.00 37.56  ? 237 ILE B N     1 
ATOM   5341 C  CA    . ILE F 3 238 ? 0.877   26.349  23.702  1.00 37.58  ? 237 ILE B CA    1 
ATOM   5342 C  C     . ILE F 3 238 ? 2.281   26.120  23.287  1.00 38.17  ? 237 ILE B C     1 
ATOM   5343 O  O     . ILE F 3 238 ? 3.127   26.990  23.505  1.00 38.50  ? 237 ILE B O     1 
ATOM   5344 C  CB    . ILE F 3 238 ? 0.357   27.539  22.908  1.00 37.56  ? 237 ILE B CB    1 
ATOM   5345 C  CG1   . ILE F 3 238 ? -1.182  27.519  22.865  1.00 36.16  ? 237 ILE B CG1   1 
ATOM   5346 C  CG2   . ILE F 3 238 ? 0.999   27.589  21.482  1.00 37.76  ? 237 ILE B CG2   1 
ATOM   5347 C  CD1   . ILE F 3 238 ? -1.839  27.872  24.188  1.00 32.83  ? 237 ILE B CD1   1 
ATOM   5348 N  N     . ARG F 3 239 ? 2.534   24.949  22.706  1.00 38.53  ? 238 ARG B N     1 
ATOM   5349 C  CA    . ARG F 3 239 ? 3.857   24.644  22.201  1.00 39.05  ? 238 ARG B CA    1 
ATOM   5350 C  C     . ARG F 3 239 ? 3.878   23.880  20.887  1.00 38.42  ? 238 ARG B C     1 
ATOM   5351 O  O     . ARG F 3 239 ? 2.952   23.137  20.563  1.00 37.53  ? 238 ARG B O     1 
ATOM   5352 C  CB    . ARG F 3 239 ? 4.740   23.957  23.274  1.00 39.93  ? 238 ARG B CB    1 
ATOM   5353 C  CG    . ARG F 3 239 ? 4.280   22.569  23.780  1.00 42.47  ? 238 ARG B CG    1 
ATOM   5354 C  CD    . ARG F 3 239 ? 5.255   21.999  24.872  1.00 45.25  ? 238 ARG B CD    1 
ATOM   5355 N  NE    . ARG F 3 239 ? 5.069   22.616  26.197  1.00 47.71  ? 238 ARG B NE    1 
ATOM   5356 C  CZ    . ARG F 3 239 ? 6.018   23.244  26.910  1.00 48.60  ? 238 ARG B CZ    1 
ATOM   5357 N  NH1   . ARG F 3 239 ? 5.712   23.753  28.102  1.00 48.27  ? 238 ARG B NH1   1 
ATOM   5358 N  NH2   . ARG F 3 239 ? 7.275   23.349  26.461  1.00 48.88  ? 238 ARG B NH2   1 
ATOM   5359 N  N     . THR F 3 240 ? 4.976   24.030  20.151  1.00 38.19  ? 239 THR B N     1 
ATOM   5360 C  CA    . THR F 3 240 ? 5.165   23.325  18.888  1.00 38.31  ? 239 THR B CA    1 
ATOM   5361 C  C     . THR F 3 240 ? 5.459   21.837  19.087  1.00 38.20  ? 239 THR B C     1 
ATOM   5362 O  O     . THR F 3 240 ? 6.565   21.453  19.466  1.00 38.70  ? 239 THR B O     1 
ATOM   5363 C  CB    . THR F 3 240 ? 6.301   23.953  18.058  1.00 38.08  ? 239 THR B CB    1 
ATOM   5364 O  OG1   . THR F 3 240 ? 5.900   25.251  17.600  1.00 38.62  ? 239 THR B OG1   1 
ATOM   5365 C  CG2   . THR F 3 240 ? 6.632   23.077  16.859  1.00 36.97  ? 239 THR B CG2   1 
ATOM   5366 N  N     . ARG F 3 241 ? 4.453   21.010  18.822  1.00 38.53  ? 240 ARG B N     1 
ATOM   5367 C  CA    . ARG F 3 241 ? 4.571   19.558  18.892  1.00 38.68  ? 240 ARG B CA    1 
ATOM   5368 C  C     . ARG F 3 241 ? 5.590   19.080  17.851  1.00 38.86  ? 240 ARG B C     1 
ATOM   5369 O  O     . ARG F 3 241 ? 5.561   19.493  16.666  1.00 38.69  ? 240 ARG B O     1 
ATOM   5370 C  CB    . ARG F 3 241 ? 3.234   18.882  18.662  1.00 38.84  ? 240 ARG B CB    1 
ATOM   5371 C  CG    . ARG F 3 241 ? 2.324   18.926  19.877  1.00 39.65  ? 240 ARG B CG    1 
ATOM   5372 C  CD    . ARG F 3 241 ? 0.862   18.609  19.461  1.00 39.70  ? 240 ARG B CD    1 
ATOM   5373 N  NE    . ARG F 3 241 ? -0.115  18.917  20.504  1.00 38.79  ? 240 ARG B NE    1 
ATOM   5374 C  CZ    . ARG F 3 241 ? -1.168  18.161  20.779  1.00 39.65  ? 240 ARG B CZ    1 
ATOM   5375 N  NH1   . ARG F 3 241 ? -1.387  17.043  20.099  1.00 39.60  ? 240 ARG B NH1   1 
ATOM   5376 N  NH2   . ARG F 3 241 ? -2.011  18.523  21.738  1.00 41.15  ? 240 ARG B NH2   1 
ATOM   5377 N  N     . VAL F 3 242 ? 6.530   18.257  18.321  1.00 38.58  ? 241 VAL B N     1 
ATOM   5378 C  CA    . VAL F 3 242 ? 7.548   17.735  17.449  1.00 37.91  ? 241 VAL B CA    1 
ATOM   5379 C  C     . VAL F 3 242 ? 7.226   16.265  17.350  1.00 37.76  ? 241 VAL B C     1 
ATOM   5380 O  O     . VAL F 3 242 ? 6.881   15.612  18.349  1.00 37.28  ? 241 VAL B O     1 
ATOM   5381 C  CB    . VAL F 3 242 ? 8.971   18.069  17.960  1.00 38.28  ? 241 VAL B CB    1 
ATOM   5382 C  CG1   . VAL F 3 242 ? 10.063  17.692  16.922  1.00 37.01  ? 241 VAL B CG1   1 
ATOM   5383 C  CG2   . VAL F 3 242 ? 9.054   19.576  18.292  1.00 37.84  ? 241 VAL B CG2   1 
ATOM   5384 N  N     . ARG F 3 243 ? 7.246   15.777  16.112  1.00 37.62  ? 242 ARG B N     1 
ATOM   5385 C  CA    . ARG F 3 243 ? 6.884   14.387  15.820  1.00 37.27  ? 242 ARG B CA    1 
ATOM   5386 C  C     . ARG F 3 243 ? 7.971   13.500  16.437  1.00 35.85  ? 242 ARG B C     1 
ATOM   5387 O  O     . ARG F 3 243 ? 9.130   13.731  16.181  1.00 35.59  ? 242 ARG B O     1 
ATOM   5388 C  CB    . ARG F 3 243 ? 6.747   14.185  14.284  1.00 37.49  ? 242 ARG B CB    1 
ATOM   5389 C  CG    . ARG F 3 243 ? 6.755   15.517  13.474  1.00 39.24  ? 242 ARG B CG    1 
ATOM   5390 C  CD    . ARG F 3 243 ? 6.309   15.340  12.013  1.00 41.93  ? 242 ARG B CD    1 
ATOM   5391 N  NE    . ARG F 3 243 ? 6.325   16.581  11.220  1.00 44.63  ? 242 ARG B NE    1 
ATOM   5392 C  CZ    . ARG F 3 243 ? 5.355   17.499  11.252  1.00 45.17  ? 242 ARG B CZ    1 
ATOM   5393 N  NH1   . ARG F 3 243 ? 4.302   17.330  12.047  1.00 46.14  ? 242 ARG B NH1   1 
ATOM   5394 N  NH2   . ARG F 3 243 ? 5.435   18.591  10.498  1.00 44.48  ? 242 ARG B NH2   1 
ATOM   5395 N  N     . LYS F 3 244 ? 7.578   12.537  17.273  1.00 34.92  ? 243 LYS B N     1 
ATOM   5396 C  CA    . LYS F 3 244 ? 8.490   11.565  17.894  1.00 34.26  ? 243 LYS B CA    1 
ATOM   5397 C  C     . LYS F 3 244 ? 8.777   10.334  17.019  1.00 34.47  ? 243 LYS B C     1 
ATOM   5398 O  O     . LYS F 3 244 ? 9.900   9.932   16.922  1.00 35.69  ? 243 LYS B O     1 
ATOM   5399 C  CB    . LYS F 3 244 ? 8.019   11.140  19.282  1.00 34.05  ? 243 LYS B CB    1 
ATOM   5400 C  CG    . LYS F 3 244 ? 8.440   12.083  20.426  1.00 34.89  ? 243 LYS B CG    1 
ATOM   5401 C  CD    . LYS F 3 244 ? 7.686   13.400  20.386  1.00 37.20  ? 243 LYS B CD    1 
ATOM   5402 C  CE    . LYS F 3 244 ? 8.337   14.530  21.221  1.00 39.89  ? 243 LYS B CE    1 
ATOM   5403 N  NZ    . LYS F 3 244 ? 9.599   15.129  20.622  1.00 40.18  ? 243 LYS B NZ    1 
ATOM   5404 N  N     . SER F 3 245 ? 7.792   9.754   16.350  1.00 34.28  ? 244 SER B N     1 
ATOM   5405 C  CA    . SER F 3 245 ? 8.087   8.697   15.400  1.00 33.19  ? 244 SER B CA    1 
ATOM   5406 C  C     . SER F 3 245 ? 7.283   8.870   14.152  1.00 32.75  ? 244 SER B C     1 
ATOM   5407 O  O     . SER F 3 245 ? 6.156   9.309   14.230  1.00 32.69  ? 244 SER B O     1 
ATOM   5408 C  CB    . SER F 3 245 ? 7.709   7.376   15.978  1.00 33.36  ? 244 SER B CB    1 
ATOM   5409 O  OG    . SER F 3 245 ? 6.393   7.452   16.433  1.00 33.60  ? 244 SER B OG    1 
ATOM   5410 N  N     . ILE F 3 246 ? 7.886   8.545   13.005  1.00 32.00  ? 245 ILE B N     1 
ATOM   5411 C  CA    . ILE F 3 246 ? 7.199   8.474   11.716  1.00 30.84  ? 245 ILE B CA    1 
ATOM   5412 C  C     . ILE F 3 246 ? 7.228   7.017   11.312  1.00 30.67  ? 245 ILE B C     1 
ATOM   5413 O  O     . ILE F 3 246 ? 8.187   6.358   11.595  1.00 30.12  ? 245 ILE B O     1 
ATOM   5414 C  CB    . ILE F 3 246 ? 7.926   9.229   10.631  1.00 30.22  ? 245 ILE B CB    1 
ATOM   5415 C  CG1   . ILE F 3 246 ? 7.488   10.688  10.570  1.00 29.48  ? 245 ILE B CG1   1 
ATOM   5416 C  CG2   . ILE F 3 246 ? 7.584   8.641   9.347   1.00 30.92  ? 245 ILE B CG2   1 
ATOM   5417 C  CD1   . ILE F 3 246 ? 8.266   11.623  11.505  1.00 27.48  ? 245 ILE B CD1   1 
ATOM   5418 N  N     . GLY F 3 247 ? 6.170   6.523   10.667  1.00 31.30  ? 246 GLY B N     1 
ATOM   5419 C  CA    . GLY F 3 247 ? 6.027   5.093   10.344  1.00 30.79  ? 246 GLY B CA    1 
ATOM   5420 C  C     . GLY F 3 247 ? 4.884   4.844   9.358   1.00 30.55  ? 246 GLY B C     1 
ATOM   5421 O  O     . GLY F 3 247 ? 4.048   5.715   9.136   1.00 30.61  ? 246 GLY B O     1 
ATOM   5422 N  N     . ARG F 3 248 ? 4.895   3.658   8.747   1.00 29.55  ? 247 ARG B N     1 
ATOM   5423 C  CA    . ARG F 3 248 ? 3.932   3.237   7.762   1.00 29.34  ? 247 ARG B CA    1 
ATOM   5424 C  C     . ARG F 3 248 ? 3.732   1.780   8.061   1.00 29.21  ? 247 ARG B C     1 
ATOM   5425 O  O     . ARG F 3 248 ? 4.670   1.120   8.462   1.00 29.48  ? 247 ARG B O     1 
ATOM   5426 C  CB    . ARG F 3 248 ? 4.482   3.354   6.353   1.00 29.81  ? 247 ARG B CB    1 
ATOM   5427 C  CG    . ARG F 3 248 ? 3.431   3.163   5.262   1.00 32.07  ? 247 ARG B CG    1 
ATOM   5428 C  CD    . ARG F 3 248 ? 2.836   4.508   4.803   1.00 34.19  ? 247 ARG B CD    1 
ATOM   5429 N  NE    . ARG F 3 248 ? 1.959   4.318   3.649   1.00 34.52  ? 247 ARG B NE    1 
ATOM   5430 C  CZ    . ARG F 3 248 ? 0.780   3.704   3.704   1.00 35.19  ? 247 ARG B CZ    1 
ATOM   5431 N  NH1   . ARG F 3 248 ? 0.331   3.219   4.857   1.00 36.62  ? 247 ARG B NH1   1 
ATOM   5432 N  NH2   . ARG F 3 248 ? 0.044   3.586   2.612   1.00 36.75  ? 247 ARG B NH2   1 
ATOM   5433 N  N     . ILE F 3 249 ? 2.501   1.295   7.928   1.00 28.93  ? 248 ILE B N     1 
ATOM   5434 C  CA    . ILE F 3 249 ? 2.201   -0.099  8.145   1.00 29.08  ? 248 ILE B CA    1 
ATOM   5435 C  C     . ILE F 3 249 ? 1.198   -0.456  7.053   1.00 29.06  ? 248 ILE B C     1 
ATOM   5436 O  O     . ILE F 3 249 ? 0.370   0.376   6.730   1.00 29.29  ? 248 ILE B O     1 
ATOM   5437 C  CB    . ILE F 3 249 ? 1.651   -0.314  9.575   1.00 29.15  ? 248 ILE B CB    1 
ATOM   5438 C  CG1   . ILE F 3 249 ? 1.302   -1.780  9.820   1.00 28.96  ? 248 ILE B CG1   1 
ATOM   5439 C  CG2   . ILE F 3 249 ? 0.395   0.531   9.800   1.00 31.01  ? 248 ILE B CG2   1 
ATOM   5440 C  CD1   . ILE F 3 249 ? -0.161  -2.055  9.623   1.00 28.89  ? 248 ILE B CD1   1 
ATOM   5441 N  N     . VAL F 3 250 ? 1.287   -1.642  6.452   1.00 29.07  ? 249 VAL B N     1 
ATOM   5442 C  CA    . VAL F 3 250 ? 0.399   -1.976  5.316   1.00 29.38  ? 249 VAL B CA    1 
ATOM   5443 C  C     . VAL F 3 250 ? -0.174  -3.390  5.407   1.00 29.93  ? 249 VAL B C     1 
ATOM   5444 O  O     . VAL F 3 250 ? 0.441   -4.287  6.025   1.00 29.70  ? 249 VAL B O     1 
ATOM   5445 C  CB    . VAL F 3 250 ? 1.090   -1.847  3.912   1.00 29.71  ? 249 VAL B CB    1 
ATOM   5446 C  CG1   . VAL F 3 250 ? 2.126   -0.690  3.858   1.00 29.50  ? 249 VAL B CG1   1 
ATOM   5447 C  CG2   . VAL F 3 250 ? 1.751   -3.201  3.472   1.00 29.44  ? 249 VAL B CG2   1 
ATOM   5448 N  N     . THR F 3 251 ? -1.332  -3.574  4.755   1.00 30.43  ? 250 THR B N     1 
ATOM   5449 C  CA    . THR F 3 251 ? -2.016  -4.825  4.740   1.00 30.69  ? 250 THR B CA    1 
ATOM   5450 C  C     . THR F 3 251 ? -1.531  -5.646  3.559   1.00 31.80  ? 250 THR B C     1 
ATOM   5451 O  O     . THR F 3 251 ? -1.298  -5.128  2.455   1.00 31.05  ? 250 THR B O     1 
ATOM   5452 C  CB    . THR F 3 251 ? -3.544  -4.642  4.751   1.00 31.30  ? 250 THR B CB    1 
ATOM   5453 O  OG1   . THR F 3 251 ? -3.908  -3.739  5.818   1.00 32.40  ? 250 THR B OG1   1 
ATOM   5454 C  CG2   . THR F 3 251 ? -4.272  -6.023  4.946   1.00 30.11  ? 250 THR B CG2   1 
ATOM   5455 N  N     . MET F 3 252 ? -1.330  -6.931  3.843   1.00 33.05  ? 251 MET B N     1 
ATOM   5456 C  CA    . MET F 3 252 ? -0.880  -7.895  2.885   1.00 35.20  ? 251 MET B CA    1 
ATOM   5457 C  C     . MET F 3 252 ? -2.127  -8.544  2.324   1.00 36.78  ? 251 MET B C     1 
ATOM   5458 O  O     . MET F 3 252 ? -3.128  -8.703  3.047   1.00 37.29  ? 251 MET B O     1 
ATOM   5459 C  CB    . MET F 3 252 ? -0.040  -8.972  3.579   1.00 35.16  ? 251 MET B CB    1 
ATOM   5460 C  CG    . MET F 3 252 ? 1.273   -8.508  4.199   1.00 35.81  ? 251 MET B CG    1 
ATOM   5461 S  SD    . MET F 3 252 ? 2.239   -9.943  4.693   1.00 37.38  ? 251 MET B SD    1 
ATOM   5462 C  CE    . MET F 3 252 ? 1.957   -9.946  6.441   1.00 35.76  ? 251 MET B CE    1 
ATOM   5463 N  N     . LYS F 3 253 ? -2.068  -8.941  1.054   1.00 38.35  ? 252 LYS B N     1 
ATOM   5464 C  CA    . LYS F 3 253 ? -3.202  -9.622  0.433   1.00 40.20  ? 252 LYS B CA    1 
ATOM   5465 C  C     . LYS F 3 253 ? -3.589  -10.904 1.202   1.00 41.15  ? 252 LYS B C     1 
ATOM   5466 O  O     . LYS F 3 253 ? -4.752  -11.071 1.631   1.00 41.63  ? 252 LYS B O     1 
ATOM   5467 C  CB    . LYS F 3 253 ? -2.912  -9.958  -1.045  1.00 40.05  ? 252 LYS B CB    1 
ATOM   5468 C  CG    . LYS F 3 253 ? -4.156  -10.327 -1.797  1.00 41.22  ? 252 LYS B CG    1 
ATOM   5469 C  CD    . LYS F 3 253 ? -5.020  -9.117  -2.177  1.00 43.57  ? 252 LYS B CD    1 
ATOM   5470 C  CE    . LYS F 3 253 ? -6.486  -9.539  -2.153  1.00 44.54  ? 252 LYS B CE    1 
ATOM   5471 N  NZ    . LYS F 3 253 ? -7.338  -9.005  -3.280  1.00 44.72  ? 252 LYS B NZ    1 
ATOM   5472 N  N     . ARG F 3 254 ? -2.621  -11.798 1.375   1.00 41.62  ? 253 ARG B N     1 
ATOM   5473 C  CA    . ARG F 3 254 ? -2.856  -13.051 2.082   1.00 42.50  ? 253 ARG B CA    1 
ATOM   5474 C  C     . ARG F 3 254 ? -1.801  -13.287 3.158   1.00 42.71  ? 253 ARG B C     1 
ATOM   5475 O  O     . ARG F 3 254 ? -0.744  -13.858 2.889   1.00 42.65  ? 253 ARG B O     1 
ATOM   5476 C  CB    . ARG F 3 254 ? -2.877  -14.224 1.100   1.00 42.27  ? 253 ARG B CB    1 
ATOM   5477 C  CG    . ARG F 3 254 ? -2.481  -15.556 1.716   1.00 43.43  ? 253 ARG B CG    1 
ATOM   5478 C  CD    . ARG F 3 254 ? -1.686  -16.403 0.736   1.00 45.36  ? 253 ARG B CD    1 
ATOM   5479 N  NE    . ARG F 3 254 ? -0.471  -16.944 1.339   1.00 45.31  ? 253 ARG B NE    1 
ATOM   5480 C  CZ    . ARG F 3 254 ? 0.440   -17.650 0.678   1.00 45.55  ? 253 ARG B CZ    1 
ATOM   5481 N  NH1   . ARG F 3 254 ? 0.277   -17.905 -0.613  1.00 46.38  ? 253 ARG B NH1   1 
ATOM   5482 N  NH2   . ARG F 3 254 ? 1.516   -18.103 1.308   1.00 44.69  ? 253 ARG B NH2   1 
ATOM   5483 N  N     . ASN F 3 255 ? -2.096  -12.846 4.377   1.00 42.86  ? 254 ASN B N     1 
ATOM   5484 C  CA    . ASN F 3 255 ? -1.177  -13.020 5.495   1.00 42.94  ? 254 ASN B CA    1 
ATOM   5485 C  C     . ASN F 3 255 ? -0.377  -14.312 5.374   1.00 43.08  ? 254 ASN B C     1 
ATOM   5486 O  O     . ASN F 3 255 ? -0.946  -15.395 5.239   1.00 42.88  ? 254 ASN B O     1 
ATOM   5487 C  CB    . ASN F 3 255 ? -1.937  -12.994 6.823   1.00 43.49  ? 254 ASN B CB    1 
ATOM   5488 C  CG    . ASN F 3 255 ? -3.418  -12.723 6.642   1.00 44.68  ? 254 ASN B CG    1 
ATOM   5489 O  OD1   . ASN F 3 255 ? -3.974  -12.944 5.566   1.00 46.14  ? 254 ASN B OD1   1 
ATOM   5490 N  ND2   . ASN F 3 255 ? -4.064  -12.242 7.697   1.00 45.02  ? 254 ASN B ND2   1 
ATOM   5491 N  N     . SER F 3 256 ? 0.946   -14.191 5.420   1.00 43.29  ? 255 SER B N     1 
ATOM   5492 C  CA    . SER F 3 256 ? 1.821   -15.351 5.296   1.00 43.15  ? 255 SER B CA    1 
ATOM   5493 C  C     . SER F 3 256 ? 2.941   -15.328 6.331   1.00 42.99  ? 255 SER B C     1 
ATOM   5494 O  O     . SER F 3 256 ? 3.212   -14.298 6.948   1.00 43.23  ? 255 SER B O     1 
ATOM   5495 C  CB    . SER F 3 256 ? 2.411   -15.427 3.886   1.00 43.04  ? 255 SER B CB    1 
ATOM   5496 O  OG    . SER F 3 256 ? 3.795   -15.730 3.928   1.00 43.53  ? 255 SER B OG    1 
ATOM   5497 N  N     . ARG F 3 257 ? 3.588   -16.475 6.513   1.00 42.38  ? 256 ARG B N     1 
ATOM   5498 C  CA    . ARG F 3 257 ? 4.667   -16.599 7.442   1.00 42.07  ? 256 ARG B CA    1 
ATOM   5499 C  C     . ARG F 3 257 ? 6.064   -16.799 6.773   1.00 41.89  ? 256 ARG B C     1 
ATOM   5500 O  O     . ARG F 3 257 ? 7.101   -16.918 7.457   1.00 41.57  ? 256 ARG B O     1 
ATOM   5501 C  CB    . ARG F 3 257 ? 4.294   -17.609 8.542   1.00 42.06  ? 256 ARG B CB    1 
ATOM   5502 C  CG    . ARG F 3 257 ? 4.444   -19.095 8.263   1.00 41.93  ? 256 ARG B CG    1 
ATOM   5503 C  CD    . ARG F 3 257 ? 4.131   -19.862 9.566   1.00 42.64  ? 256 ARG B CD    1 
ATOM   5504 N  NE    . ARG F 3 257 ? 5.132   -19.568 10.593  1.00 41.33  ? 256 ARG B NE    1 
ATOM   5505 C  CZ    . ARG F 3 257 ? 5.064   -18.544 11.442  1.00 39.77  ? 256 ARG B CZ    1 
ATOM   5506 N  NH1   . ARG F 3 257 ? 4.002   -17.746 11.417  1.00 38.84  ? 256 ARG B NH1   1 
ATOM   5507 N  NH2   . ARG F 3 257 ? 6.044   -18.336 12.322  1.00 36.95  ? 256 ARG B NH2   1 
ATOM   5508 N  N     . ASN F 3 258 ? 6.073   -16.781 5.437   1.00 41.62  ? 257 ASN B N     1 
ATOM   5509 C  CA    . ASN F 3 258 ? 7.305   -16.855 4.631   1.00 41.48  ? 257 ASN B CA    1 
ATOM   5510 C  C     . ASN F 3 258 ? 7.948   -15.474 4.404   1.00 40.92  ? 257 ASN B C     1 
ATOM   5511 O  O     . ASN F 3 258 ? 7.321   -14.522 3.932   1.00 40.70  ? 257 ASN B O     1 
ATOM   5512 C  CB    . ASN F 3 258 ? 7.052   -17.602 3.310   1.00 41.47  ? 257 ASN B CB    1 
ATOM   5513 C  CG    . ASN F 3 258 ? 7.861   -17.049 2.138   1.00 42.66  ? 257 ASN B CG    1 
ATOM   5514 O  OD1   . ASN F 3 258 ? 7.301   -16.762 1.078   1.00 42.93  ? 257 ASN B OD1   1 
ATOM   5515 N  ND2   . ASN F 3 258 ? 9.187   -16.905 2.321   1.00 43.32  ? 257 ASN B ND2   1 
ATOM   5516 N  N     . LEU F 3 259 ? 9.215   -15.387 4.763   1.00 40.45  ? 258 LEU B N     1 
ATOM   5517 C  CA    . LEU F 3 259 ? 9.970   -14.144 4.670   1.00 39.81  ? 258 LEU B CA    1 
ATOM   5518 C  C     . LEU F 3 259 ? 9.943   -13.469 3.268   1.00 39.26  ? 258 LEU B C     1 
ATOM   5519 O  O     . LEU F 3 259 ? 9.685   -12.254 3.161   1.00 38.47  ? 258 LEU B O     1 
ATOM   5520 C  CB    . LEU F 3 259 ? 11.409  -14.421 5.114   1.00 39.63  ? 258 LEU B CB    1 
ATOM   5521 C  CG    . LEU F 3 259 ? 12.368  -13.238 5.180   1.00 39.39  ? 258 LEU B CG    1 
ATOM   5522 C  CD1   . LEU F 3 259 ? 11.925  -12.359 6.294   1.00 40.85  ? 258 LEU B CD1   1 
ATOM   5523 C  CD2   . LEU F 3 259 ? 13.798  -13.690 5.392   1.00 37.73  ? 258 LEU B CD2   1 
ATOM   5524 N  N     . GLU F 3 260 ? 10.201  -14.273 2.227   1.00 38.62  ? 259 GLU B N     1 
ATOM   5525 C  CA    . GLU F 3 260 ? 10.418  -13.806 0.852   1.00 38.26  ? 259 GLU B CA    1 
ATOM   5526 C  C     . GLU F 3 260 ? 9.179   -13.229 0.228   1.00 37.82  ? 259 GLU B C     1 
ATOM   5527 O  O     . GLU F 3 260 ? 9.261   -12.463 -0.744  1.00 36.99  ? 259 GLU B O     1 
ATOM   5528 C  CB    . GLU F 3 260 ? 10.910  -14.939 -0.051  1.00 38.43  ? 259 GLU B CB    1 
ATOM   5529 C  CG    . GLU F 3 260 ? 12.287  -15.473 0.273   1.00 39.24  ? 259 GLU B CG    1 
ATOM   5530 C  CD    . GLU F 3 260 ? 13.196  -14.429 0.863   1.00 41.49  ? 259 GLU B CD    1 
ATOM   5531 O  OE1   . GLU F 3 260 ? 13.703  -13.558 0.101   1.00 42.76  ? 259 GLU B OE1   1 
ATOM   5532 O  OE2   . GLU F 3 260 ? 13.408  -14.485 2.098   1.00 42.19  ? 259 GLU B OE2   1 
ATOM   5533 N  N     . GLU F 3 261 ? 8.037   -13.639 0.778   1.00 37.35  ? 260 GLU B N     1 
ATOM   5534 C  CA    . GLU F 3 261 ? 6.752   -13.056 0.426   1.00 37.23  ? 260 GLU B CA    1 
ATOM   5535 C  C     . GLU F 3 261 ? 6.351   -11.845 1.309   1.00 36.27  ? 260 GLU B C     1 
ATOM   5536 O  O     . GLU F 3 261 ? 5.757   -10.915 0.785   1.00 36.68  ? 260 GLU B O     1 
ATOM   5537 C  CB    . GLU F 3 261 ? 5.645   -14.119 0.371   1.00 37.39  ? 260 GLU B CB    1 
ATOM   5538 C  CG    . GLU F 3 261 ? 4.248   -13.588 0.727   1.00 37.92  ? 260 GLU B CG    1 
ATOM   5539 C  CD    . GLU F 3 261 ? 3.173   -14.683 0.751   1.00 38.20  ? 260 GLU B CD    1 
ATOM   5540 O  OE1   . GLU F 3 261 ? 3.308   -15.656 1.523   1.00 38.50  ? 260 GLU B OE1   1 
ATOM   5541 O  OE2   . GLU F 3 261 ? 2.196   -14.559 -0.016  1.00 37.34  ? 260 GLU B OE2   1 
ATOM   5542 N  N     . ILE F 3 262 ? 6.667   -11.862 2.608   1.00 34.68  ? 261 ILE B N     1 
ATOM   5543 C  CA    . ILE F 3 262 ? 6.472   -10.699 3.483   1.00 33.47  ? 261 ILE B CA    1 
ATOM   5544 C  C     . ILE F 3 262 ? 7.417   -9.511  3.212   1.00 33.23  ? 261 ILE B C     1 
ATOM   5545 O  O     . ILE F 3 262 ? 7.040   -8.360  3.472   1.00 32.82  ? 261 ILE B O     1 
ATOM   5546 C  CB    . ILE F 3 262 ? 6.660   -11.055 4.952   1.00 33.79  ? 261 ILE B CB    1 
ATOM   5547 C  CG1   . ILE F 3 262 ? 5.734   -12.212 5.371   1.00 33.82  ? 261 ILE B CG1   1 
ATOM   5548 C  CG2   . ILE F 3 262 ? 6.488   -9.786  5.838   1.00 33.27  ? 261 ILE B CG2   1 
ATOM   5549 C  CD1   . ILE F 3 262 ? 6.071   -12.816 6.750   1.00 32.86  ? 261 ILE B CD1   1 
ATOM   5550 N  N     . LYS F 3 263 ? 8.627   -9.786  2.701   1.00 32.62  ? 262 LYS B N     1 
ATOM   5551 C  CA    . LYS F 3 263 ? 9.654   -8.748  2.528   1.00 32.12  ? 262 LYS B CA    1 
ATOM   5552 C  C     . LYS F 3 263 ? 9.247   -7.584  1.611   1.00 32.18  ? 262 LYS B C     1 
ATOM   5553 O  O     . LYS F 3 263 ? 9.371   -6.417  1.987   1.00 31.66  ? 262 LYS B O     1 
ATOM   5554 C  CB    . LYS F 3 263 ? 10.974  -9.342  2.051   1.00 32.29  ? 262 LYS B CB    1 
ATOM   5555 C  CG    . LYS F 3 263 ? 11.921  -9.877  3.140   1.00 31.79  ? 262 LYS B CG    1 
ATOM   5556 C  CD    . LYS F 3 263 ? 12.988  -10.869 2.572   1.00 31.06  ? 262 LYS B CD    1 
ATOM   5557 C  CE    . LYS F 3 263 ? 14.262  -10.155 2.131   1.00 31.78  ? 262 LYS B CE    1 
ATOM   5558 N  NZ    . LYS F 3 263 ? 14.883  -10.727 0.891   1.00 32.00  ? 262 LYS B NZ    1 
ATOM   5559 N  N     . PRO F 3 264 ? 8.753   -7.888  0.399   1.00 32.48  ? 263 PRO B N     1 
ATOM   5560 C  CA    . PRO F 3 264 ? 8.408   -6.743  -0.461  1.00 31.99  ? 263 PRO B CA    1 
ATOM   5561 C  C     . PRO F 3 264 ? 7.422   -5.784  0.237   1.00 31.23  ? 263 PRO B C     1 
ATOM   5562 O  O     . PRO F 3 264 ? 7.482   -4.563  0.011   1.00 31.17  ? 263 PRO B O     1 
ATOM   5563 C  CB    . PRO F 3 264 ? 7.757   -7.404  -1.697  1.00 32.71  ? 263 PRO B CB    1 
ATOM   5564 C  CG    . PRO F 3 264 ? 8.080   -8.872  -1.609  1.00 32.60  ? 263 PRO B CG    1 
ATOM   5565 C  CD    . PRO F 3 264 ? 8.283   -9.176  -0.158  1.00 32.48  ? 263 PRO B CD    1 
ATOM   5566 N  N     . TYR F 3 265 ? 6.551   -6.331  1.089   1.00 29.95  ? 264 TYR B N     1 
ATOM   5567 C  CA    . TYR F 3 265 ? 5.605   -5.519  1.859   1.00 29.50  ? 264 TYR B CA    1 
ATOM   5568 C  C     . TYR F 3 265 ? 6.342   -4.606  2.840   1.00 28.93  ? 264 TYR B C     1 
ATOM   5569 O  O     . TYR F 3 265 ? 6.032   -3.399  2.981   1.00 28.40  ? 264 TYR B O     1 
ATOM   5570 C  CB    . TYR F 3 265 ? 4.636   -6.406  2.638   1.00 29.61  ? 264 TYR B CB    1 
ATOM   5571 C  CG    . TYR F 3 265 ? 3.578   -7.127  1.809   1.00 30.37  ? 264 TYR B CG    1 
ATOM   5572 C  CD1   . TYR F 3 265 ? 2.468   -6.438  1.282   1.00 30.74  ? 264 TYR B CD1   1 
ATOM   5573 C  CD2   . TYR F 3 265 ? 3.664   -8.514  1.569   1.00 31.12  ? 264 TYR B CD2   1 
ATOM   5574 C  CE1   . TYR F 3 265 ? 1.466   -7.103  0.518   1.00 31.59  ? 264 TYR B CE1   1 
ATOM   5575 C  CE2   . TYR F 3 265 ? 2.646   -9.203  0.801   1.00 32.10  ? 264 TYR B CE2   1 
ATOM   5576 C  CZ    . TYR F 3 265 ? 1.559   -8.475  0.298   1.00 32.13  ? 264 TYR B CZ    1 
ATOM   5577 O  OH    . TYR F 3 265 ? 0.591   -9.106  -0.422  1.00 33.76  ? 264 TYR B OH    1 
ATOM   5578 N  N     . LEU F 3 266 ? 7.349   -5.200  3.482   1.00 28.00  ? 265 LEU B N     1 
ATOM   5579 C  CA    . LEU F 3 266 ? 8.191   -4.531  4.466   1.00 26.92  ? 265 LEU B CA    1 
ATOM   5580 C  C     . LEU F 3 266 ? 8.988   -3.395  3.869   1.00 26.57  ? 265 LEU B C     1 
ATOM   5581 O  O     . LEU F 3 266 ? 9.079   -2.298  4.468   1.00 26.64  ? 265 LEU B O     1 
ATOM   5582 C  CB    . LEU F 3 266 ? 9.129   -5.546  5.118   1.00 26.34  ? 265 LEU B CB    1 
ATOM   5583 C  CG    . LEU F 3 266 ? 10.167  -5.004  6.077   1.00 24.52  ? 265 LEU B CG    1 
ATOM   5584 C  CD1   . LEU F 3 266 ? 9.490   -4.101  7.060   1.00 23.91  ? 265 LEU B CD1   1 
ATOM   5585 C  CD2   . LEU F 3 266 ? 10.826  -6.186  6.778   1.00 21.82  ? 265 LEU B CD2   1 
ATOM   5586 N  N     . PHE F 3 267 ? 9.541   -3.655  2.695   1.00 25.68  ? 266 PHE B N     1 
ATOM   5587 C  CA    . PHE F 3 267 ? 10.416  -2.697  2.013   1.00 26.31  ? 266 PHE B CA    1 
ATOM   5588 C  C     . PHE F 3 267 ? 9.701   -1.421  1.557   1.00 27.18  ? 266 PHE B C     1 
ATOM   5589 O  O     . PHE F 3 267 ? 10.267  -0.316  1.679   1.00 27.60  ? 266 PHE B O     1 
ATOM   5590 C  CB    . PHE F 3 267 ? 11.081  -3.358  0.799   1.00 26.16  ? 266 PHE B CB    1 
ATOM   5591 C  CG    . PHE F 3 267 ? 12.081  -4.417  1.160   1.00 26.26  ? 266 PHE B CG    1 
ATOM   5592 C  CD1   . PHE F 3 267 ? 12.538  -4.556  2.497   1.00 24.64  ? 266 PHE B CD1   1 
ATOM   5593 C  CD2   . PHE F 3 267 ? 12.613  -5.245  0.174   1.00 27.79  ? 266 PHE B CD2   1 
ATOM   5594 C  CE1   . PHE F 3 267 ? 13.479  -5.500  2.840   1.00 24.73  ? 266 PHE B CE1   1 
ATOM   5595 C  CE2   . PHE F 3 267 ? 13.600  -6.212  0.496   1.00 27.47  ? 266 PHE B CE2   1 
ATOM   5596 C  CZ    . PHE F 3 267 ? 14.032  -6.344  1.825   1.00 26.62  ? 266 PHE B CZ    1 
ATOM   5597 N  N     . ARG F 3 268 ? 8.479   -1.555  1.014   1.00 27.58  ? 267 ARG B N     1 
ATOM   5598 C  CA    . ARG F 3 268 ? 7.721   -0.357  0.642   1.00 27.39  ? 267 ARG B CA    1 
ATOM   5599 C  C     . ARG F 3 268 ? 7.246   0.440   1.869   1.00 27.23  ? 267 ARG B C     1 
ATOM   5600 O  O     . ARG F 3 268 ? 7.027   1.651   1.780   1.00 27.92  ? 267 ARG B O     1 
ATOM   5601 C  CB    . ARG F 3 268 ? 6.565   -0.679  -0.306  1.00 27.96  ? 267 ARG B CB    1 
ATOM   5602 C  CG    . ARG F 3 268 ? 5.161   -0.885  0.317   1.00 28.05  ? 267 ARG B CG    1 
ATOM   5603 C  CD    . ARG F 3 268 ? 4.081   -0.908  -0.777  1.00 29.49  ? 267 ARG B CD    1 
ATOM   5604 N  NE    . ARG F 3 268 ? 4.409   -1.893  -1.817  1.00 32.60  ? 267 ARG B NE    1 
ATOM   5605 C  CZ    . ARG F 3 268 ? 3.791   -3.073  -2.010  1.00 33.25  ? 267 ARG B CZ    1 
ATOM   5606 N  NH1   . ARG F 3 268 ? 2.771   -3.430  -1.216  1.00 32.82  ? 267 ARG B NH1   1 
ATOM   5607 N  NH2   . ARG F 3 268 ? 4.198   -3.897  -2.999  1.00 30.73  ? 267 ARG B NH2   1 
ATOM   5608 N  N     . ALA F 3 269 ? 7.070   -0.227  3.007   1.00 26.67  ? 268 ALA B N     1 
ATOM   5609 C  CA    . ALA F 3 269 ? 6.773   0.495   4.240   1.00 25.96  ? 268 ALA B CA    1 
ATOM   5610 C  C     . ALA F 3 269 ? 8.011   1.354   4.660   1.00 25.79  ? 268 ALA B C     1 
ATOM   5611 O  O     . ALA F 3 269 ? 7.855   2.451   5.194   1.00 25.74  ? 268 ALA B O     1 
ATOM   5612 C  CB    . ALA F 3 269 ? 6.316   -0.472  5.343   1.00 25.25  ? 268 ALA B CB    1 
ATOM   5613 N  N     . ILE F 3 270 ? 9.225   0.864   4.378   1.00 25.89  ? 269 ILE B N     1 
ATOM   5614 C  CA    . ILE F 3 270 ? 10.471  1.635   4.571   1.00 25.65  ? 269 ILE B CA    1 
ATOM   5615 C  C     . ILE F 3 270 ? 10.663  2.798   3.589   1.00 27.05  ? 269 ILE B C     1 
ATOM   5616 O  O     . ILE F 3 270 ? 10.910  3.936   4.013   1.00 28.07  ? 269 ILE B O     1 
ATOM   5617 C  CB    . ILE F 3 270 ? 11.715  0.756   4.523   1.00 24.83  ? 269 ILE B CB    1 
ATOM   5618 C  CG1   . ILE F 3 270 ? 11.770  -0.194  5.723   1.00 23.72  ? 269 ILE B CG1   1 
ATOM   5619 C  CG2   . ILE F 3 270 ? 12.945  1.618   4.529   1.00 24.04  ? 269 ILE B CG2   1 
ATOM   5620 C  CD1   . ILE F 3 270 ? 12.083  -1.656  5.339   1.00 19.14  ? 269 ILE B CD1   1 
ATOM   5621 N  N     . GLU F 3 271 ? 10.549  2.544   2.287   1.00 28.09  ? 270 GLU B N     1 
ATOM   5622 C  CA    . GLU F 3 271 ? 10.548  3.649   1.287   1.00 28.98  ? 270 GLU B CA    1 
ATOM   5623 C  C     . GLU F 3 271 ? 9.549   4.733   1.682   1.00 29.27  ? 270 GLU B C     1 
ATOM   5624 O  O     . GLU F 3 271 ? 9.877   5.923   1.763   1.00 29.48  ? 270 GLU B O     1 
ATOM   5625 C  CB    . GLU F 3 271 ? 10.264  3.131   -0.126  1.00 29.06  ? 270 GLU B CB    1 
ATOM   5626 C  CG    . GLU F 3 271 ? 11.371  2.236   -0.692  1.00 30.24  ? 270 GLU B CG    1 
ATOM   5627 C  CD    . GLU F 3 271 ? 12.756  2.940   -0.753  1.00 34.71  ? 270 GLU B CD    1 
ATOM   5628 O  OE1   . GLU F 3 271 ? 12.805  4.202   -0.836  1.00 37.70  ? 270 GLU B OE1   1 
ATOM   5629 O  OE2   . GLU F 3 271 ? 13.810  2.239   -0.723  1.00 33.90  ? 270 GLU B OE2   1 
ATOM   5630 N  N     . GLU F 3 272 ? 8.340   4.316   2.018   1.00 29.78  ? 271 GLU B N     1 
ATOM   5631 C  CA    . GLU F 3 272 ? 7.359   5.286   2.443   1.00 30.48  ? 271 GLU B CA    1 
ATOM   5632 C  C     . GLU F 3 272 ? 7.721   5.943   3.787   1.00 30.68  ? 271 GLU B C     1 
ATOM   5633 O  O     . GLU F 3 272 ? 7.682   7.165   3.876   1.00 31.51  ? 271 GLU B O     1 
ATOM   5634 C  CB    . GLU F 3 272 ? 5.941   4.729   2.361   1.00 31.32  ? 271 GLU B CB    1 
ATOM   5635 C  CG    . GLU F 3 272 ? 5.361   4.717   0.897   1.00 33.45  ? 271 GLU B CG    1 
ATOM   5636 C  CD    . GLU F 3 272 ? 4.408   3.540   0.635   1.00 36.52  ? 271 GLU B CD    1 
ATOM   5637 O  OE1   . GLU F 3 272 ? 3.494   3.355   1.477   1.00 35.79  ? 271 GLU B OE1   1 
ATOM   5638 O  OE2   . GLU F 3 272 ? 4.592   2.799   -0.398  1.00 38.35  ? 271 GLU B OE2   1 
ATOM   5639 N  N     . SER F 3 273 ? 8.129   5.203   4.818   1.00 30.36  ? 272 SER B N     1 
ATOM   5640 C  CA    . SER F 3 273 ? 8.589   5.931   6.012   1.00 30.40  ? 272 SER B CA    1 
ATOM   5641 C  C     . SER F 3 273 ? 9.715   6.915   5.631   1.00 31.70  ? 272 SER B C     1 
ATOM   5642 O  O     . SER F 3 273 ? 9.598   8.091   5.951   1.00 32.89  ? 272 SER B O     1 
ATOM   5643 C  CB    . SER F 3 273 ? 8.957   5.029   7.178   1.00 29.90  ? 272 SER B CB    1 
ATOM   5644 O  OG    . SER F 3 273 ? 7.965   4.036   7.365   1.00 26.18  ? 272 SER B OG    1 
ATOM   5645 N  N     . TYR F 3 274 ? 10.700  6.497   4.851   1.00 32.23  ? 273 TYR B N     1 
ATOM   5646 C  CA    . TYR F 3 274 ? 11.756  7.416   4.448   1.00 33.13  ? 273 TYR B CA    1 
ATOM   5647 C  C     . TYR F 3 274 ? 11.366  8.690   3.670   1.00 34.71  ? 273 TYR B C     1 
ATOM   5648 O  O     . TYR F 3 274 ? 11.824  9.745   4.002   1.00 35.34  ? 273 TYR B O     1 
ATOM   5649 C  CB    . TYR F 3 274 ? 12.935  6.666   3.829   1.00 32.30  ? 273 TYR B CB    1 
ATOM   5650 C  CG    . TYR F 3 274 ? 13.884  6.168   4.870   1.00 31.24  ? 273 TYR B CG    1 
ATOM   5651 C  CD1   . TYR F 3 274 ? 15.019  6.871   5.197   1.00 30.18  ? 273 TYR B CD1   1 
ATOM   5652 C  CD2   . TYR F 3 274 ? 13.624  5.023   5.560   1.00 29.35  ? 273 TYR B CD2   1 
ATOM   5653 C  CE1   . TYR F 3 274 ? 15.859  6.441   6.159   1.00 27.96  ? 273 TYR B CE1   1 
ATOM   5654 C  CE2   . TYR F 3 274 ? 14.452  4.597   6.516   1.00 29.49  ? 273 TYR B CE2   1 
ATOM   5655 C  CZ    . TYR F 3 274 ? 15.569  5.311   6.818   1.00 28.56  ? 273 TYR B CZ    1 
ATOM   5656 O  OH    . TYR F 3 274 ? 16.394  4.871   7.778   1.00 27.50  ? 273 TYR B OH    1 
ATOM   5657 N  N     . TYR F 3 275 ? 10.527  8.609   2.652   1.00 36.45  ? 274 TYR B N     1 
ATOM   5658 C  CA    . TYR F 3 275 ? 9.922   9.791   2.051   1.00 37.91  ? 274 TYR B CA    1 
ATOM   5659 C  C     . TYR F 3 275 ? 9.333   10.689  3.145   1.00 37.96  ? 274 TYR B C     1 
ATOM   5660 O  O     . TYR F 3 275 ? 9.607   11.888  3.193   1.00 38.76  ? 274 TYR B O     1 
ATOM   5661 C  CB    . TYR F 3 275 ? 8.836   9.392   1.052   1.00 38.91  ? 274 TYR B CB    1 
ATOM   5662 C  CG    . TYR F 3 275 ? 8.524   10.458  0.026   1.00 41.63  ? 274 TYR B CG    1 
ATOM   5663 C  CD1   . TYR F 3 275 ? 9.047   10.388  -1.258  1.00 43.64  ? 274 TYR B CD1   1 
ATOM   5664 C  CD2   . TYR F 3 275 ? 7.707   11.535  0.342   1.00 43.57  ? 274 TYR B CD2   1 
ATOM   5665 C  CE1   . TYR F 3 275 ? 8.765   11.360  -2.199  1.00 45.73  ? 274 TYR B CE1   1 
ATOM   5666 C  CE2   . TYR F 3 275 ? 7.419   12.512  -0.592  1.00 44.66  ? 274 TYR B CE2   1 
ATOM   5667 C  CZ    . TYR F 3 275 ? 7.950   12.419  -1.861  1.00 45.93  ? 274 TYR B CZ    1 
ATOM   5668 O  OH    . TYR F 3 275 ? 7.667   13.390  -2.794  1.00 47.42  ? 274 TYR B OH    1 
ATOM   5669 N  N     . LYS F 3 276 ? 8.526   10.095  4.023   1.00 37.80  ? 275 LYS B N     1 
ATOM   5670 C  CA    . LYS F 3 276 ? 7.935   10.795  5.153   1.00 38.19  ? 275 LYS B CA    1 
ATOM   5671 C  C     . LYS F 3 276 ? 8.977   11.418  6.101   1.00 38.59  ? 275 LYS B C     1 
ATOM   5672 O  O     . LYS F 3 276 ? 8.719   12.487  6.665   1.00 38.74  ? 275 LYS B O     1 
ATOM   5673 C  CB    . LYS F 3 276 ? 6.997   9.861   5.951   1.00 38.84  ? 275 LYS B CB    1 
ATOM   5674 C  CG    . LYS F 3 276 ? 5.436   10.059  5.785   1.00 40.33  ? 275 LYS B CG    1 
ATOM   5675 C  CD    . LYS F 3 276 ? 4.671   8.689   6.029   1.00 41.98  ? 275 LYS B CD    1 
ATOM   5676 C  CE    . LYS F 3 276 ? 3.235   8.804   6.586   1.00 42.73  ? 275 LYS B CE    1 
ATOM   5677 N  NZ    . LYS F 3 276 ? 2.773   7.514   7.255   1.00 40.82  ? 275 LYS B NZ    1 
ATOM   5678 N  N     . LEU F 3 277 ? 10.127  10.753  6.295   1.00 38.46  ? 276 LEU B N     1 
ATOM   5679 C  CA    . LEU F 3 277 ? 11.157  11.222  7.241   1.00 38.09  ? 276 LEU B CA    1 
ATOM   5680 C  C     . LEU F 3 277 ? 11.664  12.582  6.838   1.00 38.16  ? 276 LEU B C     1 
ATOM   5681 O  O     . LEU F 3 277 ? 11.963  13.401  7.693   1.00 37.84  ? 276 LEU B O     1 
ATOM   5682 C  CB    . LEU F 3 277 ? 12.350  10.263  7.340   1.00 37.60  ? 276 LEU B CB    1 
ATOM   5683 C  CG    . LEU F 3 277 ? 12.181  9.120   8.341   1.00 37.44  ? 276 LEU B CG    1 
ATOM   5684 C  CD1   . LEU F 3 277 ? 13.085  7.927   8.053   1.00 37.26  ? 276 LEU B CD1   1 
ATOM   5685 C  CD2   . LEU F 3 277 ? 12.432  9.617   9.735   1.00 37.12  ? 276 LEU B CD2   1 
ATOM   5686 N  N     . ASP F 3 278 ? 11.740  12.819  5.533   1.00 38.30  ? 277 ASP B N     1 
ATOM   5687 C  CA    . ASP F 3 278 ? 12.155  14.111  4.999   1.00 39.39  ? 277 ASP B CA    1 
ATOM   5688 C  C     . ASP F 3 278 ? 13.198  14.793  5.876   1.00 39.16  ? 277 ASP B C     1 
ATOM   5689 O  O     . ASP F 3 278 ? 12.861  15.570  6.769   1.00 39.84  ? 277 ASP B O     1 
ATOM   5690 C  CB    . ASP F 3 278 ? 10.942  15.027  4.818   1.00 40.14  ? 277 ASP B CB    1 
ATOM   5691 C  CG    . ASP F 3 278 ? 11.331  16.431  4.398   1.00 41.88  ? 277 ASP B CG    1 
ATOM   5692 O  OD1   . ASP F 3 278 ? 12.129  16.570  3.447   1.00 42.90  ? 277 ASP B OD1   1 
ATOM   5693 O  OD2   . ASP F 3 278 ? 10.840  17.397  5.020   1.00 44.98  ? 277 ASP B OD2   1 
ATOM   5694 N  N     . LYS F 3 279 ? 14.466  14.501  5.610   1.00 37.98  ? 278 LYS B N     1 
ATOM   5695 C  CA    . LYS F 3 279 ? 15.565  15.140  6.324   1.00 36.64  ? 278 LYS B CA    1 
ATOM   5696 C  C     . LYS F 3 279 ? 15.850  14.491  7.675   1.00 35.00  ? 278 LYS B C     1 
ATOM   5697 O  O     . LYS F 3 279 ? 16.986  14.110  7.958   1.00 35.45  ? 278 LYS B O     1 
ATOM   5698 C  CB    . LYS F 3 279 ? 15.283  16.633  6.511   1.00 36.82  ? 278 LYS B CB    1 
ATOM   5699 C  CG    . LYS F 3 279 ? 15.681  17.493  5.323   1.00 37.01  ? 278 LYS B CG    1 
ATOM   5700 C  CD    . LYS F 3 279 ? 16.955  16.980  4.672   1.00 39.17  ? 278 LYS B CD    1 
ATOM   5701 C  CE    . LYS F 3 279 ? 16.659  15.871  3.676   1.00 40.00  ? 278 LYS B CE    1 
ATOM   5702 N  NZ    . LYS F 3 279 ? 17.778  15.675  2.714   1.00 39.63  ? 278 LYS B NZ    1 
ATOM   5703 N  N     . ARG F 3 280 ? 14.822  14.371  8.509   1.00 32.63  ? 279 ARG B N     1 
ATOM   5704 C  CA    . ARG F 3 280 ? 15.007  13.848  9.840   1.00 31.19  ? 279 ARG B CA    1 
ATOM   5705 C  C     . ARG F 3 280 ? 15.798  12.547  9.667   1.00 30.07  ? 279 ARG B C     1 
ATOM   5706 O  O     . ARG F 3 280 ? 15.751  11.963  8.575   1.00 29.93  ? 279 ARG B O     1 
ATOM   5707 C  CB    . ARG F 3 280 ? 13.660  13.656  10.538  1.00 31.30  ? 279 ARG B CB    1 
ATOM   5708 C  CG    . ARG F 3 280 ? 12.892  15.006  10.718  1.00 32.60  ? 279 ARG B CG    1 
ATOM   5709 C  CD    . ARG F 3 280 ? 11.413  14.911  11.308  1.00 34.22  ? 279 ARG B CD    1 
ATOM   5710 N  NE    . ARG F 3 280 ? 10.621  13.860  10.665  1.00 35.93  ? 279 ARG B NE    1 
ATOM   5711 C  CZ    . ARG F 3 280 ? 9.881   13.995  9.558   1.00 36.45  ? 279 ARG B CZ    1 
ATOM   5712 N  NH1   . ARG F 3 280 ? 9.749   15.162  8.932   1.00 34.74  ? 279 ARG B NH1   1 
ATOM   5713 N  NH2   . ARG F 3 280 ? 9.229   12.938  9.077   1.00 38.58  ? 279 ARG B NH2   1 
ATOM   5714 N  N     . ILE F 3 281 ? 16.558  12.130  10.698  1.00 28.37  ? 280 ILE B N     1 
ATOM   5715 C  CA    . ILE F 3 281 ? 17.381  10.888  10.654  1.00 26.86  ? 280 ILE B CA    1 
ATOM   5716 C  C     . ILE F 3 281 ? 17.135  10.012  11.877  1.00 25.39  ? 280 ILE B C     1 
ATOM   5717 O  O     . ILE F 3 281 ? 17.645  10.336  12.935  1.00 25.48  ? 280 ILE B O     1 
ATOM   5718 C  CB    . ILE F 3 281 ? 18.952  11.099  10.617  1.00 27.36  ? 280 ILE B CB    1 
ATOM   5719 C  CG1   . ILE F 3 281 ? 19.434  12.173  9.604   1.00 27.65  ? 280 ILE B CG1   1 
ATOM   5720 C  CG2   . ILE F 3 281 ? 19.680  9.731   10.453  1.00 26.10  ? 280 ILE B CG2   1 
ATOM   5721 C  CD1   . ILE F 3 281 ? 19.212  11.812  8.169   1.00 29.69  ? 280 ILE B CD1   1 
ATOM   5722 N  N     . PRO F 3 282 ? 16.414  8.871   11.716  1.00 23.69  ? 281 PRO B N     1 
ATOM   5723 C  CA    . PRO F 3 282 ? 16.046  8.085   12.885  1.00 22.83  ? 281 PRO B CA    1 
ATOM   5724 C  C     . PRO F 3 282 ? 17.238  7.351   13.495  1.00 21.92  ? 281 PRO B C     1 
ATOM   5725 O  O     . PRO F 3 282 ? 18.195  6.993   12.764  1.00 21.83  ? 281 PRO B O     1 
ATOM   5726 C  CB    . PRO F 3 282 ? 15.051  7.053   12.320  1.00 23.10  ? 281 PRO B CB    1 
ATOM   5727 C  CG    . PRO F 3 282 ? 15.439  6.889   10.905  1.00 22.64  ? 281 PRO B CG    1 
ATOM   5728 C  CD    . PRO F 3 282 ? 15.935  8.240   10.465  1.00 23.14  ? 281 PRO B CD    1 
ATOM   5729 N  N     . LYS F 3 283 ? 17.179  7.112   14.812  1.00 20.01  ? 282 LYS B N     1 
ATOM   5730 C  CA    . LYS F 3 283 ? 18.187  6.248   15.428  1.00 18.69  ? 282 LYS B CA    1 
ATOM   5731 C  C     . LYS F 3 283 ? 17.573  4.968   15.949  1.00 17.50  ? 282 LYS B C     1 
ATOM   5732 O  O     . LYS F 3 283 ? 18.297  4.112   16.406  1.00 17.67  ? 282 LYS B O     1 
ATOM   5733 C  CB    . LYS F 3 283 ? 19.024  6.967   16.508  1.00 19.03  ? 282 LYS B CB    1 
ATOM   5734 C  CG    . LYS F 3 283 ? 19.568  8.356   16.041  1.00 19.56  ? 282 LYS B CG    1 
ATOM   5735 C  CD    . LYS F 3 283 ? 20.759  8.900   16.825  1.00 21.76  ? 282 LYS B CD    1 
ATOM   5736 C  CE    . LYS F 3 283 ? 20.523  8.959   18.304  1.00 24.06  ? 282 LYS B CE    1 
ATOM   5737 N  NZ    . LYS F 3 283 ? 19.579  10.066  18.550  1.00 29.10  ? 282 LYS B NZ    1 
ATOM   5738 N  N     . ALA F 3 284 ? 16.250  4.834   15.898  1.00 15.69  ? 283 ALA B N     1 
ATOM   5739 C  CA    . ALA F 3 284 ? 15.625  3.569   16.278  1.00 14.75  ? 283 ALA B CA    1 
ATOM   5740 C  C     . ALA F 3 284 ? 14.765  3.097   15.192  1.00 14.29  ? 283 ALA B C     1 
ATOM   5741 O  O     . ALA F 3 284 ? 14.229  3.905   14.432  1.00 14.90  ? 283 ALA B O     1 
ATOM   5742 C  CB    . ALA F 3 284 ? 14.761  3.681   17.566  1.00 14.26  ? 283 ALA B CB    1 
ATOM   5743 N  N     . ILE F 3 285 ? 14.561  1.790   15.153  1.00 13.75  ? 284 ILE B N     1 
ATOM   5744 C  CA    . ILE F 3 285 ? 13.700  1.190   14.165  1.00 13.98  ? 284 ILE B CA    1 
ATOM   5745 C  C     . ILE F 3 285 ? 12.928  0.085   14.880  1.00 14.65  ? 284 ILE B C     1 
ATOM   5746 O  O     . ILE F 3 285 ? 13.501  -0.579  15.682  1.00 16.00  ? 284 ILE B O     1 
ATOM   5747 C  CB    . ILE F 3 285 ? 14.509  0.676   12.944  1.00 13.30  ? 284 ILE B CB    1 
ATOM   5748 C  CG1   . ILE F 3 285 ? 13.589  0.145   11.845  1.00 11.83  ? 284 ILE B CG1   1 
ATOM   5749 C  CG2   . ILE F 3 285 ? 15.474  -0.406  13.368  1.00 13.78  ? 284 ILE B CG2   1 
ATOM   5750 C  CD1   . ILE F 3 285 ? 14.289  -0.321  10.621  1.00 15.14  ? 284 ILE B CD1   1 
ATOM   5751 N  N     . HIS F 3 286 ? 11.648  -0.089  14.595  1.00 15.21  ? 285 HIS B N     1 
ATOM   5752 C  CA    . HIS F 3 286 ? 10.848  -1.152  15.176  1.00 16.50  ? 285 HIS B CA    1 
ATOM   5753 C  C     . HIS F 3 286 ? 10.026  -1.700  14.003  1.00 17.05  ? 285 HIS B C     1 
ATOM   5754 O  O     . HIS F 3 286 ? 9.536   -0.917  13.166  1.00 16.57  ? 285 HIS B O     1 
ATOM   5755 C  CB    . HIS F 3 286 ? 9.842   -0.619  16.207  1.00 16.13  ? 285 HIS B CB    1 
ATOM   5756 C  CG    . HIS F 3 286 ? 10.453  0.149   17.334  1.00 19.58  ? 285 HIS B CG    1 
ATOM   5757 N  ND1   . HIS F 3 286 ? 10.685  -0.409  18.578  1.00 21.43  ? 285 HIS B ND1   1 
ATOM   5758 C  CD2   . HIS F 3 286 ? 10.887  1.433   17.410  1.00 21.30  ? 285 HIS B CD2   1 
ATOM   5759 C  CE1   . HIS F 3 286 ? 11.249  0.494   19.365  1.00 22.41  ? 285 HIS B CE1   1 
ATOM   5760 N  NE2   . HIS F 3 286 ? 11.381  1.622   18.682  1.00 22.65  ? 285 HIS B NE2   1 
ATOM   5761 N  N     . VAL F 3 287 ? 9.893   -3.019  13.940  1.00 16.91  ? 286 VAL B N     1 
ATOM   5762 C  CA    . VAL F 3 287 ? 9.011   -3.641  12.982  1.00 17.21  ? 286 VAL B CA    1 
ATOM   5763 C  C     . VAL F 3 287 ? 7.696   -4.103  13.648  1.00 19.02  ? 286 VAL B C     1 
ATOM   5764 O  O     . VAL F 3 287 ? 7.658   -4.702  14.774  1.00 18.38  ? 286 VAL B O     1 
ATOM   5765 C  CB    . VAL F 3 287 ? 9.694   -4.796  12.254  1.00 16.87  ? 286 VAL B CB    1 
ATOM   5766 C  CG1   . VAL F 3 287 ? 8.659   -5.614  11.484  1.00 14.29  ? 286 VAL B CG1   1 
ATOM   5767 C  CG2   . VAL F 3 287 ? 10.802  -4.226  11.338  1.00 14.68  ? 286 VAL B CG2   1 
ATOM   5768 N  N     . VAL F 3 288 ? 6.613   -3.807  12.951  1.00 19.93  ? 287 VAL B N     1 
ATOM   5769 C  CA    . VAL F 3 288 ? 5.340   -4.015  13.539  1.00 21.56  ? 287 VAL B CA    1 
ATOM   5770 C  C     . VAL F 3 288 ? 4.572   -4.971  12.687  1.00 22.58  ? 287 VAL B C     1 
ATOM   5771 O  O     . VAL F 3 288 ? 4.349   -4.742  11.510  1.00 22.62  ? 287 VAL B O     1 
ATOM   5772 C  CB    . VAL F 3 288 ? 4.636   -2.703  13.765  1.00 21.74  ? 287 VAL B CB    1 
ATOM   5773 C  CG1   . VAL F 3 288 ? 3.333   -2.947  14.486  1.00 23.67  ? 287 VAL B CG1   1 
ATOM   5774 C  CG2   . VAL F 3 288 ? 5.535   -1.779  14.586  1.00 21.79  ? 287 VAL B CG2   1 
ATOM   5775 N  N     . ALA F 3 289 ? 4.227   -6.081  13.314  1.00 24.20  ? 288 ALA B N     1 
ATOM   5776 C  CA    . ALA F 3 289 ? 3.472   -7.133  12.713  1.00 25.51  ? 288 ALA B CA    1 
ATOM   5777 C  C     . ALA F 3 289 ? 2.107   -7.263  13.401  1.00 27.23  ? 288 ALA B C     1 
ATOM   5778 O  O     . ALA F 3 289 ? 2.014   -7.361  14.648  1.00 27.86  ? 288 ALA B O     1 
ATOM   5779 C  CB    . ALA F 3 289 ? 4.218   -8.378  12.904  1.00 25.67  ? 288 ALA B CB    1 
ATOM   5780 N  N     . VAL F 3 290 ? 1.042   -7.273  12.611  1.00 28.46  ? 289 VAL B N     1 
ATOM   5781 C  CA    . VAL F 3 290 ? -0.276  -7.611  13.132  1.00 29.53  ? 289 VAL B CA    1 
ATOM   5782 C  C     . VAL F 3 290 ? -0.659  -9.023  12.699  1.00 31.00  ? 289 VAL B C     1 
ATOM   5783 O  O     . VAL F 3 290 ? -0.804  -9.293  11.505  1.00 29.89  ? 289 VAL B O     1 
ATOM   5784 C  CB    . VAL F 3 290 ? -1.337  -6.631  12.666  1.00 29.43  ? 289 VAL B CB    1 
ATOM   5785 C  CG1   . VAL F 3 290 ? -2.678  -6.926  13.346  1.00 29.02  ? 289 VAL B CG1   1 
ATOM   5786 C  CG2   . VAL F 3 290 ? -0.881  -5.188  12.921  1.00 29.31  ? 289 VAL B CG2   1 
ATOM   5787 N  N     . THR F 3 291 ? -0.832  -9.913  13.671  1.00 33.30  ? 290 THR B N     1 
ATOM   5788 C  CA    . THR F 3 291 ? -1.126  -11.316 13.393  1.00 35.34  ? 290 THR B CA    1 
ATOM   5789 C  C     . THR F 3 291 ? -2.556  -11.562 12.911  1.00 36.45  ? 290 THR B C     1 
ATOM   5790 O  O     . THR F 3 291 ? -3.248  -10.643 12.472  1.00 36.38  ? 290 THR B O     1 
ATOM   5791 C  CB    . THR F 3 291 ? -0.859  -12.200 14.627  1.00 35.86  ? 290 THR B CB    1 
ATOM   5792 O  OG1   . THR F 3 291 ? -1.999  -12.171 15.495  1.00 37.26  ? 290 THR B OG1   1 
ATOM   5793 C  CG2   . THR F 3 291 ? 0.363   -11.703 15.385  1.00 35.21  ? 290 THR B CG2   1 
ATOM   5794 N  N     . GLU F 3 292 ? -2.991  -12.814 12.996  1.00 38.19  ? 291 GLU B N     1 
ATOM   5795 C  CA    . GLU F 3 292 ? -4.334  -13.189 12.569  1.00 39.66  ? 291 GLU B CA    1 
ATOM   5796 C  C     . GLU F 3 292 ? -5.380  -12.755 13.591  1.00 40.20  ? 291 GLU B C     1 
ATOM   5797 O  O     . GLU F 3 292 ? -6.395  -12.155 13.238  1.00 40.28  ? 291 GLU B O     1 
ATOM   5798 C  CB    . GLU F 3 292 ? -4.421  -14.699 12.337  1.00 39.53  ? 291 GLU B CB    1 
ATOM   5799 C  CG    . GLU F 3 292 ? -3.581  -15.524 13.298  1.00 40.33  ? 291 GLU B CG    1 
ATOM   5800 C  CD    . GLU F 3 292 ? -3.387  -16.951 12.825  1.00 41.56  ? 291 GLU B CD    1 
ATOM   5801 O  OE1   . GLU F 3 292 ? -2.495  -17.641 13.362  1.00 41.17  ? 291 GLU B OE1   1 
ATOM   5802 O  OE2   . GLU F 3 292 ? -4.127  -17.384 11.916  1.00 43.29  ? 291 GLU B OE2   1 
ATOM   5803 N  N     . ASP F 3 293 ? -5.125  -13.064 14.859  1.00 41.57  ? 292 ASP B N     1 
ATOM   5804 C  CA    . ASP F 3 293 ? -6.044  -12.707 15.933  1.00 42.86  ? 292 ASP B CA    1 
ATOM   5805 C  C     . ASP F 3 293 ? -6.078  -11.199 16.153  1.00 42.98  ? 292 ASP B C     1 
ATOM   5806 O  O     . ASP F 3 293 ? -6.227  -10.730 17.282  1.00 42.49  ? 292 ASP B O     1 
ATOM   5807 C  CB    . ASP F 3 293 ? -5.653  -13.419 17.230  1.00 43.76  ? 292 ASP B CB    1 
ATOM   5808 C  CG    . ASP F 3 293 ? -5.318  -14.882 17.014  1.00 45.04  ? 292 ASP B CG    1 
ATOM   5809 O  OD1   . ASP F 3 293 ? -5.396  -15.346 15.857  1.00 46.75  ? 292 ASP B OD1   1 
ATOM   5810 O  OD2   . ASP F 3 293 ? -4.977  -15.567 18.000  1.00 46.63  ? 292 ASP B OD2   1 
ATOM   5811 N  N     . LEU F 3 294 ? -5.940  -10.444 15.068  1.00 43.42  ? 293 LEU B N     1 
ATOM   5812 C  CA    . LEU F 3 294 ? -5.955  -8.988  15.141  1.00 44.18  ? 293 LEU B CA    1 
ATOM   5813 C  C     . LEU F 3 294 ? -4.974  -8.478  16.191  1.00 44.65  ? 293 LEU B C     1 
ATOM   5814 O  O     . LEU F 3 294 ? -5.159  -7.399  16.755  1.00 45.64  ? 293 LEU B O     1 
ATOM   5815 C  CB    . LEU F 3 294 ? -7.366  -8.482  15.448  1.00 44.03  ? 293 LEU B CB    1 
ATOM   5816 C  CG    . LEU F 3 294 ? -8.236  -8.125  14.242  1.00 43.44  ? 293 LEU B CG    1 
ATOM   5817 C  CD1   . LEU F 3 294 ? -9.441  -7.303  14.672  1.00 41.64  ? 293 LEU B CD1   1 
ATOM   5818 C  CD2   . LEU F 3 294 ? -7.423  -7.384  13.192  1.00 41.74  ? 293 LEU B CD2   1 
ATOM   5819 N  N     . ASP F 3 295 ? -3.932  -9.261  16.450  1.00 44.64  ? 294 ASP B N     1 
ATOM   5820 C  CA    . ASP F 3 295 ? -2.910  -8.887  17.444  1.00 44.93  ? 294 ASP B CA    1 
ATOM   5821 C  C     . ASP F 3 295 ? -1.757  -8.030  16.861  1.00 44.04  ? 294 ASP B C     1 
ATOM   5822 O  O     . ASP F 3 295 ? -1.467  -8.134  15.656  1.00 43.52  ? 294 ASP B O     1 
ATOM   5823 C  CB    . ASP F 3 295 ? -2.331  -10.143 18.073  1.00 45.95  ? 294 ASP B CB    1 
ATOM   5824 C  CG    . ASP F 3 295 ? -2.987  -10.501 19.394  1.00 48.24  ? 294 ASP B CG    1 
ATOM   5825 O  OD1   . ASP F 3 295 ? -2.262  -10.394 20.413  1.00 50.51  ? 294 ASP B OD1   1 
ATOM   5826 O  OD2   . ASP F 3 295 ? -4.192  -10.899 19.413  1.00 49.68  ? 294 ASP B OD2   1 
ATOM   5827 N  N     . ILE F 3 296 ? -1.109  -7.215  17.714  1.00 42.84  ? 295 ILE B N     1 
ATOM   5828 C  CA    . ILE F 3 296 ? 0.012   -6.300  17.317  1.00 41.71  ? 295 ILE B CA    1 
ATOM   5829 C  C     . ILE F 3 296 ? 1.312   -6.718  17.996  1.00 40.23  ? 295 ILE B C     1 
ATOM   5830 O  O     . ILE F 3 296 ? 1.403   -6.610  19.205  1.00 40.65  ? 295 ILE B O     1 
ATOM   5831 C  CB    . ILE F 3 296 ? -0.272  -4.773  17.641  1.00 41.90  ? 295 ILE B CB    1 
ATOM   5832 C  CG1   . ILE F 3 296 ? -1.566  -4.283  16.971  1.00 42.21  ? 295 ILE B CG1   1 
ATOM   5833 C  CG2   . ILE F 3 296 ? 0.933   -3.841  17.207  1.00 41.70  ? 295 ILE B CG2   1 
ATOM   5834 C  CD1   . ILE F 3 296 ? -2.273  -3.070  17.688  1.00 41.52  ? 295 ILE B CD1   1 
ATOM   5835 N  N     . VAL F 3 297 ? 2.288   -7.200  17.213  1.00 38.44  ? 296 VAL B N     1 
ATOM   5836 C  CA    . VAL F 3 297 ? 3.589   -7.748  17.682  1.00 36.25  ? 296 VAL B CA    1 
ATOM   5837 C  C     . VAL F 3 297 ? 4.720   -6.829  17.174  1.00 35.19  ? 296 VAL B C     1 
ATOM   5838 O  O     . VAL F 3 297 ? 4.679   -6.354  16.022  1.00 35.29  ? 296 VAL B O     1 
ATOM   5839 C  CB    . VAL F 3 297 ? 3.856   -9.183  17.111  1.00 36.15  ? 296 VAL B CB    1 
ATOM   5840 C  CG1   . VAL F 3 297 ? 4.945   -9.902  17.892  1.00 36.46  ? 296 VAL B CG1   1 
ATOM   5841 C  CG2   . VAL F 3 297 ? 2.615   -10.042 17.139  1.00 36.06  ? 296 VAL B CG2   1 
ATOM   5842 N  N     . SER F 3 298 ? 5.751   -6.614  17.995  1.00 33.31  ? 297 SER B N     1 
ATOM   5843 C  CA    . SER F 3 298 ? 6.789   -5.635  17.688  1.00 30.92  ? 297 SER B CA    1 
ATOM   5844 C  C     . SER F 3 298 ? 8.167   -5.989  18.244  1.00 29.35  ? 297 SER B C     1 
ATOM   5845 O  O     . SER F 3 298 ? 8.274   -6.544  19.324  1.00 29.45  ? 297 SER B O     1 
ATOM   5846 C  CB    . SER F 3 298 ? 6.368   -4.275  18.214  1.00 31.06  ? 297 SER B CB    1 
ATOM   5847 O  OG    . SER F 3 298 ? 6.981   -3.249  17.473  1.00 31.95  ? 297 SER B OG    1 
ATOM   5848 N  N     . ARG F 3 299 ? 9.215   -5.674  17.478  1.00 27.28  ? 298 ARG B N     1 
ATOM   5849 C  CA    . ARG F 3 299 ? 10.608  -5.848  17.865  1.00 25.09  ? 298 ARG B CA    1 
ATOM   5850 C  C     . ARG F 3 299 ? 11.313  -4.685  17.243  1.00 23.32  ? 298 ARG B C     1 
ATOM   5851 O  O     . ARG F 3 299 ? 11.020  -4.320  16.111  1.00 23.27  ? 298 ARG B O     1 
ATOM   5852 C  CB    . ARG F 3 299 ? 11.206  -7.103  17.235  1.00 25.45  ? 298 ARG B CB    1 
ATOM   5853 C  CG    . ARG F 3 299 ? 10.533  -8.412  17.536  1.00 27.13  ? 298 ARG B CG    1 
ATOM   5854 C  CD    . ARG F 3 299 ? 10.786  -8.853  18.953  1.00 30.55  ? 298 ARG B CD    1 
ATOM   5855 N  NE    . ARG F 3 299 ? 10.198  -10.182 19.264  1.00 35.06  ? 298 ARG B NE    1 
ATOM   5856 C  CZ    . ARG F 3 299 ? 9.012   -10.391 19.853  1.00 33.70  ? 298 ARG B CZ    1 
ATOM   5857 N  NH1   . ARG F 3 299 ? 8.233   -9.385  20.210  1.00 32.66  ? 298 ARG B NH1   1 
ATOM   5858 N  NH2   . ARG F 3 299 ? 8.616   -11.620 20.087  1.00 34.07  ? 298 ARG B NH2   1 
ATOM   5859 N  N     . GLY F 3 300 ? 12.243  -4.091  17.968  1.00 21.61  ? 299 GLY B N     1 
ATOM   5860 C  CA    . GLY F 3 300 ? 12.953  -2.941  17.481  1.00 19.52  ? 299 GLY B CA    1 
ATOM   5861 C  C     . GLY F 3 300 ? 14.379  -2.946  17.943  1.00 19.63  ? 299 GLY B C     1 
ATOM   5862 O  O     . GLY F 3 300 ? 14.834  -3.897  18.650  1.00 19.38  ? 299 GLY B O     1 
ATOM   5863 N  N     . ARG F 3 301 ? 15.112  -1.908  17.525  1.00 19.11  ? 300 ARG B N     1 
ATOM   5864 C  CA    . ARG F 3 301 ? 16.554  -1.795  17.831  1.00 19.63  ? 300 ARG B CA    1 
ATOM   5865 C  C     . ARG F 3 301 ? 16.974  -0.341  17.776  1.00 19.61  ? 300 ARG B C     1 
ATOM   5866 O  O     . ARG F 3 301 ? 16.507  0.416   16.924  1.00 19.51  ? 300 ARG B O     1 
ATOM   5867 C  CB    . ARG F 3 301 ? 17.364  -2.622  16.849  1.00 19.24  ? 300 ARG B CB    1 
ATOM   5868 C  CG    . ARG F 3 301 ? 18.838  -2.419  16.944  1.00 21.80  ? 300 ARG B CG    1 
ATOM   5869 C  CD    . ARG F 3 301 ? 19.600  -3.684  16.458  1.00 23.20  ? 300 ARG B CD    1 
ATOM   5870 N  NE    . ARG F 3 301 ? 21.051  -3.530  16.658  1.00 26.04  ? 300 ARG B NE    1 
ATOM   5871 C  CZ    . ARG F 3 301 ? 21.995  -3.878  15.779  1.00 25.98  ? 300 ARG B CZ    1 
ATOM   5872 N  NH1   . ARG F 3 301 ? 21.691  -4.433  14.613  1.00 23.34  ? 300 ARG B NH1   1 
ATOM   5873 N  NH2   . ARG F 3 301 ? 23.271  -3.676  16.082  1.00 28.27  ? 300 ARG B NH2   1 
ATOM   5874 N  N     . THR F 3 302 ? 17.816  0.069   18.714  1.00 19.36  ? 301 THR B N     1 
ATOM   5875 C  CA    . THR F 3 302 ? 18.230  1.475   18.826  1.00 18.95  ? 301 THR B CA    1 
ATOM   5876 C  C     . THR F 3 302 ? 19.721  1.496   18.591  1.00 18.27  ? 301 THR B C     1 
ATOM   5877 O  O     . THR F 3 302 ? 20.456  0.658   19.110  1.00 18.59  ? 301 THR B O     1 
ATOM   5878 C  CB    . THR F 3 302 ? 17.934  2.061   20.223  1.00 19.32  ? 301 THR B CB    1 
ATOM   5879 O  OG1   . THR F 3 302 ? 16.553  1.910   20.519  1.00 20.69  ? 301 THR B OG1   1 
ATOM   5880 C  CG2   . THR F 3 302 ? 18.288  3.560   20.296  1.00 19.06  ? 301 THR B CG2   1 
ATOM   5881 N  N     . PHE F 3 303 ? 20.177  2.437   17.797  1.00 17.76  ? 302 PHE B N     1 
ATOM   5882 C  CA    . PHE F 3 303 ? 21.598  2.486   17.457  1.00 17.58  ? 302 PHE B CA    1 
ATOM   5883 C  C     . PHE F 3 303 ? 22.128  3.743   18.095  1.00 17.06  ? 302 PHE B C     1 
ATOM   5884 O  O     . PHE F 3 303 ? 21.388  4.676   18.192  1.00 16.71  ? 302 PHE B O     1 
ATOM   5885 C  CB    . PHE F 3 303 ? 21.754  2.605   15.916  1.00 17.09  ? 302 PHE B CB    1 
ATOM   5886 C  CG    . PHE F 3 303 ? 21.294  1.436   15.177  1.00 15.25  ? 302 PHE B CG    1 
ATOM   5887 C  CD1   . PHE F 3 303 ? 19.971  1.306   14.820  1.00 16.04  ? 302 PHE B CD1   1 
ATOM   5888 C  CD2   . PHE F 3 303 ? 22.183  0.457   14.811  1.00 16.16  ? 302 PHE B CD2   1 
ATOM   5889 C  CE1   . PHE F 3 303 ? 19.523  0.200   14.085  1.00 17.54  ? 302 PHE B CE1   1 
ATOM   5890 C  CE2   . PHE F 3 303 ? 21.764  -0.661  14.109  1.00 18.52  ? 302 PHE B CE2   1 
ATOM   5891 C  CZ    . PHE F 3 303 ? 20.417  -0.800  13.733  1.00 17.30  ? 302 PHE B CZ    1 
ATOM   5892 N  N     . PRO F 3 304 ? 23.432  3.811   18.432  1.00 17.48  ? 303 PRO B N     1 
ATOM   5893 C  CA    . PRO F 3 304 ? 23.970  5.077   18.904  1.00 17.74  ? 303 PRO B CA    1 
ATOM   5894 C  C     . PRO F 3 304 ? 24.356  6.015   17.749  1.00 18.99  ? 303 PRO B C     1 
ATOM   5895 O  O     . PRO F 3 304 ? 25.269  6.868   17.933  1.00 20.32  ? 303 PRO B O     1 
ATOM   5896 C  CB    . PRO F 3 304 ? 25.234  4.639   19.614  1.00 17.64  ? 303 PRO B CB    1 
ATOM   5897 C  CG    . PRO F 3 304 ? 25.747  3.454   18.829  1.00 16.23  ? 303 PRO B CG    1 
ATOM   5898 C  CD    . PRO F 3 304 ? 24.512  2.851   18.146  1.00 17.42  ? 303 PRO B CD    1 
ATOM   5899 N  N     . HIS F 3 305 ? 23.736  5.827   16.570  1.00 18.58  ? 304 HIS B N     1 
ATOM   5900 C  CA    . HIS F 3 305 ? 23.956  6.680   15.357  1.00 18.64  ? 304 HIS B CA    1 
ATOM   5901 C  C     . HIS F 3 305 ? 22.723  6.548   14.405  1.00 19.62  ? 304 HIS B C     1 
ATOM   5902 O  O     . HIS F 3 305 ? 21.874  5.639   14.592  1.00 20.28  ? 304 HIS B O     1 
ATOM   5903 C  CB    . HIS F 3 305 ? 25.205  6.234   14.610  1.00 17.65  ? 304 HIS B CB    1 
ATOM   5904 C  CG    . HIS F 3 305 ? 25.093  4.851   14.042  1.00 15.60  ? 304 HIS B CG    1 
ATOM   5905 N  ND1   . HIS F 3 305 ? 25.814  3.784   14.524  1.00 14.69  ? 304 HIS B ND1   1 
ATOM   5906 C  CD2   . HIS F 3 305 ? 24.306  4.349   13.056  1.00 13.73  ? 304 HIS B CD2   1 
ATOM   5907 C  CE1   . HIS F 3 305 ? 25.493  2.686   13.853  1.00 13.35  ? 304 HIS B CE1   1 
ATOM   5908 N  NE2   . HIS F 3 305 ? 24.600  3.010   12.940  1.00 11.58  ? 304 HIS B NE2   1 
ATOM   5909 N  N     . GLY F 3 306 ? 22.638  7.403   13.380  1.00 19.49  ? 305 GLY B N     1 
ATOM   5910 C  CA    . GLY F 3 306 ? 21.459  7.434   12.479  1.00 19.30  ? 305 GLY B CA    1 
ATOM   5911 C  C     . GLY F 3 306 ? 21.353  6.240   11.533  1.00 18.75  ? 305 GLY B C     1 
ATOM   5912 O  O     . GLY F 3 306 ? 22.368  5.660   11.197  1.00 19.62  ? 305 GLY B O     1 
ATOM   5913 N  N     . ILE F 3 307 ? 20.135  5.897   11.097  1.00 17.79  ? 306 ILE B N     1 
ATOM   5914 C  CA    . ILE F 3 307 ? 19.865  4.713   10.253  1.00 16.97  ? 306 ILE B CA    1 
ATOM   5915 C  C     . ILE F 3 307 ? 19.655  5.113   8.796   1.00 17.56  ? 306 ILE B C     1 
ATOM   5916 O  O     . ILE F 3 307 ? 18.629  5.698   8.443   1.00 17.07  ? 306 ILE B O     1 
ATOM   5917 C  CB    . ILE F 3 307 ? 18.594  3.917   10.729  1.00 16.63  ? 306 ILE B CB    1 
ATOM   5918 C  CG1   . ILE F 3 307 ? 18.657  3.651   12.257  1.00 16.55  ? 306 ILE B CG1   1 
ATOM   5919 C  CG2   . ILE F 3 307 ? 18.412  2.680   9.864   1.00 13.02  ? 306 ILE B CG2   1 
ATOM   5920 C  CD1   . ILE F 3 307 ? 17.693  2.612   12.811  1.00 15.22  ? 306 ILE B CD1   1 
ATOM   5921 N  N     . SER F 3 308 ? 20.623  4.824   7.932   1.00 18.69  ? 307 SER B N     1 
ATOM   5922 C  CA    . SER F 3 308 ? 20.464  5.165   6.501   1.00 18.43  ? 307 SER B CA    1 
ATOM   5923 C  C     . SER F 3 308 ? 19.374  4.267   5.965   1.00 19.40  ? 307 SER B C     1 
ATOM   5924 O  O     . SER F 3 308 ? 19.015  3.294   6.619   1.00 18.23  ? 307 SER B O     1 
ATOM   5925 C  CB    . SER F 3 308 ? 21.732  4.931   5.712   1.00 17.74  ? 307 SER B CB    1 
ATOM   5926 O  OG    . SER F 3 308 ? 22.137  3.556   5.746   1.00 16.91  ? 307 SER B OG    1 
ATOM   5927 N  N     . LYS F 3 309 ? 18.873  4.580   4.762   1.00 21.03  ? 308 LYS B N     1 
ATOM   5928 C  CA    . LYS F 3 309 ? 17.761  3.820   4.174   1.00 22.13  ? 308 LYS B CA    1 
ATOM   5929 C  C     . LYS F 3 309 ? 18.175  2.352   3.930   1.00 22.43  ? 308 LYS B C     1 
ATOM   5930 O  O     . LYS F 3 309 ? 17.424  1.426   4.274   1.00 22.89  ? 308 LYS B O     1 
ATOM   5931 C  CB    . LYS F 3 309 ? 17.253  4.494   2.890   1.00 22.66  ? 308 LYS B CB    1 
ATOM   5932 C  CG    . LYS F 3 309 ? 15.976  3.935   2.307   1.00 24.42  ? 308 LYS B CG    1 
ATOM   5933 C  CD    . LYS F 3 309 ? 16.088  3.912   0.779   1.00 28.89  ? 308 LYS B CD    1 
ATOM   5934 C  CE    . LYS F 3 309 ? 15.512  5.210   0.099   1.00 32.10  ? 308 LYS B CE    1 
ATOM   5935 N  NZ    . LYS F 3 309 ? 14.187  5.620   0.686   1.00 32.52  ? 308 LYS B NZ    1 
ATOM   5936 N  N     . GLU F 3 310 ? 19.374  2.154   3.392   1.00 21.30  ? 309 GLU B N     1 
ATOM   5937 C  CA    . GLU F 3 310 ? 19.820  0.838   3.061   1.00 21.75  ? 309 GLU B CA    1 
ATOM   5938 C  C     . GLU F 3 310 ? 19.954  -0.079  4.284   1.00 21.48  ? 309 GLU B C     1 
ATOM   5939 O  O     . GLU F 3 310 ? 19.501  -1.211  4.240   1.00 21.84  ? 309 GLU B O     1 
ATOM   5940 C  CB    . GLU F 3 310 ? 21.112  0.951   2.274   1.00 22.69  ? 309 GLU B CB    1 
ATOM   5941 C  CG    . GLU F 3 310 ? 20.896  1.631   0.903   1.00 24.88  ? 309 GLU B CG    1 
ATOM   5942 C  CD    . GLU F 3 310 ? 21.105  3.150   0.903   1.00 27.03  ? 309 GLU B CD    1 
ATOM   5943 O  OE1   . GLU F 3 310 ? 21.301  3.750   1.998   1.00 29.25  ? 309 GLU B OE1   1 
ATOM   5944 O  OE2   . GLU F 3 310 ? 21.083  3.734   -0.209  1.00 27.10  ? 309 GLU B OE2   1 
ATOM   5945 N  N     . THR F 3 311 ? 20.508  0.439   5.378   1.00 21.32  ? 310 THR B N     1 
ATOM   5946 C  CA    . THR F 3 311 ? 20.639  -0.246  6.680   1.00 20.45  ? 310 THR B CA    1 
ATOM   5947 C  C     . THR F 3 311 ? 19.268  -0.593  7.264   1.00 20.71  ? 310 THR B C     1 
ATOM   5948 O  O     . THR F 3 311 ? 19.034  -1.712  7.806   1.00 20.17  ? 310 THR B O     1 
ATOM   5949 C  CB    . THR F 3 311 ? 21.387  0.667   7.678   1.00 20.89  ? 310 THR B CB    1 
ATOM   5950 O  OG1   . THR F 3 311 ? 22.559  1.257   7.051   1.00 20.57  ? 310 THR B OG1   1 
ATOM   5951 C  CG2   . THR F 3 311 ? 21.765  -0.102  8.975   1.00 19.94  ? 310 THR B CG2   1 
ATOM   5952 N  N     . ALA F 3 312 ? 18.343  0.350   7.122   1.00 20.23  ? 311 ALA B N     1 
ATOM   5953 C  CA    . ALA F 3 312 ? 16.967  0.061   7.478   1.00 20.95  ? 311 ALA B CA    1 
ATOM   5954 C  C     . ALA F 3 312 ? 16.392  -1.187  6.780   1.00 20.74  ? 311 ALA B C     1 
ATOM   5955 O  O     . ALA F 3 312 ? 15.673  -1.954  7.421   1.00 20.82  ? 311 ALA B O     1 
ATOM   5956 C  CB    . ALA F 3 312 ? 16.062  1.290   7.278   1.00 21.52  ? 311 ALA B CB    1 
ATOM   5957 N  N     . TYR F 3 313 ? 16.757  -1.441  5.521   1.00 20.50  ? 312 TYR B N     1 
ATOM   5958 C  CA    . TYR F 3 313 ? 16.201  -2.621  4.808   1.00 20.99  ? 312 TYR B CA    1 
ATOM   5959 C  C     . TYR F 3 313 ? 16.675  -3.873  5.508   1.00 20.86  ? 312 TYR B C     1 
ATOM   5960 O  O     . TYR F 3 313 ? 15.908  -4.733  5.793   1.00 21.59  ? 312 TYR B O     1 
ATOM   5961 C  CB    . TYR F 3 313 ? 16.623  -2.692  3.333   1.00 20.98  ? 312 TYR B CB    1 
ATOM   5962 C  CG    . TYR F 3 313 ? 15.743  -2.029  2.303   1.00 23.26  ? 312 TYR B CG    1 
ATOM   5963 C  CD1   . TYR F 3 313 ? 15.168  -2.784  1.288   1.00 25.32  ? 312 TYR B CD1   1 
ATOM   5964 C  CD2   . TYR F 3 313 ? 15.505  -0.641  2.309   1.00 24.97  ? 312 TYR B CD2   1 
ATOM   5965 C  CE1   . TYR F 3 313 ? 14.332  -2.214  0.348   1.00 26.44  ? 312 TYR B CE1   1 
ATOM   5966 C  CE2   . TYR F 3 313 ? 14.663  -0.041  1.344   1.00 26.75  ? 312 TYR B CE2   1 
ATOM   5967 C  CZ    . TYR F 3 313 ? 14.094  -0.852  0.370   1.00 27.01  ? 312 TYR B CZ    1 
ATOM   5968 O  OH    . TYR F 3 313 ? 13.306  -0.346  -0.617  1.00 28.55  ? 312 TYR B OH    1 
ATOM   5969 N  N     . SER F 3 314 ? 17.960  -3.947  5.804   1.00 20.94  ? 313 SER B N     1 
ATOM   5970 C  CA    . SER F 3 314 ? 18.596  -5.114  6.398   1.00 20.83  ? 313 SER B CA    1 
ATOM   5971 C  C     . SER F 3 314 ? 18.188  -5.409  7.839   1.00 20.98  ? 313 SER B C     1 
ATOM   5972 O  O     . SER F 3 314 ? 17.936  -6.554  8.222   1.00 22.74  ? 313 SER B O     1 
ATOM   5973 C  CB    . SER F 3 314 ? 20.098  -4.847  6.422   1.00 20.69  ? 313 SER B CB    1 
ATOM   5974 O  OG    . SER F 3 314 ? 20.765  -6.066  6.411   1.00 23.04  ? 313 SER B OG    1 
ATOM   5975 N  N     . GLU F 3 315 ? 18.219  -4.388  8.669   1.00 20.11  ? 314 GLU B N     1 
ATOM   5976 C  CA    . GLU F 3 315 ? 17.803  -4.509  10.029  1.00 19.78  ? 314 GLU B CA    1 
ATOM   5977 C  C     . GLU F 3 315 ? 16.299  -4.926  10.139  1.00 19.41  ? 314 GLU B C     1 
ATOM   5978 O  O     . GLU F 3 315 ? 15.911  -5.791  10.944  1.00 17.41  ? 314 GLU B O     1 
ATOM   5979 C  CB    . GLU F 3 315 ? 18.052  -3.168  10.670  1.00 20.02  ? 314 GLU B CB    1 
ATOM   5980 C  CG    . GLU F 3 315 ? 18.195  -3.285  12.087  1.00 23.86  ? 314 GLU B CG    1 
ATOM   5981 C  CD    . GLU F 3 315 ? 19.442  -4.074  12.475  1.00 26.98  ? 314 GLU B CD    1 
ATOM   5982 O  OE1   . GLU F 3 315 ? 19.368  -4.701  13.566  1.00 28.56  ? 314 GLU B OE1   1 
ATOM   5983 O  OE2   . GLU F 3 315 ? 20.460  -4.053  11.706  1.00 27.90  ? 314 GLU B OE2   1 
ATOM   5984 N  N     . SER F 3 316 ? 15.474  -4.350  9.263   1.00 19.15  ? 315 SER B N     1 
ATOM   5985 C  CA    . SER F 3 316 ? 14.053  -4.604  9.326   1.00 19.30  ? 315 SER B CA    1 
ATOM   5986 C  C     . SER F 3 316 ? 13.853  -6.089  9.062   1.00 19.25  ? 315 SER B C     1 
ATOM   5987 O  O     . SER F 3 316 ? 13.026  -6.745  9.707   1.00 18.26  ? 315 SER B O     1 
ATOM   5988 C  CB    . SER F 3 316 ? 13.267  -3.652  8.394   1.00 19.35  ? 315 SER B CB    1 
ATOM   5989 O  OG    . SER F 3 316 ? 13.449  -3.965  7.004   1.00 20.08  ? 315 SER B OG    1 
ATOM   5990 N  N     . VAL F 3 317 ? 14.713  -6.630  8.200   1.00 20.22  ? 316 VAL B N     1 
ATOM   5991 C  CA    . VAL F 3 317 ? 14.786  -8.079  7.900   1.00 21.24  ? 316 VAL B CA    1 
ATOM   5992 C  C     . VAL F 3 317 ? 15.132  -8.976  9.123   1.00 21.86  ? 316 VAL B C     1 
ATOM   5993 O  O     . VAL F 3 317 ? 14.646  -10.081 9.223   1.00 22.23  ? 316 VAL B O     1 
ATOM   5994 C  CB    . VAL F 3 317 ? 15.702  -8.333  6.652   1.00 21.36  ? 316 VAL B CB    1 
ATOM   5995 C  CG1   . VAL F 3 317 ? 16.103  -9.803  6.490   1.00 20.99  ? 316 VAL B CG1   1 
ATOM   5996 C  CG2   . VAL F 3 317 ? 14.961  -7.913  5.413   1.00 21.97  ? 316 VAL B CG2   1 
ATOM   5997 N  N     . LYS F 3 318 ? 15.939  -8.489  10.057  1.00 22.67  ? 317 LYS B N     1 
ATOM   5998 C  CA    . LYS F 3 318 ? 16.255  -9.250  11.268  1.00 23.48  ? 317 LYS B CA    1 
ATOM   5999 C  C     . LYS F 3 318 ? 15.148  -9.154  12.285  1.00 23.68  ? 317 LYS B C     1 
ATOM   6000 O  O     . LYS F 3 318 ? 14.756  -10.137 12.910  1.00 24.40  ? 317 LYS B O     1 
ATOM   6001 C  CB    . LYS F 3 318 ? 17.551  -8.741  11.869  1.00 23.64  ? 317 LYS B CB    1 
ATOM   6002 C  CG    . LYS F 3 318 ? 18.664  -8.722  10.836  1.00 26.16  ? 317 LYS B CG    1 
ATOM   6003 C  CD    . LYS F 3 318 ? 20.021  -8.328  11.416  1.00 30.24  ? 317 LYS B CD    1 
ATOM   6004 C  CE    . LYS F 3 318 ? 20.762  -7.423  10.461  1.00 30.89  ? 317 LYS B CE    1 
ATOM   6005 N  NZ    . LYS F 3 318 ? 22.205  -7.612  10.723  1.00 32.53  ? 317 LYS B NZ    1 
ATOM   6006 N  N     . LEU F 3 319 ? 14.618  -7.959  12.453  1.00 23.77  ? 318 LEU B N     1 
ATOM   6007 C  CA    . LEU F 3 319 ? 13.461  -7.791  13.308  1.00 23.36  ? 318 LEU B CA    1 
ATOM   6008 C  C     . LEU F 3 319 ? 12.279  -8.625  12.778  1.00 24.76  ? 318 LEU B C     1 
ATOM   6009 O  O     . LEU F 3 319 ? 11.498  -9.220  13.563  1.00 24.95  ? 318 LEU B O     1 
ATOM   6010 C  CB    . LEU F 3 319 ? 13.137  -6.295  13.508  1.00 21.89  ? 318 LEU B CB    1 
ATOM   6011 C  CG    . LEU F 3 319 ? 14.352  -5.488  14.026  1.00 18.83  ? 318 LEU B CG    1 
ATOM   6012 C  CD1   . LEU F 3 319 ? 14.183  -4.042  13.886  1.00 11.84  ? 318 LEU B CD1   1 
ATOM   6013 C  CD2   . LEU F 3 319 ? 14.796  -5.819  15.503  1.00 15.97  ? 318 LEU B CD2   1 
ATOM   6014 N  N     . LEU F 3 320 ? 12.155  -8.720  11.450  1.00 26.06  ? 319 LEU B N     1 
ATOM   6015 C  CA    . LEU F 3 320 ? 11.109  -9.591  10.919  1.00 26.78  ? 319 LEU B CA    1 
ATOM   6016 C  C     . LEU F 3 320 ? 11.388  -11.038 11.344  1.00 27.98  ? 319 LEU B C     1 
ATOM   6017 O  O     . LEU F 3 320 ? 10.445  -11.745 11.814  1.00 28.51  ? 319 LEU B O     1 
ATOM   6018 C  CB    . LEU F 3 320 ? 10.962  -9.512  9.392   1.00 26.51  ? 319 LEU B CB    1 
ATOM   6019 C  CG    . LEU F 3 320 ? 9.768   -10.372 8.913   1.00 24.78  ? 319 LEU B CG    1 
ATOM   6020 C  CD1   . LEU F 3 320 ? 8.578   -10.179 9.805   1.00 21.49  ? 319 LEU B CD1   1 
ATOM   6021 C  CD2   . LEU F 3 320 ? 9.383   -10.121 7.462   1.00 23.19  ? 319 LEU B CD2   1 
ATOM   6022 N  N     . GLN F 3 321 ? 12.650  -11.467 11.181  1.00 27.91  ? 320 GLN B N     1 
ATOM   6023 C  CA    . GLN F 3 321 ? 12.990  -12.876 11.400  1.00 29.15  ? 320 GLN B CA    1 
ATOM   6024 C  C     . GLN F 3 321 ? 12.714  -13.199 12.838  1.00 30.24  ? 320 GLN B C     1 
ATOM   6025 O  O     . GLN F 3 321 ? 12.045  -14.187 13.123  1.00 31.48  ? 320 GLN B O     1 
ATOM   6026 C  CB    . GLN F 3 321 ? 14.451  -13.205 11.118  1.00 28.71  ? 320 GLN B CB    1 
ATOM   6027 C  CG    . GLN F 3 321 ? 14.964  -13.062 9.686   1.00 28.42  ? 320 GLN B CG    1 
ATOM   6028 C  CD    . GLN F 3 321 ? 16.486  -13.307 9.627   1.00 28.55  ? 320 GLN B CD    1 
ATOM   6029 O  OE1   . GLN F 3 321 ? 17.262  -12.595 10.277  1.00 28.82  ? 320 GLN B OE1   1 
ATOM   6030 N  NE2   . GLN F 3 321 ? 16.907  -14.336 8.865   1.00 27.09  ? 320 GLN B NE2   1 
ATOM   6031 N  N     . LYS F 3 322 ? 13.208  -12.348 13.732  1.00 30.97  ? 321 LYS B N     1 
ATOM   6032 C  CA    . LYS F 3 322 ? 12.968  -12.485 15.165  1.00 31.76  ? 321 LYS B CA    1 
ATOM   6033 C  C     . LYS F 3 322 ? 11.494  -12.776 15.437  1.00 32.04  ? 321 LYS B C     1 
ATOM   6034 O  O     . LYS F 3 322 ? 11.170  -13.840 15.997  1.00 31.43  ? 321 LYS B O     1 
ATOM   6035 C  CB    . LYS F 3 322 ? 13.421  -11.217 15.897  1.00 31.86  ? 321 LYS B CB    1 
ATOM   6036 C  CG    . LYS F 3 322 ? 13.497  -11.348 17.406  1.00 32.93  ? 321 LYS B CG    1 
ATOM   6037 C  CD    . LYS F 3 322 ? 14.157  -10.110 18.129  1.00 34.43  ? 321 LYS B CD    1 
ATOM   6038 C  CE    . LYS F 3 322 ? 15.669  -10.244 18.241  1.00 34.98  ? 321 LYS B CE    1 
ATOM   6039 N  NZ    . LYS F 3 322 ? 16.391  -8.996  18.661  1.00 36.78  ? 321 LYS B NZ    1 
ATOM   6040 N  N     . ILE F 3 323 ? 10.619  -11.829 15.043  1.00 32.68  ? 322 ILE B N     1 
ATOM   6041 C  CA    . ILE F 3 323 ? 9.156   -11.922 15.259  1.00 33.06  ? 322 ILE B CA    1 
ATOM   6042 C  C     . ILE F 3 323 ? 8.671   -13.308 14.838  1.00 34.26  ? 322 ILE B C     1 
ATOM   6043 O  O     . ILE F 3 323 ? 8.200   -14.111 15.641  1.00 34.11  ? 322 ILE B O     1 
ATOM   6044 C  CB    . ILE F 3 323 ? 8.424   -10.863 14.427  1.00 32.43  ? 322 ILE B CB    1 
ATOM   6045 C  CG1   . ILE F 3 323 ? 8.454   -9.523  15.134  1.00 31.85  ? 322 ILE B CG1   1 
ATOM   6046 C  CG2   . ILE F 3 323 ? 6.978   -11.258 14.165  1.00 32.08  ? 322 ILE B CG2   1 
ATOM   6047 C  CD1   . ILE F 3 323 ? 8.071   -8.393  14.278  1.00 28.08  ? 322 ILE B CD1   1 
ATOM   6048 N  N     . LEU F 3 324 ? 8.860   -13.618 13.561  1.00 35.72  ? 323 LEU B N     1 
ATOM   6049 C  CA    . LEU F 3 324 ? 8.481   -14.923 13.027  1.00 38.22  ? 323 LEU B CA    1 
ATOM   6050 C  C     . LEU F 3 324 ? 9.154   -16.108 13.733  1.00 39.84  ? 323 LEU B C     1 
ATOM   6051 O  O     . LEU F 3 324 ? 8.811   -17.260 13.467  1.00 40.33  ? 323 LEU B O     1 
ATOM   6052 C  CB    . LEU F 3 324 ? 8.767   -14.984 11.524  1.00 38.21  ? 323 LEU B CB    1 
ATOM   6053 C  CG    . LEU F 3 324 ? 7.737   -15.725 10.667  1.00 37.52  ? 323 LEU B CG    1 
ATOM   6054 C  CD1   . LEU F 3 324 ? 6.381   -15.041 10.746  1.00 37.74  ? 323 LEU B CD1   1 
ATOM   6055 C  CD2   . LEU F 3 324 ? 8.210   -15.824 9.225   1.00 36.62  ? 323 LEU B CD2   1 
ATOM   6056 N  N     . GLU F 3 325 ? 10.105  -15.835 14.625  1.00 41.66  ? 324 GLU B N     1 
ATOM   6057 C  CA    . GLU F 3 325 ? 10.813  -16.912 15.325  1.00 43.48  ? 324 GLU B CA    1 
ATOM   6058 C  C     . GLU F 3 325 ? 10.330  -17.078 16.757  1.00 44.59  ? 324 GLU B C     1 
ATOM   6059 O  O     . GLU F 3 325 ? 10.681  -18.052 17.420  1.00 45.13  ? 324 GLU B O     1 
ATOM   6060 C  CB    . GLU F 3 325 ? 12.336  -16.679 15.315  1.00 43.71  ? 324 GLU B CB    1 
ATOM   6061 C  CG    . GLU F 3 325 ? 13.200  -17.746 16.068  1.00 44.42  ? 324 GLU B CG    1 
ATOM   6062 C  CD    . GLU F 3 325 ? 13.279  -19.103 15.370  1.00 44.25  ? 324 GLU B CD    1 
ATOM   6063 O  OE1   . GLU F 3 325 ? 12.972  -19.183 14.163  1.00 44.55  ? 324 GLU B OE1   1 
ATOM   6064 O  OE2   . GLU F 3 325 ? 13.666  -20.094 16.032  1.00 43.51  ? 324 GLU B OE2   1 
ATOM   6065 N  N     . GLU F 3 326 ? 9.529   -16.127 17.223  1.00 45.75  ? 325 GLU B N     1 
ATOM   6066 C  CA    . GLU F 3 326 ? 9.079   -16.080 18.615  1.00 46.48  ? 325 GLU B CA    1 
ATOM   6067 C  C     . GLU F 3 326 ? 7.572   -15.950 18.628  1.00 46.53  ? 325 GLU B C     1 
ATOM   6068 O  O     . GLU F 3 326 ? 6.924   -15.970 19.680  1.00 46.47  ? 325 GLU B O     1 
ATOM   6069 C  CB    . GLU F 3 326 ? 9.742   -14.906 19.338  1.00 46.65  ? 325 GLU B CB    1 
ATOM   6070 C  CG    . GLU F 3 326 ? 11.260  -14.919 19.178  1.00 47.39  ? 325 GLU B CG    1 
ATOM   6071 C  CD    . GLU F 3 326 ? 11.953  -13.735 19.806  1.00 49.02  ? 325 GLU B CD    1 
ATOM   6072 O  OE1   . GLU F 3 326 ? 11.268  -12.856 20.391  1.00 49.74  ? 325 GLU B OE1   1 
ATOM   6073 O  OE2   . GLU F 3 326 ? 13.201  -13.683 19.700  1.00 49.45  ? 325 GLU B OE2   1 
ATOM   6074 N  N     . ASP F 3 327 ? 7.021   -15.799 17.435  1.00 46.60  ? 326 ASP B N     1 
ATOM   6075 C  CA    . ASP F 3 327 ? 5.598   -15.905 17.284  1.00 47.03  ? 326 ASP B CA    1 
ATOM   6076 C  C     . ASP F 3 327 ? 5.186   -16.915 16.227  1.00 47.14  ? 326 ASP B C     1 
ATOM   6077 O  O     . ASP F 3 327 ? 5.747   -16.967 15.126  1.00 47.36  ? 326 ASP B O     1 
ATOM   6078 C  CB    . ASP F 3 327 ? 4.935   -14.554 17.053  1.00 47.12  ? 326 ASP B CB    1 
ATOM   6079 C  CG    . ASP F 3 327 ? 3.435   -14.637 17.201  1.00 47.20  ? 326 ASP B CG    1 
ATOM   6080 O  OD1   . ASP F 3 327 ? 2.828   -15.262 16.310  1.00 46.47  ? 326 ASP B OD1   1 
ATOM   6081 O  OD2   . ASP F 3 327 ? 2.874   -14.111 18.203  1.00 47.70  ? 326 ASP B OD2   1 
ATOM   6082 N  N     . GLU F 3 328 ? 4.175   -17.698 16.604  1.00 47.22  ? 327 GLU B N     1 
ATOM   6083 C  CA    . GLU F 3 328 ? 3.641   -18.821 15.834  1.00 46.66  ? 327 GLU B CA    1 
ATOM   6084 C  C     . GLU F 3 328 ? 2.675   -18.350 14.731  1.00 45.66  ? 327 GLU B C     1 
ATOM   6085 O  O     . GLU F 3 328 ? 2.809   -18.753 13.574  1.00 46.01  ? 327 GLU B O     1 
ATOM   6086 C  CB    . GLU F 3 328 ? 2.944   -19.807 16.789  1.00 47.06  ? 327 GLU B CB    1 
ATOM   6087 C  CG    . GLU F 3 328 ? 3.567   -19.918 18.224  1.00 49.00  ? 327 GLU B CG    1 
ATOM   6088 C  CD    . GLU F 3 328 ? 2.912   -18.996 19.309  1.00 51.22  ? 327 GLU B CD    1 
ATOM   6089 O  OE1   . GLU F 3 328 ? 2.232   -17.984 18.970  1.00 50.50  ? 327 GLU B OE1   1 
ATOM   6090 O  OE2   . GLU F 3 328 ? 3.100   -19.307 20.519  1.00 52.43  ? 327 GLU B OE2   1 
ATOM   6091 N  N     . ARG F 3 329 ? 1.725   -17.492 15.102  1.00 44.36  ? 328 ARG B N     1 
ATOM   6092 C  CA    . ARG F 3 329 ? 0.680   -16.949 14.200  1.00 43.28  ? 328 ARG B CA    1 
ATOM   6093 C  C     . ARG F 3 329 ? 1.197   -16.353 12.880  1.00 42.40  ? 328 ARG B C     1 
ATOM   6094 O  O     . ARG F 3 329 ? 2.260   -15.734 12.840  1.00 42.19  ? 328 ARG B O     1 
ATOM   6095 C  CB    . ARG F 3 329 ? -0.162  -15.890 14.933  1.00 43.11  ? 328 ARG B CB    1 
ATOM   6096 C  CG    . ARG F 3 329 ? -0.574  -16.260 16.345  1.00 43.81  ? 328 ARG B CG    1 
ATOM   6097 C  CD    . ARG F 3 329 ? -1.510  -15.248 16.972  1.00 45.65  ? 328 ARG B CD    1 
ATOM   6098 N  NE    . ARG F 3 329 ? -0.786  -14.059 17.389  1.00 47.01  ? 328 ARG B NE    1 
ATOM   6099 C  CZ    . ARG F 3 329 ? -1.066  -13.340 18.466  1.00 47.47  ? 328 ARG B CZ    1 
ATOM   6100 N  NH1   . ARG F 3 329 ? -2.065  -13.683 19.266  1.00 48.44  ? 328 ARG B NH1   1 
ATOM   6101 N  NH2   . ARG F 3 329 ? -0.343  -12.273 18.745  1.00 47.09  ? 328 ARG B NH2   1 
ATOM   6102 N  N     . LYS F 3 330 ? 0.428   -16.532 11.811  1.00 41.13  ? 329 LYS B N     1 
ATOM   6103 C  CA    . LYS F 3 330 ? 0.725   -15.920 10.514  1.00 39.64  ? 329 LYS B CA    1 
ATOM   6104 C  C     . LYS F 3 330 ? 0.360   -14.428 10.578  1.00 38.98  ? 329 LYS B C     1 
ATOM   6105 O  O     . LYS F 3 330 ? -0.411  -14.020 11.451  1.00 39.14  ? 329 LYS B O     1 
ATOM   6106 C  CB    . LYS F 3 330 ? -0.080  -16.618 9.420   1.00 39.60  ? 329 LYS B CB    1 
ATOM   6107 C  CG    . LYS F 3 330 ? -0.476  -18.086 9.721   1.00 38.97  ? 329 LYS B CG    1 
ATOM   6108 C  CD    . LYS F 3 330 ? -1.509  -18.617 8.693   1.00 38.60  ? 329 LYS B CD    1 
ATOM   6109 C  CE    . LYS F 3 330 ? -1.779  -20.099 8.884   1.00 37.23  ? 329 LYS B CE    1 
ATOM   6110 N  NZ    . LYS F 3 330 ? -2.385  -20.700 7.692   1.00 36.13  ? 329 LYS B NZ    1 
ATOM   6111 N  N     . ILE F 3 331 ? 0.891   -13.621 9.654   1.00 37.89  ? 330 ILE B N     1 
ATOM   6112 C  CA    . ILE F 3 331 ? 0.831   -12.130 9.745   1.00 36.00  ? 330 ILE B CA    1 
ATOM   6113 C  C     . ILE F 3 331 ? -0.172  -11.472 8.783   1.00 35.40  ? 330 ILE B C     1 
ATOM   6114 O  O     . ILE F 3 331 ? -0.240  -11.783 7.590   1.00 35.28  ? 330 ILE B O     1 
ATOM   6115 C  CB    . ILE F 3 331 ? 2.274   -11.454 9.601   1.00 35.68  ? 330 ILE B CB    1 
ATOM   6116 C  CG1   . ILE F 3 331 ? 3.116   -11.651 10.862  1.00 35.01  ? 330 ILE B CG1   1 
ATOM   6117 C  CG2   . ILE F 3 331 ? 2.227   -9.945  9.338   1.00 33.71  ? 330 ILE B CG2   1 
ATOM   6118 C  CD1   . ILE F 3 331 ? 4.085   -12.771 10.760  1.00 34.75  ? 330 ILE B CD1   1 
ATOM   6119 N  N     . ARG F 3 332 ? -0.938  -10.538 9.335   1.00 34.76  ? 331 ARG B N     1 
ATOM   6120 C  CA    . ARG F 3 332 ? -1.919  -9.770  8.601   1.00 34.05  ? 331 ARG B CA    1 
ATOM   6121 C  C     . ARG F 3 332 ? -1.209  -8.524  8.071   1.00 32.90  ? 331 ARG B C     1 
ATOM   6122 O  O     . ARG F 3 332 ? -1.094  -8.342  6.874   1.00 32.76  ? 331 ARG B O     1 
ATOM   6123 C  CB    . ARG F 3 332 ? -3.065  -9.388  9.555   1.00 34.60  ? 331 ARG B CB    1 
ATOM   6124 C  CG    . ARG F 3 332 ? -4.301  -8.799  8.908   1.00 36.21  ? 331 ARG B CG    1 
ATOM   6125 C  CD    . ARG F 3 332 ? -5.292  -9.897  8.586   1.00 40.44  ? 331 ARG B CD    1 
ATOM   6126 N  NE    . ARG F 3 332 ? -6.545  -9.782  9.349   1.00 42.85  ? 331 ARG B NE    1 
ATOM   6127 C  CZ    . ARG F 3 332 ? -7.170  -10.810 9.930   1.00 42.87  ? 331 ARG B CZ    1 
ATOM   6128 N  NH1   . ARG F 3 332 ? -6.655  -12.042 9.872   1.00 41.93  ? 331 ARG B NH1   1 
ATOM   6129 N  NH2   . ARG F 3 332 ? -8.290  -10.593 10.606  1.00 42.40  ? 331 ARG B NH2   1 
ATOM   6130 N  N     . ARG F 3 333 ? -0.710  -7.686  8.978   1.00 31.76  ? 332 ARG B N     1 
ATOM   6131 C  CA    . ARG F 3 333 ? -0.171  -6.404  8.592   1.00 30.26  ? 332 ARG B CA    1 
ATOM   6132 C  C     . ARG F 3 333 ? 1.273   -6.347  9.034   1.00 28.56  ? 332 ARG B C     1 
ATOM   6133 O  O     . ARG F 3 333 ? 1.584   -6.685  10.167  1.00 28.57  ? 332 ARG B O     1 
ATOM   6134 C  CB    . ARG F 3 333 ? -0.986  -5.287  9.261   1.00 31.04  ? 332 ARG B CB    1 
ATOM   6135 C  CG    . ARG F 3 333 ? -2.367  -5.007  8.624   1.00 32.87  ? 332 ARG B CG    1 
ATOM   6136 C  CD    . ARG F 3 333 ? -3.398  -4.389  9.602   1.00 36.66  ? 332 ARG B CD    1 
ATOM   6137 N  NE    . ARG F 3 333 ? -3.006  -3.055  10.085  1.00 39.51  ? 332 ARG B NE    1 
ATOM   6138 C  CZ    . ARG F 3 333 ? -3.633  -2.364  11.062  1.00 40.02  ? 332 ARG B CZ    1 
ATOM   6139 N  NH1   . ARG F 3 333 ? -4.711  -2.865  11.673  1.00 38.21  ? 332 ARG B NH1   1 
ATOM   6140 N  NH2   . ARG F 3 333 ? -3.165  -1.164  11.442  1.00 39.16  ? 332 ARG B NH2   1 
ATOM   6141 N  N     . ILE F 3 334 ? 2.149   -5.912  8.138   1.00 25.93  ? 333 ILE B N     1 
ATOM   6142 C  CA    . ILE F 3 334 ? 3.550   -5.745  8.455   1.00 23.62  ? 333 ILE B CA    1 
ATOM   6143 C  C     . ILE F 3 334 ? 4.024   -4.300  8.239   1.00 24.29  ? 333 ILE B C     1 
ATOM   6144 O  O     . ILE F 3 334 ? 3.804   -3.709  7.172   1.00 24.34  ? 333 ILE B O     1 
ATOM   6145 C  CB    . ILE F 3 334 ? 4.362   -6.621  7.509   1.00 22.34  ? 333 ILE B CB    1 
ATOM   6146 C  CG1   . ILE F 3 334 ? 5.834   -6.688  7.918   1.00 18.64  ? 333 ILE B CG1   1 
ATOM   6147 C  CG2   . ILE F 3 334 ? 4.138   -6.149  6.101   1.00 21.44  ? 333 ILE B CG2   1 
ATOM   6148 C  CD1   . ILE F 3 334 ? 6.033   -7.172  9.351   1.00 11.35  ? 333 ILE B CD1   1 
ATOM   6149 N  N     . GLY F 3 335 ? 4.727   -3.737  9.211   1.00 24.49  ? 334 GLY B N     1 
ATOM   6150 C  CA    . GLY F 3 335 ? 5.206   -2.380  9.042   1.00 24.56  ? 334 GLY B CA    1 
ATOM   6151 C  C     . GLY F 3 335 ? 6.468   -2.077  9.813   1.00 25.03  ? 334 GLY B C     1 
ATOM   6152 O  O     . GLY F 3 335 ? 7.053   -2.944  10.458  1.00 24.72  ? 334 GLY B O     1 
ATOM   6153 N  N     . VAL F 3 336 ? 6.844   -0.800  9.760   1.00 25.10  ? 335 VAL B N     1 
ATOM   6154 C  CA    . VAL F 3 336 ? 8.058   -0.313  10.342  1.00 24.31  ? 335 VAL B CA    1 
ATOM   6155 C  C     . VAL F 3 336 ? 7.831   1.097   10.820  1.00 23.99  ? 335 VAL B C     1 
ATOM   6156 O  O     . VAL F 3 336 ? 7.217   1.921   10.149  1.00 23.64  ? 335 VAL B O     1 
ATOM   6157 C  CB    . VAL F 3 336 ? 9.218   -0.332  9.334   1.00 24.46  ? 335 VAL B CB    1 
ATOM   6158 C  CG1   . VAL F 3 336 ? 8.945   0.648   8.184   1.00 24.13  ? 335 VAL B CG1   1 
ATOM   6159 C  CG2   . VAL F 3 336 ? 10.490  0.078   10.044  1.00 24.69  ? 335 VAL B CG2   1 
ATOM   6160 N  N     . ARG F 3 337 ? 8.375   1.360   11.998  1.00 24.14  ? 336 ARG B N     1 
ATOM   6161 C  CA    . ARG F 3 337 ? 8.295   2.638   12.666  1.00 23.52  ? 336 ARG B CA    1 
ATOM   6162 C  C     . ARG F 3 337 ? 9.696   3.106   13.133  1.00 22.51  ? 336 ARG B C     1 
ATOM   6163 O  O     . ARG F 3 337 ? 10.431  2.380   13.841  1.00 22.57  ? 336 ARG B O     1 
ATOM   6164 C  CB    . ARG F 3 337 ? 7.299   2.524   13.820  1.00 24.45  ? 336 ARG B CB    1 
ATOM   6165 C  CG    . ARG F 3 337 ? 6.909   3.848   14.466  1.00 27.54  ? 336 ARG B CG    1 
ATOM   6166 C  CD    . ARG F 3 337 ? 5.508   3.823   15.042  1.00 30.12  ? 336 ARG B CD    1 
ATOM   6167 N  NE    . ARG F 3 337 ? 4.761   4.933   14.450  1.00 32.52  ? 336 ARG B NE    1 
ATOM   6168 C  CZ    . ARG F 3 337 ? 4.206   4.863   13.249  1.00 33.84  ? 336 ARG B CZ    1 
ATOM   6169 N  NH1   . ARG F 3 337 ? 4.295   3.751   12.539  1.00 35.89  ? 336 ARG B NH1   1 
ATOM   6170 N  NH2   . ARG F 3 337 ? 3.560   5.889   12.758  1.00 34.94  ? 336 ARG B NH2   1 
ATOM   6171 N  N     . PHE F 3 338 ? 10.053  4.309   12.708  1.00 20.96  ? 337 PHE B N     1 
ATOM   6172 C  CA    . PHE F 3 338 ? 11.317  4.934   13.005  1.00 20.82  ? 337 PHE B CA    1 
ATOM   6173 C  C     . PHE F 3 338 ? 11.101  5.994   14.046  1.00 21.63  ? 337 PHE B C     1 
ATOM   6174 O  O     . PHE F 3 338 ? 10.007  6.569   14.123  1.00 22.68  ? 337 PHE B O     1 
ATOM   6175 C  CB    . PHE F 3 338 ? 11.822  5.593   11.739  1.00 20.29  ? 337 PHE B CB    1 
ATOM   6176 C  CG    . PHE F 3 338 ? 12.050  4.633   10.666  1.00 20.15  ? 337 PHE B CG    1 
ATOM   6177 C  CD1   . PHE F 3 338 ? 13.242  3.933   10.618  1.00 19.13  ? 337 PHE B CD1   1 
ATOM   6178 C  CD2   . PHE F 3 338 ? 11.051  4.366   9.729   1.00 20.35  ? 337 PHE B CD2   1 
ATOM   6179 C  CE1   . PHE F 3 338 ? 13.472  3.007   9.652   1.00 20.44  ? 337 PHE B CE1   1 
ATOM   6180 C  CE2   . PHE F 3 338 ? 11.256  3.423   8.743   1.00 20.10  ? 337 PHE B CE2   1 
ATOM   6181 C  CZ    . PHE F 3 338 ? 12.464  2.742   8.702   1.00 21.68  ? 337 PHE B CZ    1 
ATOM   6182 N  N     . SER F 3 339 ? 12.123  6.268   14.856  1.00 21.62  ? 338 SER B N     1 
ATOM   6183 C  CA    . SER F 3 339 ? 12.013  7.264   15.926  1.00 21.59  ? 338 SER B CA    1 
ATOM   6184 C  C     . SER F 3 339 ? 13.372  7.761   16.437  1.00 23.16  ? 338 SER B C     1 
ATOM   6185 O  O     . SER F 3 339 ? 14.406  7.512   15.818  1.00 23.77  ? 338 SER B O     1 
ATOM   6186 C  CB    . SER F 3 339 ? 11.189  6.708   17.090  1.00 20.59  ? 338 SER B CB    1 
ATOM   6187 O  OG    . SER F 3 339 ? 11.864  5.636   17.727  1.00 18.93  ? 338 SER B OG    1 
ATOM   6188 N  N     . LYS F 3 340 ? 13.356  8.465   17.569  1.00 24.71  ? 339 LYS B N     1 
ATOM   6189 C  CA    . LYS F 3 340 ? 14.573  9.024   18.159  1.00 25.55  ? 339 LYS B CA    1 
ATOM   6190 C  C     . LYS F 3 340 ? 15.361  9.789   17.118  1.00 26.45  ? 339 LYS B C     1 
ATOM   6191 O  O     . LYS F 3 340 ? 16.441  9.376   16.749  1.00 27.07  ? 339 LYS B O     1 
ATOM   6192 C  CB    . LYS F 3 340 ? 15.403  7.913   18.842  1.00 25.92  ? 339 LYS B CB    1 
ATOM   6193 C  CG    . LYS F 3 340 ? 14.791  7.366   20.149  1.00 26.92  ? 339 LYS B CG    1 
ATOM   6194 C  CD    . LYS F 3 340 ? 15.675  6.271   20.861  1.00 29.53  ? 339 LYS B CD    1 
ATOM   6195 C  CE    . LYS F 3 340 ? 15.045  5.925   22.304  1.00 31.78  ? 339 LYS B CE    1 
ATOM   6196 N  NZ    . LYS F 3 340 ? 15.593  4.793   23.143  1.00 30.62  ? 339 LYS B NZ    1 
ATOM   6197 N  N     . PHE F 3 341 ? 14.814  10.905  16.638  1.00 28.16  ? 340 PHE B N     1 
ATOM   6198 C  CA    . PHE F 3 341 ? 15.384  11.650  15.493  1.00 29.25  ? 340 PHE B CA    1 
ATOM   6199 C  C     . PHE F 3 341 ? 16.603  12.462  15.875  1.00 30.44  ? 340 PHE B C     1 
ATOM   6200 O  O     . PHE F 3 341 ? 16.638  13.043  16.956  1.00 30.92  ? 340 PHE B O     1 
ATOM   6201 C  CB    . PHE F 3 341 ? 14.342  12.572  14.877  1.00 28.74  ? 340 PHE B CB    1 
ATOM   6202 C  CG    . PHE F 3 341 ? 13.087  11.871  14.454  1.00 29.42  ? 340 PHE B CG    1 
ATOM   6203 C  CD1   . PHE F 3 341 ? 13.140  10.730  13.656  1.00 30.31  ? 340 PHE B CD1   1 
ATOM   6204 C  CD2   . PHE F 3 341 ? 11.850  12.348  14.851  1.00 30.03  ? 340 PHE B CD2   1 
ATOM   6205 C  CE1   . PHE F 3 341 ? 11.966  10.081  13.262  1.00 30.73  ? 340 PHE B CE1   1 
ATOM   6206 C  CE2   . PHE F 3 341 ? 10.701  11.710  14.486  1.00 31.30  ? 340 PHE B CE2   1 
ATOM   6207 C  CZ    . PHE F 3 341 ? 10.747  10.570  13.681  1.00 31.79  ? 340 PHE B CZ    1 
ATOM   6208 N  N     . ILE F 3 342 ? 17.588  12.542  14.984  1.00 32.24  ? 341 ILE B N     1 
ATOM   6209 C  CA    . ILE F 3 342 ? 18.869  13.158  15.341  1.00 33.82  ? 341 ILE B CA    1 
ATOM   6210 C  C     . ILE F 3 342 ? 18.596  14.615  15.498  1.00 35.28  ? 341 ILE B C     1 
ATOM   6211 O  O     . ILE F 3 342 ? 18.411  15.338  14.502  1.00 36.60  ? 341 ILE B O     1 
ATOM   6212 C  CB    . ILE F 3 342 ? 20.010  12.900  14.305  1.00 34.16  ? 341 ILE B CB    1 
ATOM   6213 C  CG1   . ILE F 3 342 ? 20.817  11.670  14.718  1.00 34.37  ? 341 ILE B CG1   1 
ATOM   6214 C  CG2   . ILE F 3 342 ? 21.007  14.121  14.178  1.00 33.82  ? 341 ILE B CG2   1 
ATOM   6215 C  CD1   . ILE F 3 342 ? 22.140  11.530  13.963  1.00 33.68  ? 341 ILE B CD1   1 
ATOM   6216 O  OXT   . ILE F 3 342 ? 18.531  15.077  16.645  1.00 36.86  ? 341 ILE B OXT   1 
HETATM 6217 CA CA    . CA  G 4 .   ? 22.697  3.203   -22.724 1.00 126.97 ? 401 CA  A CA    1 
HETATM 6218 CA CA    . CA  H 4 .   ? -10.376 17.583  15.501  1.00 99.86  ? 401 CA  B CA    1 
HETATM 6219 O  O     . HOH I 5 .   ? 12.568  4.478   -22.868 1.00 15.27  ? 101 HOH C O     1 
HETATM 6220 O  O     . HOH J 5 .   ? 10.258  9.649   -7.388  1.00 55.96  ? 501 HOH A O     1 
HETATM 6221 O  O     . HOH J 5 .   ? 23.383  -2.356  -20.989 1.00 63.85  ? 502 HOH A O     1 
HETATM 6222 O  O     . HOH J 5 .   ? 20.291  -2.303  -19.980 1.00 33.67  ? 503 HOH A O     1 
HETATM 6223 O  O     . HOH J 5 .   ? 19.272  0.140   -20.096 1.00 41.44  ? 504 HOH A O     1 
HETATM 6224 O  O     . HOH J 5 .   ? 20.703  0.199   -22.386 1.00 36.85  ? 505 HOH A O     1 
HETATM 6225 O  O     . HOH J 5 .   ? 3.302   8.843   -6.688  1.00 65.60  ? 506 HOH A O     1 
HETATM 6226 O  O     . HOH J 5 .   ? 37.893  13.770  -14.636 1.00 28.22  ? 507 HOH A O     1 
HETATM 6227 O  O     . HOH J 5 .   ? 34.581  15.709  -17.799 1.00 23.48  ? 508 HOH A O     1 
HETATM 6228 O  O     . HOH J 5 .   ? 34.645  17.058  -15.210 1.00 69.94  ? 509 HOH A O     1 
HETATM 6229 O  O     . HOH J 5 .   ? 44.765  6.719   -23.295 1.00 39.72  ? 510 HOH A O     1 
HETATM 6230 O  O     . HOH J 5 .   ? 49.055  8.523   -23.448 1.00 55.23  ? 511 HOH A O     1 
HETATM 6231 O  O     . HOH J 5 .   ? 13.496  27.907  -1.679  1.00 26.00  ? 512 HOH A O     1 
HETATM 6232 O  O     . HOH J 5 .   ? 17.443  -8.686  -12.580 1.00 22.41  ? 513 HOH A O     1 
HETATM 6233 O  O     . HOH J 5 .   ? 28.668  7.160   -4.279  1.00 25.45  ? 514 HOH A O     1 
HETATM 6234 O  O     . HOH J 5 .   ? 19.543  3.704   -53.929 1.00 87.61  ? 515 HOH A O     1 
HETATM 6235 O  O     . HOH J 5 .   ? 8.437   15.278  -42.850 1.00 33.60  ? 516 HOH A O     1 
HETATM 6236 O  O     . HOH K 5 .   ? -2.867  12.158  -2.299  1.00 59.95  ? 501 HOH B O     1 
HETATM 6237 O  O     . HOH K 5 .   ? -12.241 17.807  17.319  1.00 66.22  ? 502 HOH B O     1 
HETATM 6238 O  O     . HOH K 5 .   ? -13.634 17.223  14.812  1.00 79.87  ? 503 HOH B O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    O  "O5'" . DG  A 7   ? 0.6707 0.6136 0.5772 -0.0329 -0.0455 -0.0373 4   DG  C "O5'" 
2    C  "C5'" . DG  A 7   ? 0.6722 0.6165 0.5766 -0.0297 -0.0416 -0.0298 4   DG  C "C5'" 
3    C  "C4'" . DG  A 7   ? 0.6752 0.6121 0.5722 -0.0258 -0.0355 -0.0242 4   DG  C "C4'" 
4    O  "O4'" . DG  A 7   ? 0.6836 0.6184 0.5629 -0.0222 -0.0369 -0.0268 4   DG  C "O4'" 
5    C  "C3'" . DG  A 7   ? 0.6730 0.6136 0.5764 -0.0200 -0.0298 -0.0239 4   DG  C "C3'" 
6    O  "O3'" . DG  A 7   ? 0.6582 0.6044 0.5776 -0.0198 -0.0103 -0.0141 4   DG  C "O3'" 
7    C  "C2'" . DG  A 7   ? 0.6865 0.6185 0.5755 -0.0202 -0.0422 -0.0272 4   DG  C "C2'" 
8    C  "C1'" . DG  A 7   ? 0.6821 0.6161 0.5627 -0.0162 -0.0477 -0.0389 4   DG  C "C1'" 
9    N  N9    . DG  A 7   ? 0.6815 0.6215 0.5573 0.0069  -0.0550 -0.0533 4   DG  C N9    
10   C  C8    . DG  A 7   ? 0.6836 0.6178 0.5621 0.0127  -0.0626 -0.0570 4   DG  C C8    
11   N  N7    . DG  A 7   ? 0.6898 0.6212 0.5760 0.0238  -0.0709 -0.0705 4   DG  C N7    
12   C  C5    . DG  A 7   ? 0.6964 0.6275 0.5829 0.0297  -0.0847 -0.0839 4   DG  C C5    
13   C  C6    . DG  A 7   ? 0.7043 0.6334 0.5978 0.0432  -0.1015 -0.1009 4   DG  C C6    
14   O  O6    . DG  A 7   ? 0.7164 0.6648 0.6045 0.0471  -0.1165 -0.1178 4   DG  C O6    
15   N  N1    . DG  A 7   ? 0.7020 0.6267 0.5961 0.0479  -0.1084 -0.1062 4   DG  C N1    
16   C  C2    . DG  A 7   ? 0.6882 0.6201 0.5831 0.0492  -0.0936 -0.0973 4   DG  C C2    
17   N  N2    . DG  A 7   ? 0.6847 0.6109 0.5782 0.0514  -0.0927 -0.1085 4   DG  C N2    
18   N  N3    . DG  A 7   ? 0.6941 0.6228 0.5764 0.0369  -0.0874 -0.0859 4   DG  C N3    
19   C  C4    . DG  A 7   ? 0.6916 0.6206 0.5696 0.0249  -0.0709 -0.0729 4   DG  C C4    
20   P  P     . DT  A 8   ? 0.6478 0.6065 0.5841 -0.0337 -0.0043 0.0023  5   DT  C P     
21   O  OP1   . DT  A 8   ? 0.6455 0.6025 0.5789 -0.0322 0.0011  0.0070  5   DT  C OP1   
22   O  OP2   . DT  A 8   ? 0.6592 0.6030 0.5936 -0.0200 0.0024  0.0001  5   DT  C OP2   
23   O  "O5'" . DT  A 8   ? 0.6424 0.6150 0.5908 -0.0133 -0.0066 -0.0026 5   DT  C "O5'" 
24   C  "C5'" . DT  A 8   ? 0.6244 0.6041 0.5935 -0.0125 0.0027  0.0000  5   DT  C "C5'" 
25   C  "C4'" . DT  A 8   ? 0.6163 0.5912 0.6066 -0.0043 0.0028  -0.0037 5   DT  C "C4'" 
26   O  "O4'" . DT  A 8   ? 0.6278 0.5889 0.6170 0.0112  -0.0044 -0.0079 5   DT  C "O4'" 
27   C  "C3'" . DT  A 8   ? 0.5893 0.5822 0.6109 -0.0028 0.0020  -0.0082 5   DT  C "C3'" 
28   O  "O3'" . DT  A 8   ? 0.5387 0.5617 0.6068 -0.0319 0.0063  -0.0147 5   DT  C "O3'" 
29   C  "C2'" . DT  A 8   ? 0.6306 0.5896 0.6193 0.0026  -0.0070 -0.0099 5   DT  C "C2'" 
30   C  "C1'" . DT  A 8   ? 0.6410 0.5948 0.6248 0.0170  -0.0076 -0.0142 5   DT  C "C1'" 
31   N  N1    . DT  A 8   ? 0.6711 0.6094 0.6444 0.0399  -0.0216 -0.0257 5   DT  C N1    
32   C  C2    . DT  A 8   ? 0.6876 0.6035 0.6408 0.0552  -0.0304 -0.0199 5   DT  C C2    
33   O  O2    . DT  A 8   ? 0.6951 0.5961 0.6200 0.0595  -0.0369 -0.0128 5   DT  C O2    
34   N  N3    . DT  A 8   ? 0.7015 0.6127 0.6555 0.0584  -0.0299 -0.0322 5   DT  C N3    
35   C  C4    . DT  A 8   ? 0.6892 0.6127 0.6662 0.0545  -0.0257 -0.0298 5   DT  C C4    
36   O  O4    . DT  A 8   ? 0.6969 0.6099 0.6919 0.0618  -0.0237 -0.0260 5   DT  C O4    
37   C  C5    . DT  A 8   ? 0.6827 0.6062 0.6727 0.0462  -0.0292 -0.0300 5   DT  C C5    
38   C  C7    . DT  A 8   ? 0.6687 0.6016 0.6808 0.0458  -0.0247 -0.0330 5   DT  C C7    
39   C  C6    . DT  A 8   ? 0.6737 0.6070 0.6624 0.0448  -0.0233 -0.0261 5   DT  C C6    
40   P  P     . DC  A 9   ? 0.4821 0.5547 0.6163 -0.0391 0.0053  -0.0241 6   DC  C P     
41   O  OP1   . DC  A 9   ? 0.4501 0.5505 0.6060 -0.0472 0.0103  -0.0128 6   DC  C OP1   
42   O  OP2   . DC  A 9   ? 0.4519 0.5239 0.6108 -0.0466 -0.0026 -0.0365 6   DC  C OP2   
43   O  "O5'" . DC  A 9   ? 0.5152 0.5658 0.6319 -0.0216 0.0044  -0.0286 6   DC  C "O5'" 
44   C  "C5'" . DC  A 9   ? 0.5334 0.5608 0.6247 -0.0144 0.0080  -0.0194 6   DC  C "C5'" 
45   C  "C4'" . DC  A 9   ? 0.5297 0.5440 0.6090 -0.0152 0.0168  -0.0170 6   DC  C "C4'" 
46   O  "O4'" . DC  A 9   ? 0.5434 0.5480 0.6214 -0.0012 0.0202  -0.0230 6   DC  C "O4'" 
47   C  "C3'" . DC  A 9   ? 0.5285 0.5244 0.5953 -0.0208 0.0299  -0.0198 6   DC  C "C3'" 
48   O  "O3'" . DC  A 9   ? 0.5342 0.4627 0.5748 -0.0429 0.0338  -0.0266 6   DC  C "O3'" 
49   C  "C2'" . DC  A 9   ? 0.5411 0.5354 0.6109 -0.0249 0.0331  -0.0179 6   DC  C "C2'" 
50   C  "C1'" . DC  A 9   ? 0.5678 0.5596 0.6320 -0.0203 0.0254  -0.0015 6   DC  C "C1'" 
51   N  N1    . DC  A 9   ? 0.5951 0.5827 0.6618 -0.0223 0.0373  0.0018  6   DC  C N1    
52   C  C2    . DC  A 9   ? 0.6100 0.5943 0.6720 -0.0206 0.0327  0.0045  6   DC  C C2    
53   O  O2    . DC  A 9   ? 0.6088 0.6071 0.6809 -0.0148 0.0301  0.0073  6   DC  C O2    
54   N  N3    . DC  A 9   ? 0.6014 0.5903 0.6830 -0.0245 0.0472  0.0081  6   DC  C N3    
55   C  C4    . DC  A 9   ? 0.5920 0.5811 0.6809 -0.0305 0.0568  0.0082  6   DC  C C4    
56   N  N4    . DC  A 9   ? 0.5804 0.5767 0.7085 -0.0163 0.0640  0.0056  6   DC  C N4    
57   C  C5    . DC  A 9   ? 0.5839 0.5826 0.6768 -0.0315 0.0506  0.0142  6   DC  C C5    
58   C  C6    . DC  A 9   ? 0.5816 0.5820 0.6670 -0.0309 0.0413  0.0116  6   DC  C C6    
59   P  P     . DC  A 10  ? 0.5263 0.4807 0.5569 -0.0307 0.0450  -0.0146 7   DC  C P     
60   O  OP1   . DC  A 10  ? 0.5508 0.4842 0.5641 -0.0343 0.0481  -0.0259 7   DC  C OP1   
61   O  OP2   . DC  A 10  ? 0.5045 0.4326 0.5747 -0.0510 0.0460  -0.0232 7   DC  C OP2   
62   O  "O5'" . DC  A 10  ? 0.5399 0.4999 0.5918 -0.0400 0.0634  0.0010  7   DC  C "O5'" 
63   C  "C5'" . DC  A 10  ? 0.5877 0.5988 0.6054 -0.0474 0.0475  0.0153  7   DC  C "C5'" 
64   C  "C4'" . DC  A 10  ? 0.6549 0.6359 0.6574 -0.0368 0.0385  0.0042  7   DC  C "C4'" 
65   O  "O4'" . DC  A 10  ? 0.6712 0.6764 0.6567 -0.0326 0.0341  0.0111  7   DC  C "O4'" 
66   C  "C3'" . DC  A 10  ? 0.6805 0.6663 0.6795 -0.0376 0.0418  0.0123  7   DC  C "C3'" 
67   O  "O3'" . DC  A 10  ? 0.6897 0.6711 0.7047 -0.0461 0.0516  0.0173  7   DC  C "O3'" 
68   C  "C2'" . DC  A 10  ? 0.6916 0.6807 0.6952 -0.0316 0.0382  -0.0005 7   DC  C "C2'" 
69   C  "C1'" . DC  A 10  ? 0.7051 0.6869 0.6892 -0.0189 0.0304  -0.0017 7   DC  C "C1'" 
70   N  N1    . DC  A 10  ? 0.7191 0.7193 0.7187 0.0006  0.0240  -0.0048 7   DC  C N1    
71   C  C2    . DC  A 10  ? 0.7375 0.7328 0.7318 0.0090  0.0155  -0.0086 7   DC  C C2    
72   O  O2    . DC  A 10  ? 0.7402 0.7421 0.7577 0.0017  0.0056  -0.0050 7   DC  C O2    
73   N  N3    . DC  A 10  ? 0.7364 0.7301 0.7340 0.0210  0.0167  -0.0040 7   DC  C N3    
74   C  C4    . DC  A 10  ? 0.7325 0.7271 0.7327 0.0276  0.0177  -0.0037 7   DC  C C4    
75   N  N4    . DC  A 10  ? 0.7330 0.7180 0.7162 0.0368  0.0236  -0.0009 7   DC  C N4    
76   C  C5    . DC  A 10  ? 0.7391 0.7309 0.7377 0.0205  0.0231  -0.0067 7   DC  C C5    
77   C  C6    . DC  A 10  ? 0.7367 0.7256 0.7259 0.0112  0.0238  -0.0115 7   DC  C C6    
78   P  P     . DT  A 11  ? 0.6991 0.6934 0.6815 -0.0498 0.0716  0.0202  8   DT  C P     
79   O  OP1   . DT  A 11  ? 0.6958 0.6698 0.6708 -0.0571 0.0721  0.0438  8   DT  C OP1   
80   O  OP2   . DT  A 11  ? 0.6759 0.6740 0.6748 -0.0619 0.0806  0.0233  8   DT  C OP2   
81   O  "O5'" . DT  A 11  ? 0.7282 0.7125 0.7158 -0.0511 0.0644  0.0051  8   DT  C "O5'" 
82   C  "C5'" . DT  A 11  ? 0.7644 0.7557 0.7521 -0.0365 0.0248  -0.0264 8   DT  C "C5'" 
83   C  "C4'" . DT  A 11  ? 0.7860 0.7695 0.7658 -0.0272 0.0145  -0.0405 8   DT  C "C4'" 
84   O  "O4'" . DT  A 11  ? 0.7887 0.7951 0.7589 -0.0290 0.0152  -0.0422 8   DT  C "O4'" 
85   C  "C3'" . DT  A 11  ? 0.7920 0.7670 0.7848 -0.0212 0.0050  -0.0390 8   DT  C "C3'" 
86   O  "O3'" . DT  A 11  ? 0.7825 0.7265 0.7975 -0.0084 -0.0065 -0.0269 8   DT  C "O3'" 
87   C  "C2'" . DT  A 11  ? 0.7942 0.7904 0.7864 -0.0194 0.0057  -0.0424 8   DT  C "C2'" 
88   C  "C1'" . DT  A 11  ? 0.7961 0.8170 0.7913 -0.0159 0.0083  -0.0398 8   DT  C "C1'" 
89   N  N1    . DT  A 11  ? 0.8028 0.8622 0.8086 -0.0117 0.0010  -0.0352 8   DT  C N1    
90   C  C2    . DT  A 11  ? 0.8116 0.8797 0.8016 -0.0166 0.0021  -0.0238 8   DT  C C2    
91   O  O2    . DT  A 11  ? 0.8136 0.8843 0.7916 -0.0271 -0.0108 -0.0138 8   DT  C O2    
92   N  N3    . DT  A 11  ? 0.8092 0.8878 0.8105 -0.0175 0.0031  -0.0197 8   DT  C N3    
93   C  C4    . DT  A 11  ? 0.8116 0.8905 0.8147 -0.0095 0.0028  -0.0170 8   DT  C C4    
94   O  O4    . DT  A 11  ? 0.8034 0.8984 0.8254 -0.0175 0.0100  -0.0056 8   DT  C O4    
95   C  C5    . DT  A 11  ? 0.8104 0.8851 0.8261 -0.0010 0.0009  -0.0265 8   DT  C C5    
96   C  C7    . DT  A 11  ? 0.8077 0.8660 0.8169 0.0053  0.0015  -0.0260 8   DT  C C7    
97   C  C6    . DT  A 11  ? 0.8108 0.8742 0.8094 -0.0016 -0.0006 -0.0324 8   DT  C C6    
98   P  P     . DT  A 12  ? 0.7645 0.7064 0.8063 -0.0082 -0.0105 -0.0277 9   DT  C P     
99   O  OP1   . DT  A 12  ? 0.7558 0.7015 0.8139 -0.0039 -0.0242 -0.0039 9   DT  C OP1   
100  O  OP2   . DT  A 12  ? 0.7510 0.6723 0.7970 -0.0187 -0.0070 -0.0196 9   DT  C OP2   
101  O  "O5'" . DT  A 12  ? 0.7746 0.7180 0.8118 -0.0028 -0.0057 -0.0224 9   DT  C "O5'" 
102  C  "C5'" . DT  A 12  ? 0.7668 0.7337 0.7962 0.0001  -0.0066 -0.0123 9   DT  C "C5'" 
103  C  "C4'" . DT  A 12  ? 0.7506 0.7570 0.7733 0.0073  -0.0007 -0.0122 9   DT  C "C4'" 
104  O  "O4'" . DT  A 12  ? 0.7466 0.7743 0.7787 0.0196  -0.0053 -0.0028 9   DT  C "O4'" 
105  C  "C3'" . DT  A 12  ? 0.7304 0.7559 0.7558 0.0072  -0.0020 -0.0149 9   DT  C "C3'" 
106  O  "O3'" . DT  A 12  ? 0.6801 0.7323 0.7255 -0.0159 -0.0055 -0.0102 9   DT  C "O3'" 
107  C  "C2'" . DT  A 12  ? 0.7505 0.7711 0.7517 0.0149  -0.0023 -0.0038 9   DT  C "C2'" 
108  C  "C1'" . DT  A 12  ? 0.7564 0.7887 0.7563 0.0206  -0.0023 -0.0019 9   DT  C "C1'" 
109  N  N1    . DT  A 12  ? 0.7866 0.8013 0.7408 0.0289  -0.0045 0.0120  9   DT  C N1    
110  C  C2    . DT  A 12  ? 0.8078 0.7876 0.7234 0.0341  -0.0016 0.0303  9   DT  C C2    
111  O  O2    . DT  A 12  ? 0.8113 0.7797 0.6810 0.0376  -0.0014 0.0528  9   DT  C O2    
112  N  N3    . DT  A 12  ? 0.8274 0.7795 0.7204 0.0352  -0.0069 0.0395  9   DT  C N3    
113  C  C4    . DT  A 12  ? 0.8314 0.7894 0.7320 0.0339  -0.0031 0.0361  9   DT  C C4    
114  O  O4    . DT  A 12  ? 0.8516 0.7761 0.7225 0.0310  -0.0051 0.0470  9   DT  C O4    
115  C  C5    . DT  A 12  ? 0.8153 0.8030 0.7477 0.0349  -0.0049 0.0184  9   DT  C C5    
116  C  C7    . DT  A 12  ? 0.8234 0.8103 0.7520 0.0321  0.0010  0.0073  9   DT  C C7    
117  C  C6    . DT  A 12  ? 0.8008 0.8085 0.7543 0.0341  -0.0073 0.0061  9   DT  C C6    
118  P  P     . DA  A 13  ? 0.6230 0.7130 0.6853 -0.0312 -0.0111 -0.0105 10  DA  C P     
119  O  OP1   . DA  A 13  ? 0.6170 0.7489 0.6873 -0.0362 -0.0033 -0.0174 10  DA  C OP1   
120  O  OP2   . DA  A 13  ? 0.6266 0.6991 0.6873 -0.0318 -0.0073 -0.0155 10  DA  C OP2   
121  O  "O5'" . DA  A 13  ? 0.6295 0.6953 0.6688 -0.0264 -0.0135 -0.0104 10  DA  C "O5'" 
122  C  "C5'" . DA  A 13  ? 0.5980 0.6811 0.6099 -0.0205 -0.0115 0.0064  10  DA  C "C5'" 
123  C  "C4'" . DA  A 13  ? 0.5910 0.6396 0.5622 -0.0107 -0.0007 0.0109  10  DA  C "C4'" 
124  O  "O4'" . DA  A 13  ? 0.5895 0.6133 0.5571 0.0016  -0.0025 0.0233  10  DA  C "O4'" 
125  C  "C3'" . DA  A 13  ? 0.5760 0.6309 0.5418 -0.0218 0.0021  -0.0012 10  DA  C "C3'" 
126  O  "O3'" . DA  A 13  ? 0.5613 0.6433 0.4665 -0.0292 -0.0090 -0.0168 10  DA  C "O3'" 
127  C  "C2'" . DA  A 13  ? 0.5757 0.6046 0.5380 -0.0161 0.0082  0.0079  10  DA  C "C2'" 
128  C  "C1'" . DA  A 13  ? 0.5778 0.5885 0.5394 -0.0042 0.0169  0.0201  10  DA  C "C1'" 
129  N  N9    . DA  A 13  ? 0.5531 0.5455 0.5147 -0.0035 0.0323  0.0527  10  DA  C N9    
130  C  C8    . DA  A 13  ? 0.5510 0.5343 0.5055 0.0002  0.0383  0.0583  10  DA  C C8    
131  N  N7    . DA  A 13  ? 0.5329 0.5111 0.4837 -0.0012 0.0477  0.0804  10  DA  C N7    
132  C  C5    . DA  A 13  ? 0.5432 0.4865 0.4818 -0.0062 0.0493  0.0846  10  DA  C C5    
133  C  C6    . DA  A 13  ? 0.5452 0.4535 0.4937 -0.0081 0.0579  0.0794  10  DA  C C6    
134  N  N6    . DA  A 13  ? 0.5639 0.4323 0.4855 -0.0204 0.0756  0.0869  10  DA  C N6    
135  N  N1    . DA  A 13  ? 0.5271 0.4375 0.5052 -0.0056 0.0566  0.0803  10  DA  C N1    
136  C  C2    . DA  A 13  ? 0.5373 0.4487 0.4844 -0.0038 0.0438  0.0912  10  DA  C C2    
137  N  N3    . DA  A 13  ? 0.5425 0.4892 0.4669 0.0028  0.0380  0.0902  10  DA  C N3    
138  C  C4    . DA  A 13  ? 0.5464 0.5033 0.4845 0.0009  0.0399  0.0750  10  DA  C C4    
139  P  P     . DG  A 14  ? 0.5384 0.6647 0.4509 -0.0294 -0.0274 -0.0247 11  DG  C P     
140  O  OP1   . DG  A 14  ? 0.5281 0.6902 0.4429 -0.0313 -0.0319 -0.0137 11  DG  C OP1   
141  O  OP2   . DG  A 14  ? 0.5287 0.6849 0.4299 -0.0224 -0.0267 -0.0107 11  DG  C OP2   
142  O  "O5'" . DG  A 14  ? 0.5245 0.6324 0.4397 -0.0372 -0.0065 -0.0109 11  DG  C "O5'" 
143  C  "C5'" . DG  A 14  ? 0.5138 0.5647 0.4013 -0.0333 -0.0051 -0.0054 11  DG  C "C5'" 
144  C  "C4'" . DG  A 14  ? 0.4877 0.5006 0.3731 -0.0339 0.0100  0.0233  11  DG  C "C4'" 
145  O  "O4'" . DG  A 14  ? 0.4902 0.4777 0.3473 -0.0469 0.0075  0.0314  11  DG  C "O4'" 
146  C  "C3'" . DG  A 14  ? 0.4663 0.4748 0.3660 -0.0263 0.0127  0.0267  11  DG  C "C3'" 
147  O  "O3'" . DG  A 14  ? 0.4583 0.4524 0.3276 -0.0237 0.0190  0.0332  11  DG  C "O3'" 
148  C  "C2'" . DG  A 14  ? 0.4662 0.4408 0.3474 -0.0333 0.0000  0.0418  11  DG  C "C2'" 
149  C  "C1'" . DG  A 14  ? 0.4683 0.4370 0.3631 -0.0341 0.0014  0.0489  11  DG  C "C1'" 
150  N  N9    . DG  A 14  ? 0.4370 0.3723 0.3382 -0.0394 -0.0060 0.0819  11  DG  C N9    
151  C  C8    . DG  A 14  ? 0.4279 0.3449 0.3427 -0.0296 -0.0066 0.0898  11  DG  C C8    
152  N  N7    . DG  A 14  ? 0.4041 0.3279 0.3190 -0.0314 -0.0057 0.1011  11  DG  C N7    
153  C  C5    . DG  A 14  ? 0.4072 0.2825 0.3309 -0.0353 -0.0087 0.1145  11  DG  C C5    
154  C  C6    . DG  A 14  ? 0.3869 0.2345 0.3432 -0.0505 -0.0070 0.1134  11  DG  C C6    
155  O  O6    . DG  A 14  ? 0.3929 0.2410 0.3762 -0.0485 0.0055  0.1003  11  DG  C O6    
156  N  N1    . DG  A 14  ? 0.3869 0.1711 0.3626 -0.0480 -0.0142 0.1273  11  DG  C N1    
157  C  C2    . DG  A 14  ? 0.3968 0.1726 0.3598 -0.0434 -0.0239 0.1142  11  DG  C C2    
158  N  N2    . DG  A 14  ? 0.4110 0.1410 0.3597 -0.0508 -0.0362 0.0825  11  DG  C N2    
159  N  N3    . DG  A 14  ? 0.4131 0.2160 0.3316 -0.0456 -0.0320 0.1246  11  DG  C N3    
160  C  C4    . DG  A 14  ? 0.4080 0.2975 0.3278 -0.0357 -0.0177 0.1123  11  DG  C C4    
161  P  P     . DC  A 15  ? 0.4709 0.4604 0.3375 -0.0238 0.0367  0.0325  12  DC  C P     
162  O  OP1   . DC  A 15  ? 0.4702 0.4515 0.3193 -0.0108 0.0332  0.0066  12  DC  C OP1   
163  O  OP2   . DC  A 15  ? 0.4627 0.4568 0.2901 -0.0270 0.0443  0.0370  12  DC  C OP2   
164  O  "O5'" . DC  A 15  ? 0.4386 0.4204 0.3199 -0.0076 0.0534  0.0630  12  DC  C "O5'" 
165  C  "C5'" . DC  A 15  ? 0.4202 0.3945 0.2878 0.0092  0.0372  0.1022  12  DC  C "C5'" 
166  C  "C4'" . DC  A 15  ? 0.4353 0.3865 0.3071 0.0123  0.0219  0.1105  12  DC  C "C4'" 
167  O  "O4'" . DC  A 15  ? 0.4305 0.3635 0.3265 0.0043  0.0111  0.1605  12  DC  C "O4'" 
168  C  "C3'" . DC  A 15  ? 0.4258 0.3887 0.3063 0.0091  0.0149  0.1131  12  DC  C "C3'" 
169  O  "O3'" . DC  A 15  ? 0.4169 0.4097 0.2564 -0.0049 0.0038  0.0706  12  DC  C "O3'" 
170  C  "C2'" . DC  A 15  ? 0.4108 0.3820 0.3159 0.0033  0.0210  0.1422  12  DC  C "C2'" 
171  C  "C1'" . DC  A 15  ? 0.4146 0.3688 0.3384 -0.0073 0.0324  0.1548  12  DC  C "C1'" 
172  N  N1    . DC  A 15  ? 0.4050 0.3462 0.3534 -0.0180 0.0207  0.1814  12  DC  C N1    
173  C  C2    . DC  A 15  ? 0.3778 0.3319 0.3586 -0.0411 0.0426  0.2017  12  DC  C C2    
174  O  O2    . DC  A 15  ? 0.3762 0.3136 0.3425 -0.0702 0.0605  0.2308  12  DC  C O2    
175  N  N3    . DC  A 15  ? 0.3737 0.3345 0.3629 -0.0522 0.0245  0.2242  12  DC  C N3    
176  C  C4    . DC  A 15  ? 0.3749 0.3734 0.3769 -0.0493 0.0338  0.2059  12  DC  C C4    
177  N  N4    . DC  A 15  ? 0.3618 0.4052 0.4237 -0.0684 0.0588  0.2001  12  DC  C N4    
178  C  C5    . DC  A 15  ? 0.3792 0.3644 0.3671 -0.0408 0.0423  0.2086  12  DC  C C5    
179  C  C6    . DC  A 15  ? 0.3865 0.3519 0.3484 -0.0132 0.0187  0.2014  12  DC  C C6    
180  P  P     . DC  A 16  ? 0.4247 0.4451 0.2569 -0.0140 -0.0117 0.0448  13  DC  C P     
181  O  OP1   . DC  A 16  ? 0.4207 0.4713 0.2448 -0.0362 0.0140  0.0298  13  DC  C OP1   
182  O  OP2   . DC  A 16  ? 0.4189 0.4464 0.2579 -0.0212 -0.0272 0.0599  13  DC  C OP2   
183  O  "O5'" . DC  A 16  ? 0.3938 0.4163 0.2148 -0.0333 0.0043  0.0531  13  DC  C "O5'" 
184  C  "C5'" . DC  A 16  ? 0.3399 0.3348 0.1868 -0.0274 0.0102  0.1048  13  DC  C "C5'" 
185  C  "C4'" . DC  A 16  ? 0.3056 0.2769 0.2134 -0.0371 0.0268  0.0987  13  DC  C "C4'" 
186  O  "O4'" . DC  A 16  ? 0.3288 0.2526 0.2645 -0.0376 0.0070  0.0930  13  DC  C "O4'" 
187  C  "C3'" . DC  A 16  ? 0.3005 0.2655 0.1957 -0.0507 0.0191  0.1184  13  DC  C "C3'" 
188  O  "O3'" . DC  A 16  ? 0.3272 0.2289 0.1530 -0.0513 0.0408  0.1261  13  DC  C "O3'" 
189  C  "C2'" . DC  A 16  ? 0.2869 0.2422 0.1838 -0.0693 0.0118  0.1238  13  DC  C "C2'" 
190  C  "C1'" . DC  A 16  ? 0.2860 0.2287 0.2541 -0.0621 -0.0044 0.0925  13  DC  C "C1'" 
191  N  N1    . DC  A 16  ? 0.2825 0.2236 0.2716 -0.0708 -0.0207 0.0559  13  DC  C N1    
192  C  C2    . DC  A 16  ? 0.2679 0.2375 0.2662 -0.0778 -0.0335 0.0453  13  DC  C C2    
193  O  O2    . DC  A 16  ? 0.2866 0.2796 0.2337 -0.0791 -0.0237 0.0548  13  DC  C O2    
194  N  N3    . DC  A 16  ? 0.2597 0.1919 0.2589 -0.0813 -0.0409 0.0503  13  DC  C N3    
195  C  C4    . DC  A 16  ? 0.2438 0.1808 0.2372 -0.0774 -0.0565 0.0543  13  DC  C C4    
196  N  N4    . DC  A 16  ? 0.2452 0.1612 0.2277 -0.0508 -0.0731 0.0599  13  DC  C N4    
197  C  C5    . DC  A 16  ? 0.2638 0.1965 0.2285 -0.0845 -0.0389 0.0439  13  DC  C C5    
198  C  C6    . DC  A 16  ? 0.2650 0.2108 0.2537 -0.0730 -0.0410 0.0592  13  DC  C C6    
199  O  "O5'" . DG  B 1   ? 0.3984 0.3152 0.4880 -0.0780 0.0168  0.0173  5   DG  D "O5'" 
200  C  "C5'" . DG  B 1   ? 0.4059 0.3302 0.4849 -0.0505 0.0146  0.0221  5   DG  D "C5'" 
201  C  "C4'" . DG  B 1   ? 0.3920 0.3232 0.4568 -0.0400 0.0212  0.0453  5   DG  D "C4'" 
202  O  "O4'" . DG  B 1   ? 0.3683 0.2992 0.4153 -0.0657 0.0404  0.0604  5   DG  D "O4'" 
203  C  "C3'" . DG  B 1   ? 0.3765 0.3453 0.4699 -0.0424 0.0334  0.0454  5   DG  D "C3'" 
204  O  "O3'" . DG  B 1   ? 0.3580 0.3425 0.4969 -0.0413 0.0175  0.0601  5   DG  D "O3'" 
205  C  "C2'" . DG  B 1   ? 0.3789 0.3298 0.4357 -0.0392 0.0294  0.0574  5   DG  D "C2'" 
206  C  "C1'" . DG  B 1   ? 0.3699 0.3086 0.4063 -0.0446 0.0352  0.0439  5   DG  D "C1'" 
207  N  N9    . DG  B 1   ? 0.3663 0.2773 0.3724 -0.0463 0.0374  0.0580  5   DG  D N9    
208  C  C8    . DG  B 1   ? 0.3657 0.2427 0.3301 -0.0437 0.0489  0.0737  5   DG  D C8    
209  N  N7    . DG  B 1   ? 0.3456 0.2363 0.2912 -0.0442 0.0642  0.0858  5   DG  D N7    
210  C  C5    . DG  B 1   ? 0.3326 0.2410 0.3018 -0.0610 0.0746  0.0710  5   DG  D C5    
211  C  C6    . DG  B 1   ? 0.3187 0.2447 0.2824 -0.0776 0.0810  0.0724  5   DG  D C6    
212  O  O6    . DG  B 1   ? 0.2614 0.1928 0.2870 -0.0914 0.1183  0.0715  5   DG  D O6    
213  N  N1    . DG  B 1   ? 0.3346 0.2529 0.3000 -0.0665 0.0601  0.0730  5   DG  D N1    
214  C  C2    . DG  B 1   ? 0.3379 0.2331 0.3347 -0.0529 0.0343  0.0638  5   DG  D C2    
215  N  N2    . DG  B 1   ? 0.3366 0.2098 0.3486 -0.0573 0.0184  0.0889  5   DG  D N2    
216  N  N3    . DG  B 1   ? 0.3259 0.2321 0.3378 -0.0645 0.0628  0.0472  5   DG  D N3    
217  C  C4    . DG  B 1   ? 0.3434 0.2481 0.3352 -0.0614 0.0609  0.0549  5   DG  D C4    
218  P  P     . DG  B 2   ? 0.3421 0.3346 0.5265 -0.0486 0.0320  0.0591  6   DG  D P     
219  O  OP1   . DG  B 2   ? 0.3486 0.3163 0.5369 -0.0435 0.0176  0.0594  6   DG  D OP1   
220  O  OP2   . DG  B 2   ? 0.3570 0.3133 0.5480 -0.0545 0.0256  0.0793  6   DG  D OP2   
221  O  "O5'" . DG  B 2   ? 0.3522 0.3224 0.5404 -0.0551 0.0351  0.0631  6   DG  D "O5'" 
222  C  "C5'" . DG  B 2   ? 0.3523 0.2903 0.4867 -0.0590 0.0473  0.0770  6   DG  D "C5'" 
223  C  "C4'" . DG  B 2   ? 0.3436 0.2692 0.4495 -0.0579 0.0518  0.0814  6   DG  D "C4'" 
224  O  "O4'" . DG  B 2   ? 0.3342 0.2644 0.4197 -0.0517 0.0479  0.0932  6   DG  D "O4'" 
225  C  "C3'" . DG  B 2   ? 0.3302 0.2539 0.4315 -0.0693 0.0610  0.0842  6   DG  D "C3'" 
226  O  "O3'" . DG  B 2   ? 0.3279 0.2384 0.4576 -0.0711 0.0569  0.0905  6   DG  D "O3'" 
227  C  "C2'" . DG  B 2   ? 0.3120 0.2449 0.4064 -0.0753 0.0701  0.0989  6   DG  D "C2'" 
228  C  "C1'" . DG  B 2   ? 0.3182 0.2751 0.4038 -0.0472 0.0608  0.0786  6   DG  D "C1'" 
229  N  N9    . DG  B 2   ? 0.3397 0.3024 0.4261 -0.0509 0.0491  0.0691  6   DG  D N9    
230  C  C8    . DG  B 2   ? 0.3470 0.3010 0.4192 -0.0377 0.0479  0.0779  6   DG  D C8    
231  N  N7    . DG  B 2   ? 0.3733 0.3037 0.4360 -0.0393 0.0245  0.0821  6   DG  D N7    
232  C  C5    . DG  B 2   ? 0.3667 0.3077 0.4425 -0.0480 0.0329  0.0760  6   DG  D C5    
233  C  C6    . DG  B 2   ? 0.3670 0.2931 0.4337 -0.0583 0.0277  0.0876  6   DG  D C6    
234  O  O6    . DG  B 2   ? 0.3835 0.2980 0.4431 -0.1059 0.0280  0.0956  6   DG  D O6    
235  N  N1    . DG  B 2   ? 0.3820 0.2360 0.4468 -0.0469 0.0231  0.1238  6   DG  D N1    
236  C  C2    . DG  B 2   ? 0.3661 0.2262 0.4640 -0.0287 0.0210  0.1080  6   DG  D C2    
237  N  N2    . DG  B 2   ? 0.3680 0.2124 0.5035 -0.0350 0.0000  0.1380  6   DG  D N2    
238  N  N3    . DG  B 2   ? 0.3697 0.2490 0.4520 -0.0275 0.0340  0.0823  6   DG  D N3    
239  C  C4    . DG  B 2   ? 0.3580 0.2956 0.4486 -0.0462 0.0368  0.0670  6   DG  D C4    
240  P  P     . DC  B 3   ? 0.3227 0.2297 0.4894 -0.0905 0.0321  0.0595  7   DC  D P     
241  O  OP1   . DC  B 3   ? 0.3662 0.2548 0.4339 -0.0819 0.0426  0.0652  7   DC  D OP1   
242  O  OP2   . DC  B 3   ? 0.3049 0.1971 0.5237 -0.0969 0.0433  0.0586  7   DC  D OP2   
243  O  "O5'" . DC  B 3   ? 0.3184 0.2440 0.4800 -0.0968 0.0401  0.0701  7   DC  D "O5'" 
244  C  "C5'" . DC  B 3   ? 0.3192 0.2253 0.4342 -0.0988 0.0450  0.0939  7   DC  D "C5'" 
245  C  "C4'" . DC  B 3   ? 0.3078 0.2484 0.4255 -0.0876 0.0450  0.1027  7   DC  D "C4'" 
246  O  "O4'" . DC  B 3   ? 0.3418 0.2591 0.4097 -0.0878 0.0505  0.0970  7   DC  D "O4'" 
247  C  "C3'" . DC  B 3   ? 0.3232 0.2540 0.4190 -0.0889 0.0348  0.1172  7   DC  D "C3'" 
248  O  "O3'" . DC  B 3   ? 0.3327 0.2604 0.4475 -0.0765 0.0125  0.1142  7   DC  D "O3'" 
249  C  "C2'" . DC  B 3   ? 0.3121 0.2556 0.4055 -0.0867 0.0417  0.1115  7   DC  D "C2'" 
250  C  "C1'" . DC  B 3   ? 0.3096 0.2625 0.3738 -0.0843 0.0515  0.1025  7   DC  D "C1'" 
251  N  N1    . DC  B 3   ? 0.2981 0.2961 0.3449 -0.0852 0.0567  0.0876  7   DC  D N1    
252  C  C2    . DC  B 3   ? 0.2882 0.3266 0.3368 -0.0769 0.0515  0.0897  7   DC  D C2    
253  O  O2    . DC  B 3   ? 0.2746 0.3572 0.3388 -0.0981 0.0610  0.0739  7   DC  D O2    
254  N  N3    . DC  B 3   ? 0.3021 0.3507 0.2617 -0.0665 0.0504  0.0947  7   DC  D N3    
255  C  C4    . DC  B 3   ? 0.2992 0.3683 0.2809 -0.0802 0.0446  0.0901  7   DC  D C4    
256  N  N4    . DC  B 3   ? 0.3517 0.3636 0.2449 -0.1016 0.0348  0.0793  7   DC  D N4    
257  C  C5    . DC  B 3   ? 0.3186 0.3464 0.3194 -0.0812 0.0427  0.0721  7   DC  D C5    
258  C  C6    . DC  B 3   ? 0.2882 0.2974 0.3400 -0.0820 0.0483  0.0734  7   DC  D C6    
259  P  P     . DT  B 4   ? 0.2981 0.2854 0.4689 -0.0890 0.0247  0.0773  8   DT  D P     
260  O  OP1   . DT  B 4   ? 0.3191 0.2619 0.4624 -0.0610 0.0272  0.0874  8   DT  D OP1   
261  O  OP2   . DT  B 4   ? 0.2842 0.2632 0.4548 -0.0728 0.0166  0.0827  8   DT  D OP2   
262  O  "O5'" . DT  B 4   ? 0.3063 0.2731 0.4497 -0.0518 0.0229  0.0723  8   DT  D "O5'" 
263  C  "C5'" . DT  B 4   ? 0.3432 0.2790 0.4521 -0.0391 0.0311  0.0532  8   DT  D "C5'" 
264  C  "C4'" . DT  B 4   ? 0.3540 0.2636 0.4387 -0.0179 0.0494  0.0369  8   DT  D "C4'" 
265  O  "O4'" . DT  B 4   ? 0.3636 0.2545 0.4136 -0.0302 0.0585  0.0395  8   DT  D "O4'" 
266  C  "C3'" . DT  B 4   ? 0.3797 0.2914 0.4311 -0.0198 0.0589  0.0496  8   DT  D "C3'" 
267  O  "O3'" . DT  B 4   ? 0.3970 0.3361 0.4597 0.0051  0.0651  0.0447  8   DT  D "O3'" 
268  C  "C2'" . DT  B 4   ? 0.3743 0.2884 0.4315 -0.0388 0.0727  0.0406  8   DT  D "C2'" 
269  C  "C1'" . DT  B 4   ? 0.3666 0.2595 0.4283 -0.0208 0.0643  0.0435  8   DT  D "C1'" 
270  N  N1    . DT  B 4   ? 0.3642 0.2890 0.4291 -0.0203 0.0764  0.0307  8   DT  D N1    
271  C  C2    . DT  B 4   ? 0.3552 0.3149 0.4193 -0.0077 0.0706  0.0236  8   DT  D C2    
272  O  O2    . DT  B 4   ? 0.3389 0.3471 0.4162 -0.0021 0.0796  0.0363  8   DT  D O2    
273  N  N3    . DT  B 4   ? 0.3415 0.3346 0.3767 -0.0017 0.0717  0.0280  8   DT  D N3    
274  C  C4    . DT  B 4   ? 0.3491 0.3264 0.3278 -0.0203 0.0822  0.0492  8   DT  D C4    
275  O  O4    . DT  B 4   ? 0.3572 0.3425 0.2536 -0.0316 0.0768  0.0584  8   DT  D O4    
276  C  C5    . DT  B 4   ? 0.3537 0.3051 0.3671 -0.0372 0.0910  0.0426  8   DT  D C5    
277  C  C7    . DT  B 4   ? 0.3343 0.2671 0.3869 -0.0290 0.0920  0.0496  8   DT  D C7    
278  C  C6    . DT  B 4   ? 0.3473 0.2769 0.3856 -0.0373 0.1016  0.0397  8   DT  D C6    
279  P  P     . DA  B 5   ? 0.4396 0.3892 0.4790 0.0034  0.0987  0.0445  9   DA  D P     
280  O  OP1   . DA  B 5   ? 0.4569 0.4142 0.4934 -0.0252 0.0845  0.0648  9   DA  D OP1   
281  O  OP2   . DA  B 5   ? 0.4503 0.3756 0.5023 -0.0092 0.0771  0.0671  9   DA  D OP2   
282  O  "O5'" . DA  B 5   ? 0.4959 0.4227 0.5023 -0.0072 0.0789  0.0475  9   DA  D "O5'" 
283  C  "C5'" . DA  B 5   ? 0.5446 0.4310 0.5098 0.0069  0.0943  0.0374  9   DA  D "C5'" 
284  C  "C4'" . DA  B 5   ? 0.5825 0.4441 0.5149 0.0089  0.0956  0.0271  9   DA  D "C4'" 
285  O  "O4'" . DA  B 5   ? 0.5845 0.4047 0.4602 0.0097  0.1192  0.0439  9   DA  D "O4'" 
286  C  "C3'" . DA  B 5   ? 0.6104 0.4831 0.5371 0.0093  0.0888  0.0401  9   DA  D "C3'" 
287  O  "O3'" . DA  B 5   ? 0.6576 0.5497 0.5964 0.0177  0.0729  -0.0024 9   DA  D "O3'" 
288  C  "C2'" . DA  B 5   ? 0.6063 0.4574 0.5070 0.0023  0.0983  0.0379  9   DA  D "C2'" 
289  C  "C1'" . DA  B 5   ? 0.6015 0.4432 0.4695 0.0062  0.1041  0.0607  9   DA  D "C1'" 
290  N  N9    . DA  B 5   ? 0.5996 0.4538 0.4426 -0.0128 0.1123  0.0977  9   DA  D N9    
291  C  C8    . DA  B 5   ? 0.6054 0.4345 0.4627 -0.0115 0.1018  0.0971  9   DA  D C8    
292  N  N7    . DA  B 5   ? 0.6088 0.4359 0.4635 -0.0030 0.1047  0.1002  9   DA  D N7    
293  C  C5    . DA  B 5   ? 0.6188 0.4454 0.4544 -0.0079 0.1003  0.1156  9   DA  D C5    
294  C  C6    . DA  B 5   ? 0.6271 0.4268 0.4462 -0.0110 0.0987  0.1370  9   DA  D C6    
295  N  N6    . DA  B 5   ? 0.6337 0.4484 0.3878 -0.0175 0.1137  0.1937  9   DA  D N6    
296  N  N1    . DA  B 5   ? 0.6334 0.3993 0.4308 -0.0194 0.1052  0.1488  9   DA  D N1    
297  C  C2    . DA  B 5   ? 0.6271 0.4342 0.4231 -0.0294 0.1088  0.1453  9   DA  D C2    
298  N  N3    . DA  B 5   ? 0.6247 0.4270 0.4420 -0.0299 0.1080  0.1305  9   DA  D N3    
299  C  C4    . DA  B 5   ? 0.6144 0.4479 0.4447 -0.0205 0.1064  0.1115  9   DA  D C4    
300  P  P     . DC  B 6   ? 0.6905 0.6156 0.6365 0.0122  0.0646  -0.0048 10  DC  D P     
301  O  OP1   . DC  B 6   ? 0.6890 0.6194 0.6498 0.0136  0.0634  -0.0104 10  DC  D OP1   
302  O  OP2   . DC  B 6   ? 0.6864 0.6037 0.6593 0.0028  0.0654  -0.0075 10  DC  D OP2   
303  O  "O5'" . DC  B 6   ? 0.7069 0.6386 0.6487 0.0113  0.0433  -0.0074 10  DC  D "O5'" 
304  C  "C5'" . DC  B 6   ? 0.7125 0.6561 0.6497 0.0092  0.0258  0.0117  10  DC  D "C5'" 
305  C  "C4'" . DC  B 6   ? 0.7236 0.6782 0.6404 0.0105  0.0177  0.0189  10  DC  D "C4'" 
306  O  "O4'" . DC  B 6   ? 0.7254 0.6762 0.6232 0.0102  0.0153  0.0360  10  DC  D "O4'" 
307  C  "C3'" . DC  B 6   ? 0.7198 0.7016 0.6312 0.0125  0.0166  0.0153  10  DC  D "C3'" 
308  O  "O3'" . DC  B 6   ? 0.7119 0.7339 0.6574 0.0124  0.0091  -0.0039 10  DC  D "O3'" 
309  C  "C2'" . DC  B 6   ? 0.7263 0.6752 0.5966 0.0094  0.0190  0.0398  10  DC  D "C2'" 
310  C  "C1'" . DC  B 6   ? 0.7377 0.6569 0.6015 0.0037  0.0183  0.0495  10  DC  D "C1'" 
311  N  N1    . DC  B 6   ? 0.7582 0.6030 0.5531 -0.0032 0.0269  0.0913  10  DC  D N1    
312  C  C2    . DC  B 6   ? 0.7668 0.5880 0.5237 -0.0151 0.0335  0.1136  10  DC  D C2    
313  O  O2    . DC  B 6   ? 0.7839 0.5637 0.4685 -0.0280 0.0547  0.1347  10  DC  D O2    
314  N  N3    . DC  B 6   ? 0.7766 0.5594 0.5380 -0.0084 0.0251  0.1280  10  DC  D N3    
315  C  C4    . DC  B 6   ? 0.7748 0.5675 0.5421 -0.0019 0.0190  0.1275  10  DC  D C4    
316  N  N4    . DC  B 6   ? 0.7710 0.5721 0.5057 0.0118  0.0235  0.1528  10  DC  D N4    
317  C  C5    . DC  B 6   ? 0.7734 0.5792 0.5581 -0.0055 0.0205  0.1163  10  DC  D C5    
318  C  C6    . DC  B 6   ? 0.7577 0.5925 0.5524 -0.0055 0.0251  0.1017  10  DC  D C6    
319  P  P     . DA  B 7   ? 0.7034 0.7382 0.6505 0.0189  -0.0011 -0.0218 11  DA  D P     
320  O  OP1   . DA  B 7   ? 0.6911 0.7312 0.6626 0.0213  -0.0001 -0.0277 11  DA  D OP1   
321  O  OP2   . DA  B 7   ? 0.7034 0.7369 0.6348 0.0186  0.0071  -0.0247 11  DA  D OP2   
322  O  "O5'" . DA  B 7   ? 0.7026 0.7257 0.6498 0.0144  -0.0017 -0.0254 11  DA  D "O5'" 
323  C  "C5'" . DA  B 7   ? 0.7055 0.6749 0.6314 0.0121  -0.0023 -0.0051 11  DA  D "C5'" 
324  C  "C4'" . DA  B 7   ? 0.6985 0.6406 0.6204 0.0047  0.0059  0.0001  11  DA  D "C4'" 
325  O  "O4'" . DA  B 7   ? 0.6977 0.6061 0.6072 0.0025  0.0061  0.0172  11  DA  D "O4'" 
326  C  "C3'" . DA  B 7   ? 0.6884 0.6249 0.6158 0.0039  0.0026  0.0093  11  DA  D "C3'" 
327  O  "O3'" . DA  B 7   ? 0.6712 0.6362 0.6208 0.0030  0.0045  -0.0008 11  DA  D "O3'" 
328  C  "C2'" . DA  B 7   ? 0.6954 0.6174 0.5992 -0.0008 0.0082  0.0206  11  DA  D "C2'" 
329  C  "C1'" . DA  B 7   ? 0.6995 0.5949 0.5991 0.0034  0.0041  0.0353  11  DA  D "C1'" 
330  N  N9    . DA  B 7   ? 0.7009 0.5426 0.5887 -0.0053 0.0036  0.0700  11  DA  D N9    
331  C  C8    . DA  B 7   ? 0.7043 0.5221 0.5784 -0.0088 -0.0013 0.0812  11  DA  D C8    
332  N  N7    . DA  B 7   ? 0.7008 0.5017 0.5732 -0.0024 0.0008  0.0856  11  DA  D N7    
333  C  C5    . DA  B 7   ? 0.7022 0.4937 0.5874 -0.0008 -0.0018 0.0839  11  DA  D C5    
334  C  C6    . DA  B 7   ? 0.7090 0.4812 0.5910 0.0043  -0.0049 0.0865  11  DA  D C6    
335  N  N6    . DA  B 7   ? 0.7091 0.4586 0.6172 0.0070  -0.0153 0.0943  11  DA  D N6    
336  N  N1    . DA  B 7   ? 0.7101 0.4597 0.5879 0.0120  -0.0068 0.0810  11  DA  D N1    
337  C  C2    . DA  B 7   ? 0.7152 0.4760 0.5880 0.0032  -0.0068 0.0833  11  DA  D C2    
338  N  N3    . DA  B 7   ? 0.7112 0.4856 0.5932 0.0011  -0.0010 0.0768  11  DA  D N3    
339  C  C4    . DA  B 7   ? 0.7063 0.5022 0.5844 -0.0016 0.0015  0.0751  11  DA  D C4    
340  P  P     . DG  B 8   ? 0.6481 0.6501 0.6078 -0.0014 -0.0019 -0.0106 12  DG  D P     
341  O  OP1   . DG  B 8   ? 0.6531 0.6411 0.5957 0.0031  0.0005  -0.0245 12  DG  D OP1   
342  O  OP2   . DG  B 8   ? 0.6506 0.6169 0.6130 0.0113  0.0023  -0.0165 12  DG  D OP2   
343  O  "O5'" . DG  B 8   ? 0.6354 0.6368 0.5984 -0.0003 -0.0024 -0.0164 12  DG  D "O5'" 
344  C  "C5'" . DG  B 8   ? 0.5918 0.6082 0.5886 -0.0035 0.0050  -0.0318 12  DG  D "C5'" 
345  C  "C4'" . DG  B 8   ? 0.5691 0.5751 0.5456 -0.0113 0.0068  -0.0401 12  DG  D "C4'" 
346  O  "O4'" . DG  B 8   ? 0.5462 0.5596 0.5383 -0.0082 0.0117  -0.0332 12  DG  D "O4'" 
347  C  "C3'" . DG  B 8   ? 0.5542 0.5772 0.5327 -0.0099 0.0062  -0.0413 12  DG  D "C3'" 
348  O  "O3'" . DG  B 8   ? 0.5575 0.5767 0.5138 -0.0133 0.0116  -0.0604 12  DG  D "O3'" 
349  C  "C2'" . DG  B 8   ? 0.5446 0.5771 0.5087 -0.0127 0.0077  -0.0346 12  DG  D "C2'" 
350  C  "C1'" . DG  B 8   ? 0.5317 0.5626 0.5084 -0.0141 0.0075  -0.0366 12  DG  D "C1'" 
351  N  N9    . DG  B 8   ? 0.5069 0.5466 0.4687 -0.0075 0.0162  -0.0219 12  DG  D N9    
352  C  C8    . DG  B 8   ? 0.5035 0.5458 0.4519 -0.0133 0.0124  -0.0174 12  DG  D C8    
353  N  N7    . DG  B 8   ? 0.4900 0.5197 0.4472 -0.0062 0.0196  -0.0168 12  DG  D N7    
354  C  C5    . DG  B 8   ? 0.4860 0.5323 0.4431 -0.0082 0.0192  -0.0226 12  DG  D C5    
355  C  C6    . DG  B 8   ? 0.4827 0.5437 0.4468 -0.0085 0.0073  -0.0254 12  DG  D C6    
356  O  O6    . DG  B 8   ? 0.4811 0.5397 0.4541 -0.0018 -0.0014 -0.0245 12  DG  D O6    
357  N  N1    . DG  B 8   ? 0.4861 0.5543 0.4598 -0.0082 0.0081  -0.0338 12  DG  D N1    
358  C  C2    . DG  B 8   ? 0.4765 0.5570 0.4599 -0.0051 0.0145  -0.0327 12  DG  D C2    
359  N  N2    . DG  B 8   ? 0.4727 0.5541 0.4739 0.0047  0.0137  -0.0354 12  DG  D N2    
360  N  N3    . DG  B 8   ? 0.4855 0.5499 0.4398 -0.0133 0.0160  -0.0304 12  DG  D N3    
361  C  C4    . DG  B 8   ? 0.4908 0.5388 0.4462 -0.0112 0.0170  -0.0237 12  DG  D C4    
362  O  "O5'" . DG  C 7   ? 0.5978 0.7028 0.5813 0.0008  0.0566  0.0361  4   DG  E "O5'" 
363  C  "C5'" . DG  C 7   ? 0.6081 0.6851 0.5792 -0.0047 0.0480  0.0312  4   DG  E "C5'" 
364  C  "C4'" . DG  C 7   ? 0.6065 0.6808 0.5767 -0.0005 0.0373  0.0286  4   DG  E "C4'" 
365  O  "O4'" . DG  C 7   ? 0.6098 0.6874 0.5651 0.0016  0.0391  0.0314  4   DG  E "O4'" 
366  C  "C3'" . DG  C 7   ? 0.6032 0.6730 0.5777 -0.0031 0.0278  0.0204  4   DG  E "C3'" 
367  O  "O3'" . DG  C 7   ? 0.5978 0.6636 0.5862 -0.0060 0.0169  0.0072  4   DG  E "O3'" 
368  C  "C2'" . DG  C 7   ? 0.5984 0.6784 0.5722 0.0030  0.0370  0.0299  4   DG  E "C2'" 
369  C  "C1'" . DG  C 7   ? 0.5983 0.6813 0.5589 0.0110  0.0477  0.0290  4   DG  E "C1'" 
370  N  N9    . DG  C 7   ? 0.6162 0.6662 0.5531 0.0249  0.0625  0.0344  4   DG  E N9    
371  C  C8    . DG  C 7   ? 0.6333 0.6664 0.5505 0.0285  0.0692  0.0376  4   DG  E C8    
372  N  N7    . DG  C 7   ? 0.6485 0.6703 0.5537 0.0386  0.0791  0.0423  4   DG  E N7    
373  C  C5    . DG  C 7   ? 0.6582 0.6670 0.5738 0.0458  0.1036  0.0504  4   DG  E C5    
374  C  C6    . DG  C 7   ? 0.6706 0.6685 0.5914 0.0557  0.1265  0.0645  4   DG  E C6    
375  O  O6    . DG  C 7   ? 0.7032 0.6741 0.5940 0.0538  0.1530  0.0674  4   DG  E O6    
376  N  N1    . DG  C 7   ? 0.6527 0.6654 0.5894 0.0627  0.1306  0.0681  4   DG  E N1    
377  C  C2    . DG  C 7   ? 0.6442 0.6567 0.5859 0.0589  0.1208  0.0586  4   DG  E C2    
378  N  N2    . DG  C 7   ? 0.6404 0.6487 0.5884 0.0663  0.1348  0.0561  4   DG  E N2    
379  N  N3    . DG  C 7   ? 0.6319 0.6619 0.5720 0.0502  0.1016  0.0507  4   DG  E N3    
380  C  C4    . DG  C 7   ? 0.6304 0.6625 0.5633 0.0416  0.0854  0.0426  4   DG  E C4    
381  P  P     . DT  C 8   ? 0.5998 0.6684 0.6059 -0.0118 0.0035  0.0111  5   DT  E P     
382  O  OP1   . DT  C 8   ? 0.5983 0.6598 0.6003 -0.0055 -0.0019 0.0049  5   DT  E OP1   
383  O  OP2   . DT  C 8   ? 0.5941 0.6680 0.6094 0.0064  0.0035  0.0000  5   DT  E OP2   
384  O  "O5'" . DT  C 8   ? 0.6067 0.6495 0.6002 -0.0063 -0.0029 -0.0012 5   DT  E "O5'" 
385  C  "C5'" . DT  C 8   ? 0.5969 0.6342 0.5940 -0.0083 -0.0062 -0.0022 5   DT  E "C5'" 
386  C  "C4'" . DT  C 8   ? 0.5964 0.6135 0.6055 0.0030  0.0005  -0.0017 5   DT  E "C4'" 
387  O  "O4'" . DT  C 8   ? 0.6024 0.6272 0.6133 0.0179  0.0001  0.0041  5   DT  E "O4'" 
388  C  "C3'" . DT  C 8   ? 0.5824 0.5861 0.6110 -0.0027 0.0088  -0.0060 5   DT  E "C3'" 
389  O  "O3'" . DT  C 8   ? 0.5407 0.5617 0.6077 -0.0304 0.0111  -0.0113 5   DT  E "O3'" 
390  C  "C2'" . DT  C 8   ? 0.5918 0.6157 0.6235 0.0083  0.0122  0.0010  5   DT  E "C2'" 
391  C  "C1'" . DT  C 8   ? 0.6083 0.6278 0.6267 0.0244  0.0163  0.0035  5   DT  E "C1'" 
392  N  N1    . DT  C 8   ? 0.6400 0.6345 0.6390 0.0477  0.0331  0.0089  5   DT  E N1    
393  C  C2    . DT  C 8   ? 0.6481 0.6372 0.6434 0.0698  0.0314  0.0189  5   DT  E C2    
394  O  O2    . DT  C 8   ? 0.6391 0.6345 0.6244 0.0786  0.0326  0.0329  5   DT  E O2    
395  N  N3    . DT  C 8   ? 0.6625 0.6503 0.6637 0.0716  0.0428  0.0173  5   DT  E N3    
396  C  C4    . DT  C 8   ? 0.6499 0.6511 0.6741 0.0688  0.0402  0.0159  5   DT  E C4    
397  O  O4    . DT  C 8   ? 0.6472 0.6515 0.7028 0.0875  0.0424  0.0180  5   DT  E O4    
398  C  C5    . DT  C 8   ? 0.6385 0.6450 0.6731 0.0608  0.0352  0.0179  5   DT  E C5    
399  C  C7    . DT  C 8   ? 0.6308 0.6416 0.6908 0.0648  0.0440  0.0209  5   DT  E C7    
400  C  C6    . DT  C 8   ? 0.6348 0.6302 0.6546 0.0529  0.0344  0.0082  5   DT  E C6    
401  P  P     . DC  C 9   ? 0.5294 0.5180 0.6097 -0.0386 0.0169  -0.0125 6   DC  E P     
402  O  OP1   . DC  C 9   ? 0.5112 0.5062 0.6094 -0.0636 0.0065  -0.0062 6   DC  E OP1   
403  O  OP2   . DC  C 9   ? 0.5102 0.4956 0.6279 -0.0469 0.0354  -0.0065 6   DC  E OP2   
404  O  "O5'" . DC  C 9   ? 0.5467 0.5302 0.6168 -0.0307 0.0263  -0.0224 6   DC  E "O5'" 
405  C  "C5'" . DC  C 9   ? 0.5441 0.5379 0.6130 -0.0179 0.0164  -0.0245 6   DC  E "C5'" 
406  C  "C4'" . DC  C 9   ? 0.5287 0.5402 0.6086 -0.0138 0.0077  -0.0269 6   DC  E "C4'" 
407  O  "O4'" . DC  C 9   ? 0.5426 0.5554 0.6332 -0.0096 0.0088  -0.0256 6   DC  E "O4'" 
408  C  "C3'" . DC  C 9   ? 0.5114 0.5535 0.6028 -0.0165 0.0085  -0.0341 6   DC  E "C3'" 
409  O  "O3'" . DC  C 9   ? 0.4434 0.5600 0.5817 -0.0082 0.0074  -0.0408 6   DC  E "O3'" 
410  C  "C2'" . DC  C 9   ? 0.5244 0.5664 0.6163 -0.0144 0.0048  -0.0338 6   DC  E "C2'" 
411  C  "C1'" . DC  C 9   ? 0.5489 0.5853 0.6365 -0.0173 -0.0101 -0.0285 6   DC  E "C1'" 
412  N  N1    . DC  C 9   ? 0.5541 0.5992 0.6565 -0.0142 -0.0205 -0.0440 6   DC  E N1    
413  C  C2    . DC  C 9   ? 0.5646 0.6095 0.6611 -0.0095 -0.0272 -0.0375 6   DC  E C2    
414  O  O2    . DC  C 9   ? 0.5838 0.6044 0.6677 -0.0022 -0.0221 -0.0343 6   DC  E O2    
415  N  N3    . DC  C 9   ? 0.5578 0.6162 0.6764 -0.0132 -0.0338 -0.0425 6   DC  E N3    
416  C  C4    . DC  C 9   ? 0.5540 0.6097 0.6821 -0.0185 -0.0360 -0.0497 6   DC  E C4    
417  N  N4    . DC  C 9   ? 0.5570 0.5963 0.7179 -0.0074 -0.0303 -0.0634 6   DC  E N4    
418  C  C5    . DC  C 9   ? 0.5543 0.6015 0.6775 -0.0232 -0.0328 -0.0464 6   DC  E C5    
419  C  C6    . DC  C 9   ? 0.5459 0.5955 0.6691 -0.0236 -0.0286 -0.0383 6   DC  E C6    
420  P  P     . DC  C 10  ? 0.4544 0.5583 0.5720 -0.0226 -0.0032 -0.0558 7   DC  E P     
421  O  OP1   . DC  C 10  ? 0.4364 0.5563 0.5593 -0.0188 -0.0077 -0.0641 7   DC  E OP1   
422  O  OP2   . DC  C 10  ? 0.3877 0.5456 0.5694 -0.0211 0.0085  -0.0550 7   DC  E OP2   
423  O  "O5'" . DC  C 10  ? 0.4815 0.5907 0.5913 -0.0174 -0.0229 -0.0601 7   DC  E "O5'" 
424  C  "C5'" . DC  C 10  ? 0.5746 0.6342 0.6135 -0.0346 -0.0302 -0.0369 7   DC  E "C5'" 
425  C  "C4'" . DC  C 10  ? 0.6190 0.6811 0.6617 -0.0168 -0.0120 -0.0337 7   DC  E "C4'" 
426  O  "O4'" . DC  C 10  ? 0.6659 0.6983 0.6591 -0.0202 -0.0166 -0.0341 7   DC  E "O4'" 
427  C  "C3'" . DC  C 10  ? 0.6485 0.7009 0.6846 -0.0245 -0.0213 -0.0372 7   DC  E "C3'" 
428  O  "O3'" . DC  C 10  ? 0.6451 0.7131 0.7023 -0.0286 -0.0283 -0.0410 7   DC  E "O3'" 
429  C  "C2'" . DC  C 10  ? 0.6710 0.7156 0.6995 -0.0206 -0.0117 -0.0334 7   DC  E "C2'" 
430  C  "C1'" . DC  C 10  ? 0.6908 0.7186 0.6991 -0.0066 -0.0005 -0.0346 7   DC  E "C1'" 
431  N  N1    . DC  C 10  ? 0.7342 0.7199 0.7249 0.0011  0.0047  -0.0221 7   DC  E N1    
432  C  C2    . DC  C 10  ? 0.7471 0.7250 0.7335 0.0066  0.0076  -0.0223 7   DC  E C2    
433  O  O2    . DC  C 10  ? 0.7389 0.7297 0.7360 0.0040  -0.0006 -0.0186 7   DC  E O2    
434  N  N3    . DC  C 10  ? 0.7548 0.7287 0.7433 0.0147  0.0060  -0.0214 7   DC  E N3    
435  C  C4    . DC  C 10  ? 0.7556 0.7172 0.7385 0.0205  -0.0073 -0.0199 7   DC  E C4    
436  N  N4    . DC  C 10  ? 0.7522 0.7137 0.7271 0.0256  -0.0126 -0.0140 7   DC  E N4    
437  C  C5    . DC  C 10  ? 0.7546 0.7286 0.7345 0.0172  -0.0074 -0.0263 7   DC  E C5    
438  C  C6    . DC  C 10  ? 0.7492 0.7293 0.7255 0.0173  -0.0028 -0.0262 7   DC  E C6    
439  P  P     . DT  C 11  ? 0.6695 0.7292 0.6958 -0.0414 -0.0294 -0.0601 8   DT  E P     
440  O  OP1   . DT  C 11  ? 0.6398 0.7321 0.6811 -0.0368 -0.0540 -0.0587 8   DT  E OP1   
441  O  OP2   . DT  C 11  ? 0.6493 0.7159 0.6738 -0.0414 -0.0342 -0.0640 8   DT  E OP2   
442  O  "O5'" . DT  C 11  ? 0.6765 0.7621 0.7296 -0.0340 -0.0230 -0.0621 8   DT  E "O5'" 
443  C  "C5'" . DT  C 11  ? 0.7252 0.7924 0.7547 -0.0261 0.0144  -0.0355 8   DT  E "C5'" 
444  C  "C4'" . DT  C 11  ? 0.7562 0.8017 0.7755 -0.0150 0.0272  -0.0314 8   DT  E "C4'" 
445  O  "O4'" . DT  C 11  ? 0.7795 0.8100 0.7805 -0.0242 0.0301  -0.0293 8   DT  E "O4'" 
446  C  "C3'" . DT  C 11  ? 0.7591 0.8061 0.7867 -0.0072 0.0315  -0.0222 8   DT  E "C3'" 
447  O  "O3'" . DT  C 11  ? 0.7302 0.7866 0.7898 0.0071  0.0298  -0.0023 8   DT  E "O3'" 
448  C  "C2'" . DT  C 11  ? 0.7851 0.8127 0.7837 -0.0166 0.0361  -0.0217 8   DT  E "C2'" 
449  C  "C1'" . DT  C 11  ? 0.8064 0.8084 0.7947 -0.0210 0.0336  -0.0231 8   DT  E "C1'" 
450  N  N1    . DT  C 11  ? 0.8491 0.8127 0.8062 -0.0301 0.0335  -0.0158 8   DT  E N1    
451  C  C2    . DT  C 11  ? 0.8647 0.8330 0.8079 -0.0341 0.0284  -0.0129 8   DT  E C2    
452  O  O2    . DT  C 11  ? 0.8458 0.8404 0.8015 -0.0455 0.0220  -0.0035 8   DT  E O2    
453  N  N3    . DT  C 11  ? 0.8758 0.8318 0.8144 -0.0343 0.0237  -0.0104 8   DT  E N3    
454  C  C4    . DT  C 11  ? 0.8713 0.8245 0.8104 -0.0285 0.0144  -0.0065 8   DT  E C4    
455  O  O4    . DT  C 11  ? 0.8639 0.8249 0.8024 -0.0385 0.0011  -0.0101 8   DT  E O4    
456  C  C5    . DT  C 11  ? 0.8700 0.8240 0.8160 -0.0189 0.0199  -0.0104 8   DT  E C5    
457  C  C7    . DT  C 11  ? 0.8623 0.8214 0.8284 -0.0091 0.0280  -0.0054 8   DT  E C7    
458  C  C6    . DT  C 11  ? 0.8598 0.8179 0.8044 -0.0216 0.0240  -0.0127 8   DT  E C6    
459  P  P     . DT  C 12  ? 0.7155 0.7709 0.7988 0.0029  0.0340  -0.0090 9   DT  E P     
460  O  OP1   . DT  C 12  ? 0.7056 0.7478 0.8084 0.0071  0.0170  0.0192  9   DT  E OP1   
461  O  OP2   . DT  C 12  ? 0.6821 0.7674 0.7972 0.0028  0.0241  0.0021  9   DT  E OP2   
462  O  "O5'" . DT  C 12  ? 0.7254 0.7598 0.8001 0.0161  0.0219  -0.0037 9   DT  E "O5'" 
463  C  "C5'" . DT  C 12  ? 0.7509 0.7631 0.7944 0.0084  0.0153  0.0014  9   DT  E "C5'" 
464  C  "C4'" . DT  C 12  ? 0.7684 0.7524 0.7691 0.0033  0.0091  -0.0023 9   DT  E "C4'" 
465  O  "O4'" . DT  C 12  ? 0.8053 0.7491 0.7818 0.0035  -0.0023 -0.0008 9   DT  E "O4'" 
466  C  "C3'" . DT  C 12  ? 0.7619 0.7403 0.7493 -0.0086 0.0137  -0.0042 9   DT  E "C3'" 
467  O  "O3'" . DT  C 12  ? 0.7224 0.7083 0.7219 -0.0333 0.0106  0.0025  9   DT  E "O3'" 
468  C  "C2'" . DT  C 12  ? 0.7823 0.7598 0.7587 0.0018  0.0005  0.0014  9   DT  E "C2'" 
469  C  "C1'" . DT  C 12  ? 0.8087 0.7523 0.7587 0.0024  -0.0009 0.0013  9   DT  E "C1'" 
470  N  N1    . DT  C 12  ? 0.8304 0.7731 0.7382 0.0168  -0.0091 0.0093  9   DT  E N1    
471  C  C2    . DT  C 12  ? 0.8256 0.7767 0.7157 0.0305  -0.0270 0.0179  9   DT  E C2    
472  O  O2    . DT  C 12  ? 0.8181 0.7773 0.6670 0.0359  -0.0471 0.0263  9   DT  E O2    
473  N  N3    . DT  C 12  ? 0.8184 0.7976 0.7180 0.0444  -0.0312 0.0216  9   DT  E N3    
474  C  C4    . DT  C 12  ? 0.8255 0.7988 0.7358 0.0465  -0.0244 0.0212  9   DT  E C4    
475  O  O4    . DT  C 12  ? 0.8222 0.8313 0.7415 0.0570  -0.0293 0.0238  9   DT  E O4    
476  C  C5    . DT  C 12  ? 0.8333 0.7957 0.7474 0.0369  -0.0098 0.0150  9   DT  E C5    
477  C  C7    . DT  C 12  ? 0.8411 0.8072 0.7409 0.0363  -0.0035 0.0011  9   DT  E C7    
478  C  C6    . DT  C 12  ? 0.8368 0.7846 0.7522 0.0263  -0.0014 0.0071  9   DT  E C6    
479  P  P     . DA  C 13  ? 0.6956 0.6642 0.6990 -0.0632 0.0118  0.0080  10  DA  E P     
480  O  OP1   . DA  C 13  ? 0.7225 0.6566 0.6929 -0.0846 0.0100  -0.0120 10  DA  E OP1   
481  O  OP2   . DA  C 13  ? 0.6871 0.6610 0.6906 -0.0619 0.0239  -0.0071 10  DA  E OP2   
482  O  "O5'" . DA  C 13  ? 0.6866 0.6541 0.6948 -0.0420 0.0188  0.0067  10  DA  E "O5'" 
483  C  "C5'" . DA  C 13  ? 0.6663 0.6289 0.6323 -0.0417 -0.0050 0.0122  10  DA  E "C5'" 
484  C  "C4'" . DA  C 13  ? 0.6305 0.6051 0.5717 -0.0226 -0.0074 0.0112  10  DA  E "C4'" 
485  O  "O4'" . DA  C 13  ? 0.6201 0.5897 0.5673 -0.0008 -0.0200 0.0118  10  DA  E "O4'" 
486  C  "C3'" . DA  C 13  ? 0.6096 0.5947 0.5465 -0.0336 0.0048  0.0025  10  DA  E "C3'" 
487  O  "O3'" . DA  C 13  ? 0.6228 0.5949 0.4724 -0.0476 0.0153  -0.0005 10  DA  E "O3'" 
488  C  "C2'" . DA  C 13  ? 0.5986 0.5886 0.5368 -0.0212 -0.0105 -0.0104 10  DA  E "C2'" 
489  C  "C1'" . DA  C 13  ? 0.5865 0.5750 0.5319 -0.0013 -0.0309 -0.0122 10  DA  E "C1'" 
490  N  N9    . DA  C 13  ? 0.5324 0.5506 0.5196 0.0086  -0.0577 -0.0071 10  DA  E N9    
491  C  C8    . DA  C 13  ? 0.5369 0.5573 0.5078 0.0117  -0.0608 -0.0144 10  DA  E C8    
492  N  N7    . DA  C 13  ? 0.5207 0.5374 0.4818 0.0089  -0.0951 -0.0340 10  DA  E N7    
493  C  C5    . DA  C 13  ? 0.4844 0.5337 0.4781 0.0179  -0.1007 -0.0159 10  DA  E C5    
494  C  C6    . DA  C 13  ? 0.4623 0.5247 0.4851 0.0304  -0.0992 -0.0238 10  DA  E C6    
495  N  N6    . DA  C 13  ? 0.4377 0.5140 0.4770 0.0375  -0.1124 -0.0265 10  DA  E N6    
496  N  N1    . DA  C 13  ? 0.4724 0.5272 0.5219 0.0331  -0.0979 -0.0252 10  DA  E N1    
497  C  C2    . DA  C 13  ? 0.4715 0.5208 0.4828 0.0329  -0.0949 -0.0162 10  DA  E C2    
498  N  N3    . DA  C 13  ? 0.5011 0.5175 0.4581 0.0271  -0.0962 -0.0145 10  DA  E N3    
499  C  C4    . DA  C 13  ? 0.5019 0.5316 0.4899 0.0198  -0.0857 -0.0132 10  DA  E C4    
500  P  P     . DG  C 14  ? 0.6344 0.5819 0.4628 -0.0683 0.0245  0.0073  11  DG  E P     
501  O  OP1   . DG  C 14  ? 0.6427 0.5774 0.4471 -0.0825 0.0245  0.0124  11  DG  E OP1   
502  O  OP2   . DG  C 14  ? 0.6569 0.5770 0.4433 -0.0761 0.0092  0.0219  11  DG  E OP2   
503  O  "O5'" . DG  C 14  ? 0.5840 0.5494 0.4408 -0.0639 0.0095  0.0032  11  DG  E "O5'" 
504  C  "C5'" . DG  C 14  ? 0.5333 0.5226 0.4009 -0.0439 0.0136  0.0026  11  DG  E "C5'" 
505  C  "C4'" . DG  C 14  ? 0.4704 0.5143 0.3776 -0.0271 -0.0217 -0.0040 11  DG  E "C4'" 
506  O  "O4'" . DG  C 14  ? 0.4557 0.5130 0.3601 -0.0375 -0.0246 0.0077  11  DG  E "O4'" 
507  C  "C3'" . DG  C 14  ? 0.4526 0.4909 0.3644 -0.0310 -0.0278 -0.0008 11  DG  E "C3'" 
508  O  "O3'" . DG  C 14  ? 0.4381 0.4700 0.3508 -0.0250 -0.0386 -0.0048 11  DG  E "O3'" 
509  C  "C2'" . DG  C 14  ? 0.4197 0.4830 0.3447 -0.0201 -0.0407 0.0150  11  DG  E "C2'" 
510  C  "C1'" . DG  C 14  ? 0.4096 0.4732 0.3526 -0.0221 -0.0483 0.0210  11  DG  E "C1'" 
511  N  N9    . DG  C 14  ? 0.3609 0.4451 0.3334 -0.0151 -0.0679 0.0373  11  DG  E N9    
512  C  C8    . DG  C 14  ? 0.3461 0.4355 0.3445 0.0003  -0.0729 0.0317  11  DG  E C8    
513  N  N7    . DG  C 14  ? 0.3338 0.4154 0.3334 -0.0051 -0.0878 0.0355  11  DG  E N7    
514  C  C5    . DG  C 14  ? 0.2992 0.4160 0.3446 0.0069  -0.0893 0.0449  11  DG  E C5    
515  C  C6    . DG  C 14  ? 0.2472 0.4078 0.3575 0.0124  -0.1034 0.0508  11  DG  E C6    
516  O  O6    . DG  C 14  ? 0.2548 0.4045 0.3929 0.0401  -0.1157 0.0590  11  DG  E O6    
517  N  N1    . DG  C 14  ? 0.1644 0.3964 0.3732 0.0268  -0.1250 0.0567  11  DG  E N1    
518  C  C2    . DG  C 14  ? 0.1807 0.3807 0.3653 0.0399  -0.0941 0.0654  11  DG  E C2    
519  N  N2    . DG  C 14  ? 0.1456 0.4027 0.3276 0.0568  -0.0632 0.0533  11  DG  E N2    
520  N  N3    . DG  C 14  ? 0.2343 0.4103 0.3476 0.0243  -0.0812 0.0670  11  DG  E N3    
521  C  C4    . DG  C 14  ? 0.3073 0.4102 0.3431 0.0024  -0.0794 0.0523  11  DG  E C4    
522  P  P     . DC  C 15  ? 0.4031 0.4896 0.3546 -0.0125 -0.0325 -0.0427 12  DC  E P     
523  O  OP1   . DC  C 15  ? 0.4183 0.4389 0.3258 0.0133  -0.0102 -0.0360 12  DC  E OP1   
524  O  OP2   . DC  C 15  ? 0.4504 0.4929 0.3421 -0.0281 -0.0388 -0.0453 12  DC  E OP2   
525  O  "O5'" . DC  C 15  ? 0.4232 0.4446 0.3411 -0.0118 -0.0674 -0.0288 12  DC  E "O5'" 
526  C  "C5'" . DC  C 15  ? 0.4272 0.4259 0.3088 0.0178  -0.0980 -0.0028 12  DC  E "C5'" 
527  C  "C4'" . DC  C 15  ? 0.4201 0.4250 0.3091 0.0257  -0.1040 0.0331  12  DC  E "C4'" 
528  O  "O4'" . DC  C 15  ? 0.3996 0.4094 0.3230 0.0170  -0.1463 0.0451  12  DC  E "O4'" 
529  C  "C3'" . DC  C 15  ? 0.4131 0.4191 0.3062 0.0119  -0.1149 0.0270  12  DC  E "C3'" 
530  O  "O3'" . DC  C 15  ? 0.4320 0.4381 0.2590 0.0126  -0.0788 0.0228  12  DC  E "O3'" 
531  C  "C2'" . DC  C 15  ? 0.3962 0.3995 0.3038 0.0078  -0.1404 0.0296  12  DC  E "C2'" 
532  C  "C1'" . DC  C 15  ? 0.3736 0.4053 0.3279 0.0092  -0.1465 0.0229  12  DC  E "C1'" 
533  N  N1    . DC  C 15  ? 0.3594 0.4167 0.3510 -0.0033 -0.1661 0.0414  12  DC  E N1    
534  C  C2    . DC  C 15  ? 0.3361 0.3990 0.3647 -0.0108 -0.1915 0.0353  12  DC  E C2    
535  O  O2    . DC  C 15  ? 0.3191 0.4140 0.3476 -0.0040 -0.2142 0.0373  12  DC  E O2    
536  N  N3    . DC  C 15  ? 0.3091 0.3951 0.3697 -0.0193 -0.2159 0.0675  12  DC  E N3    
537  C  C4    . DC  C 15  ? 0.3311 0.3945 0.3739 -0.0297 -0.2162 0.0409  12  DC  E C4    
538  N  N4    . DC  C 15  ? 0.2959 0.4110 0.4121 -0.0761 -0.2431 0.0291  12  DC  E N4    
539  C  C5    . DC  C 15  ? 0.3401 0.4056 0.3496 -0.0183 -0.2136 0.0430  12  DC  E C5    
540  C  C6    . DC  C 15  ? 0.3592 0.4009 0.3396 -0.0038 -0.1930 0.0508  12  DC  E C6    
541  P  P     . DC  C 16  ? 0.4355 0.4478 0.2092 -0.0129 -0.0486 0.0227  13  DC  E P     
542  O  OP1   . DC  C 16  ? 0.4511 0.4571 0.1834 -0.0381 -0.0350 -0.0100 13  DC  E OP1   
543  O  OP2   . DC  C 16  ? 0.4272 0.4290 0.2392 -0.0242 -0.0524 0.0415  13  DC  E OP2   
544  O  "O5'" . DC  C 16  ? 0.3975 0.4431 0.2052 -0.0311 -0.0602 0.0064  13  DC  E "O5'" 
545  C  "C5'" . DC  C 16  ? 0.3112 0.3715 0.1619 -0.0236 -0.1176 0.0221  13  DC  E "C5'" 
546  C  "C4'" . DC  C 16  ? 0.2476 0.3253 0.2038 -0.0278 -0.0972 0.0115  13  DC  E "C4'" 
547  O  "O4'" . DC  C 16  ? 0.2282 0.3362 0.2410 -0.0109 -0.1044 0.0345  13  DC  E "O4'" 
548  C  "C3'" . DC  C 16  ? 0.2333 0.3238 0.1624 -0.0310 -0.1304 0.0305  13  DC  E "C3'" 
549  O  "O3'" . DC  C 16  ? 0.2378 0.3467 0.1242 -0.0409 -0.1369 -0.0038 13  DC  E "O3'" 
550  C  "C2'" . DC  C 16  ? 0.1767 0.3287 0.1615 -0.0303 -0.1419 0.0411  13  DC  E "C2'" 
551  C  "C1'" . DC  C 16  ? 0.2125 0.3204 0.2498 -0.0321 -0.0796 0.0384  13  DC  E "C1'" 
552  N  N1    . DC  C 16  ? 0.1943 0.3294 0.2622 -0.0473 -0.0513 0.0362  13  DC  E N1    
553  C  C2    . DC  C 16  ? 0.1594 0.3131 0.2740 -0.0361 -0.0380 0.0562  13  DC  E C2    
554  O  O2    . DC  C 16  ? 0.1760 0.3285 0.2589 -0.0465 -0.0556 0.0684  13  DC  E O2    
555  N  N3    . DC  C 16  ? 0.1110 0.3224 0.2480 -0.0253 -0.0414 0.0828  13  DC  E N3    
556  C  C4    . DC  C 16  ? 0.1344 0.3032 0.2376 -0.0331 -0.0352 0.0764  13  DC  E C4    
557  N  N4    . DC  C 16  ? 0.1122 0.2787 0.2365 -0.0227 -0.0400 0.0845  13  DC  E N4    
558  C  C5    . DC  C 16  ? 0.1254 0.2990 0.2240 -0.0447 -0.0342 0.0540  13  DC  E C5    
559  C  C6    . DC  C 16  ? 0.1510 0.3191 0.2478 -0.0362 -0.0495 0.0570  13  DC  E C6    
560  O  "O5'" . DG  D 1   ? 0.2887 0.4375 0.4754 -0.0241 -0.0063 -0.0107 5   DG  F "O5'" 
561  C  "C5'" . DG  D 1   ? 0.3012 0.4230 0.4859 -0.0162 -0.0208 -0.0106 5   DG  F "C5'" 
562  C  "C4'" . DG  D 1   ? 0.3032 0.4112 0.4726 -0.0116 -0.0428 -0.0130 5   DG  F "C4'" 
563  O  "O4'" . DG  D 1   ? 0.2738 0.4086 0.4427 -0.0147 -0.0587 -0.0213 5   DG  F "O4'" 
564  C  "C3'" . DG  D 1   ? 0.3191 0.3961 0.4874 -0.0177 -0.0487 -0.0189 5   DG  F "C3'" 
565  O  "O3'" . DG  D 1   ? 0.3098 0.3758 0.5161 -0.0227 -0.0564 -0.0056 5   DG  F "O3'" 
566  C  "C2'" . DG  D 1   ? 0.2900 0.3995 0.4274 -0.0151 -0.0713 -0.0146 5   DG  F "C2'" 
567  C  "C1'" . DG  D 1   ? 0.2711 0.3952 0.4013 -0.0142 -0.0538 -0.0226 5   DG  F "C1'" 
568  N  N9    . DG  D 1   ? 0.2332 0.3823 0.3573 -0.0112 -0.0820 -0.0234 5   DG  F N9    
569  C  C8    . DG  D 1   ? 0.2060 0.3818 0.3138 0.0028  -0.0981 -0.0320 5   DG  F C8    
570  N  N7    . DG  D 1   ? 0.2003 0.3531 0.2753 0.0123  -0.1100 -0.0323 5   DG  F N7    
571  C  C5    . DG  D 1   ? 0.2095 0.3665 0.3018 -0.0071 -0.0845 -0.0346 5   DG  F C5    
572  C  C6    . DG  D 1   ? 0.2143 0.3720 0.2835 -0.0350 -0.0871 -0.0437 5   DG  F C6    
573  O  O6    . DG  D 1   ? 0.1793 0.3334 0.2936 -0.0395 -0.1009 -0.0802 5   DG  F O6    
574  N  N1    . DG  D 1   ? 0.2039 0.3839 0.3057 -0.0411 -0.0835 -0.0347 5   DG  F N1    
575  C  C2    . DG  D 1   ? 0.1991 0.3719 0.3368 -0.0174 -0.0648 -0.0113 5   DG  F C2    
576  N  N2    . DG  D 1   ? 0.1734 0.3835 0.3424 -0.0078 -0.0747 0.0211  5   DG  F N2    
577  N  N3    . DG  D 1   ? 0.1856 0.3717 0.3200 -0.0119 -0.0534 -0.0439 5   DG  F N3    
578  C  C4    . DG  D 1   ? 0.2016 0.3673 0.3307 -0.0070 -0.0698 -0.0354 5   DG  F C4    
579  P  P     . DG  D 2   ? 0.3015 0.3650 0.5618 -0.0468 -0.0498 -0.0204 6   DG  F P     
580  O  OP1   . DG  D 2   ? 0.2736 0.3665 0.5353 -0.0445 -0.0799 -0.0121 6   DG  F OP1   
581  O  OP2   . DG  D 2   ? 0.2355 0.3951 0.5769 -0.0425 -0.0931 0.0068  6   DG  F OP2   
582  O  "O5'" . DG  D 2   ? 0.2856 0.3918 0.5379 -0.0319 -0.0733 -0.0227 6   DG  F "O5'" 
583  C  "C5'" . DG  D 2   ? 0.2521 0.3774 0.5013 -0.0274 -0.0724 -0.0230 6   DG  F "C5'" 
584  C  "C4'" . DG  D 2   ? 0.2171 0.3654 0.4380 -0.0182 -0.0960 -0.0120 6   DG  F "C4'" 
585  O  "O4'" . DG  D 2   ? 0.1950 0.3305 0.3811 0.0004  -0.1155 -0.0095 6   DG  F "O4'" 
586  C  "C3'" . DG  D 2   ? 0.2146 0.3615 0.4375 -0.0328 -0.0966 -0.0243 6   DG  F "C3'" 
587  O  "O3'" . DG  D 2   ? 0.1991 0.3586 0.4711 -0.0319 -0.1007 -0.0195 6   DG  F "O3'" 
588  C  "C2'" . DG  D 2   ? 0.2000 0.3431 0.4042 -0.0311 -0.1072 -0.0366 6   DG  F "C2'" 
589  C  "C1'" . DG  D 2   ? 0.2236 0.3430 0.4038 -0.0230 -0.0963 -0.0389 6   DG  F "C1'" 
590  N  N9    . DG  D 2   ? 0.2352 0.3629 0.4223 -0.0268 -0.0916 -0.0257 6   DG  F N9    
591  C  C8    . DG  D 2   ? 0.2258 0.3545 0.3885 -0.0120 -0.1094 -0.0188 6   DG  F C8    
592  N  N7    . DG  D 2   ? 0.2485 0.3818 0.4179 0.0041  -0.1041 0.0097  6   DG  F N7    
593  C  C5    . DG  D 2   ? 0.2557 0.3830 0.4348 -0.0168 -0.0929 -0.0009 6   DG  F C5    
594  C  C6    . DG  D 2   ? 0.2459 0.3951 0.4169 -0.0203 -0.1042 0.0064  6   DG  F C6    
595  O  O6    . DG  D 2   ? 0.2620 0.4426 0.4250 -0.0383 -0.1098 0.0124  6   DG  F O6    
596  N  N1    . DG  D 2   ? 0.1684 0.3828 0.4139 0.0145  -0.1460 0.0141  6   DG  F N1    
597  C  C2    . DG  D 2   ? 0.1681 0.3561 0.4444 0.0243  -0.1280 0.0117  6   DG  F C2    
598  N  N2    . DG  D 2   ? 0.0936 0.3531 0.4658 0.0395  -0.1589 0.0226  6   DG  F N2    
599  N  N3    . DG  D 2   ? 0.2155 0.3810 0.4582 0.0107  -0.0957 -0.0020 6   DG  F N3    
600  C  C4    . DG  D 2   ? 0.2388 0.3793 0.4413 -0.0149 -0.0796 -0.0124 6   DG  F C4    
601  P  P     . DC  D 3   ? 0.1897 0.3645 0.5028 -0.0494 -0.0539 -0.0186 7   DC  F P     
602  O  OP1   . DC  D 3   ? 0.2449 0.3837 0.4568 -0.0185 -0.0479 -0.0239 7   DC  F OP1   
603  O  OP2   . DC  D 3   ? 0.1078 0.3249 0.5012 -0.0701 -0.0730 -0.0258 7   DC  F OP2   
604  O  "O5'" . DC  D 3   ? 0.1662 0.3665 0.4660 -0.0436 -0.0835 -0.0234 7   DC  F "O5'" 
605  C  "C5'" . DC  D 3   ? 0.1559 0.3459 0.4378 -0.0491 -0.0970 -0.0118 7   DC  F "C5'" 
606  C  "C4'" . DC  D 3   ? 0.1904 0.3367 0.4222 -0.0416 -0.1047 -0.0012 7   DC  F "C4'" 
607  O  "O4'" . DC  D 3   ? 0.2041 0.3391 0.4007 -0.0546 -0.1021 -0.0202 7   DC  F "O4'" 
608  C  "C3'" . DC  D 3   ? 0.2119 0.3494 0.4259 -0.0381 -0.1128 0.0085  7   DC  F "C3'" 
609  O  "O3'" . DC  D 3   ? 0.2233 0.3755 0.4674 -0.0430 -0.1017 0.0259  7   DC  F "O3'" 
610  C  "C2'" . DC  D 3   ? 0.2150 0.3393 0.4192 -0.0399 -0.1095 0.0070  7   DC  F "C2'" 
611  C  "C1'" . DC  D 3   ? 0.2021 0.3391 0.3870 -0.0463 -0.1118 -0.0039 7   DC  F "C1'" 
612  N  N1    . DC  D 3   ? 0.2140 0.3477 0.3502 -0.0558 -0.1086 -0.0109 7   DC  F N1    
613  C  C2    . DC  D 3   ? 0.2418 0.3229 0.3377 -0.0665 -0.1041 -0.0235 7   DC  F C2    
614  O  O2    . DC  D 3   ? 0.2402 0.3303 0.3570 -0.0964 -0.0855 -0.0502 7   DC  F O2    
615  N  N3    . DC  D 3   ? 0.2859 0.3493 0.2533 -0.0617 -0.1236 -0.0161 7   DC  F N3    
616  C  C4    . DC  D 3   ? 0.3092 0.3580 0.2833 -0.0745 -0.1095 -0.0048 7   DC  F C4    
617  N  N4    . DC  D 3   ? 0.3071 0.3930 0.2351 -0.0748 -0.0915 0.0012  7   DC  F N4    
618  C  C5    . DC  D 3   ? 0.2659 0.3552 0.3034 -0.0689 -0.0929 -0.0185 7   DC  F C5    
619  C  C6    . DC  D 3   ? 0.1995 0.3420 0.3121 -0.0634 -0.0993 -0.0258 7   DC  F C6    
620  P  P     . DT  D 4   ? 0.1801 0.3620 0.4512 -0.0330 -0.0775 0.0089  8   DT  F P     
621  O  OP1   . DT  D 4   ? 0.1862 0.3446 0.4748 -0.0213 -0.0812 -0.0023 8   DT  F OP1   
622  O  OP2   . DT  D 4   ? 0.2394 0.3312 0.4486 -0.0471 -0.0806 0.0148  8   DT  F OP2   
623  O  "O5'" . DT  D 4   ? 0.2312 0.3553 0.4618 -0.0102 -0.0639 -0.0004 8   DT  F "O5'" 
624  C  "C5'" . DT  D 4   ? 0.2625 0.3618 0.4562 0.0048  -0.0537 -0.0108 8   DT  F "C5'" 
625  C  "C4'" . DT  D 4   ? 0.2594 0.3654 0.4413 0.0115  -0.0491 -0.0366 8   DT  F "C4'" 
626  O  "O4'" . DT  D 4   ? 0.2218 0.3838 0.4318 -0.0008 -0.0499 -0.0417 8   DT  F "O4'" 
627  C  "C3'" . DT  D 4   ? 0.2643 0.3823 0.4440 0.0093  -0.0624 -0.0393 8   DT  F "C3'" 
628  O  "O3'" . DT  D 4   ? 0.3371 0.4281 0.4739 0.0151  -0.0579 -0.0463 8   DT  F "O3'" 
629  C  "C2'" . DT  D 4   ? 0.2493 0.3636 0.4275 0.0111  -0.0661 -0.0481 8   DT  F "C2'" 
630  C  "C1'" . DT  D 4   ? 0.2415 0.3595 0.4274 0.0162  -0.0622 -0.0436 8   DT  F "C1'" 
631  N  N1    . DT  D 4   ? 0.2654 0.3612 0.4127 0.0108  -0.0694 -0.0554 8   DT  F N1    
632  C  C2    . DT  D 4   ? 0.2898 0.3553 0.4153 0.0092  -0.0622 -0.0655 8   DT  F C2    
633  O  O2    . DT  D 4   ? 0.3241 0.3188 0.4076 -0.0052 -0.0753 -0.0836 8   DT  F O2    
634  N  N3    . DT  D 4   ? 0.3063 0.3501 0.3826 0.0000  -0.0748 -0.0566 8   DT  F N3    
635  C  C4    . DT  D 4   ? 0.2960 0.3637 0.3536 -0.0014 -0.0707 -0.0549 8   DT  F C4    
636  O  O4    . DT  D 4   ? 0.3240 0.3625 0.3104 0.0028  -0.0606 -0.0490 8   DT  F O4    
637  C  C5    . DT  D 4   ? 0.2839 0.3803 0.3812 -0.0005 -0.0653 -0.0632 8   DT  F C5    
638  C  C7    . DT  D 4   ? 0.2314 0.3441 0.3925 0.0057  -0.0859 -0.0785 8   DT  F C7    
639  C  C6    . DT  D 4   ? 0.2557 0.3734 0.3837 -0.0039 -0.0696 -0.0777 8   DT  F C6    
640  P  P     . DA  D 5   ? 0.4095 0.4538 0.4958 0.0167  -0.0782 -0.0653 9   DA  F P     
641  O  OP1   . DA  D 5   ? 0.4163 0.4634 0.5077 -0.0012 -0.0906 -0.0597 9   DA  F OP1   
642  O  OP2   . DA  D 5   ? 0.4063 0.4643 0.5096 0.0111  -0.0822 -0.0493 9   DA  F OP2   
643  O  "O5'" . DA  D 5   ? 0.4261 0.4984 0.5080 0.0204  -0.0702 -0.0612 9   DA  F "O5'" 
644  C  "C5'" . DA  D 5   ? 0.4303 0.5264 0.5114 0.0414  -0.0708 -0.0734 9   DA  F "C5'" 
645  C  "C4'" . DA  D 5   ? 0.4525 0.5625 0.5069 0.0548  -0.0592 -0.0786 9   DA  F "C4'" 
646  O  "O4'" . DA  D 5   ? 0.4098 0.5575 0.4473 0.0725  -0.0836 -0.0959 9   DA  F "O4'" 
647  C  "C3'" . DA  D 5   ? 0.4945 0.5901 0.5337 0.0500  -0.0656 -0.0675 9   DA  F "C3'" 
648  O  "O3'" . DA  D 5   ? 0.5705 0.6215 0.5906 0.0512  -0.0274 -0.0645 9   DA  F "O3'" 
649  C  "C2'" . DA  D 5   ? 0.4692 0.5873 0.4980 0.0477  -0.0646 -0.0826 9   DA  F "C2'" 
650  C  "C1'" . DA  D 5   ? 0.4537 0.5824 0.4655 0.0580  -0.0921 -0.0748 9   DA  F "C1'" 
651  N  N9    . DA  D 5   ? 0.4487 0.5934 0.4468 0.0391  -0.1319 -0.0723 9   DA  F N9    
652  C  C8    . DA  D 5   ? 0.4316 0.5977 0.4532 0.0448  -0.1383 -0.0687 9   DA  F C8    
653  N  N7    . DA  D 5   ? 0.4235 0.6038 0.4571 0.0536  -0.1483 -0.0585 9   DA  F N7    
654  C  C5    . DA  D 5   ? 0.4473 0.6101 0.4543 0.0501  -0.1495 -0.0529 9   DA  F C5    
655  C  C6    . DA  D 5   ? 0.4385 0.6172 0.4443 0.0613  -0.1671 -0.0412 9   DA  F C6    
656  N  N6    . DA  D 5   ? 0.4609 0.6263 0.3955 0.0548  -0.2260 -0.0410 9   DA  F N6    
657  N  N1    . DA  D 5   ? 0.4010 0.6201 0.4478 0.0717  -0.1747 -0.0421 9   DA  F N1    
658  C  C2    . DA  D 5   ? 0.4260 0.6253 0.4526 0.0527  -0.1737 -0.0490 9   DA  F C2    
659  N  N3    . DA  D 5   ? 0.4093 0.6295 0.4629 0.0488  -0.1621 -0.0518 9   DA  F N3    
660  C  C4    . DA  D 5   ? 0.4332 0.6117 0.4493 0.0403  -0.1424 -0.0605 9   DA  F C4    
661  P  P     . DC  D 6   ? 0.6324 0.6614 0.6238 0.0361  -0.0190 -0.0607 10  DC  F P     
662  O  OP1   . DC  D 6   ? 0.6472 0.6726 0.6438 0.0429  -0.0066 -0.0563 10  DC  F OP1   
663  O  OP2   . DC  D 6   ? 0.6152 0.6683 0.6392 0.0326  -0.0094 -0.0643 10  DC  F OP2   
664  O  "O5'" . DC  D 6   ? 0.6463 0.6796 0.6364 0.0380  -0.0039 -0.0467 10  DC  F "O5'" 
665  C  "C5'" . DC  D 6   ? 0.6736 0.7000 0.6367 0.0312  -0.0202 -0.0220 10  DC  F "C5'" 
666  C  "C4'" . DC  D 6   ? 0.6891 0.7093 0.6326 0.0231  -0.0291 -0.0099 10  DC  F "C4'" 
667  O  "O4'" . DC  D 6   ? 0.6843 0.7158 0.6169 0.0310  -0.0449 0.0012  10  DC  F "O4'" 
668  C  "C3'" . DC  D 6   ? 0.7102 0.7108 0.6367 0.0197  -0.0182 -0.0091 10  DC  F "C3'" 
669  O  "O3'" . DC  D 6   ? 0.7378 0.7045 0.6558 0.0066  0.0043  -0.0080 10  DC  F "O3'" 
670  C  "C2'" . DC  D 6   ? 0.6939 0.7164 0.6129 0.0234  -0.0436 -0.0032 10  DC  F "C2'" 
671  C  "C1'" . DC  D 6   ? 0.6647 0.7235 0.6033 0.0321  -0.0609 0.0036  10  DC  F "C1'" 
672  N  N1    . DC  D 6   ? 0.6207 0.7422 0.5498 0.0481  -0.0949 0.0077  10  DC  F N1    
673  C  C2    . DC  D 6   ? 0.5928 0.7535 0.5307 0.0527  -0.1182 0.0144  10  DC  F C2    
674  O  O2    . DC  D 6   ? 0.5554 0.7694 0.4610 0.0549  -0.1565 -0.0068 10  DC  F O2    
675  N  N3    . DC  D 6   ? 0.5806 0.7592 0.5562 0.0717  -0.1259 0.0287  10  DC  F N3    
676  C  C4    . DC  D 6   ? 0.5966 0.7528 0.5513 0.0704  -0.1203 0.0290  10  DC  F C4    
677  N  N4    . DC  D 6   ? 0.6090 0.7450 0.5124 0.0789  -0.1523 0.0329  10  DC  F N4    
678  C  C5    . DC  D 6   ? 0.6015 0.7475 0.5717 0.0676  -0.1141 0.0244  10  DC  F C5    
679  C  C6    . DC  D 6   ? 0.6122 0.7434 0.5685 0.0489  -0.1030 0.0172  10  DC  F C6    
680  P  P     . DA  D 7   ? 0.7574 0.7043 0.6680 -0.0054 0.0297  0.0014  11  DA  F P     
681  O  OP1   . DA  D 7   ? 0.7430 0.6842 0.6590 -0.0017 0.0304  -0.0041 11  DA  F OP1   
682  O  OP2   . DA  D 7   ? 0.7317 0.6925 0.6244 0.0038  0.0224  -0.0163 11  DA  F OP2   
683  O  "O5'" . DA  D 7   ? 0.7298 0.7001 0.6611 0.0035  0.0275  -0.0038 11  DA  F "O5'" 
684  C  "C5'" . DA  D 7   ? 0.6903 0.6902 0.6430 0.0177  0.0066  0.0015  11  DA  F "C5'" 
685  C  "C4'" . DA  D 7   ? 0.6417 0.6920 0.6277 0.0205  -0.0017 -0.0054 11  DA  F "C4'" 
686  O  "O4'" . DA  D 7   ? 0.6170 0.6867 0.6050 0.0262  -0.0221 -0.0023 11  DA  F "O4'" 
687  C  "C3'" . DA  D 7   ? 0.6306 0.6783 0.6138 0.0253  -0.0061 -0.0081 11  DA  F "C3'" 
688  O  "O3'" . DA  D 7   ? 0.6418 0.6590 0.6155 0.0100  0.0091  -0.0138 11  DA  F "O3'" 
689  C  "C2'" . DA  D 7   ? 0.6245 0.6904 0.6021 0.0201  -0.0253 0.0016  11  DA  F "C2'" 
690  C  "C1'" . DA  D 7   ? 0.6046 0.6855 0.6025 0.0387  -0.0340 0.0081  11  DA  F "C1'" 
691  N  N9    . DA  D 7   ? 0.5445 0.6821 0.5935 0.0559  -0.0670 0.0213  11  DA  F N9    
692  C  C8    . DA  D 7   ? 0.5290 0.6812 0.5801 0.0627  -0.0776 0.0323  11  DA  F C8    
693  N  N7    . DA  D 7   ? 0.5242 0.6773 0.5631 0.0666  -0.0871 0.0372  11  DA  F N7    
694  C  C5    . DA  D 7   ? 0.5164 0.6768 0.5801 0.0709  -0.0807 0.0330  11  DA  F C5    
695  C  C6    . DA  D 7   ? 0.5084 0.6773 0.6004 0.0816  -0.0752 0.0377  11  DA  F C6    
696  N  N6    . DA  D 7   ? 0.4916 0.6741 0.6296 0.0918  -0.0706 0.0495  11  DA  F N6    
697  N  N1    . DA  D 7   ? 0.4972 0.6711 0.6073 0.0947  -0.0712 0.0396  11  DA  F N1    
698  C  C2    . DA  D 7   ? 0.5037 0.6845 0.5923 0.0843  -0.0762 0.0320  11  DA  F C2    
699  N  N3    . DA  D 7   ? 0.5091 0.6862 0.5939 0.0747  -0.0752 0.0241  11  DA  F N3    
700  C  C4    . DA  D 7   ? 0.5230 0.6836 0.5841 0.0674  -0.0763 0.0265  11  DA  F C4    
701  P  P     . DG  D 8   ? 0.6508 0.6448 0.6330 0.0059  0.0199  -0.0049 12  DG  F P     
702  O  OP1   . DG  D 8   ? 0.6541 0.6463 0.6255 0.0024  0.0153  -0.0091 12  DG  F OP1   
703  O  OP2   . DG  D 8   ? 0.6396 0.6491 0.6289 0.0062  0.0189  -0.0043 12  DG  F OP2   
704  O  "O5'" . DG  D 8   ? 0.6301 0.6261 0.6164 0.0024  0.0250  -0.0089 12  DG  F "O5'" 
705  C  "C5'" . DG  D 8   ? 0.6061 0.5991 0.5915 -0.0057 0.0295  -0.0225 12  DG  F "C5'" 
706  C  "C4'" . DG  D 8   ? 0.5751 0.5848 0.5529 -0.0159 0.0353  -0.0191 12  DG  F "C4'" 
707  O  "O4'" . DG  D 8   ? 0.5619 0.5696 0.5479 -0.0218 0.0336  -0.0222 12  DG  F "O4'" 
708  C  "C3'" . DG  D 8   ? 0.5714 0.5675 0.5306 -0.0170 0.0318  -0.0174 12  DG  F "C3'" 
709  O  "O3'" . DG  D 8   ? 0.5608 0.5675 0.5164 -0.0165 0.0500  -0.0270 12  DG  F "O3'" 
710  C  "C2'" . DG  D 8   ? 0.5680 0.5613 0.5235 -0.0211 0.0291  -0.0160 12  DG  F "C2'" 
711  C  "C1'" . DG  D 8   ? 0.5630 0.5459 0.5063 -0.0263 0.0317  -0.0229 12  DG  F "C1'" 
712  N  N9    . DG  D 8   ? 0.5474 0.5234 0.4697 -0.0227 0.0252  -0.0317 12  DG  F N9    
713  C  C8    . DG  D 8   ? 0.5418 0.5204 0.4542 -0.0257 0.0240  -0.0249 12  DG  F C8    
714  N  N7    . DG  D 8   ? 0.5160 0.5068 0.4397 -0.0174 0.0123  -0.0236 12  DG  F N7    
715  C  C5    . DG  D 8   ? 0.5204 0.5024 0.4400 -0.0214 0.0122  -0.0224 12  DG  F C5    
716  C  C6    . DG  D 8   ? 0.5205 0.4971 0.4321 -0.0241 0.0077  -0.0093 12  DG  F C6    
717  O  O6    . DG  D 8   ? 0.5158 0.5033 0.4418 -0.0213 0.0034  0.0054  12  DG  F O6    
718  N  N1    . DG  D 8   ? 0.5261 0.4935 0.4236 -0.0273 0.0140  -0.0228 12  DG  F N1    
719  C  C2    . DG  D 8   ? 0.5333 0.4846 0.4239 -0.0320 0.0135  -0.0330 12  DG  F C2    
720  N  N2    . DG  D 8   ? 0.5215 0.4792 0.4388 -0.0208 0.0289  -0.0367 12  DG  F N2    
721  N  N3    . DG  D 8   ? 0.5270 0.5023 0.4565 -0.0303 0.0196  -0.0210 12  DG  F N3    
722  C  C4    . DG  D 8   ? 0.5285 0.5053 0.4590 -0.0253 0.0202  -0.0249 12  DG  F C4    
723  N  N     . SER E 1   ? 0.9878 0.9117 0.9344 -0.0190 0.0234  0.0053  0   SER A N     
724  C  CA    . SER E 1   ? 0.9596 0.8942 0.9114 -0.0238 0.0282  0.0090  0   SER A CA    
725  C  C     . SER E 1   ? 0.8995 0.8117 0.8321 -0.0258 0.0175  0.0064  0   SER A C     
726  O  O     . SER E 1   ? 0.8934 0.8292 0.8407 -0.0269 0.0222  0.0085  0   SER A O     
727  C  CB    . SER E 1   ? 0.9959 0.9265 0.9361 -0.0252 0.0312  0.0135  0   SER A CB    
728  O  OG    . SER E 1   ? 1.0016 0.9466 0.9465 -0.0373 0.0449  0.0107  0   SER A OG    
729  N  N     . MET E 2   ? 0.7318 0.6811 0.6811 -0.0243 0.0131  0.0261  1   MET A N     
730  C  CA    . MET E 2   ? 0.6202 0.5481 0.5613 -0.0275 -0.0098 0.0287  1   MET A CA    
731  C  C     . MET E 2   ? 0.5459 0.4927 0.4867 -0.0205 -0.0068 0.0157  1   MET A C     
732  O  O     . MET E 2   ? 0.5305 0.4707 0.4777 -0.0260 -0.0102 0.0255  1   MET A O     
733  C  CB    . MET E 2   ? 0.6055 0.5456 0.5494 -0.0275 -0.0087 0.0280  1   MET A CB    
734  C  CG    . MET E 2   ? 0.5960 0.5345 0.5222 -0.0283 -0.0198 0.0340  1   MET A CG    
735  S  SD    . MET E 2   ? 0.6217 0.5792 0.5881 -0.0162 -0.0447 0.0253  1   MET A SD    
736  C  CE    . MET E 2   ? 0.6230 0.5498 0.5202 -0.0198 -0.0176 0.0511  1   MET A CE    
737  N  N     . ILE E 3   ? 0.4756 0.4266 0.4228 -0.0172 0.0063  0.0159  2   ILE A N     
738  C  CA    . ILE E 3   ? 0.4194 0.3766 0.3650 -0.0111 0.0127  0.0039  2   ILE A CA    
739  C  C     . ILE E 3   ? 0.3985 0.3536 0.3387 -0.0130 0.0200  0.0060  2   ILE A C     
740  O  O     . ILE E 3   ? 0.3920 0.3428 0.3245 -0.0067 0.0271  0.0016  2   ILE A O     
741  C  CB    . ILE E 3   ? 0.4122 0.3664 0.3573 -0.0108 0.0114  0.0027  2   ILE A CB    
742  C  CG1   . ILE E 3   ? 0.4000 0.3691 0.3369 -0.0177 0.0032  0.0066  2   ILE A CG1   
743  C  CG2   . ILE E 3   ? 0.3912 0.3703 0.3510 -0.0159 0.0203  -0.0034 2   ILE A CG2   
744  C  CD1   . ILE E 3   ? 0.3687 0.3507 0.2988 -0.0114 0.0090  -0.0144 2   ILE A CD1   
745  N  N     . VAL E 4   ? 0.3856 0.3281 0.3148 -0.0099 0.0282  0.0047  3   VAL A N     
746  C  CA    . VAL E 4   ? 0.3650 0.3112 0.3006 -0.0171 0.0341  0.0171  3   VAL A CA    
747  C  C     . VAL E 4   ? 0.3593 0.3058 0.2893 -0.0208 0.0363  0.0080  3   VAL A C     
748  O  O     . VAL E 4   ? 0.3776 0.3003 0.2920 -0.0224 0.0371  0.0024  3   VAL A O     
749  C  CB    . VAL E 4   ? 0.3634 0.3157 0.3003 -0.0136 0.0344  0.0186  3   VAL A CB    
750  C  CG1   . VAL E 4   ? 0.3555 0.3039 0.2866 -0.0103 0.0481  0.0309  3   VAL A CG1   
751  C  CG2   . VAL E 4   ? 0.3413 0.2861 0.2991 -0.0171 0.0358  0.0263  3   VAL A CG2   
752  N  N     . LEU E 5   ? 0.3403 0.2874 0.2679 -0.0242 0.0463  0.0022  4   LEU A N     
753  C  CA    . LEU E 5   ? 0.3280 0.2709 0.2425 -0.0239 0.0537  0.0036  4   LEU A CA    
754  C  C     . LEU E 5   ? 0.3309 0.2665 0.2502 -0.0242 0.0508  0.0075  4   LEU A C     
755  O  O     . LEU E 5   ? 0.3405 0.2724 0.2532 -0.0268 0.0480  -0.0011 4   LEU A O     
756  C  CB    . LEU E 5   ? 0.3203 0.2618 0.2375 -0.0256 0.0609  0.0107  4   LEU A CB    
757  C  CG    . LEU E 5   ? 0.3082 0.2767 0.2126 -0.0267 0.0624  0.0027  4   LEU A CG    
758  C  CD1   . LEU E 5   ? 0.2894 0.2204 0.1003 -0.0377 0.0567  0.0446  4   LEU A CD1   
759  C  CD2   . LEU E 5   ? 0.2464 0.2660 0.1882 -0.0560 0.0930  0.0111  4   LEU A CD2   
760  N  N     . PHE E 6   ? 0.3131 0.2427 0.2254 -0.0326 0.0533  0.0143  5   PHE A N     
761  C  CA    . PHE E 6   ? 0.3056 0.2316 0.2053 -0.0318 0.0512  0.0216  5   PHE A CA    
762  C  C     . PHE E 6   ? 0.3140 0.2256 0.1959 -0.0246 0.0453  0.0185  5   PHE A C     
763  O  O     . PHE E 6   ? 0.3297 0.2403 0.2078 -0.0274 0.0454  0.0198  5   PHE A O     
764  C  CB    . PHE E 6   ? 0.2989 0.2258 0.1929 -0.0362 0.0556  0.0252  5   PHE A CB    
765  C  CG    . PHE E 6   ? 0.2958 0.2430 0.2165 -0.0436 0.0482  0.0236  5   PHE A CG    
766  C  CD1   . PHE E 6   ? 0.2661 0.2418 0.1869 -0.0567 0.0670  0.0086  5   PHE A CD1   
767  C  CD2   . PHE E 6   ? 0.2878 0.2682 0.2170 -0.0464 0.0619  0.0133  5   PHE A CD2   
768  C  CE1   . PHE E 6   ? 0.2672 0.2565 0.1826 -0.0468 0.0522  -0.0114 5   PHE A CE1   
769  C  CE2   . PHE E 6   ? 0.2697 0.2463 0.1468 -0.0557 0.0686  0.0170  5   PHE A CE2   
770  C  CZ    . PHE E 6   ? 0.2855 0.2588 0.1463 -0.0442 0.0675  0.0138  5   PHE A CZ    
771  N  N     . VAL E 7   ? 0.3112 0.2167 0.1809 -0.0258 0.0459  0.0271  6   VAL A N     
772  C  CA    . VAL E 7   ? 0.2967 0.2071 0.1723 -0.0204 0.0388  0.0234  6   VAL A CA    
773  C  C     . VAL E 7   ? 0.2957 0.2044 0.1676 -0.0176 0.0395  0.0269  6   VAL A C     
774  O  O     . VAL E 7   ? 0.3140 0.1999 0.1625 -0.0200 0.0314  0.0175  6   VAL A O     
775  C  CB    . VAL E 7   ? 0.2911 0.2056 0.1631 -0.0191 0.0394  0.0207  6   VAL A CB    
776  C  CG1   . VAL E 7   ? 0.2754 0.1537 0.1633 -0.0357 0.0519  0.0003  6   VAL A CG1   
777  C  CG2   . VAL E 7   ? 0.2679 0.2044 0.1732 -0.0306 0.0410  0.0518  6   VAL A CG2   
778  N  N     . ASP E 8   ? 0.2930 0.1893 0.1648 -0.0168 0.0371  0.0444  7   ASP A N     
779  C  CA    . ASP E 8   ? 0.3097 0.1884 0.1690 -0.0114 0.0399  0.0367  7   ASP A CA    
780  C  C     . ASP E 8   ? 0.2967 0.1631 0.1448 -0.0043 0.0391  0.0363  7   ASP A C     
781  O  O     . ASP E 8   ? 0.3159 0.1756 0.1273 -0.0172 0.0704  0.0489  7   ASP A O     
782  C  CB    . ASP E 8   ? 0.3161 0.2005 0.1677 -0.0238 0.0323  0.0456  7   ASP A CB    
783  C  CG    . ASP E 8   ? 0.3380 0.2029 0.2086 -0.0090 0.0426  0.0504  7   ASP A CG    
784  O  OD1   . ASP E 8   ? 0.4092 0.2376 0.2330 -0.0003 0.0656  0.1038  7   ASP A OD1   
785  O  OD2   . ASP E 8   ? 0.4094 0.2568 0.2401 -0.0717 0.0615  0.0957  7   ASP A OD2   
786  N  N     . PHE E 9   ? 0.2735 0.1335 0.1584 0.0020  0.0221  0.0230  8   PHE A N     
787  C  CA    . PHE E 9   ? 0.2474 0.1362 0.1600 0.0012  0.0073  0.0007  8   PHE A CA    
788  C  C     . PHE E 9   ? 0.2522 0.1583 0.1740 0.0034  0.0011  -0.0027 8   PHE A C     
789  O  O     . PHE E 9   ? 0.2729 0.1784 0.1980 0.0098  0.0047  -0.0200 8   PHE A O     
790  C  CB    . PHE E 9   ? 0.2465 0.1297 0.1739 0.0093  0.0094  0.0089  8   PHE A CB    
791  C  CG    . PHE E 9   ? 0.2072 0.1427 0.1746 0.0135  -0.0091 -0.0229 8   PHE A CG    
792  C  CD1   . PHE E 9   ? 0.1898 0.1368 0.1692 -0.0010 -0.0078 -0.0340 8   PHE A CD1   
793  C  CD2   . PHE E 9   ? 0.2352 0.1375 0.1830 -0.0128 -0.0453 -0.0168 8   PHE A CD2   
794  C  CE1   . PHE E 9   ? 0.1962 0.1466 0.2041 0.0049  -0.0470 -0.0368 8   PHE A CE1   
795  C  CE2   . PHE E 9   ? 0.1688 0.1765 0.1674 0.0217  -0.0237 0.0058  8   PHE A CE2   
796  C  CZ    . PHE E 9   ? 0.1591 0.1880 0.1821 0.0382  -0.0304 -0.0348 8   PHE A CZ    
797  N  N     . ASP E 10  ? 0.2475 0.1670 0.1677 -0.0253 -0.0114 0.0031  9   ASP A N     
798  C  CA    . ASP E 10  ? 0.2449 0.1936 0.1722 -0.0299 -0.0268 -0.0034 9   ASP A CA    
799  C  C     . ASP E 10  ? 0.2262 0.1938 0.1608 -0.0344 -0.0299 -0.0010 9   ASP A C     
800  O  O     . ASP E 10  ? 0.2334 0.1848 0.1696 -0.0379 -0.0337 0.0010  9   ASP A O     
801  C  CB    . ASP E 10  ? 0.2511 0.1840 0.1705 -0.0360 -0.0333 -0.0076 9   ASP A CB    
802  C  CG    . ASP E 10  ? 0.2755 0.2202 0.1869 -0.0276 -0.0215 -0.0208 9   ASP A CG    
803  O  OD1   . ASP E 10  ? 0.3281 0.2587 0.2349 -0.0741 -0.0146 -0.0344 9   ASP A OD1   
804  O  OD2   . ASP E 10  ? 0.3098 0.2123 0.2268 -0.0105 -0.0413 -0.0514 9   ASP A OD2   
805  N  N     . TYR E 11  ? 0.2174 0.2058 0.1565 -0.0542 -0.0400 0.0127  10  TYR A N     
806  C  CA    . TYR E 11  ? 0.2008 0.1938 0.1459 -0.0665 -0.0429 0.0207  10  TYR A CA    
807  C  C     . TYR E 11  ? 0.1818 0.1813 0.1410 -0.0754 -0.0436 0.0310  10  TYR A C     
808  O  O     . TYR E 11  ? 0.1770 0.2066 0.1586 -0.0999 -0.0611 0.0290  10  TYR A O     
809  C  CB    . TYR E 11  ? 0.2072 0.2086 0.1586 -0.0700 -0.0476 0.0313  10  TYR A CB    
810  C  CG    . TYR E 11  ? 0.2466 0.2369 0.2049 -0.0366 -0.0499 0.0196  10  TYR A CG    
811  C  CD1   . TYR E 11  ? 0.2862 0.2392 0.1849 -0.0225 -0.0451 0.0147  10  TYR A CD1   
812  C  CD2   . TYR E 11  ? 0.3084 0.2615 0.2340 -0.0126 -0.0564 0.0066  10  TYR A CD2   
813  C  CE1   . TYR E 11  ? 0.3292 0.1719 0.1771 0.0010  -0.0495 0.0455  10  TYR A CE1   
814  C  CE2   . TYR E 11  ? 0.3526 0.2577 0.2385 -0.0036 -0.0503 0.0553  10  TYR A CE2   
815  C  CZ    . TYR E 11  ? 0.3647 0.2634 0.2334 0.0132  -0.0706 0.0377  10  TYR A CZ    
816  O  OH    . TYR E 11  ? 0.4037 0.3361 0.2850 0.0290  -0.1272 0.0135  10  TYR A OH    
817  N  N     . PHE E 12  ? 0.1668 0.1374 0.1099 -0.0759 -0.0451 0.0386  11  PHE A N     
818  C  CA    . PHE E 12  ? 0.1936 0.1261 0.1129 -0.0673 -0.0409 0.0276  11  PHE A CA    
819  C  C     . PHE E 12  ? 0.1979 0.1310 0.1244 -0.0642 -0.0366 0.0303  11  PHE A C     
820  O  O     . PHE E 12  ? 0.2010 0.0961 0.1328 -0.0614 -0.0539 0.0105  11  PHE A O     
821  C  CB    . PHE E 12  ? 0.1796 0.1393 0.1194 -0.0808 -0.0433 0.0179  11  PHE A CB    
822  C  CG    . PHE E 12  ? 0.1859 0.1181 0.0970 -0.0516 -0.0593 0.0145  11  PHE A CG    
823  C  CD1   . PHE E 12  ? 0.2100 0.1221 0.1005 -0.0333 -0.0939 0.0216  11  PHE A CD1   
824  C  CD2   . PHE E 12  ? 0.1551 0.0792 0.0574 -0.0293 -0.0545 0.0229  11  PHE A CD2   
825  C  CE1   . PHE E 12  ? 0.2085 0.0793 0.1422 -0.0588 -0.0908 0.0242  11  PHE A CE1   
826  C  CE2   . PHE E 12  ? 0.1332 0.0467 0.0916 -0.0411 -0.0618 0.0368  11  PHE A CE2   
827  C  CZ    . PHE E 12  ? 0.1784 0.0872 0.1148 -0.0462 -0.0699 0.0227  11  PHE A CZ    
828  N  N     . TYR E 13  ? 0.2004 0.1448 0.1238 -0.0577 -0.0312 0.0395  12  TYR A N     
829  C  CA    . TYR E 13  ? 0.1988 0.1313 0.1304 -0.0627 -0.0163 0.0397  12  TYR A CA    
830  C  C     . TYR E 13  ? 0.2271 0.1562 0.1294 -0.0606 -0.0219 0.0322  12  TYR A C     
831  O  O     . TYR E 13  ? 0.2549 0.1473 0.1307 -0.0516 -0.0257 0.0214  12  TYR A O     
832  C  CB    . TYR E 13  ? 0.1597 0.1253 0.1122 -0.0657 -0.0025 0.0539  12  TYR A CB    
833  C  CG    . TYR E 13  ? 0.1550 0.1600 0.2144 -0.0368 0.0163  0.0709  12  TYR A CG    
834  C  CD1   . TYR E 13  ? 0.1574 0.1470 0.2566 -0.0310 0.0395  0.1197  12  TYR A CD1   
835  C  CD2   . TYR E 13  ? 0.1302 0.1371 0.2361 -0.0266 0.0576  0.1145  12  TYR A CD2   
836  C  CE1   . TYR E 13  ? 0.1569 0.1346 0.2806 0.0012  0.0481  0.1265  12  TYR A CE1   
837  C  CE2   . TYR E 13  ? 0.1323 0.1515 0.2889 -0.0012 0.0382  0.1657  12  TYR A CE2   
838  C  CZ    . TYR E 13  ? 0.1698 0.1829 0.3390 -0.0078 0.0487  0.1634  12  TYR A CZ    
839  O  OH    . TYR E 13  ? 0.2056 0.1454 0.3837 -0.0030 0.0836  0.1945  12  TYR A OH    
840  N  N     . ALA E 14  ? 0.2337 0.1499 0.1328 -0.0634 -0.0288 0.0301  13  ALA A N     
841  C  CA    . ALA E 14  ? 0.2212 0.1682 0.1115 -0.0570 -0.0158 0.0285  13  ALA A CA    
842  C  C     . ALA E 14  ? 0.2197 0.1745 0.1126 -0.0447 -0.0075 0.0251  13  ALA A C     
843  O  O     . ALA E 14  ? 0.2204 0.1743 0.1067 -0.0384 0.0069  0.0468  13  ALA A O     
844  C  CB    . ALA E 14  ? 0.2093 0.1673 0.1165 -0.0558 -0.0105 0.0224  13  ALA A CB    
845  N  N     . GLN E 15  ? 0.2154 0.1839 0.1029 -0.0418 -0.0038 0.0244  14  GLN A N     
846  C  CA    . GLN E 15  ? 0.2253 0.2057 0.1010 -0.0355 -0.0170 0.0262  14  GLN A CA    
847  C  C     . GLN E 15  ? 0.2124 0.2031 0.1138 -0.0370 -0.0235 0.0116  14  GLN A C     
848  O  O     . GLN E 15  ? 0.2061 0.2133 0.0824 -0.0494 -0.0214 0.0247  14  GLN A O     
849  C  CB    . GLN E 15  ? 0.2310 0.2002 0.1100 -0.0231 -0.0163 0.0243  14  GLN A CB    
850  C  CG    . GLN E 15  ? 0.2754 0.2041 0.1084 -0.0170 -0.0302 0.0690  14  GLN A CG    
851  C  CD    . GLN E 15  ? 0.2758 0.2252 0.1406 -0.0058 -0.0196 0.0771  14  GLN A CD    
852  O  OE1   . GLN E 15  ? 0.3052 0.2967 0.1870 -0.0625 -0.0037 0.0881  14  GLN A OE1   
853  N  NE2   . GLN E 15  ? 0.2941 0.1287 0.1258 -0.0057 -0.0378 0.0999  14  GLN A NE2   
854  N  N     . VAL E 16  ? 0.2120 0.2128 0.1323 -0.0255 -0.0304 -0.0017 15  VAL A N     
855  C  CA    . VAL E 16  ? 0.2111 0.2253 0.1343 -0.0207 -0.0330 -0.0153 15  VAL A CA    
856  C  C     . VAL E 16  ? 0.2128 0.2318 0.1390 -0.0266 -0.0259 -0.0164 15  VAL A C     
857  O  O     . VAL E 16  ? 0.1953 0.2422 0.1466 -0.0398 -0.0353 -0.0370 15  VAL A O     
858  C  CB    . VAL E 16  ? 0.2151 0.2161 0.1354 -0.0224 -0.0283 -0.0238 15  VAL A CB    
859  C  CG1   . VAL E 16  ? 0.1951 0.2428 0.1194 -0.0001 -0.0410 -0.0182 15  VAL A CG1   
860  C  CG2   . VAL E 16  ? 0.1643 0.1989 0.0964 -0.0149 -0.0348 -0.0258 15  VAL A CG2   
861  N  N     . GLU E 17  ? 0.2220 0.2351 0.1539 -0.0169 -0.0272 -0.0150 16  GLU A N     
862  C  CA    . GLU E 17  ? 0.2302 0.2354 0.1663 -0.0245 -0.0233 -0.0118 16  GLU A CA    
863  C  C     . GLU E 17  ? 0.2267 0.2314 0.1722 -0.0211 -0.0214 -0.0211 16  GLU A C     
864  O  O     . GLU E 17  ? 0.2252 0.2294 0.1763 -0.0238 -0.0137 -0.0206 16  GLU A O     
865  C  CB    . GLU E 17  ? 0.2428 0.2340 0.1703 -0.0284 -0.0347 -0.0043 16  GLU A CB    
866  C  CG    . GLU E 17  ? 0.2897 0.2789 0.2225 -0.0242 -0.0481 0.0008  16  GLU A CG    
867  C  CD    . GLU E 17  ? 0.3410 0.3052 0.2398 -0.0169 -0.0492 -0.0022 16  GLU A CD    
868  O  OE1   . GLU E 17  ? 0.3784 0.3972 0.3045 -0.0166 -0.0565 0.0192  16  GLU A OE1   
869  O  OE2   . GLU E 17  ? 0.3604 0.2983 0.3034 -0.0129 -0.0721 0.0220  16  GLU A OE2   
870  N  N     . GLU E 18  ? 0.2369 0.2388 0.1902 -0.0272 -0.0294 -0.0239 17  GLU A N     
871  C  CA    . GLU E 18  ? 0.2562 0.2266 0.1915 -0.0175 -0.0287 -0.0316 17  GLU A CA    
872  C  C     . GLU E 18  ? 0.2572 0.2206 0.1836 -0.0114 -0.0280 -0.0326 17  GLU A C     
873  O  O     . GLU E 18  ? 0.2770 0.2296 0.1888 -0.0161 -0.0334 -0.0601 17  GLU A O     
874  C  CB    . GLU E 18  ? 0.2637 0.2380 0.1922 -0.0107 -0.0241 -0.0339 17  GLU A CB    
875  C  CG    . GLU E 18  ? 0.3046 0.2591 0.2331 -0.0207 -0.0258 -0.0471 17  GLU A CG    
876  C  CD    . GLU E 18  ? 0.4067 0.3101 0.2890 -0.0142 -0.0275 -0.0675 17  GLU A CD    
877  O  OE1   . GLU E 18  ? 0.4310 0.2845 0.2649 -0.0179 -0.0216 -0.0345 17  GLU A OE1   
878  O  OE2   . GLU E 18  ? 0.4420 0.3359 0.3543 -0.0135 -0.0320 -0.0504 17  GLU A OE2   
879  N  N     . VAL E 19  ? 0.2479 0.2353 0.1733 -0.0049 -0.0296 -0.0319 18  VAL A N     
880  C  CA    . VAL E 19  ? 0.2511 0.2306 0.1837 -0.0010 -0.0381 -0.0231 18  VAL A CA    
881  C  C     . VAL E 19  ? 0.2723 0.2512 0.2012 -0.0026 -0.0401 -0.0176 18  VAL A C     
882  O  O     . VAL E 19  ? 0.2778 0.2553 0.2150 -0.0054 -0.0512 -0.0025 18  VAL A O     
883  C  CB    . VAL E 19  ? 0.2405 0.2213 0.1839 0.0001  -0.0360 -0.0285 18  VAL A CB    
884  C  CG1   . VAL E 19  ? 0.1988 0.1648 0.1676 0.0292  -0.0529 -0.0168 18  VAL A CG1   
885  C  CG2   . VAL E 19  ? 0.1863 0.2126 0.1297 0.0001  -0.0616 -0.0303 18  VAL A CG2   
886  N  N     . LEU E 20  ? 0.2799 0.2587 0.2245 0.0015  -0.0430 -0.0230 19  LEU A N     
887  C  CA    . LEU E 20  ? 0.2897 0.2754 0.2198 -0.0059 -0.0439 -0.0222 19  LEU A CA    
888  C  C     . LEU E 20  ? 0.2905 0.2830 0.2250 -0.0184 -0.0417 -0.0170 19  LEU A C     
889  O  O     . LEU E 20  ? 0.2927 0.2799 0.2450 -0.0329 -0.0537 -0.0289 19  LEU A O     
890  C  CB    . LEU E 20  ? 0.2906 0.2804 0.2267 -0.0036 -0.0426 -0.0307 19  LEU A CB    
891  C  CG    . LEU E 20  ? 0.2990 0.2784 0.2293 0.0099  -0.0389 -0.0274 19  LEU A CG    
892  C  CD1   . LEU E 20  ? 0.2832 0.3126 0.2479 0.0300  0.0289  -0.0181 19  LEU A CD1   
893  C  CD2   . LEU E 20  ? 0.2839 0.3086 0.1496 0.0144  -0.0610 -0.0477 19  LEU A CD2   
894  N  N     . ASN E 21  ? 0.3065 0.2968 0.2260 -0.0169 -0.0412 -0.0171 20  ASN A N     
895  C  CA    . ASN E 21  ? 0.3230 0.3138 0.2384 -0.0179 -0.0420 -0.0053 20  ASN A CA    
896  C  C     . ASN E 21  ? 0.3294 0.3239 0.2568 -0.0164 -0.0363 0.0046  20  ASN A C     
897  O  O     . ASN E 21  ? 0.3337 0.3409 0.2806 -0.0255 -0.0367 0.0205  20  ASN A O     
898  C  CB    . ASN E 21  ? 0.3202 0.3201 0.2370 -0.0108 -0.0320 -0.0150 20  ASN A CB    
899  C  CG    . ASN E 21  ? 0.3416 0.3273 0.2180 -0.0208 -0.0432 -0.0077 20  ASN A CG    
900  O  OD1   . ASN E 21  ? 0.3574 0.3983 0.1682 0.0114  -0.1039 -0.0190 20  ASN A OD1   
901  N  ND2   . ASN E 21  ? 0.2968 0.3590 0.2101 -0.0154 -0.0033 -0.0283 20  ASN A ND2   
902  N  N     . PRO E 22  ? 0.3282 0.3290 0.2735 -0.0164 -0.0389 0.0095  21  PRO A N     
903  C  CA    . PRO E 22  ? 0.3353 0.3311 0.2880 -0.0176 -0.0428 0.0092  21  PRO A CA    
904  C  C     . PRO E 22  ? 0.3325 0.3306 0.2928 -0.0189 -0.0418 0.0090  21  PRO A C     
905  O  O     . PRO E 22  ? 0.3445 0.3125 0.3043 -0.0146 -0.0482 0.0182  21  PRO A O     
906  C  CB    . PRO E 22  ? 0.3320 0.3339 0.3134 -0.0155 -0.0521 0.0099  21  PRO A CB    
907  C  CG    . PRO E 22  ? 0.3361 0.3350 0.3080 -0.0153 -0.0505 0.0109  21  PRO A CG    
908  C  CD    . PRO E 22  ? 0.3234 0.3239 0.2755 -0.0117 -0.0343 0.0045  21  PRO A CD    
909  N  N     . SER E 23  ? 0.3260 0.3477 0.2861 -0.0242 -0.0342 0.0095  22  SER A N     
910  C  CA    . SER E 23  ? 0.3240 0.3561 0.2917 -0.0216 -0.0175 0.0095  22  SER A CA    
911  C  C     . SER E 23  ? 0.3282 0.3699 0.3166 -0.0185 -0.0178 0.0100  22  SER A C     
912  O  O     . SER E 23  ? 0.3195 0.3692 0.3254 -0.0087 -0.0117 0.0107  22  SER A O     
913  C  CB    . SER E 23  ? 0.3111 0.3492 0.2906 -0.0197 -0.0202 0.0112  22  SER A CB    
914  O  OG    . SER E 23  ? 0.2790 0.3054 0.2678 -0.0286 0.0158  0.0089  22  SER A OG    
915  N  N     . LEU E 24  ? 0.3405 0.3754 0.3226 -0.0170 -0.0164 0.0147  23  LEU A N     
916  C  CA    . LEU E 24  ? 0.3509 0.3789 0.3362 -0.0147 -0.0123 0.0102  23  LEU A CA    
917  C  C     . LEU E 24  ? 0.3701 0.3904 0.3608 -0.0132 -0.0117 0.0084  23  LEU A C     
918  O  O     . LEU E 24  ? 0.3862 0.3917 0.3605 -0.0169 -0.0175 0.0216  23  LEU A O     
919  C  CB    . LEU E 24  ? 0.3381 0.3632 0.3163 -0.0122 -0.0077 0.0103  23  LEU A CB    
920  C  CG    . LEU E 24  ? 0.3440 0.3692 0.2952 -0.0162 -0.0033 0.0100  23  LEU A CG    
921  C  CD1   . LEU E 24  ? 0.3228 0.3256 0.2583 -0.0138 0.0175  -0.0231 23  LEU A CD1   
922  C  CD2   . LEU E 24  ? 0.3467 0.3428 0.2105 -0.0097 -0.0080 -0.0053 23  LEU A CD2   
923  N  N     . LYS E 25  ? 0.3784 0.3914 0.3885 -0.0083 -0.0113 0.0075  24  LYS A N     
924  C  CA    . LYS E 25  ? 0.3840 0.4059 0.4052 -0.0074 0.0008  0.0010  24  LYS A CA    
925  C  C     . LYS E 25  ? 0.3865 0.4131 0.4083 -0.0054 0.0032  -0.0008 24  LYS A C     
926  O  O     . LYS E 25  ? 0.4018 0.4237 0.4160 0.0005  0.0107  0.0028  24  LYS A O     
927  C  CB    . LYS E 25  ? 0.3887 0.4101 0.4175 -0.0073 0.0001  0.0040  24  LYS A CB    
928  C  CG    . LYS E 25  ? 0.4003 0.4131 0.4315 -0.0164 0.0103  0.0049  24  LYS A CG    
929  C  CD    . LYS E 25  ? 0.3812 0.4531 0.4921 -0.0035 0.0297  0.0136  24  LYS A CD    
930  C  CE    . LYS E 25  ? 0.4092 0.4332 0.5250 0.0079  0.0154  0.0189  24  LYS A CE    
931  N  NZ    . LYS E 25  ? 0.4116 0.4488 0.5636 0.0130  -0.0238 0.0181  24  LYS A NZ    
932  N  N     . GLY E 26  ? 0.3782 0.4196 0.4080 -0.0015 0.0023  -0.0046 25  GLY A N     
933  C  CA    . GLY E 26  ? 0.3724 0.4161 0.3988 -0.0051 0.0002  -0.0066 25  GLY A CA    
934  C  C     . GLY E 26  ? 0.3624 0.4236 0.4020 -0.0085 0.0010  -0.0105 25  GLY A C     
935  O  O     . GLY E 26  ? 0.3726 0.4388 0.4089 -0.0083 0.0055  -0.0125 25  GLY A O     
936  N  N     . LYS E 27  ? 0.3518 0.4123 0.3825 -0.0162 0.0021  -0.0042 26  LYS A N     
937  C  CA    . LYS E 27  ? 0.3406 0.3830 0.3721 -0.0160 -0.0004 0.0036  26  LYS A CA    
938  C  C     . LYS E 27  ? 0.3221 0.3549 0.3614 -0.0239 -0.0071 0.0029  26  LYS A C     
939  O  O     . LYS E 27  ? 0.3295 0.3613 0.3688 -0.0217 -0.0055 -0.0072 26  LYS A O     
940  C  CB    . LYS E 27  ? 0.3442 0.3881 0.3759 -0.0201 0.0000  0.0059  26  LYS A CB    
941  C  CG    . LYS E 27  ? 0.3481 0.3901 0.3944 -0.0175 -0.0054 0.0224  26  LYS A CG    
942  C  CD    . LYS E 27  ? 0.3936 0.3975 0.3999 -0.0158 -0.0085 0.0283  26  LYS A CD    
943  C  CE    . LYS E 27  ? 0.4269 0.3772 0.4651 -0.0066 -0.0186 0.0294  26  LYS A CE    
944  N  NZ    . LYS E 27  ? 0.4464 0.3239 0.4873 -0.0004 -0.0234 0.0021  26  LYS A NZ    
945  N  N     . PRO E 28  ? 0.3065 0.3270 0.3388 -0.0323 -0.0171 0.0094  27  PRO A N     
946  C  CA    . PRO E 28  ? 0.2914 0.3044 0.3268 -0.0345 -0.0296 0.0061  27  PRO A CA    
947  C  C     . PRO E 28  ? 0.2749 0.2886 0.3035 -0.0404 -0.0407 0.0074  27  PRO A C     
948  O  O     . PRO E 28  ? 0.2722 0.3029 0.2885 -0.0361 -0.0599 0.0046  27  PRO A O     
949  C  CB    . PRO E 28  ? 0.2905 0.3047 0.3309 -0.0438 -0.0290 0.0033  27  PRO A CB    
950  C  CG    . PRO E 28  ? 0.2835 0.3085 0.3188 -0.0276 -0.0142 0.0095  27  PRO A CG    
951  C  CD    . PRO E 28  ? 0.3072 0.3246 0.3386 -0.0327 -0.0170 0.0109  27  PRO A CD    
952  N  N     . VAL E 29  ? 0.2434 0.2422 0.2835 -0.0496 -0.0460 0.0123  28  VAL A N     
953  C  CA    . VAL E 29  ? 0.2395 0.2102 0.2749 -0.0520 -0.0493 0.0261  28  VAL A CA    
954  C  C     . VAL E 29  ? 0.2314 0.2150 0.2661 -0.0638 -0.0453 0.0181  28  VAL A C     
955  O  O     . VAL E 29  ? 0.2338 0.2008 0.2724 -0.0702 -0.0609 0.0113  28  VAL A O     
956  C  CB    . VAL E 29  ? 0.2554 0.2065 0.2706 -0.0514 -0.0571 0.0258  28  VAL A CB    
957  C  CG1   . VAL E 29  ? 0.2610 0.1714 0.2783 -0.0372 -0.0541 0.0692  28  VAL A CG1   
958  C  CG2   . VAL E 29  ? 0.2746 0.1757 0.2863 -0.0447 -0.0599 0.0230  28  VAL A CG2   
959  N  N     . VAL E 30  ? 0.2190 0.2026 0.2603 -0.0747 -0.0369 0.0186  29  VAL A N     
960  C  CA    . VAL E 30  ? 0.2191 0.2064 0.2644 -0.0791 -0.0280 0.0200  29  VAL A CA    
961  C  C     . VAL E 30  ? 0.2334 0.2231 0.2699 -0.0737 -0.0270 0.0159  29  VAL A C     
962  O  O     . VAL E 30  ? 0.2397 0.2469 0.2792 -0.0747 -0.0155 0.0301  29  VAL A O     
963  C  CB    . VAL E 30  ? 0.2195 0.2003 0.2627 -0.0776 -0.0330 0.0232  29  VAL A CB    
964  C  CG1   . VAL E 30  ? 0.2080 0.1846 0.2331 -0.0930 -0.0303 0.0430  29  VAL A CG1   
965  C  CG2   . VAL E 30  ? 0.2122 0.2426 0.2753 -0.0788 -0.0404 0.0018  29  VAL A CG2   
966  N  N     . VAL E 31  ? 0.2313 0.2222 0.2695 -0.0784 -0.0276 0.0135  30  VAL A N     
967  C  CA    . VAL E 31  ? 0.2400 0.2244 0.2685 -0.0749 -0.0371 -0.0015 30  VAL A CA    
968  C  C     . VAL E 31  ? 0.2529 0.2513 0.3109 -0.0661 -0.0335 -0.0036 30  VAL A C     
969  O  O     . VAL E 31  ? 0.2628 0.2667 0.3397 -0.0681 -0.0457 0.0038  30  VAL A O     
970  C  CB    . VAL E 31  ? 0.2285 0.2049 0.2569 -0.0718 -0.0412 -0.0073 30  VAL A CB    
971  C  CG1   . VAL E 31  ? 0.2043 0.2260 0.2278 -0.0780 -0.0507 -0.0231 30  VAL A CG1   
972  C  CG2   . VAL E 31  ? 0.2346 0.1815 0.1822 -0.1000 -0.0722 -0.0397 30  VAL A CG2   
973  N  N     . CYS E 32  ? 0.2649 0.2792 0.3331 -0.0598 -0.0228 -0.0108 31  CYS A N     
974  C  CA    . CYS E 32  ? 0.2955 0.3032 0.3748 -0.0460 -0.0173 -0.0026 31  CYS A CA    
975  C  C     . CYS E 32  ? 0.2971 0.3038 0.3752 -0.0426 -0.0101 -0.0060 31  CYS A C     
976  O  O     . CYS E 32  ? 0.2974 0.3142 0.3787 -0.0290 -0.0033 0.0033  31  CYS A O     
977  C  CB    . CYS E 32  ? 0.2953 0.3154 0.3875 -0.0426 -0.0135 -0.0067 31  CYS A CB    
978  S  SG    . CYS E 32  ? 0.3847 0.3814 0.5121 -0.0469 -0.0196 -0.0131 31  CYS A SG    
979  N  N     . VAL E 33  ? 0.3146 0.3192 0.3929 -0.0390 -0.0076 -0.0064 32  VAL A N     
980  C  CA    . VAL E 33  ? 0.3436 0.3344 0.4108 -0.0363 -0.0033 0.0013  32  VAL A CA    
981  C  C     . VAL E 33  ? 0.3639 0.3626 0.4241 -0.0297 -0.0018 0.0025  32  VAL A C     
982  O  O     . VAL E 33  ? 0.3725 0.3679 0.4090 -0.0295 -0.0001 0.0040  32  VAL A O     
983  C  CB    . VAL E 33  ? 0.3339 0.3292 0.4204 -0.0332 -0.0023 -0.0009 32  VAL A CB    
984  C  CG1   . VAL E 33  ? 0.3235 0.3082 0.4246 -0.0592 -0.0176 -0.0075 32  VAL A CG1   
985  C  CG2   . VAL E 33  ? 0.3345 0.3246 0.4157 -0.0517 0.0098  -0.0055 32  VAL A CG2   
986  N  N     . PHE E 34  ? 0.3989 0.3929 0.4434 -0.0279 -0.0034 0.0028  33  PHE A N     
987  C  CA    . PHE E 34  ? 0.4249 0.4304 0.4750 -0.0218 -0.0012 0.0063  33  PHE A CA    
988  C  C     . PHE E 34  ? 0.4559 0.4547 0.4976 -0.0177 -0.0012 0.0041  33  PHE A C     
989  O  O     . PHE E 34  ? 0.4741 0.4591 0.5067 -0.0194 -0.0032 -0.0012 33  PHE A O     
990  C  CB    . PHE E 34  ? 0.4159 0.4303 0.4820 -0.0249 -0.0016 0.0088  33  PHE A CB    
991  C  CG    . PHE E 34  ? 0.4126 0.4489 0.4951 -0.0268 -0.0063 0.0275  33  PHE A CG    
992  C  CD1   . PHE E 34  ? 0.4119 0.4710 0.5147 -0.0251 -0.0211 0.0343  33  PHE A CD1   
993  C  CD2   . PHE E 34  ? 0.4078 0.4720 0.5160 -0.0433 -0.0086 0.0338  33  PHE A CD2   
994  C  CE1   . PHE E 34  ? 0.4271 0.4932 0.5387 -0.0227 -0.0141 0.0339  33  PHE A CE1   
995  C  CE2   . PHE E 34  ? 0.4091 0.4821 0.5253 -0.0327 -0.0116 0.0255  33  PHE A CE2   
996  C  CZ    . PHE E 34  ? 0.4180 0.5006 0.5379 -0.0298 -0.0110 0.0256  33  PHE A CZ    
997  N  N     . SER E 35  ? 0.4866 0.4904 0.5140 -0.0088 -0.0064 0.0056  34  SER A N     
998  C  CA    . SER E 35  ? 0.5187 0.5114 0.5298 -0.0041 -0.0049 0.0090  34  SER A CA    
999  C  C     . SER E 35  ? 0.5404 0.5323 0.5448 -0.0061 -0.0056 0.0054  34  SER A C     
1000 O  O     . SER E 35  ? 0.5475 0.5331 0.5445 -0.0050 -0.0034 0.0108  34  SER A O     
1001 C  CB    . SER E 35  ? 0.5169 0.5169 0.5327 0.0003  -0.0041 0.0078  34  SER A CB    
1002 O  OG    . SER E 35  ? 0.5106 0.4983 0.5196 0.0091  0.0031  0.0214  34  SER A OG    
1003 N  N     . GLY E 36  ? 0.5629 0.5571 0.5598 -0.0065 -0.0065 0.0045  35  GLY A N     
1004 C  CA    . GLY E 36  ? 0.5830 0.5751 0.5684 -0.0036 -0.0061 0.0007  35  GLY A CA    
1005 C  C     . GLY E 36  ? 0.6027 0.5918 0.5899 -0.0030 -0.0092 0.0000  35  GLY A C     
1006 O  O     . GLY E 36  ? 0.6143 0.5957 0.5926 -0.0047 -0.0166 -0.0050 35  GLY A O     
1007 N  N     . ARG E 37  ? 0.6179 0.6015 0.5990 -0.0046 -0.0088 -0.0019 36  ARG A N     
1008 C  CA    . ARG E 37  ? 0.6276 0.6129 0.6103 -0.0032 -0.0092 -0.0007 36  ARG A CA    
1009 C  C     . ARG E 37  ? 0.6296 0.6154 0.6129 -0.0041 -0.0053 0.0013  36  ARG A C     
1010 O  O     . ARG E 37  ? 0.6309 0.6116 0.6125 -0.0017 -0.0008 0.0008  36  ARG A O     
1011 C  CB    . ARG E 37  ? 0.6371 0.6147 0.6118 -0.0015 -0.0093 -0.0005 36  ARG A CB    
1012 C  CG    . ARG E 37  ? 0.6549 0.6277 0.6051 0.0050  -0.0088 0.0030  36  ARG A CG    
1013 C  CD    . ARG E 37  ? 0.6886 0.6203 0.5912 -0.0034 0.0048  0.0048  36  ARG A CD    
1014 N  NE    . ARG E 37  ? 0.6796 0.6140 0.5404 0.0014  0.0269  -0.0002 36  ARG A NE    
1015 C  CZ    . ARG E 37  ? 0.6459 0.5855 0.5064 -0.0030 0.0320  -0.0146 36  ARG A CZ    
1016 N  NH1   . ARG E 37  ? 0.6296 0.5691 0.4784 -0.0036 0.0314  -0.0126 36  ARG A NH1   
1017 N  NH2   . ARG E 37  ? 0.6461 0.5632 0.4683 -0.0149 0.0365  -0.0141 36  ARG A NH2   
1018 N  N     . PHE E 38  ? 0.6300 0.6200 0.6215 -0.0076 -0.0043 0.0043  37  PHE A N     
1019 C  CA    . PHE E 38  ? 0.6260 0.6227 0.6309 -0.0061 -0.0053 0.0040  37  PHE A CA    
1020 C  C     . PHE E 38  ? 0.6273 0.6222 0.6331 -0.0067 -0.0028 0.0047  37  PHE A C     
1021 O  O     . PHE E 38  ? 0.6314 0.6201 0.6352 -0.0066 -0.0080 0.0024  37  PHE A O     
1022 C  CB    . PHE E 38  ? 0.6251 0.6221 0.6341 -0.0074 -0.0055 0.0045  37  PHE A CB    
1023 C  CG    . PHE E 38  ? 0.6194 0.6264 0.6380 -0.0147 -0.0114 0.0016  37  PHE A CG    
1024 C  CD1   . PHE E 38  ? 0.5967 0.6097 0.6507 -0.0253 -0.0242 0.0095  37  PHE A CD1   
1025 C  CD2   . PHE E 38  ? 0.6164 0.6308 0.6550 -0.0109 -0.0235 0.0033  37  PHE A CD2   
1026 C  CE1   . PHE E 38  ? 0.5865 0.6202 0.6605 -0.0276 -0.0291 -0.0052 37  PHE A CE1   
1027 C  CE2   . PHE E 38  ? 0.5963 0.6203 0.6514 -0.0152 -0.0258 0.0078  37  PHE A CE2   
1028 C  CZ    . PHE E 38  ? 0.5887 0.6262 0.6524 -0.0279 -0.0278 0.0020  37  PHE A CZ    
1029 N  N     . GLU E 39  ? 0.6233 0.6228 0.6311 -0.0060 -0.0011 0.0048  38  GLU A N     
1030 C  CA    . GLU E 39  ? 0.6157 0.6235 0.6267 -0.0071 -0.0001 0.0057  38  GLU A CA    
1031 C  C     . GLU E 39  ? 0.6006 0.6185 0.6224 -0.0062 0.0006  0.0072  38  GLU A C     
1032 O  O     . GLU E 39  ? 0.5886 0.6266 0.6250 -0.0058 -0.0024 0.0085  38  GLU A O     
1033 C  CB    . GLU E 39  ? 0.6280 0.6272 0.6252 -0.0110 -0.0004 0.0071  38  GLU A CB    
1034 C  CG    . GLU E 39  ? 0.6521 0.6463 0.6365 -0.0227 -0.0088 0.0117  38  GLU A CG    
1035 C  CD    . GLU E 39  ? 0.6895 0.6607 0.6458 -0.0386 -0.0175 0.0149  38  GLU A CD    
1036 O  OE1   . GLU E 39  ? 0.6949 0.6565 0.6628 -0.0459 -0.0193 0.0165  38  GLU A OE1   
1037 O  OE2   . GLU E 39  ? 0.7065 0.6583 0.6526 -0.0429 -0.0216 0.0259  38  GLU A OE2   
1038 N  N     . ASP E 40  ? 0.5848 0.5983 0.6085 -0.0065 0.0055  0.0081  39  ASP A N     
1039 C  CA    . ASP E 40  ? 0.5633 0.5708 0.5944 -0.0063 0.0047  0.0105  39  ASP A CA    
1040 C  C     . ASP E 40  ? 0.5455 0.5522 0.5807 -0.0063 0.0044  0.0056  39  ASP A C     
1041 O  O     . ASP E 40  ? 0.5465 0.5471 0.5861 -0.0037 0.0091  0.0031  39  ASP A O     
1042 C  CB    . ASP E 40  ? 0.5696 0.5711 0.5969 -0.0078 0.0049  0.0104  39  ASP A CB    
1043 C  CG    . ASP E 40  ? 0.5868 0.5765 0.6176 -0.0001 -0.0086 0.0079  39  ASP A CG    
1044 O  OD1   . ASP E 40  ? 0.6271 0.5746 0.6219 0.0054  -0.0379 -0.0013 39  ASP A OD1   
1045 O  OD2   . ASP E 40  ? 0.5950 0.5757 0.6380 0.0116  -0.0128 0.0150  39  ASP A OD2   
1046 N  N     . SER E 41  ? 0.5166 0.5219 0.5530 -0.0128 0.0022  0.0069  40  SER A N     
1047 C  CA    . SER E 41  ? 0.4919 0.5038 0.5353 -0.0142 -0.0005 -0.0005 40  SER A CA    
1048 C  C     . SER E 41  ? 0.4787 0.4828 0.5068 -0.0171 0.0003  0.0005  40  SER A C     
1049 O  O     . SER E 41  ? 0.4757 0.4898 0.5132 -0.0215 0.0027  -0.0020 40  SER A O     
1050 C  CB    . SER E 41  ? 0.4956 0.5116 0.5402 -0.0141 -0.0059 -0.0033 40  SER A CB    
1051 O  OG    . SER E 41  ? 0.5267 0.5261 0.5586 -0.0045 -0.0147 -0.0119 40  SER A OG    
1052 N  N     . GLY E 42  ? 0.4469 0.4449 0.4718 -0.0222 0.0006  0.0102  41  GLY A N     
1053 C  CA    . GLY E 42  ? 0.4338 0.3995 0.4313 -0.0168 -0.0089 0.0150  41  GLY A CA    
1054 C  C     . GLY E 42  ? 0.4055 0.3670 0.4057 -0.0207 -0.0131 0.0182  41  GLY A C     
1055 O  O     . GLY E 42  ? 0.4055 0.3629 0.4139 -0.0223 -0.0161 0.0213  41  GLY A O     
1056 N  N     . ALA E 43  ? 0.3857 0.3405 0.3671 -0.0284 -0.0113 0.0206  42  ALA A N     
1057 C  CA    . ALA E 43  ? 0.3659 0.3240 0.3359 -0.0310 -0.0150 0.0241  42  ALA A CA    
1058 C  C     . ALA E 43  ? 0.3569 0.3025 0.3075 -0.0362 -0.0197 0.0242  42  ALA A C     
1059 O  O     . ALA E 43  ? 0.3633 0.3229 0.2900 -0.0339 -0.0197 0.0267  42  ALA A O     
1060 C  CB    . ALA E 43  ? 0.3732 0.3132 0.3306 -0.0299 -0.0138 0.0308  42  ALA A CB    
1061 N  N     . VAL E 44  ? 0.3284 0.2675 0.2837 -0.0428 -0.0241 0.0281  43  VAL A N     
1062 C  CA    . VAL E 44  ? 0.2937 0.2201 0.2589 -0.0518 -0.0230 0.0275  43  VAL A CA    
1063 C  C     . VAL E 44  ? 0.2851 0.2044 0.2599 -0.0567 -0.0340 0.0217  43  VAL A C     
1064 O  O     . VAL E 44  ? 0.2884 0.1632 0.2686 -0.0721 -0.0404 0.0253  43  VAL A O     
1065 C  CB    . VAL E 44  ? 0.2865 0.2230 0.2591 -0.0541 -0.0240 0.0264  43  VAL A CB    
1066 C  CG1   . VAL E 44  ? 0.2890 0.2385 0.2624 -0.0476 -0.0227 0.0139  43  VAL A CG1   
1067 C  CG2   . VAL E 44  ? 0.3178 0.2077 0.2383 -0.0460 -0.0306 0.0239  43  VAL A CG2   
1068 N  N     . ALA E 45  ? 0.2680 0.1989 0.2494 -0.0557 -0.0311 0.0175  44  ALA A N     
1069 C  CA    . ALA E 45  ? 0.2479 0.1974 0.2366 -0.0502 -0.0282 0.0212  44  ALA A CA    
1070 C  C     . ALA E 45  ? 0.2520 0.2098 0.2259 -0.0534 -0.0265 0.0177  44  ALA A C     
1071 O  O     . ALA E 45  ? 0.2645 0.2302 0.2484 -0.0513 -0.0190 0.0267  44  ALA A O     
1072 C  CB    . ALA E 45  ? 0.2487 0.2045 0.2238 -0.0498 -0.0305 0.0235  44  ALA A CB    
1073 N  N     . THR E 46  ? 0.2428 0.2107 0.2217 -0.0405 -0.0366 0.0104  45  THR A N     
1074 C  CA    . THR E 46  ? 0.2191 0.2080 0.2058 -0.0231 -0.0319 0.0008  45  THR A CA    
1075 C  C     . THR E 46  ? 0.2036 0.2061 0.1982 -0.0175 -0.0399 0.0008  45  THR A C     
1076 O  O     . THR E 46  ? 0.2132 0.2188 0.2153 -0.0043 -0.0480 0.0169  45  THR A O     
1077 C  CB    . THR E 46  ? 0.2371 0.2106 0.2005 -0.0165 -0.0393 -0.0018 45  THR A CB    
1078 O  OG1   . THR E 46  ? 0.2583 0.2319 0.2442 0.0045  -0.0213 -0.0081 45  THR A OG1   
1079 C  CG2   . THR E 46  ? 0.2459 0.2172 0.2276 -0.0214 -0.0393 -0.0275 45  THR A CG2   
1080 N  N     . ALA E 47  ? 0.1900 0.2047 0.1912 -0.0330 -0.0423 0.0010  46  ALA A N     
1081 C  CA    . ALA E 47  ? 0.1752 0.2043 0.2020 -0.0536 -0.0328 -0.0014 46  ALA A CA    
1082 C  C     . ALA E 47  ? 0.1816 0.2054 0.2101 -0.0630 -0.0376 0.0000  46  ALA A C     
1083 O  O     . ALA E 47  ? 0.1701 0.2006 0.1923 -0.0694 -0.0279 0.0022  46  ALA A O     
1084 C  CB    . ALA E 47  ? 0.1808 0.2194 0.2138 -0.0436 -0.0312 0.0049  46  ALA A CB    
1085 N  N     . ASN E 48  ? 0.1799 0.1843 0.2175 -0.0792 -0.0291 0.0112  47  ASN A N     
1086 C  CA    . ASN E 48  ? 0.1841 0.1901 0.2292 -0.0657 -0.0192 0.0032  47  ASN A CA    
1087 C  C     . ASN E 48  ? 0.2059 0.2166 0.2447 -0.0661 -0.0182 0.0001  47  ASN A C     
1088 O  O     . ASN E 48  ? 0.2061 0.2218 0.2625 -0.0649 -0.0092 0.0089  47  ASN A O     
1089 C  CB    . ASN E 48  ? 0.1749 0.1794 0.2296 -0.0613 -0.0212 -0.0042 47  ASN A CB    
1090 C  CG    . ASN E 48  ? 0.1944 0.1815 0.2315 -0.0455 -0.0285 0.0152  47  ASN A CG    
1091 O  OD1   . ASN E 48  ? 0.2213 0.1839 0.2814 -0.0345 -0.0375 0.0665  47  ASN A OD1   
1092 N  ND2   . ASN E 48  ? 0.1633 0.1775 0.2198 -0.0118 -0.0525 -0.0224 47  ASN A ND2   
1093 N  N     . TYR E 49  ? 0.2236 0.2420 0.2565 -0.0637 -0.0145 -0.0038 48  TYR A N     
1094 C  CA    . TYR E 49  ? 0.2477 0.2679 0.2586 -0.0649 -0.0089 -0.0035 48  TYR A CA    
1095 C  C     . TYR E 49  ? 0.2550 0.2709 0.2670 -0.0641 -0.0141 -0.0026 48  TYR A C     
1096 O  O     . TYR E 49  ? 0.2683 0.2946 0.2608 -0.0528 -0.0264 -0.0037 48  TYR A O     
1097 C  CB    . TYR E 49  ? 0.2559 0.2671 0.2639 -0.0616 -0.0117 0.0000  48  TYR A CB    
1098 C  CG    . TYR E 49  ? 0.2511 0.3079 0.2766 -0.0916 0.0035  -0.0084 48  TYR A CG    
1099 C  CD1   . TYR E 49  ? 0.2841 0.3025 0.2815 -0.1191 -0.0072 -0.0086 48  TYR A CD1   
1100 C  CD2   . TYR E 49  ? 0.2560 0.3269 0.2774 -0.0982 0.0039  0.0073  48  TYR A CD2   
1101 C  CE1   . TYR E 49  ? 0.2921 0.3432 0.2698 -0.1182 -0.0051 -0.0080 48  TYR A CE1   
1102 C  CE2   . TYR E 49  ? 0.2594 0.3302 0.2708 -0.1080 0.0087  0.0130  48  TYR A CE2   
1103 C  CZ    . TYR E 49  ? 0.2862 0.3379 0.2844 -0.1010 -0.0047 -0.0011 48  TYR A CZ    
1104 O  OH    . TYR E 49  ? 0.2283 0.3172 0.3071 -0.0875 0.0028  0.0166  48  TYR A OH    
1105 N  N     . GLU E 50  ? 0.2526 0.2699 0.2647 -0.0596 -0.0137 0.0030  49  GLU A N     
1106 C  CA    . GLU E 50  ? 0.2430 0.2643 0.2794 -0.0580 -0.0064 -0.0009 49  GLU A CA    
1107 C  C     . GLU E 50  ? 0.2407 0.2576 0.2794 -0.0583 -0.0094 0.0014  49  GLU A C     
1108 O  O     . GLU E 50  ? 0.2296 0.2622 0.2910 -0.0565 -0.0054 -0.0136 49  GLU A O     
1109 C  CB    . GLU E 50  ? 0.2485 0.2590 0.2847 -0.0605 -0.0048 0.0033  49  GLU A CB    
1110 C  CG    . GLU E 50  ? 0.2618 0.2926 0.3366 -0.0650 0.0172  -0.0012 49  GLU A CG    
1111 C  CD    . GLU E 50  ? 0.3027 0.3382 0.4259 -0.0540 0.0135  -0.0341 49  GLU A CD    
1112 O  OE1   . GLU E 50  ? 0.3029 0.3130 0.4318 -0.0735 0.0096  -0.0302 49  GLU A OE1   
1113 O  OE2   . GLU E 50  ? 0.2981 0.4486 0.4438 -0.0580 -0.0050 -0.0494 49  GLU A OE2   
1114 N  N     . ALA E 51  ? 0.2420 0.2699 0.2676 -0.0430 -0.0090 0.0201  50  ALA A N     
1115 C  CA    . ALA E 51  ? 0.2221 0.2723 0.2541 -0.0457 -0.0133 0.0258  50  ALA A CA    
1116 C  C     . ALA E 51  ? 0.2202 0.2762 0.2590 -0.0477 -0.0171 0.0249  50  ALA A C     
1117 O  O     . ALA E 51  ? 0.2260 0.2972 0.2672 -0.0548 -0.0150 0.0344  50  ALA A O     
1118 C  CB    . ALA E 51  ? 0.2048 0.2482 0.2331 -0.0442 -0.0184 0.0296  50  ALA A CB    
1119 N  N     . ARG E 52  ? 0.2300 0.2744 0.2582 -0.0377 -0.0188 0.0133  51  ARG A N     
1120 C  CA    . ARG E 52  ? 0.2282 0.2606 0.2646 -0.0398 -0.0134 0.0158  51  ARG A CA    
1121 C  C     . ARG E 52  ? 0.2277 0.2633 0.2580 -0.0440 -0.0143 0.0168  51  ARG A C     
1122 O  O     . ARG E 52  ? 0.2150 0.2590 0.2561 -0.0452 -0.0105 0.0202  51  ARG A O     
1123 C  CB    . ARG E 52  ? 0.2292 0.2515 0.2844 -0.0436 -0.0167 0.0166  51  ARG A CB    
1124 C  CG    . ARG E 52  ? 0.2454 0.2646 0.3057 -0.0489 -0.0230 0.0020  51  ARG A CG    
1125 C  CD    . ARG E 52  ? 0.2645 0.2177 0.3343 -0.0943 -0.0196 0.0097  51  ARG A CD    
1126 N  NE    . ARG E 52  ? 0.2751 0.2053 0.3420 -0.0859 -0.0264 0.0094  51  ARG A NE    
1127 C  CZ    . ARG E 52  ? 0.2511 0.2051 0.3175 -0.0854 -0.0228 -0.0650 51  ARG A CZ    
1128 N  NH1   . ARG E 52  ? 0.2832 0.2198 0.2687 -0.0243 -0.0310 -0.0986 51  ARG A NH1   
1129 N  NH2   . ARG E 52  ? 0.2396 0.1204 0.3113 -0.1092 0.0183  -0.0777 51  ARG A NH2   
1130 N  N     . LYS E 53  ? 0.2451 0.2680 0.2483 -0.0488 -0.0108 0.0180  52  LYS A N     
1131 C  CA    . LYS E 53  ? 0.2579 0.2641 0.2460 -0.0512 -0.0098 0.0129  52  LYS A CA    
1132 C  C     . LYS E 53  ? 0.2621 0.2708 0.2449 -0.0488 -0.0068 0.0114  52  LYS A C     
1133 O  O     . LYS E 53  ? 0.2620 0.2774 0.2604 -0.0427 -0.0096 0.0072  52  LYS A O     
1134 C  CB    . LYS E 53  ? 0.2612 0.2680 0.2552 -0.0572 -0.0150 0.0129  52  LYS A CB    
1135 C  CG    . LYS E 53  ? 0.2938 0.2823 0.2958 -0.0686 -0.0152 0.0288  52  LYS A CG    
1136 C  CD    . LYS E 53  ? 0.3554 0.2074 0.3655 -0.1325 -0.0483 0.0371  52  LYS A CD    
1137 C  CE    . LYS E 53  ? 0.3517 0.1885 0.3566 -0.1817 -0.0840 0.0349  52  LYS A CE    
1138 N  NZ    . LYS E 53  ? 0.3269 0.2228 0.3929 -0.1905 -0.1095 0.0499  52  LYS A NZ    
1139 N  N     . PHE E 54  ? 0.2717 0.2855 0.2433 -0.0517 -0.0002 0.0134  53  PHE A N     
1140 C  CA    . PHE E 54  ? 0.2799 0.2932 0.2405 -0.0519 0.0004  0.0091  53  PHE A CA    
1141 C  C     . PHE E 54  ? 0.2813 0.2953 0.2469 -0.0477 0.0000  0.0010  53  PHE A C     
1142 O  O     . PHE E 54  ? 0.2896 0.3091 0.2503 -0.0574 0.0064  -0.0089 53  PHE A O     
1143 C  CB    . PHE E 54  ? 0.2834 0.2959 0.2468 -0.0529 0.0037  0.0111  53  PHE A CB    
1144 C  CG    . PHE E 54  ? 0.2788 0.2648 0.2206 -0.0950 -0.0038 0.0232  53  PHE A CG    
1145 C  CD1   . PHE E 54  ? 0.2993 0.2713 0.1982 -0.0953 -0.0234 0.0064  53  PHE A CD1   
1146 C  CD2   . PHE E 54  ? 0.2660 0.2283 0.2213 -0.1347 -0.0099 0.0160  53  PHE A CD2   
1147 C  CE1   . PHE E 54  ? 0.3027 0.2644 0.2261 -0.1473 -0.0354 0.0144  53  PHE A CE1   
1148 C  CE2   . PHE E 54  ? 0.2697 0.2875 0.2464 -0.1324 -0.0398 0.0259  53  PHE A CE2   
1149 C  CZ    . PHE E 54  ? 0.3119 0.2974 0.2578 -0.1595 -0.0485 0.0155  53  PHE A CZ    
1150 N  N     . GLY E 55  ? 0.2756 0.2918 0.2565 -0.0484 0.0034  0.0000  54  GLY A N     
1151 C  CA    . GLY E 55  ? 0.2874 0.2887 0.2659 -0.0400 -0.0046 0.0060  54  GLY A CA    
1152 C  C     . GLY E 55  ? 0.2969 0.2882 0.2843 -0.0382 -0.0100 0.0070  54  GLY A C     
1153 O  O     . GLY E 55  ? 0.2992 0.2969 0.2907 -0.0298 -0.0093 0.0067  54  GLY A O     
1154 N  N     . VAL E 56  ? 0.3068 0.2844 0.2947 -0.0386 -0.0189 0.0114  55  VAL A N     
1155 C  CA    . VAL E 56  ? 0.3062 0.2931 0.3065 -0.0328 -0.0235 0.0141  55  VAL A CA    
1156 C  C     . VAL E 56  ? 0.3110 0.3048 0.3231 -0.0358 -0.0228 0.0156  55  VAL A C     
1157 O  O     . VAL E 56  ? 0.3158 0.2992 0.3447 -0.0307 -0.0255 0.0141  55  VAL A O     
1158 C  CB    . VAL E 56  ? 0.3009 0.2847 0.2967 -0.0376 -0.0238 0.0173  55  VAL A CB    
1159 C  CG1   . VAL E 56  ? 0.2897 0.2553 0.2910 -0.0171 -0.0523 0.0235  55  VAL A CG1   
1160 C  CG2   . VAL E 56  ? 0.3045 0.2682 0.2819 -0.0324 -0.0137 0.0298  55  VAL A CG2   
1161 N  N     . LYS E 57  ? 0.3173 0.3239 0.3268 -0.0317 -0.0242 0.0149  56  LYS A N     
1162 C  CA    . LYS E 57  ? 0.3175 0.3461 0.3221 -0.0291 -0.0226 0.0114  56  LYS A CA    
1163 C  C     . LYS E 57  ? 0.3061 0.3295 0.3160 -0.0261 -0.0170 0.0158  56  LYS A C     
1164 O  O     . LYS E 57  ? 0.2909 0.3293 0.3301 -0.0183 -0.0303 0.0169  56  LYS A O     
1165 C  CB    . LYS E 57  ? 0.3294 0.3711 0.3321 -0.0250 -0.0180 0.0032  56  LYS A CB    
1166 C  CG    . LYS E 57  ? 0.3587 0.4125 0.3638 -0.0037 -0.0396 0.0102  56  LYS A CG    
1167 C  CD    . LYS E 57  ? 0.4307 0.4753 0.3895 0.0084  -0.0383 -0.0182 56  LYS A CD    
1168 C  CE    . LYS E 57  ? 0.4784 0.5520 0.4236 0.0145  -0.0430 -0.0058 56  LYS A CE    
1169 N  NZ    . LYS E 57  ? 0.5271 0.5827 0.4649 0.0208  -0.0384 -0.0212 56  LYS A NZ    
1170 N  N     . ALA E 58  ? 0.3231 0.3213 0.3155 -0.0258 -0.0129 0.0200  57  ALA A N     
1171 C  CA    . ALA E 58  ? 0.3249 0.3055 0.3156 -0.0225 -0.0113 0.0171  57  ALA A CA    
1172 C  C     . ALA E 58  ? 0.3312 0.3029 0.3140 -0.0223 -0.0132 0.0229  57  ALA A C     
1173 O  O     . ALA E 58  ? 0.3484 0.2844 0.3238 -0.0214 -0.0177 0.0196  57  ALA A O     
1174 C  CB    . ALA E 58  ? 0.3166 0.2958 0.3049 -0.0257 0.0001  0.0274  57  ALA A CB    
1175 N  N     . GLY E 59  ? 0.3271 0.3099 0.3144 -0.0220 -0.0102 0.0284  58  GLY A N     
1176 C  CA    . GLY E 59  ? 0.3280 0.3123 0.3312 -0.0231 -0.0119 0.0307  58  GLY A CA    
1177 C  C     . GLY E 59  ? 0.3368 0.3159 0.3475 -0.0201 -0.0163 0.0315  58  GLY A C     
1178 O  O     . GLY E 59  ? 0.3597 0.3280 0.3679 -0.0089 -0.0261 0.0378  58  GLY A O     
1179 N  N     . ILE E 60  ? 0.3266 0.3063 0.3482 -0.0282 -0.0181 0.0285  59  ILE A N     
1180 C  CA    . ILE E 60  ? 0.3159 0.3062 0.3435 -0.0313 -0.0140 0.0237  59  ILE A CA    
1181 C  C     . ILE E 60  ? 0.3135 0.3080 0.3534 -0.0315 -0.0148 0.0157  59  ILE A C     
1182 O  O     . ILE E 60  ? 0.3111 0.2905 0.3572 -0.0394 -0.0186 0.0200  59  ILE A O     
1183 C  CB    . ILE E 60  ? 0.3179 0.2989 0.3418 -0.0296 -0.0167 0.0245  59  ILE A CB    
1184 C  CG1   . ILE E 60  ? 0.3070 0.3001 0.3333 -0.0384 -0.0145 0.0253  59  ILE A CG1   
1185 C  CG2   . ILE E 60  ? 0.2954 0.2850 0.3354 -0.0341 -0.0143 0.0302  59  ILE A CG2   
1186 C  CD1   . ILE E 60  ? 0.3113 0.3087 0.3431 -0.0205 -0.0186 0.0200  59  ILE A CD1   
1187 N  N     . PRO E 61  ? 0.3145 0.3197 0.3608 -0.0305 -0.0103 0.0106  60  PRO A N     
1188 C  CA    . PRO E 61  ? 0.3152 0.3254 0.3706 -0.0294 -0.0085 0.0069  60  PRO A CA    
1189 C  C     . PRO E 61  ? 0.3188 0.3312 0.3793 -0.0284 -0.0098 0.0048  60  PRO A C     
1190 O  O     . PRO E 61  ? 0.3289 0.3284 0.4062 -0.0265 -0.0066 0.0047  60  PRO A O     
1191 C  CB    . PRO E 61  ? 0.3120 0.3298 0.3662 -0.0300 -0.0053 0.0032  60  PRO A CB    
1192 C  CG    . PRO E 61  ? 0.3054 0.3232 0.3634 -0.0293 -0.0164 0.0051  60  PRO A CG    
1193 C  CD    . PRO E 61  ? 0.3069 0.3094 0.3565 -0.0353 -0.0093 0.0109  60  PRO A CD    
1194 N  N     . ILE E 62  ? 0.3183 0.3426 0.3830 -0.0281 -0.0102 0.0026  61  ILE A N     
1195 C  CA    . ILE E 62  ? 0.3178 0.3442 0.3928 -0.0232 -0.0122 0.0068  61  ILE A CA    
1196 C  C     . ILE E 62  ? 0.3267 0.3512 0.4077 -0.0289 -0.0166 0.0047  61  ILE A C     
1197 O  O     . ILE E 62  ? 0.3299 0.3649 0.4226 -0.0195 -0.0210 -0.0006 61  ILE A O     
1198 C  CB    . ILE E 62  ? 0.3113 0.3443 0.3811 -0.0211 -0.0150 0.0073  61  ILE A CB    
1199 C  CG1   . ILE E 62  ? 0.3028 0.3278 0.3775 -0.0144 -0.0164 0.0098  61  ILE A CG1   
1200 C  CG2   . ILE E 62  ? 0.2974 0.3296 0.3873 -0.0171 -0.0138 0.0123  61  ILE A CG2   
1201 C  CD1   . ILE E 62  ? 0.2865 0.3365 0.3788 0.0210  -0.0247 0.0263  61  ILE A CD1   
1202 N  N     . VAL E 63  ? 0.3336 0.3589 0.4154 -0.0256 -0.0168 0.0032  62  VAL A N     
1203 C  CA    . VAL E 63  ? 0.3427 0.3826 0.4216 -0.0263 -0.0157 -0.0010 62  VAL A CA    
1204 C  C     . VAL E 63  ? 0.3456 0.3858 0.4222 -0.0268 -0.0237 0.0013  62  VAL A C     
1205 O  O     . VAL E 63  ? 0.3431 0.3936 0.4218 -0.0345 -0.0166 0.0075  62  VAL A O     
1206 C  CB    . VAL E 63  ? 0.3455 0.3791 0.4241 -0.0285 -0.0165 -0.0062 62  VAL A CB    
1207 C  CG1   . VAL E 63  ? 0.3496 0.3952 0.4119 -0.0321 -0.0110 -0.0046 62  VAL A CG1   
1208 C  CG2   . VAL E 63  ? 0.3602 0.3843 0.4398 -0.0294 -0.0076 -0.0103 62  VAL A CG2   
1209 N  N     . GLU E 64  ? 0.3501 0.3951 0.4142 -0.0245 -0.0323 0.0057  63  GLU A N     
1210 C  CA    . GLU E 64  ? 0.3621 0.3998 0.4164 -0.0273 -0.0450 0.0099  63  GLU A CA    
1211 C  C     . GLU E 64  ? 0.3591 0.3928 0.4122 -0.0339 -0.0459 0.0106  63  GLU A C     
1212 O  O     . GLU E 64  ? 0.3664 0.3878 0.4102 -0.0333 -0.0545 0.0087  63  GLU A O     
1213 C  CB    . GLU E 64  ? 0.3678 0.4125 0.4245 -0.0248 -0.0456 0.0110  63  GLU A CB    
1214 C  CG    . GLU E 64  ? 0.4269 0.4372 0.4444 -0.0283 -0.0658 0.0048  63  GLU A CG    
1215 C  CD    . GLU E 64  ? 0.4741 0.4340 0.4683 -0.0379 -0.0818 -0.0044 63  GLU A CD    
1216 O  OE1   . GLU E 64  ? 0.4808 0.4558 0.4797 -0.0084 -0.0911 -0.0018 63  GLU A OE1   
1217 O  OE2   . GLU E 64  ? 0.5306 0.4249 0.4478 -0.0242 -0.0821 0.0013  63  GLU A OE2   
1218 N  N     . ALA E 65  ? 0.3417 0.3836 0.4025 -0.0362 -0.0461 0.0143  64  ALA A N     
1219 C  CA    . ALA E 65  ? 0.3276 0.3718 0.3900 -0.0395 -0.0492 0.0140  64  ALA A CA    
1220 C  C     . ALA E 65  ? 0.3161 0.3691 0.3788 -0.0423 -0.0501 0.0155  64  ALA A C     
1221 O  O     . ALA E 65  ? 0.3036 0.3722 0.3699 -0.0432 -0.0613 0.0141  64  ALA A O     
1222 C  CB    . ALA E 65  ? 0.3310 0.3617 0.3872 -0.0382 -0.0511 0.0134  64  ALA A CB    
1223 N  N     . LYS E 66  ? 0.3128 0.3616 0.3782 -0.0441 -0.0444 0.0125  65  LYS A N     
1224 C  CA    . LYS E 66  ? 0.3257 0.3670 0.3806 -0.0456 -0.0350 0.0118  65  LYS A CA    
1225 C  C     . LYS E 66  ? 0.3299 0.3673 0.3829 -0.0447 -0.0293 0.0074  65  LYS A C     
1226 O  O     . LYS E 66  ? 0.3290 0.3591 0.3827 -0.0397 -0.0242 0.0063  65  LYS A O     
1227 C  CB    . LYS E 66  ? 0.3246 0.3638 0.3804 -0.0489 -0.0352 0.0146  65  LYS A CB    
1228 C  CG    . LYS E 66  ? 0.3293 0.3794 0.3936 -0.0591 -0.0418 0.0235  65  LYS A CG    
1229 C  CD    . LYS E 66  ? 0.3375 0.4075 0.3932 -0.0387 -0.0526 0.0203  65  LYS A CD    
1230 C  CE    . LYS E 66  ? 0.3445 0.4449 0.4073 -0.0461 -0.0636 0.0206  65  LYS A CE    
1231 N  NZ    . LYS E 66  ? 0.3603 0.4596 0.4468 -0.0653 -0.0787 0.0428  65  LYS A NZ    
1232 N  N     . LYS E 67  ? 0.3315 0.3698 0.3863 -0.0453 -0.0245 0.0031  66  LYS A N     
1233 C  CA    . LYS E 67  ? 0.3441 0.3627 0.3819 -0.0398 -0.0226 -0.0007 66  LYS A CA    
1234 C  C     . LYS E 67  ? 0.3324 0.3533 0.3665 -0.0471 -0.0187 -0.0012 66  LYS A C     
1235 O  O     . LYS E 67  ? 0.3456 0.3524 0.3574 -0.0470 -0.0108 0.0123  66  LYS A O     
1236 C  CB    . LYS E 67  ? 0.3530 0.3696 0.3810 -0.0326 -0.0228 0.0039  66  LYS A CB    
1237 C  CG    . LYS E 67  ? 0.3684 0.3975 0.4016 -0.0250 -0.0244 0.0077  66  LYS A CG    
1238 C  CD    . LYS E 67  ? 0.4284 0.4341 0.4286 -0.0070 -0.0388 0.0194  66  LYS A CD    
1239 C  CE    . LYS E 67  ? 0.4554 0.4552 0.4401 0.0047  -0.0279 0.0311  66  LYS A CE    
1240 N  NZ    . LYS E 67  ? 0.4687 0.4560 0.4564 -0.0055 -0.0400 0.0467  66  LYS A NZ    
1241 N  N     . ILE E 68  ? 0.3061 0.3262 0.3457 -0.0586 -0.0163 -0.0044 67  ILE A N     
1242 C  CA    . ILE E 68  ? 0.2956 0.3138 0.3285 -0.0645 -0.0111 -0.0106 67  ILE A CA    
1243 C  C     . ILE E 68  ? 0.2920 0.3112 0.3236 -0.0643 -0.0107 -0.0101 67  ILE A C     
1244 O  O     . ILE E 68  ? 0.2838 0.2941 0.3086 -0.0698 -0.0092 -0.0035 67  ILE A O     
1245 C  CB    . ILE E 68  ? 0.2955 0.3027 0.3274 -0.0681 -0.0081 -0.0114 67  ILE A CB    
1246 C  CG1   . ILE E 68  ? 0.3043 0.2731 0.3324 -0.0681 -0.0001 -0.0083 67  ILE A CG1   
1247 C  CG2   . ILE E 68  ? 0.2893 0.2978 0.3121 -0.0683 -0.0008 -0.0153 67  ILE A CG2   
1248 C  CD1   . ILE E 68  ? 0.3280 0.2178 0.3311 -0.0644 0.0002  -0.0245 67  ILE A CD1   
1249 N  N     . LEU E 69  ? 0.2815 0.3234 0.3131 -0.0610 -0.0145 -0.0123 68  LEU A N     
1250 C  CA    . LEU E 69  ? 0.2823 0.3281 0.3036 -0.0635 -0.0111 -0.0145 68  LEU A CA    
1251 C  C     . LEU E 69  ? 0.2848 0.3390 0.3168 -0.0631 -0.0120 -0.0174 68  LEU A C     
1252 O  O     . LEU E 69  ? 0.2802 0.3511 0.3266 -0.0691 -0.0226 -0.0120 68  LEU A O     
1253 C  CB    . LEU E 69  ? 0.2743 0.3151 0.2861 -0.0689 -0.0109 -0.0119 68  LEU A CB    
1254 C  CG    . LEU E 69  ? 0.2534 0.3033 0.2438 -0.0782 -0.0114 -0.0110 68  LEU A CG    
1255 C  CD1   . LEU E 69  ? 0.2528 0.2785 0.1958 -0.0830 -0.0379 -0.0131 68  LEU A CD1   
1256 C  CD2   . LEU E 69  ? 0.2029 0.2912 0.1443 -0.0853 -0.0177 0.0387  68  LEU A CD2   
1257 N  N     . PRO E 70  ? 0.2823 0.3407 0.3178 -0.0671 -0.0111 -0.0172 69  PRO A N     
1258 C  CA    . PRO E 70  ? 0.2858 0.3471 0.3236 -0.0613 -0.0145 -0.0199 69  PRO A CA    
1259 C  C     . PRO E 70  ? 0.2918 0.3548 0.3308 -0.0552 -0.0237 -0.0200 69  PRO A C     
1260 O  O     . PRO E 70  ? 0.2968 0.3652 0.3337 -0.0564 -0.0215 -0.0225 69  PRO A O     
1261 C  CB    . PRO E 70  ? 0.2771 0.3402 0.3254 -0.0661 -0.0122 -0.0233 69  PRO A CB    
1262 C  CG    . PRO E 70  ? 0.2741 0.3319 0.3183 -0.0654 -0.0142 -0.0176 69  PRO A CG    
1263 C  CD    . PRO E 70  ? 0.2805 0.3322 0.3149 -0.0670 -0.0109 -0.0234 69  PRO A CD    
1264 N  N     . ASN E 71  ? 0.2975 0.3475 0.3291 -0.0476 -0.0291 -0.0133 70  ASN A N     
1265 C  CA    . ASN E 71  ? 0.2917 0.3389 0.3264 -0.0483 -0.0291 -0.0116 70  ASN A CA    
1266 C  C     . ASN E 71  ? 0.2833 0.3200 0.3153 -0.0504 -0.0331 -0.0047 70  ASN A C     
1267 O  O     . ASN E 71  ? 0.2891 0.3459 0.3356 -0.0557 -0.0503 -0.0038 70  ASN A O     
1268 C  CB    . ASN E 71  ? 0.3000 0.3498 0.3180 -0.0469 -0.0243 -0.0126 70  ASN A CB    
1269 C  CG    . ASN E 71  ? 0.3104 0.3857 0.3281 -0.0589 -0.0166 -0.0238 70  ASN A CG    
1270 O  OD1   . ASN E 71  ? 0.3557 0.4230 0.3150 -0.0528 -0.0268 -0.0305 70  ASN A OD1   
1271 N  ND2   . ASN E 71  ? 0.3169 0.4060 0.3113 -0.0666 -0.0044 -0.0357 70  ASN A ND2   
1272 N  N     . ALA E 72  ? 0.2655 0.2904 0.2854 -0.0459 -0.0287 -0.0012 71  ALA A N     
1273 C  CA    . ALA E 72  ? 0.2483 0.2744 0.2683 -0.0426 -0.0234 -0.0031 71  ALA A CA    
1274 C  C     . ALA E 72  ? 0.2472 0.2712 0.2654 -0.0482 -0.0192 0.0042  71  ALA A C     
1275 O  O     . ALA E 72  ? 0.2479 0.2905 0.2743 -0.0508 -0.0278 -0.0012 71  ALA A O     
1276 C  CB    . ALA E 72  ? 0.2354 0.2596 0.2658 -0.0442 -0.0262 0.0053  71  ALA A CB    
1277 N  N     . VAL E 73  ? 0.2462 0.2569 0.2448 -0.0550 -0.0167 0.0082  72  VAL A N     
1278 C  CA    . VAL E 73  ? 0.2376 0.2344 0.2283 -0.0555 -0.0097 0.0134  72  VAL A CA    
1279 C  C     . VAL E 73  ? 0.2298 0.2212 0.2134 -0.0467 -0.0148 0.0129  72  VAL A C     
1280 O  O     . VAL E 73  ? 0.2171 0.2125 0.2143 -0.0426 -0.0210 0.0196  72  VAL A O     
1281 C  CB    . VAL E 73  ? 0.2448 0.2342 0.2251 -0.0542 -0.0123 0.0159  72  VAL A CB    
1282 C  CG1   . VAL E 73  ? 0.2372 0.2113 0.1995 -0.0659 0.0011  0.0074  72  VAL A CG1   
1283 C  CG2   . VAL E 73  ? 0.2401 0.2071 0.2328 -0.0636 -0.0096 0.0220  72  VAL A CG2   
1284 N  N     . TYR E 74  ? 0.2315 0.2207 0.1965 -0.0520 -0.0124 0.0087  73  TYR A N     
1285 C  CA    . TYR E 74  ? 0.2333 0.2100 0.1935 -0.0597 -0.0024 -0.0002 73  TYR A CA    
1286 C  C     . TYR E 74  ? 0.2357 0.2251 0.2021 -0.0567 -0.0029 0.0027  73  TYR A C     
1287 O  O     . TYR E 74  ? 0.2304 0.2429 0.1986 -0.0663 -0.0022 -0.0115 73  TYR A O     
1288 C  CB    . TYR E 74  ? 0.2318 0.1964 0.1819 -0.0572 -0.0033 0.0063  73  TYR A CB    
1289 C  CG    . TYR E 74  ? 0.2549 0.1837 0.1549 -0.0586 -0.0013 0.0085  73  TYR A CG    
1290 C  CD1   . TYR E 74  ? 0.2963 0.1887 0.1622 -0.0744 -0.0060 0.0045  73  TYR A CD1   
1291 C  CD2   . TYR E 74  ? 0.2479 0.2008 0.1257 -0.0969 0.0032  -0.0046 73  TYR A CD2   
1292 C  CE1   . TYR E 74  ? 0.2865 0.1737 0.1887 -0.0916 -0.0008 0.0066  73  TYR A CE1   
1293 C  CE2   . TYR E 74  ? 0.2781 0.2023 0.1516 -0.0963 -0.0059 0.0017  73  TYR A CE2   
1294 C  CZ    . TYR E 74  ? 0.2802 0.2054 0.1734 -0.1019 -0.0275 -0.0036 73  TYR A CZ    
1295 O  OH    . TYR E 74  ? 0.2334 0.2547 0.1911 -0.0920 -0.0910 -0.0107 73  TYR A OH    
1296 N  N     . LEU E 75  ? 0.2232 0.2280 0.2057 -0.0522 -0.0027 0.0045  74  LEU A N     
1297 C  CA    . LEU E 75  ? 0.2199 0.2213 0.2003 -0.0503 -0.0084 0.0022  74  LEU A CA    
1298 C  C     . LEU E 75  ? 0.2215 0.2272 0.2080 -0.0368 -0.0126 0.0024  74  LEU A C     
1299 O  O     . LEU E 75  ? 0.2104 0.2210 0.1885 -0.0229 -0.0138 0.0110  74  LEU A O     
1300 C  CB    . LEU E 75  ? 0.2132 0.2139 0.1965 -0.0559 -0.0125 0.0057  74  LEU A CB    
1301 C  CG    . LEU E 75  ? 0.2073 0.2564 0.1895 -0.0504 -0.0167 -0.0082 74  LEU A CG    
1302 C  CD1   . LEU E 75  ? 0.2069 0.3128 0.2404 -0.0414 -0.0103 -0.0153 74  LEU A CD1   
1303 C  CD2   . LEU E 75  ? 0.1207 0.2086 0.1108 -0.0924 -0.0382 0.0064  74  LEU A CD2   
1304 N  N     . PRO E 76  ? 0.2362 0.2379 0.2283 -0.0302 -0.0055 0.0006  75  PRO A N     
1305 C  CA    . PRO E 76  ? 0.2498 0.2455 0.2444 -0.0289 -0.0057 0.0000  75  PRO A CA    
1306 C  C     . PRO E 76  ? 0.2693 0.2650 0.2642 -0.0291 -0.0007 0.0000  75  PRO A C     
1307 O  O     . PRO E 76  ? 0.2732 0.2791 0.2881 -0.0327 -0.0043 -0.0035 75  PRO A O     
1308 C  CB    . PRO E 76  ? 0.2539 0.2439 0.2470 -0.0266 -0.0092 -0.0037 75  PRO A CB    
1309 C  CG    . PRO E 76  ? 0.2350 0.2273 0.2268 -0.0302 -0.0029 0.0001  75  PRO A CG    
1310 C  CD    . PRO E 76  ? 0.2284 0.2348 0.2251 -0.0380 -0.0101 -0.0006 75  PRO A CD    
1311 N  N     . MET E 77  ? 0.2904 0.2767 0.2797 -0.0269 0.0038  -0.0028 76  MET A N     
1312 C  CA    . MET E 77  ? 0.2950 0.2857 0.2867 -0.0244 0.0225  -0.0062 76  MET A CA    
1313 C  C     . MET E 77  ? 0.2848 0.2829 0.2870 -0.0264 0.0205  -0.0011 76  MET A C     
1314 O  O     . MET E 77  ? 0.3013 0.3009 0.2965 -0.0291 0.0277  0.0024  76  MET A O     
1315 C  CB    . MET E 77  ? 0.3031 0.3018 0.3006 -0.0164 0.0216  -0.0029 76  MET A CB    
1316 C  CG    . MET E 77  ? 0.3778 0.3610 0.3240 -0.0027 0.0336  -0.0118 76  MET A CG    
1317 S  SD    . MET E 77  ? 0.4813 0.4838 0.3440 0.0352  0.0409  -0.0074 76  MET A SD    
1318 C  CE    . MET E 77  ? 0.4095 0.4549 0.3690 0.0196  0.0730  0.0106  76  MET A CE    
1319 N  N     . ARG E 78  ? 0.2756 0.2758 0.2870 -0.0232 0.0205  -0.0036 77  ARG A N     
1320 C  CA    . ARG E 78  ? 0.2666 0.2576 0.2893 -0.0384 0.0153  -0.0171 77  ARG A CA    
1321 C  C     . ARG E 78  ? 0.2797 0.2677 0.3133 -0.0401 0.0086  -0.0148 77  ARG A C     
1322 O  O     . ARG E 78  ? 0.2832 0.2971 0.3225 -0.0414 0.0178  -0.0156 77  ARG A O     
1323 C  CB    . ARG E 78  ? 0.2598 0.2604 0.2682 -0.0463 0.0075  -0.0250 77  ARG A CB    
1324 C  CG    . ARG E 78  ? 0.2501 0.2246 0.2783 -0.0648 -0.0150 -0.0149 77  ARG A CG    
1325 C  CD    . ARG E 78  ? 0.2542 0.2013 0.2805 -0.0845 -0.0278 -0.0299 77  ARG A CD    
1326 N  NE    . ARG E 78  ? 0.2484 0.2040 0.2859 -0.0829 -0.0514 -0.0153 77  ARG A NE    
1327 C  CZ    . ARG E 78  ? 0.2570 0.1816 0.2830 -0.0915 -0.0403 -0.0327 77  ARG A CZ    
1328 N  NH1   . ARG E 78  ? 0.2625 0.1450 0.2932 -0.1087 -0.0604 -0.0754 77  ARG A NH1   
1329 N  NH2   . ARG E 78  ? 0.2686 0.1767 0.2599 -0.0806 -0.0267 -0.0437 77  ARG A NH2   
1330 N  N     . LYS E 79  ? 0.2826 0.2558 0.3223 -0.0417 0.0066  -0.0119 78  LYS A N     
1331 C  CA    . LYS E 79  ? 0.2812 0.2529 0.3499 -0.0421 0.0108  -0.0109 78  LYS A CA    
1332 C  C     . LYS E 79  ? 0.2746 0.2392 0.3585 -0.0410 0.0043  -0.0172 78  LYS A C     
1333 O  O     . LYS E 79  ? 0.2742 0.2411 0.3770 -0.0651 0.0217  0.0016  78  LYS A O     
1334 C  CB    . LYS E 79  ? 0.2930 0.2729 0.3500 -0.0514 0.0090  -0.0046 78  LYS A CB    
1335 C  CG    . LYS E 79  ? 0.3461 0.2960 0.3685 -0.0574 0.0240  0.0027  78  LYS A CG    
1336 C  CD    . LYS E 79  ? 0.4029 0.3015 0.3733 -0.0455 0.0309  0.0201  78  LYS A CD    
1337 C  CE    . LYS E 79  ? 0.3968 0.3407 0.3747 -0.0285 0.0610  0.0728  78  LYS A CE    
1338 N  NZ    . LYS E 79  ? 0.4109 0.3564 0.3961 -0.0082 0.0580  0.1076  78  LYS A NZ    
1339 N  N     . GLU E 80  ? 0.2640 0.2392 0.3663 -0.0309 -0.0079 -0.0247 79  GLU A N     
1340 C  CA    . GLU E 80  ? 0.2689 0.2466 0.3952 -0.0276 -0.0180 -0.0281 79  GLU A CA    
1341 C  C     . GLU E 80  ? 0.2613 0.2375 0.3826 -0.0250 -0.0138 -0.0395 79  GLU A C     
1342 O  O     . GLU E 80  ? 0.2553 0.2382 0.3997 -0.0146 -0.0080 -0.0503 79  GLU A O     
1343 C  CB    . GLU E 80  ? 0.2653 0.2543 0.4022 -0.0381 -0.0206 -0.0385 79  GLU A CB    
1344 C  CG    . GLU E 80  ? 0.3432 0.3148 0.5001 -0.0387 -0.0408 -0.0104 79  GLU A CG    
1345 C  CD    . GLU E 80  ? 0.4197 0.3929 0.6372 -0.0664 -0.0559 0.0040  79  GLU A CD    
1346 O  OE1   . GLU E 80  ? 0.4951 0.3639 0.6671 -0.0486 -0.0785 0.0362  79  GLU A OE1   
1347 O  OE2   . GLU E 80  ? 0.4041 0.4719 0.6854 -0.0788 -0.0460 -0.0125 79  GLU A OE2   
1348 N  N     . VAL E 81  ? 0.2579 0.2183 0.3537 -0.0144 -0.0161 -0.0453 80  VAL A N     
1349 C  CA    . VAL E 81  ? 0.2408 0.2064 0.3077 -0.0137 -0.0185 -0.0485 80  VAL A CA    
1350 C  C     . VAL E 81  ? 0.2293 0.2030 0.2912 -0.0107 -0.0267 -0.0601 80  VAL A C     
1351 O  O     . VAL E 81  ? 0.2267 0.1963 0.2989 -0.0060 -0.0266 -0.0703 80  VAL A O     
1352 C  CB    . VAL E 81  ? 0.2393 0.2139 0.3105 -0.0139 -0.0215 -0.0467 80  VAL A CB    
1353 C  CG1   . VAL E 81  ? 0.2392 0.1797 0.2969 -0.0063 -0.0158 -0.0665 80  VAL A CG1   
1354 C  CG2   . VAL E 81  ? 0.2147 0.1510 0.2672 -0.0172 -0.0157 -0.0540 80  VAL A CG2   
1355 N  N     . TYR E 82  ? 0.2259 0.2035 0.2691 -0.0142 -0.0286 -0.0586 81  TYR A N     
1356 C  CA    . TYR E 82  ? 0.2215 0.2052 0.2571 -0.0232 -0.0273 -0.0451 81  TYR A CA    
1357 C  C     . TYR E 82  ? 0.2238 0.1966 0.2503 -0.0379 -0.0244 -0.0476 81  TYR A C     
1358 O  O     . TYR E 82  ? 0.2168 0.1715 0.2431 -0.0283 -0.0388 -0.0598 81  TYR A O     
1359 C  CB    . TYR E 82  ? 0.2072 0.2041 0.2482 -0.0213 -0.0330 -0.0403 81  TYR A CB    
1360 C  CG    . TYR E 82  ? 0.2066 0.2332 0.2454 -0.0061 -0.0352 -0.0133 81  TYR A CG    
1361 C  CD1   . TYR E 82  ? 0.2031 0.2766 0.2109 0.0083  -0.0402 -0.0021 81  TYR A CD1   
1362 C  CD2   . TYR E 82  ? 0.1987 0.2849 0.2690 0.0060  -0.0169 0.0271  81  TYR A CD2   
1363 C  CE1   . TYR E 82  ? 0.1891 0.2990 0.2496 0.0186  -0.0438 -0.0067 81  TYR A CE1   
1364 C  CE2   . TYR E 82  ? 0.2085 0.3319 0.2504 0.0115  -0.0205 0.0231  81  TYR A CE2   
1365 C  CZ    . TYR E 82  ? 0.1890 0.3148 0.2465 0.0132  -0.0161 0.0049  81  TYR A CZ    
1366 O  OH    . TYR E 82  ? 0.2013 0.3172 0.2455 -0.0218 -0.0056 -0.0075 81  TYR A OH    
1367 N  N     . GLN E 83  ? 0.2317 0.2064 0.2515 -0.0504 -0.0127 -0.0417 82  GLN A N     
1368 C  CA    . GLN E 83  ? 0.2293 0.2344 0.2405 -0.0628 0.0027  -0.0312 82  GLN A CA    
1369 C  C     . GLN E 83  ? 0.2239 0.2379 0.2337 -0.0727 -0.0005 -0.0268 82  GLN A C     
1370 O  O     . GLN E 83  ? 0.2436 0.2520 0.2417 -0.0738 -0.0019 -0.0248 82  GLN A O     
1371 C  CB    . GLN E 83  ? 0.2234 0.2118 0.2381 -0.0760 0.0122  -0.0277 82  GLN A CB    
1372 C  CG    . GLN E 83  ? 0.2802 0.2814 0.2794 -0.0790 0.0190  -0.0340 82  GLN A CG    
1373 C  CD    . GLN E 83  ? 0.2898 0.3638 0.3141 -0.0863 0.0388  0.0074  82  GLN A CD    
1374 O  OE1   . GLN E 83  ? 0.3375 0.3935 0.3939 -0.1246 -0.0115 0.0202  82  GLN A OE1   
1375 N  NE2   . GLN E 83  ? 0.2312 0.3423 0.3404 -0.1309 0.0993  0.0578  82  GLN A NE2   
1376 N  N     . GLN E 84  ? 0.2120 0.2365 0.2407 -0.0640 -0.0034 -0.0224 83  GLN A N     
1377 C  CA    . GLN E 84  ? 0.2086 0.2300 0.2367 -0.0588 -0.0078 -0.0173 83  GLN A CA    
1378 C  C     . GLN E 84  ? 0.2065 0.2165 0.2156 -0.0525 -0.0050 -0.0196 83  GLN A C     
1379 O  O     . GLN E 84  ? 0.2226 0.2334 0.2107 -0.0413 -0.0155 -0.0285 83  GLN A O     
1380 C  CB    . GLN E 84  ? 0.1938 0.2213 0.2440 -0.0671 -0.0032 -0.0110 83  GLN A CB    
1381 C  CG    . GLN E 84  ? 0.1981 0.2336 0.3021 -0.0550 -0.0122 -0.0025 83  GLN A CG    
1382 C  CD    . GLN E 84  ? 0.2363 0.2534 0.3540 -0.0312 -0.0368 0.0285  83  GLN A CD    
1383 O  OE1   . GLN E 84  ? 0.2602 0.2713 0.3606 -0.0054 -0.0920 0.0581  83  GLN A OE1   
1384 N  NE2   . GLN E 84  ? 0.2114 0.2933 0.3643 -0.0390 -0.0421 0.0642  83  GLN A NE2   
1385 N  N     . VAL E 85  ? 0.2087 0.2178 0.1938 -0.0415 -0.0080 -0.0269 84  VAL A N     
1386 C  CA    . VAL E 85  ? 0.2141 0.2214 0.1791 -0.0367 -0.0185 -0.0248 84  VAL A CA    
1387 C  C     . VAL E 85  ? 0.2191 0.2221 0.1935 -0.0321 -0.0159 -0.0206 84  VAL A C     
1388 O  O     . VAL E 85  ? 0.2338 0.2321 0.2203 -0.0202 -0.0329 -0.0180 84  VAL A O     
1389 C  CB    . VAL E 85  ? 0.2218 0.2150 0.1745 -0.0363 -0.0145 -0.0239 84  VAL A CB    
1390 C  CG1   . VAL E 85  ? 0.2357 0.2361 0.1312 -0.0056 -0.0158 -0.0486 84  VAL A CG1   
1391 C  CG2   . VAL E 85  ? 0.1961 0.2003 0.0923 -0.0401 -0.0354 -0.0424 84  VAL A CG2   
1392 N  N     . SER E 86  ? 0.2260 0.2175 0.2000 -0.0347 -0.0152 -0.0143 85  SER A N     
1393 C  CA    . SER E 86  ? 0.2392 0.2041 0.2049 -0.0297 -0.0154 -0.0142 85  SER A CA    
1394 C  C     . SER E 86  ? 0.2366 0.2084 0.2123 -0.0264 -0.0095 -0.0130 85  SER A C     
1395 O  O     . SER E 86  ? 0.2420 0.2190 0.2237 -0.0249 -0.0112 -0.0073 85  SER A O     
1396 C  CB    . SER E 86  ? 0.2338 0.1950 0.2026 -0.0339 -0.0220 -0.0093 85  SER A CB    
1397 O  OG    . SER E 86  ? 0.2717 0.2055 0.1998 -0.0151 -0.0316 -0.0290 85  SER A OG    
1398 N  N     . SER E 87  ? 0.2484 0.2181 0.2227 -0.0280 -0.0112 -0.0169 86  SER A N     
1399 C  CA    . SER E 87  ? 0.2690 0.2371 0.2514 -0.0187 -0.0032 -0.0233 86  SER A CA    
1400 C  C     . SER E 87  ? 0.2737 0.2401 0.2541 -0.0197 -0.0005 -0.0281 86  SER A C     
1401 O  O     . SER E 87  ? 0.2701 0.2559 0.2499 -0.0237 0.0107  -0.0302 86  SER A O     
1402 C  CB    . SER E 87  ? 0.2836 0.2434 0.2656 -0.0197 -0.0043 -0.0211 86  SER A CB    
1403 O  OG    . SER E 87  ? 0.3091 0.2629 0.3059 0.0021  -0.0070 -0.0271 86  SER A OG    
1404 N  N     . ARG E 88  ? 0.2818 0.2505 0.2683 -0.0124 -0.0125 -0.0376 87  ARG A N     
1405 C  CA    . ARG E 88  ? 0.2742 0.2698 0.2711 -0.0136 -0.0191 -0.0421 87  ARG A CA    
1406 C  C     . ARG E 88  ? 0.2724 0.2832 0.2831 -0.0056 -0.0174 -0.0438 87  ARG A C     
1407 O  O     . ARG E 88  ? 0.2704 0.2888 0.2892 -0.0179 0.0043  -0.0482 87  ARG A O     
1408 C  CB    . ARG E 88  ? 0.2699 0.2702 0.2615 -0.0171 -0.0237 -0.0374 87  ARG A CB    
1409 C  CG    . ARG E 88  ? 0.2570 0.2487 0.2519 -0.0303 -0.0412 -0.0393 87  ARG A CG    
1410 C  CD    . ARG E 88  ? 0.2502 0.2556 0.2218 -0.0732 -0.0646 -0.0532 87  ARG A CD    
1411 N  NE    . ARG E 88  ? 0.2201 0.2980 0.2318 -0.0699 -0.0803 -0.0285 87  ARG A NE    
1412 C  CZ    . ARG E 88  ? 0.1651 0.2834 0.2560 -0.0778 -0.0931 -0.0197 87  ARG A CZ    
1413 N  NH1   . ARG E 88  ? 0.1680 0.2564 0.2788 -0.0726 -0.1063 -0.0045 87  ARG A NH1   
1414 N  NH2   . ARG E 88  ? 0.2174 0.2797 0.2785 -0.0660 -0.0882 0.0104  87  ARG A NH2   
1415 N  N     . ILE E 89  ? 0.2901 0.2895 0.2754 0.0051  -0.0258 -0.0373 88  ILE A N     
1416 C  CA    . ILE E 89  ? 0.2829 0.3119 0.2619 0.0017  -0.0313 -0.0236 88  ILE A CA    
1417 C  C     . ILE E 89  ? 0.2895 0.3242 0.2722 -0.0016 -0.0236 -0.0173 88  ILE A C     
1418 O  O     . ILE E 89  ? 0.3013 0.3472 0.2739 -0.0023 -0.0310 -0.0209 88  ILE A O     
1419 C  CB    . ILE E 89  ? 0.2730 0.3152 0.2605 0.0033  -0.0391 -0.0221 88  ILE A CB    
1420 C  CG1   . ILE E 89  ? 0.2586 0.3132 0.2273 0.0006  -0.0546 -0.0063 88  ILE A CG1   
1421 C  CG2   . ILE E 89  ? 0.2712 0.2795 0.2615 0.0277  -0.0382 -0.0433 88  ILE A CG2   
1422 C  CD1   . ILE E 89  ? 0.1938 0.3190 0.1786 0.0209  -0.0741 -0.0047 88  ILE A CD1   
1423 N  N     . MET E 90  ? 0.2890 0.3190 0.2715 -0.0065 -0.0129 -0.0104 89  MET A N     
1424 C  CA    . MET E 90  ? 0.2895 0.3220 0.2723 -0.0164 -0.0066 -0.0121 89  MET A CA    
1425 C  C     . MET E 90  ? 0.2802 0.3301 0.2621 -0.0185 -0.0029 -0.0143 89  MET A C     
1426 O  O     . MET E 90  ? 0.2894 0.3482 0.2672 -0.0301 -0.0176 -0.0164 89  MET A O     
1427 C  CB    . MET E 90  ? 0.2951 0.3034 0.2816 -0.0169 -0.0033 -0.0087 89  MET A CB    
1428 C  CG    . MET E 90  ? 0.2901 0.2733 0.2619 -0.0326 -0.0010 -0.0087 89  MET A CG    
1429 S  SD    . MET E 90  ? 0.3252 0.2910 0.2728 -0.0903 0.0233  0.0158  89  MET A SD    
1430 C  CE    . MET E 90  ? 0.3317 0.3266 0.2868 -0.0621 -0.0173 -0.0352 89  MET A CE    
1431 N  N     . ASN E 91  ? 0.2768 0.3260 0.2524 -0.0207 0.0071  -0.0283 90  ASN A N     
1432 C  CA    . ASN E 91  ? 0.2797 0.3306 0.2552 -0.0208 0.0138  -0.0298 90  ASN A CA    
1433 C  C     . ASN E 91  ? 0.2870 0.3412 0.2536 -0.0246 0.0155  -0.0334 90  ASN A C     
1434 O  O     . ASN E 91  ? 0.2910 0.3442 0.2389 -0.0337 0.0210  -0.0360 90  ASN A O     
1435 C  CB    . ASN E 91  ? 0.2720 0.3289 0.2653 -0.0177 0.0191  -0.0301 90  ASN A CB    
1436 C  CG    . ASN E 91  ? 0.2984 0.3514 0.2862 -0.0145 0.0198  -0.0461 90  ASN A CG    
1437 O  OD1   . ASN E 91  ? 0.2886 0.3469 0.2982 0.0255  0.0096  -0.0348 90  ASN A OD1   
1438 N  ND2   . ASN E 91  ? 0.2737 0.3489 0.2236 -0.0373 0.0340  -0.0069 90  ASN A ND2   
1439 N  N     . LEU E 92  ? 0.2879 0.3361 0.2476 -0.0193 0.0208  -0.0276 91  LEU A N     
1440 C  CA    . LEU E 92  ? 0.3029 0.3385 0.2733 -0.0113 0.0110  -0.0178 91  LEU A CA    
1441 C  C     . LEU E 92  ? 0.3219 0.3406 0.2764 -0.0096 0.0109  -0.0202 91  LEU A C     
1442 O  O     . LEU E 92  ? 0.3217 0.3218 0.2553 -0.0036 0.0212  -0.0236 91  LEU A O     
1443 C  CB    . LEU E 92  ? 0.2945 0.3452 0.2722 -0.0116 0.0042  -0.0147 91  LEU A CB    
1444 C  CG    . LEU E 92  ? 0.2974 0.3321 0.3098 -0.0011 -0.0061 -0.0166 91  LEU A CG    
1445 C  CD1   . LEU E 92  ? 0.2399 0.3479 0.3300 -0.0162 0.0011  -0.0093 91  LEU A CD1   
1446 C  CD2   . LEU E 92  ? 0.2398 0.2762 0.3058 0.0324  -0.0176 -0.0097 91  LEU A CD2   
1447 N  N     . LEU E 93  ? 0.3424 0.3452 0.2969 -0.0113 0.0059  -0.0175 92  LEU A N     
1448 C  CA    . LEU E 93  ? 0.3648 0.3479 0.3162 -0.0112 0.0108  -0.0105 92  LEU A CA    
1449 C  C     . LEU E 93  ? 0.3864 0.3558 0.3472 -0.0199 0.0057  -0.0055 92  LEU A C     
1450 O  O     . LEU E 93  ? 0.3899 0.3375 0.3426 -0.0122 0.0133  0.0008  92  LEU A O     
1451 C  CB    . LEU E 93  ? 0.3552 0.3243 0.3020 -0.0053 0.0139  -0.0035 92  LEU A CB    
1452 C  CG    . LEU E 93  ? 0.3490 0.3182 0.2795 -0.0016 0.0211  -0.0154 92  LEU A CG    
1453 C  CD1   . LEU E 93  ? 0.3541 0.2497 0.2543 0.0277  0.0388  0.0137  92  LEU A CD1   
1454 C  CD2   . LEU E 93  ? 0.3157 0.3029 0.2331 -0.0130 0.0495  0.0030  92  LEU A CD2   
1455 N  N     . ARG E 94  ? 0.4161 0.3834 0.3795 -0.0230 0.0011  -0.0158 93  ARG A N     
1456 C  CA    . ARG E 94  ? 0.4389 0.4080 0.4144 -0.0318 -0.0047 -0.0148 93  ARG A CA    
1457 C  C     . ARG E 94  ? 0.4319 0.4258 0.4277 -0.0319 -0.0038 -0.0151 93  ARG A C     
1458 O  O     . ARG E 94  ? 0.4494 0.4260 0.4322 -0.0349 -0.0078 -0.0121 93  ARG A O     
1459 C  CB    . ARG E 94  ? 0.4471 0.4052 0.4100 -0.0362 -0.0060 -0.0198 93  ARG A CB    
1460 C  CG    . ARG E 94  ? 0.4617 0.4268 0.4313 -0.0474 -0.0276 -0.0339 93  ARG A CG    
1461 C  CD    . ARG E 94  ? 0.4624 0.4341 0.4825 -0.0592 -0.0254 -0.0479 93  ARG A CD    
1462 N  NE    . ARG E 94  ? 0.4717 0.4715 0.5192 -0.0858 -0.0127 -0.0514 93  ARG A NE    
1463 C  CZ    . ARG E 94  ? 0.4653 0.4543 0.5183 -0.1212 -0.0045 -0.0467 93  ARG A CZ    
1464 N  NH1   . ARG E 94  ? 0.4788 0.4026 0.5062 -0.1510 0.0046  -0.0379 93  ARG A NH1   
1465 N  NH2   . ARG E 94  ? 0.4709 0.4242 0.5229 -0.1540 0.0197  -0.0533 93  ARG A NH2   
1466 N  N     . GLU E 95  ? 0.4380 0.4435 0.4515 -0.0281 -0.0046 -0.0145 94  GLU A N     
1467 C  CA    . GLU E 95  ? 0.4464 0.4630 0.4780 -0.0239 -0.0037 -0.0229 94  GLU A CA    
1468 C  C     . GLU E 95  ? 0.4505 0.4628 0.4892 -0.0195 -0.0083 -0.0258 94  GLU A C     
1469 O  O     . GLU E 95  ? 0.4562 0.4663 0.4989 -0.0179 -0.0109 -0.0290 94  GLU A O     
1470 C  CB    . GLU E 95  ? 0.4438 0.4630 0.4848 -0.0246 -0.0060 -0.0210 94  GLU A CB    
1471 C  CG    . GLU E 95  ? 0.4754 0.5112 0.5048 -0.0201 0.0025  -0.0374 94  GLU A CG    
1472 C  CD    . GLU E 95  ? 0.5138 0.5422 0.5404 -0.0051 0.0044  -0.0478 94  GLU A CD    
1473 O  OE1   . GLU E 95  ? 0.5099 0.5769 0.5617 -0.0033 0.0001  -0.0630 94  GLU A OE1   
1474 O  OE2   . GLU E 95  ? 0.4952 0.5548 0.5179 0.0144  0.0118  -0.0548 94  GLU A OE2   
1475 N  N     . TYR E 96  ? 0.4482 0.4627 0.4982 -0.0178 -0.0096 -0.0220 95  TYR A N     
1476 C  CA    . TYR E 96  ? 0.4457 0.4641 0.4968 -0.0141 -0.0122 -0.0212 95  TYR A CA    
1477 C  C     . TYR E 96  ? 0.4495 0.4660 0.5034 -0.0174 -0.0111 -0.0200 95  TYR A C     
1478 O  O     . TYR E 96  ? 0.4413 0.4809 0.5167 -0.0187 -0.0128 -0.0252 95  TYR A O     
1479 C  CB    . TYR E 96  ? 0.4407 0.4516 0.4873 -0.0096 -0.0131 -0.0202 95  TYR A CB    
1480 C  CG    . TYR E 96  ? 0.4389 0.4421 0.4884 0.0052  -0.0122 -0.0213 95  TYR A CG    
1481 C  CD1   . TYR E 96  ? 0.4309 0.4533 0.4823 0.0166  -0.0150 -0.0103 95  TYR A CD1   
1482 C  CD2   . TYR E 96  ? 0.4422 0.4185 0.4682 0.0362  -0.0112 -0.0185 95  TYR A CD2   
1483 C  CE1   . TYR E 96  ? 0.4429 0.4231 0.4828 0.0318  -0.0176 0.0031  95  TYR A CE1   
1484 C  CE2   . TYR E 96  ? 0.4770 0.4281 0.4773 0.0403  -0.0055 -0.0122 95  TYR A CE2   
1485 C  CZ    . TYR E 96  ? 0.4761 0.4358 0.4916 0.0356  -0.0161 0.0093  95  TYR A CZ    
1486 O  OH    . TYR E 96  ? 0.5187 0.4544 0.5298 0.0338  -0.0463 0.0269  95  TYR A OH    
1487 N  N     . SER E 97  ? 0.4578 0.4656 0.5085 -0.0224 -0.0079 -0.0185 96  SER A N     
1488 C  CA    . SER E 97  ? 0.4579 0.4618 0.5029 -0.0255 -0.0065 -0.0137 96  SER A CA    
1489 C  C     . SER E 97  ? 0.4534 0.4596 0.5037 -0.0243 -0.0028 -0.0072 96  SER A C     
1490 O  O     . SER E 97  ? 0.4458 0.4653 0.5214 -0.0227 -0.0028 -0.0056 96  SER A O     
1491 C  CB    . SER E 97  ? 0.4563 0.4606 0.4992 -0.0259 -0.0058 -0.0141 96  SER A CB    
1492 O  OG    . SER E 97  ? 0.4338 0.4498 0.4968 -0.0334 0.0025  -0.0315 96  SER A OG    
1493 N  N     . GLU E 98  ? 0.4555 0.4613 0.5027 -0.0309 0.0008  -0.0026 97  GLU A N     
1494 C  CA    . GLU E 98  ? 0.4492 0.4607 0.5035 -0.0336 0.0029  -0.0039 97  GLU A CA    
1495 C  C     . GLU E 98  ? 0.4403 0.4477 0.4838 -0.0365 0.0092  -0.0034 97  GLU A C     
1496 O  O     . GLU E 98  ? 0.4452 0.4466 0.4936 -0.0408 0.0157  0.0006  97  GLU A O     
1497 C  CB    . GLU E 98  ? 0.4556 0.4694 0.5033 -0.0374 0.0056  -0.0019 97  GLU A CB    
1498 C  CG    . GLU E 98  ? 0.4571 0.5092 0.5219 -0.0367 0.0048  -0.0041 97  GLU A CG    
1499 C  CD    . GLU E 98  ? 0.4805 0.5487 0.5342 -0.0222 0.0036  -0.0256 97  GLU A CD    
1500 O  OE1   . GLU E 98  ? 0.4926 0.5917 0.5501 -0.0288 -0.0283 -0.0375 97  GLU A OE1   
1501 O  OE2   . GLU E 98  ? 0.4934 0.5989 0.5282 -0.0455 -0.0059 -0.0384 97  GLU A OE2   
1502 N  N     . LYS E 99  ? 0.4239 0.4254 0.4588 -0.0388 0.0100  -0.0007 98  LYS A N     
1503 C  CA    . LYS E 99  ? 0.4012 0.3990 0.4331 -0.0460 0.0180  0.0021  98  LYS A CA    
1504 C  C     . LYS E 99  ? 0.3912 0.3716 0.4114 -0.0449 0.0140  0.0027  98  LYS A C     
1505 O  O     . LYS E 99  ? 0.3880 0.3688 0.4202 -0.0540 0.0093  0.0057  98  LYS A O     
1506 C  CB    . LYS E 99  ? 0.4079 0.3996 0.4277 -0.0477 0.0165  0.0045  98  LYS A CB    
1507 C  CG    . LYS E 99  ? 0.4041 0.4011 0.4399 -0.0564 0.0323  0.0119  98  LYS A CG    
1508 C  CD    . LYS E 99  ? 0.4027 0.4093 0.4620 -0.0802 0.0557  0.0108  98  LYS A CD    
1509 C  CE    . LYS E 99  ? 0.4039 0.4129 0.4850 -0.1034 0.0516  0.0370  98  LYS A CE    
1510 N  NZ    . LYS E 99  ? 0.3522 0.3934 0.4956 -0.1065 0.0596  0.0355  98  LYS A NZ    
1511 N  N     . ILE E 100 ? 0.3671 0.3425 0.3642 -0.0516 0.0165  0.0067  99  ILE A N     
1512 C  CA    . ILE E 100 ? 0.3503 0.3070 0.3335 -0.0460 0.0104  0.0075  99  ILE A CA    
1513 C  C     . ILE E 100 ? 0.3426 0.2959 0.3311 -0.0493 0.0090  0.0111  99  ILE A C     
1514 O  O     . ILE E 100 ? 0.3492 0.2951 0.3382 -0.0452 0.0060  0.0045  99  ILE A O     
1515 C  CB    . ILE E 100 ? 0.3467 0.3084 0.3222 -0.0514 0.0080  0.0070  99  ILE A CB    
1516 C  CG1   . ILE E 100 ? 0.3211 0.3051 0.3080 -0.0563 0.0053  0.0004  99  ILE A CG1   
1517 C  CG2   . ILE E 100 ? 0.3452 0.2740 0.2826 -0.0494 0.0160  0.0078  99  ILE A CG2   
1518 C  CD1   . ILE E 100 ? 0.2757 0.2457 0.3224 -0.0550 -0.0191 -0.0153 99  ILE A CD1   
1519 N  N     . GLU E 101 ? 0.3152 0.2685 0.3073 -0.0562 0.0148  0.0173  100 GLU A N     
1520 C  CA    . GLU E 101 ? 0.3057 0.2569 0.3020 -0.0528 0.0213  0.0222  100 GLU A CA    
1521 C  C     . GLU E 101 ? 0.3009 0.2564 0.3029 -0.0496 0.0230  0.0252  100 GLU A C     
1522 O  O     . GLU E 101 ? 0.2795 0.2641 0.3065 -0.0606 0.0224  0.0314  100 GLU A O     
1523 C  CB    . GLU E 101 ? 0.3046 0.2530 0.3006 -0.0492 0.0197  0.0307  100 GLU A CB    
1524 C  CG    . GLU E 101 ? 0.2992 0.3028 0.3168 -0.0177 0.0285  0.0256  100 GLU A CG    
1525 C  CD    . GLU E 101 ? 0.3216 0.3715 0.3526 0.0054  0.0296  0.0330  100 GLU A CD    
1526 O  OE1   . GLU E 101 ? 0.3072 0.3782 0.3699 0.0015  0.0423  0.0779  100 GLU A OE1   
1527 O  OE2   . GLU E 101 ? 0.3280 0.4060 0.3964 0.0150  0.0201  0.0067  100 GLU A OE2   
1528 N  N     . ILE E 102 ? 0.3016 0.2501 0.3083 -0.0473 0.0260  0.0336  101 ILE A N     
1529 C  CA    . ILE E 102 ? 0.3067 0.2565 0.3150 -0.0454 0.0195  0.0420  101 ILE A CA    
1530 C  C     . ILE E 102 ? 0.3158 0.2499 0.3214 -0.0438 0.0099  0.0469  101 ILE A C     
1531 O  O     . ILE E 102 ? 0.3303 0.2477 0.3420 -0.0423 0.0044  0.0491  101 ILE A O     
1532 C  CB    . ILE E 102 ? 0.3088 0.2565 0.3085 -0.0459 0.0247  0.0405  101 ILE A CB    
1533 C  CG1   . ILE E 102 ? 0.2846 0.2625 0.3035 -0.0662 0.0345  0.0454  101 ILE A CG1   
1534 C  CG2   . ILE E 102 ? 0.3011 0.2641 0.3282 -0.0492 0.0367  0.0386  101 ILE A CG2   
1535 C  CD1   . ILE E 102 ? 0.2917 0.2453 0.3203 -0.0829 0.0592  0.0523  101 ILE A CD1   
1536 N  N     . ALA E 103 ? 0.3105 0.2282 0.3015 -0.0445 0.0087  0.0560  102 ALA A N     
1537 C  CA    . ALA E 103 ? 0.3023 0.2230 0.2740 -0.0376 0.0030  0.0559  102 ALA A CA    
1538 C  C     . ALA E 103 ? 0.3034 0.2352 0.2767 -0.0231 -0.0113 0.0477  102 ALA A C     
1539 O  O     . ALA E 103 ? 0.3116 0.2687 0.2919 -0.0220 -0.0320 0.0497  102 ALA A O     
1540 C  CB    . ALA E 103 ? 0.3095 0.2163 0.2576 -0.0420 0.0086  0.0652  102 ALA A CB    
1541 N  N     . SER E 104 ? 0.2873 0.2228 0.2471 -0.0193 -0.0135 0.0466  103 SER A N     
1542 C  CA    . SER E 104 ? 0.2718 0.2182 0.2521 -0.0170 -0.0156 0.0407  103 SER A CA    
1543 C  C     . SER E 104 ? 0.2636 0.2177 0.2495 -0.0209 -0.0095 0.0241  103 SER A C     
1544 O  O     . SER E 104 ? 0.2561 0.2217 0.2659 -0.0195 -0.0057 0.0212  103 SER A O     
1545 C  CB    . SER E 104 ? 0.2875 0.2214 0.2541 -0.0116 -0.0315 0.0288  103 SER A CB    
1546 O  OG    . SER E 104 ? 0.2935 0.2560 0.2973 0.0160  -0.0474 0.0408  103 SER A OG    
1547 N  N     . ILE E 105 ? 0.2562 0.2028 0.2284 -0.0246 -0.0006 0.0269  104 ILE A N     
1548 C  CA    . ILE E 105 ? 0.2624 0.2037 0.2195 -0.0227 0.0006  0.0280  104 ILE A CA    
1549 C  C     . ILE E 105 ? 0.2702 0.2213 0.2222 -0.0177 -0.0016 0.0230  104 ILE A C     
1550 O  O     . ILE E 105 ? 0.2706 0.2228 0.2259 -0.0117 -0.0135 0.0377  104 ILE A O     
1551 C  CB    . ILE E 105 ? 0.2623 0.2084 0.2166 -0.0206 -0.0011 0.0228  104 ILE A CB    
1552 C  CG1   . ILE E 105 ? 0.2832 0.2370 0.2098 -0.0291 0.0049  0.0148  104 ILE A CG1   
1553 C  CG2   . ILE E 105 ? 0.2584 0.1739 0.2082 -0.0144 -0.0132 0.0508  104 ILE A CG2   
1554 C  CD1   . ILE E 105 ? 0.3193 0.2479 0.2497 0.0083  0.0134  0.0021  104 ILE A CD1   
1555 N  N     . ASP E 106 ? 0.2756 0.2220 0.2164 -0.0206 0.0055  0.0152  105 ASP A N     
1556 C  CA    . ASP E 106 ? 0.2822 0.2234 0.2148 -0.0270 -0.0011 0.0202  105 ASP A CA    
1557 C  C     . ASP E 106 ? 0.2771 0.2207 0.2090 -0.0243 -0.0027 0.0160  105 ASP A C     
1558 O  O     . ASP E 106 ? 0.2876 0.2025 0.2024 -0.0183 0.0006  0.0220  105 ASP A O     
1559 C  CB    . ASP E 106 ? 0.2804 0.2371 0.2184 -0.0272 0.0177  0.0257  105 ASP A CB    
1560 C  CG    . ASP E 106 ? 0.3168 0.2513 0.2307 -0.0301 0.0170  0.0309  105 ASP A CG    
1561 O  OD1   . ASP E 106 ? 0.3298 0.2818 0.1770 -0.0113 0.0550  0.0418  105 ASP A OD1   
1562 O  OD2   . ASP E 106 ? 0.3598 0.3270 0.3406 -0.0512 0.0408  0.0283  105 ASP A OD2   
1563 N  N     . GLU E 107 ? 0.2656 0.2249 0.2139 -0.0348 -0.0134 0.0105  106 GLU A N     
1564 C  CA    . GLU E 107 ? 0.2724 0.2432 0.2442 -0.0340 -0.0159 0.0070  106 GLU A CA    
1565 C  C     . GLU E 107 ? 0.2841 0.2380 0.2370 -0.0295 -0.0205 0.0034  106 GLU A C     
1566 O  O     . GLU E 107 ? 0.2994 0.2488 0.2456 -0.0294 -0.0240 0.0015  106 GLU A O     
1567 C  CB    . GLU E 107 ? 0.2900 0.2477 0.2513 -0.0405 -0.0153 0.0057  106 GLU A CB    
1568 C  CG    . GLU E 107 ? 0.3324 0.3233 0.3441 -0.0434 -0.0252 0.0182  106 GLU A CG    
1569 C  CD    . GLU E 107 ? 0.3604 0.4023 0.4200 -0.0875 -0.0183 0.0247  106 GLU A CD    
1570 O  OE1   . GLU E 107 ? 0.3413 0.4457 0.5054 -0.0943 0.0384  0.0125  106 GLU A OE1   
1571 O  OE2   . GLU E 107 ? 0.4325 0.4331 0.4556 -0.0637 0.0257  0.0314  106 GLU A OE2   
1572 N  N     . ALA E 108 ? 0.2783 0.2279 0.2196 -0.0243 -0.0279 0.0029  107 ALA A N     
1573 C  CA    . ALA E 108 ? 0.2751 0.2365 0.2100 -0.0180 -0.0208 -0.0026 107 ALA A CA    
1574 C  C     . ALA E 108 ? 0.2791 0.2250 0.2123 -0.0116 -0.0221 -0.0134 107 ALA A C     
1575 O  O     . ALA E 108 ? 0.2803 0.2145 0.2193 -0.0062 -0.0225 -0.0194 107 ALA A O     
1576 C  CB    . ALA E 108 ? 0.2887 0.2342 0.2186 -0.0117 -0.0260 0.0005  107 ALA A CB    
1577 N  N     . TYR E 109 ? 0.2648 0.2591 0.2050 -0.0115 -0.0093 -0.0183 108 TYR A N     
1578 C  CA    . TYR E 109 ? 0.2665 0.2659 0.1969 -0.0215 -0.0041 -0.0077 108 TYR A CA    
1579 C  C     . TYR E 109 ? 0.2802 0.2746 0.2028 -0.0238 -0.0016 -0.0035 108 TYR A C     
1580 O  O     . TYR E 109 ? 0.2933 0.2762 0.1801 -0.0234 -0.0047 0.0062  108 TYR A O     
1581 C  CB    . TYR E 109 ? 0.2526 0.2618 0.2023 -0.0192 -0.0049 -0.0081 108 TYR A CB    
1582 C  CG    . TYR E 109 ? 0.2454 0.2784 0.2000 -0.0258 0.0001  -0.0002 108 TYR A CG    
1583 C  CD1   . TYR E 109 ? 0.2235 0.3075 0.1444 -0.0430 0.0010  0.0096  108 TYR A CD1   
1584 C  CD2   . TYR E 109 ? 0.2246 0.3069 0.2632 -0.0299 -0.0079 0.0056  108 TYR A CD2   
1585 C  CE1   . TYR E 109 ? 0.2164 0.3383 0.1753 -0.0459 -0.0197 -0.0180 108 TYR A CE1   
1586 C  CE2   . TYR E 109 ? 0.2259 0.3185 0.2807 -0.0474 -0.0336 0.0018  108 TYR A CE2   
1587 C  CZ    . TYR E 109 ? 0.2297 0.3600 0.2275 -0.0355 -0.0513 -0.0183 108 TYR A CZ    
1588 O  OH    . TYR E 109 ? 0.2741 0.4088 0.2907 -0.0613 -0.0809 0.0063  108 TYR A OH    
1589 N  N     . LEU E 110 ? 0.2836 0.2703 0.2190 -0.0190 0.0105  -0.0002 109 LEU A N     
1590 C  CA    . LEU E 110 ? 0.2970 0.2802 0.2504 -0.0250 0.0111  0.0008  109 LEU A CA    
1591 C  C     . LEU E 110 ? 0.3150 0.2917 0.2710 -0.0215 0.0227  0.0027  109 LEU A C     
1592 O  O     . LEU E 110 ? 0.3257 0.3085 0.2953 -0.0234 0.0265  0.0054  109 LEU A O     
1593 C  CB    . LEU E 110 ? 0.2969 0.2704 0.2508 -0.0312 0.0103  -0.0031 109 LEU A CB    
1594 C  CG    . LEU E 110 ? 0.2705 0.2617 0.2399 -0.0443 0.0048  -0.0102 109 LEU A CG    
1595 C  CD1   . LEU E 110 ? 0.2557 0.2211 0.2236 -0.0477 -0.0219 -0.0512 109 LEU A CD1   
1596 C  CD2   . LEU E 110 ? 0.2705 0.2713 0.2871 -0.0442 -0.0145 -0.0309 109 LEU A CD2   
1597 N  N     . ASP E 111 ? 0.3296 0.3056 0.2872 -0.0118 0.0308  0.0125  110 ASP A N     
1598 C  CA    . ASP E 111 ? 0.3492 0.3226 0.2997 -0.0096 0.0393  0.0183  110 ASP A CA    
1599 C  C     . ASP E 111 ? 0.3578 0.3270 0.3085 -0.0107 0.0382  0.0245  110 ASP A C     
1600 O  O     . ASP E 111 ? 0.3642 0.3266 0.3093 -0.0145 0.0342  0.0316  110 ASP A O     
1601 C  CB    . ASP E 111 ? 0.3559 0.3274 0.3038 -0.0047 0.0428  0.0156  110 ASP A CB    
1602 C  CG    . ASP E 111 ? 0.3794 0.3564 0.3161 0.0119  0.0585  0.0178  110 ASP A CG    
1603 O  OD1   . ASP E 111 ? 0.3897 0.3690 0.3293 0.0278  0.0602  0.0416  110 ASP A OD1   
1604 O  OD2   . ASP E 111 ? 0.3789 0.4031 0.3302 0.0373  0.0541  0.0042  110 ASP A OD2   
1605 N  N     . ILE E 112 ? 0.3709 0.3460 0.3256 -0.0061 0.0385  0.0235  111 ILE A N     
1606 C  CA    . ILE E 112 ? 0.3831 0.3626 0.3474 -0.0010 0.0347  0.0218  111 ILE A CA    
1607 C  C     . ILE E 112 ? 0.4057 0.3738 0.3706 0.0046  0.0337  0.0188  111 ILE A C     
1608 O  O     . ILE E 112 ? 0.4156 0.3766 0.3810 0.0087  0.0264  0.0200  111 ILE A O     
1609 C  CB    . ILE E 112 ? 0.3787 0.3597 0.3384 0.0002  0.0318  0.0207  111 ILE A CB    
1610 C  CG1   . ILE E 112 ? 0.3675 0.3547 0.3139 -0.0040 0.0367  0.0198  111 ILE A CG1   
1611 C  CG2   . ILE E 112 ? 0.3508 0.3555 0.3331 0.0061  0.0378  0.0143  111 ILE A CG2   
1612 C  CD1   . ILE E 112 ? 0.3131 0.3063 0.2811 -0.0092 0.0371  -0.0134 111 ILE A CD1   
1613 N  N     . SER E 113 ? 0.4282 0.3880 0.3884 0.0033  0.0296  0.0249  112 SER A N     
1614 C  CA    . SER E 113 ? 0.4495 0.4037 0.4173 -0.0004 0.0276  0.0270  112 SER A CA    
1615 C  C     . SER E 113 ? 0.4629 0.4239 0.4444 0.0012  0.0203  0.0266  112 SER A C     
1616 O  O     . SER E 113 ? 0.4691 0.4199 0.4471 0.0008  0.0229  0.0286  112 SER A O     
1617 C  CB    . SER E 113 ? 0.4489 0.4021 0.4123 -0.0009 0.0252  0.0299  112 SER A CB    
1618 O  OG    . SER E 113 ? 0.4451 0.3706 0.3816 0.0023  0.0437  0.0429  112 SER A OG    
1619 N  N     . ASP E 114 ? 0.4835 0.4548 0.4664 0.0002  0.0104  0.0206  113 ASP A N     
1620 C  CA    . ASP E 114 ? 0.4926 0.4806 0.4944 0.0004  0.0081  0.0166  113 ASP A CA    
1621 C  C     . ASP E 114 ? 0.4924 0.4888 0.5095 0.0026  0.0074  0.0158  113 ASP A C     
1622 O  O     . ASP E 114 ? 0.4871 0.4882 0.5200 0.0031  0.0056  0.0155  113 ASP A O     
1623 C  CB    . ASP E 114 ? 0.4988 0.4898 0.4958 -0.0027 0.0075  0.0123  113 ASP A CB    
1624 C  CG    . ASP E 114 ? 0.5198 0.5101 0.5141 -0.0006 0.0056  0.0098  113 ASP A CG    
1625 O  OD1   . ASP E 114 ? 0.5086 0.5457 0.5274 0.0000  0.0214  -0.0106 113 ASP A OD1   
1626 O  OD2   . ASP E 114 ? 0.5551 0.5484 0.5215 -0.0025 0.0194  -0.0093 113 ASP A OD2   
1627 N  N     . LYS E 115 ? 0.4948 0.5014 0.5156 -0.0001 0.0126  0.0164  114 LYS A N     
1628 C  CA    . LYS E 115 ? 0.4934 0.5100 0.5254 0.0025  0.0135  0.0124  114 LYS A CA    
1629 C  C     . LYS E 115 ? 0.4951 0.5146 0.5257 0.0073  0.0178  0.0088  114 LYS A C     
1630 O  O     . LYS E 115 ? 0.4885 0.5157 0.5206 0.0098  0.0225  0.0108  114 LYS A O     
1631 C  CB    . LYS E 115 ? 0.4995 0.5070 0.5258 0.0024  0.0108  0.0083  114 LYS A CB    
1632 C  CG    . LYS E 115 ? 0.4898 0.5125 0.5493 0.0037  0.0047  0.0107  114 LYS A CG    
1633 C  CD    . LYS E 115 ? 0.4717 0.5254 0.5635 0.0012  -0.0034 0.0098  114 LYS A CD    
1634 C  CE    . LYS E 115 ? 0.4823 0.5372 0.5924 0.0037  -0.0138 -0.0012 114 LYS A CE    
1635 N  NZ    . LYS E 115 ? 0.4871 0.5645 0.5970 0.0109  -0.0286 0.0035  114 LYS A NZ    
1636 N  N     . VAL E 116 ? 0.5034 0.5191 0.5239 0.0081  0.0200  0.0064  115 VAL A N     
1637 C  CA    . VAL E 116 ? 0.5159 0.5177 0.5294 0.0075  0.0181  0.0087  115 VAL A CA    
1638 C  C     . VAL E 116 ? 0.5277 0.5309 0.5367 0.0090  0.0172  0.0054  115 VAL A C     
1639 O  O     . VAL E 116 ? 0.5303 0.5351 0.5330 0.0109  0.0153  0.0056  115 VAL A O     
1640 C  CB    . VAL E 116 ? 0.5101 0.5107 0.5266 0.0080  0.0209  0.0111  115 VAL A CB    
1641 C  CG1   . VAL E 116 ? 0.4950 0.4888 0.5198 0.0101  0.0210  -0.0010 115 VAL A CG1   
1642 C  CG2   . VAL E 116 ? 0.4995 0.4905 0.5101 0.0071  0.0316  0.0152  115 VAL A CG2   
1643 N  N     . ARG E 117 ? 0.5401 0.5408 0.5471 0.0124  0.0115  0.0026  116 ARG A N     
1644 C  CA    . ARG E 117 ? 0.5524 0.5475 0.5555 0.0123  0.0097  0.0021  116 ARG A CA    
1645 C  C     . ARG E 117 ? 0.5536 0.5425 0.5493 0.0144  0.0104  -0.0003 116 ARG A C     
1646 O  O     . ARG E 117 ? 0.5579 0.5476 0.5487 0.0155  0.0112  -0.0054 116 ARG A O     
1647 C  CB    . ARG E 117 ? 0.5515 0.5547 0.5643 0.0143  0.0094  0.0015  116 ARG A CB    
1648 C  CG    . ARG E 117 ? 0.5688 0.5665 0.5841 0.0105  -0.0065 0.0093  116 ARG A CG    
1649 C  CD    . ARG E 117 ? 0.5868 0.5760 0.6408 0.0242  -0.0166 -0.0006 116 ARG A CD    
1650 N  NE    . ARG E 117 ? 0.6118 0.5952 0.6786 0.0276  -0.0400 -0.0114 116 ARG A NE    
1651 C  CZ    . ARG E 117 ? 0.6110 0.6154 0.7044 0.0266  -0.0491 -0.0099 116 ARG A CZ    
1652 N  NH1   . ARG E 117 ? 0.6070 0.6009 0.7237 0.0269  -0.0527 -0.0082 116 ARG A NH1   
1653 N  NH2   . ARG E 117 ? 0.6110 0.6237 0.7178 0.0228  -0.0576 -0.0105 116 ARG A NH2   
1654 N  N     . ASP E 118 ? 0.5466 0.5338 0.5477 0.0150  0.0135  -0.0053 117 ASP A N     
1655 C  CA    . ASP E 118 ? 0.5396 0.5241 0.5390 0.0188  0.0172  -0.0082 117 ASP A CA    
1656 C  C     . ASP E 118 ? 0.5355 0.5173 0.5300 0.0239  0.0192  -0.0120 117 ASP A C     
1657 O  O     . ASP E 118 ? 0.5253 0.5130 0.5314 0.0293  0.0198  -0.0099 117 ASP A O     
1658 C  CB    . ASP E 118 ? 0.5406 0.5266 0.5385 0.0176  0.0192  -0.0057 117 ASP A CB    
1659 C  CG    . ASP E 118 ? 0.5537 0.5192 0.5425 0.0159  0.0125  -0.0090 117 ASP A CG    
1660 O  OD1   . ASP E 118 ? 0.5612 0.5043 0.5290 0.0166  0.0088  -0.0101 117 ASP A OD1   
1661 O  OD2   . ASP E 118 ? 0.5827 0.5162 0.5257 0.0171  0.0126  -0.0062 117 ASP A OD2   
1662 N  N     . TYR E 119 ? 0.5329 0.5059 0.5170 0.0242  0.0261  -0.0180 118 TYR A N     
1663 C  CA    . TYR E 119 ? 0.5332 0.4942 0.5114 0.0247  0.0266  -0.0219 118 TYR A CA    
1664 C  C     . TYR E 119 ? 0.5291 0.4964 0.5111 0.0205  0.0256  -0.0194 118 TYR A C     
1665 O  O     . TYR E 119 ? 0.5247 0.4876 0.4997 0.0231  0.0326  -0.0231 118 TYR A O     
1666 C  CB    . TYR E 119 ? 0.5328 0.4934 0.5032 0.0285  0.0303  -0.0258 118 TYR A CB    
1667 C  CG    . TYR E 119 ? 0.5330 0.4773 0.4947 0.0351  0.0386  -0.0389 118 TYR A CG    
1668 C  CD1   . TYR E 119 ? 0.5447 0.4835 0.4803 0.0325  0.0459  -0.0462 118 TYR A CD1   
1669 C  CD2   . TYR E 119 ? 0.5371 0.4620 0.4939 0.0378  0.0482  -0.0440 118 TYR A CD2   
1670 C  CE1   . TYR E 119 ? 0.5265 0.4554 0.4773 0.0466  0.0615  -0.0657 118 TYR A CE1   
1671 C  CE2   . TYR E 119 ? 0.5321 0.4625 0.4690 0.0363  0.0515  -0.0552 118 TYR A CE2   
1672 C  CZ    . TYR E 119 ? 0.5147 0.4666 0.4714 0.0443  0.0691  -0.0432 118 TYR A CZ    
1673 O  OH    . TYR E 119 ? 0.5171 0.4397 0.4752 0.0475  0.0998  -0.0433 118 TYR A OH    
1674 N  N     . ARG E 120 ? 0.5234 0.5007 0.5119 0.0153  0.0215  -0.0169 119 ARG A N     
1675 C  CA    . ARG E 120 ? 0.5163 0.4979 0.5019 0.0125  0.0201  -0.0096 119 ARG A CA    
1676 C  C     . ARG E 120 ? 0.5086 0.4860 0.4957 0.0145  0.0268  -0.0123 119 ARG A C     
1677 O  O     . ARG E 120 ? 0.5084 0.4928 0.4946 0.0164  0.0304  -0.0190 119 ARG A O     
1678 C  CB    . ARG E 120 ? 0.5170 0.5044 0.4999 0.0090  0.0191  -0.0085 119 ARG A CB    
1679 C  CG    . ARG E 120 ? 0.5355 0.5358 0.5163 -0.0036 0.0093  0.0122  119 ARG A CG    
1680 C  CD    . ARG E 120 ? 0.5140 0.5819 0.5073 -0.0119 0.0027  0.0360  119 ARG A CD    
1681 N  NE    . ARG E 120 ? 0.5249 0.6219 0.5374 -0.0311 -0.0219 0.0435  119 ARG A NE    
1682 C  CZ    . ARG E 120 ? 0.5252 0.6442 0.5597 -0.0427 -0.0326 0.0491  119 ARG A CZ    
1683 N  NH1   . ARG E 120 ? 0.5248 0.6569 0.5590 -0.0559 -0.0325 0.0438  119 ARG A NH1   
1684 N  NH2   . ARG E 120 ? 0.5216 0.6439 0.5886 -0.0463 -0.0490 0.0510  119 ARG A NH2   
1685 N  N     . GLU E 121 ? 0.5039 0.4776 0.4865 0.0156  0.0256  -0.0188 120 GLU A N     
1686 C  CA    . GLU E 121 ? 0.4990 0.4615 0.4809 0.0143  0.0253  -0.0183 120 GLU A CA    
1687 C  C     . GLU E 121 ? 0.4898 0.4422 0.4661 0.0102  0.0233  -0.0163 120 GLU A C     
1688 O  O     . GLU E 121 ? 0.4891 0.4310 0.4633 0.0156  0.0281  -0.0173 120 GLU A O     
1689 C  CB    . GLU E 121 ? 0.5051 0.4653 0.4849 0.0117  0.0262  -0.0168 120 GLU A CB    
1690 C  CG    . GLU E 121 ? 0.5271 0.4741 0.5151 0.0215  0.0153  -0.0153 120 GLU A CG    
1691 C  CD    . GLU E 121 ? 0.5611 0.4977 0.5405 0.0170  0.0183  -0.0063 120 GLU A CD    
1692 O  OE1   . GLU E 121 ? 0.5695 0.4752 0.5473 0.0378  0.0206  0.0081  120 GLU A OE1   
1693 O  OE2   . GLU E 121 ? 0.5964 0.5101 0.5489 0.0213  0.0076  -0.0194 120 GLU A OE2   
1694 N  N     . ALA E 122 ? 0.4761 0.4188 0.4442 0.0041  0.0243  -0.0144 121 ALA A N     
1695 C  CA    . ALA E 122 ? 0.4646 0.4059 0.4191 -0.0011 0.0256  -0.0121 121 ALA A CA    
1696 C  C     . ALA E 122 ? 0.4611 0.4036 0.4128 -0.0042 0.0254  -0.0126 121 ALA A C     
1697 O  O     . ALA E 122 ? 0.4548 0.3982 0.4049 -0.0033 0.0325  -0.0140 121 ALA A O     
1698 C  CB    . ALA E 122 ? 0.4616 0.3927 0.4086 0.0006  0.0231  -0.0130 121 ALA A CB    
1699 N  N     . TYR E 123 ? 0.4542 0.4023 0.3932 -0.0041 0.0264  -0.0065 122 TYR A N     
1700 C  CA    . TYR E 123 ? 0.4456 0.3950 0.3846 -0.0024 0.0236  -0.0012 122 TYR A CA    
1701 C  C     . TYR E 123 ? 0.4383 0.3971 0.3901 0.0000  0.0219  0.0005  122 TYR A C     
1702 O  O     . TYR E 123 ? 0.4350 0.4117 0.3898 0.0047  0.0255  -0.0001 122 TYR A O     
1703 C  CB    . TYR E 123 ? 0.4437 0.3901 0.3746 0.0001  0.0294  -0.0058 122 TYR A CB    
1704 C  CG    . TYR E 123 ? 0.4398 0.3829 0.3679 0.0081  0.0289  -0.0127 122 TYR A CG    
1705 C  CD1   . TYR E 123 ? 0.4488 0.3808 0.3572 0.0020  0.0432  -0.0283 122 TYR A CD1   
1706 C  CD2   . TYR E 123 ? 0.4315 0.3578 0.3765 0.0149  0.0305  0.0091  122 TYR A CD2   
1707 C  CE1   . TYR E 123 ? 0.4732 0.3442 0.3524 0.0137  0.0395  -0.0138 122 TYR A CE1   
1708 C  CE2   . TYR E 123 ? 0.4470 0.3616 0.3871 0.0174  0.0250  -0.0054 122 TYR A CE2   
1709 C  CZ    . TYR E 123 ? 0.4610 0.3495 0.3727 0.0162  0.0246  -0.0145 122 TYR A CZ    
1710 O  OH    . TYR E 123 ? 0.4913 0.3112 0.3594 0.0179  0.0178  0.0013  122 TYR A OH    
1711 N  N     . ASN E 124 ? 0.4297 0.3797 0.3829 0.0043  0.0193  0.0007  123 ASN A N     
1712 C  CA    . ASN E 124 ? 0.4294 0.3574 0.3746 0.0059  0.0172  0.0064  123 ASN A CA    
1713 C  C     . ASN E 124 ? 0.4201 0.3395 0.3648 0.0148  0.0250  0.0076  123 ASN A C     
1714 O  O     . ASN E 124 ? 0.4238 0.3339 0.3473 0.0194  0.0281  0.0031  123 ASN A O     
1715 C  CB    . ASN E 124 ? 0.4325 0.3570 0.3765 0.0127  0.0145  0.0077  123 ASN A CB    
1716 C  CG    . ASN E 124 ? 0.4593 0.3781 0.3908 -0.0109 -0.0023 0.0140  123 ASN A CG    
1717 O  OD1   . ASN E 124 ? 0.4581 0.4124 0.3645 -0.0052 0.0027  0.0336  123 ASN A OD1   
1718 N  ND2   . ASN E 124 ? 0.4775 0.3856 0.3825 -0.0382 -0.0076 0.0295  123 ASN A ND2   
1719 N  N     . LEU E 125 ? 0.4002 0.3073 0.3525 0.0173  0.0287  0.0110  124 LEU A N     
1720 C  CA    . LEU E 125 ? 0.3825 0.2923 0.3422 0.0123  0.0258  0.0148  124 LEU A CA    
1721 C  C     . LEU E 125 ? 0.3787 0.2678 0.3322 0.0179  0.0241  0.0145  124 LEU A C     
1722 O  O     . LEU E 125 ? 0.3850 0.2600 0.3457 0.0157  0.0281  0.0076  124 LEU A O     
1723 C  CB    . LEU E 125 ? 0.3741 0.3002 0.3428 0.0156  0.0257  0.0102  124 LEU A CB    
1724 C  CG    . LEU E 125 ? 0.3672 0.3261 0.3489 0.0054  0.0166  0.0250  124 LEU A CG    
1725 C  CD1   . LEU E 125 ? 0.3313 0.3713 0.3357 -0.0040 0.0159  0.0272  124 LEU A CD1   
1726 C  CD2   . LEU E 125 ? 0.3363 0.3660 0.3326 -0.0138 0.0363  0.0334  124 LEU A CD2   
1727 N  N     . GLY E 126 ? 0.3639 0.2506 0.3130 0.0215  0.0157  0.0238  125 GLY A N     
1728 C  CA    . GLY E 126 ? 0.3578 0.2345 0.3110 0.0179  0.0157  0.0189  125 GLY A CA    
1729 C  C     . GLY E 126 ? 0.3569 0.2447 0.3307 0.0159  0.0198  0.0095  125 GLY A C     
1730 O  O     . GLY E 126 ? 0.3685 0.2516 0.3397 0.0123  0.0159  0.0073  125 GLY A O     
1731 N  N     . LEU E 127 ? 0.3483 0.2359 0.3276 0.0186  0.0202  0.0132  126 LEU A N     
1732 C  CA    . LEU E 127 ? 0.3376 0.2405 0.3297 0.0152  0.0265  0.0050  126 LEU A CA    
1733 C  C     . LEU E 127 ? 0.3347 0.2407 0.3268 0.0138  0.0204  0.0040  126 LEU A C     
1734 O  O     . LEU E 127 ? 0.3218 0.2358 0.3139 0.0158  0.0171  0.0125  126 LEU A O     
1735 C  CB    . LEU E 127 ? 0.3334 0.2357 0.3320 0.0123  0.0278  0.0034  126 LEU A CB    
1736 C  CG    . LEU E 127 ? 0.3206 0.2236 0.3267 0.0062  0.0504  -0.0036 126 LEU A CG    
1737 C  CD1   . LEU E 127 ? 0.2840 0.2344 0.3041 -0.0085 0.0797  0.0312  126 LEU A CD1   
1738 C  CD2   . LEU E 127 ? 0.3063 0.1749 0.2584 0.0250  0.0783  -0.0186 126 LEU A CD2   
1739 N  N     . GLU E 128 ? 0.3369 0.2518 0.3218 0.0151  0.0244  -0.0009 127 GLU A N     
1740 C  CA    . GLU E 128 ? 0.3475 0.2808 0.3194 0.0103  0.0135  -0.0005 127 GLU A CA    
1741 C  C     . GLU E 128 ? 0.3588 0.2912 0.3041 0.0060  0.0129  0.0030  127 GLU A C     
1742 O  O     . GLU E 128 ? 0.3672 0.3084 0.2983 0.0010  0.0108  0.0071  127 GLU A O     
1743 C  CB    . GLU E 128 ? 0.3439 0.2846 0.3175 0.0094  0.0209  -0.0032 127 GLU A CB    
1744 C  CG    . GLU E 128 ? 0.3775 0.3429 0.3843 -0.0024 0.0152  -0.0200 127 GLU A CG    
1745 C  CD    . GLU E 128 ? 0.3954 0.4232 0.4798 -0.0302 0.0184  -0.0409 127 GLU A CD    
1746 O  OE1   . GLU E 128 ? 0.4151 0.4702 0.5141 -0.0024 0.0232  -0.0608 127 GLU A OE1   
1747 O  OE2   . GLU E 128 ? 0.4227 0.4230 0.5175 -0.0419 -0.0010 -0.0505 127 GLU A OE2   
1748 N  N     . ILE E 129 ? 0.3507 0.2826 0.2968 0.0081  0.0087  0.0059  128 ILE A N     
1749 C  CA    . ILE E 129 ? 0.3499 0.2814 0.2808 0.0084  0.0101  0.0105  128 ILE A CA    
1750 C  C     . ILE E 129 ? 0.3532 0.2849 0.2763 0.0100  0.0097  0.0092  128 ILE A C     
1751 O  O     . ILE E 129 ? 0.3687 0.2866 0.2798 0.0147  0.0089  0.0072  128 ILE A O     
1752 C  CB    . ILE E 129 ? 0.3547 0.2858 0.2865 0.0065  0.0140  0.0154  128 ILE A CB    
1753 C  CG1   . ILE E 129 ? 0.3544 0.2880 0.2695 0.0149  0.0496  0.0280  128 ILE A CG1   
1754 C  CG2   . ILE E 129 ? 0.3409 0.2591 0.2358 0.0251  0.0186  0.0130  128 ILE A CG2   
1755 C  CD1   . ILE E 129 ? 0.3208 0.3059 0.3008 0.0653  0.0483  0.0085  128 ILE A CD1   
1756 N  N     . LYS E 130 ? 0.3438 0.2895 0.2715 0.0083  0.0114  0.0084  129 LYS A N     
1757 C  CA    . LYS E 130 ? 0.3343 0.2955 0.2732 0.0110  0.0142  -0.0006 129 LYS A CA    
1758 C  C     . LYS E 130 ? 0.3298 0.2964 0.2666 0.0143  0.0094  -0.0003 129 LYS A C     
1759 O  O     . LYS E 130 ? 0.3387 0.2927 0.2581 0.0085  0.0086  -0.0009 129 LYS A O     
1760 C  CB    . LYS E 130 ? 0.3377 0.2955 0.2714 0.0152  0.0166  -0.0120 129 LYS A CB    
1761 C  CG    . LYS E 130 ? 0.3184 0.2825 0.2957 0.0189  0.0087  -0.0143 129 LYS A CG    
1762 C  CD    . LYS E 130 ? 0.3031 0.2456 0.3268 0.0470  0.0208  -0.0295 129 LYS A CD    
1763 C  CE    . LYS E 130 ? 0.3033 0.2433 0.3734 0.0405  0.0523  -0.0531 129 LYS A CE    
1764 N  NZ    . LYS E 130 ? 0.3030 0.2366 0.4714 0.0567  0.0343  -0.0139 129 LYS A NZ    
1765 N  N     . ASN E 131 ? 0.3224 0.3034 0.2645 0.0188  0.0102  0.0049  130 ASN A N     
1766 C  CA    . ASN E 131 ? 0.3231 0.3059 0.2667 0.0289  0.0041  0.0018  130 ASN A CA    
1767 C  C     . ASN E 131 ? 0.3171 0.3020 0.2646 0.0429  0.0005  0.0030  130 ASN A C     
1768 O  O     . ASN E 131 ? 0.3194 0.3050 0.2615 0.0519  0.0106  0.0081  130 ASN A O     
1769 C  CB    . ASN E 131 ? 0.3343 0.3170 0.2695 0.0247  0.0135  -0.0015 130 ASN A CB    
1770 C  CG    . ASN E 131 ? 0.3653 0.3544 0.2811 0.0111  0.0163  -0.0124 130 ASN A CG    
1771 O  OD1   . ASN E 131 ? 0.3885 0.3953 0.2331 -0.0040 0.0383  -0.0149 130 ASN A OD1   
1772 N  ND2   . ASN E 131 ? 0.3783 0.3771 0.3182 0.0176  0.0363  -0.0063 130 ASN A ND2   
1773 N  N     . LYS E 132 ? 0.3000 0.2904 0.2573 0.0476  -0.0039 0.0054  131 LYS A N     
1774 C  CA    . LYS E 132 ? 0.3151 0.2977 0.2628 0.0488  -0.0218 0.0040  131 LYS A CA    
1775 C  C     . LYS E 132 ? 0.3145 0.3045 0.2580 0.0502  -0.0300 0.0006  131 LYS A C     
1776 O  O     . LYS E 132 ? 0.3265 0.3077 0.2659 0.0592  -0.0377 0.0049  131 LYS A O     
1777 C  CB    . LYS E 132 ? 0.3216 0.3152 0.2720 0.0495  -0.0195 -0.0001 131 LYS A CB    
1778 C  CG    . LYS E 132 ? 0.3403 0.3048 0.3088 0.0397  -0.0473 0.0154  131 LYS A CG    
1779 C  CD    . LYS E 132 ? 0.3651 0.3563 0.3560 0.0801  -0.0572 0.0657  131 LYS A CD    
1780 C  CE    . LYS E 132 ? 0.3734 0.4034 0.3999 0.0973  -0.0525 0.0638  131 LYS A CE    
1781 N  NZ    . LYS E 132 ? 0.3815 0.4101 0.4180 0.1272  -0.0721 0.0610  131 LYS A NZ    
1782 N  N     . ILE E 133 ? 0.3115 0.2926 0.2413 0.0520  -0.0412 -0.0028 132 ILE A N     
1783 C  CA    . ILE E 133 ? 0.3029 0.2786 0.2332 0.0436  -0.0421 0.0077  132 ILE A CA    
1784 C  C     . ILE E 133 ? 0.3062 0.3031 0.2532 0.0368  -0.0380 0.0102  132 ILE A C     
1785 O  O     . ILE E 133 ? 0.3121 0.3028 0.2570 0.0430  -0.0506 0.0032  132 ILE A O     
1786 C  CB    . ILE E 133 ? 0.3003 0.2669 0.2322 0.0448  -0.0393 0.0075  132 ILE A CB    
1787 C  CG1   . ILE E 133 ? 0.2977 0.2202 0.1972 0.0613  -0.0452 0.0055  132 ILE A CG1   
1788 C  CG2   . ILE E 133 ? 0.3039 0.2179 0.2007 0.0549  -0.0426 0.0199  132 ILE A CG2   
1789 C  CD1   . ILE E 133 ? 0.3110 0.1155 0.1211 0.0874  -0.0029 -0.0450 132 ILE A CD1   
1790 N  N     . LEU E 134 ? 0.3133 0.3108 0.2627 0.0339  -0.0280 0.0126  133 LEU A N     
1791 C  CA    . LEU E 134 ? 0.3179 0.3304 0.2886 0.0241  -0.0001 0.0233  133 LEU A CA    
1792 C  C     . LEU E 134 ? 0.3230 0.3593 0.3097 0.0249  0.0020  0.0335  133 LEU A C     
1793 O  O     . LEU E 134 ? 0.3313 0.3557 0.3219 0.0205  0.0101  0.0470  133 LEU A O     
1794 C  CB    . LEU E 134 ? 0.3185 0.3167 0.2844 0.0247  0.0133  0.0353  133 LEU A CB    
1795 C  CG    . LEU E 134 ? 0.3179 0.2951 0.3084 0.0253  0.0284  0.0263  133 LEU A CG    
1796 C  CD1   . LEU E 134 ? 0.3060 0.2156 0.2724 0.0198  0.0517  0.0560  133 LEU A CD1   
1797 C  CD2   . LEU E 134 ? 0.2948 0.2639 0.2884 0.0171  0.0531  0.0379  133 LEU A CD2   
1798 N  N     . GLU E 135 ? 0.3253 0.3927 0.3297 0.0248  0.0002  0.0283  134 GLU A N     
1799 C  CA    . GLU E 135 ? 0.3292 0.4106 0.3369 0.0163  -0.0084 0.0250  134 GLU A CA    
1800 C  C     . GLU E 135 ? 0.3358 0.4045 0.3301 0.0053  -0.0112 0.0230  134 GLU A C     
1801 O  O     . GLU E 135 ? 0.3481 0.4087 0.3377 -0.0021 -0.0232 0.0370  134 GLU A O     
1802 C  CB    . GLU E 135 ? 0.3305 0.4168 0.3592 0.0200  -0.0121 0.0267  134 GLU A CB    
1803 C  CG    . GLU E 135 ? 0.3379 0.4991 0.3827 0.0241  -0.0111 0.0369  134 GLU A CG    
1804 C  CD    . GLU E 135 ? 0.3266 0.5631 0.4371 0.0537  -0.0058 0.0435  134 GLU A CD    
1805 O  OE1   . GLU E 135 ? 0.3113 0.5755 0.4296 0.0665  -0.0101 0.0503  134 GLU A OE1   
1806 O  OE2   . GLU E 135 ? 0.3333 0.5960 0.4434 0.0602  -0.0081 0.0674  134 GLU A OE2   
1807 N  N     . LYS E 136 ? 0.3264 0.3982 0.3204 -0.0029 -0.0140 0.0190  135 LYS A N     
1808 C  CA    . LYS E 136 ? 0.3154 0.3990 0.3018 -0.0121 -0.0233 0.0054  135 LYS A CA    
1809 C  C     . LYS E 136 ? 0.3071 0.3961 0.2898 -0.0167 -0.0213 0.0001  135 LYS A C     
1810 O  O     . LYS E 136 ? 0.3144 0.4103 0.2897 -0.0242 -0.0295 0.0067  135 LYS A O     
1811 C  CB    . LYS E 136 ? 0.3121 0.3980 0.3035 -0.0206 -0.0224 0.0032  135 LYS A CB    
1812 C  CG    . LYS E 136 ? 0.3058 0.4143 0.3167 -0.0364 -0.0324 0.0006  135 LYS A CG    
1813 C  CD    . LYS E 136 ? 0.3279 0.4395 0.3594 -0.0489 -0.0443 -0.0252 135 LYS A CD    
1814 C  CE    . LYS E 136 ? 0.3176 0.4130 0.3926 -0.0576 -0.0367 -0.0438 135 LYS A CE    
1815 N  NZ    . LYS E 136 ? 0.3417 0.3870 0.4509 -0.0679 -0.0472 -0.0500 135 LYS A NZ    
1816 N  N     . GLU E 137 ? 0.2987 0.3814 0.2705 -0.0131 -0.0236 -0.0073 136 GLU A N     
1817 C  CA    . GLU E 137 ? 0.2921 0.3698 0.2583 -0.0079 -0.0326 -0.0095 136 GLU A CA    
1818 C  C     . GLU E 137 ? 0.2853 0.3462 0.2418 0.0056  -0.0190 0.0021  136 GLU A C     
1819 O  O     . GLU E 137 ? 0.2742 0.3496 0.2307 0.0146  -0.0265 0.0116  136 GLU A O     
1820 C  CB    . GLU E 137 ? 0.3017 0.3670 0.2660 -0.0112 -0.0330 -0.0120 136 GLU A CB    
1821 C  CG    . GLU E 137 ? 0.3062 0.4263 0.2847 -0.0386 -0.0481 -0.0414 136 GLU A CG    
1822 C  CD    . GLU E 137 ? 0.3658 0.4813 0.3068 -0.0360 -0.0553 -0.0758 136 GLU A CD    
1823 O  OE1   . GLU E 137 ? 0.3851 0.5313 0.2561 -0.0244 -0.0673 -0.0578 136 GLU A OE1   
1824 O  OE2   . GLU E 137 ? 0.4469 0.4878 0.3394 -0.0707 -0.0760 -0.1101 136 GLU A OE2   
1825 N  N     . LYS E 138 ? 0.2910 0.3409 0.2460 0.0018  -0.0113 0.0027  137 LYS A N     
1826 C  CA    . LYS E 138 ? 0.2784 0.3242 0.2550 0.0088  0.0061  0.0091  137 LYS A CA    
1827 C  C     . LYS E 138 ? 0.2543 0.3073 0.2491 0.0080  0.0144  0.0098  137 LYS A C     
1828 O  O     . LYS E 138 ? 0.2759 0.3185 0.2560 0.0077  0.0208  -0.0013 137 LYS A O     
1829 C  CB    . LYS E 138 ? 0.2829 0.3227 0.2755 0.0160  0.0204  0.0075  137 LYS A CB    
1830 C  CG    . LYS E 138 ? 0.3165 0.3361 0.3474 0.0208  0.0197  0.0187  137 LYS A CG    
1831 C  CD    . LYS E 138 ? 0.3639 0.3597 0.3661 0.0353  0.0390  0.0145  137 LYS A CD    
1832 C  CE    . LYS E 138 ? 0.3975 0.3961 0.4504 0.0346  0.0378  0.0420  137 LYS A CE    
1833 N  NZ    . LYS E 138 ? 0.3859 0.3636 0.4327 0.0756  0.0498  0.0833  137 LYS A NZ    
1834 N  N     . ILE E 139 ? 0.2260 0.2703 0.2155 0.0172  0.0190  0.0138  138 ILE A N     
1835 C  CA    . ILE E 139 ? 0.2177 0.2395 0.1953 0.0088  0.0285  0.0241  138 ILE A CA    
1836 C  C     . ILE E 139 ? 0.2238 0.2263 0.1957 0.0138  0.0203  0.0298  138 ILE A C     
1837 O  O     . ILE E 139 ? 0.2412 0.2226 0.1635 0.0065  0.0265  0.0414  138 ILE A O     
1838 C  CB    . ILE E 139 ? 0.2059 0.2349 0.1982 -0.0032 0.0317  0.0203  138 ILE A CB    
1839 C  CG1   . ILE E 139 ? 0.1952 0.2498 0.1963 -0.0032 0.0546  0.0431  138 ILE A CG1   
1840 C  CG2   . ILE E 139 ? 0.2052 0.2090 0.1785 0.0039  0.0285  0.0180  138 ILE A CG2   
1841 C  CD1   . ILE E 139 ? 0.1952 0.2982 0.2355 0.0164  0.0753  0.0345  138 ILE A CD1   
1842 N  N     . THR E 140 ? 0.2271 0.2169 0.1887 0.0125  0.0144  0.0288  139 THR A N     
1843 C  CA    . THR E 140 ? 0.2403 0.2359 0.2212 0.0096  0.0100  0.0292  139 THR A CA    
1844 C  C     . THR E 140 ? 0.2465 0.2506 0.2195 0.0120  0.0070  0.0208  139 THR A C     
1845 O  O     . THR E 140 ? 0.2306 0.2773 0.2229 0.0104  0.0023  0.0183  139 THR A O     
1846 C  CB    . THR E 140 ? 0.2469 0.2386 0.2288 0.0119  0.0074  0.0276  139 THR A CB    
1847 O  OG1   . THR E 140 ? 0.2098 0.2481 0.2590 0.0333  0.0109  0.0187  139 THR A OG1   
1848 C  CG2   . THR E 140 ? 0.2354 0.1847 0.2232 0.0188  0.0208  0.0558  139 THR A CG2   
1849 N  N     . VAL E 141 ? 0.2431 0.2504 0.2105 0.0150  0.0173  0.0035  140 VAL A N     
1850 C  CA    . VAL E 141 ? 0.2581 0.2591 0.2142 0.0066  0.0240  -0.0106 140 VAL A CA    
1851 C  C     . VAL E 141 ? 0.2779 0.2655 0.2172 0.0061  0.0252  -0.0095 140 VAL A C     
1852 O  O     . VAL E 141 ? 0.2755 0.2650 0.2136 0.0016  0.0286  0.0001  140 VAL A O     
1853 C  CB    . VAL E 141 ? 0.2542 0.2622 0.2168 0.0065  0.0281  -0.0135 140 VAL A CB    
1854 C  CG1   . VAL E 141 ? 0.2463 0.2463 0.2090 0.0075  0.0249  -0.0256 140 VAL A CG1   
1855 C  CG2   . VAL E 141 ? 0.2704 0.2830 0.1545 -0.0007 0.0287  -0.0182 140 VAL A CG2   
1856 N  N     . THR E 142 ? 0.3048 0.2674 0.2340 -0.0006 0.0264  -0.0056 141 THR A N     
1857 C  CA    . THR E 142 ? 0.3269 0.2765 0.2244 -0.0062 0.0251  -0.0142 141 THR A CA    
1858 C  C     . THR E 142 ? 0.3507 0.2854 0.2334 -0.0032 0.0216  -0.0195 141 THR A C     
1859 O  O     . THR E 142 ? 0.3719 0.3061 0.2444 0.0076  0.0074  -0.0222 141 THR A O     
1860 C  CB    . THR E 142 ? 0.3261 0.2813 0.2244 -0.0032 0.0238  -0.0135 141 THR A CB    
1861 O  OG1   . THR E 142 ? 0.3181 0.2736 0.2236 -0.0188 0.0337  -0.0056 141 THR A OG1   
1862 C  CG2   . THR E 142 ? 0.3274 0.2904 0.2204 -0.0165 0.0267  -0.0120 141 THR A CG2   
1863 N  N     . VAL E 143 ? 0.3574 0.2919 0.2396 -0.0055 0.0253  -0.0249 142 VAL A N     
1864 C  CA    . VAL E 143 ? 0.3633 0.3017 0.2292 -0.0093 0.0323  -0.0275 142 VAL A CA    
1865 C  C     . VAL E 143 ? 0.3682 0.3026 0.2440 -0.0100 0.0305  -0.0228 142 VAL A C     
1866 O  O     . VAL E 143 ? 0.3663 0.3052 0.2433 -0.0008 0.0411  -0.0251 142 VAL A O     
1867 C  CB    . VAL E 143 ? 0.3662 0.3043 0.2305 -0.0106 0.0317  -0.0242 142 VAL A CB    
1868 C  CG1   . VAL E 143 ? 0.3763 0.3159 0.1870 -0.0031 0.0485  -0.0376 142 VAL A CG1   
1869 C  CG2   . VAL E 143 ? 0.3667 0.2766 0.1897 -0.0058 0.0448  -0.0295 142 VAL A CG2   
1870 N  N     . GLY E 144 ? 0.3658 0.3018 0.2497 -0.0141 0.0339  -0.0183 143 GLY A N     
1871 C  CA    . GLY E 144 ? 0.3736 0.3051 0.2447 -0.0229 0.0295  -0.0171 143 GLY A CA    
1872 C  C     . GLY E 144 ? 0.3846 0.3144 0.2557 -0.0261 0.0198  -0.0133 143 GLY A C     
1873 O  O     . GLY E 144 ? 0.4033 0.3132 0.2589 -0.0312 0.0139  -0.0008 143 GLY A O     
1874 N  N     . ILE E 145 ? 0.3722 0.3148 0.2379 -0.0255 0.0236  -0.0240 144 ILE A N     
1875 C  CA    . ILE E 145 ? 0.3611 0.3145 0.2417 -0.0272 0.0259  -0.0228 144 ILE A CA    
1876 C  C     . ILE E 145 ? 0.3571 0.3253 0.2594 -0.0249 0.0343  -0.0247 144 ILE A C     
1877 O  O     . ILE E 145 ? 0.3411 0.3229 0.2396 -0.0278 0.0450  -0.0333 144 ILE A O     
1878 C  CB    . ILE E 145 ? 0.3696 0.3165 0.2416 -0.0313 0.0212  -0.0225 144 ILE A CB    
1879 C  CG1   . ILE E 145 ? 0.3806 0.3102 0.2198 -0.0308 0.0299  -0.0193 144 ILE A CG1   
1880 C  CG2   . ILE E 145 ? 0.3638 0.3221 0.2143 -0.0267 0.0205  -0.0242 144 ILE A CG2   
1881 C  CD1   . ILE E 145 ? 0.4190 0.2626 0.2065 -0.0161 -0.0015 -0.0309 144 ILE A CD1   
1882 N  N     . SER E 146 ? 0.3627 0.3287 0.2729 -0.0230 0.0308  -0.0218 145 SER A N     
1883 C  CA    . SER E 146 ? 0.3774 0.3471 0.2821 -0.0250 0.0252  -0.0168 145 SER A CA    
1884 C  C     . SER E 146 ? 0.3814 0.3651 0.2968 -0.0275 0.0241  -0.0181 145 SER A C     
1885 O  O     . SER E 146 ? 0.3844 0.3781 0.2918 -0.0303 0.0211  -0.0216 145 SER A O     
1886 C  CB    . SER E 146 ? 0.3751 0.3460 0.2906 -0.0236 0.0300  -0.0179 145 SER A CB    
1887 O  OG    . SER E 146 ? 0.3973 0.3468 0.2788 -0.0197 0.0293  -0.0049 145 SER A OG    
1888 N  N     . LYS E 147 ? 0.3848 0.3751 0.2883 -0.0274 0.0221  -0.0140 146 LYS A N     
1889 C  CA    . LYS E 147 ? 0.3934 0.3906 0.2971 -0.0283 0.0194  -0.0103 146 LYS A CA    
1890 C  C     . LYS E 147 ? 0.3967 0.3910 0.2947 -0.0276 0.0172  -0.0082 146 LYS A C     
1891 O  O     . LYS E 147 ? 0.4007 0.3954 0.2925 -0.0255 0.0198  -0.0009 146 LYS A O     
1892 C  CB    . LYS E 147 ? 0.3965 0.3967 0.3026 -0.0311 0.0184  -0.0117 146 LYS A CB    
1893 C  CG    . LYS E 147 ? 0.3968 0.4186 0.3135 -0.0263 0.0179  -0.0119 146 LYS A CG    
1894 C  CD    . LYS E 147 ? 0.3927 0.4528 0.3192 -0.0429 0.0316  -0.0160 146 LYS A CD    
1895 C  CE    . LYS E 147 ? 0.3900 0.4665 0.3260 -0.0451 0.0412  -0.0083 146 LYS A CE    
1896 N  NZ    . LYS E 147 ? 0.3689 0.4934 0.3305 -0.0515 0.0720  -0.0058 146 LYS A NZ    
1897 N  N     . ASN E 148 ? 0.3979 0.3971 0.2943 -0.0291 0.0151  -0.0062 147 ASN A N     
1898 C  CA    . ASN E 148 ? 0.3998 0.3972 0.2905 -0.0219 0.0111  -0.0035 147 ASN A CA    
1899 C  C     . ASN E 148 ? 0.3977 0.3956 0.2864 -0.0203 0.0040  -0.0014 147 ASN A C     
1900 O  O     . ASN E 148 ? 0.4027 0.3923 0.2785 -0.0190 0.0000  -0.0004 147 ASN A O     
1901 C  CB    . ASN E 148 ? 0.4069 0.4082 0.2830 -0.0221 0.0122  -0.0097 147 ASN A CB    
1902 C  CG    . ASN E 148 ? 0.4318 0.4333 0.2855 -0.0251 0.0233  -0.0131 147 ASN A CG    
1903 O  OD1   . ASN E 148 ? 0.4780 0.4787 0.2797 -0.0281 0.0227  -0.0036 147 ASN A OD1   
1904 N  ND2   . ASN E 148 ? 0.4415 0.4501 0.2572 -0.0117 0.0496  -0.0202 147 ASN A ND2   
1905 N  N     . LYS E 149 ? 0.3929 0.3942 0.2845 -0.0215 -0.0008 0.0006  148 LYS A N     
1906 C  CA    . LYS E 149 ? 0.3834 0.3984 0.2926 -0.0246 0.0023  0.0018  148 LYS A CA    
1907 C  C     . LYS E 149 ? 0.3778 0.4061 0.2952 -0.0225 -0.0013 -0.0046 148 LYS A C     
1908 O  O     . LYS E 149 ? 0.3840 0.3987 0.2958 -0.0277 -0.0031 -0.0019 148 LYS A O     
1909 C  CB    . LYS E 149 ? 0.3788 0.3965 0.2906 -0.0248 0.0037  0.0029  148 LYS A CB    
1910 C  CG    . LYS E 149 ? 0.3854 0.4202 0.3128 -0.0264 0.0125  -0.0036 148 LYS A CG    
1911 C  CD    . LYS E 149 ? 0.3957 0.4005 0.3465 -0.0367 0.0200  0.0253  148 LYS A CD    
1912 C  CE    . LYS E 149 ? 0.3977 0.4124 0.3346 -0.0513 0.0225  0.0321  148 LYS A CE    
1913 N  NZ    . LYS E 149 ? 0.3813 0.4027 0.3395 -0.0427 0.0485  0.0424  148 LYS A NZ    
1914 N  N     . VAL E 150 ? 0.3746 0.4067 0.2860 -0.0262 0.0038  -0.0117 149 VAL A N     
1915 C  CA    . VAL E 150 ? 0.3759 0.4032 0.2912 -0.0276 0.0076  -0.0168 149 VAL A CA    
1916 C  C     . VAL E 150 ? 0.3740 0.3997 0.2934 -0.0309 0.0126  -0.0191 149 VAL A C     
1917 O  O     . VAL E 150 ? 0.3809 0.4220 0.3021 -0.0356 0.0157  -0.0202 149 VAL A O     
1918 C  CB    . VAL E 150 ? 0.3692 0.4065 0.2952 -0.0255 0.0058  -0.0166 149 VAL A CB    
1919 C  CG1   . VAL E 150 ? 0.3619 0.4139 0.2788 -0.0269 0.0187  -0.0282 149 VAL A CG1   
1920 C  CG2   . VAL E 150 ? 0.3735 0.4063 0.2807 -0.0232 0.0175  -0.0144 149 VAL A CG2   
1921 N  N     . PHE E 151 ? 0.3619 0.3789 0.2822 -0.0322 0.0155  -0.0283 150 PHE A N     
1922 C  CA    . PHE E 151 ? 0.3542 0.3623 0.2711 -0.0362 0.0139  -0.0286 150 PHE A CA    
1923 C  C     . PHE E 151 ? 0.3525 0.3559 0.2618 -0.0427 0.0172  -0.0349 150 PHE A C     
1924 O  O     . PHE E 151 ? 0.3485 0.3563 0.2738 -0.0392 0.0154  -0.0366 150 PHE A O     
1925 C  CB    . PHE E 151 ? 0.3526 0.3545 0.2739 -0.0350 0.0146  -0.0303 150 PHE A CB    
1926 C  CG    . PHE E 151 ? 0.3609 0.3454 0.2690 -0.0180 0.0192  -0.0295 150 PHE A CG    
1927 C  CD1   . PHE E 151 ? 0.3801 0.3332 0.2777 -0.0168 0.0156  -0.0300 150 PHE A CD1   
1928 C  CD2   . PHE E 151 ? 0.3658 0.3282 0.2923 0.0010  0.0176  -0.0355 150 PHE A CD2   
1929 C  CE1   . PHE E 151 ? 0.3995 0.3350 0.3345 -0.0117 0.0056  -0.0032 150 PHE A CE1   
1930 C  CE2   . PHE E 151 ? 0.3873 0.3408 0.3121 -0.0017 0.0073  0.0019  150 PHE A CE2   
1931 C  CZ    . PHE E 151 ? 0.4047 0.3387 0.3428 0.0015  -0.0035 -0.0008 150 PHE A CZ    
1932 N  N     . ALA E 152 ? 0.3523 0.3454 0.2443 -0.0462 0.0218  -0.0359 151 ALA A N     
1933 C  CA    . ALA E 152 ? 0.3604 0.3456 0.2304 -0.0497 0.0227  -0.0409 151 ALA A CA    
1934 C  C     . ALA E 152 ? 0.3685 0.3488 0.2249 -0.0540 0.0185  -0.0409 151 ALA A C     
1935 O  O     . ALA E 152 ? 0.3727 0.3401 0.2277 -0.0600 0.0229  -0.0465 151 ALA A O     
1936 C  CB    . ALA E 152 ? 0.3552 0.3405 0.2018 -0.0527 0.0289  -0.0435 151 ALA A CB    
1937 N  N     . LYS E 153 ? 0.3749 0.3586 0.2256 -0.0600 0.0083  -0.0439 152 LYS A N     
1938 C  CA    . LYS E 153 ? 0.3833 0.3636 0.2246 -0.0652 -0.0016 -0.0430 152 LYS A CA    
1939 C  C     . LYS E 153 ? 0.3964 0.3678 0.2174 -0.0665 0.0015  -0.0401 152 LYS A C     
1940 O  O     . LYS E 153 ? 0.4014 0.3911 0.2213 -0.0679 0.0027  -0.0430 152 LYS A O     
1941 C  CB    . LYS E 153 ? 0.3728 0.3622 0.2307 -0.0645 -0.0117 -0.0453 152 LYS A CB    
1942 C  CG    . LYS E 153 ? 0.3543 0.3820 0.2548 -0.0808 -0.0199 -0.0344 152 LYS A CG    
1943 C  CD    . LYS E 153 ? 0.3285 0.4201 0.3399 -0.0885 -0.0522 -0.0223 152 LYS A CD    
1944 C  CE    . LYS E 153 ? 0.2759 0.3644 0.3732 -0.0942 -0.0628 -0.0222 152 LYS A CE    
1945 N  NZ    . LYS E 153 ? 0.2298 0.3423 0.4734 -0.1263 -0.0868 0.0144  152 LYS A NZ    
1946 N  N     . ILE E 154 ? 0.4119 0.3530 0.2149 -0.0623 0.0076  -0.0473 153 ILE A N     
1947 C  CA    . ILE E 154 ? 0.4135 0.3514 0.2121 -0.0612 0.0134  -0.0468 153 ILE A CA    
1948 C  C     . ILE E 154 ? 0.4149 0.3493 0.2176 -0.0589 0.0190  -0.0450 153 ILE A C     
1949 O  O     . ILE E 154 ? 0.4180 0.3536 0.2211 -0.0613 0.0312  -0.0504 153 ILE A O     
1950 C  CB    . ILE E 154 ? 0.4153 0.3522 0.2027 -0.0615 0.0137  -0.0442 153 ILE A CB    
1951 C  CG1   . ILE E 154 ? 0.4086 0.3438 0.1912 -0.0561 0.0223  -0.0436 153 ILE A CG1   
1952 C  CG2   . ILE E 154 ? 0.4240 0.3646 0.2008 -0.0741 0.0218  -0.0436 153 ILE A CG2   
1953 C  CD1   . ILE E 154 ? 0.4196 0.3521 0.1869 -0.0291 0.0415  -0.0538 153 ILE A CD1   
1954 N  N     . ALA E 155 ? 0.4099 0.3449 0.2232 -0.0529 0.0207  -0.0489 154 ALA A N     
1955 C  CA    . ALA E 155 ? 0.4088 0.3318 0.2242 -0.0484 0.0258  -0.0440 154 ALA A CA    
1956 C  C     . ALA E 155 ? 0.4145 0.3391 0.2418 -0.0441 0.0327  -0.0387 154 ALA A C     
1957 O  O     . ALA E 155 ? 0.4315 0.3513 0.2518 -0.0445 0.0278  -0.0315 154 ALA A O     
1958 C  CB    . ALA E 155 ? 0.4116 0.3300 0.2105 -0.0437 0.0265  -0.0461 154 ALA A CB    
1959 N  N     . ALA E 156 ? 0.4143 0.3383 0.2512 -0.0413 0.0403  -0.0419 155 ALA A N     
1960 C  CA    . ALA E 156 ? 0.4137 0.3451 0.2665 -0.0378 0.0442  -0.0390 155 ALA A CA    
1961 C  C     . ALA E 156 ? 0.4136 0.3492 0.2837 -0.0328 0.0465  -0.0394 155 ALA A C     
1962 O  O     . ALA E 156 ? 0.4076 0.3410 0.2765 -0.0259 0.0492  -0.0464 155 ALA A O     
1963 C  CB    . ALA E 156 ? 0.4088 0.3488 0.2574 -0.0393 0.0495  -0.0381 155 ALA A CB    
1964 N  N     . ASP E 157 ? 0.4206 0.3691 0.3115 -0.0289 0.0488  -0.0344 156 ASP A N     
1965 C  CA    . ASP E 157 ? 0.4259 0.3833 0.3445 -0.0226 0.0550  -0.0302 156 ASP A CA    
1966 C  C     . ASP E 157 ? 0.4285 0.3947 0.3642 -0.0251 0.0580  -0.0371 156 ASP A C     
1967 O  O     . ASP E 157 ? 0.4286 0.4048 0.3918 -0.0305 0.0659  -0.0283 156 ASP A O     
1968 C  CB    . ASP E 157 ? 0.4327 0.3933 0.3396 -0.0187 0.0567  -0.0301 156 ASP A CB    
1969 C  CG    . ASP E 157 ? 0.4593 0.3911 0.3494 -0.0076 0.0529  -0.0117 156 ASP A CG    
1970 O  OD1   . ASP E 157 ? 0.5002 0.4271 0.3643 0.0062  0.0190  -0.0190 156 ASP A OD1   
1971 O  OD2   . ASP E 157 ? 0.4712 0.4258 0.3534 0.0161  0.0536  0.0062  156 ASP A OD2   
1972 N  N     . MET E 158 ? 0.4258 0.3935 0.3536 -0.0241 0.0625  -0.0506 157 MET A N     
1973 C  CA    . MET E 158 ? 0.4231 0.3954 0.3689 -0.0267 0.0620  -0.0478 157 MET A CA    
1974 C  C     . MET E 158 ? 0.4120 0.3869 0.3629 -0.0267 0.0625  -0.0542 157 MET A C     
1975 O  O     . MET E 158 ? 0.4133 0.3996 0.3811 -0.0212 0.0714  -0.0613 157 MET A O     
1976 C  CB    . MET E 158 ? 0.4266 0.4050 0.3848 -0.0288 0.0620  -0.0523 157 MET A CB    
1977 C  CG    . MET E 158 ? 0.4468 0.4294 0.4227 -0.0404 0.0626  -0.0469 157 MET A CG    
1978 S  SD    . MET E 158 ? 0.5019 0.4964 0.4953 -0.0648 0.0992  -0.0728 157 MET A SD    
1979 C  CE    . MET E 158 ? 0.4891 0.4698 0.4920 -0.0623 0.0873  -0.1178 157 MET A CE    
1980 N  N     . ALA E 159 ? 0.4058 0.3649 0.3524 -0.0333 0.0581  -0.0537 158 ALA A N     
1981 C  CA    . ALA E 159 ? 0.3990 0.3577 0.3415 -0.0355 0.0484  -0.0488 158 ALA A CA    
1982 C  C     . ALA E 159 ? 0.4023 0.3563 0.3333 -0.0387 0.0423  -0.0399 158 ALA A C     
1983 O  O     . ALA E 159 ? 0.4088 0.3308 0.3406 -0.0457 0.0470  -0.0291 158 ALA A O     
1984 C  CB    . ALA E 159 ? 0.3999 0.3530 0.3411 -0.0374 0.0455  -0.0556 158 ALA A CB    
1985 N  N     . LYS E 160 ? 0.4017 0.3660 0.3231 -0.0386 0.0391  -0.0350 159 LYS A N     
1986 C  CA    . LYS E 160 ? 0.4026 0.3676 0.3119 -0.0424 0.0354  -0.0295 159 LYS A CA    
1987 C  C     . LYS E 160 ? 0.3986 0.3660 0.3051 -0.0493 0.0358  -0.0278 159 LYS A C     
1988 O  O     . LYS E 160 ? 0.4034 0.3828 0.3141 -0.0513 0.0353  -0.0275 159 LYS A O     
1989 C  CB    . LYS E 160 ? 0.3983 0.3733 0.2987 -0.0406 0.0385  -0.0306 159 LYS A CB    
1990 C  CG    . LYS E 160 ? 0.4117 0.3974 0.3486 -0.0213 0.0409  -0.0341 159 LYS A CG    
1991 C  CD    . LYS E 160 ? 0.4655 0.3971 0.3532 0.0121  0.0504  -0.0334 159 LYS A CD    
1992 C  CE    . LYS E 160 ? 0.4819 0.4097 0.3744 0.0202  0.0521  -0.0289 159 LYS A CE    
1993 N  NZ    . LYS E 160 ? 0.4998 0.4265 0.3812 0.0331  0.0392  -0.0336 159 LYS A NZ    
1994 N  N     . PRO E 161 ? 0.3968 0.3498 0.2946 -0.0498 0.0360  -0.0186 160 PRO A N     
1995 C  CA    . PRO E 161 ? 0.3970 0.3377 0.2922 -0.0482 0.0411  -0.0101 160 PRO A CA    
1996 C  C     . PRO E 161 ? 0.3994 0.3290 0.2896 -0.0427 0.0452  -0.0059 160 PRO A C     
1997 O  O     . PRO E 161 ? 0.4108 0.3325 0.2963 -0.0523 0.0415  -0.0030 160 PRO A O     
1998 C  CB    . PRO E 161 ? 0.4039 0.3406 0.2903 -0.0474 0.0404  -0.0158 160 PRO A CB    
1999 C  CG    . PRO E 161 ? 0.3963 0.3410 0.2999 -0.0523 0.0396  -0.0251 160 PRO A CG    
2000 C  CD    . PRO E 161 ? 0.3986 0.3335 0.2971 -0.0561 0.0300  -0.0209 160 PRO A CD    
2001 N  N     . ASN E 162 ? 0.4050 0.3227 0.2868 -0.0322 0.0491  -0.0063 161 ASN A N     
2002 C  CA    . ASN E 162 ? 0.4103 0.3170 0.3138 -0.0181 0.0573  -0.0042 161 ASN A CA    
2003 C  C     . ASN E 162 ? 0.4188 0.3233 0.3199 -0.0167 0.0598  -0.0015 161 ASN A C     
2004 O  O     . ASN E 162 ? 0.4341 0.3329 0.3350 -0.0056 0.0613  -0.0040 161 ASN A O     
2005 C  CB    . ASN E 162 ? 0.4046 0.3225 0.3188 -0.0115 0.0563  -0.0056 161 ASN A CB    
2006 C  CG    . ASN E 162 ? 0.4072 0.3102 0.3690 0.0009  0.0634  0.0009  161 ASN A CG    
2007 O  OD1   . ASN E 162 ? 0.4306 0.2649 0.4690 -0.0151 0.0750  0.0060  161 ASN A OD1   
2008 N  ND2   . ASN E 162 ? 0.3673 0.2596 0.4477 -0.0102 0.0927  -0.0194 161 ASN A ND2   
2009 N  N     . GLY E 163 ? 0.4217 0.3229 0.3286 -0.0199 0.0623  -0.0077 162 GLY A N     
2010 C  CA    . GLY E 163 ? 0.4182 0.3153 0.3276 -0.0231 0.0658  -0.0077 162 GLY A CA    
2011 C  C     . GLY E 163 ? 0.4155 0.3085 0.3246 -0.0221 0.0616  -0.0054 162 GLY A C     
2012 O  O     . GLY E 163 ? 0.4194 0.2986 0.3378 -0.0250 0.0662  -0.0049 162 GLY A O     
2013 N  N     . ILE E 164 ? 0.4088 0.3122 0.3084 -0.0256 0.0503  0.0022  163 ILE A N     
2014 C  CA    . ILE E 164 ? 0.3952 0.3042 0.3064 -0.0200 0.0525  -0.0016 163 ILE A CA    
2015 C  C     . ILE E 164 ? 0.4016 0.3110 0.3103 -0.0154 0.0513  -0.0079 163 ILE A C     
2016 O  O     . ILE E 164 ? 0.3981 0.2883 0.3173 -0.0170 0.0565  -0.0002 163 ILE A O     
2017 C  CB    . ILE E 164 ? 0.3907 0.2970 0.2970 -0.0169 0.0553  0.0067  163 ILE A CB    
2018 C  CG1   . ILE E 164 ? 0.3801 0.2878 0.2897 -0.0197 0.0622  -0.0045 163 ILE A CG1   
2019 C  CG2   . ILE E 164 ? 0.3969 0.2658 0.2971 -0.0228 0.0594  -0.0062 163 ILE A CG2   
2020 C  CD1   . ILE E 164 ? 0.3560 0.2674 0.2469 -0.0340 0.0893  0.0461  163 ILE A CD1   
2021 N  N     . LYS E 165 ? 0.4111 0.3178 0.3097 -0.0096 0.0408  -0.0059 164 LYS A N     
2022 C  CA    . LYS E 165 ? 0.4174 0.3394 0.3132 -0.0079 0.0313  -0.0131 164 LYS A CA    
2023 C  C     . LYS E 165 ? 0.4221 0.3471 0.3065 -0.0068 0.0286  -0.0169 164 LYS A C     
2024 O  O     . LYS E 165 ? 0.4223 0.3570 0.3041 0.0036  0.0246  -0.0169 164 LYS A O     
2025 C  CB    . LYS E 165 ? 0.4204 0.3507 0.3277 -0.0114 0.0308  -0.0161 164 LYS A CB    
2026 C  CG    . LYS E 165 ? 0.4366 0.3542 0.3380 -0.0155 0.0242  -0.0266 164 LYS A CG    
2027 C  CD    . LYS E 165 ? 0.4401 0.3774 0.3953 -0.0398 0.0060  -0.0570 164 LYS A CD    
2028 C  CE    . LYS E 165 ? 0.4503 0.3878 0.4246 -0.0459 -0.0296 -0.0674 164 LYS A CE    
2029 N  NZ    . LYS E 165 ? 0.4370 0.3843 0.4705 -0.0491 -0.0404 -0.0915 164 LYS A NZ    
2030 N  N     . VAL E 166 ? 0.4278 0.3474 0.2908 -0.0039 0.0274  -0.0221 165 VAL A N     
2031 C  CA    . VAL E 166 ? 0.4243 0.3578 0.2802 -0.0111 0.0274  -0.0235 165 VAL A CA    
2032 C  C     . VAL E 166 ? 0.4197 0.3607 0.2768 -0.0141 0.0268  -0.0211 165 VAL A C     
2033 O  O     . VAL E 166 ? 0.4252 0.3603 0.2597 -0.0098 0.0223  -0.0359 165 VAL A O     
2034 C  CB    . VAL E 166 ? 0.4263 0.3610 0.2908 -0.0144 0.0257  -0.0163 165 VAL A CB    
2035 C  CG1   . VAL E 166 ? 0.4281 0.3491 0.2391 -0.0005 0.0192  -0.0490 165 VAL A CG1   
2036 C  CG2   . VAL E 166 ? 0.4520 0.3646 0.2664 -0.0244 0.0162  -0.0234 165 VAL A CG2   
2037 N  N     . ILE E 167 ? 0.4154 0.3687 0.2655 -0.0184 0.0317  -0.0146 166 ILE A N     
2038 C  CA    . ILE E 167 ? 0.4246 0.3863 0.2756 -0.0206 0.0323  -0.0103 166 ILE A CA    
2039 C  C     . ILE E 167 ? 0.4314 0.4103 0.2958 -0.0193 0.0371  -0.0068 166 ILE A C     
2040 O  O     . ILE E 167 ? 0.4315 0.4240 0.2994 -0.0227 0.0437  -0.0036 166 ILE A O     
2041 C  CB    . ILE E 167 ? 0.4208 0.3862 0.2655 -0.0233 0.0359  -0.0108 166 ILE A CB    
2042 C  CG1   . ILE E 167 ? 0.4407 0.3720 0.2229 -0.0200 0.0298  0.0035  166 ILE A CG1   
2043 C  CG2   . ILE E 167 ? 0.4180 0.3774 0.2491 -0.0253 0.0255  -0.0103 166 ILE A CG2   
2044 C  CD1   . ILE E 167 ? 0.4211 0.3790 0.1303 -0.0201 0.0298  0.0014  166 ILE A CD1   
2045 N  N     . ASP E 168 ? 0.4402 0.4296 0.3034 -0.0119 0.0373  -0.0072 167 ASP A N     
2046 C  CA    . ASP E 168 ? 0.4522 0.4603 0.3318 -0.0087 0.0383  -0.0065 167 ASP A CA    
2047 C  C     . ASP E 168 ? 0.4587 0.4783 0.3416 -0.0036 0.0346  -0.0071 167 ASP A C     
2048 O  O     . ASP E 168 ? 0.4596 0.4785 0.3535 -0.0005 0.0370  -0.0045 167 ASP A O     
2049 C  CB    . ASP E 168 ? 0.4566 0.4612 0.3327 -0.0080 0.0351  -0.0046 167 ASP A CB    
2050 C  CG    . ASP E 168 ? 0.4704 0.4681 0.3216 -0.0036 0.0432  -0.0104 167 ASP A CG    
2051 O  OD1   . ASP E 168 ? 0.4930 0.4771 0.3444 0.0125  0.0440  -0.0105 167 ASP A OD1   
2052 O  OD2   . ASP E 168 ? 0.4490 0.5042 0.2512 0.0170  0.0431  0.0058  167 ASP A OD2   
2053 N  N     . ASP E 169 ? 0.4675 0.5026 0.3489 -0.0031 0.0389  -0.0108 168 ASP A N     
2054 C  CA    . ASP E 169 ? 0.4723 0.5217 0.3558 0.0025  0.0414  -0.0184 168 ASP A CA    
2055 C  C     . ASP E 169 ? 0.4769 0.5320 0.3574 0.0019  0.0415  -0.0213 168 ASP A C     
2056 O  O     . ASP E 169 ? 0.4721 0.5404 0.3599 0.0049  0.0483  -0.0257 168 ASP A O     
2057 C  CB    . ASP E 169 ? 0.4721 0.5276 0.3602 0.0000  0.0411  -0.0175 168 ASP A CB    
2058 C  CG    . ASP E 169 ? 0.4648 0.5376 0.3733 0.0054  0.0421  -0.0309 168 ASP A CG    
2059 O  OD1   . ASP E 169 ? 0.4324 0.5537 0.3723 0.0105  0.0660  -0.0470 168 ASP A OD1   
2060 O  OD2   . ASP E 169 ? 0.4685 0.5626 0.4168 0.0090  0.0372  -0.0437 168 ASP A OD2   
2061 N  N     . GLU E 170 ? 0.4905 0.5362 0.3616 0.0031  0.0427  -0.0288 169 GLU A N     
2062 C  CA    . GLU E 170 ? 0.5049 0.5447 0.3688 0.0051  0.0394  -0.0358 169 GLU A CA    
2063 C  C     . GLU E 170 ? 0.5130 0.5450 0.3656 0.0079  0.0339  -0.0408 169 GLU A C     
2064 O  O     . GLU E 170 ? 0.5203 0.5470 0.3494 0.0090  0.0278  -0.0488 169 GLU A O     
2065 C  CB    . GLU E 170 ? 0.5061 0.5456 0.3741 0.0077  0.0436  -0.0314 169 GLU A CB    
2066 C  CG    . GLU E 170 ? 0.5127 0.5687 0.4182 0.0013  0.0431  -0.0323 169 GLU A CG    
2067 C  CD    . GLU E 170 ? 0.5300 0.6069 0.4617 0.0085  0.0466  -0.0358 169 GLU A CD    
2068 O  OE1   . GLU E 170 ? 0.5272 0.6053 0.4580 0.0091  0.0630  -0.0508 169 GLU A OE1   
2069 O  OE2   . GLU E 170 ? 0.5303 0.6236 0.5022 0.0075  0.0346  -0.0352 169 GLU A OE2   
2070 N  N     . GLU E 171 ? 0.5209 0.5419 0.3597 0.0073  0.0301  -0.0451 170 GLU A N     
2071 C  CA    . GLU E 171 ? 0.5250 0.5344 0.3549 0.0079  0.0290  -0.0507 170 GLU A CA    
2072 C  C     . GLU E 171 ? 0.5222 0.5325 0.3393 0.0080  0.0321  -0.0513 170 GLU A C     
2073 O  O     . GLU E 171 ? 0.5254 0.5409 0.3239 0.0105  0.0382  -0.0514 170 GLU A O     
2074 C  CB    . GLU E 171 ? 0.5329 0.5316 0.3598 0.0077  0.0252  -0.0554 170 GLU A CB    
2075 C  CG    . GLU E 171 ? 0.5430 0.5245 0.3974 0.0124  0.0229  -0.0793 170 GLU A CG    
2076 C  CD    . GLU E 171 ? 0.5930 0.5241 0.4425 0.0147  0.0312  -0.0857 170 GLU A CD    
2077 O  OE1   . GLU E 171 ? 0.5897 0.5424 0.4824 0.0189  0.0261  -0.1007 170 GLU A OE1   
2078 O  OE2   . GLU E 171 ? 0.6120 0.5390 0.4958 0.0088  0.0180  -0.1114 170 GLU A OE2   
2079 N  N     . VAL E 172 ? 0.5154 0.5232 0.3350 0.0079  0.0316  -0.0515 171 VAL A N     
2080 C  CA    . VAL E 172 ? 0.5127 0.5136 0.3478 0.0102  0.0312  -0.0477 171 VAL A CA    
2081 C  C     . VAL E 172 ? 0.5183 0.5142 0.3599 0.0080  0.0282  -0.0437 171 VAL A C     
2082 O  O     . VAL E 172 ? 0.5266 0.5081 0.3488 0.0077  0.0306  -0.0457 171 VAL A O     
2083 C  CB    . VAL E 172 ? 0.5085 0.5153 0.3484 0.0127  0.0327  -0.0499 171 VAL A CB    
2084 C  CG1   . VAL E 172 ? 0.5065 0.5242 0.3260 0.0108  0.0297  -0.0362 171 VAL A CG1   
2085 C  CG2   . VAL E 172 ? 0.4999 0.5070 0.3418 0.0194  0.0305  -0.0433 171 VAL A CG2   
2086 N  N     . LYS E 173 ? 0.5227 0.5178 0.3757 0.0073  0.0258  -0.0418 172 LYS A N     
2087 C  CA    . LYS E 173 ? 0.5307 0.5241 0.3950 0.0049  0.0235  -0.0452 172 LYS A CA    
2088 C  C     . LYS E 173 ? 0.5343 0.5255 0.4007 0.0041  0.0224  -0.0451 172 LYS A C     
2089 O  O     . LYS E 173 ? 0.5347 0.5266 0.3990 0.0065  0.0249  -0.0502 172 LYS A O     
2090 C  CB    . LYS E 173 ? 0.5308 0.5303 0.4082 0.0052  0.0234  -0.0370 172 LYS A CB    
2091 C  CG    . LYS E 173 ? 0.5331 0.5258 0.4147 0.0017  0.0268  -0.0370 172 LYS A CG    
2092 C  CD    . LYS E 173 ? 0.5426 0.5256 0.4306 -0.0063 0.0231  -0.0271 172 LYS A CD    
2093 C  CE    . LYS E 173 ? 0.5413 0.5325 0.4184 -0.0006 0.0377  -0.0428 172 LYS A CE    
2094 N  NZ    . LYS E 173 ? 0.5528 0.5314 0.3876 -0.0039 0.0392  -0.0515 172 LYS A NZ    
2095 N  N     . ARG E 174 ? 0.5395 0.5245 0.4038 0.0013  0.0156  -0.0425 173 ARG A N     
2096 C  CA    . ARG E 174 ? 0.5464 0.5267 0.4212 -0.0053 0.0065  -0.0367 173 ARG A CA    
2097 C  C     . ARG E 174 ? 0.5473 0.5283 0.4226 -0.0061 0.0039  -0.0340 173 ARG A C     
2098 O  O     . ARG E 174 ? 0.5493 0.5294 0.4204 -0.0042 0.0065  -0.0351 173 ARG A O     
2099 C  CB    . ARG E 174 ? 0.5502 0.5257 0.4303 -0.0046 0.0054  -0.0368 173 ARG A CB    
2100 C  CG    . ARG E 174 ? 0.5640 0.5405 0.4530 -0.0163 0.0004  -0.0304 173 ARG A CG    
2101 C  CD    . ARG E 174 ? 0.5874 0.5397 0.5059 -0.0270 -0.0135 -0.0154 173 ARG A CD    
2102 N  NE    . ARG E 174 ? 0.5981 0.5274 0.5302 -0.0326 -0.0149 -0.0389 173 ARG A NE    
2103 C  CZ    . ARG E 174 ? 0.5953 0.5346 0.5330 -0.0459 -0.0202 -0.0295 173 ARG A CZ    
2104 N  NH1   . ARG E 174 ? 0.6043 0.5169 0.5560 -0.0514 -0.0259 -0.0552 173 ARG A NH1   
2105 N  NH2   . ARG E 174 ? 0.5984 0.5434 0.5173 -0.0403 -0.0333 -0.0269 173 ARG A NH2   
2106 N  N     . LEU E 175 ? 0.5493 0.5298 0.4232 -0.0104 -0.0014 -0.0314 174 LEU A N     
2107 C  CA    . LEU E 175 ? 0.5526 0.5348 0.4239 -0.0108 -0.0067 -0.0282 174 LEU A CA    
2108 C  C     . LEU E 175 ? 0.5577 0.5358 0.4293 -0.0123 -0.0083 -0.0259 174 LEU A C     
2109 O  O     . LEU E 175 ? 0.5582 0.5313 0.4234 -0.0130 -0.0099 -0.0240 174 LEU A O     
2110 C  CB    . LEU E 175 ? 0.5532 0.5355 0.4201 -0.0122 -0.0091 -0.0262 174 LEU A CB    
2111 C  CG    . LEU E 175 ? 0.5495 0.5383 0.3978 -0.0157 -0.0137 -0.0336 174 LEU A CG    
2112 C  CD1   . LEU E 175 ? 0.5607 0.5299 0.3681 -0.0165 -0.0059 -0.0303 174 LEU A CD1   
2113 C  CD2   . LEU E 175 ? 0.5528 0.5401 0.3295 -0.0178 -0.0330 -0.0265 174 LEU A CD2   
2114 N  N     . ILE E 176 ? 0.5582 0.5402 0.4355 -0.0122 -0.0067 -0.0238 175 ILE A N     
2115 C  CA    . ILE E 176 ? 0.5640 0.5492 0.4555 -0.0100 -0.0062 -0.0210 175 ILE A CA    
2116 C  C     . ILE E 176 ? 0.5703 0.5608 0.4702 -0.0129 -0.0073 -0.0175 175 ILE A C     
2117 O  O     . ILE E 176 ? 0.5722 0.5601 0.4632 -0.0104 -0.0080 -0.0191 175 ILE A O     
2118 C  CB    . ILE E 176 ? 0.5610 0.5444 0.4554 -0.0108 -0.0107 -0.0215 175 ILE A CB    
2119 C  CG1   . ILE E 176 ? 0.5536 0.5345 0.4269 -0.0024 -0.0145 -0.0363 175 ILE A CG1   
2120 C  CG2   . ILE E 176 ? 0.5557 0.5542 0.4427 -0.0154 -0.0116 -0.0202 175 ILE A CG2   
2121 C  CD1   . ILE E 176 ? 0.5388 0.5050 0.3478 -0.0024 -0.0330 -0.0590 175 ILE A CD1   
2122 N  N     . ARG E 177 ? 0.5812 0.5701 0.4923 -0.0139 -0.0056 -0.0137 176 ARG A N     
2123 C  CA    . ARG E 177 ? 0.5885 0.5817 0.5137 -0.0155 -0.0059 -0.0123 176 ARG A CA    
2124 C  C     . ARG E 177 ? 0.5934 0.5921 0.5336 -0.0185 -0.0046 -0.0108 176 ARG A C     
2125 O  O     . ARG E 177 ? 0.5905 0.5934 0.5280 -0.0190 -0.0104 -0.0100 176 ARG A O     
2126 C  CB    . ARG E 177 ? 0.5871 0.5773 0.5065 -0.0148 -0.0035 -0.0124 176 ARG A CB    
2127 C  CG    . ARG E 177 ? 0.5771 0.5718 0.4959 -0.0100 -0.0071 -0.0209 176 ARG A CG    
2128 C  CD    . ARG E 177 ? 0.5644 0.5748 0.4423 -0.0223 -0.0032 -0.0457 176 ARG A CD    
2129 N  NE    . ARG E 177 ? 0.5574 0.5924 0.4238 -0.0246 0.0177  -0.0681 176 ARG A NE    
2130 C  CZ    . ARG E 177 ? 0.5415 0.6001 0.3938 -0.0278 0.0154  -0.0773 176 ARG A CZ    
2131 N  NH1   . ARG E 177 ? 0.5472 0.5970 0.3652 -0.0300 0.0102  -0.0945 176 ARG A NH1   
2132 N  NH2   . ARG E 177 ? 0.5305 0.5986 0.3516 -0.0267 0.0312  -0.0817 176 ARG A NH2   
2133 N  N     . GLU E 178 ? 0.6037 0.6010 0.5539 -0.0193 -0.0054 -0.0090 177 GLU A N     
2134 C  CA    . GLU E 178 ? 0.6132 0.6126 0.5806 -0.0216 -0.0025 -0.0099 177 GLU A CA    
2135 C  C     . GLU E 178 ? 0.6138 0.6182 0.5899 -0.0236 -0.0013 -0.0115 177 GLU A C     
2136 O  O     . GLU E 178 ? 0.6171 0.6141 0.5912 -0.0258 0.0010  -0.0089 177 GLU A O     
2137 C  CB    . GLU E 178 ? 0.6170 0.6136 0.5847 -0.0197 -0.0019 -0.0089 177 GLU A CB    
2138 C  CG    . GLU E 178 ? 0.6358 0.6210 0.6039 -0.0150 -0.0071 -0.0113 177 GLU A CG    
2139 C  CD    . GLU E 178 ? 0.6602 0.6393 0.6289 -0.0003 -0.0208 -0.0030 177 GLU A CD    
2140 O  OE1   . GLU E 178 ? 0.6636 0.6547 0.6338 0.0036  -0.0314 -0.0023 177 GLU A OE1   
2141 O  OE2   . GLU E 178 ? 0.6660 0.6278 0.6230 0.0074  -0.0323 -0.0099 177 GLU A OE2   
2142 N  N     . LEU E 179 ? 0.6138 0.6240 0.6004 -0.0253 -0.0010 -0.0144 178 LEU A N     
2143 C  CA    . LEU E 179 ? 0.6093 0.6241 0.5998 -0.0255 -0.0041 -0.0137 178 LEU A CA    
2144 C  C     . LEU E 179 ? 0.6103 0.6280 0.6039 -0.0272 -0.0061 -0.0123 178 LEU A C     
2145 O  O     . LEU E 179 ? 0.6108 0.6244 0.5980 -0.0282 -0.0082 -0.0078 178 LEU A O     
2146 C  CB    . LEU E 179 ? 0.6053 0.6247 0.5976 -0.0243 -0.0036 -0.0141 178 LEU A CB    
2147 C  CG    . LEU E 179 ? 0.5934 0.6114 0.5960 -0.0263 -0.0023 -0.0134 178 LEU A CG    
2148 C  CD1   . LEU E 179 ? 0.5696 0.6022 0.5810 -0.0282 0.0093  -0.0163 178 LEU A CD1   
2149 C  CD2   . LEU E 179 ? 0.5857 0.6032 0.5968 -0.0163 0.0021  -0.0092 178 LEU A CD2   
2150 N  N     . ASP E 180 ? 0.6093 0.6256 0.5972 -0.0304 -0.0068 -0.0124 179 ASP A N     
2151 C  CA    . ASP E 180 ? 0.6091 0.6265 0.5979 -0.0324 -0.0047 -0.0142 179 ASP A CA    
2152 C  C     . ASP E 180 ? 0.6064 0.6267 0.5918 -0.0336 -0.0048 -0.0107 179 ASP A C     
2153 O  O     . ASP E 180 ? 0.6054 0.6311 0.5910 -0.0378 -0.0065 -0.0115 179 ASP A O     
2154 C  CB    . ASP E 180 ? 0.6125 0.6259 0.6029 -0.0338 -0.0058 -0.0118 179 ASP A CB    
2155 C  CG    . ASP E 180 ? 0.6183 0.6378 0.6257 -0.0357 -0.0072 -0.0118 179 ASP A CG    
2156 O  OD1   . ASP E 180 ? 0.6247 0.6356 0.6374 -0.0322 -0.0042 -0.0056 179 ASP A OD1   
2157 O  OD2   . ASP E 180 ? 0.6428 0.6329 0.6512 -0.0483 -0.0069 -0.0117 179 ASP A OD2   
2158 N  N     . ILE E 181 ? 0.5989 0.6193 0.5866 -0.0313 -0.0025 -0.0122 180 ILE A N     
2159 C  CA    . ILE E 181 ? 0.5911 0.6127 0.5754 -0.0322 0.0001  -0.0126 180 ILE A CA    
2160 C  C     . ILE E 181 ? 0.5895 0.6126 0.5708 -0.0330 0.0040  -0.0113 180 ILE A C     
2161 O  O     . ILE E 181 ? 0.5900 0.6124 0.5729 -0.0352 0.0095  -0.0096 180 ILE A O     
2162 C  CB    . ILE E 181 ? 0.5894 0.6106 0.5698 -0.0346 -0.0019 -0.0132 180 ILE A CB    
2163 C  CG1   . ILE E 181 ? 0.5879 0.6096 0.5771 -0.0344 -0.0017 -0.0209 180 ILE A CG1   
2164 C  CG2   . ILE E 181 ? 0.5861 0.6113 0.5664 -0.0370 -0.0051 -0.0097 180 ILE A CG2   
2165 C  CD1   . ILE E 181 ? 0.5730 0.5993 0.5507 -0.0337 -0.0128 -0.0393 180 ILE A CD1   
2166 N  N     . ALA E 182 ? 0.5850 0.6090 0.5640 -0.0289 0.0057  -0.0117 181 ALA A N     
2167 C  CA    . ALA E 182 ? 0.5778 0.5969 0.5580 -0.0253 0.0042  -0.0129 181 ALA A CA    
2168 C  C     . ALA E 182 ? 0.5733 0.5920 0.5504 -0.0204 0.0062  -0.0126 181 ALA A C     
2169 O  O     . ALA E 182 ? 0.5832 0.5997 0.5684 -0.0191 0.0092  -0.0055 181 ALA A O     
2170 C  CB    . ALA E 182 ? 0.5792 0.5966 0.5480 -0.0223 0.0081  -0.0167 181 ALA A CB    
2171 N  N     . ASP E 183 ? 0.5577 0.5757 0.5374 -0.0180 0.0065  -0.0125 182 ASP A N     
2172 C  CA    . ASP E 183 ? 0.5509 0.5683 0.5372 -0.0117 0.0145  -0.0124 182 ASP A CA    
2173 C  C     . ASP E 183 ? 0.5459 0.5632 0.5295 -0.0091 0.0131  -0.0153 182 ASP A C     
2174 O  O     . ASP E 183 ? 0.5376 0.5730 0.5453 -0.0147 0.0154  -0.0207 182 ASP A O     
2175 C  CB    . ASP E 183 ? 0.5526 0.5670 0.5433 -0.0132 0.0156  -0.0156 182 ASP A CB    
2176 C  CG    . ASP E 183 ? 0.5611 0.5834 0.5453 0.0039  0.0231  -0.0103 182 ASP A CG    
2177 O  OD1   . ASP E 183 ? 0.5771 0.6321 0.5553 0.0208  0.0236  -0.0342 182 ASP A OD1   
2178 O  OD2   . ASP E 183 ? 0.5524 0.5857 0.5434 0.0332  0.0254  0.0104  182 ASP A OD2   
2179 N  N     . VAL E 184 ? 0.5355 0.5427 0.5108 -0.0083 0.0173  -0.0166 183 VAL A N     
2180 C  CA    . VAL E 184 ? 0.5258 0.5356 0.4932 -0.0055 0.0158  -0.0176 183 VAL A CA    
2181 C  C     . VAL E 184 ? 0.5228 0.5455 0.4932 -0.0050 0.0179  -0.0189 183 VAL A C     
2182 O  O     . VAL E 184 ? 0.5315 0.5453 0.5026 -0.0044 0.0226  -0.0198 183 VAL A O     
2183 C  CB    . VAL E 184 ? 0.5227 0.5329 0.4850 -0.0058 0.0124  -0.0211 183 VAL A CB    
2184 C  CG1   . VAL E 184 ? 0.5116 0.5063 0.4424 0.0043  0.0096  -0.0154 183 VAL A CG1   
2185 C  CG2   . VAL E 184 ? 0.5209 0.5270 0.4861 -0.0021 0.0117  -0.0129 183 VAL A CG2   
2186 N  N     . PRO E 185 ? 0.5211 0.5482 0.4948 -0.0045 0.0164  -0.0177 184 PRO A N     
2187 C  CA    . PRO E 185 ? 0.5191 0.5484 0.5016 -0.0031 0.0159  -0.0194 184 PRO A CA    
2188 C  C     . PRO E 185 ? 0.5210 0.5519 0.5056 -0.0046 0.0156  -0.0179 184 PRO A C     
2189 O  O     . PRO E 185 ? 0.5136 0.5538 0.4919 -0.0038 0.0206  -0.0300 184 PRO A O     
2190 C  CB    . PRO E 185 ? 0.5203 0.5512 0.4984 -0.0025 0.0148  -0.0198 184 PRO A CB    
2191 C  CG    . PRO E 185 ? 0.5158 0.5473 0.4960 -0.0063 0.0131  -0.0120 184 PRO A CG    
2192 C  CD    . PRO E 185 ? 0.5231 0.5396 0.4901 -0.0068 0.0179  -0.0150 184 PRO A CD    
2193 N  N     . GLY E 186 ? 0.5275 0.5603 0.5133 -0.0074 0.0136  -0.0186 185 GLY A N     
2194 C  CA    . GLY E 186 ? 0.5321 0.5609 0.5264 -0.0065 0.0166  -0.0209 185 GLY A CA    
2195 C  C     . GLY E 186 ? 0.5382 0.5710 0.5310 -0.0075 0.0136  -0.0203 185 GLY A C     
2196 O  O     . GLY E 186 ? 0.5393 0.5647 0.5336 -0.0035 0.0183  -0.0211 185 GLY A O     
2197 N  N     . ILE E 187 ? 0.5438 0.5838 0.5397 -0.0147 0.0156  -0.0211 186 ILE A N     
2198 C  CA    . ILE E 187 ? 0.5462 0.5946 0.5421 -0.0212 0.0137  -0.0246 186 ILE A CA    
2199 C  C     . ILE E 187 ? 0.5614 0.6096 0.5572 -0.0244 0.0119  -0.0242 186 ILE A C     
2200 O  O     . ILE E 187 ? 0.5563 0.6103 0.5450 -0.0262 0.0101  -0.0314 186 ILE A O     
2201 C  CB    . ILE E 187 ? 0.5443 0.5893 0.5340 -0.0240 0.0128  -0.0201 186 ILE A CB    
2202 C  CG1   . ILE E 187 ? 0.5321 0.5809 0.5316 -0.0251 0.0121  -0.0253 186 ILE A CG1   
2203 C  CG2   . ILE E 187 ? 0.5310 0.5908 0.5227 -0.0164 0.0244  -0.0230 186 ILE A CG2   
2204 C  CD1   . ILE E 187 ? 0.5224 0.5491 0.5077 -0.0263 0.0324  -0.0095 186 ILE A CD1   
2205 N  N     . GLY E 188 ? 0.5763 0.6349 0.5871 -0.0251 0.0132  -0.0220 187 GLY A N     
2206 C  CA    . GLY E 188 ? 0.6041 0.6660 0.6135 -0.0278 0.0121  -0.0171 187 GLY A CA    
2207 C  C     . GLY E 188 ? 0.6222 0.6876 0.6284 -0.0289 0.0062  -0.0204 187 GLY A C     
2208 O  O     . GLY E 188 ? 0.6235 0.6864 0.6215 -0.0273 0.0090  -0.0215 187 GLY A O     
2209 N  N     . ASN E 189 ? 0.6341 0.7092 0.6430 -0.0270 0.0104  -0.0170 188 ASN A N     
2210 C  CA    . ASN E 189 ? 0.6467 0.7272 0.6628 -0.0275 0.0100  -0.0146 188 ASN A CA    
2211 C  C     . ASN E 189 ? 0.6555 0.7377 0.6685 -0.0266 0.0097  -0.0126 188 ASN A C     
2212 O  O     . ASN E 189 ? 0.6473 0.7429 0.6657 -0.0302 0.0085  -0.0099 188 ASN A O     
2213 C  CB    . ASN E 189 ? 0.6507 0.7313 0.6661 -0.0263 0.0113  -0.0170 188 ASN A CB    
2214 C  CG    . ASN E 189 ? 0.6545 0.7411 0.6764 -0.0291 0.0145  -0.0184 188 ASN A CG    
2215 O  OD1   . ASN E 189 ? 0.6445 0.7467 0.7068 -0.0333 0.0249  -0.0231 188 ASN A OD1   
2216 N  ND2   . ASN E 189 ? 0.6556 0.7378 0.6587 -0.0348 0.0168  -0.0178 188 ASN A ND2   
2217 N  N     . ILE E 190 ? 0.6731 0.7432 0.6811 -0.0244 0.0107  -0.0103 189 ILE A N     
2218 C  CA    . ILE E 190 ? 0.6871 0.7579 0.6953 -0.0241 0.0085  -0.0106 189 ILE A CA    
2219 C  C     . ILE E 190 ? 0.6980 0.7644 0.7027 -0.0251 0.0124  -0.0133 189 ILE A C     
2220 O  O     . ILE E 190 ? 0.6896 0.7609 0.6959 -0.0289 0.0134  -0.0130 189 ILE A O     
2221 C  CB    . ILE E 190 ? 0.6891 0.7607 0.6970 -0.0229 0.0069  -0.0114 189 ILE A CB    
2222 C  CG1   . ILE E 190 ? 0.6911 0.7597 0.6924 -0.0241 0.0039  -0.0091 189 ILE A CG1   
2223 C  CG2   . ILE E 190 ? 0.6954 0.7652 0.6947 -0.0265 0.0069  -0.0029 189 ILE A CG2   
2224 C  CD1   . ILE E 190 ? 0.7020 0.7546 0.7113 -0.0178 0.0016  -0.0115 189 ILE A CD1   
2225 N  N     . THR E 191 ? 0.7128 0.7738 0.7178 -0.0244 0.0140  -0.0144 190 THR A N     
2226 C  CA    . THR E 191 ? 0.7295 0.7832 0.7283 -0.0243 0.0134  -0.0130 190 THR A CA    
2227 C  C     . THR E 191 ? 0.7373 0.7877 0.7361 -0.0207 0.0092  -0.0114 190 THR A C     
2228 O  O     . THR E 191 ? 0.7383 0.7888 0.7313 -0.0187 0.0080  -0.0077 190 THR A O     
2229 C  CB    . THR E 191 ? 0.7304 0.7826 0.7288 -0.0266 0.0160  -0.0134 190 THR A CB    
2230 O  OG1   . THR E 191 ? 0.7329 0.7778 0.7235 -0.0287 0.0234  -0.0154 190 THR A OG1   
2231 C  CG2   . THR E 191 ? 0.7328 0.7863 0.7311 -0.0313 0.0182  -0.0206 190 THR A CG2   
2232 N  N     . ALA E 192 ? 0.7446 0.7961 0.7462 -0.0184 0.0050  -0.0092 191 ALA A N     
2233 C  CA    . ALA E 192 ? 0.7507 0.8009 0.7555 -0.0161 0.0020  -0.0083 191 ALA A CA    
2234 C  C     . ALA E 192 ? 0.7540 0.8065 0.7614 -0.0149 -0.0014 -0.0091 191 ALA A C     
2235 O  O     . ALA E 192 ? 0.7515 0.8111 0.7605 -0.0148 -0.0014 -0.0088 191 ALA A O     
2236 C  CB    . ALA E 192 ? 0.7510 0.8027 0.7539 -0.0142 0.0006  -0.0062 191 ALA A CB    
2237 N  N     . GLU E 193 ? 0.7588 0.8083 0.7676 -0.0115 -0.0022 -0.0074 192 GLU A N     
2238 C  CA    . GLU E 193 ? 0.7627 0.8049 0.7714 -0.0106 -0.0019 -0.0014 192 GLU A CA    
2239 C  C     . GLU E 193 ? 0.7653 0.8009 0.7671 -0.0102 -0.0024 -0.0001 192 GLU A C     
2240 O  O     . GLU E 193 ? 0.7623 0.7990 0.7641 -0.0107 -0.0024 -0.0003 192 GLU A O     
2241 C  CB    . GLU E 193 ? 0.7618 0.8093 0.7740 -0.0108 -0.0025 0.0000  192 GLU A CB    
2242 C  CG    . GLU E 193 ? 0.7527 0.7968 0.7843 -0.0138 -0.0011 0.0116  192 GLU A CG    
2243 C  CD    . GLU E 193 ? 0.7403 0.7914 0.7953 -0.0155 -0.0029 0.0245  192 GLU A CD    
2244 O  OE1   . GLU E 193 ? 0.7286 0.7719 0.7970 -0.0162 -0.0122 0.0445  192 GLU A OE1   
2245 O  OE2   . GLU E 193 ? 0.7397 0.7790 0.8020 -0.0198 0.0047  0.0297  192 GLU A OE2   
2246 N  N     . LYS E 194 ? 0.7679 0.7979 0.7689 -0.0111 -0.0012 0.0038  193 LYS A N     
2247 C  CA    . LYS E 194 ? 0.7705 0.7964 0.7749 -0.0112 0.0001  0.0069  193 LYS A CA    
2248 C  C     . LYS E 194 ? 0.7716 0.7954 0.7786 -0.0121 0.0001  0.0057  193 LYS A C     
2249 O  O     . LYS E 194 ? 0.7729 0.8036 0.7786 -0.0125 -0.0006 0.0040  193 LYS A O     
2250 C  CB    . LYS E 194 ? 0.7700 0.7950 0.7750 -0.0101 0.0003  0.0119  193 LYS A CB    
2251 C  CG    . LYS E 194 ? 0.7706 0.7976 0.7796 -0.0080 0.0077  0.0197  193 LYS A CG    
2252 C  CD    . LYS E 194 ? 0.7821 0.8043 0.8045 -0.0030 0.0100  0.0323  193 LYS A CD    
2253 C  CE    . LYS E 194 ? 0.7777 0.8079 0.8194 -0.0013 0.0060  0.0424  193 LYS A CE    
2254 N  NZ    . LYS E 194 ? 0.7679 0.8019 0.8190 -0.0136 0.0153  0.0643  193 LYS A NZ    
2255 N  N     . LEU E 195 ? 0.7719 0.7902 0.7801 -0.0123 -0.0001 0.0043  194 LEU A N     
2256 C  CA    . LEU E 195 ? 0.7739 0.7870 0.7809 -0.0110 0.0001  0.0022  194 LEU A CA    
2257 C  C     . LEU E 195 ? 0.7714 0.7861 0.7789 -0.0105 0.0000  0.0019  194 LEU A C     
2258 O  O     . LEU E 195 ? 0.7722 0.7825 0.7766 -0.0116 0.0000  0.0015  194 LEU A O     
2259 C  CB    . LEU E 195 ? 0.7752 0.7865 0.7813 -0.0110 0.0001  0.0007  194 LEU A CB    
2260 C  CG    . LEU E 195 ? 0.7826 0.7831 0.7871 -0.0088 -0.0044 -0.0018 194 LEU A CG    
2261 C  CD1   . LEU E 195 ? 0.7888 0.7867 0.7862 -0.0126 -0.0120 -0.0078 194 LEU A CD1   
2262 C  CD2   . LEU E 195 ? 0.7858 0.7798 0.7902 -0.0116 0.0008  -0.0008 194 LEU A CD2   
2263 N  N     . LYS E 196 ? 0.7683 0.7854 0.7781 -0.0085 -0.0013 0.0009  195 LYS A N     
2264 C  CA    . LYS E 196 ? 0.7619 0.7875 0.7741 -0.0072 -0.0032 0.0009  195 LYS A CA    
2265 C  C     . LYS E 196 ? 0.7555 0.7842 0.7646 -0.0071 -0.0043 -0.0001 195 LYS A C     
2266 O  O     . LYS E 196 ? 0.7551 0.7864 0.7630 -0.0098 -0.0086 -0.0023 195 LYS A O     
2267 C  CB    . LYS E 196 ? 0.7623 0.7881 0.7747 -0.0065 -0.0016 0.0025  195 LYS A CB    
2268 C  CG    . LYS E 196 ? 0.7607 0.7851 0.7892 -0.0032 0.0013  0.0057  195 LYS A CG    
2269 C  CD    . LYS E 196 ? 0.7489 0.7902 0.8074 0.0036  0.0140  0.0087  195 LYS A CD    
2270 C  CE    . LYS E 196 ? 0.7409 0.7951 0.8111 0.0075  0.0198  0.0073  195 LYS A CE    
2271 N  NZ    . LYS E 196 ? 0.7390 0.8009 0.8147 0.0051  0.0268  0.0007  195 LYS A NZ    
2272 N  N     . LYS E 197 ? 0.7437 0.7786 0.7510 -0.0064 -0.0040 0.0001  196 LYS A N     
2273 C  CA    . LYS E 197 ? 0.7326 0.7729 0.7419 -0.0065 0.0020  0.0007  196 LYS A CA    
2274 C  C     . LYS E 197 ? 0.7233 0.7659 0.7294 -0.0068 0.0015  0.0001  196 LYS A C     
2275 O  O     . LYS E 197 ? 0.7233 0.7658 0.7271 -0.0075 0.0014  0.0003  196 LYS A O     
2276 C  CB    . LYS E 197 ? 0.7315 0.7763 0.7463 -0.0057 0.0020  0.0012  196 LYS A CB    
2277 C  CG    . LYS E 197 ? 0.7255 0.7795 0.7484 -0.0077 0.0010  0.0001  196 LYS A CG    
2278 C  CD    . LYS E 197 ? 0.7061 0.7839 0.7391 -0.0174 -0.0064 -0.0079 196 LYS A CD    
2279 C  CE    . LYS E 197 ? 0.7004 0.7875 0.7469 -0.0170 -0.0061 -0.0086 196 LYS A CE    
2280 N  NZ    . LYS E 197 ? 0.6825 0.7835 0.7518 -0.0231 -0.0043 -0.0099 196 LYS A NZ    
2281 N  N     . LEU E 198 ? 0.7110 0.7548 0.7128 -0.0055 0.0033  0.0000  197 LEU A N     
2282 C  CA    . LEU E 198 ? 0.6907 0.7376 0.7003 -0.0055 0.0021  -0.0013 197 LEU A CA    
2283 C  C     . LEU E 198 ? 0.6769 0.7276 0.6864 -0.0061 0.0020  -0.0007 197 LEU A C     
2284 O  O     . LEU E 198 ? 0.6717 0.7297 0.6841 -0.0052 -0.0006 -0.0024 197 LEU A O     
2285 C  CB    . LEU E 198 ? 0.6893 0.7358 0.6995 -0.0041 0.0044  0.0018  197 LEU A CB    
2286 C  CG    . LEU E 198 ? 0.6853 0.7300 0.6919 -0.0057 0.0063  0.0002  197 LEU A CG    
2287 C  CD1   . LEU E 198 ? 0.6761 0.7324 0.6944 -0.0043 0.0089  0.0041  197 LEU A CD1   
2288 C  CD2   . LEU E 198 ? 0.6702 0.7162 0.6851 -0.0086 0.0052  0.0011  197 LEU A CD2   
2289 N  N     . GLY E 199 ? 0.6625 0.7140 0.6712 -0.0055 0.0018  -0.0033 198 GLY A N     
2290 C  CA    . GLY E 199 ? 0.6474 0.6957 0.6504 -0.0110 0.0019  -0.0030 198 GLY A CA    
2291 C  C     . GLY E 199 ? 0.6394 0.6794 0.6363 -0.0138 0.0039  -0.0063 198 GLY A C     
2292 O  O     . GLY E 199 ? 0.6380 0.6764 0.6341 -0.0156 0.0053  -0.0066 198 GLY A O     
2293 N  N     . ILE E 200 ? 0.6262 0.6682 0.6224 -0.0140 0.0043  -0.0078 199 ILE A N     
2294 C  CA    . ILE E 200 ? 0.6149 0.6522 0.6064 -0.0144 0.0023  -0.0124 199 ILE A CA    
2295 C  C     . ILE E 200 ? 0.6096 0.6471 0.6048 -0.0167 0.0017  -0.0112 199 ILE A C     
2296 O  O     . ILE E 200 ? 0.6099 0.6475 0.6101 -0.0202 0.0016  -0.0154 199 ILE A O     
2297 C  CB    . ILE E 200 ? 0.6106 0.6481 0.5993 -0.0135 -0.0006 -0.0155 199 ILE A CB    
2298 C  CG1   . ILE E 200 ? 0.5961 0.6407 0.5965 -0.0088 0.0046  -0.0201 199 ILE A CG1   
2299 C  CG2   . ILE E 200 ? 0.6152 0.6407 0.5901 -0.0135 -0.0022 -0.0203 199 ILE A CG2   
2300 C  CD1   . ILE E 200 ? 0.5755 0.6413 0.5760 -0.0023 0.0084  -0.0229 199 ILE A CD1   
2301 N  N     . ASN E 201 ? 0.6059 0.6421 0.5992 -0.0183 0.0018  -0.0085 200 ASN A N     
2302 C  CA    . ASN E 201 ? 0.6028 0.6402 0.5931 -0.0188 0.0012  -0.0072 200 ASN A CA    
2303 C  C     . ASN E 201 ? 0.5996 0.6331 0.5833 -0.0209 0.0003  -0.0062 200 ASN A C     
2304 O  O     . ASN E 201 ? 0.5989 0.6341 0.5897 -0.0226 0.0020  -0.0008 200 ASN A O     
2305 C  CB    . ASN E 201 ? 0.6057 0.6409 0.5936 -0.0187 0.0027  -0.0067 200 ASN A CB    
2306 C  CG    . ASN E 201 ? 0.6067 0.6547 0.6051 -0.0125 0.0011  -0.0093 200 ASN A CG    
2307 O  OD1   . ASN E 201 ? 0.6051 0.6732 0.6200 -0.0117 0.0116  -0.0042 200 ASN A OD1   
2308 N  ND2   . ASN E 201 ? 0.6107 0.6637 0.6020 -0.0070 -0.0011 -0.0106 200 ASN A ND2   
2309 N  N     . LYS E 202 ? 0.5935 0.6237 0.5722 -0.0194 -0.0020 -0.0085 201 LYS A N     
2310 C  CA    . LYS E 202 ? 0.5877 0.6124 0.5591 -0.0190 -0.0029 -0.0093 201 LYS A CA    
2311 C  C     . LYS E 202 ? 0.5806 0.6070 0.5522 -0.0151 -0.0037 -0.0124 201 LYS A C     
2312 O  O     . LYS E 202 ? 0.5777 0.6033 0.5504 -0.0144 -0.0049 -0.0140 201 LYS A O     
2313 C  CB    . LYS E 202 ? 0.5892 0.6118 0.5589 -0.0209 -0.0053 -0.0074 201 LYS A CB    
2314 C  CG    . LYS E 202 ? 0.6009 0.6165 0.5631 -0.0299 -0.0089 -0.0022 201 LYS A CG    
2315 C  CD    . LYS E 202 ? 0.6139 0.6197 0.5804 -0.0472 -0.0042 0.0059  201 LYS A CD    
2316 C  CE    . LYS E 202 ? 0.6256 0.6321 0.6037 -0.0569 -0.0013 0.0091  201 LYS A CE    
2317 N  NZ    . LYS E 202 ? 0.6232 0.6335 0.5974 -0.0732 -0.0062 -0.0021 201 LYS A NZ    
2318 N  N     . LEU E 203 ? 0.5754 0.5985 0.5406 -0.0121 -0.0034 -0.0153 202 LEU A N     
2319 C  CA    . LEU E 203 ? 0.5673 0.5891 0.5248 -0.0085 -0.0061 -0.0160 202 LEU A CA    
2320 C  C     . LEU E 203 ? 0.5656 0.5868 0.5210 -0.0079 -0.0086 -0.0217 202 LEU A C     
2321 O  O     . LEU E 203 ? 0.5621 0.5839 0.5049 -0.0105 -0.0107 -0.0256 202 LEU A O     
2322 C  CB    . LEU E 203 ? 0.5652 0.5856 0.5170 -0.0060 -0.0074 -0.0151 202 LEU A CB    
2323 C  CG    . LEU E 203 ? 0.5550 0.5798 0.4842 -0.0030 -0.0014 -0.0035 202 LEU A CG    
2324 C  CD1   . LEU E 203 ? 0.5493 0.5784 0.4314 -0.0109 0.0088  -0.0007 202 LEU A CD1   
2325 C  CD2   . LEU E 203 ? 0.5436 0.5730 0.4595 -0.0046 -0.0087 0.0114  202 LEU A CD2   
2326 N  N     . VAL E 204 ? 0.5647 0.5875 0.5242 -0.0058 -0.0101 -0.0239 203 VAL A N     
2327 C  CA    . VAL E 204 ? 0.5654 0.5878 0.5349 -0.0052 -0.0116 -0.0291 203 VAL A CA    
2328 C  C     . VAL E 204 ? 0.5694 0.5923 0.5314 -0.0052 -0.0106 -0.0301 203 VAL A C     
2329 O  O     . VAL E 204 ? 0.5669 0.5896 0.5261 -0.0053 -0.0109 -0.0343 203 VAL A O     
2330 C  CB    . VAL E 204 ? 0.5637 0.5836 0.5363 -0.0039 -0.0134 -0.0296 203 VAL A CB    
2331 C  CG1   . VAL E 204 ? 0.5583 0.5831 0.5501 -0.0043 -0.0175 -0.0308 203 VAL A CG1   
2332 C  CG2   . VAL E 204 ? 0.5557 0.5716 0.5372 -0.0030 -0.0119 -0.0333 203 VAL A CG2   
2333 N  N     . ASP E 205 ? 0.5722 0.6003 0.5351 -0.0031 -0.0083 -0.0303 204 ASP A N     
2334 C  CA    . ASP E 205 ? 0.5764 0.6051 0.5358 -0.0001 -0.0077 -0.0287 204 ASP A CA    
2335 C  C     . ASP E 205 ? 0.5785 0.6062 0.5363 -0.0018 -0.0054 -0.0275 204 ASP A C     
2336 O  O     . ASP E 205 ? 0.5806 0.6112 0.5274 -0.0041 -0.0063 -0.0311 204 ASP A O     
2337 C  CB    . ASP E 205 ? 0.5768 0.6066 0.5428 0.0006  -0.0082 -0.0286 204 ASP A CB    
2338 C  CG    . ASP E 205 ? 0.5841 0.6110 0.5557 0.0064  -0.0103 -0.0278 204 ASP A CG    
2339 O  OD1   . ASP E 205 ? 0.5821 0.6179 0.5631 0.0036  -0.0124 -0.0317 204 ASP A OD1   
2340 O  OD2   . ASP E 205 ? 0.5795 0.6276 0.5809 0.0118  -0.0092 -0.0229 204 ASP A OD2   
2341 N  N     . THR E 206 ? 0.5798 0.6090 0.5412 -0.0013 -0.0051 -0.0249 205 THR A N     
2342 C  CA    . THR E 206 ? 0.5861 0.6112 0.5433 -0.0003 -0.0028 -0.0260 205 THR A CA    
2343 C  C     . THR E 206 ? 0.5929 0.6147 0.5464 -0.0011 -0.0008 -0.0197 205 THR A C     
2344 O  O     . THR E 206 ? 0.5951 0.6175 0.5483 -0.0022 -0.0001 -0.0211 205 THR A O     
2345 C  CB    . THR E 206 ? 0.5851 0.6097 0.5389 0.0000  -0.0034 -0.0282 205 THR A CB    
2346 O  OG1   . THR E 206 ? 0.5839 0.6007 0.5167 0.0026  -0.0024 -0.0446 205 THR A OG1   
2347 C  CG2   . THR E 206 ? 0.5788 0.6076 0.5414 -0.0031 -0.0059 -0.0284 205 THR A CG2   
2348 N  N     . LEU E 207 ? 0.6011 0.6182 0.5477 0.0000  0.0027  -0.0193 206 LEU A N     
2349 C  CA    . LEU E 207 ? 0.6131 0.6270 0.5588 0.0016  0.0054  -0.0168 206 LEU A CA    
2350 C  C     . LEU E 207 ? 0.6189 0.6343 0.5638 0.0036  0.0060  -0.0165 206 LEU A C     
2351 O  O     . LEU E 207 ? 0.6169 0.6334 0.5581 0.0060  0.0061  -0.0151 206 LEU A O     
2352 C  CB    . LEU E 207 ? 0.6132 0.6259 0.5563 -0.0001 0.0042  -0.0138 206 LEU A CB    
2353 C  CG    . LEU E 207 ? 0.6173 0.6169 0.5366 -0.0027 0.0079  -0.0110 206 LEU A CG    
2354 C  CD1   . LEU E 207 ? 0.6136 0.6205 0.5192 -0.0089 0.0202  -0.0029 206 LEU A CD1   
2355 C  CD2   . LEU E 207 ? 0.6143 0.6146 0.5006 -0.0156 0.0189  -0.0136 206 LEU A CD2   
2356 N  N     . SER E 208 ? 0.6270 0.6418 0.5701 0.0042  0.0111  -0.0168 207 SER A N     
2357 C  CA    . SER E 208 ? 0.6378 0.6465 0.5679 0.0059  0.0119  -0.0192 207 SER A CA    
2358 C  C     . SER E 208 ? 0.6443 0.6555 0.5750 0.0054  0.0143  -0.0155 207 SER A C     
2359 O  O     . SER E 208 ? 0.6467 0.6594 0.5732 0.0034  0.0157  -0.0150 207 SER A O     
2360 C  CB    . SER E 208 ? 0.6371 0.6426 0.5627 0.0080  0.0128  -0.0205 207 SER A CB    
2361 O  OG    . SER E 208 ? 0.6381 0.6315 0.5495 0.0148  0.0131  -0.0320 207 SER A OG    
2362 N  N     . ILE E 209 ? 0.6512 0.6580 0.5846 0.0051  0.0160  -0.0135 208 ILE A N     
2363 C  CA    . ILE E 209 ? 0.6539 0.6617 0.5980 0.0091  0.0148  -0.0114 208 ILE A CA    
2364 C  C     . ILE E 209 ? 0.6594 0.6643 0.6069 0.0101  0.0161  -0.0102 208 ILE A C     
2365 O  O     . ILE E 209 ? 0.6599 0.6638 0.6055 0.0105  0.0170  -0.0096 208 ILE A O     
2366 C  CB    . ILE E 209 ? 0.6535 0.6630 0.6050 0.0098  0.0138  -0.0116 208 ILE A CB    
2367 C  CG1   . ILE E 209 ? 0.6531 0.6669 0.6058 0.0113  0.0113  -0.0090 208 ILE A CG1   
2368 C  CG2   . ILE E 209 ? 0.6516 0.6660 0.5921 0.0116  0.0173  -0.0166 208 ILE A CG2   
2369 C  CD1   . ILE E 209 ? 0.6578 0.6849 0.6068 0.0177  0.0162  -0.0016 208 ILE A CD1   
2370 N  N     . GLU E 210 ? 0.6659 0.6676 0.6214 0.0108  0.0164  -0.0099 209 GLU A N     
2371 C  CA    . GLU E 210 ? 0.6734 0.6691 0.6362 0.0097  0.0167  -0.0098 209 GLU A CA    
2372 C  C     . GLU E 210 ? 0.6802 0.6727 0.6418 0.0090  0.0139  -0.0122 209 GLU A C     
2373 O  O     . GLU E 210 ? 0.6782 0.6686 0.6421 0.0083  0.0143  -0.0153 209 GLU A O     
2374 C  CB    . GLU E 210 ? 0.6717 0.6659 0.6332 0.0117  0.0179  -0.0079 209 GLU A CB    
2375 C  CG    . GLU E 210 ? 0.6654 0.6512 0.6283 0.0132  0.0229  -0.0100 209 GLU A CG    
2376 C  CD    . GLU E 210 ? 0.6554 0.6289 0.6369 0.0114  0.0300  -0.0110 209 GLU A CD    
2377 O  OE1   . GLU E 210 ? 0.6591 0.6170 0.6463 0.0137  0.0321  -0.0182 209 GLU A OE1   
2378 O  OE2   . GLU E 210 ? 0.6491 0.6260 0.6351 0.0061  0.0339  -0.0113 209 GLU A OE2   
2379 N  N     . PHE E 211 ? 0.6908 0.6769 0.6544 0.0084  0.0140  -0.0119 210 PHE A N     
2380 C  CA    . PHE E 211 ? 0.7019 0.6835 0.6693 0.0077  0.0105  -0.0094 210 PHE A CA    
2381 C  C     . PHE E 211 ? 0.7067 0.6871 0.6727 0.0082  0.0113  -0.0079 210 PHE A C     
2382 O  O     . PHE E 211 ? 0.7104 0.6830 0.6650 0.0082  0.0154  -0.0091 210 PHE A O     
2383 C  CB    . PHE E 211 ? 0.6998 0.6829 0.6731 0.0087  0.0098  -0.0113 210 PHE A CB    
2384 C  CG    . PHE E 211 ? 0.7075 0.6800 0.6880 0.0087  0.0017  -0.0114 210 PHE A CG    
2385 C  CD1   . PHE E 211 ? 0.7077 0.6678 0.6847 0.0068  0.0047  -0.0075 210 PHE A CD1   
2386 C  CD2   . PHE E 211 ? 0.7167 0.6682 0.7009 0.0173  -0.0044 -0.0071 210 PHE A CD2   
2387 C  CE1   . PHE E 211 ? 0.7091 0.6730 0.6740 0.0155  0.0039  -0.0089 210 PHE A CE1   
2388 C  CE2   . PHE E 211 ? 0.7187 0.6678 0.7004 0.0209  -0.0076 -0.0053 210 PHE A CE2   
2389 C  CZ    . PHE E 211 ? 0.7187 0.6712 0.6915 0.0149  -0.0057 -0.0145 210 PHE A CZ    
2390 N  N     . ASP E 212 ? 0.7097 0.6960 0.6818 0.0080  0.0080  -0.0060 211 ASP A N     
2391 C  CA    . ASP E 212 ? 0.7105 0.7018 0.6866 0.0085  0.0058  -0.0055 211 ASP A CA    
2392 C  C     . ASP E 212 ? 0.7099 0.7033 0.6831 0.0081  0.0060  -0.0055 211 ASP A C     
2393 O  O     . ASP E 212 ? 0.7093 0.7036 0.6734 0.0089  0.0065  -0.0028 211 ASP A O     
2394 C  CB    . ASP E 212 ? 0.7154 0.7021 0.6869 0.0109  0.0032  -0.0034 211 ASP A CB    
2395 C  CG    . ASP E 212 ? 0.7220 0.7095 0.7073 0.0118  -0.0046 -0.0028 211 ASP A CG    
2396 O  OD1   . ASP E 212 ? 0.7367 0.7216 0.7308 0.0225  -0.0232 0.0032  211 ASP A OD1   
2397 O  OD2   . ASP E 212 ? 0.7361 0.7086 0.7183 0.0181  -0.0136 -0.0039 211 ASP A OD2   
2398 N  N     . LYS E 213 ? 0.7084 0.7053 0.6863 0.0067  0.0052  -0.0061 212 LYS A N     
2399 C  CA    . LYS E 213 ? 0.7031 0.7087 0.6828 0.0060  0.0028  -0.0094 212 LYS A CA    
2400 C  C     . LYS E 213 ? 0.7000 0.7061 0.6763 0.0036  0.0036  -0.0090 212 LYS A C     
2401 O  O     . LYS E 213 ? 0.6967 0.7033 0.6727 0.0010  0.0026  -0.0071 212 LYS A O     
2402 C  CB    . LYS E 213 ? 0.7041 0.7096 0.6851 0.0063  0.0013  -0.0113 212 LYS A CB    
2403 C  CG    . LYS E 213 ? 0.7024 0.7170 0.6927 0.0115  -0.0057 -0.0156 212 LYS A CG    
2404 C  CD    . LYS E 213 ? 0.7023 0.7278 0.7080 0.0145  -0.0233 -0.0177 212 LYS A CD    
2405 C  CE    . LYS E 213 ? 0.7057 0.7295 0.6959 0.0158  -0.0373 -0.0308 212 LYS A CE    
2406 N  NZ    . LYS E 213 ? 0.6967 0.7314 0.6868 0.0051  -0.0532 -0.0419 212 LYS A NZ    
2407 N  N     . LEU E 214 ? 0.7001 0.7068 0.6735 0.0019  0.0029  -0.0111 213 LEU A N     
2408 C  CA    . LEU E 214 ? 0.6978 0.7060 0.6720 0.0007  0.0033  -0.0110 213 LEU A CA    
2409 C  C     . LEU E 214 ? 0.6967 0.7056 0.6704 -0.0018 0.0024  -0.0124 213 LEU A C     
2410 O  O     . LEU E 214 ? 0.6917 0.7055 0.6807 -0.0050 0.0008  -0.0173 213 LEU A O     
2411 C  CB    . LEU E 214 ? 0.6991 0.7032 0.6693 0.0021  0.0035  -0.0116 213 LEU A CB    
2412 C  CG    . LEU E 214 ? 0.7007 0.6976 0.6738 0.0045  0.0016  -0.0176 213 LEU A CG    
2413 C  CD1   . LEU E 214 ? 0.7100 0.6834 0.6665 0.0075  -0.0032 -0.0143 213 LEU A CD1   
2414 C  CD2   . LEU E 214 ? 0.7060 0.6843 0.6513 0.0090  0.0038  -0.0324 213 LEU A CD2   
2415 N  N     . LYS E 215 ? 0.6997 0.7067 0.6707 -0.0019 0.0029  -0.0155 214 LYS A N     
2416 C  CA    . LYS E 215 ? 0.7018 0.7094 0.6717 -0.0029 0.0048  -0.0175 214 LYS A CA    
2417 C  C     . LYS E 215 ? 0.7002 0.7114 0.6752 -0.0017 0.0053  -0.0186 214 LYS A C     
2418 O  O     . LYS E 215 ? 0.6997 0.7087 0.6757 -0.0014 0.0067  -0.0177 214 LYS A O     
2419 C  CB    . LYS E 215 ? 0.7037 0.7082 0.6690 -0.0046 0.0053  -0.0179 214 LYS A CB    
2420 C  CG    . LYS E 215 ? 0.7129 0.7035 0.6620 -0.0072 0.0059  -0.0137 214 LYS A CG    
2421 C  CD    . LYS E 215 ? 0.7246 0.7118 0.6783 -0.0208 0.0175  -0.0258 214 LYS A CD    
2422 C  CE    . LYS E 215 ? 0.7350 0.7081 0.6949 -0.0269 0.0261  -0.0285 214 LYS A CE    
2423 N  NZ    . LYS E 215 ? 0.7363 0.6931 0.7081 -0.0337 0.0242  -0.0306 214 LYS A NZ    
2424 N  N     . GLY E 216 ? 0.6966 0.7115 0.6740 0.0000  0.0048  -0.0209 215 GLY A N     
2425 C  CA    . GLY E 216 ? 0.6967 0.7126 0.6770 0.0001  0.0065  -0.0203 215 GLY A CA    
2426 C  C     . GLY E 216 ? 0.6967 0.7143 0.6821 0.0018  0.0067  -0.0200 215 GLY A C     
2427 O  O     . GLY E 216 ? 0.6997 0.7135 0.6859 0.0016  0.0062  -0.0236 215 GLY A O     
2428 N  N     . MET E 217 ? 0.6902 0.7088 0.6802 0.0052  0.0076  -0.0198 216 MET A N     
2429 C  CA    . MET E 217 ? 0.6840 0.7081 0.6741 0.0062  0.0076  -0.0208 216 MET A CA    
2430 C  C     . MET E 217 ? 0.6728 0.7073 0.6669 0.0070  0.0082  -0.0191 216 MET A C     
2431 O  O     . MET E 217 ? 0.6746 0.7110 0.6701 0.0041  0.0098  -0.0209 216 MET A O     
2432 C  CB    . MET E 217 ? 0.6866 0.7064 0.6817 0.0074  0.0122  -0.0225 216 MET A CB    
2433 C  CG    . MET E 217 ? 0.7022 0.7067 0.7106 0.0043  0.0107  -0.0304 216 MET A CG    
2434 S  SD    . MET E 217 ? 0.7296 0.6887 0.7956 0.0159  0.0344  -0.0221 216 MET A SD    
2435 C  CE    . MET E 217 ? 0.7388 0.7093 0.7814 0.0131  0.0324  -0.0266 216 MET A CE    
2436 N  N     . ILE E 218 ? 0.6590 0.7023 0.6489 0.0083  0.0075  -0.0173 217 ILE A N     
2437 C  CA    . ILE E 218 ? 0.6442 0.6909 0.6299 0.0073  0.0096  -0.0194 217 ILE A CA    
2438 C  C     . ILE E 218 ? 0.6381 0.6831 0.6173 0.0085  0.0109  -0.0172 217 ILE A C     
2439 O  O     . ILE E 218 ? 0.6400 0.6840 0.6183 0.0050  0.0164  -0.0231 217 ILE A O     
2440 C  CB    . ILE E 218 ? 0.6411 0.6917 0.6279 0.0076  0.0086  -0.0196 217 ILE A CB    
2441 C  CG1   . ILE E 218 ? 0.6397 0.6948 0.6223 0.0057  0.0036  -0.0291 217 ILE A CG1   
2442 C  CG2   . ILE E 218 ? 0.6283 0.6970 0.6297 0.0094  0.0120  -0.0223 217 ILE A CG2   
2443 C  CD1   . ILE E 218 ? 0.6398 0.6970 0.5796 0.0005  -0.0104 -0.0293 217 ILE A CD1   
2444 N  N     . GLY E 219 ? 0.6304 0.6719 0.6075 0.0086  0.0103  -0.0156 218 GLY A N     
2445 C  CA    . GLY E 219 ? 0.6292 0.6660 0.5924 0.0092  0.0146  -0.0108 218 GLY A CA    
2446 C  C     . GLY E 219 ? 0.6317 0.6616 0.5829 0.0096  0.0154  -0.0100 218 GLY A C     
2447 O  O     . GLY E 219 ? 0.6313 0.6593 0.5642 0.0112  0.0213  -0.0012 218 GLY A O     
2448 N  N     . GLU E 220 ? 0.6289 0.6570 0.5779 0.0082  0.0136  -0.0105 219 GLU A N     
2449 C  CA    . GLU E 220 ? 0.6273 0.6545 0.5788 0.0061  0.0110  -0.0110 219 GLU A CA    
2450 C  C     . GLU E 220 ? 0.6231 0.6527 0.5720 0.0047  0.0100  -0.0135 219 GLU A C     
2451 O  O     . GLU E 220 ? 0.6191 0.6601 0.5747 0.0045  0.0106  -0.0120 219 GLU A O     
2452 C  CB    . GLU E 220 ? 0.6318 0.6552 0.5838 0.0043  0.0106  -0.0139 219 GLU A CB    
2453 C  CG    . GLU E 220 ? 0.6324 0.6712 0.6110 0.0038  0.0190  -0.0175 219 GLU A CG    
2454 C  CD    . GLU E 220 ? 0.6499 0.6828 0.6352 0.0002  0.0198  -0.0251 219 GLU A CD    
2455 O  OE1   . GLU E 220 ? 0.6606 0.6908 0.6347 0.0051  0.0266  -0.0541 219 GLU A OE1   
2456 O  OE2   . GLU E 220 ? 0.6495 0.7001 0.6304 0.0049  0.0199  -0.0290 219 GLU A OE2   
2457 N  N     . ALA E 221 ? 0.6138 0.6455 0.5597 0.0060  0.0108  -0.0098 220 ALA A N     
2458 C  CA    . ALA E 221 ? 0.6070 0.6329 0.5403 0.0035  0.0114  -0.0070 220 ALA A CA    
2459 C  C     . ALA E 221 ? 0.5977 0.6282 0.5284 0.0014  0.0131  -0.0079 220 ALA A C     
2460 O  O     . ALA E 221 ? 0.6022 0.6357 0.5342 0.0032  0.0151  -0.0108 220 ALA A O     
2461 C  CB    . ALA E 221 ? 0.6078 0.6292 0.5484 0.0036  0.0114  -0.0082 220 ALA A CB    
2462 N  N     . LYS E 222 ? 0.5849 0.6159 0.5088 -0.0012 0.0121  -0.0059 221 LYS A N     
2463 C  CA    . LYS E 222 ? 0.5718 0.6075 0.4884 -0.0014 0.0126  -0.0013 221 LYS A CA    
2464 C  C     . LYS E 222 ? 0.5625 0.5975 0.4758 -0.0022 0.0168  0.0021  221 LYS A C     
2465 O  O     . LYS E 222 ? 0.5601 0.5980 0.4677 -0.0058 0.0191  0.0029  221 LYS A O     
2466 C  CB    . LYS E 222 ? 0.5693 0.6104 0.4836 -0.0028 0.0117  -0.0006 221 LYS A CB    
2467 C  CG    . LYS E 222 ? 0.5641 0.6332 0.4889 0.0090  -0.0011 0.0110  221 LYS A CG    
2468 C  CD    . LYS E 222 ? 0.5541 0.6640 0.4862 0.0243  -0.0217 0.0158  221 LYS A CD    
2469 C  CE    . LYS E 222 ? 0.5445 0.6752 0.4725 0.0195  -0.0485 0.0120  221 LYS A CE    
2470 N  NZ    . LYS E 222 ? 0.5329 0.6863 0.4715 0.0096  -0.0640 -0.0007 221 LYS A NZ    
2471 N  N     . ALA E 223 ? 0.5552 0.5836 0.4614 -0.0010 0.0228  0.0015  222 ALA A N     
2472 C  CA    . ALA E 223 ? 0.5428 0.5727 0.4518 -0.0004 0.0231  0.0010  222 ALA A CA    
2473 C  C     . ALA E 223 ? 0.5383 0.5667 0.4440 -0.0007 0.0253  -0.0011 222 ALA A C     
2474 O  O     . ALA E 223 ? 0.5348 0.5687 0.4354 -0.0015 0.0267  0.0015  222 ALA A O     
2475 C  CB    . ALA E 223 ? 0.5391 0.5714 0.4511 0.0016  0.0242  0.0001  222 ALA A CB    
2476 N  N     . LYS E 224 ? 0.5326 0.5648 0.4409 -0.0005 0.0233  -0.0086 223 LYS A N     
2477 C  CA    . LYS E 224 ? 0.5268 0.5579 0.4304 -0.0002 0.0231  -0.0136 223 LYS A CA    
2478 C  C     . LYS E 224 ? 0.5213 0.5497 0.4148 -0.0009 0.0228  -0.0203 223 LYS A C     
2479 O  O     . LYS E 224 ? 0.5193 0.5643 0.4224 -0.0032 0.0270  -0.0258 223 LYS A O     
2480 C  CB    . LYS E 224 ? 0.5280 0.5592 0.4245 -0.0014 0.0263  -0.0119 223 LYS A CB    
2481 C  CG    . LYS E 224 ? 0.5381 0.5770 0.4461 0.0035  0.0335  -0.0021 223 LYS A CG    
2482 C  CD    . LYS E 224 ? 0.5710 0.6057 0.5114 -0.0064 0.0482  0.0083  223 LYS A CD    
2483 C  CE    . LYS E 224 ? 0.5764 0.6147 0.5356 -0.0154 0.0466  0.0100  223 LYS A CE    
2484 N  NZ    . LYS E 224 ? 0.5849 0.6097 0.5157 -0.0114 0.0514  0.0204  223 LYS A NZ    
2485 N  N     . TYR E 225 ? 0.5141 0.5333 0.3941 0.0002  0.0238  -0.0181 224 TYR A N     
2486 C  CA    . TYR E 225 ? 0.5060 0.5135 0.3763 0.0016  0.0232  -0.0174 224 TYR A CA    
2487 C  C     . TYR E 225 ? 0.5028 0.5108 0.3636 0.0016  0.0207  -0.0194 224 TYR A C     
2488 O  O     . TYR E 225 ? 0.5077 0.5173 0.3591 0.0033  0.0192  -0.0245 224 TYR A O     
2489 C  CB    . TYR E 225 ? 0.5008 0.5078 0.3723 0.0009  0.0200  -0.0175 224 TYR A CB    
2490 C  CG    . TYR E 225 ? 0.4880 0.4789 0.3700 0.0010  0.0265  -0.0219 224 TYR A CG    
2491 C  CD1   . TYR E 225 ? 0.4868 0.4570 0.3718 -0.0029 0.0307  -0.0122 224 TYR A CD1   
2492 C  CD2   . TYR E 225 ? 0.4839 0.4709 0.3704 0.0064  0.0270  -0.0170 224 TYR A CD2   
2493 C  CE1   . TYR E 225 ? 0.5047 0.4513 0.3922 -0.0073 0.0289  -0.0114 224 TYR A CE1   
2494 C  CE2   . TYR E 225 ? 0.4850 0.4795 0.3913 0.0030  0.0169  -0.0108 224 TYR A CE2   
2495 C  CZ    . TYR E 225 ? 0.4950 0.4674 0.3960 -0.0039 0.0202  -0.0029 224 TYR A CZ    
2496 O  OH    . TYR E 225 ? 0.5225 0.4341 0.3905 -0.0404 0.0177  0.0080  224 TYR A OH    
2497 N  N     . LEU E 226 ? 0.4985 0.5044 0.3510 0.0000  0.0177  -0.0204 225 LEU A N     
2498 C  CA    . LEU E 226 ? 0.4950 0.4992 0.3490 0.0016  0.0183  -0.0160 225 LEU A CA    
2499 C  C     . LEU E 226 ? 0.4962 0.4996 0.3573 0.0054  0.0180  -0.0105 225 LEU A C     
2500 O  O     . LEU E 226 ? 0.4990 0.4991 0.3578 0.0090  0.0185  -0.0139 225 LEU A O     
2501 C  CB    . LEU E 226 ? 0.4935 0.4966 0.3351 -0.0017 0.0207  -0.0150 225 LEU A CB    
2502 C  CG    . LEU E 226 ? 0.4821 0.4899 0.3313 -0.0106 0.0116  -0.0199 225 LEU A CG    
2503 C  CD1   . LEU E 226 ? 0.4825 0.4789 0.3107 -0.0124 0.0064  -0.0378 225 LEU A CD1   
2504 C  CD2   . LEU E 226 ? 0.4586 0.4867 0.2843 -0.0330 0.0035  -0.0221 225 LEU A CD2   
2505 N  N     . ILE E 227 ? 0.4954 0.4985 0.3593 0.0066  0.0207  -0.0058 226 ILE A N     
2506 C  CA    . ILE E 227 ? 0.4919 0.4984 0.3628 0.0073  0.0182  -0.0020 226 ILE A CA    
2507 C  C     . ILE E 227 ? 0.4917 0.4977 0.3741 0.0071  0.0170  -0.0005 226 ILE A C     
2508 O  O     . ILE E 227 ? 0.4982 0.4937 0.3712 0.0119  0.0198  -0.0022 226 ILE A O     
2509 C  CB    . ILE E 227 ? 0.4895 0.4969 0.3513 0.0087  0.0172  -0.0013 226 ILE A CB    
2510 C  CG1   . ILE E 227 ? 0.4959 0.5037 0.3178 0.0086  0.0239  -0.0098 226 ILE A CG1   
2511 C  CG2   . ILE E 227 ? 0.4845 0.4818 0.3393 0.0091  0.0181  -0.0089 226 ILE A CG2   
2512 C  CD1   . ILE E 227 ? 0.4972 0.5084 0.2065 0.0127  0.0223  -0.0223 226 ILE A CD1   
2513 N  N     . SER E 228 ? 0.4867 0.4962 0.3707 0.0024  0.0117  0.0015  227 SER A N     
2514 C  CA    . SER E 228 ? 0.4864 0.4987 0.3786 0.0000  0.0106  0.0038  227 SER A CA    
2515 C  C     . SER E 228 ? 0.4844 0.5007 0.3818 0.0020  0.0132  0.0066  227 SER A C     
2516 O  O     . SER E 228 ? 0.4861 0.5063 0.3866 0.0031  0.0112  0.0083  227 SER A O     
2517 C  CB    . SER E 228 ? 0.4883 0.5014 0.3779 -0.0017 0.0108  -0.0002 227 SER A CB    
2518 O  OG    . SER E 228 ? 0.4967 0.5119 0.3669 -0.0140 -0.0008 -0.0004 227 SER A OG    
2519 N  N     . LEU E 229 ? 0.4748 0.4955 0.3708 0.0065  0.0162  0.0072  228 LEU A N     
2520 C  CA    . LEU E 229 ? 0.4716 0.4933 0.3634 0.0071  0.0158  0.0055  228 LEU A CA    
2521 C  C     . LEU E 229 ? 0.4709 0.4929 0.3527 0.0117  0.0145  0.0066  228 LEU A C     
2522 O  O     . LEU E 229 ? 0.4739 0.4963 0.3558 0.0118  0.0173  0.0120  228 LEU A O     
2523 C  CB    . LEU E 229 ? 0.4676 0.4943 0.3645 0.0097  0.0153  0.0026  228 LEU A CB    
2524 C  CG    . LEU E 229 ? 0.4606 0.4913 0.3581 0.0083  0.0205  0.0068  228 LEU A CG    
2525 C  CD1   . LEU E 229 ? 0.4622 0.4890 0.3939 0.0045  0.0141  0.0175  228 LEU A CD1   
2526 C  CD2   . LEU E 229 ? 0.4551 0.4817 0.3510 0.0038  0.0331  0.0084  228 LEU A CD2   
2527 N  N     . ALA E 230 ? 0.4724 0.4876 0.3367 0.0151  0.0077  0.0032  229 ALA A N     
2528 C  CA    . ALA E 230 ? 0.4766 0.4868 0.3332 0.0170  0.0044  -0.0012 229 ALA A CA    
2529 C  C     . ALA E 230 ? 0.4789 0.4877 0.3181 0.0176  0.0006  -0.0065 229 ALA A C     
2530 O  O     . ALA E 230 ? 0.4792 0.4901 0.3149 0.0220  -0.0042 -0.0032 229 ALA A O     
2531 C  CB    . ALA E 230 ? 0.4797 0.4888 0.3257 0.0185  0.0063  0.0000  229 ALA A CB    
2532 N  N     . ARG E 231 ? 0.4839 0.4857 0.3083 0.0163  -0.0005 -0.0141 230 ARG A N     
2533 C  CA    . ARG E 231 ? 0.4924 0.4945 0.3042 0.0129  0.0061  -0.0205 230 ARG A CA    
2534 C  C     . ARG E 231 ? 0.4988 0.5054 0.3101 0.0112  0.0047  -0.0201 230 ARG A C     
2535 O  O     . ARG E 231 ? 0.5017 0.5052 0.2896 0.0104  0.0009  -0.0185 230 ARG A O     
2536 C  CB    . ARG E 231 ? 0.4897 0.4916 0.3068 0.0155  0.0098  -0.0265 230 ARG A CB    
2537 C  CG    . ARG E 231 ? 0.5077 0.4976 0.2597 0.0038  0.0143  -0.0256 230 ARG A CG    
2538 C  CD    . ARG E 231 ? 0.5371 0.5005 0.3034 -0.0190 0.0141  -0.0172 230 ARG A CD    
2539 N  NE    . ARG E 231 ? 0.5772 0.5131 0.2982 -0.0420 0.0191  0.0192  230 ARG A NE    
2540 C  CZ    . ARG E 231 ? 0.5956 0.5175 0.2806 -0.0542 0.0252  0.0265  230 ARG A CZ    
2541 N  NH1   . ARG E 231 ? 0.6075 0.4922 0.2763 -0.0602 0.0441  0.0486  230 ARG A NH1   
2542 N  NH2   . ARG E 231 ? 0.6081 0.5179 0.3375 -0.0700 0.0150  0.0068  230 ARG A NH2   
2543 N  N     . ASP E 232 ? 0.5076 0.5187 0.3273 0.0096  0.0114  -0.0157 231 ASP A N     
2544 C  CA    . ASP E 232 ? 0.5147 0.5303 0.3285 0.0085  0.0080  -0.0176 231 ASP A CA    
2545 C  C     . ASP E 232 ? 0.5134 0.5355 0.3317 0.0046  0.0107  -0.0182 231 ASP A C     
2546 O  O     . ASP E 232 ? 0.5076 0.5268 0.3091 0.0096  0.0151  -0.0261 231 ASP A O     
2547 C  CB    . ASP E 232 ? 0.5213 0.5403 0.3474 0.0112  0.0088  -0.0126 231 ASP A CB    
2548 C  CG    . ASP E 232 ? 0.5421 0.5631 0.3655 0.0214  0.0071  -0.0156 231 ASP A CG    
2549 O  OD1   . ASP E 232 ? 0.5806 0.5754 0.3797 0.0308  0.0059  -0.0116 231 ASP A OD1   
2550 O  OD2   . ASP E 232 ? 0.5579 0.5928 0.4010 0.0319  0.0324  -0.0128 231 ASP A OD2   
2551 N  N     . GLU E 233 ? 0.5165 0.5451 0.3591 -0.0014 0.0111  -0.0145 232 GLU A N     
2552 C  CA    . GLU E 233 ? 0.5158 0.5512 0.3898 -0.0079 0.0158  -0.0126 232 GLU A CA    
2553 C  C     . GLU E 233 ? 0.5151 0.5475 0.3968 -0.0150 0.0187  -0.0135 232 GLU A C     
2554 O  O     . GLU E 233 ? 0.5172 0.5513 0.4068 -0.0200 0.0207  -0.0132 232 GLU A O     
2555 C  CB    . GLU E 233 ? 0.5106 0.5520 0.3829 -0.0048 0.0144  -0.0118 232 GLU A CB    
2556 C  CG    . GLU E 233 ? 0.5060 0.5720 0.3949 0.0057  0.0129  -0.0184 232 GLU A CG    
2557 C  CD    . GLU E 233 ? 0.4897 0.6034 0.4016 0.0196  0.0096  -0.0167 232 GLU A CD    
2558 O  OE1   . GLU E 233 ? 0.4995 0.6052 0.4213 0.0481  0.0025  -0.0223 232 GLU A OE1   
2559 O  OE2   . GLU E 233 ? 0.4836 0.6232 0.3651 0.0115  0.0104  -0.0223 232 GLU A OE2   
2560 N  N     . TYR E 234 ? 0.5143 0.5486 0.4133 -0.0173 0.0193  -0.0079 233 TYR A N     
2561 C  CA    . TYR E 234 ? 0.5083 0.5445 0.4151 -0.0193 0.0217  -0.0041 233 TYR A CA    
2562 C  C     . TYR E 234 ? 0.5084 0.5424 0.4245 -0.0213 0.0213  -0.0031 233 TYR A C     
2563 O  O     . TYR E 234 ? 0.5061 0.5492 0.4216 -0.0228 0.0187  0.0005  233 TYR A O     
2564 C  CB    . TYR E 234 ? 0.5053 0.5432 0.4073 -0.0221 0.0220  -0.0021 233 TYR A CB    
2565 C  CG    . TYR E 234 ? 0.5058 0.5421 0.4067 -0.0294 0.0280  0.0098  233 TYR A CG    
2566 C  CD1   . TYR E 234 ? 0.4932 0.5517 0.3931 -0.0347 0.0400  0.0099  233 TYR A CD1   
2567 C  CD2   . TYR E 234 ? 0.5118 0.5439 0.3797 -0.0474 0.0459  0.0190  233 TYR A CD2   
2568 C  CE1   . TYR E 234 ? 0.5047 0.5576 0.3715 -0.0507 0.0348  0.0176  233 TYR A CE1   
2569 C  CE2   . TYR E 234 ? 0.5214 0.5261 0.3644 -0.0509 0.0414  0.0373  233 TYR A CE2   
2570 C  CZ    . TYR E 234 ? 0.5000 0.5463 0.3591 -0.0522 0.0468  0.0313  233 TYR A CZ    
2571 O  OH    . TYR E 234 ? 0.4825 0.5610 0.2956 -0.0922 0.0728  0.0698  233 TYR A OH    
2572 N  N     . ASN E 235 ? 0.5099 0.5434 0.4437 -0.0234 0.0231  -0.0001 234 ASN A N     
2573 C  CA    . ASN E 235 ? 0.5148 0.5411 0.4656 -0.0224 0.0196  0.0038  234 ASN A CA    
2574 C  C     . ASN E 235 ? 0.5163 0.5336 0.4784 -0.0212 0.0161  0.0076  234 ASN A C     
2575 O  O     . ASN E 235 ? 0.5136 0.5376 0.4901 -0.0217 0.0165  0.0145  234 ASN A O     
2576 C  CB    . ASN E 235 ? 0.5167 0.5471 0.4775 -0.0264 0.0195  0.0011  234 ASN A CB    
2577 C  CG    . ASN E 235 ? 0.5275 0.5533 0.4849 -0.0368 0.0078  0.0000  234 ASN A CG    
2578 O  OD1   . ASN E 235 ? 0.5423 0.5835 0.4791 -0.0564 0.0015  0.0039  234 ASN A OD1   
2579 N  ND2   . ASN E 235 ? 0.5353 0.5360 0.4679 -0.0557 0.0096  0.0016  234 ASN A ND2   
2580 N  N     . GLU E 236 ? 0.5186 0.5220 0.4890 -0.0162 0.0131  0.0097  235 GLU A N     
2581 C  CA    . GLU E 236 ? 0.5172 0.5216 0.4878 -0.0135 0.0104  0.0127  235 GLU A CA    
2582 C  C     . GLU E 236 ? 0.5050 0.5003 0.4822 -0.0132 0.0070  0.0160  235 GLU A C     
2583 O  O     . GLU E 236 ? 0.5052 0.5071 0.4895 -0.0135 0.0001  0.0198  235 GLU A O     
2584 C  CB    . GLU E 236 ? 0.5219 0.5253 0.4898 -0.0144 0.0177  0.0139  235 GLU A CB    
2585 C  CG    . GLU E 236 ? 0.5417 0.5715 0.5053 -0.0121 0.0089  0.0112  235 GLU A CG    
2586 C  CD    . GLU E 236 ? 0.5904 0.6005 0.5491 -0.0223 0.0053  0.0032  235 GLU A CD    
2587 O  OE1   . GLU E 236 ? 0.5785 0.6339 0.5390 -0.0153 0.0157  -0.0114 235 GLU A OE1   
2588 O  OE2   . GLU E 236 ? 0.6133 0.6569 0.5584 -0.0288 -0.0026 0.0057  235 GLU A OE2   
2589 N  N     . PRO E 237 ? 0.4944 0.4851 0.4799 -0.0096 0.0054  0.0138  236 PRO A N     
2590 C  CA    . PRO E 237 ? 0.4860 0.4710 0.4784 -0.0087 0.0091  0.0128  236 PRO A CA    
2591 C  C     . PRO E 237 ? 0.4850 0.4634 0.4835 -0.0098 0.0081  0.0130  236 PRO A C     
2592 O  O     . PRO E 237 ? 0.4795 0.4617 0.4930 -0.0154 0.0087  0.0160  236 PRO A O     
2593 C  CB    . PRO E 237 ? 0.4855 0.4715 0.4754 -0.0045 0.0094  0.0115  236 PRO A CB    
2594 C  CG    . PRO E 237 ? 0.4851 0.4728 0.4741 -0.0059 0.0102  0.0141  236 PRO A CG    
2595 C  CD    . PRO E 237 ? 0.4874 0.4767 0.4791 -0.0105 0.0050  0.0139  236 PRO A CD    
2596 N  N     . ILE E 238 ? 0.4846 0.4586 0.4858 -0.0102 0.0073  0.0136  237 ILE A N     
2597 C  CA    . ILE E 238 ? 0.4814 0.4586 0.4791 -0.0094 0.0088  0.0128  237 ILE A CA    
2598 C  C     . ILE E 238 ? 0.4833 0.4634 0.4814 -0.0084 0.0074  0.0103  237 ILE A C     
2599 O  O     . ILE E 238 ? 0.4857 0.4679 0.4818 -0.0063 0.0051  0.0094  237 ILE A O     
2600 C  CB    . ILE E 238 ? 0.4737 0.4618 0.4752 -0.0099 0.0077  0.0128  237 ILE A CB    
2601 C  CG1   . ILE E 238 ? 0.4695 0.4354 0.4614 -0.0027 0.0075  0.0104  237 ILE A CG1   
2602 C  CG2   . ILE E 238 ? 0.4805 0.4718 0.4804 -0.0136 0.0003  -0.0005 237 ILE A CG2   
2603 C  CD1   . ILE E 238 ? 0.4204 0.3728 0.4239 -0.0269 0.0202  0.0226  237 ILE A CD1   
2604 N  N     . ARG E 239 ? 0.4955 0.4682 0.4901 -0.0077 0.0070  0.0110  238 ARG A N     
2605 C  CA    . ARG E 239 ? 0.5030 0.4750 0.5006 -0.0027 0.0071  0.0096  238 ARG A CA    
2606 C  C     . ARG E 239 ? 0.4915 0.4706 0.5065 -0.0003 0.0074  0.0074  238 ARG A C     
2607 O  O     . ARG E 239 ? 0.4811 0.4673 0.5108 0.0052  0.0086  0.0095  238 ARG A O     
2608 C  CB    . ARG E 239 ? 0.5163 0.4779 0.5140 -0.0048 0.0066  0.0130  238 ARG A CB    
2609 C  CG    . ARG E 239 ? 0.5496 0.5054 0.5266 -0.0053 -0.0022 0.0093  238 ARG A CG    
2610 C  CD    . ARG E 239 ? 0.6238 0.5123 0.5491 -0.0063 0.0080  0.0106  238 ARG A CD    
2611 N  NE    . ARG E 239 ? 0.6611 0.5331 0.5721 -0.0241 0.0152  -0.0056 238 ARG A NE    
2612 C  CZ    . ARG E 239 ? 0.6907 0.5223 0.5856 -0.0309 0.0194  -0.0104 238 ARG A CZ    
2613 N  NH1   . ARG E 239 ? 0.7016 0.5024 0.5763 -0.0351 0.0165  -0.0176 238 ARG A NH1   
2614 N  NH2   . ARG E 239 ? 0.7142 0.5301 0.5981 -0.0398 0.0044  -0.0117 238 ARG A NH2   
2615 N  N     . THR E 240 ? 0.4846 0.4678 0.5112 -0.0009 0.0112  0.0021  239 THR A N     
2616 C  CA    . THR E 240 ? 0.4756 0.4680 0.5067 -0.0024 0.0201  -0.0026 239 THR A CA    
2617 C  C     . THR E 240 ? 0.4789 0.4634 0.5168 -0.0052 0.0260  -0.0011 239 THR A C     
2618 O  O     . THR E 240 ? 0.4837 0.4704 0.5219 -0.0013 0.0286  0.0002  239 THR A O     
2619 C  CB    . THR E 240 ? 0.4745 0.4763 0.5025 -0.0015 0.0192  -0.0051 239 THR A CB    
2620 O  OG1   . THR E 240 ? 0.4730 0.4975 0.4946 0.0135  0.0112  -0.0183 239 THR A OG1   
2621 C  CG2   . THR E 240 ? 0.4726 0.4734 0.5020 -0.0082 0.0222  0.0002  239 THR A CG2   
2622 N  N     . ARG E 241 ? 0.4791 0.4487 0.5285 -0.0091 0.0320  -0.0019 240 ARG A N     
2623 C  CA    . ARG E 241 ? 0.4777 0.4505 0.5334 -0.0124 0.0372  -0.0045 240 ARG A CA    
2624 C  C     . ARG E 241 ? 0.4760 0.4528 0.5310 -0.0181 0.0446  -0.0006 240 ARG A C     
2625 O  O     . ARG E 241 ? 0.4775 0.4687 0.5302 -0.0243 0.0471  0.0030  240 ARG A O     
2626 C  CB    . ARG E 241 ? 0.4799 0.4367 0.5347 -0.0098 0.0322  -0.0077 240 ARG A CB    
2627 C  CG    . ARG E 241 ? 0.4926 0.4380 0.5518 0.0041  0.0213  -0.0152 240 ARG A CG    
2628 C  CD    . ARG E 241 ? 0.5109 0.4501 0.5418 0.0007  0.0247  -0.0201 240 ARG A CD    
2629 N  NE    . ARG E 241 ? 0.5220 0.4852 0.5264 0.0107  0.0190  -0.0292 240 ARG A NE    
2630 C  CZ    . ARG E 241 ? 0.5319 0.4997 0.4968 0.0273  0.0100  -0.0477 240 ARG A CZ    
2631 N  NH1   . ARG E 241 ? 0.5269 0.5254 0.4966 0.0483  0.0094  -0.0420 240 ARG A NH1   
2632 N  NH2   . ARG E 241 ? 0.5606 0.4961 0.4711 0.0606  0.0252  -0.0597 240 ARG A NH2   
2633 N  N     . VAL E 242 ? 0.4723 0.4426 0.5359 -0.0169 0.0558  0.0024  241 VAL A N     
2634 C  CA    . VAL E 242 ? 0.4664 0.4347 0.5356 -0.0142 0.0608  0.0007  241 VAL A CA    
2635 C  C     . VAL E 242 ? 0.4741 0.4341 0.5311 -0.0089 0.0566  0.0002  241 VAL A C     
2636 O  O     . VAL E 242 ? 0.4744 0.4341 0.5338 -0.0052 0.0477  0.0015  241 VAL A O     
2637 C  CB    . VAL E 242 ? 0.4640 0.4361 0.5416 -0.0164 0.0656  -0.0026 241 VAL A CB    
2638 C  CG1   . VAL E 242 ? 0.4387 0.4358 0.5319 -0.0166 0.0689  -0.0160 241 VAL A CG1   
2639 C  CG2   . VAL E 242 ? 0.4660 0.4148 0.5508 -0.0289 0.0787  0.0061  241 VAL A CG2   
2640 N  N     . ARG E 243 ? 0.4804 0.4257 0.5232 -0.0019 0.0527  -0.0036 242 ARG A N     
2641 C  CA    . ARG E 243 ? 0.4784 0.4135 0.5224 0.0000  0.0494  -0.0059 242 ARG A CA    
2642 C  C     . ARG E 243 ? 0.4738 0.3999 0.5152 -0.0010 0.0501  -0.0080 242 ARG A C     
2643 O  O     . ARG E 243 ? 0.4759 0.3989 0.5132 0.0036  0.0529  -0.0089 242 ARG A O     
2644 C  CB    . ARG E 243 ? 0.4900 0.4152 0.5216 -0.0009 0.0490  -0.0084 242 ARG A CB    
2645 C  CG    . ARG E 243 ? 0.5009 0.4235 0.5590 0.0145  0.0340  -0.0194 242 ARG A CG    
2646 C  CD    . ARG E 243 ? 0.5694 0.4076 0.6363 0.0329  -0.0030 -0.0052 242 ARG A CD    
2647 N  NE    . ARG E 243 ? 0.5933 0.4424 0.6830 0.0385  -0.0437 -0.0139 242 ARG A NE    
2648 C  CZ    . ARG E 243 ? 0.5913 0.4311 0.7106 0.0307  -0.0694 -0.0019 242 ARG A CZ    
2649 N  NH1   . ARG E 243 ? 0.6149 0.4449 0.7294 0.0316  -0.0660 0.0010  242 ARG A NH1   
2650 N  NH2   . ARG E 243 ? 0.5777 0.3788 0.7117 0.0449  -0.0926 0.0237  242 ARG A NH2   
2651 N  N     . LYS E 244 ? 0.4659 0.3838 0.5091 -0.0040 0.0535  -0.0104 243 LYS A N     
2652 C  CA    . LYS E 244 ? 0.4581 0.3764 0.4987 -0.0127 0.0618  -0.0077 243 LYS A CA    
2653 C  C     . LYS E 244 ? 0.4526 0.3669 0.4967 -0.0144 0.0659  -0.0085 243 LYS A C     
2654 O  O     . LYS E 244 ? 0.4570 0.3601 0.4971 -0.0102 0.0673  -0.0156 243 LYS A O     
2655 C  CB    . LYS E 244 ? 0.4567 0.3687 0.4953 -0.0120 0.0618  -0.0079 243 LYS A CB    
2656 C  CG    . LYS E 244 ? 0.4714 0.3949 0.4987 -0.0285 0.0663  -0.0004 243 LYS A CG    
2657 C  CD    . LYS E 244 ? 0.4918 0.4527 0.5229 -0.0352 0.0678  -0.0041 243 LYS A CD    
2658 C  CE    . LYS E 244 ? 0.4849 0.5023 0.5278 -0.0503 0.0694  0.0057  243 LYS A CE    
2659 N  NZ    . LYS E 244 ? 0.5023 0.5578 0.5124 -0.0590 0.0687  -0.0186 243 LYS A NZ    
2660 N  N     . SER E 245 ? 0.4398 0.3718 0.4970 -0.0170 0.0660  -0.0171 244 SER A N     
2661 C  CA    . SER E 245 ? 0.4175 0.3566 0.4870 -0.0183 0.0688  -0.0123 244 SER A CA    
2662 C  C     . SER E 245 ? 0.4058 0.3503 0.4930 -0.0199 0.0709  -0.0107 244 SER A C     
2663 O  O     . SER E 245 ? 0.3968 0.3598 0.5168 -0.0168 0.0728  -0.0039 244 SER A O     
2664 C  CB    . SER E 245 ? 0.4215 0.3487 0.4785 -0.0186 0.0687  -0.0128 244 SER A CB    
2665 O  OG    . SER E 245 ? 0.4281 0.3498 0.4977 -0.0303 0.0739  -0.0003 244 SER A OG    
2666 N  N     . ILE E 246 ? 0.3950 0.3512 0.4826 -0.0239 0.0681  -0.0010 245 ILE A N     
2667 C  CA    . ILE E 246 ? 0.3800 0.3446 0.4761 -0.0237 0.0684  0.0070  245 ILE A CA    
2668 C  C     . ILE E 246 ? 0.3828 0.3365 0.4767 -0.0182 0.0657  0.0113  245 ILE A C     
2669 O  O     . ILE E 246 ? 0.3718 0.3121 0.4838 -0.0197 0.0677  0.0007  245 ILE A O     
2670 C  CB    . ILE E 246 ? 0.3717 0.3455 0.4733 -0.0283 0.0708  0.0096  245 ILE A CB    
2671 C  CG1   . ILE E 246 ? 0.3846 0.3144 0.4808 -0.0255 0.0790  0.0006  245 ILE A CG1   
2672 C  CG2   . ILE E 246 ? 0.3743 0.3659 0.4723 -0.0284 0.0754  -0.0040 245 ILE A CG2   
2673 C  CD1   . ILE E 246 ? 0.3768 0.3089 0.4545 -0.0056 0.0921  -0.0241 245 ILE A CD1   
2674 N  N     . GLY E 247 ? 0.3841 0.3481 0.4724 -0.0101 0.0689  0.0156  246 GLY A N     
2675 C  CA    . GLY E 247 ? 0.3862 0.3405 0.4603 -0.0016 0.0630  0.0268  246 GLY A CA    
2676 C  C     . GLY E 247 ? 0.3873 0.3286 0.4504 0.0020  0.0564  0.0329  246 GLY A C     
2677 O  O     . GLY E 247 ? 0.3959 0.3428 0.4435 0.0139  0.0566  0.0370  246 GLY A O     
2678 N  N     . ARG E 248 ? 0.3773 0.3141 0.4301 0.0063  0.0519  0.0309  247 ARG A N     
2679 C  CA    . ARG E 248 ? 0.3753 0.2971 0.4274 -0.0057 0.0427  0.0263  247 ARG A CA    
2680 C  C     . ARG E 248 ? 0.3712 0.2804 0.4219 -0.0162 0.0404  0.0229  247 ARG A C     
2681 O  O     . ARG E 248 ? 0.3738 0.3021 0.4235 -0.0346 0.0336  0.0139  247 ARG A O     
2682 C  CB    . ARG E 248 ? 0.3749 0.3040 0.4208 -0.0040 0.0379  0.0285  247 ARG A CB    
2683 C  CG    . ARG E 248 ? 0.4056 0.3445 0.4310 -0.0063 0.0368  0.0386  247 ARG A CG    
2684 C  CD    . ARG E 248 ? 0.4576 0.4046 0.4624 0.0226  0.0434  0.0627  247 ARG A CD    
2685 N  NE    . ARG E 248 ? 0.4708 0.4494 0.4344 -0.0081 0.0342  0.0912  247 ARG A NE    
2686 C  CZ    . ARG E 248 ? 0.4848 0.4759 0.4472 0.0171  0.0180  0.0612  247 ARG A CZ    
2687 N  NH1   . ARG E 248 ? 0.4226 0.5474 0.4487 0.0297  0.0228  0.0333  247 ARG A NH1   
2688 N  NH2   . ARG E 248 ? 0.4812 0.5211 0.4671 -0.0016 0.0278  0.0771  247 ARG A NH2   
2689 N  N     . ILE E 249 ? 0.3679 0.2657 0.4240 -0.0135 0.0473  0.0243  248 ILE A N     
2690 C  CA    . ILE E 249 ? 0.3577 0.2533 0.4321 -0.0147 0.0518  0.0287  248 ILE A CA    
2691 C  C     . ILE E 249 ? 0.3532 0.2675 0.4373 -0.0215 0.0576  0.0273  248 ILE A C     
2692 O  O     . ILE E 249 ? 0.3426 0.2809 0.4348 -0.0103 0.0559  0.0482  248 ILE A O     
2693 C  CB    . ILE E 249 ? 0.3508 0.2477 0.4323 -0.0175 0.0541  0.0290  248 ILE A CB    
2694 C  CG1   . ILE E 249 ? 0.3445 0.2237 0.4650 -0.0067 0.0499  0.0093  248 ILE A CG1   
2695 C  CG2   . ILE E 249 ? 0.3835 0.2787 0.4761 0.0033  0.0514  0.0169  248 ILE A CG2   
2696 C  CD1   . ILE E 249 ? 0.3396 0.1656 0.5033 -0.0082 0.0658  0.0145  248 ILE A CD1   
2697 N  N     . VAL E 250 ? 0.3593 0.2721 0.4416 -0.0281 0.0605  0.0300  249 VAL A N     
2698 C  CA    . VAL E 250 ? 0.3632 0.2906 0.4342 -0.0383 0.0639  0.0316  249 VAL A CA    
2699 C  C     . VAL E 250 ? 0.3632 0.2935 0.4357 -0.0387 0.0647  0.0364  249 VAL A C     
2700 O  O     . VAL E 250 ? 0.3592 0.2780 0.4397 -0.0429 0.0725  0.0476  249 VAL A O     
2701 C  CB    . VAL E 250 ? 0.3638 0.2925 0.4456 -0.0394 0.0629  0.0334  249 VAL A CB    
2702 C  CG1   . VAL E 250 ? 0.3611 0.3097 0.4378 -0.0567 0.0708  0.0408  249 VAL A CG1   
2703 C  CG2   . VAL E 250 ? 0.3667 0.2864 0.4541 -0.0399 0.0704  0.0280  249 VAL A CG2   
2704 N  N     . THR E 251 ? 0.3818 0.2945 0.4403 -0.0419 0.0661  0.0393  250 THR A N     
2705 C  CA    . THR E 251 ? 0.3823 0.3121 0.4467 -0.0546 0.0713  0.0447  250 THR A CA    
2706 C  C     . THR E 251 ? 0.4061 0.3254 0.4570 -0.0652 0.0691  0.0482  250 THR A C     
2707 O  O     . THR E 251 ? 0.4096 0.3188 0.4568 -0.0819 0.0774  0.0676  250 THR A O     
2708 C  CB    . THR E 251 ? 0.3858 0.3281 0.4531 -0.0446 0.0696  0.0393  250 THR A CB    
2709 O  OG1   . THR E 251 ? 0.3949 0.3743 0.4578 -0.0366 0.0797  0.0445  250 THR A OG1   
2710 C  CG2   . THR E 251 ? 0.3613 0.3032 0.4403 -0.0507 0.0825  0.0469  250 THR A CG2   
2711 N  N     . MET E 252 ? 0.4202 0.3437 0.4685 -0.0592 0.0665  0.0455  251 MET A N     
2712 C  CA    . MET E 252 ? 0.4597 0.3846 0.4874 -0.0484 0.0667  0.0339  251 MET A CA    
2713 C  C     . MET E 252 ? 0.4734 0.4074 0.5048 -0.0485 0.0581  0.0287  251 MET A C     
2714 O  O     . MET E 252 ? 0.4888 0.4111 0.5159 -0.0407 0.0600  0.0263  251 MET A O     
2715 C  CB    . MET E 252 ? 0.4600 0.3872 0.4836 -0.0489 0.0733  0.0345  251 MET A CB    
2716 C  CG    . MET E 252 ? 0.5008 0.3742 0.4883 -0.0457 0.0756  0.0264  251 MET A CG    
2717 S  SD    . MET E 252 ? 0.5369 0.3573 0.4860 -0.0389 0.1053  -0.0010 251 MET A SD    
2718 C  CE    . MET E 252 ? 0.5547 0.3485 0.4701 -0.0553 0.1055  0.0104  251 MET A CE    
2719 N  N     . LYS E 253 ? 0.4916 0.4457 0.5156 -0.0403 0.0510  0.0169  252 LYS A N     
2720 C  CA    . LYS E 253 ? 0.5120 0.4823 0.5365 -0.0324 0.0359  0.0082  252 LYS A CA    
2721 C  C     . LYS E 253 ? 0.5211 0.4925 0.5459 -0.0311 0.0278  0.0063  252 LYS A C     
2722 O  O     . LYS E 253 ? 0.5297 0.4954 0.5505 -0.0331 0.0217  0.0020  252 LYS A O     
2723 C  CB    . LYS E 253 ? 0.5065 0.4898 0.5327 -0.0287 0.0421  0.0086  252 LYS A CB    
2724 C  CG    . LYS E 253 ? 0.5289 0.5153 0.5541 -0.0043 0.0301  -0.0008 252 LYS A CG    
2725 C  CD    . LYS E 253 ? 0.5708 0.5236 0.5953 0.0331  0.0305  -0.0005 252 LYS A CD    
2726 C  CE    . LYS E 253 ? 0.5654 0.5526 0.5983 0.0506  0.0423  0.0011  252 LYS A CE    
2727 N  NZ    . LYS E 253 ? 0.5525 0.5797 0.6043 0.0702  0.0565  -0.0137 252 LYS A NZ    
2728 N  N     . ARG E 254 ? 0.5345 0.5001 0.5518 -0.0265 0.0187  0.0079  253 ARG A N     
2729 C  CA    . ARG E 254 ? 0.5479 0.5144 0.5550 -0.0252 0.0109  0.0061  253 ARG A CA    
2730 C  C     . ARG E 254 ? 0.5538 0.5222 0.5597 -0.0312 0.0106  0.0067  253 ARG A C     
2731 O  O     . ARG E 254 ? 0.5601 0.5145 0.5597 -0.0327 0.0090  0.0075  253 ARG A O     
2732 C  CB    . ARG E 254 ? 0.5479 0.5130 0.5537 -0.0212 0.0101  0.0066  253 ARG A CB    
2733 C  CG    . ARG E 254 ? 0.5710 0.5312 0.5776 -0.0088 -0.0008 -0.0033 253 ARG A CG    
2734 C  CD    . ARG E 254 ? 0.5914 0.5574 0.5963 0.0148  -0.0142 -0.0166 253 ARG A CD    
2735 N  NE    . ARG E 254 ? 0.5902 0.5737 0.5912 0.0285  -0.0217 -0.0199 253 ARG A NE    
2736 C  CZ    . ARG E 254 ? 0.5779 0.5757 0.5841 0.0390  -0.0183 -0.0231 253 ARG A CZ    
2737 N  NH1   . ARG E 254 ? 0.5849 0.5756 0.5814 0.0399  -0.0227 -0.0233 253 ARG A NH1   
2738 N  NH2   . ARG E 254 ? 0.5608 0.5709 0.5795 0.0330  -0.0154 -0.0249 253 ARG A NH2   
2739 N  N     . ASN E 255 ? 0.5539 0.5323 0.5600 -0.0358 0.0150  0.0059  254 ASN A N     
2740 C  CA    . ASN E 255 ? 0.5573 0.5459 0.5696 -0.0368 0.0117  0.0057  254 ASN A CA    
2741 C  C     . ASN E 255 ? 0.5488 0.5467 0.5651 -0.0329 0.0128  0.0080  254 ASN A C     
2742 O  O     . ASN E 255 ? 0.5447 0.5431 0.5594 -0.0373 0.0148  0.0103  254 ASN A O     
2743 C  CB    . ASN E 255 ? 0.5581 0.5537 0.5776 -0.0429 0.0136  0.0030  254 ASN A CB    
2744 C  CG    . ASN E 255 ? 0.5781 0.5559 0.6025 -0.0635 0.0124  0.0114  254 ASN A CG    
2745 O  OD1   . ASN E 255 ? 0.5824 0.5592 0.5995 -0.0724 0.0287  0.0198  254 ASN A OD1   
2746 N  ND2   . ASN E 255 ? 0.5857 0.5654 0.6004 -0.0755 0.0090  0.0103  254 ASN A ND2   
2747 N  N     . SER E 256 ? 0.5444 0.5541 0.5648 -0.0300 0.0159  0.0113  255 SER A N     
2748 C  CA    . SER E 256 ? 0.5425 0.5542 0.5646 -0.0263 0.0101  0.0164  255 SER A CA    
2749 C  C     . SER E 256 ? 0.5367 0.5541 0.5650 -0.0224 0.0107  0.0135  255 SER A C     
2750 O  O     . SER E 256 ? 0.5346 0.5526 0.5663 -0.0285 0.0150  0.0200  255 SER A O     
2751 C  CB    . SER E 256 ? 0.5459 0.5555 0.5650 -0.0290 0.0104  0.0199  255 SER A CB    
2752 O  OG    . SER E 256 ? 0.5285 0.5660 0.5702 -0.0344 -0.0015 0.0258  255 SER A OG    
2753 N  N     . ARG E 257 ? 0.5320 0.5491 0.5662 -0.0201 0.0034  0.0101  256 ARG A N     
2754 C  CA    . ARG E 257 ? 0.5168 0.5440 0.5655 -0.0172 0.0014  0.0048  256 ARG A CA    
2755 C  C     . ARG E 257 ? 0.5195 0.5408 0.5679 -0.0136 -0.0027 0.0031  256 ARG A C     
2756 O  O     . ARG E 257 ? 0.5166 0.5323 0.5734 -0.0070 -0.0091 0.0067  256 ARG A O     
2757 C  CB    . ARG E 257 ? 0.5072 0.5477 0.5675 -0.0146 0.0018  0.0038  256 ARG A CB    
2758 C  CG    . ARG E 257 ? 0.4862 0.5365 0.5673 -0.0147 -0.0043 0.0111  256 ARG A CG    
2759 C  CD    . ARG E 257 ? 0.4263 0.5592 0.5793 -0.0067 -0.0296 0.0055  256 ARG A CD    
2760 N  NE    . ARG E 257 ? 0.3766 0.5766 0.5756 0.0086  -0.0482 -0.0072 256 ARG A NE    
2761 C  CZ    . ARG E 257 ? 0.3306 0.5816 0.5728 0.0122  -0.0768 -0.0113 256 ARG A CZ    
2762 N  NH1   . ARG E 257 ? 0.2885 0.6188 0.5870 0.0171  -0.0999 -0.0326 256 ARG A NH1   
2763 N  NH2   . ARG E 257 ? 0.2679 0.5829 0.5747 0.0083  -0.1003 -0.0167 256 ARG A NH2   
2764 N  N     . ASN E 258 ? 0.5234 0.5360 0.5650 -0.0169 -0.0009 -0.0032 257 ASN A N     
2765 C  CA    . ASN E 258 ? 0.5256 0.5247 0.5604 -0.0148 -0.0019 -0.0046 257 ASN A CA    
2766 C  C     . ASN E 258 ? 0.5254 0.5096 0.5517 -0.0171 -0.0016 -0.0042 257 ASN A C     
2767 O  O     . ASN E 258 ? 0.5296 0.5145 0.5558 -0.0168 -0.0069 -0.0052 257 ASN A O     
2768 C  CB    . ASN E 258 ? 0.5302 0.5279 0.5641 -0.0186 -0.0052 -0.0057 257 ASN A CB    
2769 C  CG    . ASN E 258 ? 0.5382 0.5153 0.5736 -0.0223 -0.0068 -0.0113 257 ASN A CG    
2770 O  OD1   . ASN E 258 ? 0.5398 0.5015 0.5788 -0.0334 -0.0065 -0.0153 257 ASN A OD1   
2771 N  ND2   . ASN E 258 ? 0.5024 0.5206 0.5949 -0.0257 -0.0050 -0.0169 257 ASN A ND2   
2772 N  N     . LEU E 259 ? 0.5211 0.4987 0.5410 -0.0122 0.0012  -0.0065 258 LEU A N     
2773 C  CA    . LEU E 259 ? 0.5064 0.4907 0.5298 -0.0045 0.0103  -0.0019 258 LEU A CA    
2774 C  C     . LEU E 259 ? 0.5028 0.4871 0.5283 -0.0019 0.0110  -0.0041 258 LEU A C     
2775 O  O     . LEU E 259 ? 0.4987 0.4828 0.5228 -0.0061 0.0174  -0.0066 258 LEU A O     
2776 C  CB    . LEU E 259 ? 0.5003 0.4794 0.5257 -0.0097 0.0118  0.0052  258 LEU A CB    
2777 C  CG    . LEU E 259 ? 0.4988 0.4755 0.5276 -0.0012 0.0104  0.0118  258 LEU A CG    
2778 C  CD1   . LEU E 259 ? 0.4942 0.5324 0.5414 0.0034  0.0099  0.0212  258 LEU A CD1   
2779 C  CD2   . LEU E 259 ? 0.4862 0.4420 0.5090 0.0159  0.0265  0.0376  258 LEU A CD2   
2780 N  N     . GLU E 260 ? 0.5070 0.4845 0.5211 0.0039  0.0114  -0.0076 259 GLU A N     
2781 C  CA    . GLU E 260 ? 0.5045 0.4769 0.5194 0.0085  0.0150  -0.0048 259 GLU A CA    
2782 C  C     . GLU E 260 ? 0.4948 0.4670 0.5191 0.0137  0.0191  -0.0082 259 GLU A C     
2783 O  O     . GLU E 260 ? 0.4925 0.4796 0.5179 0.0193  0.0213  -0.0138 259 GLU A O     
2784 C  CB    . GLU E 260 ? 0.5128 0.4778 0.5236 0.0099  0.0097  -0.0050 259 GLU A CB    
2785 C  CG    . GLU E 260 ? 0.5255 0.4753 0.5244 0.0117  0.0050  -0.0016 259 GLU A CG    
2786 C  CD    . GLU E 260 ? 0.5514 0.4870 0.5250 0.0084  0.0078  -0.0016 259 GLU A CD    
2787 O  OE1   . GLU E 260 ? 0.5813 0.4848 0.5190 0.0173  -0.0066 0.0007  259 GLU A OE1   
2788 O  OE2   . GLU E 260 ? 0.5603 0.5153 0.5119 0.0075  0.0089  -0.0254 259 GLU A OE2   
2789 N  N     . GLU E 261 ? 0.4857 0.4530 0.5160 0.0099  0.0233  -0.0060 260 GLU A N     
2790 C  CA    . GLU E 261 ? 0.4774 0.4401 0.5141 0.0060  0.0249  0.0003  260 GLU A CA    
2791 C  C     . GLU E 261 ? 0.4699 0.4252 0.5052 0.0048  0.0276  0.0007  260 GLU A C     
2792 O  O     . GLU E 261 ? 0.4734 0.4320 0.5163 0.0061  0.0229  -0.0141 260 GLU A O     
2793 C  CB    . GLU E 261 ? 0.4750 0.4411 0.5154 0.0003  0.0249  0.0050  260 GLU A CB    
2794 C  CG    . GLU E 261 ? 0.4903 0.4442 0.5281 -0.0032 0.0231  0.0073  260 GLU A CG    
2795 C  CD    . GLU E 261 ? 0.5015 0.4452 0.5403 -0.0008 0.0044  0.0154  260 GLU A CD    
2796 O  OE1   . GLU E 261 ? 0.4960 0.4612 0.5442 0.0129  -0.0131 0.0014  260 GLU A OE1   
2797 O  OE2   . GLU E 261 ? 0.4947 0.3907 0.5453 -0.0159 0.0127  0.0138  260 GLU A OE2   
2798 N  N     . ILE E 262 ? 0.4509 0.4026 0.4889 0.0033  0.0361  0.0051  261 ILE A N     
2799 C  CA    . ILE E 262 ? 0.4423 0.3883 0.4783 0.0007  0.0401  0.0066  261 ILE A CA    
2800 C  C     . ILE E 262 ? 0.4416 0.3925 0.4677 0.0004  0.0437  0.0088  261 ILE A C     
2801 O  O     . ILE E 262 ? 0.4482 0.3922 0.4649 -0.0008 0.0494  0.0143  261 ILE A O     
2802 C  CB    . ILE E 262 ? 0.4378 0.3821 0.4831 0.0056  0.0393  -0.0003 261 ILE A CB    
2803 C  CG1   . ILE E 262 ? 0.4091 0.3870 0.4892 0.0168  0.0422  -0.0069 261 ILE A CG1   
2804 C  CG2   . ILE E 262 ? 0.4260 0.3580 0.4810 -0.0113 0.0448  0.0072  261 ILE A CG2   
2805 C  CD1   . ILE E 262 ? 0.3713 0.4033 0.4843 0.0238  0.0485  -0.0184 261 ILE A CD1   
2806 N  N     . LYS E 263 ? 0.4379 0.3975 0.4538 -0.0074 0.0460  0.0118  262 LYS A N     
2807 C  CA    . LYS E 263 ? 0.4338 0.4010 0.4319 -0.0073 0.0496  0.0133  262 LYS A CA    
2808 C  C     . LYS E 263 ? 0.4318 0.4014 0.4240 -0.0074 0.0492  0.0172  262 LYS A C     
2809 O  O     . LYS E 263 ? 0.4376 0.4042 0.4247 -0.0087 0.0513  0.0147  262 LYS A O     
2810 C  CB    . LYS E 263 ? 0.4357 0.3997 0.4306 -0.0091 0.0471  0.0118  262 LYS A CB    
2811 C  CG    . LYS E 263 ? 0.4195 0.3981 0.4033 -0.0048 0.0594  0.0168  262 LYS A CG    
2812 C  CD    . LYS E 263 ? 0.4055 0.3812 0.4164 -0.0152 0.0557  0.0198  262 LYS A CD    
2813 C  CE    . LYS E 263 ? 0.4067 0.3753 0.4014 -0.0143 0.0654  0.0157  262 LYS A CE    
2814 N  NZ    . LYS E 263 ? 0.3825 0.3485 0.3921 -0.0176 0.0769  0.0063  262 LYS A NZ    
2815 N  N     . PRO E 264 ? 0.4323 0.4023 0.4215 -0.0086 0.0483  0.0204  263 PRO A N     
2816 C  CA    . PRO E 264 ? 0.4296 0.3964 0.4162 -0.0086 0.0475  0.0224  263 PRO A CA    
2817 C  C     . PRO E 264 ? 0.4250 0.3942 0.4088 -0.0120 0.0481  0.0234  263 PRO A C     
2818 O  O     . PRO E 264 ? 0.4372 0.4096 0.4059 -0.0192 0.0416  0.0259  263 PRO A O     
2819 C  CB    . PRO E 264 ? 0.4291 0.3940 0.4070 -0.0073 0.0489  0.0331  263 PRO A CB    
2820 C  CG    . PRO E 264 ? 0.4225 0.3962 0.4063 -0.0121 0.0581  0.0251  263 PRO A CG    
2821 C  CD    . PRO E 264 ? 0.4243 0.4036 0.4233 -0.0117 0.0511  0.0192  263 PRO A CD    
2822 N  N     . TYR E 265 ? 0.4155 0.3742 0.4086 -0.0151 0.0552  0.0252  264 TYR A N     
2823 C  CA    . TYR E 265 ? 0.4014 0.3473 0.3988 -0.0103 0.0634  0.0287  264 TYR A CA    
2824 C  C     . TYR E 265 ? 0.4054 0.3357 0.3782 -0.0029 0.0614  0.0244  264 TYR A C     
2825 O  O     . TYR E 265 ? 0.4176 0.3420 0.3719 -0.0028 0.0613  0.0302  264 TYR A O     
2826 C  CB    . TYR E 265 ? 0.4072 0.3576 0.4044 -0.0077 0.0638  0.0286  264 TYR A CB    
2827 C  CG    . TYR E 265 ? 0.3751 0.3256 0.4370 -0.0162 0.0707  0.0602  264 TYR A CG    
2828 C  CD1   . TYR E 265 ? 0.3783 0.3487 0.4673 -0.0063 0.0738  0.0815  264 TYR A CD1   
2829 C  CD2   . TYR E 265 ? 0.3680 0.3146 0.4525 -0.0192 0.0758  0.0833  264 TYR A CD2   
2830 C  CE1   . TYR E 265 ? 0.3840 0.3643 0.4808 0.0047  0.0728  0.1106  264 TYR A CE1   
2831 C  CE2   . TYR E 265 ? 0.3878 0.3452 0.4847 -0.0206 0.0766  0.1023  264 TYR A CE2   
2832 C  CZ    . TYR E 265 ? 0.3757 0.3684 0.4873 -0.0109 0.0679  0.1188  264 TYR A CZ    
2833 O  OH    . TYR E 265 ? 0.4503 0.3909 0.4667 -0.0262 0.0598  0.1540  264 TYR A OH    
2834 N  N     . LEU E 266 ? 0.3908 0.3108 0.3582 0.0008  0.0637  0.0230  265 LEU A N     
2835 C  CA    . LEU E 266 ? 0.3771 0.2826 0.3499 -0.0076 0.0697  0.0323  265 LEU A CA    
2836 C  C     . LEU E 266 ? 0.3845 0.2815 0.3452 -0.0128 0.0663  0.0296  265 LEU A C     
2837 O  O     . LEU E 266 ? 0.3827 0.2757 0.3407 -0.0261 0.0773  0.0413  265 LEU A O     
2838 C  CB    . LEU E 266 ? 0.3755 0.2851 0.3458 -0.0101 0.0794  0.0269  265 LEU A CB    
2839 C  CG    . LEU E 266 ? 0.3496 0.2490 0.3352 -0.0131 0.0919  0.0267  265 LEU A CG    
2840 C  CD1   . LEU E 266 ? 0.2715 0.2622 0.3408 -0.0129 0.1127  0.0258  265 LEU A CD1   
2841 C  CD2   . LEU E 266 ? 0.3169 0.1433 0.3262 -0.0376 0.1337  0.0332  265 LEU A CD2   
2842 N  N     . PHE E 267 ? 0.3851 0.2817 0.3493 -0.0149 0.0685  0.0233  266 PHE A N     
2843 C  CA    . PHE E 267 ? 0.3884 0.2968 0.3459 -0.0181 0.0659  0.0188  266 PHE A CA    
2844 C  C     . PHE E 267 ? 0.3896 0.3002 0.3432 -0.0297 0.0624  0.0318  266 PHE A C     
2845 O  O     . PHE E 267 ? 0.3799 0.3134 0.3288 -0.0378 0.0792  0.0282  266 PHE A O     
2846 C  CB    . PHE E 267 ? 0.3893 0.2995 0.3490 -0.0200 0.0664  0.0123  266 PHE A CB    
2847 C  CG    . PHE E 267 ? 0.3762 0.2976 0.3226 0.0078  0.0716  -0.0073 266 PHE A CG    
2848 C  CD1   . PHE E 267 ? 0.3592 0.2925 0.3111 0.0023  0.0955  -0.0313 266 PHE A CD1   
2849 C  CD2   . PHE E 267 ? 0.3803 0.3496 0.3041 0.0263  0.0953  -0.0022 266 PHE A CD2   
2850 C  CE1   . PHE E 267 ? 0.3282 0.3357 0.3028 0.0239  0.0975  -0.0308 266 PHE A CE1   
2851 C  CE2   . PHE E 267 ? 0.3683 0.3389 0.2939 0.0459  0.1132  -0.0199 266 PHE A CE2   
2852 C  CZ    . PHE E 267 ? 0.3617 0.3300 0.3221 0.0442  0.0795  -0.0203 266 PHE A CZ    
2853 N  N     . ARG E 268 ? 0.3990 0.3146 0.3425 -0.0371 0.0611  0.0391  267 ARG A N     
2854 C  CA    . ARG E 268 ? 0.3919 0.3165 0.3409 -0.0447 0.0620  0.0440  267 ARG A CA    
2855 C  C     . ARG E 268 ? 0.3864 0.3192 0.3365 -0.0473 0.0613  0.0530  267 ARG A C     
2856 O  O     . ARG E 268 ? 0.3921 0.3397 0.3469 -0.0581 0.0684  0.0693  267 ARG A O     
2857 C  CB    . ARG E 268 ? 0.3904 0.3171 0.3454 -0.0508 0.0637  0.0420  267 ARG A CB    
2858 C  CG    . ARG E 268 ? 0.3813 0.3263 0.3380 -0.0587 0.0720  0.0351  267 ARG A CG    
2859 C  CD    . ARG E 268 ? 0.3758 0.3719 0.3723 -0.0766 0.0988  0.0089  267 ARG A CD    
2860 N  NE    . ARG E 268 ? 0.3272 0.4096 0.4064 -0.0774 0.1209  -0.0035 267 ARG A NE    
2861 C  CZ    . ARG E 268 ? 0.3153 0.4421 0.4210 -0.0838 0.1205  -0.0252 267 ARG A CZ    
2862 N  NH1   . ARG E 268 ? 0.3050 0.4318 0.4254 -0.0950 0.1157  -0.0236 267 ARG A NH1   
2863 N  NH2   . ARG E 268 ? 0.2980 0.4346 0.3872 -0.0857 0.1358  -0.0257 267 ARG A NH2   
2864 N  N     . ALA E 269 ? 0.3899 0.3061 0.3258 -0.0502 0.0614  0.0493  268 ALA A N     
2865 C  CA    . ALA E 269 ? 0.3756 0.2905 0.3101 -0.0507 0.0675  0.0477  268 ALA A CA    
2866 C  C     . ALA E 269 ? 0.3836 0.2896 0.3048 -0.0533 0.0621  0.0483  268 ALA A C     
2867 O  O     . ALA E 269 ? 0.3845 0.2766 0.2925 -0.0571 0.0799  0.0615  268 ALA A O     
2868 C  CB    . ALA E 269 ? 0.3780 0.2842 0.3063 -0.0483 0.0690  0.0443  268 ALA A CB    
2869 N  N     . ILE E 270 ? 0.3818 0.2929 0.2987 -0.0560 0.0549  0.0453  269 ILE A N     
2870 C  CA    . ILE E 270 ? 0.3770 0.3083 0.3081 -0.0598 0.0526  0.0382  269 ILE A CA    
2871 C  C     . ILE E 270 ? 0.3919 0.3389 0.3273 -0.0576 0.0450  0.0425  269 ILE A C     
2872 O  O     . ILE E 270 ? 0.4146 0.3558 0.3394 -0.0603 0.0415  0.0459  269 ILE A O     
2873 C  CB    . ILE E 270 ? 0.3742 0.2929 0.3000 -0.0699 0.0538  0.0389  269 ILE A CB    
2874 C  CG1   . ILE E 270 ? 0.3445 0.2461 0.3104 -0.0992 0.0526  0.0216  269 ILE A CG1   
2875 C  CG2   . ILE E 270 ? 0.3757 0.3100 0.2880 -0.0595 0.0566  0.0424  269 ILE A CG2   
2876 C  CD1   . ILE E 270 ? 0.3110 0.1122 0.3114 -0.1572 0.0094  -0.0155 269 ILE A CD1   
2877 N  N     . GLU E 271 ? 0.3972 0.3569 0.3403 -0.0526 0.0423  0.0443  270 GLU A N     
2878 C  CA    . GLU E 271 ? 0.4090 0.3670 0.3556 -0.0454 0.0359  0.0506  270 GLU A CA    
2879 C  C     . GLU E 271 ? 0.4182 0.3572 0.3715 -0.0449 0.0255  0.0634  270 GLU A C     
2880 O  O     . GLU E 271 ? 0.4130 0.3639 0.3814 -0.0510 0.0180  0.0728  270 GLU A O     
2881 C  CB    . GLU E 271 ? 0.4176 0.3662 0.3585 -0.0516 0.0334  0.0553  270 GLU A CB    
2882 C  CG    . GLU E 271 ? 0.4270 0.4022 0.3582 -0.0379 0.0553  0.0425  270 GLU A CG    
2883 C  CD    . GLU E 271 ? 0.4666 0.4427 0.3987 -0.0463 0.0510  0.0527  270 GLU A CD    
2884 O  OE1   . GLU E 271 ? 0.4783 0.4814 0.4235 -0.0369 0.0557  0.0532  270 GLU A OE1   
2885 O  OE2   . GLU E 271 ? 0.5095 0.4489 0.3437 -0.0417 0.0451  0.0774  270 GLU A OE2   
2886 N  N     . GLU E 272 ? 0.4252 0.3567 0.3800 -0.0460 0.0210  0.0636  271 GLU A N     
2887 C  CA    . GLU E 272 ? 0.4448 0.3626 0.3970 -0.0399 0.0245  0.0636  271 GLU A CA    
2888 C  C     . GLU E 272 ? 0.4501 0.3688 0.4116 -0.0362 0.0286  0.0710  271 GLU A C     
2889 O  O     . GLU E 272 ? 0.4545 0.3747 0.4207 -0.0375 0.0259  0.0865  271 GLU A O     
2890 C  CB    . GLU E 272 ? 0.4503 0.3697 0.4085 -0.0438 0.0236  0.0690  271 GLU A CB    
2891 C  CG    . GLU E 272 ? 0.4912 0.3796 0.4525 -0.0445 0.0244  0.0562  271 GLU A CG    
2892 C  CD    . GLU E 272 ? 0.5349 0.3708 0.4803 -0.0713 0.0226  0.0711  271 GLU A CD    
2893 O  OE1   . GLU E 272 ? 0.5840 0.3435 0.5292 -0.0624 0.0176  0.0561  271 GLU A OE1   
2894 O  OE2   . GLU E 272 ? 0.5287 0.3808 0.5001 -0.0762 0.0088  0.0504  271 GLU A OE2   
2895 N  N     . SER E 273 ? 0.4519 0.3596 0.4034 -0.0295 0.0259  0.0704  272 SER A N     
2896 C  CA    . SER E 273 ? 0.4518 0.3491 0.3954 -0.0237 0.0317  0.0625  272 SER A CA    
2897 C  C     . SER E 273 ? 0.4639 0.3546 0.4123 -0.0187 0.0392  0.0639  272 SER A C     
2898 O  O     . SER E 273 ? 0.4770 0.3709 0.4110 -0.0072 0.0530  0.0646  272 SER A O     
2899 C  CB    . SER E 273 ? 0.4535 0.3417 0.3900 -0.0292 0.0362  0.0632  272 SER A CB    
2900 O  OG    . SER E 273 ? 0.4627 0.3368 0.3580 -0.0143 0.0372  0.0489  272 SER A OG    
2901 N  N     . TYR E 274 ? 0.4771 0.3596 0.4354 -0.0196 0.0316  0.0572  273 TYR A N     
2902 C  CA    . TYR E 274 ? 0.4712 0.3807 0.4612 -0.0174 0.0273  0.0533  273 TYR A CA    
2903 C  C     . TYR E 274 ? 0.4834 0.3902 0.4860 -0.0074 0.0255  0.0499  273 TYR A C     
2904 O  O     . TYR E 274 ? 0.4965 0.3924 0.5050 -0.0118 0.0294  0.0540  273 TYR A O     
2905 C  CB    . TYR E 274 ? 0.4646 0.3702 0.4506 -0.0216 0.0277  0.0534  273 TYR A CB    
2906 C  CG    . TYR E 274 ? 0.4275 0.3609 0.4550 -0.0312 0.0299  0.0546  273 TYR A CG    
2907 C  CD1   . TYR E 274 ? 0.4182 0.3847 0.4507 -0.0416 0.0259  0.0579  273 TYR A CD1   
2908 C  CD2   . TYR E 274 ? 0.4054 0.3504 0.4567 -0.0214 0.0464  0.0547  273 TYR A CD2   
2909 C  CE1   . TYR E 274 ? 0.3801 0.3533 0.4484 -0.0318 0.0321  0.0617  273 TYR A CE1   
2910 C  CE2   . TYR E 274 ? 0.3787 0.3539 0.4506 -0.0090 0.0560  0.0626  273 TYR A CE2   
2911 C  CZ    . TYR E 274 ? 0.3762 0.3370 0.4502 -0.0053 0.0554  0.0641  273 TYR A CZ    
2912 O  OH    . TYR E 274 ? 0.3714 0.3775 0.4540 -0.0005 0.0889  0.0673  273 TYR A OH    
2913 N  N     . TYR E 275 ? 0.4997 0.4182 0.4998 0.0007  0.0199  0.0442  274 TYR A N     
2914 C  CA    . TYR E 275 ? 0.5103 0.4437 0.5198 0.0055  0.0048  0.0431  274 TYR A CA    
2915 C  C     . TYR E 275 ? 0.5002 0.4489 0.5353 0.0073  0.0002  0.0401  274 TYR A C     
2916 O  O     . TYR E 275 ? 0.4971 0.4606 0.5494 0.0046  -0.0018 0.0457  274 TYR A O     
2917 C  CB    . TYR E 275 ? 0.5181 0.4544 0.5296 0.0008  0.0051  0.0437  274 TYR A CB    
2918 C  CG    . TYR E 275 ? 0.5597 0.4958 0.5501 0.0158  -0.0254 0.0513  274 TYR A CG    
2919 C  CD1   . TYR E 275 ? 0.5808 0.5236 0.5545 0.0173  -0.0392 0.0425  274 TYR A CD1   
2920 C  CD2   . TYR E 275 ? 0.5782 0.5109 0.5813 0.0166  -0.0421 0.0492  274 TYR A CD2   
2921 C  CE1   . TYR E 275 ? 0.5926 0.5536 0.5874 0.0132  -0.0525 0.0478  274 TYR A CE1   
2922 C  CE2   . TYR E 275 ? 0.5750 0.5463 0.5926 0.0119  -0.0500 0.0526  274 TYR A CE2   
2923 C  CZ    . TYR E 275 ? 0.5881 0.5574 0.6000 0.0140  -0.0528 0.0469  274 TYR A CZ    
2924 O  OH    . TYR E 275 ? 0.5684 0.5849 0.6338 0.0173  -0.0625 0.0727  274 TYR A OH    
2925 N  N     . LYS E 276 ? 0.4987 0.4515 0.5392 0.0101  -0.0075 0.0327  275 LYS A N     
2926 C  CA    . LYS E 276 ? 0.4904 0.4627 0.5484 0.0087  -0.0100 0.0320  275 LYS A CA    
2927 C  C     . LYS E 276 ? 0.4858 0.4704 0.5532 0.0116  -0.0126 0.0312  275 LYS A C     
2928 O  O     . LYS E 276 ? 0.4879 0.4680 0.5669 0.0174  -0.0172 0.0290  275 LYS A O     
2929 C  CB    . LYS E 276 ? 0.4940 0.4610 0.5590 0.0088  -0.0178 0.0311  275 LYS A CB    
2930 C  CG    . LYS E 276 ? 0.4936 0.4571 0.5946 -0.0023 -0.0260 0.0283  275 LYS A CG    
2931 C  CD    . LYS E 276 ? 0.5063 0.4495 0.6452 -0.0068 -0.0517 0.0240  275 LYS A CD    
2932 C  CE    . LYS E 276 ? 0.5055 0.4472 0.6842 -0.0133 -0.0569 0.0156  275 LYS A CE    
2933 N  NZ    . LYS E 276 ? 0.5019 0.3489 0.7013 -0.0004 -0.0708 0.0304  275 LYS A NZ    
2934 N  N     . LEU E 277 ? 0.4768 0.4804 0.5461 0.0124  -0.0126 0.0323  276 LEU A N     
2935 C  CA    . LEU E 277 ? 0.4697 0.4904 0.5263 0.0116  -0.0116 0.0310  276 LEU A CA    
2936 C  C     . LEU E 277 ? 0.4693 0.5066 0.5153 0.0117  -0.0125 0.0246  276 LEU A C     
2937 O  O     . LEU E 277 ? 0.4569 0.5127 0.5018 0.0125  -0.0096 0.0218  276 LEU A O     
2938 C  CB    . LEU E 277 ? 0.4651 0.4839 0.5262 0.0145  -0.0127 0.0301  276 LEU A CB    
2939 C  CG    . LEU E 277 ? 0.4540 0.4638 0.5124 0.0107  -0.0131 0.0360  276 LEU A CG    
2940 C  CD1   . LEU E 277 ? 0.4671 0.4576 0.5121 0.0211  -0.0381 0.0486  276 LEU A CD1   
2941 C  CD2   . LEU E 277 ? 0.4285 0.4418 0.4841 0.0041  -0.0198 0.0735  276 LEU A CD2   
2942 N  N     . ASP E 278 ? 0.4799 0.5195 0.5217 0.0083  -0.0144 0.0193  277 ASP A N     
2943 C  CA    . ASP E 278 ? 0.4848 0.5229 0.5219 0.0038  -0.0130 0.0147  277 ASP A CA    
2944 C  C     . ASP E 278 ? 0.4889 0.5040 0.5075 -0.0043 -0.0094 0.0183  277 ASP A C     
2945 O  O     . ASP E 278 ? 0.4989 0.5239 0.5073 -0.0036 -0.0113 0.0150  277 ASP A O     
2946 C  CB    . ASP E 278 ? 0.4861 0.5248 0.5303 0.0105  -0.0155 0.0094  277 ASP A CB    
2947 C  CG    . ASP E 278 ? 0.4920 0.5567 0.5438 0.0222  -0.0261 -0.0097 277 ASP A CG    
2948 O  OD1   . ASP E 278 ? 0.4528 0.5836 0.5573 0.0205  -0.0441 -0.0335 277 ASP A OD1   
2949 O  OD2   . ASP E 278 ? 0.5304 0.5861 0.5898 0.0448  -0.0424 -0.0241 277 ASP A OD2   
2950 N  N     . LYS E 279 ? 0.4821 0.4853 0.4892 -0.0094 -0.0079 0.0248  278 LYS A N     
2951 C  CA    . LYS E 279 ? 0.4758 0.4710 0.4688 -0.0154 0.0000  0.0305  278 LYS A CA    
2952 C  C     . LYS E 279 ? 0.4614 0.4591 0.4592 -0.0209 0.0034  0.0328  278 LYS A C     
2953 O  O     . LYS E 279 ? 0.4781 0.4731 0.4648 -0.0180 0.0021  0.0337  278 LYS A O     
2954 C  CB    . LYS E 279 ? 0.4750 0.4640 0.4699 -0.0171 0.0046  0.0340  278 LYS A CB    
2955 C  CG    . LYS E 279 ? 0.5037 0.4725 0.4799 -0.0142 0.0084  0.0062  278 LYS A CG    
2956 C  CD    . LYS E 279 ? 0.5353 0.4842 0.4954 -0.0114 0.0267  -0.0154 278 LYS A CD    
2957 C  CE    . LYS E 279 ? 0.5443 0.4814 0.4853 -0.0185 0.0602  -0.0205 278 LYS A CE    
2958 N  NZ    . LYS E 279 ? 0.5350 0.4796 0.5067 -0.0280 0.0585  -0.0285 278 LYS A NZ    
2959 N  N     . ARG E 280 ? 0.4361 0.4265 0.4352 -0.0220 0.0087  0.0350  279 ARG A N     
2960 C  CA    . ARG E 280 ? 0.4110 0.4015 0.4240 -0.0171 0.0100  0.0350  279 ARG A CA    
2961 C  C     . ARG E 280 ? 0.4051 0.3889 0.4105 -0.0186 0.0119  0.0324  279 ARG A C     
2962 O  O     . ARG E 280 ? 0.4049 0.3828 0.4130 -0.0179 0.0116  0.0369  279 ARG A O     
2963 C  CB    . ARG E 280 ? 0.4224 0.3989 0.4241 -0.0134 0.0109  0.0387  279 ARG A CB    
2964 C  CG    . ARG E 280 ? 0.4100 0.4049 0.4484 -0.0083 0.0073  0.0515  279 ARG A CG    
2965 C  CD    . ARG E 280 ? 0.4555 0.3513 0.4983 -0.0199 0.0016  0.0840  279 ARG A CD    
2966 N  NE    . ARG E 280 ? 0.4784 0.3661 0.5246 -0.0149 0.0129  0.0841  279 ARG A NE    
2967 C  CZ    . ARG E 280 ? 0.4788 0.3405 0.5219 -0.0293 -0.0024 0.0979  279 ARG A CZ    
2968 N  NH1   . ARG E 280 ? 0.4811 0.2954 0.5290 0.0019  -0.0238 0.0558  279 ARG A NH1   
2969 N  NH2   . ARG E 280 ? 0.4881 0.3518 0.5379 -0.0503 0.0047  0.1070  279 ARG A NH2   
2970 N  N     . ILE E 281 ? 0.3803 0.3730 0.3830 -0.0235 0.0144  0.0284  280 ILE A N     
2971 C  CA    . ILE E 281 ? 0.3461 0.3668 0.3496 -0.0273 0.0119  0.0241  280 ILE A CA    
2972 C  C     . ILE E 281 ? 0.3235 0.3510 0.3334 -0.0374 0.0138  0.0164  280 ILE A C     
2973 O  O     . ILE E 281 ? 0.3361 0.3853 0.3421 -0.0338 0.0076  0.0132  280 ILE A O     
2974 C  CB    . ILE E 281 ? 0.3476 0.3664 0.3558 -0.0195 0.0106  0.0190  280 ILE A CB    
2975 C  CG1   . ILE E 281 ? 0.3814 0.3900 0.3380 -0.0111 0.0076  0.0128  280 ILE A CG1   
2976 C  CG2   . ILE E 281 ? 0.3145 0.3548 0.3415 -0.0153 0.0155  0.0173  280 ILE A CG2   
2977 C  CD1   . ILE E 281 ? 0.3963 0.4554 0.3616 0.0082  0.0247  0.0251  280 ILE A CD1   
2978 N  N     . PRO E 282 ? 0.3059 0.3237 0.3060 -0.0446 0.0178  0.0136  281 PRO A N     
2979 C  CA    . PRO E 282 ? 0.2949 0.3005 0.2833 -0.0483 0.0206  0.0126  281 PRO A CA    
2980 C  C     . PRO E 282 ? 0.2936 0.2819 0.2654 -0.0510 0.0204  0.0094  281 PRO A C     
2981 O  O     . PRO E 282 ? 0.3025 0.2765 0.2435 -0.0547 0.0259  0.0119  281 PRO A O     
2982 C  CB    . PRO E 282 ? 0.2945 0.3085 0.2834 -0.0542 0.0141  0.0078  281 PRO A CB    
2983 C  CG    . PRO E 282 ? 0.2670 0.3176 0.2861 -0.0492 0.0343  0.0126  281 PRO A CG    
2984 C  CD    . PRO E 282 ? 0.3028 0.3113 0.2967 -0.0454 0.0186  0.0121  281 PRO A CD    
2985 N  N     . LYS E 283 ? 0.2789 0.2514 0.2459 -0.0473 0.0275  0.0000  282 LYS A N     
2986 C  CA    . LYS E 283 ? 0.2635 0.2323 0.2289 -0.0532 0.0269  -0.0006 282 LYS A CA    
2987 C  C     . LYS E 283 ? 0.2627 0.2136 0.2083 -0.0487 0.0174  -0.0038 282 LYS A C     
2988 O  O     . LYS E 283 ? 0.2621 0.1958 0.1962 -0.0608 0.0186  0.0018  282 LYS A O     
2989 C  CB    . LYS E 283 ? 0.2793 0.2389 0.2426 -0.0415 0.0305  -0.0114 282 LYS A CB    
2990 C  CG    . LYS E 283 ? 0.2661 0.2260 0.2635 -0.0421 0.0412  -0.0081 282 LYS A CG    
2991 C  CD    . LYS E 283 ? 0.2992 0.1572 0.2793 -0.0064 0.1002  -0.0098 282 LYS A CD    
2992 C  CE    . LYS E 283 ? 0.3407 0.2226 0.2999 -0.0225 0.0986  -0.0095 282 LYS A CE    
2993 N  NZ    . LYS E 283 ? 0.4043 0.2947 0.3755 0.0048  0.1064  0.0133  282 LYS A NZ    
2994 N  N     . ALA E 284 ? 0.2414 0.2005 0.1867 -0.0492 0.0120  -0.0157 283 ALA A N     
2995 C  CA    . ALA E 284 ? 0.2229 0.1926 0.1596 -0.0415 0.0107  -0.0168 283 ALA A CA    
2996 C  C     . ALA E 284 ? 0.2132 0.1929 0.1440 -0.0340 0.0085  -0.0282 283 ALA A C     
2997 O  O     . ALA E 284 ? 0.2083 0.1851 0.1420 -0.0392 0.0097  -0.0169 283 ALA A O     
2998 C  CB    . ALA E 284 ? 0.2071 0.1869 0.1576 -0.0437 0.0082  -0.0258 283 ALA A CB    
2999 N  N     . ILE E 285 ? 0.2108 0.1876 0.1210 -0.0188 0.0056  -0.0366 284 ILE A N     
3000 C  CA    . ILE E 285 ? 0.2100 0.1892 0.1106 -0.0195 0.0031  -0.0409 284 ILE A CA    
3001 C  C     . ILE E 285 ? 0.2089 0.1883 0.1079 -0.0272 0.0101  -0.0331 284 ILE A C     
3002 O  O     . ILE E 285 ? 0.1966 0.1963 0.0949 -0.0430 0.0263  -0.0254 284 ILE A O     
3003 C  CB    . ILE E 285 ? 0.2059 0.1890 0.1004 -0.0118 -0.0056 -0.0468 284 ILE A CB    
3004 C  CG1   . ILE E 285 ? 0.1864 0.2191 0.0884 -0.0044 -0.0194 -0.0846 284 ILE A CG1   
3005 C  CG2   . ILE E 285 ? 0.2205 0.1838 0.1032 0.0177  -0.0087 -0.0779 284 ILE A CG2   
3006 C  CD1   . ILE E 285 ? 0.2066 0.2631 0.1148 0.0487  -0.0283 -0.1000 284 ILE A CD1   
3007 N  N     . HIS E 286 ? 0.2179 0.1891 0.1138 -0.0301 0.0159  -0.0327 285 HIS A N     
3008 C  CA    . HIS E 286 ? 0.2218 0.1954 0.1505 -0.0343 0.0216  -0.0214 285 HIS A CA    
3009 C  C     . HIS E 286 ? 0.2186 0.2009 0.1686 -0.0277 0.0246  -0.0239 285 HIS A C     
3010 O  O     . HIS E 286 ? 0.2157 0.1859 0.1749 -0.0258 0.0325  -0.0144 285 HIS A O     
3011 C  CB    . HIS E 286 ? 0.2310 0.2139 0.1588 -0.0429 0.0208  -0.0191 285 HIS A CB    
3012 C  CG    . HIS E 286 ? 0.2548 0.2687 0.1675 -0.0399 0.0259  -0.0378 285 HIS A CG    
3013 N  ND1   . HIS E 286 ? 0.2586 0.3092 0.2164 -0.0464 0.0112  -0.0367 285 HIS A ND1   
3014 C  CD2   . HIS E 286 ? 0.2939 0.3028 0.1953 -0.0229 0.0490  -0.0452 285 HIS A CD2   
3015 C  CE1   . HIS E 286 ? 0.2926 0.3535 0.2186 -0.0327 0.0254  -0.0368 285 HIS A CE1   
3016 N  NE2   . HIS E 286 ? 0.3267 0.3593 0.2460 -0.0031 0.0162  -0.0375 285 HIS A NE2   
3017 N  N     . VAL E 287 ? 0.2159 0.1929 0.1907 -0.0260 0.0189  -0.0175 286 VAL A N     
3018 C  CA    . VAL E 287 ? 0.2001 0.2002 0.1996 -0.0307 0.0289  -0.0178 286 VAL A CA    
3019 C  C     . VAL E 287 ? 0.2159 0.2220 0.2232 -0.0326 0.0276  -0.0221 286 VAL A C     
3020 O  O     . VAL E 287 ? 0.2089 0.2271 0.2150 -0.0208 0.0384  -0.0211 286 VAL A O     
3021 C  CB    . VAL E 287 ? 0.1934 0.1832 0.1883 -0.0363 0.0249  -0.0131 286 VAL A CB    
3022 C  CG1   . VAL E 287 ? 0.1537 0.1932 0.1961 -0.0212 0.0182  -0.0371 286 VAL A CG1   
3023 C  CG2   . VAL E 287 ? 0.1641 0.2064 0.1892 -0.0478 0.0293  -0.0208 286 VAL A CG2   
3024 N  N     . VAL E 288 ? 0.2408 0.2278 0.2523 -0.0427 0.0338  -0.0190 287 VAL A N     
3025 C  CA    . VAL E 288 ? 0.2706 0.2418 0.2889 -0.0546 0.0249  -0.0219 287 VAL A CA    
3026 C  C     . VAL E 288 ? 0.2803 0.2562 0.3096 -0.0538 0.0250  -0.0248 287 VAL A C     
3027 O  O     . VAL E 288 ? 0.2737 0.2536 0.3155 -0.0650 0.0266  -0.0340 287 VAL A O     
3028 C  CB    . VAL E 288 ? 0.2773 0.2424 0.2883 -0.0628 0.0318  -0.0193 287 VAL A CB    
3029 C  CG1   . VAL E 288 ? 0.3252 0.2854 0.3055 -0.0568 0.0228  -0.0387 287 VAL A CG1   
3030 C  CG2   . VAL E 288 ? 0.3167 0.2625 0.3213 -0.0465 0.0113  -0.0256 287 VAL A CG2   
3031 N  N     . ALA E 289 ? 0.2999 0.2705 0.3434 -0.0562 0.0254  -0.0234 288 ALA A N     
3032 C  CA    . ALA E 289 ? 0.3116 0.2928 0.3692 -0.0525 0.0225  -0.0250 288 ALA A CA    
3033 C  C     . ALA E 289 ? 0.3273 0.3114 0.3886 -0.0554 0.0236  -0.0187 288 ALA A C     
3034 O  O     . ALA E 289 ? 0.3349 0.3285 0.3929 -0.0472 0.0183  -0.0169 288 ALA A O     
3035 C  CB    . ALA E 289 ? 0.3055 0.2840 0.3729 -0.0584 0.0290  -0.0330 288 ALA A CB    
3036 N  N     . VAL E 290 ? 0.3357 0.3276 0.3893 -0.0599 0.0297  -0.0112 289 VAL A N     
3037 C  CA    . VAL E 290 ? 0.3601 0.3323 0.4078 -0.0679 0.0271  -0.0144 289 VAL A CA    
3038 C  C     . VAL E 290 ? 0.3612 0.3384 0.4320 -0.0682 0.0227  -0.0075 289 VAL A C     
3039 O  O     . VAL E 290 ? 0.3491 0.3226 0.4363 -0.0732 0.0269  -0.0052 289 VAL A O     
3040 C  CB    . VAL E 290 ? 0.3617 0.3411 0.3993 -0.0669 0.0280  -0.0185 289 VAL A CB    
3041 C  CG1   . VAL E 290 ? 0.3531 0.3415 0.4036 -0.0912 0.0339  -0.0114 289 VAL A CG1   
3042 C  CG2   . VAL E 290 ? 0.3438 0.3386 0.4139 -0.0938 0.0303  -0.0359 289 VAL A CG2   
3043 N  N     . THR E 291 ? 0.3897 0.3595 0.4590 -0.0650 0.0186  0.0000  290 THR A N     
3044 C  CA    . THR E 291 ? 0.4199 0.3894 0.4916 -0.0557 0.0194  0.0014  290 THR A CA    
3045 C  C     . THR E 291 ? 0.4338 0.4087 0.5069 -0.0591 0.0185  0.0052  290 THR A C     
3046 O  O     . THR E 291 ? 0.4329 0.3814 0.5131 -0.0645 0.0240  0.0123  290 THR A O     
3047 C  CB    . THR E 291 ? 0.4238 0.3992 0.4954 -0.0525 0.0174  -0.0024 290 THR A CB    
3048 O  OG1   . THR E 291 ? 0.4391 0.3755 0.5160 -0.0742 0.0277  -0.0177 290 THR A OG1   
3049 C  CG2   . THR E 291 ? 0.4154 0.3962 0.4974 -0.0465 0.0294  -0.0066 290 THR A CG2   
3050 N  N     . GLU E 292 ? 0.4471 0.4389 0.5278 -0.0535 0.0119  0.0071  291 GLU A N     
3051 C  CA    . GLU E 292 ? 0.4770 0.4690 0.5435 -0.0509 0.0124  0.0083  291 GLU A CA    
3052 C  C     . GLU E 292 ? 0.4899 0.4785 0.5487 -0.0511 0.0100  -0.0005 291 GLU A C     
3053 O  O     . GLU E 292 ? 0.4816 0.4689 0.5453 -0.0594 0.0041  0.0007  291 GLU A O     
3054 C  CB    . GLU E 292 ? 0.4808 0.4783 0.5459 -0.0485 0.0142  0.0075  291 GLU A CB    
3055 C  CG    . GLU E 292 ? 0.4999 0.4859 0.5429 -0.0588 0.0125  0.0185  291 GLU A CG    
3056 C  CD    . GLU E 292 ? 0.5341 0.5000 0.5428 -0.0399 0.0175  0.0227  291 GLU A CD    
3057 O  OE1   . GLU E 292 ? 0.5728 0.4748 0.5110 -0.0600 0.0260  0.0476  291 GLU A OE1   
3058 O  OE2   . GLU E 292 ? 0.5610 0.5107 0.5461 -0.0493 0.0290  0.0369  291 GLU A OE2   
3059 N  N     . ASP E 293 ? 0.5156 0.4995 0.5572 -0.0498 0.0130  -0.0036 292 ASP A N     
3060 C  CA    . ASP E 293 ? 0.5445 0.5261 0.5745 -0.0449 0.0127  -0.0068 292 ASP A CA    
3061 C  C     . ASP E 293 ? 0.5468 0.5295 0.5777 -0.0422 0.0144  -0.0058 292 ASP A C     
3062 O  O     . ASP E 293 ? 0.5471 0.5211 0.5783 -0.0440 0.0155  -0.0041 292 ASP A O     
3063 C  CB    . ASP E 293 ? 0.5568 0.5345 0.5774 -0.0405 0.0109  -0.0038 292 ASP A CB    
3064 C  CG    . ASP E 293 ? 0.5888 0.5445 0.5877 -0.0389 0.0175  -0.0117 292 ASP A CG    
3065 O  OD1   . ASP E 293 ? 0.6453 0.5727 0.5890 -0.0322 0.0167  -0.0277 292 ASP A OD1   
3066 O  OD2   . ASP E 293 ? 0.6068 0.5745 0.5933 -0.0271 0.0080  -0.0301 292 ASP A OD2   
3067 N  N     . LEU E 294 ? 0.5564 0.5387 0.5801 -0.0389 0.0136  -0.0058 293 LEU A N     
3068 C  CA    . LEU E 294 ? 0.5601 0.5421 0.5806 -0.0349 0.0102  -0.0072 293 LEU A CA    
3069 C  C     . LEU E 294 ? 0.5631 0.5502 0.5800 -0.0372 0.0135  -0.0136 293 LEU A C     
3070 O  O     . LEU E 294 ? 0.5694 0.5555 0.5826 -0.0366 0.0154  -0.0254 293 LEU A O     
3071 C  CB    . LEU E 294 ? 0.5614 0.5249 0.5760 -0.0368 0.0091  -0.0032 293 LEU A CB    
3072 C  CG    . LEU E 294 ? 0.5496 0.5129 0.5672 -0.0218 0.0015  0.0030  293 LEU A CG    
3073 C  CD1   . LEU E 294 ? 0.5626 0.4702 0.5387 -0.0421 0.0039  0.0345  293 LEU A CD1   
3074 C  CD2   . LEU E 294 ? 0.5258 0.4558 0.5472 -0.0156 0.0032  0.0192  293 LEU A CD2   
3075 N  N     . ASP E 295 ? 0.5609 0.5527 0.5759 -0.0358 0.0098  -0.0109 294 ASP A N     
3076 C  CA    . ASP E 295 ? 0.5623 0.5649 0.5785 -0.0362 0.0067  -0.0134 294 ASP A CA    
3077 C  C     . ASP E 295 ? 0.5540 0.5539 0.5707 -0.0348 0.0073  -0.0102 294 ASP A C     
3078 O  O     . ASP E 295 ? 0.5624 0.5644 0.5665 -0.0301 0.0053  -0.0106 294 ASP A O     
3079 C  CB    . ASP E 295 ? 0.5689 0.5834 0.5905 -0.0329 0.0064  -0.0114 294 ASP A CB    
3080 C  CG    . ASP E 295 ? 0.5905 0.6106 0.6097 -0.0397 0.0068  -0.0083 294 ASP A CG    
3081 O  OD1   . ASP E 295 ? 0.6196 0.6625 0.6362 -0.0266 0.0138  -0.0123 294 ASP A OD1   
3082 O  OD2   . ASP E 295 ? 0.5737 0.6370 0.6351 -0.0385 -0.0067 -0.0115 294 ASP A OD2   
3083 N  N     . ILE E 296 ? 0.5394 0.5331 0.5577 -0.0416 0.0056  -0.0090 295 ILE A N     
3084 C  CA    . ILE E 296 ? 0.5189 0.5121 0.5390 -0.0455 0.0082  -0.0029 295 ILE A CA    
3085 C  C     . ILE E 296 ? 0.5037 0.4917 0.5235 -0.0494 0.0054  -0.0057 295 ILE A C     
3086 O  O     . ILE E 296 ? 0.5118 0.4884 0.5225 -0.0522 0.0005  -0.0066 295 ILE A O     
3087 C  CB    . ILE E 296 ? 0.5137 0.5144 0.5328 -0.0468 0.0131  -0.0006 295 ILE A CB    
3088 C  CG1   . ILE E 296 ? 0.5147 0.5156 0.5513 -0.0497 0.0167  -0.0049 295 ILE A CG1   
3089 C  CG2   . ILE E 296 ? 0.5121 0.5129 0.5257 -0.0492 0.0211  0.0054  295 ILE A CG2   
3090 C  CD1   . ILE E 296 ? 0.4959 0.5296 0.5348 -0.0476 0.0226  0.0211  295 ILE A CD1   
3091 N  N     . VAL E 297 ? 0.4812 0.4665 0.5104 -0.0497 0.0004  0.0010  296 VAL A N     
3092 C  CA    . VAL E 297 ? 0.4644 0.4411 0.4913 -0.0441 -0.0031 -0.0014 296 VAL A CA    
3093 C  C     . VAL E 297 ? 0.4513 0.4169 0.4664 -0.0361 -0.0029 -0.0007 296 VAL A C     
3094 O  O     . VAL E 297 ? 0.4471 0.4097 0.4688 -0.0257 -0.0130 -0.0116 296 VAL A O     
3095 C  CB    . VAL E 297 ? 0.4652 0.4413 0.4962 -0.0481 -0.0039 0.0014  296 VAL A CB    
3096 C  CG1   . VAL E 297 ? 0.4778 0.4495 0.4951 -0.0585 0.0000  0.0043  296 VAL A CG1   
3097 C  CG2   . VAL E 297 ? 0.4772 0.4432 0.4974 -0.0559 0.0051  0.0146  296 VAL A CG2   
3098 N  N     . SER E 298 ? 0.4307 0.3853 0.4420 -0.0372 -0.0052 -0.0047 297 SER A N     
3099 C  CA    . SER E 298 ? 0.4197 0.3586 0.4084 -0.0300 -0.0075 -0.0035 297 SER A CA    
3100 C  C     . SER E 298 ? 0.3941 0.3408 0.3741 -0.0315 -0.0004 0.0027  297 SER A C     
3101 O  O     . SER E 298 ? 0.3952 0.3282 0.3703 -0.0350 -0.0034 0.0066  297 SER A O     
3102 C  CB    . SER E 298 ? 0.4198 0.3536 0.4148 -0.0301 -0.0103 -0.0059 297 SER A CB    
3103 O  OG    . SER E 298 ? 0.4600 0.3565 0.4394 -0.0287 -0.0311 -0.0141 297 SER A OG    
3104 N  N     . ARG E 299 ? 0.3646 0.3154 0.3442 -0.0289 0.0069  0.0099  298 ARG A N     
3105 C  CA    . ARG E 299 ? 0.3397 0.3131 0.3135 -0.0184 0.0050  0.0017  298 ARG A CA    
3106 C  C     . ARG E 299 ? 0.3228 0.2883 0.2901 -0.0114 0.0094  0.0018  298 ARG A C     
3107 O  O     . ARG E 299 ? 0.3108 0.3029 0.2769 -0.0090 0.0091  -0.0015 298 ARG A O     
3108 C  CB    . ARG E 299 ? 0.3391 0.3098 0.3170 -0.0205 0.0020  0.0128  298 ARG A CB    
3109 C  CG    . ARG E 299 ? 0.3602 0.3552 0.3539 -0.0288 -0.0151 -0.0016 298 ARG A CG    
3110 C  CD    . ARG E 299 ? 0.3683 0.4022 0.3884 -0.0621 -0.0262 0.0038  298 ARG A CD    
3111 N  NE    . ARG E 299 ? 0.3958 0.4690 0.4445 -0.0594 -0.0512 -0.0301 298 ARG A NE    
3112 C  CZ    . ARG E 299 ? 0.3979 0.4977 0.4580 -0.0571 -0.0443 -0.0470 298 ARG A CZ    
3113 N  NH1   . ARG E 299 ? 0.3979 0.5066 0.4610 -0.0430 -0.0438 -0.0355 298 ARG A NH1   
3114 N  NH2   . ARG E 299 ? 0.3924 0.5131 0.4571 -0.0662 -0.0545 -0.0449 298 ARG A NH2   
3115 N  N     . GLY E 300 ? 0.3014 0.2571 0.2617 -0.0041 0.0113  -0.0038 299 GLY A N     
3116 C  CA    . GLY E 300 ? 0.2948 0.2336 0.2418 -0.0038 0.0095  -0.0042 299 GLY A CA    
3117 C  C     . GLY E 300 ? 0.2916 0.2264 0.2415 -0.0020 0.0015  -0.0106 299 GLY A C     
3118 O  O     . GLY E 300 ? 0.3018 0.2087 0.2259 -0.0026 -0.0134 0.0031  299 GLY A O     
3119 N  N     . ARG E 301 ? 0.2831 0.2151 0.2439 -0.0117 -0.0008 -0.0117 300 ARG A N     
3120 C  CA    . ARG E 301 ? 0.2823 0.2298 0.2506 -0.0231 0.0020  -0.0116 300 ARG A CA    
3121 C  C     . ARG E 301 ? 0.2678 0.2337 0.2473 -0.0267 -0.0001 -0.0103 300 ARG A C     
3122 O  O     . ARG E 301 ? 0.2581 0.2156 0.2556 -0.0439 -0.0008 -0.0097 300 ARG A O     
3123 C  CB    . ARG E 301 ? 0.2865 0.2311 0.2637 -0.0186 0.0038  -0.0124 300 ARG A CB    
3124 C  CG    . ARG E 301 ? 0.3320 0.2127 0.2757 -0.0287 0.0098  -0.0052 300 ARG A CG    
3125 C  CD    . ARG E 301 ? 0.3222 0.1932 0.2973 -0.0467 0.0446  -0.0068 300 ARG A CD    
3126 N  NE    . ARG E 301 ? 0.4256 0.1766 0.3374 -0.0462 0.0558  0.0019  300 ARG A NE    
3127 C  CZ    . ARG E 301 ? 0.4336 0.1909 0.3647 -0.0468 0.0814  0.0192  300 ARG A CZ    
3128 N  NH1   . ARG E 301 ? 0.3918 0.1472 0.3893 -0.0532 0.0886  0.0333  300 ARG A NH1   
3129 N  NH2   . ARG E 301 ? 0.4732 0.1799 0.3954 -0.0648 0.0778  0.0332  300 ARG A NH2   
3130 N  N     . THR E 302 ? 0.2545 0.2463 0.2373 -0.0362 -0.0027 -0.0160 301 THR A N     
3131 C  CA    . THR E 302 ? 0.2389 0.2401 0.2332 -0.0335 -0.0033 -0.0210 301 THR A CA    
3132 C  C     . THR E 302 ? 0.2352 0.2442 0.2192 -0.0383 -0.0049 -0.0191 301 THR A C     
3133 O  O     . THR E 302 ? 0.2238 0.2538 0.2173 -0.0408 -0.0148 -0.0164 301 THR A O     
3134 C  CB    . THR E 302 ? 0.2354 0.2409 0.2518 -0.0352 -0.0081 -0.0272 301 THR A CB    
3135 O  OG1   . THR E 302 ? 0.2283 0.2033 0.2717 -0.0269 -0.0335 -0.0401 301 THR A OG1   
3136 C  CG2   . THR E 302 ? 0.2239 0.2110 0.2334 -0.0413 0.0368  -0.0180 301 THR A CG2   
3137 N  N     . PHE E 303 ? 0.2406 0.2442 0.2064 -0.0385 -0.0041 -0.0180 302 PHE A N     
3138 C  CA    . PHE E 303 ? 0.2387 0.2280 0.1968 -0.0477 -0.0057 -0.0148 302 PHE A CA    
3139 C  C     . PHE E 303 ? 0.2448 0.2425 0.1936 -0.0489 0.0009  -0.0145 302 PHE A C     
3140 O  O     . PHE E 303 ? 0.2592 0.2434 0.1799 -0.0583 0.0014  -0.0096 302 PHE A O     
3141 C  CB    . PHE E 303 ? 0.2410 0.2118 0.1985 -0.0535 -0.0074 -0.0134 302 PHE A CB    
3142 C  CG    . PHE E 303 ? 0.2118 0.1925 0.1797 -0.0375 -0.0198 -0.0156 302 PHE A CG    
3143 C  CD1   . PHE E 303 ? 0.2051 0.1620 0.1928 -0.0430 -0.0251 -0.0189 302 PHE A CD1   
3144 C  CD2   . PHE E 303 ? 0.2147 0.1702 0.1976 -0.0460 -0.0373 0.0153  302 PHE A CD2   
3145 C  CE1   . PHE E 303 ? 0.2441 0.1574 0.2392 -0.0300 -0.0391 -0.0023 302 PHE A CE1   
3146 C  CE2   . PHE E 303 ? 0.2597 0.2008 0.2210 -0.0335 -0.0207 0.0051  302 PHE A CE2   
3147 C  CZ    . PHE E 303 ? 0.2534 0.1484 0.2449 -0.0393 -0.0498 -0.0228 302 PHE A CZ    
3148 N  N     . PRO E 304 ? 0.2456 0.2416 0.1987 -0.0522 0.0043  -0.0104 303 PRO A N     
3149 C  CA    . PRO E 304 ? 0.2483 0.2601 0.2105 -0.0500 0.0000  -0.0130 303 PRO A CA    
3150 C  C     . PRO E 304 ? 0.2564 0.2804 0.2178 -0.0508 0.0011  -0.0120 303 PRO A C     
3151 O  O     . PRO E 304 ? 0.2541 0.3071 0.2408 -0.0466 0.0092  -0.0167 303 PRO A O     
3152 C  CB    . PRO E 304 ? 0.2382 0.2614 0.1940 -0.0601 0.0098  -0.0067 303 PRO A CB    
3153 C  CG    . PRO E 304 ? 0.2425 0.2385 0.1901 -0.0525 -0.0110 -0.0240 303 PRO A CG    
3154 C  CD    . PRO E 304 ? 0.2383 0.2470 0.1893 -0.0493 0.0088  -0.0154 303 PRO A CD    
3155 N  N     . HIS E 305 ? 0.2661 0.2684 0.2048 -0.0543 -0.0016 -0.0093 304 HIS A N     
3156 C  CA    . HIS E 305 ? 0.2673 0.2719 0.1987 -0.0512 -0.0071 -0.0109 304 HIS A CA    
3157 C  C     . HIS E 305 ? 0.2703 0.2757 0.2035 -0.0468 -0.0108 -0.0131 304 HIS A C     
3158 O  O     . HIS E 305 ? 0.2912 0.2921 0.2094 -0.0527 -0.0033 -0.0219 304 HIS A O     
3159 C  CB    . HIS E 305 ? 0.2636 0.2715 0.1760 -0.0503 -0.0111 -0.0118 304 HIS A CB    
3160 C  CG    . HIS E 305 ? 0.2664 0.2359 0.1020 -0.0632 -0.0159 -0.0033 304 HIS A CG    
3161 N  ND1   . HIS E 305 ? 0.3013 0.2151 0.0583 -0.0581 -0.0011 -0.0055 304 HIS A ND1   
3162 C  CD2   . HIS E 305 ? 0.2646 0.1789 0.0981 -0.0950 -0.0282 -0.0197 304 HIS A CD2   
3163 C  CE1   . HIS E 305 ? 0.2984 0.1902 0.0592 -0.1227 -0.0099 0.0185  304 HIS A CE1   
3164 N  NE2   . HIS E 305 ? 0.2682 0.1656 0.0698 -0.1065 -0.0272 -0.0110 304 HIS A NE2   
3165 N  N     . GLY E 306 ? 0.2652 0.2695 0.2073 -0.0384 -0.0213 -0.0153 305 GLY A N     
3166 C  CA    . GLY E 306 ? 0.2699 0.2652 0.2117 -0.0387 -0.0295 -0.0156 305 GLY A CA    
3167 C  C     . GLY E 306 ? 0.2781 0.2662 0.2108 -0.0398 -0.0374 -0.0140 305 GLY A C     
3168 O  O     . GLY E 306 ? 0.3005 0.2893 0.2271 -0.0290 -0.0445 -0.0049 305 GLY A O     
3169 N  N     . ILE E 307 ? 0.2790 0.2651 0.2056 -0.0518 -0.0446 -0.0163 306 ILE A N     
3170 C  CA    . ILE E 307 ? 0.2739 0.2606 0.1960 -0.0623 -0.0440 -0.0189 306 ILE A CA    
3171 C  C     . ILE E 307 ? 0.2887 0.2596 0.2131 -0.0616 -0.0500 -0.0142 306 ILE A C     
3172 O  O     . ILE E 307 ? 0.2867 0.2372 0.2243 -0.0771 -0.0578 -0.0100 306 ILE A O     
3173 C  CB    . ILE E 307 ? 0.2755 0.2673 0.1898 -0.0557 -0.0456 -0.0218 306 ILE A CB    
3174 C  CG1   . ILE E 307 ? 0.2777 0.2587 0.1825 -0.0649 -0.0305 -0.0287 306 ILE A CG1   
3175 C  CG2   . ILE E 307 ? 0.2464 0.2419 0.1616 -0.0707 -0.0617 -0.0299 306 ILE A CG2   
3176 C  CD1   . ILE E 307 ? 0.3198 0.2361 0.1435 -0.0262 -0.0400 -0.0919 306 ILE A CD1   
3177 N  N     . SER E 308 ? 0.3009 0.2618 0.2131 -0.0639 -0.0485 -0.0115 307 SER A N     
3178 C  CA    . SER E 308 ? 0.3110 0.2621 0.2095 -0.0700 -0.0356 0.0134  307 SER A CA    
3179 C  C     . SER E 308 ? 0.3133 0.2760 0.2326 -0.0772 -0.0377 0.0146  307 SER A C     
3180 O  O     . SER E 308 ? 0.3251 0.2821 0.2208 -0.0781 -0.0561 0.0235  307 SER A O     
3181 C  CB    . SER E 308 ? 0.3016 0.2442 0.1938 -0.0716 -0.0348 0.0144  307 SER A CB    
3182 O  OG    . SER E 308 ? 0.3044 0.2058 0.1403 -0.0854 -0.0110 0.0348  307 SER A OG    
3183 N  N     . LYS E 309 ? 0.3261 0.2840 0.2594 -0.0705 -0.0299 0.0212  308 LYS A N     
3184 C  CA    . LYS E 309 ? 0.3262 0.3120 0.2754 -0.0679 -0.0123 0.0146  308 LYS A CA    
3185 C  C     . LYS E 309 ? 0.3326 0.3159 0.2810 -0.0664 -0.0056 0.0031  308 LYS A C     
3186 O  O     . LYS E 309 ? 0.3472 0.3235 0.2920 -0.0743 -0.0047 -0.0014 308 LYS A O     
3187 C  CB    . LYS E 309 ? 0.3328 0.3134 0.2785 -0.0731 -0.0146 0.0176  308 LYS A CB    
3188 C  CG    . LYS E 309 ? 0.3287 0.3767 0.3160 -0.0629 -0.0101 0.0305  308 LYS A CG    
3189 C  CD    . LYS E 309 ? 0.2973 0.3958 0.3440 -0.0531 -0.0258 0.0622  308 LYS A CD    
3190 C  CE    . LYS E 309 ? 0.3176 0.4279 0.4033 -0.0440 -0.0540 0.0328  308 LYS A CE    
3191 N  NZ    . LYS E 309 ? 0.3327 0.4448 0.4394 -0.0434 -0.0728 0.0490  308 LYS A NZ    
3192 N  N     . GLU E 310 ? 0.3220 0.3047 0.2739 -0.0680 0.0005  -0.0098 309 GLU A N     
3193 C  CA    . GLU E 310 ? 0.3281 0.3138 0.2725 -0.0588 0.0120  -0.0221 309 GLU A CA    
3194 C  C     . GLU E 310 ? 0.3264 0.3081 0.2728 -0.0563 0.0226  -0.0208 309 GLU A C     
3195 O  O     . GLU E 310 ? 0.3264 0.3154 0.2851 -0.0492 0.0252  -0.0329 309 GLU A O     
3196 C  CB    . GLU E 310 ? 0.3267 0.3309 0.2858 -0.0645 0.0094  -0.0235 309 GLU A CB    
3197 C  CG    . GLU E 310 ? 0.3548 0.3615 0.2985 -0.0430 0.0080  -0.0133 309 GLU A CG    
3198 C  CD    . GLU E 310 ? 0.3696 0.3900 0.3119 -0.0335 0.0100  -0.0266 309 GLU A CD    
3199 O  OE1   . GLU E 310 ? 0.4242 0.3962 0.2816 -0.0171 0.0313  -0.0300 309 GLU A OE1   
3200 O  OE2   . GLU E 310 ? 0.3769 0.3693 0.3241 -0.0497 -0.0021 0.0068  309 GLU A OE2   
3201 N  N     . THR E 311 ? 0.3297 0.2894 0.2650 -0.0586 0.0271  -0.0168 310 THR A N     
3202 C  CA    . THR E 311 ? 0.3196 0.2608 0.2544 -0.0552 0.0342  -0.0190 310 THR A CA    
3203 C  C     . THR E 311 ? 0.3181 0.2483 0.2472 -0.0580 0.0359  -0.0103 310 THR A C     
3204 O  O     . THR E 311 ? 0.3105 0.2324 0.2414 -0.0651 0.0332  0.0039  310 THR A O     
3205 C  CB    . THR E 311 ? 0.3149 0.2511 0.2460 -0.0557 0.0393  -0.0227 310 THR A CB    
3206 O  OG1   . THR E 311 ? 0.2855 0.2735 0.2559 -0.0490 0.0509  -0.0201 310 THR A OG1   
3207 C  CG2   . THR E 311 ? 0.3085 0.1970 0.2397 -0.0443 0.0391  -0.0482 310 THR A CG2   
3208 N  N     . ALA E 312 ? 0.3260 0.2472 0.2464 -0.0534 0.0406  -0.0113 311 ALA A N     
3209 C  CA    . ALA E 312 ? 0.3372 0.2507 0.2393 -0.0462 0.0414  -0.0127 311 ALA A CA    
3210 C  C     . ALA E 312 ? 0.3303 0.2463 0.2243 -0.0439 0.0512  -0.0149 311 ALA A C     
3211 O  O     . ALA E 312 ? 0.3401 0.2251 0.2106 -0.0470 0.0632  -0.0186 311 ALA A O     
3212 C  CB    . ALA E 312 ? 0.3454 0.2512 0.2461 -0.0433 0.0423  -0.0136 311 ALA A CB    
3213 N  N     . TYR E 313 ? 0.3359 0.2635 0.2197 -0.0420 0.0493  -0.0099 312 TYR A N     
3214 C  CA    . TYR E 313 ? 0.3469 0.2744 0.2288 -0.0337 0.0416  -0.0099 312 TYR A CA    
3215 C  C     . TYR E 313 ? 0.3418 0.2636 0.2165 -0.0327 0.0478  -0.0121 312 TYR A C     
3216 O  O     . TYR E 313 ? 0.3457 0.2693 0.2018 -0.0507 0.0512  -0.0038 312 TYR A O     
3217 C  CB    . TYR E 313 ? 0.3599 0.2782 0.2329 -0.0292 0.0392  -0.0080 312 TYR A CB    
3218 C  CG    . TYR E 313 ? 0.3790 0.3032 0.2632 -0.0343 0.0303  0.0210  312 TYR A CG    
3219 C  CD1   . TYR E 313 ? 0.4100 0.3540 0.2616 -0.0399 0.0005  0.0346  312 TYR A CD1   
3220 C  CD2   . TYR E 313 ? 0.3861 0.3066 0.2861 -0.0283 0.0196  0.0425  312 TYR A CD2   
3221 C  CE1   . TYR E 313 ? 0.4191 0.3336 0.3016 -0.0181 -0.0069 0.0391  312 TYR A CE1   
3222 C  CE2   . TYR E 313 ? 0.4286 0.3546 0.2934 -0.0114 -0.0102 0.0492  312 TYR A CE2   
3223 C  CZ    . TYR E 313 ? 0.4483 0.3392 0.3082 -0.0123 -0.0119 0.0454  312 TYR A CZ    
3224 O  OH    . TYR E 313 ? 0.4965 0.3486 0.3012 -0.0325 -0.0042 0.0568  312 TYR A OH    
3225 N  N     . SER E 314 ? 0.3357 0.2546 0.2156 -0.0235 0.0484  -0.0235 313 SER A N     
3226 C  CA    . SER E 314 ? 0.3197 0.2416 0.2335 -0.0087 0.0508  -0.0253 313 SER A CA    
3227 C  C     . SER E 314 ? 0.3158 0.2294 0.2421 -0.0018 0.0519  -0.0236 313 SER A C     
3228 O  O     . SER E 314 ? 0.3196 0.2413 0.2451 0.0043  0.0591  -0.0319 313 SER A O     
3229 C  CB    . SER E 314 ? 0.3209 0.2408 0.2337 -0.0113 0.0494  -0.0215 313 SER A CB    
3230 O  OG    . SER E 314 ? 0.3415 0.2637 0.2580 -0.0101 0.0377  -0.0211 313 SER A OG    
3231 N  N     . GLU E 315 ? 0.3054 0.2144 0.2475 -0.0021 0.0572  -0.0225 314 GLU A N     
3232 C  CA    . GLU E 315 ? 0.2962 0.2111 0.2692 0.0021  0.0564  -0.0276 314 GLU A CA    
3233 C  C     . GLU E 315 ? 0.2802 0.1916 0.2679 0.0023  0.0576  -0.0303 314 GLU A C     
3234 O  O     . GLU E 315 ? 0.2668 0.1661 0.2712 0.0106  0.0542  -0.0348 314 GLU A O     
3235 C  CB    . GLU E 315 ? 0.2995 0.2180 0.2656 -0.0030 0.0630  -0.0237 314 GLU A CB    
3236 C  CG    . GLU E 315 ? 0.3181 0.2850 0.2908 0.0197  0.0492  -0.0234 314 GLU A CG    
3237 C  CD    . GLU E 315 ? 0.3641 0.3520 0.3386 0.0256  0.0228  -0.0055 314 GLU A CD    
3238 O  OE1   . GLU E 315 ? 0.4037 0.4184 0.3279 0.0301  0.0123  0.0187  314 GLU A OE1   
3239 O  OE2   . GLU E 315 ? 0.3380 0.4321 0.3342 -0.0156 0.0203  -0.0452 314 GLU A OE2   
3240 N  N     . SER E 316 ? 0.2728 0.1837 0.2715 -0.0032 0.0621  -0.0289 315 SER A N     
3241 C  CA    . SER E 316 ? 0.2820 0.1950 0.2958 -0.0011 0.0447  -0.0333 315 SER A CA    
3242 C  C     . SER E 316 ? 0.2780 0.2104 0.3050 0.0011  0.0430  -0.0355 315 SER A C     
3243 O  O     . SER E 316 ? 0.2780 0.1917 0.2846 0.0107  0.0537  -0.0439 315 SER A O     
3244 C  CB    . SER E 316 ? 0.2902 0.1756 0.2968 -0.0063 0.0419  -0.0236 315 SER A CB    
3245 O  OG    . SER E 316 ? 0.2814 0.2001 0.3251 -0.0286 0.0393  -0.0405 315 SER A OG    
3246 N  N     . VAL E 317 ? 0.2766 0.2341 0.3186 0.0074  0.0316  -0.0357 316 VAL A N     
3247 C  CA    . VAL E 317 ? 0.2852 0.2452 0.3247 0.0131  0.0220  -0.0246 316 VAL A CA    
3248 C  C     . VAL E 317 ? 0.2830 0.2487 0.3434 0.0168  0.0196  -0.0119 316 VAL A C     
3249 O  O     . VAL E 317 ? 0.2762 0.2569 0.3526 0.0261  0.0201  -0.0158 316 VAL A O     
3250 C  CB    . VAL E 317 ? 0.2839 0.2446 0.3241 0.0123  0.0244  -0.0201 316 VAL A CB    
3251 C  CG1   . VAL E 317 ? 0.2754 0.2293 0.3101 0.0028  0.0182  -0.0190 316 VAL A CG1   
3252 C  CG2   . VAL E 317 ? 0.2968 0.2641 0.2925 0.0039  0.0292  -0.0166 316 VAL A CG2   
3253 N  N     . LYS E 318 ? 0.2800 0.2514 0.3514 0.0142  0.0186  -0.0013 317 LYS A N     
3254 C  CA    . LYS E 318 ? 0.2846 0.2646 0.3535 0.0139  0.0168  0.0002  317 LYS A CA    
3255 C  C     . LYS E 318 ? 0.2862 0.2538 0.3487 0.0222  0.0180  0.0010  317 LYS A C     
3256 O  O     . LYS E 318 ? 0.2955 0.2550 0.3478 0.0246  0.0180  0.0069  317 LYS A O     
3257 C  CB    . LYS E 318 ? 0.2805 0.2784 0.3609 0.0178  0.0182  0.0045  317 LYS A CB    
3258 C  CG    . LYS E 318 ? 0.2857 0.2880 0.3843 -0.0026 0.0215  -0.0048 317 LYS A CG    
3259 C  CD    . LYS E 318 ? 0.3263 0.3435 0.4522 -0.0232 0.0066  0.0295  317 LYS A CD    
3260 C  CE    . LYS E 318 ? 0.3319 0.3479 0.4974 -0.0445 -0.0057 0.0358  317 LYS A CE    
3261 N  NZ    . LYS E 318 ? 0.2903 0.3878 0.5247 -0.0439 0.0241  0.0645  317 LYS A NZ    
3262 N  N     . LEU E 319 ? 0.2899 0.2541 0.3466 0.0189  0.0132  0.0006  318 LEU A N     
3263 C  CA    . LEU E 319 ? 0.2886 0.2445 0.3359 0.0205  0.0076  -0.0071 318 LEU A CA    
3264 C  C     . LEU E 319 ? 0.2945 0.2520 0.3479 0.0186  0.0079  -0.0075 318 LEU A C     
3265 O  O     . LEU E 319 ? 0.3083 0.2474 0.3394 0.0228  0.0088  -0.0061 318 LEU A O     
3266 C  CB    . LEU E 319 ? 0.2796 0.2257 0.3326 0.0198  0.0075  -0.0164 318 LEU A CB    
3267 C  CG    . LEU E 319 ? 0.2506 0.1624 0.3143 0.0185  -0.0134 -0.0164 318 LEU A CG    
3268 C  CD1   . LEU E 319 ? 0.2013 0.0927 0.2835 -0.0234 -0.0105 -0.0348 318 LEU A CD1   
3269 C  CD2   . LEU E 319 ? 0.2292 0.0421 0.2990 0.0311  -0.0382 -0.0604 318 LEU A CD2   
3270 N  N     . LEU E 320 ? 0.3007 0.2696 0.3647 0.0168  0.0140  -0.0063 319 LEU A N     
3271 C  CA    . LEU E 320 ? 0.3170 0.2906 0.3868 0.0054  0.0122  -0.0061 319 LEU A CA    
3272 C  C     . LEU E 320 ? 0.3330 0.3032 0.4143 0.0050  0.0056  -0.0026 319 LEU A C     
3273 O  O     . LEU E 320 ? 0.3537 0.3112 0.4295 0.0080  -0.0038 -0.0067 319 LEU A O     
3274 C  CB    . LEU E 320 ? 0.3158 0.2964 0.3863 -0.0027 0.0176  -0.0007 319 LEU A CB    
3275 C  CG    . LEU E 320 ? 0.2816 0.2959 0.3661 0.0021  0.0312  -0.0259 319 LEU A CG    
3276 C  CD1   . LEU E 320 ? 0.2389 0.3269 0.3634 -0.0305 0.0349  -0.0192 319 LEU A CD1   
3277 C  CD2   . LEU E 320 ? 0.2565 0.2436 0.3577 0.0193  0.0286  -0.0144 319 LEU A CD2   
3278 N  N     . GLN E 321 ? 0.3488 0.3112 0.4280 0.0031  0.0097  -0.0035 320 GLN A N     
3279 C  CA    . GLN E 321 ? 0.3634 0.3085 0.4407 0.0053  0.0056  0.0050  320 GLN A CA    
3280 C  C     . GLN E 321 ? 0.3796 0.3129 0.4516 0.0098  0.0081  0.0108  320 GLN A C     
3281 O  O     . GLN E 321 ? 0.4018 0.3150 0.4723 0.0207  -0.0049 0.0132  320 GLN A O     
3282 C  CB    . GLN E 321 ? 0.3601 0.3128 0.4371 0.0016  0.0078  0.0075  320 GLN A CB    
3283 C  CG    . GLN E 321 ? 0.3385 0.3278 0.4294 -0.0159 0.0199  0.0072  320 GLN A CG    
3284 C  CD    . GLN E 321 ? 0.3242 0.3452 0.4190 -0.0489 0.0338  0.0012  320 GLN A CD    
3285 O  OE1   . GLN E 321 ? 0.3538 0.3763 0.4362 -0.0665 0.0110  0.0191  320 GLN A OE1   
3286 N  NE2   . GLN E 321 ? 0.2849 0.3124 0.4238 -0.0555 0.0509  0.0100  320 GLN A NE2   
3287 N  N     . LYS E 322 ? 0.3995 0.3260 0.4642 0.0093  0.0109  0.0104  321 LYS A N     
3288 C  CA    . LYS E 322 ? 0.4143 0.3453 0.4752 0.0068  0.0130  0.0076  321 LYS A CA    
3289 C  C     . LYS E 322 ? 0.4216 0.3596 0.4797 0.0053  0.0131  0.0064  321 LYS A C     
3290 O  O     . LYS E 322 ? 0.4153 0.3590 0.4839 0.0128  0.0134  0.0045  321 LYS A O     
3291 C  CB    . LYS E 322 ? 0.4099 0.3495 0.4773 0.0053  0.0211  0.0066  321 LYS A CB    
3292 C  CG    . LYS E 322 ? 0.4136 0.3424 0.5042 -0.0097 0.0195  0.0116  321 LYS A CG    
3293 C  CD    . LYS E 322 ? 0.3902 0.3885 0.5525 -0.0196 0.0361  0.0103  321 LYS A CD    
3294 C  CE    . LYS E 322 ? 0.3810 0.4004 0.5484 -0.0153 0.0395  0.0161  321 LYS A CE    
3295 N  NZ    . LYS E 322 ? 0.3825 0.3739 0.6147 -0.0245 -0.0003 0.0131  321 LYS A NZ    
3296 N  N     . ILE E 323 ? 0.4336 0.3743 0.4788 0.0085  0.0151  0.0031  322 ILE A N     
3297 C  CA    . ILE E 323 ? 0.4342 0.3800 0.4758 0.0060  0.0135  -0.0019 322 ILE A CA    
3298 C  C     . ILE E 323 ? 0.4469 0.4002 0.4971 0.0038  0.0058  -0.0027 322 ILE A C     
3299 O  O     . ILE E 323 ? 0.4577 0.3969 0.4998 0.0079  0.0000  -0.0081 322 ILE A O     
3300 C  CB    . ILE E 323 ? 0.4239 0.3766 0.4693 0.0073  0.0167  -0.0048 322 ILE A CB    
3301 C  CG1   . ILE E 323 ? 0.4082 0.3809 0.4438 0.0079  0.0137  -0.0080 322 ILE A CG1   
3302 C  CG2   . ILE E 323 ? 0.4187 0.3703 0.4498 0.0123  0.0183  0.0003  322 ILE A CG2   
3303 C  CD1   . ILE E 323 ? 0.3547 0.3547 0.4017 0.0170  0.0509  -0.0416 322 ILE A CD1   
3304 N  N     . LEU E 324 ? 0.4622 0.4268 0.5050 0.0030  0.0065  -0.0023 323 LEU A N     
3305 C  CA    . LEU E 324 ? 0.4837 0.4652 0.5214 -0.0003 0.0083  -0.0025 323 LEU A CA    
3306 C  C     . LEU E 324 ? 0.5024 0.4921 0.5370 0.0000  0.0058  -0.0062 323 LEU A C     
3307 O  O     . LEU E 324 ? 0.5079 0.4944 0.5399 -0.0065 0.0127  -0.0059 323 LEU A O     
3308 C  CB    . LEU E 324 ? 0.4822 0.4605 0.5198 0.0006  0.0052  -0.0023 323 LEU A CB    
3309 C  CG    . LEU E 324 ? 0.4594 0.4626 0.5257 0.0051  0.0040  -0.0024 323 LEU A CG    
3310 C  CD1   . LEU E 324 ? 0.4487 0.4326 0.5291 0.0095  0.0001  -0.0058 323 LEU A CD1   
3311 C  CD2   . LEU E 324 ? 0.4401 0.4461 0.5293 0.0081  0.0023  0.0004  323 LEU A CD2   
3312 N  N     . GLU E 325 ? 0.5254 0.5158 0.5496 -0.0022 0.0085  -0.0080 324 GLU A N     
3313 C  CA    . GLU E 325 ? 0.5521 0.5384 0.5619 0.0015  0.0001  -0.0112 324 GLU A CA    
3314 C  C     . GLU E 325 ? 0.5646 0.5618 0.5762 -0.0036 0.0002  -0.0144 324 GLU A C     
3315 O  O     . GLU E 325 ? 0.5665 0.5673 0.5782 -0.0037 -0.0056 -0.0131 324 GLU A O     
3316 C  CB    . GLU E 325 ? 0.5587 0.5462 0.5613 -0.0001 -0.0029 -0.0144 324 GLU A CB    
3317 C  CG    . GLU E 325 ? 0.5917 0.5137 0.5722 0.0187  -0.0132 -0.0241 324 GLU A CG    
3318 C  CD    . GLU E 325 ? 0.6304 0.5048 0.5876 0.0124  -0.0249 -0.0327 324 GLU A CD    
3319 O  OE1   . GLU E 325 ? 0.6457 0.4939 0.5885 0.0132  -0.0227 -0.0401 324 GLU A OE1   
3320 O  OE2   . GLU E 325 ? 0.6360 0.4520 0.5894 0.0262  -0.0381 -0.0217 324 GLU A OE2   
3321 N  N     . GLU E 326 ? 0.5813 0.5824 0.5905 -0.0075 0.0011  -0.0182 325 GLU A N     
3322 C  CA    . GLU E 326 ? 0.5934 0.5973 0.5995 -0.0155 0.0010  -0.0229 325 GLU A CA    
3323 C  C     . GLU E 326 ? 0.6016 0.5979 0.6045 -0.0144 0.0004  -0.0195 325 GLU A C     
3324 O  O     . GLU E 326 ? 0.6108 0.6084 0.6118 -0.0128 -0.0003 -0.0217 325 GLU A O     
3325 C  CB    . GLU E 326 ? 0.5935 0.6021 0.5990 -0.0167 0.0033  -0.0250 325 GLU A CB    
3326 C  CG    . GLU E 326 ? 0.6014 0.6055 0.6068 -0.0247 -0.0020 -0.0282 325 GLU A CG    
3327 C  CD    . GLU E 326 ? 0.6155 0.6334 0.6364 -0.0324 -0.0111 -0.0567 325 GLU A CD    
3328 O  OE1   . GLU E 326 ? 0.6095 0.6264 0.6332 -0.0406 -0.0121 -0.0754 325 GLU A OE1   
3329 O  OE2   . GLU E 326 ? 0.6265 0.6347 0.6540 -0.0429 -0.0177 -0.0638 325 GLU A OE2   
3330 N  N     . ASP E 327 ? 0.6045 0.6020 0.6042 -0.0170 0.0000  -0.0151 326 ASP A N     
3331 C  CA    . ASP E 327 ? 0.6016 0.6021 0.6077 -0.0191 0.0038  -0.0140 326 ASP A CA    
3332 C  C     . ASP E 327 ? 0.5978 0.6045 0.6137 -0.0187 0.0028  -0.0167 326 ASP A C     
3333 O  O     . ASP E 327 ? 0.6042 0.6086 0.6213 -0.0169 0.0005  -0.0217 326 ASP A O     
3334 C  CB    . ASP E 327 ? 0.5985 0.5979 0.6059 -0.0178 0.0048  -0.0118 326 ASP A CB    
3335 C  CG    . ASP E 327 ? 0.5928 0.6001 0.6015 -0.0222 0.0077  -0.0091 326 ASP A CG    
3336 O  OD1   . ASP E 327 ? 0.5866 0.5899 0.5955 -0.0389 0.0084  -0.0024 326 ASP A OD1   
3337 O  OD2   . ASP E 327 ? 0.6027 0.5872 0.6159 -0.0148 0.0025  -0.0068 326 ASP A OD2   
3338 N  N     . GLU E 328 ? 0.5895 0.5964 0.6089 -0.0209 0.0025  -0.0151 327 GLU A N     
3339 C  CA    . GLU E 328 ? 0.5793 0.5909 0.6052 -0.0241 0.0032  -0.0123 327 GLU A CA    
3340 C  C     . GLU E 328 ? 0.5679 0.5827 0.6030 -0.0281 0.0023  -0.0166 327 GLU A C     
3341 O  O     . GLU E 328 ? 0.5687 0.5853 0.6054 -0.0326 0.0041  -0.0199 327 GLU A O     
3342 C  CB    . GLU E 328 ? 0.5862 0.5989 0.6101 -0.0212 0.0043  -0.0144 327 GLU A CB    
3343 C  CG    . GLU E 328 ? 0.6098 0.6136 0.6194 -0.0072 0.0025  -0.0113 327 GLU A CG    
3344 C  CD    . GLU E 328 ? 0.6415 0.6413 0.6439 0.0199  -0.0025 -0.0247 327 GLU A CD    
3345 O  OE1   . GLU E 328 ? 0.6477 0.6414 0.6507 0.0312  -0.0118 -0.0324 327 GLU A OE1   
3346 O  OE2   . GLU E 328 ? 0.6525 0.6545 0.6490 0.0314  0.0021  -0.0172 327 GLU A OE2   
3347 N  N     . ARG E 329 ? 0.5518 0.5697 0.5909 -0.0338 0.0026  -0.0139 328 ARG A N     
3348 C  CA    . ARG E 329 ? 0.5349 0.5530 0.5811 -0.0398 0.0050  -0.0147 328 ARG A CA    
3349 C  C     . ARG E 329 ? 0.5244 0.5410 0.5717 -0.0410 0.0087  -0.0154 328 ARG A C     
3350 O  O     . ARG E 329 ? 0.5291 0.5488 0.5742 -0.0453 0.0080  -0.0228 328 ARG A O     
3351 C  CB    . ARG E 329 ? 0.5310 0.5463 0.5832 -0.0451 0.0066  -0.0133 328 ARG A CB    
3352 C  CG    . ARG E 329 ? 0.5357 0.5493 0.5887 -0.0508 0.0110  -0.0115 328 ARG A CG    
3353 C  CD    . ARG E 329 ? 0.5560 0.5826 0.6224 -0.0512 0.0258  -0.0225 328 ARG A CD    
3354 N  NE    . ARG E 329 ? 0.5684 0.6063 0.6496 -0.0659 0.0155  -0.0379 328 ARG A NE    
3355 C  CZ    . ARG E 329 ? 0.5848 0.6122 0.6519 -0.0739 0.0266  -0.0405 328 ARG A CZ    
3356 N  NH1   . ARG E 329 ? 0.5997 0.6045 0.6511 -0.0575 0.0240  -0.0321 328 ARG A NH1   
3357 N  NH2   . ARG E 329 ? 0.5780 0.6124 0.6664 -0.0857 0.0199  -0.0456 328 ARG A NH2   
3358 N  N     . LYS E 330 ? 0.5076 0.5184 0.5568 -0.0389 0.0084  -0.0155 329 LYS A N     
3359 C  CA    . LYS E 330 ? 0.4885 0.4999 0.5464 -0.0393 0.0149  -0.0200 329 LYS A CA    
3360 C  C     . LYS E 330 ? 0.4735 0.4859 0.5347 -0.0380 0.0165  -0.0222 329 LYS A C     
3361 O  O     . LYS E 330 ? 0.4722 0.4973 0.5368 -0.0396 0.0166  -0.0268 329 LYS A O     
3362 C  CB    . LYS E 330 ? 0.4906 0.5012 0.5463 -0.0375 0.0155  -0.0197 329 LYS A CB    
3363 C  CG    . LYS E 330 ? 0.4856 0.4962 0.5386 -0.0406 0.0159  -0.0181 329 LYS A CG    
3364 C  CD    . LYS E 330 ? 0.4646 0.4815 0.5198 -0.0251 0.0094  -0.0074 329 LYS A CD    
3365 C  CE    . LYS E 330 ? 0.4418 0.4735 0.5045 -0.0292 0.0169  0.0131  329 LYS A CE    
3366 N  NZ    . LYS E 330 ? 0.4192 0.4649 0.4657 -0.0265 0.0269  0.0488  329 LYS A NZ    
3367 N  N     . ILE E 331 ? 0.4478 0.4543 0.5208 -0.0353 0.0207  -0.0193 330 ILE A N     
3368 C  CA    . ILE E 331 ? 0.4319 0.4271 0.5062 -0.0333 0.0233  -0.0161 330 ILE A CA    
3369 C  C     . ILE E 331 ? 0.4188 0.4219 0.5041 -0.0333 0.0300  -0.0189 330 ILE A C     
3370 O  O     . ILE E 331 ? 0.4110 0.4223 0.5056 -0.0207 0.0371  -0.0316 330 ILE A O     
3371 C  CB    . ILE E 331 ? 0.4352 0.4201 0.5090 -0.0286 0.0206  -0.0144 330 ILE A CB    
3372 C  CG1   . ILE E 331 ? 0.4304 0.4160 0.5030 -0.0251 0.0217  -0.0152 330 ILE A CG1   
3373 C  CG2   . ILE E 331 ? 0.4277 0.3884 0.4777 -0.0483 0.0223  -0.0045 330 ILE A CG2   
3374 C  CD1   . ILE E 331 ? 0.3595 0.4219 0.5010 -0.0077 0.0263  -0.0115 330 ILE A CD1   
3375 N  N     . ARG E 332 ? 0.4102 0.4053 0.4940 -0.0351 0.0302  -0.0180 331 ARG A N     
3376 C  CA    . ARG E 332 ? 0.3992 0.3958 0.4791 -0.0342 0.0344  -0.0161 331 ARG A CA    
3377 C  C     . ARG E 332 ? 0.3991 0.3810 0.4610 -0.0299 0.0353  -0.0145 331 ARG A C     
3378 O  O     . ARG E 332 ? 0.4069 0.3827 0.4578 -0.0348 0.0402  -0.0108 331 ARG A O     
3379 C  CB    . ARG E 332 ? 0.4005 0.4002 0.4880 -0.0412 0.0356  -0.0149 331 ARG A CB    
3380 C  CG    . ARG E 332 ? 0.4118 0.4246 0.5098 -0.0494 0.0112  -0.0107 331 ARG A CG    
3381 C  CD    . ARG E 332 ? 0.4747 0.4711 0.5601 -0.0723 -0.0186 -0.0341 331 ARG A CD    
3382 N  NE    . ARG E 332 ? 0.5151 0.4873 0.5763 -0.0991 -0.0360 -0.0281 331 ARG A NE    
3383 C  CZ    . ARG E 332 ? 0.5052 0.5063 0.6093 -0.1194 -0.0266 -0.0231 331 ARG A CZ    
3384 N  NH1   . ARG E 332 ? 0.4770 0.5254 0.6149 -0.1348 -0.0244 -0.0221 331 ARG A NH1   
3385 N  NH2   . ARG E 332 ? 0.5012 0.4958 0.6124 -0.0864 -0.0352 -0.0169 331 ARG A NH2   
3386 N  N     . ARG E 333 ? 0.3820 0.3589 0.4503 -0.0264 0.0375  -0.0114 332 ARG A N     
3387 C  CA    . ARG E 333 ? 0.3649 0.3286 0.4209 -0.0105 0.0429  -0.0059 332 ARG A CA    
3388 C  C     . ARG E 333 ? 0.3473 0.3153 0.3988 -0.0001 0.0385  -0.0094 332 ARG A C     
3389 O  O     . ARG E 333 ? 0.3618 0.3051 0.3978 0.0071  0.0421  -0.0050 332 ARG A O     
3390 C  CB    . ARG E 333 ? 0.3675 0.3393 0.4308 -0.0103 0.0387  -0.0102 332 ARG A CB    
3391 C  CG    . ARG E 333 ? 0.4068 0.3692 0.4502 0.0071  0.0520  -0.0147 332 ARG A CG    
3392 C  CD    . ARG E 333 ? 0.4493 0.4306 0.4697 0.0327  0.0629  -0.0629 332 ARG A CD    
3393 N  NE    . ARG E 333 ? 0.4687 0.4720 0.5288 0.0491  0.0504  -0.0936 332 ARG A NE    
3394 C  CZ    . ARG E 333 ? 0.4614 0.4749 0.5667 0.0603  0.0485  -0.1105 332 ARG A CZ    
3395 N  NH1   . ARG E 333 ? 0.4948 0.4536 0.5680 0.0362  0.0243  -0.1102 332 ARG A NH1   
3396 N  NH2   . ARG E 333 ? 0.4635 0.4679 0.5543 0.0960  0.0447  -0.1169 332 ARG A NH2   
3397 N  N     . ILE E 334 ? 0.3154 0.2664 0.3663 0.0077  0.0430  0.0002  333 ILE A N     
3398 C  CA    . ILE E 334 ? 0.2921 0.2349 0.3463 0.0014  0.0412  0.0047  333 ILE A CA    
3399 C  C     . ILE E 334 ? 0.3033 0.2231 0.3436 0.0070  0.0303  0.0061  333 ILE A C     
3400 O  O     . ILE E 334 ? 0.3088 0.2018 0.3345 0.0083  0.0344  0.0162  333 ILE A O     
3401 C  CB    . ILE E 334 ? 0.2731 0.2328 0.3375 -0.0045 0.0462  0.0120  333 ILE A CB    
3402 C  CG1   . ILE E 334 ? 0.2425 0.1763 0.3267 0.0073  0.0539  -0.0090 333 ILE A CG1   
3403 C  CG2   . ILE E 334 ? 0.2349 0.2262 0.3131 -0.0328 0.0534  0.0243  333 ILE A CG2   
3404 C  CD1   . ILE E 334 ? 0.0860 0.0525 0.2975 0.0125  0.1079  0.0351  333 ILE A CD1   
3405 N  N     . GLY E 335 ? 0.3022 0.2181 0.3385 -0.0028 0.0280  0.0102  334 GLY A N     
3406 C  CA    . GLY E 335 ? 0.3132 0.2239 0.3499 -0.0150 0.0215  0.0197  334 GLY A CA    
3407 C  C     . GLY E 335 ? 0.3224 0.2316 0.3611 -0.0203 0.0057  0.0202  334 GLY A C     
3408 O  O     . GLY E 335 ? 0.3246 0.2132 0.3782 -0.0215 0.0010  0.0299  334 GLY A O     
3409 N  N     . VAL E 336 ? 0.3122 0.2337 0.3473 -0.0355 0.0018  0.0183  335 VAL A N     
3410 C  CA    . VAL E 336 ? 0.3058 0.2376 0.3194 -0.0424 0.0006  0.0193  335 VAL A CA    
3411 C  C     . VAL E 336 ? 0.3036 0.2350 0.3091 -0.0423 -0.0009 0.0177  335 VAL A C     
3412 O  O     . VAL E 336 ? 0.3014 0.2057 0.2848 -0.0567 0.0102  0.0215  335 VAL A O     
3413 C  CB    . VAL E 336 ? 0.3094 0.2257 0.3228 -0.0441 -0.0024 0.0241  335 VAL A CB    
3414 C  CG1   . VAL E 336 ? 0.2832 0.2490 0.3045 -0.0699 0.0039  0.0151  335 VAL A CG1   
3415 C  CG2   . VAL E 336 ? 0.3091 0.2358 0.3195 -0.0371 0.0007  0.0204  335 VAL A CG2   
3416 N  N     . ARG E 337 ? 0.2956 0.2423 0.3069 -0.0435 0.0014  0.0145  336 ARG A N     
3417 C  CA    . ARG E 337 ? 0.2993 0.2482 0.3075 -0.0406 -0.0013 0.0095  336 ARG A CA    
3418 C  C     . ARG E 337 ? 0.2852 0.2379 0.2879 -0.0422 0.0051  0.0088  336 ARG A C     
3419 O  O     . ARG E 337 ? 0.2679 0.2297 0.2659 -0.0442 0.0156  -0.0019 336 ARG A O     
3420 C  CB    . ARG E 337 ? 0.3143 0.2650 0.3296 -0.0414 -0.0051 -0.0001 336 ARG A CB    
3421 C  CG    . ARG E 337 ? 0.3335 0.2798 0.3983 -0.0279 -0.0011 -0.0040 336 ARG A CG    
3422 C  CD    . ARG E 337 ? 0.4357 0.3025 0.4276 -0.0512 -0.0009 -0.0036 336 ARG A CD    
3423 N  NE    . ARG E 337 ? 0.4878 0.3162 0.4612 -0.0419 0.0020  0.0285  336 ARG A NE    
3424 C  CZ    . ARG E 337 ? 0.5153 0.3172 0.4996 -0.0348 0.0080  0.0354  336 ARG A CZ    
3425 N  NH1   . ARG E 337 ? 0.5336 0.3372 0.5289 -0.0372 0.0368  0.0081  336 ARG A NH1   
3426 N  NH2   . ARG E 337 ? 0.5304 0.2818 0.4823 -0.0446 -0.0062 0.0379  336 ARG A NH2   
3427 N  N     . PHE E 338 ? 0.2824 0.2265 0.2757 -0.0516 0.0067  0.0168  337 PHE A N     
3428 C  CA    . PHE E 338 ? 0.2827 0.2261 0.2839 -0.0519 0.0056  0.0139  337 PHE A CA    
3429 C  C     . PHE E 338 ? 0.2829 0.2183 0.2953 -0.0514 0.0080  0.0133  337 PHE A C     
3430 O  O     . PHE E 338 ? 0.3013 0.2173 0.3187 -0.0615 0.0047  0.0071  337 PHE A O     
3431 C  CB    . PHE E 338 ? 0.2848 0.2342 0.2735 -0.0538 0.0086  0.0150  337 PHE A CB    
3432 C  CG    . PHE E 338 ? 0.2701 0.2496 0.2525 -0.0687 0.0167  0.0242  337 PHE A CG    
3433 C  CD1   . PHE E 338 ? 0.2526 0.2221 0.2166 -0.0926 0.0227  0.0398  337 PHE A CD1   
3434 C  CD2   . PHE E 338 ? 0.2745 0.2411 0.2208 -0.1006 0.0136  0.0262  337 PHE A CD2   
3435 C  CE1   . PHE E 338 ? 0.3073 0.2542 0.1951 -0.0877 0.0156  0.0319  337 PHE A CE1   
3436 C  CE2   . PHE E 338 ? 0.3072 0.2310 0.2102 -0.0874 -0.0009 0.0228  337 PHE A CE2   
3437 C  CZ    . PHE E 338 ? 0.3397 0.2556 0.2322 -0.0895 0.0182  0.0245  337 PHE A CZ    
3438 N  N     . SER E 339 ? 0.2834 0.2087 0.2929 -0.0476 0.0154  0.0231  338 SER A N     
3439 C  CA    . SER E 339 ? 0.2963 0.2035 0.3084 -0.0385 0.0297  0.0213  338 SER A CA    
3440 C  C     . SER E 339 ? 0.3110 0.2224 0.3181 -0.0388 0.0358  0.0275  338 SER A C     
3441 O  O     . SER E 339 ? 0.3107 0.2055 0.3224 -0.0483 0.0362  0.0431  338 SER A O     
3442 C  CB    . SER E 339 ? 0.2882 0.1864 0.3007 -0.0339 0.0300  0.0136  338 SER A CB    
3443 O  OG    . SER E 339 ? 0.2926 0.1526 0.2983 -0.0193 0.0518  -0.0074 338 SER A OG    
3444 N  N     . LYS E 340 ? 0.3240 0.2525 0.3254 -0.0349 0.0430  0.0313  339 LYS A N     
3445 C  CA    . LYS E 340 ? 0.3356 0.2826 0.3461 -0.0316 0.0429  0.0221  339 LYS A CA    
3446 C  C     . LYS E 340 ? 0.3361 0.3016 0.3445 -0.0271 0.0471  0.0140  339 LYS A C     
3447 O  O     . LYS E 340 ? 0.3351 0.3247 0.3521 -0.0275 0.0558  0.0124  339 LYS A O     
3448 C  CB    . LYS E 340 ? 0.3392 0.2907 0.3338 -0.0298 0.0366  0.0243  339 LYS A CB    
3449 C  CG    . LYS E 340 ? 0.3564 0.3090 0.3560 -0.0411 0.0277  0.0354  339 LYS A CG    
3450 C  CD    . LYS E 340 ? 0.3796 0.3034 0.3892 -0.0331 0.0058  0.0250  339 LYS A CD    
3451 C  CE    . LYS E 340 ? 0.4190 0.3374 0.4197 -0.0509 -0.0091 0.0241  339 LYS A CE    
3452 N  NZ    . LYS E 340 ? 0.4343 0.2870 0.4276 -0.0458 -0.0402 0.0127  339 LYS A NZ    
3453 N  N     . PHE E 341 ? 0.3439 0.3166 0.3585 -0.0213 0.0527  0.0133  340 PHE A N     
3454 C  CA    . PHE E 341 ? 0.3585 0.3402 0.3917 -0.0185 0.0540  0.0064  340 PHE A CA    
3455 C  C     . PHE E 341 ? 0.3747 0.3607 0.4052 -0.0189 0.0494  0.0015  340 PHE A C     
3456 O  O     . PHE E 341 ? 0.3697 0.3634 0.4030 -0.0136 0.0579  -0.0060 340 PHE A O     
3457 C  CB    . PHE E 341 ? 0.3434 0.3370 0.3917 -0.0150 0.0553  0.0115  340 PHE A CB    
3458 C  CG    . PHE E 341 ? 0.3634 0.3116 0.4115 0.0035  0.0692  0.0050  340 PHE A CG    
3459 C  CD1   . PHE E 341 ? 0.3760 0.3133 0.4213 -0.0039 0.0872  0.0003  340 PHE A CD1   
3460 C  CD2   . PHE E 341 ? 0.3724 0.3546 0.4394 -0.0117 0.0840  -0.0189 340 PHE A CD2   
3461 C  CE1   . PHE E 341 ? 0.3784 0.3335 0.4474 0.0026  0.1046  -0.0233 340 PHE A CE1   
3462 C  CE2   . PHE E 341 ? 0.3809 0.3272 0.4412 -0.0191 0.1019  -0.0010 340 PHE A CE2   
3463 C  CZ    . PHE E 341 ? 0.3982 0.3265 0.4454 -0.0109 0.0971  -0.0234 340 PHE A CZ    
3464 N  N     . ILE E 342 ? 0.4007 0.3863 0.4273 -0.0171 0.0423  -0.0103 341 ILE A N     
3465 C  CA    . ILE E 342 ? 0.4219 0.4135 0.4509 -0.0150 0.0376  -0.0148 341 ILE A CA    
3466 C  C     . ILE E 342 ? 0.4379 0.4265 0.4581 -0.0130 0.0340  -0.0112 341 ILE A C     
3467 O  O     . ILE E 342 ? 0.4588 0.4368 0.4711 -0.0109 0.0242  -0.0103 341 ILE A O     
3468 C  CB    . ILE E 342 ? 0.4180 0.4137 0.4570 -0.0119 0.0342  -0.0189 341 ILE A CB    
3469 C  CG1   . ILE E 342 ? 0.4211 0.4277 0.4696 -0.0076 0.0373  -0.0363 341 ILE A CG1   
3470 C  CG2   . ILE E 342 ? 0.4232 0.4174 0.4504 -0.0176 0.0397  -0.0218 341 ILE A CG2   
3471 C  CD1   . ILE E 342 ? 0.4053 0.4242 0.4940 -0.0124 0.0338  -0.0185 341 ILE A CD1   
3472 O  OXT   . ILE E 342 ? 0.4520 0.4393 0.4709 -0.0170 0.0343  -0.0073 341 ILE A OXT   
3473 N  N     . MET F 2   ? 0.4442 0.5385 0.4496 -0.0011 -0.0247 0.0185  1   MET B N     
3474 C  CA    . MET F 2   ? 0.4236 0.5147 0.4349 -0.0015 -0.0250 0.0255  1   MET B CA    
3475 C  C     . MET F 2   ? 0.4101 0.4880 0.4113 0.0046  -0.0195 0.0225  1   MET B C     
3476 O  O     . MET F 2   ? 0.4021 0.4915 0.4089 0.0094  -0.0215 0.0347  1   MET B O     
3477 C  CB    . MET F 2   ? 0.4365 0.5313 0.4495 -0.0038 -0.0303 0.0292  1   MET B CB    
3478 C  CG    . MET F 2   ? 0.4622 0.5629 0.4682 -0.0005 -0.0226 0.0223  1   MET B CG    
3479 S  SD    . MET F 2   ? 0.5795 0.6534 0.5614 0.0128  -0.0284 0.0786  1   MET B SD    
3480 C  CE    . MET F 2   ? 0.5257 0.6303 0.5084 0.0111  -0.0446 0.0398  1   MET B CE    
3481 N  N     . ILE F 3   ? 0.3848 0.4543 0.3785 0.0051  -0.0190 0.0066  2   ILE B N     
3482 C  CA    . ILE F 3   ? 0.3692 0.4157 0.3476 0.0032  -0.0093 -0.0078 2   ILE B CA    
3483 C  C     . ILE F 3   ? 0.3538 0.4012 0.3368 -0.0013 -0.0143 -0.0163 2   ILE B C     
3484 O  O     . ILE F 3   ? 0.3710 0.4034 0.3302 0.0005  -0.0108 -0.0184 2   ILE B O     
3485 C  CB    . ILE F 3   ? 0.3586 0.4059 0.3448 0.0096  -0.0128 -0.0060 2   ILE B CB    
3486 C  CG1   . ILE F 3   ? 0.3483 0.3934 0.3183 0.0035  -0.0031 0.0001  2   ILE B CG1   
3487 C  CG2   . ILE F 3   ? 0.3630 0.3916 0.3472 -0.0043 -0.0147 -0.0207 2   ILE B CG2   
3488 C  CD1   . ILE F 3   ? 0.3131 0.3524 0.2884 0.0080  0.0114  -0.0298 2   ILE B CD1   
3489 N  N     . VAL F 4   ? 0.3314 0.3818 0.3199 -0.0004 -0.0155 -0.0244 3   VAL B N     
3490 C  CA    . VAL F 4   ? 0.3074 0.3708 0.2980 -0.0002 -0.0278 -0.0248 3   VAL B CA    
3491 C  C     . VAL F 4   ? 0.2949 0.3629 0.2823 0.0009  -0.0220 -0.0319 3   VAL B C     
3492 O  O     . VAL F 4   ? 0.2977 0.3676 0.2856 0.0024  -0.0245 -0.0328 3   VAL B O     
3493 C  CB    . VAL F 4   ? 0.3150 0.3714 0.3023 0.0078  -0.0330 -0.0242 3   VAL B CB    
3494 C  CG1   . VAL F 4   ? 0.2979 0.3646 0.2736 0.0098  -0.0509 -0.0309 3   VAL B CG1   
3495 C  CG2   . VAL F 4   ? 0.2592 0.3664 0.2943 -0.0224 -0.0409 -0.0220 3   VAL B CG2   
3496 N  N     . LEU F 5   ? 0.2747 0.3449 0.2708 0.0012  -0.0263 -0.0466 4   LEU B N     
3497 C  CA    . LEU F 5   ? 0.2565 0.3238 0.2449 -0.0104 -0.0258 -0.0569 4   LEU B CA    
3498 C  C     . LEU F 5   ? 0.2428 0.3239 0.2450 -0.0123 -0.0242 -0.0563 4   LEU B C     
3499 O  O     . LEU F 5   ? 0.2186 0.3194 0.2301 -0.0162 -0.0289 -0.0649 4   LEU B O     
3500 C  CB    . LEU F 5   ? 0.2558 0.3175 0.2403 -0.0156 -0.0322 -0.0559 4   LEU B CB    
3501 C  CG    . LEU F 5   ? 0.2544 0.3109 0.2244 -0.0246 -0.0265 -0.0609 4   LEU B CG    
3502 C  CD1   . LEU F 5   ? 0.2022 0.3076 0.1228 -0.0142 -0.0713 -0.0517 4   LEU B CD1   
3503 C  CD2   . LEU F 5   ? 0.2258 0.3154 0.1931 -0.0530 -0.0169 -0.0676 4   LEU B CD2   
3504 N  N     . PHE F 6   ? 0.2365 0.3201 0.2247 -0.0116 -0.0197 -0.0561 5   PHE B N     
3505 C  CA    . PHE F 6   ? 0.2187 0.3010 0.2070 -0.0124 -0.0254 -0.0423 5   PHE B CA    
3506 C  C     . PHE F 6   ? 0.2185 0.2980 0.1950 -0.0046 -0.0202 -0.0372 5   PHE B C     
3507 O  O     . PHE F 6   ? 0.2299 0.3314 0.2032 -0.0024 -0.0224 -0.0373 5   PHE B O     
3508 C  CB    . PHE F 6   ? 0.2093 0.2968 0.2021 -0.0116 -0.0249 -0.0447 5   PHE B CB    
3509 C  CG    . PHE F 6   ? 0.2275 0.3171 0.2062 -0.0198 -0.0330 -0.0427 5   PHE B CG    
3510 C  CD1   . PHE F 6   ? 0.2150 0.2888 0.1860 -0.0281 -0.0272 -0.0616 5   PHE B CD1   
3511 C  CD2   . PHE F 6   ? 0.2421 0.3026 0.2088 -0.0455 -0.0140 -0.0530 5   PHE B CD2   
3512 C  CE1   . PHE F 6   ? 0.2307 0.2816 0.1947 -0.0405 -0.0199 -0.0635 5   PHE B CE1   
3513 C  CE2   . PHE F 6   ? 0.2458 0.3119 0.1892 -0.0323 -0.0100 -0.0486 5   PHE B CE2   
3514 C  CZ    . PHE F 6   ? 0.2347 0.3313 0.1877 -0.0109 -0.0132 -0.0647 5   PHE B CZ    
3515 N  N     . VAL F 7   ? 0.2191 0.2798 0.1766 0.0010  -0.0250 -0.0312 6   VAL B N     
3516 C  CA    . VAL F 7   ? 0.1969 0.2808 0.1665 0.0101  -0.0322 -0.0267 6   VAL B CA    
3517 C  C     . VAL F 7   ? 0.1953 0.2819 0.1630 0.0166  -0.0371 -0.0292 6   VAL B C     
3518 O  O     . VAL F 7   ? 0.2236 0.2982 0.1587 0.0295  -0.0288 -0.0405 6   VAL B O     
3519 C  CB    . VAL F 7   ? 0.1968 0.2779 0.1543 0.0110  -0.0349 -0.0297 6   VAL B CB    
3520 C  CG1   . VAL F 7   ? 0.1541 0.2923 0.1643 -0.0001 -0.0005 -0.0382 6   VAL B CG1   
3521 C  CG2   . VAL F 7   ? 0.2088 0.2696 0.1729 0.0011  -0.0414 0.0000  6   VAL B CG2   
3522 N  N     . ASP F 8   ? 0.2021 0.2844 0.1763 0.0243  -0.0406 -0.0207 7   ASP B N     
3523 C  CA    . ASP F 8   ? 0.2041 0.2962 0.1726 0.0348  -0.0458 -0.0209 7   ASP B CA    
3524 C  C     . ASP F 8   ? 0.1969 0.2922 0.1637 0.0417  -0.0395 -0.0198 7   ASP B C     
3525 O  O     . ASP F 8   ? 0.2019 0.3112 0.1598 0.0559  -0.0516 -0.0312 7   ASP B O     
3526 C  CB    . ASP F 8   ? 0.1797 0.2945 0.1744 0.0225  -0.0567 -0.0077 7   ASP B CB    
3527 C  CG    . ASP F 8   ? 0.2072 0.3323 0.1953 0.0294  -0.0586 -0.0016 7   ASP B CG    
3528 O  OD1   . ASP F 8   ? 0.2478 0.4074 0.1812 0.0738  -0.1084 0.0099  7   ASP B OD1   
3529 O  OD2   . ASP F 8   ? 0.2110 0.4358 0.1966 0.0051  -0.0908 -0.0102 7   ASP B OD2   
3530 N  N     . PHE F 9   ? 0.1817 0.2534 0.1678 0.0467  -0.0230 -0.0190 8   PHE B N     
3531 C  CA    . PHE F 9   ? 0.1597 0.2318 0.1656 0.0383  -0.0044 -0.0055 8   PHE B CA    
3532 C  C     . PHE F 9   ? 0.1625 0.2324 0.1796 0.0307  0.0031  0.0081  8   PHE B C     
3533 O  O     . PHE F 9   ? 0.1585 0.2530 0.2031 0.0377  0.0125  0.0051  8   PHE B O     
3534 C  CB    . PHE F 9   ? 0.1630 0.2221 0.1718 0.0399  -0.0014 0.0084  8   PHE B CB    
3535 C  CG    . PHE F 9   ? 0.1566 0.1832 0.1571 0.0296  0.0112  0.0016  8   PHE B CG    
3536 C  CD1   . PHE F 9   ? 0.1447 0.1920 0.1483 0.0498  0.0349  -0.0074 8   PHE B CD1   
3537 C  CD2   . PHE F 9   ? 0.1418 0.1873 0.1752 0.0379  0.0211  0.0217  8   PHE B CD2   
3538 C  CE1   . PHE F 9   ? 0.1510 0.1169 0.1402 0.0084  0.0663  0.0508  8   PHE B CE1   
3539 C  CE2   . PHE F 9   ? 0.1811 0.1458 0.1369 0.0324  0.0267  0.0186  8   PHE B CE2   
3540 C  CZ    . PHE F 9   ? 0.1827 0.0845 0.1523 0.0111  0.0412  0.0555  8   PHE B CZ    
3541 N  N     . ASP F 10  ? 0.1608 0.2327 0.1634 0.0047  0.0005  0.0151  9   ASP B N     
3542 C  CA    . ASP F 10  ? 0.1567 0.2366 0.1472 -0.0063 0.0079  0.0206  9   ASP B CA    
3543 C  C     . ASP F 10  ? 0.1455 0.2342 0.1485 -0.0133 0.0085  0.0324  9   ASP B C     
3544 O  O     . ASP F 10  ? 0.1120 0.2318 0.1338 -0.0137 0.0120  0.0262  9   ASP B O     
3545 C  CB    . ASP F 10  ? 0.1702 0.2447 0.1547 0.0012  0.0094  0.0156  9   ASP B CB    
3546 C  CG    . ASP F 10  ? 0.2109 0.2643 0.1793 -0.0069 0.0141  0.0231  9   ASP B CG    
3547 O  OD1   . ASP F 10  ? 0.1717 0.3164 0.1686 -0.0507 0.0246  -0.0311 9   ASP B OD1   
3548 O  OD2   . ASP F 10  ? 0.2476 0.2354 0.2677 -0.0074 0.0643  0.0346  9   ASP B OD2   
3549 N  N     . TYR F 11  ? 0.1393 0.2373 0.1447 -0.0312 0.0032  0.0427  10  TYR B N     
3550 C  CA    . TYR F 11  ? 0.1268 0.2364 0.1418 -0.0445 -0.0048 0.0533  10  TYR B CA    
3551 C  C     . TYR F 11  ? 0.1089 0.2287 0.1408 -0.0513 -0.0108 0.0545  10  TYR B C     
3552 O  O     . TYR F 11  ? 0.0853 0.2253 0.1280 -0.0620 -0.0305 0.0803  10  TYR B O     
3553 C  CB    . TYR F 11  ? 0.1374 0.2527 0.1650 -0.0496 -0.0127 0.0585  10  TYR B CB    
3554 C  CG    . TYR F 11  ? 0.1797 0.2556 0.1901 -0.0368 0.0020  0.0628  10  TYR B CG    
3555 C  CD1   . TYR F 11  ? 0.1979 0.2765 0.1934 -0.0182 -0.0130 0.0472  10  TYR B CD1   
3556 C  CD2   . TYR F 11  ? 0.2060 0.2914 0.2186 0.0054  0.0175  0.0466  10  TYR B CD2   
3557 C  CE1   . TYR F 11  ? 0.2327 0.3059 0.2004 0.0197  -0.0135 0.0607  10  TYR B CE1   
3558 C  CE2   . TYR F 11  ? 0.2260 0.3132 0.2089 0.0103  -0.0125 0.0634  10  TYR B CE2   
3559 C  CZ    . TYR F 11  ? 0.2626 0.3176 0.2284 0.0322  -0.0032 0.0697  10  TYR B CZ    
3560 O  OH    . TYR F 11  ? 0.3499 0.3541 0.2370 0.0572  0.0013  0.0954  10  TYR B OH    
3561 N  N     . PHE F 12  ? 0.0825 0.2101 0.1200 -0.0492 -0.0206 0.0549  11  PHE B N     
3562 C  CA    . PHE F 12  ? 0.0755 0.2086 0.1119 -0.0371 -0.0085 0.0530  11  PHE B CA    
3563 C  C     . PHE F 12  ? 0.0760 0.2052 0.1161 -0.0393 -0.0039 0.0497  11  PHE B C     
3564 O  O     . PHE F 12  ? 0.0682 0.2132 0.1397 -0.0477 0.0107  0.0365  11  PHE B O     
3565 C  CB    . PHE F 12  ? 0.0884 0.2074 0.1308 -0.0466 0.0067  0.0560  11  PHE B CB    
3566 C  CG    . PHE F 12  ? 0.0935 0.2074 0.0911 -0.0198 0.0159  0.0729  11  PHE B CG    
3567 C  CD1   . PHE F 12  ? 0.1326 0.2406 0.1038 -0.0246 -0.0053 0.1085  11  PHE B CD1   
3568 C  CD2   . PHE F 12  ? 0.0781 0.2067 0.1009 -0.0005 0.0249  0.0735  11  PHE B CD2   
3569 C  CE1   . PHE F 12  ? 0.0492 0.2425 0.1622 -0.0223 0.0309  0.1090  11  PHE B CE1   
3570 C  CE2   . PHE F 12  ? 0.0991 0.1778 0.1369 0.0010  0.0161  0.0964  11  PHE B CE2   
3571 C  CZ    . PHE F 12  ? 0.0975 0.1970 0.1160 0.0092  0.0453  0.1089  11  PHE B CZ    
3572 N  N     . TYR F 13  ? 0.0910 0.2130 0.1137 -0.0302 -0.0128 0.0401  12  TYR B N     
3573 C  CA    . TYR F 13  ? 0.1015 0.2198 0.1240 -0.0253 -0.0175 0.0263  12  TYR B CA    
3574 C  C     . TYR F 13  ? 0.1006 0.2324 0.1297 -0.0320 -0.0150 0.0209  12  TYR B C     
3575 O  O     . TYR F 13  ? 0.0942 0.2381 0.1378 -0.0250 -0.0090 -0.0002 12  TYR B O     
3576 C  CB    . TYR F 13  ? 0.0993 0.2061 0.1205 -0.0289 -0.0160 0.0151  12  TYR B CB    
3577 C  CG    . TYR F 13  ? 0.1105 0.1898 0.1549 -0.0186 -0.0643 0.0099  12  TYR B CG    
3578 C  CD1   . TYR F 13  ? 0.1191 0.1989 0.2501 -0.0103 -0.1121 0.0041  12  TYR B CD1   
3579 C  CD2   . TYR F 13  ? 0.1189 0.1769 0.2084 -0.0306 -0.1057 -0.0029 12  TYR B CD2   
3580 C  CE1   . TYR F 13  ? 0.1418 0.2043 0.3028 -0.0198 -0.1515 -0.0005 12  TYR B CE1   
3581 C  CE2   . TYR F 13  ? 0.1205 0.1701 0.2871 -0.0024 -0.1567 0.0281  12  TYR B CE2   
3582 C  CZ    . TYR F 13  ? 0.1284 0.1751 0.3191 -0.0102 -0.1662 0.0088  12  TYR B CZ    
3583 O  OH    . TYR F 13  ? 0.0886 0.2497 0.3599 -0.0268 -0.1352 -0.0414 12  TYR B OH    
3584 N  N     . ALA F 14  ? 0.1220 0.2423 0.1357 -0.0334 -0.0148 0.0226  13  ALA B N     
3585 C  CA    . ALA F 14  ? 0.1331 0.2480 0.1242 -0.0274 -0.0162 0.0173  13  ALA B CA    
3586 C  C     . ALA F 14  ? 0.1510 0.2559 0.1099 -0.0250 -0.0215 0.0174  13  ALA B C     
3587 O  O     . ALA F 14  ? 0.1632 0.2805 0.1343 -0.0278 -0.0316 0.0057  13  ALA B O     
3588 C  CB    . ALA F 14  ? 0.1355 0.2455 0.1158 -0.0354 -0.0178 -0.0002 13  ALA B CB    
3589 N  N     . GLN F 15  ? 0.1552 0.2365 0.0877 -0.0292 -0.0208 0.0133  14  GLN B N     
3590 C  CA    . GLN F 15  ? 0.1687 0.2363 0.0935 -0.0235 -0.0215 0.0125  14  GLN B CA    
3591 C  C     . GLN F 15  ? 0.1719 0.2268 0.0953 -0.0367 -0.0097 0.0110  14  GLN B C     
3592 O  O     . GLN F 15  ? 0.1569 0.2154 0.0767 -0.0608 -0.0050 0.0165  14  GLN B O     
3593 C  CB    . GLN F 15  ? 0.1876 0.2468 0.0953 -0.0072 -0.0182 0.0199  14  GLN B CB    
3594 C  CG    . GLN F 15  ? 0.2253 0.2750 0.1247 0.0019  -0.0422 0.0257  14  GLN B CG    
3595 C  CD    . GLN F 15  ? 0.2400 0.2804 0.1473 0.0338  -0.0498 0.0348  14  GLN B CD    
3596 O  OE1   . GLN F 15  ? 0.2623 0.3596 0.1521 -0.0164 -0.0710 0.0201  14  GLN B OE1   
3597 N  NE2   . GLN F 15  ? 0.1325 0.2954 0.1197 0.0753  -0.0593 0.0739  14  GLN B NE2   
3598 N  N     . VAL F 16  ? 0.1945 0.2281 0.1127 -0.0346 0.0023  0.0094  15  VAL B N     
3599 C  CA    . VAL F 16  ? 0.2259 0.2343 0.1358 -0.0343 0.0072  0.0143  15  VAL B CA    
3600 C  C     . VAL F 16  ? 0.2442 0.2393 0.1438 -0.0328 0.0139  0.0153  15  VAL B C     
3601 O  O     . VAL F 16  ? 0.2655 0.2333 0.1342 -0.0462 0.0308  0.0242  15  VAL B O     
3602 C  CB    . VAL F 16  ? 0.2370 0.2335 0.1382 -0.0325 0.0137  0.0080  15  VAL B CB    
3603 C  CG1   . VAL F 16  ? 0.2288 0.2222 0.1319 -0.0368 0.0445  0.0011  15  VAL B CG1   
3604 C  CG2   . VAL F 16  ? 0.2292 0.2295 0.1530 -0.0449 -0.0218 0.0229  15  VAL B CG2   
3605 N  N     . GLU F 17  ? 0.2463 0.2424 0.1653 -0.0244 0.0163  0.0153  16  GLU B N     
3606 C  CA    . GLU F 17  ? 0.2478 0.2538 0.1607 -0.0208 0.0185  0.0125  16  GLU B CA    
3607 C  C     . GLU F 17  ? 0.2550 0.2611 0.1773 -0.0163 0.0233  0.0071  16  GLU B C     
3608 O  O     . GLU F 17  ? 0.2757 0.2745 0.1968 -0.0190 0.0244  0.0039  16  GLU B O     
3609 C  CB    . GLU F 17  ? 0.2447 0.2680 0.1512 -0.0206 0.0199  0.0139  16  GLU B CB    
3610 C  CG    . GLU F 17  ? 0.2621 0.2710 0.1945 -0.0137 0.0263  0.0431  16  GLU B CG    
3611 C  CD    . GLU F 17  ? 0.3005 0.3468 0.2526 0.0106  0.0190  0.0408  16  GLU B CD    
3612 O  OE1   . GLU F 17  ? 0.3695 0.3709 0.2805 0.0109  0.0176  0.0565  16  GLU B OE1   
3613 O  OE2   . GLU F 17  ? 0.2925 0.3796 0.3359 0.0027  -0.0148 0.0883  16  GLU B OE2   
3614 N  N     . GLU F 18  ? 0.2405 0.2639 0.1888 -0.0187 0.0400  0.0077  17  GLU B N     
3615 C  CA    . GLU F 18  ? 0.2272 0.2675 0.1953 -0.0106 0.0441  0.0125  17  GLU B CA    
3616 C  C     . GLU F 18  ? 0.2296 0.2604 0.2040 -0.0007 0.0358  0.0089  17  GLU B C     
3617 O  O     . GLU F 18  ? 0.2283 0.2650 0.2329 -0.0074 0.0477  0.0101  17  GLU B O     
3618 C  CB    . GLU F 18  ? 0.2510 0.2669 0.2129 -0.0044 0.0424  -0.0074 17  GLU B CB    
3619 C  CG    . GLU F 18  ? 0.2563 0.3196 0.2276 -0.0070 0.0793  0.0028  17  GLU B CG    
3620 C  CD    . GLU F 18  ? 0.3139 0.3741 0.2793 0.0269  0.0883  -0.0102 17  GLU B CD    
3621 O  OE1   . GLU F 18  ? 0.2936 0.3700 0.2819 0.0434  0.0794  0.0108  17  GLU B OE1   
3622 O  OE2   . GLU F 18  ? 0.3129 0.3641 0.3262 0.0407  0.1154  -0.0200 17  GLU B OE2   
3623 N  N     . VAL F 19  ? 0.2302 0.2465 0.1943 0.0008  0.0293  0.0120  18  VAL B N     
3624 C  CA    . VAL F 19  ? 0.2205 0.2428 0.1829 0.0093  0.0270  0.0240  18  VAL B CA    
3625 C  C     . VAL F 19  ? 0.2461 0.2602 0.2057 0.0133  0.0252  0.0202  18  VAL B C     
3626 O  O     . VAL F 19  ? 0.2584 0.2711 0.2242 0.0181  0.0299  0.0199  18  VAL B O     
3627 C  CB    . VAL F 19  ? 0.2174 0.2379 0.1833 0.0120  0.0286  0.0210  18  VAL B CB    
3628 C  CG1   . VAL F 19  ? 0.1698 0.2020 0.1145 0.0337  0.0130  0.0461  18  VAL B CG1   
3629 C  CG2   . VAL F 19  ? 0.1971 0.2121 0.1192 0.0034  0.0360  0.0478  18  VAL B CG2   
3630 N  N     . LEU F 20  ? 0.2631 0.2777 0.2247 0.0100  0.0248  0.0273  19  LEU B N     
3631 C  CA    . LEU F 20  ? 0.2771 0.2866 0.2270 0.0105  0.0256  0.0231  19  LEU B CA    
3632 C  C     . LEU F 20  ? 0.2810 0.2940 0.2243 0.0100  0.0207  0.0312  19  LEU B C     
3633 O  O     . LEU F 20  ? 0.2843 0.2951 0.2374 0.0118  0.0235  0.0458  19  LEU B O     
3634 C  CB    . LEU F 20  ? 0.2713 0.2870 0.2199 0.0091  0.0299  0.0315  19  LEU B CB    
3635 C  CG    . LEU F 20  ? 0.2901 0.2947 0.2421 0.0083  0.0140  0.0143  19  LEU B CG    
3636 C  CD1   . LEU F 20  ? 0.3165 0.2891 0.3005 0.0049  0.0045  -0.0039 19  LEU B CD1   
3637 C  CD2   . LEU F 20  ? 0.2870 0.2783 0.2031 -0.0009 0.0514  0.0603  19  LEU B CD2   
3638 N  N     . ASN F 21  ? 0.2906 0.3078 0.2420 0.0105  0.0192  0.0263  20  ASN B N     
3639 C  CA    . ASN F 21  ? 0.3138 0.3279 0.2555 -0.0006 0.0131  0.0280  20  ASN B CA    
3640 C  C     . ASN F 21  ? 0.3207 0.3385 0.2807 -0.0040 0.0084  0.0336  20  ASN B C     
3641 O  O     . ASN F 21  ? 0.3342 0.3566 0.2723 -0.0089 0.0062  0.0442  20  ASN B O     
3642 C  CB    . ASN F 21  ? 0.3232 0.3209 0.2520 0.0032  0.0082  0.0269  20  ASN B CB    
3643 C  CG    . ASN F 21  ? 0.3553 0.3338 0.2444 0.0023  0.0164  0.0284  20  ASN B CG    
3644 O  OD1   . ASN F 21  ? 0.4113 0.3337 0.1910 0.0164  0.0455  0.0662  20  ASN B OD1   
3645 N  ND2   . ASN F 21  ? 0.3924 0.3333 0.2409 0.0206  0.0199  0.0130  20  ASN B ND2   
3646 N  N     . PRO F 22  ? 0.3231 0.3398 0.2996 -0.0059 0.0067  0.0370  21  PRO B N     
3647 C  CA    . PRO F 22  ? 0.3207 0.3459 0.3046 -0.0076 0.0115  0.0300  21  PRO B CA    
3648 C  C     . PRO F 22  ? 0.3224 0.3523 0.3060 -0.0080 0.0029  0.0249  21  PRO B C     
3649 O  O     . PRO F 22  ? 0.3100 0.3742 0.3140 -0.0044 0.0048  0.0255  21  PRO B O     
3650 C  CB    . PRO F 22  ? 0.3233 0.3415 0.3095 -0.0096 0.0119  0.0338  21  PRO B CB    
3651 C  CG    . PRO F 22  ? 0.3225 0.3401 0.3170 -0.0079 0.0139  0.0366  21  PRO B CG    
3652 C  CD    . PRO F 22  ? 0.3193 0.3391 0.2940 -0.0106 0.0120  0.0347  21  PRO B CD    
3653 N  N     . SER F 23  ? 0.3263 0.3431 0.3098 -0.0113 -0.0078 0.0231  22  SER B N     
3654 C  CA    . SER F 23  ? 0.3342 0.3432 0.3048 -0.0143 -0.0107 0.0197  22  SER B CA    
3655 C  C     . SER F 23  ? 0.3415 0.3519 0.3126 -0.0144 -0.0078 0.0210  22  SER B C     
3656 O  O     . SER F 23  ? 0.3657 0.3397 0.3245 -0.0122 -0.0066 0.0252  22  SER B O     
3657 C  CB    . SER F 23  ? 0.3316 0.3374 0.2959 -0.0145 -0.0176 0.0178  22  SER B CB    
3658 O  OG    . SER F 23  ? 0.3094 0.3068 0.2712 -0.0190 -0.0317 0.0000  22  SER B OG    
3659 N  N     . LEU F 24  ? 0.3467 0.3622 0.3108 -0.0116 -0.0085 0.0186  23  LEU B N     
3660 C  CA    . LEU F 24  ? 0.3488 0.3674 0.3276 -0.0133 -0.0035 0.0140  23  LEU B CA    
3661 C  C     . LEU F 24  ? 0.3503 0.3758 0.3493 -0.0113 -0.0046 0.0082  23  LEU B C     
3662 O  O     . LEU F 24  ? 0.3503 0.3838 0.3433 -0.0036 -0.0128 0.0126  23  LEU B O     
3663 C  CB    . LEU F 24  ? 0.3399 0.3543 0.3025 -0.0068 -0.0027 0.0143  23  LEU B CB    
3664 C  CG    . LEU F 24  ? 0.3388 0.3541 0.2784 -0.0110 -0.0014 0.0086  23  LEU B CG    
3665 C  CD1   . LEU F 24  ? 0.3062 0.3367 0.2118 -0.0103 0.0313  -0.0365 23  LEU B CD1   
3666 C  CD2   . LEU F 24  ? 0.3233 0.3396 0.2093 -0.0072 0.0257  0.0154  23  LEU B CD2   
3667 N  N     . LYS F 25  ? 0.3553 0.3815 0.3844 -0.0145 -0.0045 0.0001  24  LYS B N     
3668 C  CA    . LYS F 25  ? 0.3717 0.3919 0.4154 -0.0139 -0.0062 -0.0040 24  LYS B CA    
3669 C  C     . LYS F 25  ? 0.3801 0.3953 0.4156 -0.0142 -0.0046 -0.0070 24  LYS B C     
3670 O  O     . LYS F 25  ? 0.3866 0.4133 0.4377 0.0020  -0.0084 -0.0079 24  LYS B O     
3671 C  CB    . LYS F 25  ? 0.3800 0.3932 0.4361 -0.0123 -0.0003 0.0063  24  LYS B CB    
3672 C  CG    . LYS F 25  ? 0.3889 0.4078 0.4561 -0.0223 -0.0275 -0.0048 24  LYS B CG    
3673 C  CD    . LYS F 25  ? 0.4206 0.4024 0.5012 -0.0249 -0.0093 -0.0077 24  LYS B CD    
3674 C  CE    . LYS F 25  ? 0.4215 0.4084 0.5229 -0.0187 0.0000  -0.0022 24  LYS B CE    
3675 N  NZ    . LYS F 25  ? 0.4507 0.4298 0.5525 -0.0065 0.0262  0.0172  24  LYS B NZ    
3676 N  N     . GLY F 26  ? 0.3806 0.3858 0.4103 -0.0219 -0.0047 -0.0028 25  GLY B N     
3677 C  CA    . GLY F 26  ? 0.3978 0.3797 0.4232 -0.0274 0.0009  -0.0063 25  GLY B CA    
3678 C  C     . GLY F 26  ? 0.3987 0.3740 0.4242 -0.0325 0.0061  -0.0090 25  GLY B C     
3679 O  O     . GLY F 26  ? 0.4111 0.3717 0.4243 -0.0429 0.0162  -0.0054 25  GLY B O     
3680 N  N     . LYS F 27  ? 0.3804 0.3616 0.4091 -0.0317 0.0019  -0.0122 26  LYS B N     
3681 C  CA    . LYS F 27  ? 0.3605 0.3521 0.3839 -0.0315 -0.0100 0.0025  26  LYS B CA    
3682 C  C     . LYS F 27  ? 0.3346 0.3289 0.3627 -0.0325 -0.0060 0.0140  26  LYS B C     
3683 O  O     . LYS F 27  ? 0.3438 0.3125 0.3585 -0.0375 -0.0090 0.0142  26  LYS B O     
3684 C  CB    . LYS F 27  ? 0.3743 0.3614 0.3885 -0.0334 -0.0043 -0.0012 26  LYS B CB    
3685 C  CG    . LYS F 27  ? 0.3646 0.3706 0.3933 -0.0310 -0.0297 0.0072  26  LYS B CG    
3686 C  CD    . LYS F 27  ? 0.3885 0.4091 0.4087 -0.0248 -0.0345 0.0159  26  LYS B CD    
3687 C  CE    . LYS F 27  ? 0.3736 0.4249 0.4736 0.0150  -0.0284 0.0391  26  LYS B CE    
3688 N  NZ    . LYS F 27  ? 0.3127 0.3999 0.4960 0.0305  -0.0020 0.0251  26  LYS B NZ    
3689 N  N     . PRO F 28  ? 0.2999 0.3197 0.3433 -0.0294 -0.0041 0.0172  27  PRO B N     
3690 C  CA    . PRO F 28  ? 0.2763 0.3037 0.3207 -0.0294 0.0004  0.0247  27  PRO B CA    
3691 C  C     . PRO F 28  ? 0.2638 0.2900 0.3047 -0.0286 -0.0021 0.0336  27  PRO B C     
3692 O  O     . PRO F 28  ? 0.2761 0.2809 0.3016 -0.0286 0.0095  0.0396  27  PRO B O     
3693 C  CB    . PRO F 28  ? 0.2755 0.3093 0.3181 -0.0324 0.0055  0.0286  27  PRO B CB    
3694 C  CG    . PRO F 28  ? 0.2847 0.3085 0.3345 -0.0308 -0.0071 0.0232  27  PRO B CG    
3695 C  CD    . PRO F 28  ? 0.2970 0.3193 0.3294 -0.0319 -0.0079 0.0191  27  PRO B CD    
3696 N  N     . VAL F 29  ? 0.2110 0.2695 0.2807 -0.0296 -0.0038 0.0372  28  VAL B N     
3697 C  CA    . VAL F 29  ? 0.1946 0.2631 0.2653 -0.0261 -0.0176 0.0454  28  VAL B CA    
3698 C  C     . VAL F 29  ? 0.1925 0.2620 0.2434 -0.0296 -0.0157 0.0451  28  VAL B C     
3699 O  O     . VAL F 29  ? 0.1641 0.2466 0.2213 -0.0164 -0.0327 0.0507  28  VAL B O     
3700 C  CB    . VAL F 29  ? 0.1991 0.2611 0.2608 -0.0253 -0.0084 0.0526  28  VAL B CB    
3701 C  CG1   . VAL F 29  ? 0.1242 0.2493 0.2710 -0.0236 -0.0419 0.0592  28  VAL B CG1   
3702 C  CG2   . VAL F 29  ? 0.1846 0.2605 0.2749 -0.0140 -0.0306 0.0496  28  VAL B CG2   
3703 N  N     . VAL F 30  ? 0.1802 0.2557 0.2373 -0.0424 -0.0145 0.0372  29  VAL B N     
3704 C  CA    . VAL F 30  ? 0.1784 0.2585 0.2476 -0.0507 -0.0130 0.0314  29  VAL B CA    
3705 C  C     . VAL F 30  ? 0.1983 0.2758 0.2656 -0.0515 -0.0136 0.0294  29  VAL B C     
3706 O  O     . VAL F 30  ? 0.2318 0.2961 0.2805 -0.0647 -0.0287 0.0191  29  VAL B O     
3707 C  CB    . VAL F 30  ? 0.1791 0.2681 0.2559 -0.0428 -0.0197 0.0299  29  VAL B CB    
3708 C  CG1   . VAL F 30  ? 0.1892 0.2538 0.2407 -0.0569 -0.0344 0.0428  29  VAL B CG1   
3709 C  CG2   . VAL F 30  ? 0.1658 0.2630 0.2631 -0.0768 0.0017  0.0316  29  VAL B CG2   
3710 N  N     . VAL F 31  ? 0.1951 0.2804 0.2712 -0.0488 -0.0122 0.0331  30  VAL B N     
3711 C  CA    . VAL F 31  ? 0.1877 0.2843 0.2659 -0.0441 0.0139  0.0374  30  VAL B CA    
3712 C  C     . VAL F 31  ? 0.2088 0.2970 0.3091 -0.0371 0.0121  0.0286  30  VAL B C     
3713 O  O     . VAL F 31  ? 0.2116 0.2972 0.3300 -0.0344 -0.0002 0.0432  30  VAL B O     
3714 C  CB    . VAL F 31  ? 0.1725 0.2799 0.2515 -0.0437 0.0220  0.0402  30  VAL B CB    
3715 C  CG1   . VAL F 31  ? 0.1602 0.2730 0.2135 -0.0373 0.0188  0.0469  30  VAL B CG1   
3716 C  CG2   . VAL F 31  ? 0.1361 0.2703 0.1923 -0.0388 0.0590  0.0338  30  VAL B CG2   
3717 N  N     . CYS F 32  ? 0.2313 0.3073 0.3345 -0.0420 0.0140  0.0207  31  CYS B N     
3718 C  CA    . CYS F 32  ? 0.2649 0.3308 0.3846 -0.0346 0.0125  0.0080  31  CYS B CA    
3719 C  C     . CYS F 32  ? 0.2650 0.3212 0.3762 -0.0406 0.0053  0.0000  31  CYS B C     
3720 O  O     . CYS F 32  ? 0.2802 0.3060 0.3765 -0.0341 0.0035  -0.0067 31  CYS B O     
3721 C  CB    . CYS F 32  ? 0.2673 0.3420 0.3962 -0.0337 0.0093  0.0040  31  CYS B CB    
3722 S  SG    . CYS F 32  ? 0.3406 0.4685 0.5182 -0.0397 0.0448  0.0168  31  CYS B SG    
3723 N  N     . VAL F 33  ? 0.2811 0.3456 0.3856 -0.0352 -0.0074 -0.0020 32  VAL B N     
3724 C  CA    . VAL F 33  ? 0.2969 0.3720 0.4002 -0.0223 -0.0043 0.0022  32  VAL B CA    
3725 C  C     . VAL F 33  ? 0.3303 0.3893 0.4140 -0.0186 -0.0061 0.0025  32  VAL B C     
3726 O  O     . VAL F 33  ? 0.3213 0.4131 0.3974 -0.0152 -0.0117 0.0035  32  VAL B O     
3727 C  CB    . VAL F 33  ? 0.2920 0.3655 0.4109 -0.0179 -0.0040 0.0028  32  VAL B CB    
3728 C  CG1   . VAL F 33  ? 0.2797 0.3776 0.4319 -0.0302 -0.0012 0.0077  32  VAL B CG1   
3729 C  CG2   . VAL F 33  ? 0.2580 0.3549 0.3881 -0.0160 -0.0142 -0.0034 32  VAL B CG2   
3730 N  N     . PHE F 34  ? 0.3744 0.4219 0.4412 -0.0140 -0.0046 0.0063  33  PHE B N     
3731 C  CA    . PHE F 34  ? 0.4170 0.4413 0.4708 -0.0184 -0.0070 0.0052  33  PHE B CA    
3732 C  C     . PHE F 34  ? 0.4524 0.4678 0.4915 -0.0091 -0.0020 0.0053  33  PHE B C     
3733 O  O     . PHE F 34  ? 0.4658 0.4764 0.4888 -0.0127 0.0042  0.0044  33  PHE B O     
3734 C  CB    . PHE F 34  ? 0.4156 0.4362 0.4718 -0.0244 -0.0068 0.0103  33  PHE B CB    
3735 C  CG    . PHE F 34  ? 0.4190 0.4340 0.4905 -0.0287 -0.0201 0.0148  33  PHE B CG    
3736 C  CD1   . PHE F 34  ? 0.4439 0.4227 0.5030 -0.0419 -0.0206 0.0308  33  PHE B CD1   
3737 C  CD2   . PHE F 34  ? 0.4237 0.4295 0.5249 -0.0500 -0.0330 0.0147  33  PHE B CD2   
3738 C  CE1   . PHE F 34  ? 0.4643 0.4405 0.5196 -0.0354 -0.0219 0.0267  33  PHE B CE1   
3739 C  CE2   . PHE F 34  ? 0.4545 0.4383 0.5323 -0.0538 -0.0332 0.0160  33  PHE B CE2   
3740 C  CZ    . PHE F 34  ? 0.4617 0.4504 0.5224 -0.0489 -0.0146 0.0240  33  PHE B CZ    
3741 N  N     . SER F 35  ? 0.4927 0.4882 0.5124 -0.0080 -0.0012 0.0083  34  SER B N     
3742 C  CA    . SER F 35  ? 0.5142 0.5120 0.5213 -0.0024 -0.0074 0.0087  34  SER B CA    
3743 C  C     . SER F 35  ? 0.5352 0.5345 0.5410 -0.0008 -0.0004 0.0076  34  SER B C     
3744 O  O     . SER F 35  ? 0.5309 0.5330 0.5389 -0.0018 -0.0027 0.0106  34  SER B O     
3745 C  CB    . SER F 35  ? 0.5189 0.5099 0.5110 -0.0039 -0.0088 0.0059  34  SER B CB    
3746 O  OG    . SER F 35  ? 0.5175 0.4945 0.4877 -0.0047 -0.0322 0.0193  34  SER B OG    
3747 N  N     . GLY F 36  ? 0.5562 0.5573 0.5546 -0.0034 -0.0004 0.0067  35  GLY B N     
3748 C  CA    . GLY F 36  ? 0.5815 0.5824 0.5775 -0.0022 0.0082  0.0059  35  GLY B CA    
3749 C  C     . GLY F 36  ? 0.5991 0.6023 0.5991 -0.0040 0.0078  0.0106  35  GLY B C     
3750 O  O     . GLY F 36  ? 0.5911 0.6111 0.6030 -0.0084 0.0137  0.0145  35  GLY B O     
3751 N  N     . ARG F 37  ? 0.6058 0.6221 0.6052 -0.0037 0.0106  0.0095  36  ARG B N     
3752 C  CA    . ARG F 37  ? 0.6121 0.6279 0.6118 -0.0029 0.0076  0.0092  36  ARG B CA    
3753 C  C     . ARG F 37  ? 0.6124 0.6354 0.6182 -0.0031 0.0044  0.0087  36  ARG B C     
3754 O  O     . ARG F 37  ? 0.6113 0.6465 0.6183 -0.0047 0.0109  0.0064  36  ARG B O     
3755 C  CB    . ARG F 37  ? 0.6098 0.6289 0.6082 0.0024  0.0080  0.0061  36  ARG B CB    
3756 C  CG    . ARG F 37  ? 0.6303 0.6426 0.6028 0.0026  -0.0024 0.0016  36  ARG B CG    
3757 C  CD    . ARG F 37  ? 0.6261 0.6528 0.5846 0.0146  -0.0078 -0.0125 36  ARG B CD    
3758 N  NE    . ARG F 37  ? 0.6195 0.6472 0.5376 0.0200  -0.0032 -0.0311 36  ARG B NE    
3759 C  CZ    . ARG F 37  ? 0.5877 0.6352 0.5171 0.0099  0.0071  -0.0385 36  ARG B CZ    
3760 N  NH1   . ARG F 37  ? 0.5356 0.6200 0.5030 0.0031  0.0063  -0.0389 36  ARG B NH1   
3761 N  NH2   . ARG F 37  ? 0.5626 0.6385 0.5004 0.0117  0.0127  -0.0358 36  ARG B NH2   
3762 N  N     . PHE F 38  ? 0.6150 0.6398 0.6248 -0.0017 0.0030  0.0104  37  PHE B N     
3763 C  CA    . PHE F 38  ? 0.6208 0.6362 0.6319 -0.0035 0.0005  0.0098  37  PHE B CA    
3764 C  C     . PHE F 38  ? 0.6213 0.6371 0.6306 0.0000  -0.0025 0.0057  37  PHE B C     
3765 O  O     . PHE F 38  ? 0.6253 0.6361 0.6342 -0.0031 0.0012  0.0030  37  PHE B O     
3766 C  CB    . PHE F 38  ? 0.6195 0.6374 0.6357 -0.0039 -0.0017 0.0116  37  PHE B CB    
3767 C  CG    . PHE F 38  ? 0.6161 0.6323 0.6327 -0.0109 0.0064  0.0124  37  PHE B CG    
3768 C  CD1   . PHE F 38  ? 0.5967 0.6289 0.6482 -0.0195 -0.0002 0.0291  37  PHE B CD1   
3769 C  CD2   . PHE F 38  ? 0.6160 0.6336 0.6490 -0.0089 0.0048  0.0177  37  PHE B CD2   
3770 C  CE1   . PHE F 38  ? 0.6104 0.6441 0.6667 -0.0246 0.0164  0.0407  37  PHE B CE1   
3771 C  CE2   . PHE F 38  ? 0.6011 0.6283 0.6532 -0.0139 0.0017  0.0330  37  PHE B CE2   
3772 C  CZ    . PHE F 38  ? 0.5995 0.6461 0.6582 -0.0274 0.0106  0.0330  37  PHE B CZ    
3773 N  N     . GLU F 39  ? 0.6213 0.6346 0.6285 0.0012  -0.0032 0.0046  38  GLU B N     
3774 C  CA    . GLU F 39  ? 0.6123 0.6294 0.6235 -0.0013 -0.0059 0.0056  38  GLU B CA    
3775 C  C     . GLU F 39  ? 0.6006 0.6140 0.6187 -0.0019 -0.0099 0.0037  38  GLU B C     
3776 O  O     . GLU F 39  ? 0.6021 0.6185 0.6302 -0.0068 -0.0101 0.0106  38  GLU B O     
3777 C  CB    . GLU F 39  ? 0.6202 0.6361 0.6225 -0.0028 -0.0065 0.0071  38  GLU B CB    
3778 C  CG    . GLU F 39  ? 0.6307 0.6614 0.6346 -0.0055 -0.0083 0.0137  38  GLU B CG    
3779 C  CD    . GLU F 39  ? 0.6420 0.6996 0.6376 -0.0135 -0.0112 0.0153  38  GLU B CD    
3780 O  OE1   . GLU F 39  ? 0.6127 0.7076 0.6514 -0.0183 -0.0124 0.0271  38  GLU B OE1   
3781 O  OE2   . GLU F 39  ? 0.6399 0.7165 0.6391 -0.0055 -0.0154 0.0290  38  GLU B OE2   
3782 N  N     . ASP F 40  ? 0.5764 0.5940 0.6032 -0.0030 -0.0132 0.0010  39  ASP B N     
3783 C  CA    . ASP F 40  ? 0.5521 0.5771 0.5910 -0.0020 -0.0169 0.0000  39  ASP B CA    
3784 C  C     . ASP F 40  ? 0.5254 0.5589 0.5714 -0.0019 -0.0164 -0.0021 39  ASP B C     
3785 O  O     . ASP F 40  ? 0.5139 0.5594 0.5750 0.0036  -0.0247 -0.0090 39  ASP B O     
3786 C  CB    . ASP F 40  ? 0.5543 0.5800 0.5944 -0.0048 -0.0174 0.0005  39  ASP B CB    
3787 C  CG    . ASP F 40  ? 0.5671 0.5893 0.6291 0.0045  -0.0088 0.0028  39  ASP B CG    
3788 O  OD1   . ASP F 40  ? 0.5407 0.6178 0.6472 0.0285  0.0068  0.0242  39  ASP B OD1   
3789 O  OD2   . ASP F 40  ? 0.6102 0.5966 0.6455 0.0072  -0.0015 0.0120  39  ASP B OD2   
3790 N  N     . SER F 41  ? 0.5050 0.5331 0.5429 -0.0085 -0.0138 -0.0017 40  SER B N     
3791 C  CA    . SER F 41  ? 0.4798 0.5076 0.5321 -0.0082 -0.0031 0.0039  40  SER B CA    
3792 C  C     . SER F 41  ? 0.4513 0.4915 0.4985 -0.0069 -0.0064 0.0030  40  SER B C     
3793 O  O     . SER F 41  ? 0.4569 0.5019 0.5168 -0.0086 -0.0046 0.0043  40  SER B O     
3794 C  CB    . SER F 41  ? 0.4936 0.5086 0.5354 -0.0072 0.0000  -0.0006 40  SER B CB    
3795 O  OG    . SER F 41  ? 0.5113 0.5189 0.5693 -0.0160 0.0120  0.0129  40  SER B OG    
3796 N  N     . GLY F 42  ? 0.4085 0.4573 0.4562 -0.0077 -0.0115 0.0095  41  GLY B N     
3797 C  CA    . GLY F 42  ? 0.3727 0.4286 0.4161 0.0035  -0.0141 0.0136  41  GLY B CA    
3798 C  C     . GLY F 42  ? 0.3410 0.4003 0.4001 0.0004  -0.0177 0.0190  41  GLY B C     
3799 O  O     . GLY F 42  ? 0.3277 0.3955 0.4093 0.0094  -0.0177 0.0127  41  GLY B O     
3800 N  N     . ALA F 43  ? 0.3221 0.3871 0.3636 -0.0044 -0.0158 0.0187  42  ALA B N     
3801 C  CA    . ALA F 43  ? 0.2948 0.3763 0.3392 -0.0158 -0.0199 0.0255  42  ALA B CA    
3802 C  C     . ALA F 43  ? 0.2612 0.3573 0.3089 -0.0112 -0.0188 0.0251  42  ALA B C     
3803 O  O     . ALA F 43  ? 0.2810 0.3692 0.3273 -0.0079 -0.0226 0.0243  42  ALA B O     
3804 C  CB    . ALA F 43  ? 0.3057 0.3840 0.3381 -0.0131 -0.0261 0.0253  42  ALA B CB    
3805 N  N     . VAL F 44  ? 0.2063 0.3274 0.2659 -0.0224 -0.0143 0.0251  43  VAL B N     
3806 C  CA    . VAL F 44  ? 0.1658 0.3086 0.2317 -0.0193 -0.0191 0.0283  43  VAL B CA    
3807 C  C     . VAL F 44  ? 0.1461 0.2887 0.2466 -0.0223 -0.0075 0.0331  43  VAL B C     
3808 O  O     . VAL F 44  ? 0.1039 0.2850 0.2558 -0.0168 -0.0323 0.0292  43  VAL B O     
3809 C  CB    . VAL F 44  ? 0.1601 0.2978 0.2390 -0.0228 -0.0287 0.0378  43  VAL B CB    
3810 C  CG1   . VAL F 44  ? 0.1397 0.3056 0.2241 -0.0051 -0.0202 0.0242  43  VAL B CG1   
3811 C  CG2   . VAL F 44  ? 0.1617 0.3328 0.2164 0.0021  -0.0361 0.0425  43  VAL B CG2   
3812 N  N     . ALA F 45  ? 0.1431 0.2739 0.2278 -0.0306 0.0048  0.0302  44  ALA B N     
3813 C  CA    . ALA F 45  ? 0.1448 0.2667 0.2193 -0.0251 0.0003  0.0276  44  ALA B CA    
3814 C  C     . ALA F 45  ? 0.1401 0.2523 0.2095 -0.0210 0.0055  0.0252  44  ALA B C     
3815 O  O     . ALA F 45  ? 0.1184 0.2522 0.2090 -0.0153 0.0153  0.0275  44  ALA B O     
3816 C  CB    . ALA F 45  ? 0.1210 0.2644 0.2210 -0.0419 -0.0004 0.0254  44  ALA B CB    
3817 N  N     . THR F 46  ? 0.1488 0.2339 0.2128 -0.0107 0.0104  0.0299  45  THR B N     
3818 C  CA    . THR F 46  ? 0.1779 0.2115 0.1974 -0.0151 0.0102  0.0236  45  THR B CA    
3819 C  C     . THR F 46  ? 0.1647 0.1962 0.1974 -0.0169 0.0119  0.0274  45  THR B C     
3820 O  O     . THR F 46  ? 0.1627 0.1946 0.2188 -0.0080 -0.0007 0.0404  45  THR B O     
3821 C  CB    . THR F 46  ? 0.1787 0.2105 0.2016 -0.0094 0.0273  0.0207  45  THR B CB    
3822 O  OG1   . THR F 46  ? 0.2144 0.2206 0.2462 -0.0230 -0.0027 0.0288  45  THR B OG1   
3823 C  CG2   . THR F 46  ? 0.1954 0.2188 0.2302 -0.0069 0.0348  0.0204  45  THR B CG2   
3824 N  N     . ALA F 47  ? 0.1536 0.1944 0.1634 -0.0363 0.0224  0.0248  46  ALA B N     
3825 C  CA    . ALA F 47  ? 0.1540 0.2093 0.1630 -0.0378 0.0068  0.0215  46  ALA B CA    
3826 C  C     . ALA F 47  ? 0.1593 0.2199 0.1813 -0.0409 0.0043  0.0187  46  ALA B C     
3827 O  O     . ALA F 47  ? 0.1383 0.2396 0.1876 -0.0434 -0.0147 0.0187  46  ALA B O     
3828 C  CB    . ALA F 47  ? 0.1547 0.2133 0.1844 -0.0408 -0.0055 0.0162  46  ALA B CB    
3829 N  N     . ASN F 48  ? 0.1496 0.2251 0.1870 -0.0413 0.0047  0.0124  47  ASN B N     
3830 C  CA    . ASN F 48  ? 0.1486 0.2163 0.2028 -0.0446 0.0094  0.0139  47  ASN B CA    
3831 C  C     . ASN F 48  ? 0.1777 0.2357 0.2160 -0.0517 0.0118  0.0152  47  ASN B C     
3832 O  O     . ASN F 48  ? 0.1788 0.2358 0.2228 -0.0749 0.0041  0.0095  47  ASN B O     
3833 C  CB    . ASN F 48  ? 0.1332 0.2003 0.2012 -0.0394 0.0199  0.0103  47  ASN B CB    
3834 C  CG    . ASN F 48  ? 0.1478 0.1889 0.1956 -0.0174 0.0106  0.0119  47  ASN B CG    
3835 O  OD1   . ASN F 48  ? 0.1345 0.2526 0.2360 -0.0386 -0.0358 0.0090  47  ASN B OD1   
3836 N  ND2   . ASN F 48  ? 0.1677 0.1372 0.2251 0.0105  0.0010  0.0343  47  ASN B ND2   
3837 N  N     . TYR F 49  ? 0.1934 0.2419 0.2260 -0.0509 0.0193  0.0118  48  TYR B N     
3838 C  CA    . TYR F 49  ? 0.2068 0.2620 0.2399 -0.0570 0.0160  0.0115  48  TYR B CA    
3839 C  C     . TYR F 49  ? 0.2130 0.2564 0.2419 -0.0553 0.0116  0.0103  48  TYR B C     
3840 O  O     . TYR F 49  ? 0.2171 0.2553 0.2403 -0.0517 0.0283  0.0125  48  TYR B O     
3841 C  CB    . TYR F 49  ? 0.2063 0.2581 0.2323 -0.0660 0.0153  0.0086  48  TYR B CB    
3842 C  CG    . TYR F 49  ? 0.2259 0.2860 0.2623 -0.0920 0.0137  0.0023  48  TYR B CG    
3843 C  CD1   . TYR F 49  ? 0.2290 0.3727 0.2791 -0.0725 0.0159  -0.0045 48  TYR B CD1   
3844 C  CD2   . TYR F 49  ? 0.2426 0.2998 0.2658 -0.1137 -0.0063 0.0094  48  TYR B CD2   
3845 C  CE1   . TYR F 49  ? 0.2650 0.3716 0.2677 -0.1024 -0.0031 -0.0116 48  TYR B CE1   
3846 C  CE2   . TYR F 49  ? 0.2533 0.3321 0.2456 -0.0917 -0.0111 0.0093  48  TYR B CE2   
3847 C  CZ    . TYR F 49  ? 0.2449 0.3409 0.2435 -0.0953 0.0108  0.0209  48  TYR B CZ    
3848 O  OH    . TYR F 49  ? 0.2342 0.3087 0.2457 -0.0774 0.0369  0.0268  48  TYR B OH    
3849 N  N     . GLU F 50  ? 0.2162 0.2609 0.2266 -0.0515 0.0036  0.0129  49  GLU B N     
3850 C  CA    . GLU F 50  ? 0.2080 0.2579 0.2463 -0.0498 0.0021  0.0151  49  GLU B CA    
3851 C  C     . GLU F 50  ? 0.2006 0.2574 0.2409 -0.0424 -0.0002 0.0140  49  GLU B C     
3852 O  O     . GLU F 50  ? 0.1912 0.2550 0.2409 -0.0478 -0.0009 0.0097  49  GLU B O     
3853 C  CB    . GLU F 50  ? 0.2080 0.2723 0.2394 -0.0520 0.0020  0.0094  49  GLU B CB    
3854 C  CG    . GLU F 50  ? 0.2345 0.2537 0.2797 -0.0566 0.0079  0.0003  49  GLU B CG    
3855 C  CD    . GLU F 50  ? 0.2757 0.3241 0.3985 -0.0602 0.0299  -0.0070 49  GLU B CD    
3856 O  OE1   . GLU F 50  ? 0.2537 0.3350 0.4379 -0.0461 0.0200  -0.0049 49  GLU B OE1   
3857 O  OE2   . GLU F 50  ? 0.3541 0.3369 0.4518 -0.0709 0.0424  -0.0010 49  GLU B OE2   
3858 N  N     . ALA F 51  ? 0.2124 0.2581 0.2500 -0.0402 -0.0097 0.0182  50  ALA B N     
3859 C  CA    . ALA F 51  ? 0.2130 0.2431 0.2579 -0.0374 -0.0029 0.0193  50  ALA B CA    
3860 C  C     . ALA F 51  ? 0.2066 0.2358 0.2448 -0.0339 -0.0027 0.0238  50  ALA B C     
3861 O  O     . ALA F 51  ? 0.2171 0.2692 0.2603 -0.0225 0.0073  0.0192  50  ALA B O     
3862 C  CB    . ALA F 51  ? 0.1887 0.2378 0.2571 -0.0479 0.0072  0.0155  50  ALA B CB    
3863 N  N     . ARG F 52  ? 0.2124 0.2321 0.2384 -0.0290 -0.0021 0.0242  51  ARG B N     
3864 C  CA    . ARG F 52  ? 0.2192 0.2415 0.2526 -0.0340 0.0006  0.0168  51  ARG B CA    
3865 C  C     . ARG F 52  ? 0.2217 0.2449 0.2470 -0.0426 -0.0010 0.0185  51  ARG B C     
3866 O  O     . ARG F 52  ? 0.2443 0.2267 0.2487 -0.0423 0.0027  0.0135  51  ARG B O     
3867 C  CB    . ARG F 52  ? 0.2059 0.2452 0.2566 -0.0408 -0.0121 0.0288  51  ARG B CB    
3868 C  CG    . ARG F 52  ? 0.1873 0.2578 0.2747 -0.0286 0.0102  0.0140  51  ARG B CG    
3869 C  CD    . ARG F 52  ? 0.1592 0.2984 0.2983 -0.0492 0.0197  0.0141  51  ARG B CD    
3870 N  NE    . ARG F 52  ? 0.1351 0.2869 0.3044 -0.0456 0.0061  0.0225  51  ARG B NE    
3871 C  CZ    . ARG F 52  ? 0.1200 0.3017 0.2912 -0.0520 0.0748  -0.0045 51  ARG B CZ    
3872 N  NH1   . ARG F 52  ? 0.1324 0.3004 0.2690 -0.0067 0.1587  -0.0134 51  ARG B NH1   
3873 N  NH2   . ARG F 52  ? 0.0521 0.2692 0.2347 -0.0307 0.0739  -0.0509 51  ARG B NH2   
3874 N  N     . LYS F 53  ? 0.2175 0.2578 0.2511 -0.0357 -0.0036 0.0183  52  LYS B N     
3875 C  CA    . LYS F 53  ? 0.2334 0.2861 0.2655 -0.0430 0.0034  0.0208  52  LYS B CA    
3876 C  C     . LYS F 53  ? 0.2478 0.2913 0.2611 -0.0447 0.0071  0.0062  52  LYS B C     
3877 O  O     . LYS F 53  ? 0.2527 0.2948 0.2663 -0.0441 0.0175  0.0006  52  LYS B O     
3878 C  CB    . LYS F 53  ? 0.2133 0.3037 0.2751 -0.0412 -0.0009 0.0224  52  LYS B CB    
3879 C  CG    . LYS F 53  ? 0.1944 0.3308 0.3118 -0.0427 -0.0085 0.0360  52  LYS B CG    
3880 C  CD    . LYS F 53  ? 0.1546 0.4287 0.3681 -0.0508 -0.0030 0.0637  52  LYS B CD    
3881 C  CE    . LYS F 53  ? 0.1029 0.4520 0.3763 -0.0903 -0.0156 0.0846  52  LYS B CE    
3882 N  NZ    . LYS F 53  ? 0.1295 0.4474 0.4165 -0.1238 -0.0207 0.1075  52  LYS B NZ    
3883 N  N     . PHE F 54  ? 0.2468 0.3017 0.2550 -0.0433 0.0087  0.0030  53  PHE B N     
3884 C  CA    . PHE F 54  ? 0.2502 0.3007 0.2418 -0.0435 0.0013  -0.0011 53  PHE B CA    
3885 C  C     . PHE F 54  ? 0.2598 0.3087 0.2474 -0.0458 -0.0015 -0.0018 53  PHE B C     
3886 O  O     . PHE F 54  ? 0.2701 0.3148 0.2454 -0.0505 -0.0021 -0.0031 53  PHE B O     
3887 C  CB    . PHE F 54  ? 0.2416 0.3117 0.2395 -0.0470 -0.0064 -0.0007 53  PHE B CB    
3888 C  CG    . PHE F 54  ? 0.1939 0.3150 0.2334 -0.0629 0.0054  -0.0053 53  PHE B CG    
3889 C  CD1   . PHE F 54  ? 0.2071 0.3502 0.2247 -0.0682 0.0148  0.0077  53  PHE B CD1   
3890 C  CD2   . PHE F 54  ? 0.1086 0.3349 0.1915 -0.1061 0.0227  0.0185  53  PHE B CD2   
3891 C  CE1   . PHE F 54  ? 0.1459 0.3863 0.2130 -0.1117 -0.0085 0.0409  53  PHE B CE1   
3892 C  CE2   . PHE F 54  ? 0.1764 0.3633 0.2136 -0.1326 -0.0090 0.0453  53  PHE B CE2   
3893 C  CZ    . PHE F 54  ? 0.1896 0.4188 0.2464 -0.1282 0.0199  0.0443  53  PHE B CZ    
3894 N  N     . GLY F 55  ? 0.2662 0.3074 0.2580 -0.0473 -0.0089 -0.0023 54  GLY B N     
3895 C  CA    . GLY F 55  ? 0.2627 0.3011 0.2702 -0.0353 -0.0051 0.0027  54  GLY B CA    
3896 C  C     . GLY F 55  ? 0.2601 0.3042 0.2691 -0.0322 0.0057  0.0087  54  GLY B C     
3897 O  O     . GLY F 55  ? 0.2577 0.3012 0.2827 -0.0286 0.0135  0.0118  54  GLY B O     
3898 N  N     . VAL F 56  ? 0.2673 0.3113 0.2729 -0.0284 0.0082  0.0085  55  VAL B N     
3899 C  CA    . VAL F 56  ? 0.2499 0.3114 0.2744 -0.0202 -0.0003 0.0143  55  VAL B CA    
3900 C  C     . VAL F 56  ? 0.2594 0.3173 0.2845 -0.0218 0.0031  0.0161  55  VAL B C     
3901 O  O     . VAL F 56  ? 0.2540 0.3280 0.2898 -0.0070 0.0029  0.0244  55  VAL B O     
3902 C  CB    . VAL F 56  ? 0.2438 0.3054 0.2651 -0.0192 -0.0007 0.0188  55  VAL B CB    
3903 C  CG1   . VAL F 56  ? 0.2239 0.2670 0.2359 -0.0324 -0.0139 0.0379  55  VAL B CG1   
3904 C  CG2   . VAL F 56  ? 0.2409 0.3219 0.2376 -0.0070 -0.0251 0.0101  55  VAL B CG2   
3905 N  N     . LYS F 57  ? 0.2911 0.3275 0.3000 -0.0241 0.0037  0.0171  56  LYS B N     
3906 C  CA    . LYS F 57  ? 0.3028 0.3421 0.3098 -0.0289 0.0000  0.0188  56  LYS B CA    
3907 C  C     . LYS F 57  ? 0.2938 0.3294 0.3029 -0.0284 0.0034  0.0102  56  LYS B C     
3908 O  O     . LYS F 57  ? 0.2990 0.3245 0.3060 -0.0372 0.0000  0.0142  56  LYS B O     
3909 C  CB    . LYS F 57  ? 0.3157 0.3588 0.3231 -0.0261 0.0093  0.0191  56  LYS B CB    
3910 C  CG    . LYS F 57  ? 0.3918 0.3652 0.3659 -0.0200 0.0134  0.0467  56  LYS B CG    
3911 C  CD    . LYS F 57  ? 0.4837 0.4419 0.3950 0.0132  0.0278  0.0246  56  LYS B CD    
3912 C  CE    . LYS F 57  ? 0.5513 0.4864 0.4332 0.0015  0.0068  0.0277  56  LYS B CE    
3913 N  NZ    . LYS F 57  ? 0.6121 0.5110 0.5031 0.0223  0.0228  0.0259  56  LYS B NZ    
3914 N  N     . ALA F 58  ? 0.2853 0.3263 0.2997 -0.0248 -0.0035 0.0042  57  ALA B N     
3915 C  CA    . ALA F 58  ? 0.2781 0.3249 0.3017 -0.0249 -0.0178 0.0029  57  ALA B CA    
3916 C  C     . ALA F 58  ? 0.2701 0.3281 0.2921 -0.0263 -0.0233 0.0065  57  ALA B C     
3917 O  O     . ALA F 58  ? 0.2451 0.3357 0.2941 -0.0380 -0.0160 0.0009  57  ALA B O     
3918 C  CB    . ALA F 58  ? 0.2665 0.3120 0.2875 -0.0240 -0.0175 0.0078  57  ALA B CB    
3919 N  N     . GLY F 59  ? 0.2725 0.3352 0.3111 -0.0201 -0.0316 0.0150  58  GLY B N     
3920 C  CA    . GLY F 59  ? 0.2738 0.3354 0.3038 -0.0264 -0.0354 0.0241  58  GLY B CA    
3921 C  C     . GLY F 59  ? 0.2750 0.3390 0.3118 -0.0246 -0.0262 0.0273  58  GLY B C     
3922 O  O     . GLY F 59  ? 0.2690 0.3645 0.3186 -0.0175 -0.0326 0.0388  58  GLY B O     
3923 N  N     . ILE F 60  ? 0.2811 0.3340 0.3135 -0.0264 -0.0218 0.0253  59  ILE B N     
3924 C  CA    . ILE F 60  ? 0.2796 0.3219 0.3139 -0.0322 -0.0164 0.0195  59  ILE B CA    
3925 C  C     . ILE F 60  ? 0.2829 0.3140 0.3256 -0.0365 -0.0159 0.0146  59  ILE B C     
3926 O  O     . ILE F 60  ? 0.2980 0.3167 0.3352 -0.0453 -0.0128 0.0114  59  ILE B O     
3927 C  CB    . ILE F 60  ? 0.2859 0.3209 0.3194 -0.0291 -0.0155 0.0224  59  ILE B CB    
3928 C  CG1   . ILE F 60  ? 0.2847 0.3213 0.2928 -0.0332 -0.0184 0.0054  59  ILE B CG1   
3929 C  CG2   . ILE F 60  ? 0.2854 0.2927 0.3173 -0.0255 -0.0130 0.0142  59  ILE B CG2   
3930 C  CD1   . ILE F 60  ? 0.3040 0.3231 0.3412 -0.0166 -0.0098 -0.0033 59  ILE B CD1   
3931 N  N     . PRO F 61  ? 0.2724 0.3114 0.3330 -0.0358 -0.0126 0.0177  60  PRO B N     
3932 C  CA    . PRO F 61  ? 0.2653 0.2951 0.3331 -0.0350 -0.0094 0.0055  60  PRO B CA    
3933 C  C     . PRO F 61  ? 0.2807 0.2861 0.3364 -0.0381 -0.0047 0.0052  60  PRO B C     
3934 O  O     . PRO F 61  ? 0.2846 0.2757 0.3357 -0.0447 -0.0040 0.0034  60  PRO B O     
3935 C  CB    . PRO F 61  ? 0.2612 0.2966 0.3259 -0.0327 -0.0081 0.0069  60  PRO B CB    
3936 C  CG    . PRO F 61  ? 0.2480 0.2982 0.3390 -0.0277 -0.0203 0.0153  60  PRO B CG    
3937 C  CD    . PRO F 61  ? 0.2663 0.3125 0.3333 -0.0334 -0.0170 0.0156  60  PRO B CD    
3938 N  N     . ILE F 62  ? 0.2816 0.2910 0.3485 -0.0349 0.0039  0.0067  61  ILE B N     
3939 C  CA    . ILE F 62  ? 0.2988 0.2999 0.3566 -0.0237 0.0013  0.0109  61  ILE B CA    
3940 C  C     . ILE F 62  ? 0.3078 0.3210 0.3647 -0.0232 0.0064  0.0138  61  ILE B C     
3941 O  O     . ILE F 62  ? 0.3157 0.3233 0.3677 -0.0208 0.0095  0.0202  61  ILE B O     
3942 C  CB    . ILE F 62  ? 0.2941 0.3015 0.3560 -0.0251 -0.0017 0.0163  61  ILE B CB    
3943 C  CG1   . ILE F 62  ? 0.3116 0.2702 0.3592 -0.0234 -0.0089 0.0247  61  ILE B CG1   
3944 C  CG2   . ILE F 62  ? 0.2930 0.2788 0.3626 -0.0214 -0.0057 0.0189  61  ILE B CG2   
3945 C  CD1   . ILE F 62  ? 0.2718 0.2255 0.3480 -0.0077 -0.0333 0.0445  61  ILE B CD1   
3946 N  N     . VAL F 63  ? 0.3258 0.3323 0.3824 -0.0249 0.0123  0.0137  62  VAL B N     
3947 C  CA    . VAL F 63  ? 0.3434 0.3501 0.4017 -0.0274 0.0120  0.0171  62  VAL B CA    
3948 C  C     . VAL F 63  ? 0.3471 0.3519 0.4007 -0.0293 0.0100  0.0259  62  VAL B C     
3949 O  O     . VAL F 63  ? 0.3562 0.3526 0.4072 -0.0377 0.0123  0.0300  62  VAL B O     
3950 C  CB    . VAL F 63  ? 0.3493 0.3638 0.4148 -0.0278 0.0120  0.0149  62  VAL B CB    
3951 C  CG1   . VAL F 63  ? 0.3671 0.3608 0.4033 -0.0254 0.0232  0.0291  62  VAL B CG1   
3952 C  CG2   . VAL F 63  ? 0.3380 0.3717 0.4146 -0.0190 0.0208  0.0054  62  VAL B CG2   
3953 N  N     . GLU F 64  ? 0.3503 0.3538 0.3900 -0.0331 0.0065  0.0369  63  GLU B N     
3954 C  CA    . GLU F 64  ? 0.3586 0.3652 0.3848 -0.0343 0.0064  0.0482  63  GLU B CA    
3955 C  C     . GLU F 64  ? 0.3424 0.3635 0.3713 -0.0364 0.0061  0.0471  63  GLU B C     
3956 O  O     . GLU F 64  ? 0.3304 0.3537 0.3407 -0.0357 0.0067  0.0520  63  GLU B O     
3957 C  CB    . GLU F 64  ? 0.3730 0.3780 0.3950 -0.0403 0.0029  0.0519  63  GLU B CB    
3958 C  CG    . GLU F 64  ? 0.4180 0.4408 0.4261 -0.0164 0.0140  0.0635  63  GLU B CG    
3959 C  CD    . GLU F 64  ? 0.3948 0.4900 0.4588 -0.0176 0.0226  0.0795  63  GLU B CD    
3960 O  OE1   . GLU F 64  ? 0.4143 0.4647 0.4894 -0.0125 0.0193  0.0895  63  GLU B OE1   
3961 O  OE2   . GLU F 64  ? 0.4048 0.5392 0.4305 0.0155  -0.0016 0.0638  63  GLU B OE2   
3962 N  N     . ALA F 65  ? 0.3292 0.3464 0.3646 -0.0385 0.0056  0.0504  64  ALA B N     
3963 C  CA    . ALA F 65  ? 0.3127 0.3411 0.3580 -0.0473 0.0061  0.0489  64  ALA B CA    
3964 C  C     . ALA F 65  ? 0.3132 0.3319 0.3557 -0.0566 0.0112  0.0531  64  ALA B C     
3965 O  O     . ALA F 65  ? 0.2989 0.3074 0.3493 -0.0674 0.0053  0.0700  64  ALA B O     
3966 C  CB    . ALA F 65  ? 0.3042 0.3417 0.3455 -0.0412 0.0003  0.0447  64  ALA B CB    
3967 N  N     . LYS F 66  ? 0.3060 0.3288 0.3565 -0.0569 0.0136  0.0425  65  LYS B N     
3968 C  CA    . LYS F 66  ? 0.3155 0.3475 0.3669 -0.0519 0.0051  0.0375  65  LYS B CA    
3969 C  C     . LYS F 66  ? 0.3162 0.3484 0.3682 -0.0502 0.0041  0.0293  65  LYS B C     
3970 O  O     . LYS F 66  ? 0.3090 0.3472 0.3727 -0.0445 -0.0036 0.0328  65  LYS B O     
3971 C  CB    . LYS F 66  ? 0.3232 0.3588 0.3748 -0.0542 0.0045  0.0384  65  LYS B CB    
3972 C  CG    . LYS F 66  ? 0.3398 0.3781 0.3712 -0.0751 0.0033  0.0545  65  LYS B CG    
3973 C  CD    . LYS F 66  ? 0.3593 0.3906 0.3837 -0.0615 -0.0041 0.0597  65  LYS B CD    
3974 C  CE    . LYS F 66  ? 0.3766 0.4022 0.3968 -0.0827 0.0092  0.0756  65  LYS B CE    
3975 N  NZ    . LYS F 66  ? 0.3678 0.3943 0.4215 -0.0861 -0.0025 0.1083  65  LYS B NZ    
3976 N  N     . LYS F 67  ? 0.3212 0.3506 0.3638 -0.0534 0.0023  0.0226  66  LYS B N     
3977 C  CA    . LYS F 67  ? 0.3147 0.3618 0.3615 -0.0431 0.0057  0.0200  66  LYS B CA    
3978 C  C     . LYS F 67  ? 0.2982 0.3517 0.3439 -0.0486 0.0116  0.0126  66  LYS B C     
3979 O  O     . LYS F 67  ? 0.3143 0.3676 0.3418 -0.0444 0.0149  0.0104  66  LYS B O     
3980 C  CB    . LYS F 67  ? 0.3287 0.3676 0.3772 -0.0441 0.0033  0.0237  66  LYS B CB    
3981 C  CG    . LYS F 67  ? 0.3699 0.3794 0.4040 -0.0350 -0.0017 0.0240  66  LYS B CG    
3982 C  CD    . LYS F 67  ? 0.4086 0.4365 0.4304 -0.0194 -0.0090 0.0399  66  LYS B CD    
3983 C  CE    . LYS F 67  ? 0.4149 0.4661 0.4369 0.0045  -0.0258 0.0421  66  LYS B CE    
3984 N  NZ    . LYS F 67  ? 0.4290 0.4921 0.4598 -0.0301 -0.0115 0.0647  66  LYS B NZ    
3985 N  N     . ILE F 68  ? 0.2582 0.3377 0.3140 -0.0574 0.0157  0.0094  67  ILE B N     
3986 C  CA    . ILE F 68  ? 0.2368 0.3276 0.2958 -0.0637 0.0213  0.0009  67  ILE B CA    
3987 C  C     . ILE F 68  ? 0.2261 0.3093 0.2927 -0.0692 0.0214  -0.0040 67  ILE B C     
3988 O  O     . ILE F 68  ? 0.2261 0.3199 0.2963 -0.0845 0.0379  -0.0068 67  ILE B O     
3989 C  CB    . ILE F 68  ? 0.2311 0.3301 0.3070 -0.0656 0.0236  -0.0025 67  ILE B CB    
3990 C  CG1   . ILE F 68  ? 0.2050 0.3328 0.3076 -0.0504 0.0180  0.0000  67  ILE B CG1   
3991 C  CG2   . ILE F 68  ? 0.2506 0.3379 0.2728 -0.0599 0.0201  -0.0070 67  ILE B CG2   
3992 C  CD1   . ILE F 68  ? 0.1305 0.3642 0.3149 -0.0255 0.0455  -0.0137 67  ILE B CD1   
3993 N  N     . LEU F 69  ? 0.2307 0.2956 0.2669 -0.0640 0.0233  -0.0049 68  LEU B N     
3994 C  CA    . LEU F 69  ? 0.2329 0.3019 0.2574 -0.0659 0.0151  0.0010  68  LEU B CA    
3995 C  C     . LEU F 69  ? 0.2491 0.2994 0.2575 -0.0759 0.0108  0.0091  68  LEU B C     
3996 O  O     . LEU F 69  ? 0.2537 0.2922 0.2389 -0.1157 -0.0074 0.0217  68  LEU B O     
3997 C  CB    . LEU F 69  ? 0.2185 0.2957 0.2474 -0.0658 0.0237  0.0042  68  LEU B CB    
3998 C  CG    . LEU F 69  ? 0.2367 0.3046 0.2058 -0.0790 0.0112  0.0029  68  LEU B CG    
3999 C  CD1   . LEU F 69  ? 0.2327 0.2929 0.1564 -0.0925 0.0441  0.0235  68  LEU B CD1   
4000 C  CD2   . LEU F 69  ? 0.2215 0.2614 0.1739 -0.0996 -0.0363 0.0158  68  LEU B CD2   
4001 N  N     . PRO F 70  ? 0.2657 0.2990 0.2707 -0.0762 0.0080  0.0146  69  PRO B N     
4002 C  CA    . PRO F 70  ? 0.2643 0.2991 0.2688 -0.0722 0.0215  0.0173  69  PRO B CA    
4003 C  C     . PRO F 70  ? 0.2735 0.3059 0.2731 -0.0710 0.0214  0.0192  69  PRO B C     
4004 O  O     . PRO F 70  ? 0.2725 0.3117 0.2866 -0.0723 0.0254  0.0276  69  PRO B O     
4005 C  CB    . PRO F 70  ? 0.2774 0.2826 0.2616 -0.0700 0.0227  0.0130  69  PRO B CB    
4006 C  CG    . PRO F 70  ? 0.2613 0.2790 0.2711 -0.0762 0.0131  0.0187  69  PRO B CG    
4007 C  CD    . PRO F 70  ? 0.2504 0.2957 0.2699 -0.0711 0.0284  0.0163  69  PRO B CD    
4008 N  N     . ASN F 71  ? 0.2658 0.3082 0.2743 -0.0660 0.0245  0.0305  70  ASN B N     
4009 C  CA    . ASN F 71  ? 0.2789 0.3178 0.2872 -0.0573 0.0279  0.0309  70  ASN B CA    
4010 C  C     . ASN F 71  ? 0.2755 0.3072 0.2841 -0.0549 0.0140  0.0270  70  ASN B C     
4011 O  O     . ASN F 71  ? 0.2903 0.3258 0.3428 -0.0559 0.0375  0.0358  70  ASN B O     
4012 C  CB    . ASN F 71  ? 0.2766 0.3212 0.2819 -0.0541 0.0328  0.0271  70  ASN B CB    
4013 C  CG    . ASN F 71  ? 0.2873 0.3281 0.2575 -0.0744 0.0150  0.0170  70  ASN B CG    
4014 O  OD1   . ASN F 71  ? 0.3256 0.3324 0.2198 -0.0777 -0.0103 0.0415  70  ASN B OD1   
4015 N  ND2   . ASN F 71  ? 0.2786 0.3174 0.2025 -0.0792 -0.0338 -0.0302 70  ASN B ND2   
4016 N  N     . ALA F 72  ? 0.2599 0.2803 0.2501 -0.0480 0.0064  0.0154  71  ALA B N     
4017 C  CA    . ALA F 72  ? 0.2332 0.2784 0.2442 -0.0316 0.0064  0.0112  71  ALA B CA    
4018 C  C     . ALA F 72  ? 0.2304 0.2760 0.2366 -0.0358 -0.0098 0.0117  71  ALA B C     
4019 O  O     . ALA F 72  ? 0.2193 0.2787 0.2308 -0.0323 -0.0148 0.0116  71  ALA B O     
4020 C  CB    . ALA F 72  ? 0.2184 0.2694 0.2343 -0.0326 -0.0015 0.0014  71  ALA B CB    
4021 N  N     . VAL F 73  ? 0.2147 0.2844 0.2397 -0.0383 -0.0078 0.0050  72  VAL B N     
4022 C  CA    . VAL F 73  ? 0.2046 0.2749 0.2273 -0.0343 -0.0140 -0.0068 72  VAL B CA    
4023 C  C     . VAL F 73  ? 0.1927 0.2798 0.2300 -0.0341 -0.0154 -0.0129 72  VAL B C     
4024 O  O     . VAL F 73  ? 0.1971 0.2847 0.2234 -0.0327 -0.0189 -0.0134 72  VAL B O     
4025 C  CB    . VAL F 73  ? 0.2075 0.2743 0.2280 -0.0406 -0.0110 -0.0074 72  VAL B CB    
4026 C  CG1   . VAL F 73  ? 0.1707 0.2788 0.2184 -0.0341 -0.0084 -0.0306 72  VAL B CG1   
4027 C  CG2   . VAL F 73  ? 0.1678 0.2570 0.2256 -0.0516 -0.0298 -0.0028 72  VAL B CG2   
4028 N  N     . TYR F 74  ? 0.1844 0.2775 0.2233 -0.0401 -0.0120 -0.0162 73  TYR B N     
4029 C  CA    . TYR F 74  ? 0.1701 0.2749 0.1903 -0.0443 -0.0083 -0.0076 73  TYR B CA    
4030 C  C     . TYR F 74  ? 0.1724 0.2734 0.1953 -0.0467 -0.0016 -0.0098 73  TYR B C     
4031 O  O     . TYR F 74  ? 0.1520 0.2742 0.1901 -0.0728 0.0168  -0.0047 73  TYR B O     
4032 C  CB    . TYR F 74  ? 0.1739 0.2849 0.1690 -0.0401 -0.0091 0.0005  73  TYR B CB    
4033 C  CG    . TYR F 74  ? 0.1596 0.3178 0.1582 -0.0309 -0.0027 -0.0096 73  TYR B CG    
4034 C  CD1   . TYR F 74  ? 0.1942 0.3340 0.1517 -0.0373 0.0204  0.0142  73  TYR B CD1   
4035 C  CD2   . TYR F 74  ? 0.1291 0.2892 0.0847 -0.0806 -0.0179 -0.0360 73  TYR B CD2   
4036 C  CE1   . TYR F 74  ? 0.1564 0.3386 0.1677 -0.0482 0.0120  -0.0163 73  TYR B CE1   
4037 C  CE2   . TYR F 74  ? 0.1650 0.2826 0.1265 -0.0460 -0.0023 -0.0050 73  TYR B CE2   
4038 C  CZ    . TYR F 74  ? 0.1493 0.3365 0.1456 -0.0330 0.0139  -0.0034 73  TYR B CZ    
4039 O  OH    . TYR F 74  ? 0.1696 0.3357 0.1779 -0.0445 0.0080  0.0757  73  TYR B OH    
4040 N  N     . LEU F 75  ? 0.1811 0.2671 0.2020 -0.0472 0.0037  -0.0048 74  LEU B N     
4041 C  CA    . LEU F 75  ? 0.1989 0.2615 0.2045 -0.0399 0.0048  0.0000  74  LEU B CA    
4042 C  C     . LEU F 75  ? 0.2164 0.2699 0.2124 -0.0381 0.0096  -0.0004 74  LEU B C     
4043 O  O     . LEU F 75  ? 0.2251 0.2761 0.2111 -0.0483 -0.0043 -0.0020 74  LEU B O     
4044 C  CB    . LEU F 75  ? 0.1984 0.2700 0.1983 -0.0408 0.0026  0.0071  74  LEU B CB    
4045 C  CG    . LEU F 75  ? 0.2402 0.2506 0.1883 -0.0439 0.0093  0.0086  74  LEU B CG    
4046 C  CD1   . LEU F 75  ? 0.2923 0.2419 0.2149 -0.0491 0.0285  -0.0139 74  LEU B CD1   
4047 C  CD2   . LEU F 75  ? 0.1528 0.1810 0.0694 -0.0703 0.0105  0.0413  74  LEU B CD2   
4048 N  N     . PRO F 76  ? 0.2285 0.2755 0.2369 -0.0283 0.0126  -0.0046 75  PRO B N     
4049 C  CA    . PRO F 76  ? 0.2361 0.2860 0.2483 -0.0223 0.0103  -0.0060 75  PRO B CA    
4050 C  C     . PRO F 76  ? 0.2488 0.2845 0.2738 -0.0253 0.0185  -0.0095 75  PRO B C     
4051 O  O     . PRO F 76  ? 0.2472 0.2751 0.2859 -0.0333 0.0218  -0.0061 75  PRO B O     
4052 C  CB    . PRO F 76  ? 0.2382 0.2862 0.2426 -0.0158 0.0143  -0.0055 75  PRO B CB    
4053 C  CG    . PRO F 76  ? 0.2324 0.2804 0.2145 -0.0078 0.0134  0.0005  75  PRO B CG    
4054 C  CD    . PRO F 76  ? 0.2303 0.2648 0.2140 -0.0342 0.0176  0.0086  75  PRO B CD    
4055 N  N     . MET F 77  ? 0.2476 0.3028 0.2926 -0.0293 0.0188  -0.0130 76  MET B N     
4056 C  CA    . MET F 77  ? 0.2757 0.3186 0.3239 -0.0263 0.0275  -0.0182 76  MET B CA    
4057 C  C     . MET F 77  ? 0.2649 0.3100 0.3448 -0.0300 0.0345  -0.0160 76  MET B C     
4058 O  O     . MET F 77  ? 0.2494 0.3102 0.3666 -0.0251 0.0547  -0.0296 76  MET B O     
4059 C  CB    . MET F 77  ? 0.2942 0.3279 0.3306 -0.0170 0.0126  -0.0174 76  MET B CB    
4060 C  CG    . MET F 77  ? 0.3387 0.3511 0.3722 -0.0335 0.0037  -0.0386 76  MET B CG    
4061 S  SD    . MET F 77  ? 0.5303 0.3700 0.4012 -0.0288 0.0264  -0.0661 76  MET B SD    
4062 C  CE    . MET F 77  ? 0.4706 0.3826 0.3952 -0.0136 -0.0446 -0.0748 76  MET B CE    
4063 N  N     . ARG F 78  ? 0.2612 0.3132 0.3501 -0.0404 0.0301  -0.0139 77  ARG B N     
4064 C  CA    . ARG F 78  ? 0.2489 0.3188 0.3274 -0.0395 0.0331  -0.0096 77  ARG B CA    
4065 C  C     . ARG F 78  ? 0.2433 0.3147 0.3372 -0.0431 0.0353  -0.0119 77  ARG B C     
4066 O  O     . ARG F 78  ? 0.2703 0.3240 0.3634 -0.0491 0.0384  -0.0216 77  ARG B O     
4067 C  CB    . ARG F 78  ? 0.2466 0.3251 0.3114 -0.0431 0.0294  -0.0055 77  ARG B CB    
4068 C  CG    . ARG F 78  ? 0.2154 0.3201 0.3064 -0.0340 0.0262  0.0063  77  ARG B CG    
4069 C  CD    . ARG F 78  ? 0.1697 0.3352 0.2854 -0.0286 0.0421  0.0339  77  ARG B CD    
4070 N  NE    . ARG F 78  ? 0.1972 0.3168 0.2930 -0.0218 0.0460  0.0480  77  ARG B NE    
4071 C  CZ    . ARG F 78  ? 0.1701 0.3362 0.2843 -0.0138 0.0647  0.0436  77  ARG B CZ    
4072 N  NH1   . ARG F 78  ? 0.1704 0.3762 0.2890 -0.0115 0.0787  0.0438  77  ARG B NH1   
4073 N  NH2   . ARG F 78  ? 0.1182 0.3537 0.2467 -0.0079 0.0516  0.0569  77  ARG B NH2   
4074 N  N     . LYS F 79  ? 0.2304 0.3136 0.3288 -0.0408 0.0340  -0.0101 78  LYS B N     
4075 C  CA    . LYS F 79  ? 0.2445 0.3250 0.3469 -0.0357 0.0305  -0.0155 78  LYS B CA    
4076 C  C     . LYS F 79  ? 0.2519 0.3244 0.3613 -0.0361 0.0338  -0.0171 78  LYS B C     
4077 O  O     . LYS F 79  ? 0.2558 0.3333 0.3736 -0.0415 0.0238  -0.0248 78  LYS B O     
4078 C  CB    . LYS F 79  ? 0.2405 0.3371 0.3478 -0.0258 0.0227  -0.0148 78  LYS B CB    
4079 C  CG    . LYS F 79  ? 0.2424 0.3789 0.3700 -0.0355 -0.0010 -0.0293 78  LYS B CG    
4080 C  CD    . LYS F 79  ? 0.2748 0.4303 0.3675 0.0009  -0.0269 -0.0092 78  LYS B CD    
4081 C  CE    . LYS F 79  ? 0.3241 0.4276 0.4160 -0.0091 -0.0858 -0.0207 78  LYS B CE    
4082 N  NZ    . LYS F 79  ? 0.3544 0.4323 0.4373 0.0409  -0.1165 0.0033  78  LYS B NZ    
4083 N  N     . GLU F 80  ? 0.2526 0.3205 0.3750 -0.0324 0.0395  -0.0102 79  GLU B N     
4084 C  CA    . GLU F 80  ? 0.2587 0.3105 0.3957 -0.0196 0.0412  0.0050  79  GLU B CA    
4085 C  C     . GLU F 80  ? 0.2480 0.3031 0.3891 -0.0121 0.0444  -0.0005 79  GLU B C     
4086 O  O     . GLU F 80  ? 0.2761 0.3025 0.4084 -0.0045 0.0559  0.0048  79  GLU B O     
4087 C  CB    . GLU F 80  ? 0.2663 0.3201 0.4060 -0.0248 0.0445  0.0022  79  GLU B CB    
4088 C  CG    . GLU F 80  ? 0.3026 0.3838 0.4864 -0.0211 0.0314  0.0299  79  GLU B CG    
4089 C  CD    . GLU F 80  ? 0.3934 0.4537 0.5939 -0.0482 0.0147  0.0435  79  GLU B CD    
4090 O  OE1   . GLU F 80  ? 0.4135 0.5091 0.6114 0.0014  -0.0060 0.0701  79  GLU B OE1   
4091 O  OE2   . GLU F 80  ? 0.4614 0.4825 0.6267 -0.0784 0.0332  0.0475  79  GLU B OE2   
4092 N  N     . VAL F 81  ? 0.2414 0.2855 0.3579 -0.0019 0.0458  -0.0046 80  VAL B N     
4093 C  CA    . VAL F 81  ? 0.2240 0.2586 0.3092 0.0018  0.0563  -0.0050 80  VAL B CA    
4094 C  C     . VAL F 81  ? 0.2188 0.2515 0.2780 -0.0029 0.0777  0.0010  80  VAL B C     
4095 O  O     . VAL F 81  ? 0.2152 0.2557 0.2576 -0.0159 0.1099  -0.0148 80  VAL B O     
4096 C  CB    . VAL F 81  ? 0.2107 0.2574 0.3054 0.0080  0.0497  -0.0028 80  VAL B CB    
4097 C  CG1   . VAL F 81  ? 0.2020 0.2565 0.3006 0.0112  0.0528  0.0124  80  VAL B CG1   
4098 C  CG2   . VAL F 81  ? 0.1613 0.2524 0.2703 0.0024  0.0557  0.0139  80  VAL B CG2   
4099 N  N     . TYR F 82  ? 0.2125 0.2380 0.2565 -0.0075 0.0680  0.0064  81  TYR B N     
4100 C  CA    . TYR F 82  ? 0.2133 0.2357 0.2406 -0.0195 0.0593  0.0060  81  TYR B CA    
4101 C  C     . TYR F 82  ? 0.2039 0.2503 0.2382 -0.0202 0.0602  0.0008  81  TYR B C     
4102 O  O     . TYR F 82  ? 0.2096 0.2615 0.2376 -0.0135 0.0766  0.0012  81  TYR B O     
4103 C  CB    . TYR F 82  ? 0.2140 0.2421 0.2408 -0.0208 0.0567  0.0052  81  TYR B CB    
4104 C  CG    . TYR F 82  ? 0.2278 0.2191 0.2332 -0.0166 0.0372  0.0203  81  TYR B CG    
4105 C  CD1   . TYR F 82  ? 0.2795 0.2398 0.1964 -0.0325 0.0371  0.0084  81  TYR B CD1   
4106 C  CD2   . TYR F 82  ? 0.2751 0.2203 0.2559 -0.0257 0.0017  0.0139  81  TYR B CD2   
4107 C  CE1   . TYR F 82  ? 0.3258 0.2186 0.2280 -0.0389 0.0353  0.0197  81  TYR B CE1   
4108 C  CE2   . TYR F 82  ? 0.3176 0.2438 0.2212 -0.0323 -0.0011 0.0163  81  TYR B CE2   
4109 C  CZ    . TYR F 82  ? 0.3161 0.2290 0.2491 -0.0318 0.0114  0.0188  81  TYR B CZ    
4110 O  OH    . TYR F 82  ? 0.3274 0.2628 0.2544 -0.0541 0.0299  0.0035  81  TYR B OH    
4111 N  N     . GLN F 83  ? 0.1955 0.2566 0.2366 -0.0304 0.0471  -0.0077 82  GLN B N     
4112 C  CA    . GLN F 83  ? 0.1929 0.2633 0.2175 -0.0438 0.0366  -0.0076 82  GLN B CA    
4113 C  C     . GLN F 83  ? 0.1776 0.2610 0.2228 -0.0486 0.0324  -0.0110 82  GLN B C     
4114 O  O     . GLN F 83  ? 0.1846 0.2751 0.2255 -0.0539 0.0300  -0.0149 82  GLN B O     
4115 C  CB    . GLN F 83  ? 0.1797 0.2616 0.1976 -0.0474 0.0335  -0.0065 82  GLN B CB    
4116 C  CG    . GLN F 83  ? 0.2213 0.3052 0.2532 -0.0742 0.0263  -0.0112 82  GLN B CG    
4117 C  CD    . GLN F 83  ? 0.2731 0.3460 0.2962 -0.0889 -0.0081 -0.0287 82  GLN B CD    
4118 O  OE1   . GLN F 83  ? 0.2604 0.4021 0.3264 -0.1241 -0.0054 0.0276  82  GLN B OE1   
4119 N  NE2   . GLN F 83  ? 0.2228 0.3328 0.3109 -0.1106 -0.0726 -0.0773 82  GLN B NE2   
4120 N  N     . GLN F 84  ? 0.1802 0.2538 0.2229 -0.0439 0.0228  0.0017  83  GLN B N     
4121 C  CA    . GLN F 84  ? 0.1775 0.2459 0.2353 -0.0494 0.0186  0.0024  83  GLN B CA    
4122 C  C     . GLN F 84  ? 0.1903 0.2534 0.2338 -0.0449 0.0190  0.0014  83  GLN B C     
4123 O  O     . GLN F 84  ? 0.2197 0.2693 0.2528 -0.0391 0.0145  -0.0046 83  GLN B O     
4124 C  CB    . GLN F 84  ? 0.1759 0.2342 0.2224 -0.0564 0.0184  0.0106  83  GLN B CB    
4125 C  CG    . GLN F 84  ? 0.1705 0.2334 0.2732 -0.0364 0.0007  0.0267  83  GLN B CG    
4126 C  CD    . GLN F 84  ? 0.2413 0.2559 0.3306 -0.0187 -0.0213 0.0373  83  GLN B CD    
4127 O  OE1   . GLN F 84  ? 0.2933 0.2303 0.3217 0.0078  -0.0280 0.0760  83  GLN B OE1   
4128 N  NE2   . GLN F 84  ? 0.2531 0.2483 0.3870 -0.0257 -0.0176 0.0668  83  GLN B NE2   
4129 N  N     . VAL F 85  ? 0.1882 0.2494 0.2176 -0.0373 0.0255  0.0005  84  VAL B N     
4130 C  CA    . VAL F 85  ? 0.1962 0.2532 0.1933 -0.0325 0.0218  0.0067  84  VAL B CA    
4131 C  C     . VAL F 85  ? 0.2024 0.2515 0.2096 -0.0282 0.0176  0.0014  84  VAL B C     
4132 O  O     . VAL F 85  ? 0.2027 0.2448 0.2400 -0.0232 0.0224  0.0182  84  VAL B O     
4133 C  CB    . VAL F 85  ? 0.1966 0.2674 0.1903 -0.0244 0.0147  -0.0027 84  VAL B CB    
4134 C  CG1   . VAL F 85  ? 0.2198 0.2573 0.0984 -0.0137 0.0367  -0.0175 84  VAL B CG1   
4135 C  CG2   . VAL F 85  ? 0.1944 0.2575 0.1116 -0.0336 0.0483  0.0009  84  VAL B CG2   
4136 N  N     . SER F 86  ? 0.2031 0.2543 0.2171 -0.0274 0.0161  0.0073  85  SER B N     
4137 C  CA    . SER F 86  ? 0.1939 0.2658 0.2174 -0.0170 0.0174  0.0078  85  SER B CA    
4138 C  C     . SER F 86  ? 0.1967 0.2722 0.2360 -0.0109 0.0154  0.0004  85  SER B C     
4139 O  O     . SER F 86  ? 0.1946 0.2877 0.2394 -0.0025 0.0131  -0.0018 85  SER B O     
4140 C  CB    . SER F 86  ? 0.1799 0.2614 0.2184 -0.0163 0.0105  0.0112  85  SER B CB    
4141 O  OG    . SER F 86  ? 0.1820 0.2830 0.1826 -0.0042 0.0146  0.0191  85  SER B OG    
4142 N  N     . SER F 87  ? 0.2102 0.2778 0.2590 -0.0027 0.0245  -0.0031 86  SER B N     
4143 C  CA    . SER F 87  ? 0.2349 0.2899 0.2845 0.0025  0.0241  -0.0099 86  SER B CA    
4144 C  C     . SER F 87  ? 0.2522 0.2921 0.2864 -0.0014 0.0259  -0.0116 86  SER B C     
4145 O  O     . SER F 87  ? 0.2721 0.3063 0.2957 -0.0051 0.0197  -0.0269 86  SER B O     
4146 C  CB    . SER F 87  ? 0.2206 0.2921 0.2859 0.0094  0.0318  -0.0054 86  SER B CB    
4147 O  OG    . SER F 87  ? 0.2353 0.3240 0.3528 0.0303  0.0406  -0.0332 86  SER B OG    
4148 N  N     . ARG F 88  ? 0.2443 0.2926 0.2817 0.0006  0.0311  -0.0032 87  ARG B N     
4149 C  CA    . ARG F 88  ? 0.2526 0.3006 0.2743 -0.0120 0.0395  0.0043  87  ARG B CA    
4150 C  C     . ARG F 88  ? 0.2761 0.2892 0.2809 -0.0149 0.0395  0.0012  87  ARG B C     
4151 O  O     . ARG F 88  ? 0.2901 0.2957 0.2941 -0.0222 0.0424  -0.0051 87  ARG B O     
4152 C  CB    . ARG F 88  ? 0.2424 0.3083 0.2645 -0.0143 0.0396  0.0098  87  ARG B CB    
4153 C  CG    . ARG F 88  ? 0.2102 0.3184 0.2692 0.0018  0.0392  0.0095  87  ARG B CG    
4154 C  CD    . ARG F 88  ? 0.2160 0.2992 0.2347 -0.0319 0.0630  0.0334  87  ARG B CD    
4155 N  NE    . ARG F 88  ? 0.2751 0.2907 0.2555 -0.0662 0.0447  0.0348  87  ARG B NE    
4156 C  CZ    . ARG F 88  ? 0.2618 0.2747 0.3064 -0.0750 0.0478  0.0533  87  ARG B CZ    
4157 N  NH1   . ARG F 88  ? 0.2618 0.2809 0.2980 -0.0718 0.0545  0.0721  87  ARG B NH1   
4158 N  NH2   . ARG F 88  ? 0.2671 0.3023 0.2898 -0.0886 0.0219  0.0750  87  ARG B NH2   
4159 N  N     . ILE F 89  ? 0.2951 0.2954 0.2666 -0.0111 0.0407  0.0088  88  ILE B N     
4160 C  CA    . ILE F 89  ? 0.3068 0.2846 0.2674 -0.0123 0.0341  0.0186  88  ILE B CA    
4161 C  C     . ILE F 89  ? 0.3157 0.2963 0.2677 -0.0135 0.0215  0.0143  88  ILE B C     
4162 O  O     . ILE F 89  ? 0.3291 0.2975 0.2771 -0.0163 0.0268  0.0279  88  ILE B O     
4163 C  CB    . ILE F 89  ? 0.3010 0.2745 0.2650 -0.0125 0.0368  0.0255  88  ILE B CB    
4164 C  CG1   . ILE F 89  ? 0.3220 0.2657 0.2330 -0.0286 0.0335  0.0257  88  ILE B CG1   
4165 C  CG2   . ILE F 89  ? 0.2978 0.2370 0.2299 -0.0096 0.0573  0.0363  88  ILE B CG2   
4166 C  CD1   . ILE F 89  ? 0.3459 0.2454 0.1729 -0.0447 0.0550  0.0537  88  ILE B CD1   
4167 N  N     . MET F 90  ? 0.3101 0.3106 0.2725 -0.0170 0.0173  0.0056  89  MET B N     
4168 C  CA    . MET F 90  ? 0.3048 0.3159 0.2778 -0.0190 0.0179  0.0058  89  MET B CA    
4169 C  C     . MET F 90  ? 0.3084 0.2949 0.2676 -0.0240 0.0169  0.0009  89  MET B C     
4170 O  O     . MET F 90  ? 0.3003 0.3045 0.2596 -0.0238 0.0198  0.0094  89  MET B O     
4171 C  CB    . MET F 90  ? 0.3065 0.3161 0.2868 -0.0175 0.0185  0.0047  89  MET B CB    
4172 C  CG    . MET F 90  ? 0.2725 0.3363 0.2734 -0.0218 0.0289  -0.0134 89  MET B CG    
4173 S  SD    . MET F 90  ? 0.2916 0.4615 0.2777 -0.0424 0.0374  -0.0276 89  MET B SD    
4174 C  CE    . MET F 90  ? 0.2563 0.3737 0.2702 -0.0260 0.0520  -0.0164 89  MET B CE    
4175 N  N     . ASN F 91  ? 0.3156 0.2934 0.2635 -0.0269 0.0263  -0.0043 90  ASN B N     
4176 C  CA    . ASN F 91  ? 0.3331 0.3115 0.2755 -0.0276 0.0241  -0.0164 90  ASN B CA    
4177 C  C     . ASN F 91  ? 0.3395 0.3131 0.2791 -0.0302 0.0217  -0.0159 90  ASN B C     
4178 O  O     . ASN F 91  ? 0.3544 0.3262 0.2685 -0.0316 0.0128  -0.0277 90  ASN B O     
4179 C  CB    . ASN F 91  ? 0.3327 0.3115 0.2703 -0.0278 0.0312  -0.0119 90  ASN B CB    
4180 C  CG    . ASN F 91  ? 0.3599 0.3281 0.2813 -0.0243 0.0437  -0.0155 90  ASN B CG    
4181 O  OD1   . ASN F 91  ? 0.3963 0.3424 0.3192 -0.0158 0.0437  0.0041  90  ASN B OD1   
4182 N  ND2   . ASN F 91  ? 0.3895 0.3069 0.2576 -0.0425 0.0324  -0.0104 90  ASN B ND2   
4183 N  N     . LEU F 92  ? 0.3417 0.3108 0.2755 -0.0262 0.0173  -0.0113 91  LEU B N     
4184 C  CA    . LEU F 92  ? 0.3422 0.3223 0.2858 -0.0202 0.0163  -0.0045 91  LEU B CA    
4185 C  C     . LEU F 92  ? 0.3552 0.3375 0.3026 -0.0158 0.0132  -0.0090 91  LEU B C     
4186 O  O     . LEU F 92  ? 0.3609 0.3314 0.3072 -0.0147 0.0047  -0.0167 91  LEU B O     
4187 C  CB    . LEU F 92  ? 0.3278 0.3058 0.2734 -0.0303 0.0169  0.0024  91  LEU B CB    
4188 C  CG    . LEU F 92  ? 0.3217 0.2992 0.3059 -0.0334 0.0179  0.0098  91  LEU B CG    
4189 C  CD1   . LEU F 92  ? 0.3281 0.2726 0.3296 -0.0495 0.0137  0.0138  91  LEU B CD1   
4190 C  CD2   . LEU F 92  ? 0.3027 0.2306 0.3110 -0.0116 0.0055  0.0251  91  LEU B CD2   
4191 N  N     . LEU F 93  ? 0.3611 0.3551 0.3168 -0.0051 0.0093  -0.0012 92  LEU B N     
4192 C  CA    . LEU F 93  ? 0.3551 0.3719 0.3370 -0.0024 0.0112  -0.0055 92  LEU B CA    
4193 C  C     . LEU F 93  ? 0.3684 0.3905 0.3606 -0.0042 0.0082  -0.0023 92  LEU B C     
4194 O  O     . LEU F 93  ? 0.3781 0.3821 0.3518 0.0166  0.0106  -0.0037 92  LEU B O     
4195 C  CB    . LEU F 93  ? 0.3326 0.3628 0.3263 0.0034  0.0089  -0.0077 92  LEU B CB    
4196 C  CG    . LEU F 93  ? 0.3302 0.3406 0.3151 -0.0032 0.0009  -0.0242 92  LEU B CG    
4197 C  CD1   . LEU F 93  ? 0.3371 0.3344 0.2899 0.0437  -0.0240 -0.0202 92  LEU B CD1   
4198 C  CD2   . LEU F 93  ? 0.2850 0.3240 0.2799 -0.0254 -0.0188 -0.0535 92  LEU B CD2   
4199 N  N     . ARG F 94  ? 0.3779 0.4213 0.3909 -0.0087 0.0207  -0.0001 93  ARG B N     
4200 C  CA    . ARG F 94  ? 0.3944 0.4456 0.4194 -0.0160 0.0213  0.0020  93  ARG B CA    
4201 C  C     . ARG F 94  ? 0.4018 0.4423 0.4336 -0.0256 0.0242  0.0010  93  ARG B C     
4202 O  O     . ARG F 94  ? 0.3940 0.4577 0.4277 -0.0286 0.0233  0.0029  93  ARG B O     
4203 C  CB    . ARG F 94  ? 0.3849 0.4525 0.4178 -0.0157 0.0263  0.0054  93  ARG B CB    
4204 C  CG    . ARG F 94  ? 0.4024 0.4842 0.4449 -0.0239 0.0355  0.0092  93  ARG B CG    
4205 C  CD    . ARG F 94  ? 0.4082 0.5079 0.4860 -0.0297 0.0441  0.0004  93  ARG B CD    
4206 N  NE    . ARG F 94  ? 0.4102 0.5158 0.5029 -0.0595 0.0487  -0.0084 93  ARG B NE    
4207 C  CZ    . ARG F 94  ? 0.3709 0.5515 0.5119 -0.0944 0.0492  -0.0089 93  ARG B CZ    
4208 N  NH1   . ARG F 94  ? 0.3519 0.5846 0.5167 -0.0965 0.0469  -0.0171 93  ARG B NH1   
4209 N  NH2   . ARG F 94  ? 0.3246 0.5586 0.5299 -0.1103 0.0573  -0.0244 93  ARG B NH2   
4210 N  N     . GLU F 95  ? 0.4156 0.4464 0.4460 -0.0270 0.0250  0.0007  94  GLU B N     
4211 C  CA    . GLU F 95  ? 0.4356 0.4498 0.4697 -0.0296 0.0297  0.0010  94  GLU B CA    
4212 C  C     . GLU F 95  ? 0.4466 0.4517 0.4806 -0.0272 0.0278  -0.0001 94  GLU B C     
4213 O  O     . GLU F 95  ? 0.4544 0.4608 0.4826 -0.0320 0.0290  0.0032  94  GLU B O     
4214 C  CB    . GLU F 95  ? 0.4333 0.4405 0.4679 -0.0291 0.0300  0.0046  94  GLU B CB    
4215 C  CG    . GLU F 95  ? 0.4797 0.4737 0.5023 -0.0270 0.0280  -0.0118 94  GLU B CG    
4216 C  CD    . GLU F 95  ? 0.5363 0.5062 0.5314 -0.0199 0.0361  -0.0173 94  GLU B CD    
4217 O  OE1   . GLU F 95  ? 0.5362 0.5408 0.5515 -0.0257 0.0478  -0.0236 94  GLU B OE1   
4218 O  OE2   . GLU F 95  ? 0.5005 0.4756 0.5262 -0.0191 0.0483  -0.0303 94  GLU B OE2   
4219 N  N     . TYR F 96  ? 0.4452 0.4570 0.4924 -0.0233 0.0269  -0.0028 95  TYR B N     
4220 C  CA    . TYR F 96  ? 0.4470 0.4550 0.4959 -0.0170 0.0230  -0.0021 95  TYR B CA    
4221 C  C     . TYR F 96  ? 0.4458 0.4528 0.5007 -0.0206 0.0260  0.0017  95  TYR B C     
4222 O  O     . TYR F 96  ? 0.4582 0.4476 0.5007 -0.0281 0.0339  0.0028  95  TYR B O     
4223 C  CB    . TYR F 96  ? 0.4442 0.4462 0.4895 -0.0088 0.0235  0.0008  95  TYR B CB    
4224 C  CG    . TYR F 96  ? 0.4479 0.4538 0.4914 0.0012  0.0184  -0.0053 95  TYR B CG    
4225 C  CD1   . TYR F 96  ? 0.4547 0.4274 0.4816 0.0077  0.0026  0.0072  95  TYR B CD1   
4226 C  CD2   . TYR F 96  ? 0.4476 0.4443 0.4789 0.0292  0.0128  0.0014  95  TYR B CD2   
4227 C  CE1   . TYR F 96  ? 0.4622 0.4288 0.4854 0.0343  0.0014  0.0152  95  TYR B CE1   
4228 C  CE2   . TYR F 96  ? 0.4642 0.4638 0.4848 0.0451  0.0020  0.0037  95  TYR B CE2   
4229 C  CZ    . TYR F 96  ? 0.4752 0.4546 0.4978 0.0471  -0.0093 0.0124  95  TYR B CZ    
4230 O  OH    . TYR F 96  ? 0.4623 0.4706 0.5453 0.0749  -0.0218 0.0325  95  TYR B OH    
4231 N  N     . SER F 97  ? 0.4348 0.4522 0.5086 -0.0219 0.0210  0.0006  96  SER B N     
4232 C  CA    . SER F 97  ? 0.4193 0.4490 0.5031 -0.0235 0.0169  -0.0031 96  SER B CA    
4233 C  C     . SER F 97  ? 0.4271 0.4574 0.5091 -0.0189 0.0102  -0.0021 96  SER B C     
4234 O  O     . SER F 97  ? 0.4111 0.4529 0.5165 -0.0141 0.0115  -0.0052 96  SER B O     
4235 C  CB    . SER F 97  ? 0.4129 0.4386 0.5007 -0.0253 0.0211  -0.0035 96  SER B CB    
4236 O  OG    . SER F 97  ? 0.3643 0.4051 0.5007 -0.0491 0.0316  -0.0180 96  SER B OG    
4237 N  N     . GLU F 98  ? 0.4322 0.4683 0.5109 -0.0213 0.0064  -0.0009 97  GLU B N     
4238 C  CA    . GLU F 98  ? 0.4360 0.4654 0.5033 -0.0224 0.0017  0.0000  97  GLU B CA    
4239 C  C     . GLU F 98  ? 0.4261 0.4661 0.4869 -0.0182 -0.0012 -0.0042 97  GLU B C     
4240 O  O     . GLU F 98  ? 0.4399 0.4786 0.5031 -0.0123 -0.0037 -0.0028 97  GLU B O     
4241 C  CB    . GLU F 98  ? 0.4436 0.4750 0.5046 -0.0237 0.0006  -0.0009 97  GLU B CB    
4242 C  CG    . GLU F 98  ? 0.4845 0.4927 0.5200 -0.0315 0.0078  0.0040  97  GLU B CG    
4243 C  CD    . GLU F 98  ? 0.5360 0.5048 0.5223 -0.0240 0.0279  -0.0055 97  GLU B CD    
4244 O  OE1   . GLU F 98  ? 0.5611 0.5101 0.5372 -0.0178 0.0506  0.0132  97  GLU B OE1   
4245 O  OE2   . GLU F 98  ? 0.5546 0.5202 0.5245 -0.0259 0.0329  -0.0068 97  GLU B OE2   
4246 N  N     . LYS F 99  ? 0.3980 0.4470 0.4516 -0.0207 -0.0033 -0.0098 98  LYS B N     
4247 C  CA    . LYS F 99  ? 0.3690 0.4306 0.4301 -0.0267 -0.0082 -0.0179 98  LYS B CA    
4248 C  C     . LYS F 99  ? 0.3489 0.4133 0.4100 -0.0198 -0.0045 -0.0143 98  LYS B C     
4249 O  O     . LYS F 99  ? 0.3378 0.4167 0.4136 -0.0313 0.0058  -0.0104 98  LYS B O     
4250 C  CB    . LYS F 99  ? 0.3704 0.4373 0.4263 -0.0279 -0.0083 -0.0156 98  LYS B CB    
4251 C  CG    . LYS F 99  ? 0.3722 0.4326 0.4441 -0.0494 -0.0153 -0.0305 98  LYS B CG    
4252 C  CD    . LYS F 99  ? 0.3581 0.4552 0.4626 -0.0702 -0.0313 -0.0485 98  LYS B CD    
4253 C  CE    . LYS F 99  ? 0.3419 0.4681 0.4554 -0.0862 -0.0518 -0.0423 98  LYS B CE    
4254 N  NZ    . LYS F 99  ? 0.2679 0.4197 0.5014 -0.1063 -0.0483 -0.0576 98  LYS B NZ    
4255 N  N     . ILE F 100 ? 0.3217 0.3939 0.3760 -0.0212 -0.0130 -0.0132 99  ILE B N     
4256 C  CA    . ILE F 100 ? 0.2736 0.3649 0.3281 -0.0191 -0.0117 -0.0059 99  ILE B CA    
4257 C  C     . ILE F 100 ? 0.2563 0.3552 0.3121 -0.0256 -0.0145 -0.0015 99  ILE B C     
4258 O  O     . ILE F 100 ? 0.2553 0.3503 0.2956 -0.0233 0.0020  0.0025  99  ILE B O     
4259 C  CB    . ILE F 100 ? 0.2733 0.3653 0.3286 -0.0190 -0.0093 -0.0022 99  ILE B CB    
4260 C  CG1   . ILE F 100 ? 0.2774 0.3551 0.3090 -0.0176 -0.0129 -0.0067 99  ILE B CG1   
4261 C  CG2   . ILE F 100 ? 0.2393 0.3609 0.2895 -0.0085 0.0033  0.0154  99  ILE B CG2   
4262 C  CD1   . ILE F 100 ? 0.2349 0.3246 0.3025 -0.0230 0.0216  -0.0042 99  ILE B CD1   
4263 N  N     . GLU F 101 ? 0.2341 0.3425 0.3005 -0.0214 -0.0178 -0.0104 100 GLU B N     
4264 C  CA    . GLU F 101 ? 0.2235 0.3203 0.3003 -0.0248 -0.0277 -0.0135 100 GLU B CA    
4265 C  C     . GLU F 101 ? 0.2318 0.3248 0.3101 -0.0236 -0.0258 -0.0126 100 GLU B C     
4266 O  O     . GLU F 101 ? 0.2482 0.3258 0.3202 -0.0382 -0.0266 -0.0181 100 GLU B O     
4267 C  CB    . GLU F 101 ? 0.2119 0.3096 0.2969 -0.0218 -0.0310 -0.0121 100 GLU B CB    
4268 C  CG    . GLU F 101 ? 0.2739 0.3227 0.3285 -0.0228 -0.0296 -0.0206 100 GLU B CG    
4269 C  CD    . GLU F 101 ? 0.3280 0.3125 0.3228 -0.0165 -0.0353 -0.0027 100 GLU B CD    
4270 O  OE1   . GLU F 101 ? 0.3249 0.2800 0.3232 -0.0204 -0.0647 0.0073  100 GLU B OE1   
4271 O  OE2   . GLU F 101 ? 0.3637 0.3404 0.3755 0.0112  -0.0070 -0.0202 100 GLU B OE2   
4272 N  N     . ILE F 102 ? 0.2344 0.3205 0.3269 -0.0184 -0.0356 -0.0124 101 ILE B N     
4273 C  CA    . ILE F 102 ? 0.2266 0.3227 0.3190 -0.0193 -0.0551 -0.0110 101 ILE B CA    
4274 C  C     . ILE F 102 ? 0.2292 0.3214 0.3297 -0.0122 -0.0541 -0.0041 101 ILE B C     
4275 O  O     . ILE F 102 ? 0.2567 0.3232 0.3780 -0.0122 -0.0676 -0.0020 101 ILE B O     
4276 C  CB    . ILE F 102 ? 0.2207 0.3321 0.3273 -0.0215 -0.0572 -0.0120 101 ILE B CB    
4277 C  CG1   . ILE F 102 ? 0.2182 0.3344 0.3262 -0.0526 -0.0716 -0.0037 101 ILE B CG1   
4278 C  CG2   . ILE F 102 ? 0.2375 0.3164 0.3334 -0.0123 -0.0487 -0.0232 101 ILE B CG2   
4279 C  CD1   . ILE F 102 ? 0.2458 0.3506 0.3416 -0.0572 -0.0745 -0.0329 101 ILE B CD1   
4280 N  N     . ALA F 103 ? 0.2237 0.3107 0.3070 -0.0042 -0.0477 0.0035  102 ALA B N     
4281 C  CA    . ALA F 103 ? 0.2272 0.3063 0.2784 -0.0011 -0.0422 0.0064  102 ALA B CA    
4282 C  C     . ALA F 103 ? 0.2344 0.3061 0.2699 0.0083  -0.0407 0.0127  102 ALA B C     
4283 O  O     . ALA F 103 ? 0.2638 0.3258 0.2614 0.0090  -0.0383 0.0268  102 ALA B O     
4284 C  CB    . ALA F 103 ? 0.1923 0.3055 0.2656 -0.0068 -0.0369 0.0088  102 ALA B CB    
4285 N  N     . SER F 104 ? 0.2173 0.2951 0.2462 0.0171  -0.0349 0.0133  103 SER B N     
4286 C  CA    . SER F 104 ? 0.2051 0.2802 0.2482 0.0158  -0.0320 0.0152  103 SER B CA    
4287 C  C     . SER F 104 ? 0.1989 0.2749 0.2557 0.0106  -0.0293 0.0071  103 SER B C     
4288 O  O     . SER F 104 ? 0.2084 0.2786 0.2867 0.0155  -0.0261 0.0107  103 SER B O     
4289 C  CB    . SER F 104 ? 0.2163 0.2723 0.2486 0.0186  -0.0313 0.0169  103 SER B CB    
4290 O  OG    . SER F 104 ? 0.2766 0.3068 0.2728 0.0143  -0.0339 0.0300  103 SER B OG    
4291 N  N     . ILE F 105 ? 0.1880 0.2711 0.2368 0.0129  -0.0282 0.0033  104 ILE B N     
4292 C  CA    . ILE F 105 ? 0.1893 0.2683 0.2310 0.0044  -0.0348 0.0058  104 ILE B CA    
4293 C  C     . ILE F 105 ? 0.2050 0.2720 0.2268 -0.0018 -0.0352 0.0023  104 ILE B C     
4294 O  O     . ILE F 105 ? 0.2263 0.2747 0.2233 -0.0100 -0.0550 0.0039  104 ILE B O     
4295 C  CB    . ILE F 105 ? 0.1827 0.2683 0.2245 0.0070  -0.0409 0.0088  104 ILE B CB    
4296 C  CG1   . ILE F 105 ? 0.1872 0.2779 0.2134 -0.0052 -0.0210 0.0114  104 ILE B CG1   
4297 C  CG2   . ILE F 105 ? 0.1834 0.2512 0.2356 0.0084  -0.0426 0.0381  104 ILE B CG2   
4298 C  CD1   . ILE F 105 ? 0.2189 0.2572 0.2574 0.0379  -0.0219 0.0014  104 ILE B CD1   
4299 N  N     . ASP F 106 ? 0.1975 0.2835 0.2233 -0.0041 -0.0236 -0.0037 105 ASP B N     
4300 C  CA    . ASP F 106 ? 0.2134 0.3024 0.2283 -0.0055 -0.0176 -0.0048 105 ASP B CA    
4301 C  C     . ASP F 106 ? 0.2155 0.3136 0.2145 -0.0052 -0.0041 0.0024  105 ASP B C     
4302 O  O     . ASP F 106 ? 0.2270 0.3407 0.2063 -0.0039 0.0082  -0.0029 105 ASP B O     
4303 C  CB    . ASP F 106 ? 0.2185 0.3047 0.2389 -0.0095 -0.0229 -0.0100 105 ASP B CB    
4304 C  CG    . ASP F 106 ? 0.2372 0.3440 0.2439 -0.0069 -0.0391 -0.0113 105 ASP B CG    
4305 O  OD1   . ASP F 106 ? 0.2768 0.3778 0.2406 -0.0284 -0.0513 -0.0496 105 ASP B OD1   
4306 O  OD2   . ASP F 106 ? 0.2802 0.3840 0.3500 -0.0101 -0.0603 -0.0332 105 ASP B OD2   
4307 N  N     . GLU F 107 ? 0.2070 0.3115 0.2077 -0.0099 0.0060  0.0124  106 GLU B N     
4308 C  CA    . GLU F 107 ? 0.2218 0.3047 0.2364 -0.0100 0.0094  0.0161  106 GLU B CA    
4309 C  C     . GLU F 107 ? 0.2238 0.2979 0.2222 -0.0075 0.0159  0.0197  106 GLU B C     
4310 O  O     . GLU F 107 ? 0.2274 0.3104 0.2219 0.0115  0.0133  0.0155  106 GLU B O     
4311 C  CB    . GLU F 107 ? 0.2379 0.3196 0.2556 -0.0111 0.0121  0.0190  106 GLU B CB    
4312 C  CG    . GLU F 107 ? 0.2577 0.3576 0.3369 -0.0207 -0.0173 0.0336  106 GLU B CG    
4313 C  CD    . GLU F 107 ? 0.3018 0.3902 0.4186 -0.0601 -0.0034 0.0302  106 GLU B CD    
4314 O  OE1   . GLU F 107 ? 0.2937 0.3890 0.4630 -0.0848 -0.0114 -0.0135 106 GLU B OE1   
4315 O  OE2   . GLU F 107 ? 0.3548 0.4183 0.5045 -0.0597 -0.0524 0.0030  106 GLU B OE2   
4316 N  N     . ALA F 108 ? 0.2305 0.2990 0.2088 -0.0124 0.0232  0.0216  107 ALA B N     
4317 C  CA    . ALA F 108 ? 0.2305 0.2930 0.2046 -0.0088 0.0281  0.0187  107 ALA B CA    
4318 C  C     . ALA F 108 ? 0.2343 0.2945 0.1981 -0.0061 0.0347  0.0163  107 ALA B C     
4319 O  O     . ALA F 108 ? 0.2460 0.2818 0.1969 0.0067  0.0566  0.0257  107 ALA B O     
4320 C  CB    . ALA F 108 ? 0.2045 0.3130 0.2003 -0.0097 0.0391  0.0137  107 ALA B CB    
4321 N  N     . TYR F 109 ? 0.2362 0.2842 0.1904 -0.0097 0.0292  0.0112  108 TYR B N     
4322 C  CA    . TYR F 109 ? 0.2427 0.2704 0.2129 -0.0149 0.0202  0.0014  108 TYR B CA    
4323 C  C     . TYR F 109 ? 0.2386 0.2889 0.2175 -0.0135 0.0218  -0.0008 108 TYR B C     
4324 O  O     . TYR F 109 ? 0.2320 0.2918 0.2112 -0.0073 0.0171  -0.0050 108 TYR B O     
4325 C  CB    . TYR F 109 ? 0.2362 0.2602 0.2056 -0.0173 0.0149  0.0009  108 TYR B CB    
4326 C  CG    . TYR F 109 ? 0.2573 0.2620 0.2100 -0.0383 0.0243  0.0055  108 TYR B CG    
4327 C  CD1   . TYR F 109 ? 0.2951 0.2557 0.1852 -0.0662 0.0113  -0.0056 108 TYR B CD1   
4328 C  CD2   . TYR F 109 ? 0.2919 0.2419 0.2804 -0.0631 0.0109  0.0242  108 TYR B CD2   
4329 C  CE1   . TYR F 109 ? 0.3338 0.2740 0.2240 -0.0713 0.0453  0.0103  108 TYR B CE1   
4330 C  CE2   . TYR F 109 ? 0.3051 0.2650 0.2900 -0.0539 0.0135  0.0333  108 TYR B CE2   
4331 C  CZ    . TYR F 109 ? 0.3450 0.2517 0.2614 -0.0664 0.0447  0.0437  108 TYR B CZ    
4332 O  OH    . TYR F 109 ? 0.3941 0.2946 0.3302 -0.0849 0.0191  0.0505  108 TYR B OH    
4333 N  N     . LEU F 110 ? 0.2526 0.2937 0.2369 -0.0172 0.0136  -0.0047 109 LEU B N     
4334 C  CA    . LEU F 110 ? 0.2591 0.2973 0.2528 -0.0209 0.0096  -0.0123 109 LEU B CA    
4335 C  C     . LEU F 110 ? 0.2793 0.3104 0.2638 -0.0192 -0.0030 -0.0192 109 LEU B C     
4336 O  O     . LEU F 110 ? 0.2793 0.3036 0.2774 -0.0349 -0.0064 -0.0211 109 LEU B O     
4337 C  CB    . LEU F 110 ? 0.2506 0.2936 0.2383 -0.0187 0.0090  -0.0097 109 LEU B CB    
4338 C  CG    . LEU F 110 ? 0.2582 0.2822 0.2378 -0.0325 0.0069  -0.0045 109 LEU B CG    
4339 C  CD1   . LEU F 110 ? 0.2227 0.2484 0.1831 -0.0063 0.0682  0.0048  109 LEU B CD1   
4340 C  CD2   . LEU F 110 ? 0.2912 0.2941 0.2497 -0.0302 0.0025  -0.0130 109 LEU B CD2   
4341 N  N     . ASP F 111 ? 0.2937 0.3249 0.2820 -0.0123 -0.0130 -0.0255 110 ASP B N     
4342 C  CA    . ASP F 111 ? 0.3308 0.3500 0.3053 -0.0075 -0.0261 -0.0338 110 ASP B CA    
4343 C  C     . ASP F 111 ? 0.3385 0.3526 0.3149 -0.0111 -0.0281 -0.0326 110 ASP B C     
4344 O  O     . ASP F 111 ? 0.3615 0.3649 0.3270 -0.0165 -0.0300 -0.0342 110 ASP B O     
4345 C  CB    . ASP F 111 ? 0.3367 0.3544 0.3025 -0.0011 -0.0299 -0.0362 110 ASP B CB    
4346 C  CG    . ASP F 111 ? 0.3801 0.3675 0.3212 0.0168  -0.0392 -0.0507 110 ASP B CG    
4347 O  OD1   . ASP F 111 ? 0.4065 0.3465 0.3314 0.0269  -0.0536 -0.0325 110 ASP B OD1   
4348 O  OD2   . ASP F 111 ? 0.4332 0.3950 0.3015 0.0120  -0.0516 -0.0814 110 ASP B OD2   
4349 N  N     . ILE F 112 ? 0.3451 0.3546 0.3278 -0.0040 -0.0312 -0.0378 111 ILE B N     
4350 C  CA    . ILE F 112 ? 0.3646 0.3685 0.3492 -0.0009 -0.0331 -0.0266 111 ILE B CA    
4351 C  C     . ILE F 112 ? 0.3829 0.3872 0.3766 0.0024  -0.0341 -0.0279 111 ILE B C     
4352 O  O     . ILE F 112 ? 0.3833 0.3906 0.3832 0.0041  -0.0346 -0.0275 111 ILE B O     
4353 C  CB    . ILE F 112 ? 0.3643 0.3624 0.3406 -0.0003 -0.0295 -0.0262 111 ILE B CB    
4354 C  CG1   . ILE F 112 ? 0.3558 0.3561 0.3313 -0.0110 -0.0378 -0.0199 111 ILE B CG1   
4355 C  CG2   . ILE F 112 ? 0.3683 0.3442 0.3475 0.0010  -0.0341 -0.0184 111 ILE B CG2   
4356 C  CD1   . ILE F 112 ? 0.3262 0.3418 0.3042 -0.0146 0.0059  -0.0064 111 ILE B CD1   
4357 N  N     . SER F 113 ? 0.4036 0.4086 0.4002 0.0056  -0.0372 -0.0222 112 SER B N     
4358 C  CA    . SER F 113 ? 0.4174 0.4372 0.4236 0.0072  -0.0366 -0.0184 112 SER B CA    
4359 C  C     . SER F 113 ? 0.4401 0.4528 0.4491 0.0054  -0.0319 -0.0164 112 SER B C     
4360 O  O     . SER F 113 ? 0.4431 0.4639 0.4553 0.0071  -0.0333 -0.0174 112 SER B O     
4361 C  CB    . SER F 113 ? 0.4093 0.4348 0.4232 0.0058  -0.0421 -0.0182 112 SER B CB    
4362 O  OG    . SER F 113 ? 0.3770 0.4420 0.4014 0.0180  -0.0514 -0.0012 112 SER B OG    
4363 N  N     . ASP F 114 ? 0.4601 0.4752 0.4724 0.0052  -0.0210 -0.0113 113 ASP B N     
4364 C  CA    . ASP F 114 ? 0.4875 0.4886 0.4968 0.0024  -0.0163 -0.0082 113 ASP B CA    
4365 C  C     . ASP F 114 ? 0.4973 0.4928 0.5084 0.0007  -0.0177 -0.0088 113 ASP B C     
4366 O  O     . ASP F 114 ? 0.4970 0.4858 0.5135 0.0020  -0.0160 -0.0060 113 ASP B O     
4367 C  CB    . ASP F 114 ? 0.4874 0.4959 0.5016 0.0034  -0.0094 -0.0076 113 ASP B CB    
4368 C  CG    . ASP F 114 ? 0.5123 0.5197 0.5075 -0.0016 -0.0049 -0.0036 113 ASP B CG    
4369 O  OD1   . ASP F 114 ? 0.5488 0.5243 0.5266 -0.0036 0.0182  -0.0351 113 ASP B OD1   
4370 O  OD2   . ASP F 114 ? 0.5493 0.5579 0.5349 0.0022  0.0109  0.0016  113 ASP B OD2   
4371 N  N     . LYS F 115 ? 0.5064 0.5013 0.5172 -0.0028 -0.0190 -0.0105 114 LYS B N     
4372 C  CA    . LYS F 115 ? 0.5126 0.4980 0.5232 -0.0020 -0.0190 -0.0089 114 LYS B CA    
4373 C  C     . LYS F 115 ? 0.5170 0.4967 0.5263 -0.0031 -0.0189 -0.0129 114 LYS B C     
4374 O  O     . LYS F 115 ? 0.5214 0.4954 0.5302 -0.0064 -0.0217 -0.0149 114 LYS B O     
4375 C  CB    . LYS F 115 ? 0.5128 0.5003 0.5247 -0.0013 -0.0144 -0.0089 114 LYS B CB    
4376 C  CG    . LYS F 115 ? 0.5106 0.4944 0.5383 -0.0071 -0.0144 -0.0063 114 LYS B CG    
4377 C  CD    . LYS F 115 ? 0.4970 0.4870 0.5595 -0.0191 -0.0064 0.0018  114 LYS B CD    
4378 C  CE    . LYS F 115 ? 0.5242 0.4948 0.5794 -0.0178 0.0022  0.0133  114 LYS B CE    
4379 N  NZ    . LYS F 115 ? 0.5362 0.4930 0.5885 -0.0256 0.0136  0.0210  114 LYS B NZ    
4380 N  N     . VAL F 116 ? 0.5209 0.5005 0.5255 -0.0009 -0.0196 -0.0132 115 VAL B N     
4381 C  CA    . VAL F 116 ? 0.5180 0.5143 0.5332 0.0037  -0.0193 -0.0125 115 VAL B CA    
4382 C  C     . VAL F 116 ? 0.5293 0.5283 0.5411 0.0037  -0.0171 -0.0112 115 VAL B C     
4383 O  O     . VAL F 116 ? 0.5328 0.5385 0.5449 0.0017  -0.0190 -0.0116 115 VAL B O     
4384 C  CB    . VAL F 116 ? 0.5151 0.5092 0.5316 0.0065  -0.0200 -0.0144 115 VAL B CB    
4385 C  CG1   . VAL F 116 ? 0.4968 0.5108 0.5367 0.0104  -0.0119 -0.0174 115 VAL B CG1   
4386 C  CG2   . VAL F 116 ? 0.4907 0.5028 0.5128 0.0064  -0.0267 -0.0171 115 VAL B CG2   
4387 N  N     . ARG F 117 ? 0.5454 0.5343 0.5524 0.0058  -0.0160 -0.0121 116 ARG B N     
4388 C  CA    . ARG F 117 ? 0.5563 0.5476 0.5574 0.0068  -0.0119 -0.0081 116 ARG B CA    
4389 C  C     . ARG F 117 ? 0.5506 0.5473 0.5543 0.0115  -0.0075 -0.0117 116 ARG B C     
4390 O  O     . ARG F 117 ? 0.5522 0.5592 0.5573 0.0123  -0.0041 -0.0132 116 ARG B O     
4391 C  CB    . ARG F 117 ? 0.5702 0.5528 0.5661 0.0074  -0.0127 -0.0058 116 ARG B CB    
4392 C  CG    . ARG F 117 ? 0.5716 0.5695 0.5879 0.0019  -0.0095 0.0119  116 ARG B CG    
4393 C  CD    . ARG F 117 ? 0.6045 0.5770 0.6381 0.0194  0.0049  0.0178  116 ARG B CD    
4394 N  NE    . ARG F 117 ? 0.6199 0.5963 0.6783 0.0330  0.0255  0.0351  116 ARG B NE    
4395 C  CZ    . ARG F 117 ? 0.6310 0.6089 0.7051 0.0186  0.0265  0.0493  116 ARG B CZ    
4396 N  NH1   . ARG F 117 ? 0.6248 0.5999 0.7199 0.0274  0.0284  0.0537  116 ARG B NH1   
4397 N  NH2   . ARG F 117 ? 0.6345 0.6101 0.7247 0.0157  0.0262  0.0598  116 ARG B NH2   
4398 N  N     . ASP F 118 ? 0.5456 0.5390 0.5490 0.0189  -0.0024 -0.0149 117 ASP B N     
4399 C  CA    . ASP F 118 ? 0.5414 0.5334 0.5426 0.0203  -0.0004 -0.0173 117 ASP B CA    
4400 C  C     . ASP F 118 ? 0.5371 0.5269 0.5297 0.0207  0.0003  -0.0218 117 ASP B C     
4401 O  O     . ASP F 118 ? 0.5415 0.5260 0.5318 0.0174  0.0006  -0.0207 117 ASP B O     
4402 C  CB    . ASP F 118 ? 0.5387 0.5354 0.5429 0.0228  -0.0015 -0.0183 117 ASP B CB    
4403 C  CG    . ASP F 118 ? 0.5358 0.5500 0.5481 0.0308  0.0028  -0.0121 117 ASP B CG    
4404 O  OD1   . ASP F 118 ? 0.4972 0.5576 0.5520 0.0467  0.0065  0.0045  117 ASP B OD1   
4405 O  OD2   . ASP F 118 ? 0.5523 0.5836 0.5451 0.0478  0.0087  -0.0223 117 ASP B OD2   
4406 N  N     . TYR F 119 ? 0.5308 0.5217 0.5220 0.0203  0.0000  -0.0279 118 TYR B N     
4407 C  CA    . TYR F 119 ? 0.5224 0.5195 0.5151 0.0245  0.0031  -0.0301 118 TYR B CA    
4408 C  C     . TYR F 119 ? 0.5157 0.5176 0.5201 0.0228  0.0036  -0.0303 118 TYR B C     
4409 O  O     . TYR F 119 ? 0.5053 0.5165 0.5083 0.0275  0.0061  -0.0368 118 TYR B O     
4410 C  CB    . TYR F 119 ? 0.5155 0.5175 0.5078 0.0271  0.0038  -0.0357 118 TYR B CB    
4411 C  CG    . TYR F 119 ? 0.5168 0.5089 0.4955 0.0409  0.0169  -0.0500 118 TYR B CG    
4412 C  CD1   . TYR F 119 ? 0.5164 0.5177 0.4900 0.0503  0.0179  -0.0577 118 TYR B CD1   
4413 C  CD2   . TYR F 119 ? 0.5029 0.5093 0.5073 0.0529  0.0341  -0.0523 118 TYR B CD2   
4414 C  CE1   . TYR F 119 ? 0.4922 0.4928 0.4809 0.0598  0.0336  -0.0786 118 TYR B CE1   
4415 C  CE2   . TYR F 119 ? 0.4931 0.5064 0.5077 0.0594  0.0380  -0.0622 118 TYR B CE2   
4416 C  CZ    . TYR F 119 ? 0.5048 0.4862 0.4911 0.0557  0.0306  -0.0761 118 TYR B CZ    
4417 O  OH    . TYR F 119 ? 0.4872 0.4898 0.4884 0.0805  0.0455  -0.1034 118 TYR B OH    
4418 N  N     . ARG F 120 ? 0.5171 0.5148 0.5206 0.0190  0.0030  -0.0253 119 ARG B N     
4419 C  CA    . ARG F 120 ? 0.5135 0.5126 0.5126 0.0124  0.0001  -0.0215 119 ARG B CA    
4420 C  C     . ARG F 120 ? 0.4989 0.5015 0.5042 0.0133  0.0030  -0.0259 119 ARG B C     
4421 O  O     . ARG F 120 ? 0.4938 0.4934 0.4949 0.0081  0.0046  -0.0330 119 ARG B O     
4422 C  CB    . ARG F 120 ? 0.5170 0.5177 0.5182 0.0134  -0.0001 -0.0216 119 ARG B CB    
4423 C  CG    . ARG F 120 ? 0.5353 0.5450 0.5267 -0.0004 -0.0165 -0.0048 119 ARG B CG    
4424 C  CD    . ARG F 120 ? 0.5631 0.5265 0.5239 -0.0354 -0.0396 0.0219  119 ARG B CD    
4425 N  NE    . ARG F 120 ? 0.5769 0.5658 0.5484 -0.0595 -0.0421 0.0428  119 ARG B NE    
4426 C  CZ    . ARG F 120 ? 0.6038 0.5860 0.5566 -0.0760 -0.0382 0.0511  119 ARG B CZ    
4427 N  NH1   . ARG F 120 ? 0.6008 0.5823 0.5587 -0.0931 -0.0216 0.0544  119 ARG B NH1   
4428 N  NH2   . ARG F 120 ? 0.6107 0.5856 0.5735 -0.0752 -0.0371 0.0655  119 ARG B NH2   
4429 N  N     . GLU F 121 ? 0.4845 0.4926 0.4948 0.0202  0.0071  -0.0222 120 GLU B N     
4430 C  CA    . GLU F 121 ? 0.4678 0.4809 0.4813 0.0235  0.0089  -0.0229 120 GLU B CA    
4431 C  C     . GLU F 121 ? 0.4492 0.4724 0.4680 0.0221  0.0077  -0.0168 120 GLU B C     
4432 O  O     . GLU F 121 ? 0.4465 0.4722 0.4704 0.0292  0.0087  -0.0143 120 GLU B O     
4433 C  CB    . GLU F 121 ? 0.4772 0.4885 0.4853 0.0220  0.0103  -0.0198 120 GLU B CB    
4434 C  CG    . GLU F 121 ? 0.4921 0.5081 0.5095 0.0356  0.0091  -0.0132 120 GLU B CG    
4435 C  CD    . GLU F 121 ? 0.5123 0.5518 0.5355 0.0369  0.0038  -0.0144 120 GLU B CD    
4436 O  OE1   . GLU F 121 ? 0.5274 0.5776 0.5479 0.0555  -0.0008 -0.0009 120 GLU B OE1   
4437 O  OE2   . GLU F 121 ? 0.5331 0.5728 0.5500 0.0489  0.0159  -0.0083 120 GLU B OE2   
4438 N  N     . ALA F 122 ? 0.4260 0.4603 0.4460 0.0201  0.0040  -0.0213 121 ALA B N     
4439 C  CA    . ALA F 122 ? 0.4091 0.4475 0.4247 0.0164  0.0010  -0.0207 121 ALA B CA    
4440 C  C     . ALA F 122 ? 0.3964 0.4319 0.4075 0.0144  -0.0042 -0.0254 121 ALA B C     
4441 O  O     . ALA F 122 ? 0.3886 0.4271 0.4002 0.0099  -0.0168 -0.0178 121 ALA B O     
4442 C  CB    . ALA F 122 ? 0.4030 0.4485 0.4246 0.0235  0.0051  -0.0217 121 ALA B CB    
4443 N  N     . TYR F 123 ? 0.3923 0.4184 0.3903 0.0104  -0.0099 -0.0298 122 TYR B N     
4444 C  CA    . TYR F 123 ? 0.3865 0.4091 0.3778 0.0189  -0.0103 -0.0243 122 TYR B CA    
4445 C  C     . TYR F 123 ? 0.3769 0.4050 0.3760 0.0194  -0.0136 -0.0171 122 TYR B C     
4446 O  O     . TYR F 123 ? 0.3792 0.4100 0.3789 0.0140  -0.0196 -0.0122 122 TYR B O     
4447 C  CB    . TYR F 123 ? 0.3763 0.4003 0.3697 0.0233  -0.0119 -0.0264 122 TYR B CB    
4448 C  CG    . TYR F 123 ? 0.4059 0.4114 0.3756 0.0307  -0.0058 -0.0365 122 TYR B CG    
4449 C  CD1   . TYR F 123 ? 0.3952 0.4286 0.3623 0.0270  0.0071  -0.0498 122 TYR B CD1   
4450 C  CD2   . TYR F 123 ? 0.4021 0.4097 0.3888 0.0329  -0.0184 -0.0393 122 TYR B CD2   
4451 C  CE1   . TYR F 123 ? 0.3686 0.4563 0.3613 0.0512  0.0042  -0.0555 122 TYR B CE1   
4452 C  CE2   . TYR F 123 ? 0.3532 0.4240 0.3892 0.0557  -0.0139 -0.0288 122 TYR B CE2   
4453 C  CZ    . TYR F 123 ? 0.3557 0.4386 0.3884 0.0616  -0.0023 -0.0358 122 TYR B CZ    
4454 O  OH    . TYR F 123 ? 0.3116 0.4534 0.3903 0.0980  -0.0260 -0.0391 122 TYR B OH    
4455 N  N     . ASN F 124 ? 0.3658 0.4013 0.3647 0.0188  -0.0084 -0.0191 123 ASN B N     
4456 C  CA    . ASN F 124 ? 0.3613 0.4002 0.3617 0.0235  -0.0134 -0.0127 123 ASN B CA    
4457 C  C     . ASN F 124 ? 0.3556 0.3910 0.3606 0.0299  -0.0171 -0.0133 123 ASN B C     
4458 O  O     . ASN F 124 ? 0.3606 0.3900 0.3523 0.0356  -0.0176 -0.0181 123 ASN B O     
4459 C  CB    . ASN F 124 ? 0.3707 0.4037 0.3607 0.0273  -0.0169 -0.0088 123 ASN B CB    
4460 C  CG    . ASN F 124 ? 0.3721 0.4294 0.3636 0.0154  -0.0152 0.0004  123 ASN B CG    
4461 O  OD1   . ASN F 124 ? 0.4362 0.4452 0.3459 0.0060  -0.0307 0.0204  123 ASN B OD1   
4462 N  ND2   . ASN F 124 ? 0.3545 0.4473 0.3352 0.0093  0.0003  0.0133  123 ASN B ND2   
4463 N  N     . LEU F 125 ? 0.3361 0.3702 0.3527 0.0349  -0.0161 -0.0114 124 LEU B N     
4464 C  CA    . LEU F 125 ? 0.3263 0.3620 0.3458 0.0286  -0.0137 -0.0087 124 LEU B CA    
4465 C  C     . LEU F 125 ? 0.3144 0.3479 0.3423 0.0354  -0.0128 -0.0092 124 LEU B C     
4466 O  O     . LEU F 125 ? 0.3111 0.3498 0.3435 0.0352  -0.0041 -0.0136 124 LEU B O     
4467 C  CB    . LEU F 125 ? 0.3160 0.3545 0.3444 0.0300  -0.0177 -0.0073 124 LEU B CB    
4468 C  CG    . LEU F 125 ? 0.3368 0.3613 0.3470 0.0216  -0.0237 0.0028  124 LEU B CG    
4469 C  CD1   . LEU F 125 ? 0.3766 0.3820 0.3457 -0.0051 -0.0172 0.0052  124 LEU B CD1   
4470 C  CD2   . LEU F 125 ? 0.3507 0.3751 0.3619 -0.0075 -0.0424 -0.0130 124 LEU B CD2   
4471 N  N     . GLY F 126 ? 0.2994 0.3326 0.3352 0.0410  -0.0167 -0.0039 125 GLY B N     
4472 C  CA    . GLY F 126 ? 0.2714 0.3383 0.3304 0.0420  -0.0265 -0.0053 125 GLY B CA    
4473 C  C     . GLY F 126 ? 0.2536 0.3331 0.3369 0.0414  -0.0229 -0.0081 125 GLY B C     
4474 O  O     . GLY F 126 ? 0.2389 0.3346 0.3347 0.0617  -0.0194 -0.0089 125 GLY B O     
4475 N  N     . LEU F 127 ? 0.2547 0.3200 0.3352 0.0315  -0.0211 -0.0070 126 LEU B N     
4476 C  CA    . LEU F 127 ? 0.2655 0.3231 0.3313 0.0296  -0.0162 -0.0102 126 LEU B CA    
4477 C  C     . LEU F 127 ? 0.2720 0.3376 0.3281 0.0226  -0.0162 -0.0099 126 LEU B C     
4478 O  O     . LEU F 127 ? 0.2684 0.3551 0.3301 0.0171  -0.0259 -0.0055 126 LEU B O     
4479 C  CB    . LEU F 127 ? 0.2607 0.3229 0.3367 0.0332  -0.0166 -0.0153 126 LEU B CB    
4480 C  CG    . LEU F 127 ? 0.2443 0.3044 0.3305 0.0277  -0.0168 -0.0345 126 LEU B CG    
4481 C  CD1   . LEU F 127 ? 0.2317 0.2954 0.3464 0.0272  -0.0279 -0.0540 126 LEU B CD1   
4482 C  CD2   . LEU F 127 ? 0.2444 0.2757 0.2967 0.0384  -0.0054 -0.0779 126 LEU B CD2   
4483 N  N     . GLU F 128 ? 0.2744 0.3418 0.3208 0.0209  -0.0199 -0.0088 127 GLU B N     
4484 C  CA    . GLU F 128 ? 0.2787 0.3466 0.3137 0.0199  -0.0222 0.0002  127 GLU B CA    
4485 C  C     . GLU F 128 ? 0.2678 0.3441 0.3037 0.0290  -0.0265 0.0032  127 GLU B C     
4486 O  O     . GLU F 128 ? 0.2479 0.3499 0.3020 0.0364  -0.0358 0.0105  127 GLU B O     
4487 C  CB    . GLU F 128 ? 0.2897 0.3571 0.3204 0.0157  -0.0231 0.0016  127 GLU B CB    
4488 C  CG    . GLU F 128 ? 0.3260 0.3663 0.3551 0.0082  0.0089  -0.0061 127 GLU B CG    
4489 C  CD    . GLU F 128 ? 0.4033 0.4208 0.4486 -0.0339 0.0216  -0.0149 127 GLU B CD    
4490 O  OE1   . GLU F 128 ? 0.4635 0.4481 0.4676 -0.0331 0.0402  -0.0107 127 GLU B OE1   
4491 O  OE2   . GLU F 128 ? 0.3990 0.4591 0.4741 -0.0291 0.0422  -0.0151 127 GLU B OE2   
4492 N  N     . ILE F 129 ? 0.2819 0.3472 0.3100 0.0283  -0.0187 -0.0040 128 ILE B N     
4493 C  CA    . ILE F 129 ? 0.2924 0.3363 0.2961 0.0287  -0.0207 -0.0087 128 ILE B CA    
4494 C  C     . ILE F 129 ? 0.2878 0.3361 0.2896 0.0289  -0.0157 -0.0101 128 ILE B C     
4495 O  O     . ILE F 129 ? 0.2893 0.3542 0.2943 0.0293  -0.0034 -0.0021 128 ILE B O     
4496 C  CB    . ILE F 129 ? 0.2956 0.3367 0.2977 0.0277  -0.0245 -0.0099 128 ILE B CB    
4497 C  CG1   . ILE F 129 ? 0.3177 0.3294 0.2789 0.0338  -0.0376 -0.0383 128 ILE B CG1   
4498 C  CG2   . ILE F 129 ? 0.2864 0.3414 0.2760 0.0351  -0.0308 -0.0147 128 ILE B CG2   
4499 C  CD1   . ILE F 129 ? 0.3182 0.2441 0.2874 0.0853  -0.0464 -0.0398 128 ILE B CD1   
4500 N  N     . LYS F 130 ? 0.2899 0.3235 0.2727 0.0255  -0.0073 -0.0108 129 LYS B N     
4501 C  CA    . LYS F 130 ? 0.2917 0.3146 0.2720 0.0251  -0.0027 -0.0091 129 LYS B CA    
4502 C  C     . LYS F 130 ? 0.2904 0.3128 0.2730 0.0286  -0.0108 -0.0053 129 LYS B C     
4503 O  O     . LYS F 130 ? 0.2819 0.3280 0.2620 0.0348  0.0005  0.0017  129 LYS B O     
4504 C  CB    . LYS F 130 ? 0.2766 0.3124 0.2646 0.0316  -0.0035 -0.0167 129 LYS B CB    
4505 C  CG    . LYS F 130 ? 0.2789 0.2949 0.3050 0.0325  0.0149  -0.0219 129 LYS B CG    
4506 C  CD    . LYS F 130 ? 0.2756 0.2771 0.3264 0.0428  0.0414  -0.0301 129 LYS B CD    
4507 C  CE    . LYS F 130 ? 0.2483 0.2853 0.3709 0.0445  0.0662  -0.0667 129 LYS B CE    
4508 N  NZ    . LYS F 130 ? 0.2674 0.2559 0.4578 0.0839  0.0448  -0.0474 129 LYS B NZ    
4509 N  N     . ASN F 131 ? 0.3054 0.2999 0.2707 0.0278  -0.0093 -0.0007 130 ASN B N     
4510 C  CA    . ASN F 131 ? 0.3257 0.3015 0.2703 0.0315  -0.0063 0.0022  130 ASN B CA    
4511 C  C     . ASN F 131 ? 0.3310 0.2856 0.2676 0.0405  -0.0049 0.0080  130 ASN B C     
4512 O  O     . ASN F 131 ? 0.3438 0.2907 0.2448 0.0452  -0.0115 0.0148  130 ASN B O     
4513 C  CB    . ASN F 131 ? 0.3346 0.3093 0.2723 0.0321  -0.0085 0.0006  130 ASN B CB    
4514 C  CG    . ASN F 131 ? 0.3611 0.3472 0.2871 0.0239  -0.0094 -0.0120 130 ASN B CG    
4515 O  OD1   . ASN F 131 ? 0.3781 0.4059 0.2729 -0.0195 -0.0394 -0.0224 130 ASN B OD1   
4516 N  ND2   . ASN F 131 ? 0.4299 0.3651 0.3225 0.0210  -0.0318 -0.0244 130 ASN B ND2   
4517 N  N     . LYS F 132 ? 0.3238 0.2677 0.2696 0.0390  -0.0005 0.0153  131 LYS B N     
4518 C  CA    . LYS F 132 ? 0.3351 0.2718 0.2700 0.0416  0.0036  0.0328  131 LYS B CA    
4519 C  C     . LYS F 132 ? 0.3343 0.2762 0.2638 0.0437  0.0084  0.0326  131 LYS B C     
4520 O  O     . LYS F 132 ? 0.3412 0.2741 0.2713 0.0499  0.0102  0.0393  131 LYS B O     
4521 C  CB    . LYS F 132 ? 0.3393 0.2805 0.2710 0.0417  -0.0032 0.0389  131 LYS B CB    
4522 C  CG    . LYS F 132 ? 0.3470 0.3008 0.3036 0.0407  -0.0073 0.0567  131 LYS B CG    
4523 C  CD    . LYS F 132 ? 0.4195 0.3124 0.3593 0.0607  -0.0411 0.0807  131 LYS B CD    
4524 C  CE    . LYS F 132 ? 0.4768 0.3116 0.4051 0.0679  -0.0423 0.0752  131 LYS B CE    
4525 N  NZ    . LYS F 132 ? 0.4946 0.3429 0.4113 0.0843  -0.0459 0.0816  131 LYS B NZ    
4526 N  N     . ILE F 133 ? 0.3146 0.2678 0.2474 0.0474  0.0079  0.0387  132 ILE B N     
4527 C  CA    . ILE F 133 ? 0.3018 0.2747 0.2387 0.0452  0.0047  0.0394  132 ILE B CA    
4528 C  C     . ILE F 133 ? 0.3116 0.2910 0.2581 0.0407  -0.0005 0.0353  132 ILE B C     
4529 O  O     . ILE F 133 ? 0.3078 0.2877 0.2543 0.0525  0.0029  0.0345  132 ILE B O     
4530 C  CB    . ILE F 133 ? 0.2876 0.2758 0.2339 0.0479  0.0103  0.0353  132 ILE B CB    
4531 C  CG1   . ILE F 133 ? 0.2796 0.2701 0.2055 0.0746  0.0148  0.0438  132 ILE B CG1   
4532 C  CG2   . ILE F 133 ? 0.2759 0.2468 0.2142 0.0504  0.0060  0.0528  132 ILE B CG2   
4533 C  CD1   . ILE F 133 ? 0.2370 0.2504 0.1693 0.1292  0.0544  0.0116  132 ILE B CD1   
4534 N  N     . LEU F 134 ? 0.3264 0.3030 0.2748 0.0332  -0.0081 0.0242  133 LEU B N     
4535 C  CA    . LEU F 134 ? 0.3284 0.3095 0.3000 0.0216  -0.0228 0.0090  133 LEU B CA    
4536 C  C     . LEU F 134 ? 0.3511 0.3227 0.3185 0.0143  -0.0281 0.0037  133 LEU B C     
4537 O  O     . LEU F 134 ? 0.3488 0.3421 0.3414 0.0204  -0.0226 -0.0079 133 LEU B O     
4538 C  CB    . LEU F 134 ? 0.3218 0.3063 0.2995 0.0192  -0.0310 0.0020  133 LEU B CB    
4539 C  CG    . LEU F 134 ? 0.2969 0.2975 0.2970 0.0247  -0.0296 -0.0148 133 LEU B CG    
4540 C  CD1   . LEU F 134 ? 0.2301 0.3145 0.2746 0.0328  -0.0628 -0.0277 133 LEU B CD1   
4541 C  CD2   . LEU F 134 ? 0.2612 0.2886 0.2997 0.0227  -0.0506 -0.0266 133 LEU B CD2   
4542 N  N     . GLU F 135 ? 0.3775 0.3219 0.3374 0.0049  -0.0259 0.0045  134 GLU B N     
4543 C  CA    . GLU F 135 ? 0.3941 0.3227 0.3314 -0.0097 -0.0224 0.0152  134 GLU B CA    
4544 C  C     . GLU F 135 ? 0.3966 0.3325 0.3291 -0.0203 -0.0200 0.0178  134 GLU B C     
4545 O  O     . GLU F 135 ? 0.4106 0.3448 0.3299 -0.0274 -0.0273 0.0296  134 GLU B O     
4546 C  CB    . GLU F 135 ? 0.3969 0.3198 0.3424 -0.0078 -0.0289 0.0108  134 GLU B CB    
4547 C  CG    . GLU F 135 ? 0.4819 0.3326 0.3847 -0.0270 -0.0405 0.0150  134 GLU B CG    
4548 C  CD    . GLU F 135 ? 0.5470 0.3251 0.4516 -0.0168 -0.0475 0.0186  134 GLU B CD    
4549 O  OE1   . GLU F 135 ? 0.5947 0.2951 0.4457 -0.0142 -0.0580 0.0168  134 GLU B OE1   
4550 O  OE2   . GLU F 135 ? 0.5638 0.3168 0.4830 -0.0210 -0.0766 0.0456  134 GLU B OE2   
4551 N  N     . LYS F 136 ? 0.3924 0.3288 0.3221 -0.0267 -0.0097 0.0225  135 LYS B N     
4552 C  CA    . LYS F 136 ? 0.3967 0.3262 0.3060 -0.0376 0.0028  0.0204  135 LYS B CA    
4553 C  C     . LYS F 136 ? 0.3945 0.3236 0.2907 -0.0411 0.0077  0.0183  135 LYS B C     
4554 O  O     . LYS F 136 ? 0.4179 0.3276 0.2926 -0.0456 0.0072  0.0169  135 LYS B O     
4555 C  CB    . LYS F 136 ? 0.3797 0.3274 0.3056 -0.0411 0.0060  0.0227  135 LYS B CB    
4556 C  CG    . LYS F 136 ? 0.3908 0.3473 0.3176 -0.0546 0.0144  0.0303  135 LYS B CG    
4557 C  CD    . LYS F 136 ? 0.3967 0.3627 0.3501 -0.0788 0.0349  0.0397  135 LYS B CD    
4558 C  CE    . LYS F 136 ? 0.3609 0.3715 0.3836 -0.0751 0.0566  0.0314  135 LYS B CE    
4559 N  NZ    . LYS F 136 ? 0.3283 0.4041 0.4364 -0.0598 0.0692  0.0360  135 LYS B NZ    
4560 N  N     . GLU F 137 ? 0.3707 0.3084 0.2739 -0.0437 0.0147  0.0198  136 GLU B N     
4561 C  CA    . GLU F 137 ? 0.3621 0.3104 0.2639 -0.0364 0.0163  0.0223  136 GLU B CA    
4562 C  C     . GLU F 137 ? 0.3606 0.2944 0.2599 -0.0255 0.0029  0.0195  136 GLU B C     
4563 O  O     . GLU F 137 ? 0.3702 0.2919 0.2568 -0.0286 -0.0099 0.0299  136 GLU B O     
4564 C  CB    . GLU F 137 ? 0.3627 0.3143 0.2658 -0.0361 0.0225  0.0211  136 GLU B CB    
4565 C  CG    . GLU F 137 ? 0.3917 0.3567 0.2797 -0.0603 0.0445  0.0201  136 GLU B CG    
4566 C  CD    . GLU F 137 ? 0.4425 0.4183 0.3153 -0.0628 0.0868  0.0321  136 GLU B CD    
4567 O  OE1   . GLU F 137 ? 0.5108 0.4257 0.2820 -0.0520 0.0660  0.0499  136 GLU B OE1   
4568 O  OE2   . GLU F 137 ? 0.4326 0.4889 0.3681 -0.0617 0.1037  0.0369  136 GLU B OE2   
4569 N  N     . LYS F 138 ? 0.3444 0.2827 0.2547 -0.0219 0.0007  0.0161  137 LYS B N     
4570 C  CA    . LYS F 138 ? 0.3355 0.2704 0.2550 -0.0125 -0.0075 0.0104  137 LYS B CA    
4571 C  C     . LYS F 138 ? 0.3193 0.2577 0.2378 -0.0160 -0.0113 0.0062  137 LYS B C     
4572 O  O     . LYS F 138 ? 0.3309 0.2579 0.2420 -0.0243 0.0009  0.0164  137 LYS B O     
4573 C  CB    . LYS F 138 ? 0.3408 0.2766 0.2600 -0.0050 -0.0049 0.0031  137 LYS B CB    
4574 C  CG    . LYS F 138 ? 0.3685 0.2970 0.3271 0.0172  -0.0210 0.0005  137 LYS B CG    
4575 C  CD    . LYS F 138 ? 0.4288 0.3525 0.3994 0.0424  -0.0364 -0.0071 137 LYS B CD    
4576 C  CE    . LYS F 138 ? 0.4454 0.3383 0.4650 0.0328  -0.0357 -0.0235 137 LYS B CE    
4577 N  NZ    . LYS F 138 ? 0.3937 0.3400 0.4598 0.0699  -0.0655 -0.0313 137 LYS B NZ    
4578 N  N     . ILE F 139 ? 0.2921 0.2303 0.2231 -0.0053 -0.0223 0.0035  138 ILE B N     
4579 C  CA    . ILE F 139 ? 0.2565 0.2256 0.2031 -0.0076 -0.0276 -0.0065 138 ILE B CA    
4580 C  C     . ILE F 139 ? 0.2530 0.2262 0.2076 -0.0034 -0.0243 -0.0032 138 ILE B C     
4