data_4G7H
# 
_entry.id   4G7H 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4G7H         
NDB   NA1930       
RCSB  RCSB073834   
WWPDB D_1000073834 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4G7O . unspecified 
PDB 4G7Z . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4G7H 
_pdbx_database_status.recvd_initial_deposition_date   2012-07-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, Y.'     1 
'Ebright, R.H.' 2 
# 
_citation.id                        primary 
_citation.title                     'Structural basis of transcription initiation.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            338 
_citation.page_first                1076 
_citation.page_last                 1080 
_citation.year                      2012 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23086998 
_citation.pdbx_database_id_DOI      10.1126/science.1227786 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhang, Y.'      1 
primary 'Feng, Y.'       2 
primary 'Chatterjee, S.' 3 
primary 'Tuske, S.'      4 
primary 'Ho, M.X.'       5 
primary 'Arnold, E.'     6 
primary 'Ebright, R.H.'  7 
# 
_cell.entry_id           4G7H 
_cell.length_a           185.560 
_cell.length_b           104.570 
_cell.length_c           297.550 
_cell.angle_alpha        90.00 
_cell.angle_beta         98.32 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4G7H 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-directed RNA polymerase subunit alpha'                                                 35056.164  4   
2.7.7.6 ? ? ?                    
2  polymer     nat 'DNA-directed RNA polymerase subunit beta'                                                  125436.539 2   
2.7.7.6 ? ? ?                    
3  polymer     nat 
;DNA-directed RNA polymerase subunit beta'
;
170997.391 2   2.7.7.6 ? ? ?                    
4  polymer     nat 'DNA-directed RNA polymerase subunit omega'                                                 11533.316  2   
2.7.7.6 ? ? ?                    
5  polymer     man 'RNA polymerase sigma factor'                                                               50769.398  2   ? ? 
? ?                    
6  polymer     syn "5'-D(*CP*CP*T*GP*CP*AP*TP*CP*CP*GP*TP*GP*AP*GP*TP*CP*GP*AP*G)-3'"                          5821.760   2   ? ? 
? 'template strand'    
7  polymer     syn "5'-D(*TP*AP*TP*AP*AP*TP*GP*GP*GP*AP*GP*CP*TP*GP*TP*CP*AP*CP*GP*GP*AP*TP*GP*CP*AP*GP*G)-3'" 8421.432   2   ? ? 
? 'nontemplate strand' 
8  non-polymer syn 'MAGNESIUM ION'                                                                             24.305     10  ? ? 
? ?                    
9  non-polymer syn 'ZINC ION'                                                                                  65.409     4   ? ? 
? ?                    
10 water       nat water                                                                                       18.015     514 ? ? 
? ?                    
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'RNAP subunit alpha, RNA polymerase subunit alpha, Transcriptase subunit alpha'                                    
2 'RNAP subunit beta, RNA polymerase subunit beta, Transcriptase subunit beta'                                       
3 
;RNA polymerase beta-prime subunit, RNAP subunit beta', RNA polymerase subunit beta', Transcriptase subunit beta'
;
4 'RNAP omega subunit, RNA polymerase omega subunit, Transcriptase subunit omega'                                    
5 'RNA polymerase principle sigma factor, sigma A'                                                                   
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
A,B,K,L ? 
2 'polypeptide(L)'        no no 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
C,M     ? 
3 'polypeptide(L)'        no no 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
D,N     ? 
4 'polypeptide(L)'        no no 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
E,O     ? 
5 'polypeptide(L)'        no no 
;MGSSHHHHHHSSGLVPRGSHMKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEG
LDLEEEEEDLPIPKISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSAR
VRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGL
IRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWD
AKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGRE
HTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD
;
;MGSSHHHHHHSSGLVPRGSHMKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEG
LDLEEEEEDLPIPKISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSAR
VRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGL
IRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWD
AKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGRE
HTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD
;
F,P     ? 
6 polydeoxyribonucleotide no no '(DC)(DC)(DT)(DG)(DC)(DA)(DT)(DC)(DC)(DG)(DT)(DG)(DA)(DG)(DT)(DC)(DG)(DA)(DG)' CCTGCATCCGTGAGTCGAG 
G,Q     ? 
7 polydeoxyribonucleotide no no 
;(DT)(DA)(DT)(DA)(DA)(DT)(DG)(DG)(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DA)(DC)(DG)(DG)
(DA)(DT)(DG)(DC)(DA)(DG)(DG)
;
TATAATGGGAGCTGTCACGGATGCAGG H,R     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    LEU n 
1 3    ASP n 
1 4    SER n 
1 5    LYS n 
1 6    LEU n 
1 7    LYS n 
1 8    ALA n 
1 9    PRO n 
1 10   VAL n 
1 11   PHE n 
1 12   THR n 
1 13   VAL n 
1 14   ARG n 
1 15   THR n 
1 16   GLN n 
1 17   GLY n 
1 18   ARG n 
1 19   GLU n 
1 20   TYR n 
1 21   GLY n 
1 22   GLU n 
1 23   PHE n 
1 24   VAL n 
1 25   LEU n 
1 26   GLU n 
1 27   PRO n 
1 28   LEU n 
1 29   GLU n 
1 30   ARG n 
1 31   GLY n 
1 32   PHE n 
1 33   GLY n 
1 34   VAL n 
1 35   THR n 
1 36   LEU n 
1 37   GLY n 
1 38   ASN n 
1 39   PRO n 
1 40   LEU n 
1 41   ARG n 
1 42   ARG n 
1 43   ILE n 
1 44   LEU n 
1 45   LEU n 
1 46   SER n 
1 47   SER n 
1 48   ILE n 
1 49   PRO n 
1 50   GLY n 
1 51   THR n 
1 52   ALA n 
1 53   VAL n 
1 54   THR n 
1 55   SER n 
1 56   VAL n 
1 57   TYR n 
1 58   ILE n 
1 59   GLU n 
1 60   ASP n 
1 61   VAL n 
1 62   LEU n 
1 63   HIS n 
1 64   GLU n 
1 65   PHE n 
1 66   SER n 
1 67   THR n 
1 68   ILE n 
1 69   PRO n 
1 70   GLY n 
1 71   VAL n 
1 72   LYS n 
1 73   GLU n 
1 74   ASP n 
1 75   VAL n 
1 76   VAL n 
1 77   GLU n 
1 78   ILE n 
1 79   ILE n 
1 80   LEU n 
1 81   ASN n 
1 82   LEU n 
1 83   LYS n 
1 84   GLU n 
1 85   LEU n 
1 86   VAL n 
1 87   VAL n 
1 88   ARG n 
1 89   PHE n 
1 90   LEU n 
1 91   ASN n 
1 92   PRO n 
1 93   SER n 
1 94   LEU n 
1 95   GLN n 
1 96   THR n 
1 97   VAL n 
1 98   THR n 
1 99   LEU n 
1 100  LEU n 
1 101  LEU n 
1 102  LYS n 
1 103  ALA n 
1 104  GLU n 
1 105  GLY n 
1 106  PRO n 
1 107  LYS n 
1 108  GLU n 
1 109  VAL n 
1 110  LYS n 
1 111  ALA n 
1 112  ARG n 
1 113  ASP n 
1 114  PHE n 
1 115  LEU n 
1 116  PRO n 
1 117  VAL n 
1 118  ALA n 
1 119  ASP n 
1 120  VAL n 
1 121  GLU n 
1 122  ILE n 
1 123  MET n 
1 124  ASN n 
1 125  PRO n 
1 126  ASP n 
1 127  LEU n 
1 128  HIS n 
1 129  ILE n 
1 130  ALA n 
1 131  THR n 
1 132  LEU n 
1 133  GLU n 
1 134  GLU n 
1 135  GLY n 
1 136  GLY n 
1 137  ARG n 
1 138  LEU n 
1 139  ASN n 
1 140  MET n 
1 141  GLU n 
1 142  VAL n 
1 143  ARG n 
1 144  VAL n 
1 145  ASP n 
1 146  ARG n 
1 147  GLY n 
1 148  VAL n 
1 149  GLY n 
1 150  TYR n 
1 151  VAL n 
1 152  PRO n 
1 153  ALA n 
1 154  GLU n 
1 155  LYS n 
1 156  HIS n 
1 157  GLY n 
1 158  ILE n 
1 159  LYS n 
1 160  ASP n 
1 161  ARG n 
1 162  ILE n 
1 163  ASN n 
1 164  ALA n 
1 165  ILE n 
1 166  PRO n 
1 167  VAL n 
1 168  ASP n 
1 169  ALA n 
1 170  VAL n 
1 171  PHE n 
1 172  SER n 
1 173  PRO n 
1 174  VAL n 
1 175  ARG n 
1 176  ARG n 
1 177  VAL n 
1 178  ALA n 
1 179  PHE n 
1 180  GLN n 
1 181  VAL n 
1 182  GLU n 
1 183  ASP n 
1 184  THR n 
1 185  ARG n 
1 186  LEU n 
1 187  GLY n 
1 188  GLN n 
1 189  ARG n 
1 190  THR n 
1 191  ASP n 
1 192  LEU n 
1 193  ASP n 
1 194  LYS n 
1 195  LEU n 
1 196  THR n 
1 197  LEU n 
1 198  ARG n 
1 199  ILE n 
1 200  TRP n 
1 201  THR n 
1 202  ASP n 
1 203  GLY n 
1 204  SER n 
1 205  VAL n 
1 206  THR n 
1 207  PRO n 
1 208  LEU n 
1 209  GLU n 
1 210  ALA n 
1 211  LEU n 
1 212  ASN n 
1 213  GLN n 
1 214  ALA n 
1 215  VAL n 
1 216  GLU n 
1 217  ILE n 
1 218  LEU n 
1 219  ARG n 
1 220  GLU n 
1 221  HIS n 
1 222  LEU n 
1 223  THR n 
1 224  TYR n 
1 225  PHE n 
1 226  SER n 
1 227  ASN n 
1 228  PRO n 
1 229  GLN n 
1 230  ALA n 
1 231  ALA n 
1 232  ALA n 
1 233  VAL n 
1 234  ALA n 
1 235  ALA n 
1 236  PRO n 
1 237  GLU n 
1 238  GLU n 
1 239  ALA n 
1 240  LYS n 
1 241  GLU n 
1 242  PRO n 
1 243  GLU n 
1 244  ALA n 
1 245  PRO n 
1 246  PRO n 
1 247  GLU n 
1 248  GLN n 
1 249  GLU n 
1 250  GLU n 
1 251  GLU n 
1 252  LEU n 
1 253  ASP n 
1 254  LEU n 
1 255  PRO n 
1 256  LEU n 
1 257  GLU n 
1 258  GLU n 
1 259  LEU n 
1 260  GLY n 
1 261  LEU n 
1 262  SER n 
1 263  THR n 
1 264  ARG n 
1 265  VAL n 
1 266  LEU n 
1 267  HIS n 
1 268  SER n 
1 269  LEU n 
1 270  LYS n 
1 271  GLU n 
1 272  GLU n 
1 273  GLY n 
1 274  ILE n 
1 275  GLU n 
1 276  SER n 
1 277  VAL n 
1 278  ARG n 
1 279  ALA n 
1 280  LEU n 
1 281  LEU n 
1 282  ALA n 
1 283  LEU n 
1 284  ASN n 
1 285  LEU n 
1 286  LYS n 
1 287  ASP n 
1 288  LEU n 
1 289  LYS n 
1 290  ASN n 
1 291  ILE n 
1 292  PRO n 
1 293  GLY n 
1 294  ILE n 
1 295  GLY n 
1 296  GLU n 
1 297  ARG n 
1 298  SER n 
1 299  LEU n 
1 300  GLU n 
1 301  GLU n 
1 302  ILE n 
1 303  LYS n 
1 304  GLU n 
1 305  ALA n 
1 306  LEU n 
1 307  GLU n 
1 308  LYS n 
1 309  LYS n 
1 310  GLY n 
1 311  PHE n 
1 312  THR n 
1 313  LEU n 
1 314  LYS n 
1 315  GLU n 
2 1    MET n 
2 2    GLU n 
2 3    ILE n 
2 4    LYS n 
2 5    ARG n 
2 6    PHE n 
2 7    GLY n 
2 8    ARG n 
2 9    ILE n 
2 10   ARG n 
2 11   GLU n 
2 12   VAL n 
2 13   ILE n 
2 14   PRO n 
2 15   LEU n 
2 16   PRO n 
2 17   PRO n 
2 18   LEU n 
2 19   THR n 
2 20   GLU n 
2 21   ILE n 
2 22   GLN n 
2 23   VAL n 
2 24   GLU n 
2 25   SER n 
2 26   TYR n 
2 27   ARG n 
2 28   ARG n 
2 29   ALA n 
2 30   LEU n 
2 31   GLN n 
2 32   ALA n 
2 33   ASP n 
2 34   VAL n 
2 35   PRO n 
2 36   PRO n 
2 37   GLU n 
2 38   LYS n 
2 39   ARG n 
2 40   GLU n 
2 41   ASN n 
2 42   VAL n 
2 43   GLY n 
2 44   ILE n 
2 45   GLN n 
2 46   ALA n 
2 47   ALA n 
2 48   PHE n 
2 49   ARG n 
2 50   GLU n 
2 51   THR n 
2 52   PHE n 
2 53   PRO n 
2 54   ILE n 
2 55   GLU n 
2 56   GLU n 
2 57   GLU n 
2 58   ASP n 
2 59   LYS n 
2 60   GLY n 
2 61   LYS n 
2 62   GLY n 
2 63   GLY n 
2 64   LEU n 
2 65   VAL n 
2 66   LEU n 
2 67   ASP n 
2 68   PHE n 
2 69   LEU n 
2 70   GLU n 
2 71   TYR n 
2 72   ARG n 
2 73   LEU n 
2 74   GLY n 
2 75   GLU n 
2 76   PRO n 
2 77   PRO n 
2 78   PHE n 
2 79   PRO n 
2 80   GLN n 
2 81   ASP n 
2 82   GLU n 
2 83   CYS n 
2 84   ARG n 
2 85   GLU n 
2 86   LYS n 
2 87   ASP n 
2 88   LEU n 
2 89   THR n 
2 90   TYR n 
2 91   GLN n 
2 92   ALA n 
2 93   PRO n 
2 94   LEU n 
2 95   TYR n 
2 96   ALA n 
2 97   ARG n 
2 98   LEU n 
2 99   GLN n 
2 100  LEU n 
2 101  ILE n 
2 102  HIS n 
2 103  LYS n 
2 104  ASP n 
2 105  THR n 
2 106  GLY n 
2 107  LEU n 
2 108  ILE n 
2 109  LYS n 
2 110  GLU n 
2 111  ASP n 
2 112  GLU n 
2 113  VAL n 
2 114  PHE n 
2 115  LEU n 
2 116  GLY n 
2 117  HIS n 
2 118  ILE n 
2 119  PRO n 
2 120  LEU n 
2 121  MET n 
2 122  THR n 
2 123  GLU n 
2 124  ASP n 
2 125  GLY n 
2 126  SER n 
2 127  PHE n 
2 128  ILE n 
2 129  ILE n 
2 130  ASN n 
2 131  GLY n 
2 132  ALA n 
2 133  ASP n 
2 134  ARG n 
2 135  VAL n 
2 136  ILE n 
2 137  VAL n 
2 138  SER n 
2 139  GLN n 
2 140  ILE n 
2 141  HIS n 
2 142  ARG n 
2 143  SER n 
2 144  PRO n 
2 145  GLY n 
2 146  VAL n 
2 147  TYR n 
2 148  PHE n 
2 149  THR n 
2 150  PRO n 
2 151  ASP n 
2 152  PRO n 
2 153  ALA n 
2 154  ARG n 
2 155  PRO n 
2 156  GLY n 
2 157  ARG n 
2 158  TYR n 
2 159  ILE n 
2 160  ALA n 
2 161  SER n 
2 162  ILE n 
2 163  ILE n 
2 164  PRO n 
2 165  LEU n 
2 166  PRO n 
2 167  LYS n 
2 168  ARG n 
2 169  GLY n 
2 170  PRO n 
2 171  TRP n 
2 172  ILE n 
2 173  ASP n 
2 174  LEU n 
2 175  GLU n 
2 176  VAL n 
2 177  GLU n 
2 178  PRO n 
2 179  ASN n 
2 180  GLY n 
2 181  VAL n 
2 182  VAL n 
2 183  SER n 
2 184  MET n 
2 185  LYS n 
2 186  VAL n 
2 187  ASN n 
2 188  LYS n 
2 189  ARG n 
2 190  LYS n 
2 191  PHE n 
2 192  PRO n 
2 193  LEU n 
2 194  VAL n 
2 195  LEU n 
2 196  LEU n 
2 197  LEU n 
2 198  ARG n 
2 199  VAL n 
2 200  LEU n 
2 201  GLY n 
2 202  TYR n 
2 203  ASP n 
2 204  GLN n 
2 205  GLU n 
2 206  THR n 
2 207  LEU n 
2 208  ALA n 
2 209  ARG n 
2 210  GLU n 
2 211  LEU n 
2 212  GLY n 
2 213  ALA n 
2 214  TYR n 
2 215  GLY n 
2 216  GLU n 
2 217  LEU n 
2 218  VAL n 
2 219  GLN n 
2 220  GLY n 
2 221  LEU n 
2 222  MET n 
2 223  ASP n 
2 224  GLU n 
2 225  SER n 
2 226  VAL n 
2 227  PHE n 
2 228  ALA n 
2 229  MET n 
2 230  ARG n 
2 231  PRO n 
2 232  GLU n 
2 233  GLU n 
2 234  ALA n 
2 235  LEU n 
2 236  ILE n 
2 237  ARG n 
2 238  LEU n 
2 239  PHE n 
2 240  THR n 
2 241  LEU n 
2 242  LEU n 
2 243  ARG n 
2 244  PRO n 
2 245  GLY n 
2 246  ASP n 
2 247  PRO n 
2 248  PRO n 
2 249  LYS n 
2 250  ARG n 
2 251  ASP n 
2 252  LYS n 
2 253  ALA n 
2 254  VAL n 
2 255  ALA n 
2 256  TYR n 
2 257  VAL n 
2 258  TYR n 
2 259  GLY n 
2 260  LEU n 
2 261  ILE n 
2 262  ALA n 
2 263  ASP n 
2 264  PRO n 
2 265  ARG n 
2 266  ARG n 
2 267  TYR n 
2 268  ASP n 
2 269  LEU n 
2 270  GLY n 
2 271  GLU n 
2 272  ALA n 
2 273  GLY n 
2 274  ARG n 
2 275  TYR n 
2 276  LYS n 
2 277  ALA n 
2 278  GLU n 
2 279  GLU n 
2 280  LYS n 
2 281  LEU n 
2 282  GLY n 
2 283  ILE n 
2 284  ARG n 
2 285  LEU n 
2 286  SER n 
2 287  GLY n 
2 288  ARG n 
2 289  THR n 
2 290  LEU n 
2 291  ALA n 
2 292  ARG n 
2 293  PHE n 
2 294  GLU n 
2 295  ASP n 
2 296  GLY n 
2 297  GLU n 
2 298  PHE n 
2 299  LYS n 
2 300  ASP n 
2 301  GLU n 
2 302  VAL n 
2 303  PHE n 
2 304  LEU n 
2 305  PRO n 
2 306  THR n 
2 307  LEU n 
2 308  ARG n 
2 309  TYR n 
2 310  LEU n 
2 311  PHE n 
2 312  ALA n 
2 313  LEU n 
2 314  THR n 
2 315  ALA n 
2 316  GLY n 
2 317  VAL n 
2 318  PRO n 
2 319  GLY n 
2 320  HIS n 
2 321  GLU n 
2 322  VAL n 
2 323  ASP n 
2 324  ASP n 
2 325  ILE n 
2 326  ASP n 
2 327  HIS n 
2 328  LEU n 
2 329  GLY n 
2 330  ASN n 
2 331  ARG n 
2 332  ARG n 
2 333  ILE n 
2 334  ARG n 
2 335  THR n 
2 336  VAL n 
2 337  GLY n 
2 338  GLU n 
2 339  LEU n 
2 340  MET n 
2 341  THR n 
2 342  ASP n 
2 343  GLN n 
2 344  PHE n 
2 345  ARG n 
2 346  VAL n 
2 347  GLY n 
2 348  LEU n 
2 349  ALA n 
2 350  ARG n 
2 351  LEU n 
2 352  ALA n 
2 353  ARG n 
2 354  GLY n 
2 355  VAL n 
2 356  ARG n 
2 357  GLU n 
2 358  ARG n 
2 359  MET n 
2 360  LEU n 
2 361  MET n 
2 362  GLY n 
2 363  SER n 
2 364  GLU n 
2 365  ASP n 
2 366  SER n 
2 367  LEU n 
2 368  THR n 
2 369  PRO n 
2 370  ALA n 
2 371  LYS n 
2 372  LEU n 
2 373  VAL n 
2 374  ASN n 
2 375  SER n 
2 376  ARG n 
2 377  PRO n 
2 378  LEU n 
2 379  GLU n 
2 380  ALA n 
2 381  ALA n 
2 382  ILE n 
2 383  ARG n 
2 384  GLU n 
2 385  PHE n 
2 386  PHE n 
2 387  SER n 
2 388  ARG n 
2 389  SER n 
2 390  GLN n 
2 391  LEU n 
2 392  SER n 
2 393  GLN n 
2 394  PHE n 
2 395  LYS n 
2 396  ASP n 
2 397  GLU n 
2 398  THR n 
2 399  ASN n 
2 400  PRO n 
2 401  LEU n 
2 402  SER n 
2 403  SER n 
2 404  LEU n 
2 405  ARG n 
2 406  HIS n 
2 407  LYS n 
2 408  ARG n 
2 409  ARG n 
2 410  ILE n 
2 411  SER n 
2 412  ALA n 
2 413  LEU n 
2 414  GLY n 
2 415  PRO n 
2 416  GLY n 
2 417  GLY n 
2 418  LEU n 
2 419  THR n 
2 420  ARG n 
2 421  GLU n 
2 422  ARG n 
2 423  ALA n 
2 424  GLY n 
2 425  PHE n 
2 426  ASP n 
2 427  VAL n 
2 428  ARG n 
2 429  ASP n 
2 430  VAL n 
2 431  HIS n 
2 432  ARG n 
2 433  THR n 
2 434  HIS n 
2 435  TYR n 
2 436  GLY n 
2 437  ARG n 
2 438  ILE n 
2 439  CYS n 
2 440  PRO n 
2 441  VAL n 
2 442  GLU n 
2 443  THR n 
2 444  PRO n 
2 445  GLU n 
2 446  GLY n 
2 447  ALA n 
2 448  ASN n 
2 449  ILE n 
2 450  GLY n 
2 451  LEU n 
2 452  ILE n 
2 453  THR n 
2 454  SER n 
2 455  LEU n 
2 456  ALA n 
2 457  ALA n 
2 458  TYR n 
2 459  ALA n 
2 460  ARG n 
2 461  VAL n 
2 462  ASP n 
2 463  GLU n 
2 464  LEU n 
2 465  GLY n 
2 466  PHE n 
2 467  ILE n 
2 468  ARG n 
2 469  THR n 
2 470  PRO n 
2 471  TYR n 
2 472  ARG n 
2 473  ARG n 
2 474  VAL n 
2 475  VAL n 
2 476  GLY n 
2 477  GLY n 
2 478  VAL n 
2 479  VAL n 
2 480  THR n 
2 481  ASP n 
2 482  GLU n 
2 483  VAL n 
2 484  VAL n 
2 485  TYR n 
2 486  MET n 
2 487  THR n 
2 488  ALA n 
2 489  THR n 
2 490  GLU n 
2 491  GLU n 
2 492  ASP n 
2 493  ARG n 
2 494  TYR n 
2 495  THR n 
2 496  ILE n 
2 497  ALA n 
2 498  GLN n 
2 499  ALA n 
2 500  ASN n 
2 501  THR n 
2 502  PRO n 
2 503  LEU n 
2 504  GLU n 
2 505  GLY n 
2 506  ASN n 
2 507  ARG n 
2 508  ILE n 
2 509  ALA n 
2 510  ALA n 
2 511  GLU n 
2 512  ARG n 
2 513  VAL n 
2 514  VAL n 
2 515  ALA n 
2 516  ARG n 
2 517  ARG n 
2 518  LYS n 
2 519  GLY n 
2 520  GLU n 
2 521  PRO n 
2 522  VAL n 
2 523  ILE n 
2 524  VAL n 
2 525  SER n 
2 526  PRO n 
2 527  GLU n 
2 528  GLU n 
2 529  VAL n 
2 530  GLU n 
2 531  PHE n 
2 532  MET n 
2 533  ASP n 
2 534  VAL n 
2 535  SER n 
2 536  PRO n 
2 537  LYS n 
2 538  GLN n 
2 539  VAL n 
2 540  PHE n 
2 541  SER n 
2 542  VAL n 
2 543  ASN n 
2 544  THR n 
2 545  ASN n 
2 546  LEU n 
2 547  ILE n 
2 548  PRO n 
2 549  PHE n 
2 550  LEU n 
2 551  GLU n 
2 552  HIS n 
2 553  ASP n 
2 554  ASP n 
2 555  ALA n 
2 556  ASN n 
2 557  ARG n 
2 558  ALA n 
2 559  LEU n 
2 560  MET n 
2 561  GLY n 
2 562  SER n 
2 563  ASN n 
2 564  MET n 
2 565  GLN n 
2 566  THR n 
2 567  GLN n 
2 568  ALA n 
2 569  VAL n 
2 570  PRO n 
2 571  LEU n 
2 572  ILE n 
2 573  ARG n 
2 574  ALA n 
2 575  GLN n 
2 576  ALA n 
2 577  PRO n 
2 578  VAL n 
2 579  VAL n 
2 580  MET n 
2 581  THR n 
2 582  GLY n 
2 583  LEU n 
2 584  GLU n 
2 585  GLU n 
2 586  ARG n 
2 587  VAL n 
2 588  VAL n 
2 589  ARG n 
2 590  ASP n 
2 591  SER n 
2 592  LEU n 
2 593  ALA n 
2 594  ALA n 
2 595  LEU n 
2 596  TYR n 
2 597  ALA n 
2 598  GLU n 
2 599  GLU n 
2 600  ASP n 
2 601  GLY n 
2 602  GLU n 
2 603  VAL n 
2 604  ALA n 
2 605  LYS n 
2 606  VAL n 
2 607  ASP n 
2 608  GLY n 
2 609  ASN n 
2 610  ARG n 
2 611  ILE n 
2 612  VAL n 
2 613  VAL n 
2 614  ARG n 
2 615  TYR n 
2 616  GLU n 
2 617  ASP n 
2 618  GLY n 
2 619  ARG n 
2 620  LEU n 
2 621  VAL n 
2 622  GLU n 
2 623  TYR n 
2 624  PRO n 
2 625  LEU n 
2 626  ARG n 
2 627  ARG n 
2 628  PHE n 
2 629  TYR n 
2 630  ARG n 
2 631  SER n 
2 632  ASN n 
2 633  GLN n 
2 634  GLY n 
2 635  THR n 
2 636  ALA n 
2 637  LEU n 
2 638  ASP n 
2 639  GLN n 
2 640  ARG n 
2 641  PRO n 
2 642  ARG n 
2 643  VAL n 
2 644  VAL n 
2 645  VAL n 
2 646  GLY n 
2 647  GLN n 
2 648  ARG n 
2 649  VAL n 
2 650  ARG n 
2 651  LYS n 
2 652  GLY n 
2 653  ASP n 
2 654  LEU n 
2 655  LEU n 
2 656  ALA n 
2 657  ASP n 
2 658  GLY n 
2 659  PRO n 
2 660  ALA n 
2 661  SER n 
2 662  GLU n 
2 663  ASN n 
2 664  GLY n 
2 665  PHE n 
2 666  LEU n 
2 667  ALA n 
2 668  LEU n 
2 669  GLY n 
2 670  GLN n 
2 671  ASN n 
2 672  VAL n 
2 673  LEU n 
2 674  VAL n 
2 675  ALA n 
2 676  ILE n 
2 677  MET n 
2 678  PRO n 
2 679  PHE n 
2 680  ASP n 
2 681  GLY n 
2 682  TYR n 
2 683  ASN n 
2 684  PHE n 
2 685  GLU n 
2 686  ASP n 
2 687  ALA n 
2 688  ILE n 
2 689  VAL n 
2 690  ILE n 
2 691  SER n 
2 692  GLU n 
2 693  GLU n 
2 694  LEU n 
2 695  LEU n 
2 696  LYS n 
2 697  ARG n 
2 698  ASP n 
2 699  PHE n 
2 700  TYR n 
2 701  THR n 
2 702  SER n 
2 703  ILE n 
2 704  HIS n 
2 705  ILE n 
2 706  GLU n 
2 707  ARG n 
2 708  TYR n 
2 709  GLU n 
2 710  ILE n 
2 711  GLU n 
2 712  ALA n 
2 713  ARG n 
2 714  ASP n 
2 715  THR n 
2 716  LYS n 
2 717  LEU n 
2 718  GLY n 
2 719  PRO n 
2 720  GLU n 
2 721  ARG n 
2 722  ILE n 
2 723  THR n 
2 724  ARG n 
2 725  ASP n 
2 726  ILE n 
2 727  PRO n 
2 728  HIS n 
2 729  LEU n 
2 730  SER n 
2 731  GLU n 
2 732  ALA n 
2 733  ALA n 
2 734  LEU n 
2 735  ARG n 
2 736  ASP n 
2 737  LEU n 
2 738  ASP n 
2 739  GLU n 
2 740  GLU n 
2 741  GLY n 
2 742  VAL n 
2 743  VAL n 
2 744  ARG n 
2 745  ILE n 
2 746  GLY n 
2 747  ALA n 
2 748  GLU n 
2 749  VAL n 
2 750  LYS n 
2 751  PRO n 
2 752  GLY n 
2 753  ASP n 
2 754  ILE n 
2 755  LEU n 
2 756  VAL n 
2 757  GLY n 
2 758  ARG n 
2 759  THR n 
2 760  SER n 
2 761  PHE n 
2 762  LYS n 
2 763  GLY n 
2 764  GLU n 
2 765  SER n 
2 766  GLU n 
2 767  PRO n 
2 768  THR n 
2 769  PRO n 
2 770  GLU n 
2 771  GLU n 
2 772  ARG n 
2 773  LEU n 
2 774  LEU n 
2 775  ARG n 
2 776  SER n 
2 777  ILE n 
2 778  PHE n 
2 779  GLY n 
2 780  GLU n 
2 781  LYS n 
2 782  ALA n 
2 783  ARG n 
2 784  ASP n 
2 785  VAL n 
2 786  LYS n 
2 787  ASP n 
2 788  THR n 
2 789  SER n 
2 790  LEU n 
2 791  ARG n 
2 792  VAL n 
2 793  PRO n 
2 794  PRO n 
2 795  GLY n 
2 796  GLU n 
2 797  GLY n 
2 798  GLY n 
2 799  ILE n 
2 800  VAL n 
2 801  VAL n 
2 802  ARG n 
2 803  THR n 
2 804  VAL n 
2 805  ARG n 
2 806  LEU n 
2 807  ARG n 
2 808  ARG n 
2 809  GLY n 
2 810  ASP n 
2 811  PRO n 
2 812  GLY n 
2 813  VAL n 
2 814  GLU n 
2 815  LEU n 
2 816  LYS n 
2 817  PRO n 
2 818  GLY n 
2 819  VAL n 
2 820  ARG n 
2 821  GLU n 
2 822  VAL n 
2 823  VAL n 
2 824  ARG n 
2 825  VAL n 
2 826  TYR n 
2 827  VAL n 
2 828  ALA n 
2 829  GLN n 
2 830  LYS n 
2 831  ARG n 
2 832  LYS n 
2 833  LEU n 
2 834  GLN n 
2 835  VAL n 
2 836  GLY n 
2 837  ASP n 
2 838  LYS n 
2 839  LEU n 
2 840  ALA n 
2 841  ASN n 
2 842  ARG n 
2 843  HIS n 
2 844  GLY n 
2 845  ASN n 
2 846  LYS n 
2 847  GLY n 
2 848  VAL n 
2 849  VAL n 
2 850  ALA n 
2 851  LYS n 
2 852  ILE n 
2 853  LEU n 
2 854  PRO n 
2 855  VAL n 
2 856  GLU n 
2 857  ASP n 
2 858  MET n 
2 859  PRO n 
2 860  HIS n 
2 861  LEU n 
2 862  PRO n 
2 863  ASP n 
2 864  GLY n 
2 865  THR n 
2 866  PRO n 
2 867  VAL n 
2 868  ASP n 
2 869  VAL n 
2 870  ILE n 
2 871  LEU n 
2 872  ASN n 
2 873  PRO n 
2 874  LEU n 
2 875  GLY n 
2 876  VAL n 
2 877  PRO n 
2 878  SER n 
2 879  ARG n 
2 880  MET n 
2 881  ASN n 
2 882  LEU n 
2 883  GLY n 
2 884  GLN n 
2 885  ILE n 
2 886  LEU n 
2 887  GLU n 
2 888  THR n 
2 889  HIS n 
2 890  LEU n 
2 891  GLY n 
2 892  LEU n 
2 893  ALA n 
2 894  GLY n 
2 895  TYR n 
2 896  PHE n 
2 897  LEU n 
2 898  GLY n 
2 899  GLN n 
2 900  ARG n 
2 901  TYR n 
2 902  ILE n 
2 903  SER n 
2 904  PRO n 
2 905  ILE n 
2 906  PHE n 
2 907  ASP n 
2 908  GLY n 
2 909  ALA n 
2 910  LYS n 
2 911  GLU n 
2 912  PRO n 
2 913  GLU n 
2 914  ILE n 
2 915  LYS n 
2 916  GLU n 
2 917  LEU n 
2 918  LEU n 
2 919  ALA n 
2 920  GLN n 
2 921  ALA n 
2 922  PHE n 
2 923  GLU n 
2 924  VAL n 
2 925  TYR n 
2 926  PHE n 
2 927  GLY n 
2 928  LYS n 
2 929  ARG n 
2 930  LYS n 
2 931  GLY n 
2 932  GLU n 
2 933  GLY n 
2 934  PHE n 
2 935  GLY n 
2 936  VAL n 
2 937  ASP n 
2 938  LYS n 
2 939  ARG n 
2 940  GLU n 
2 941  VAL n 
2 942  GLU n 
2 943  VAL n 
2 944  LEU n 
2 945  ARG n 
2 946  ARG n 
2 947  ALA n 
2 948  GLU n 
2 949  LYS n 
2 950  LEU n 
2 951  GLY n 
2 952  LEU n 
2 953  VAL n 
2 954  THR n 
2 955  PRO n 
2 956  GLY n 
2 957  LYS n 
2 958  THR n 
2 959  PRO n 
2 960  GLU n 
2 961  GLU n 
2 962  GLN n 
2 963  LEU n 
2 964  LYS n 
2 965  GLU n 
2 966  LEU n 
2 967  PHE n 
2 968  LEU n 
2 969  GLN n 
2 970  GLY n 
2 971  LYS n 
2 972  VAL n 
2 973  VAL n 
2 974  LEU n 
2 975  TYR n 
2 976  ASP n 
2 977  GLY n 
2 978  ARG n 
2 979  THR n 
2 980  GLY n 
2 981  GLU n 
2 982  PRO n 
2 983  ILE n 
2 984  GLU n 
2 985  GLY n 
2 986  PRO n 
2 987  ILE n 
2 988  VAL n 
2 989  VAL n 
2 990  GLY n 
2 991  GLN n 
2 992  MET n 
2 993  PHE n 
2 994  ILE n 
2 995  MET n 
2 996  LYS n 
2 997  LEU n 
2 998  TYR n 
2 999  HIS n 
2 1000 MET n 
2 1001 VAL n 
2 1002 GLU n 
2 1003 ASP n 
2 1004 LYS n 
2 1005 MET n 
2 1006 HIS n 
2 1007 ALA n 
2 1008 ARG n 
2 1009 SER n 
2 1010 THR n 
2 1011 GLY n 
2 1012 PRO n 
2 1013 TYR n 
2 1014 SER n 
2 1015 LEU n 
2 1016 ILE n 
2 1017 THR n 
2 1018 GLN n 
2 1019 GLN n 
2 1020 PRO n 
2 1021 LEU n 
2 1022 GLY n 
2 1023 GLY n 
2 1024 LYS n 
2 1025 ALA n 
2 1026 GLN n 
2 1027 PHE n 
2 1028 GLY n 
2 1029 GLY n 
2 1030 GLN n 
2 1031 ARG n 
2 1032 PHE n 
2 1033 GLY n 
2 1034 GLU n 
2 1035 MET n 
2 1036 GLU n 
2 1037 VAL n 
2 1038 TRP n 
2 1039 ALA n 
2 1040 LEU n 
2 1041 GLU n 
2 1042 ALA n 
2 1043 TYR n 
2 1044 GLY n 
2 1045 ALA n 
2 1046 ALA n 
2 1047 HIS n 
2 1048 THR n 
2 1049 LEU n 
2 1050 GLN n 
2 1051 GLU n 
2 1052 MET n 
2 1053 LEU n 
2 1054 THR n 
2 1055 LEU n 
2 1056 LYS n 
2 1057 SER n 
2 1058 ASP n 
2 1059 ASP n 
2 1060 ILE n 
2 1061 GLU n 
2 1062 GLY n 
2 1063 ARG n 
2 1064 ASN n 
2 1065 ALA n 
2 1066 ALA n 
2 1067 TYR n 
2 1068 GLU n 
2 1069 ALA n 
2 1070 ILE n 
2 1071 ILE n 
2 1072 LYS n 
2 1073 GLY n 
2 1074 GLU n 
2 1075 ASP n 
2 1076 VAL n 
2 1077 PRO n 
2 1078 GLU n 
2 1079 PRO n 
2 1080 SER n 
2 1081 VAL n 
2 1082 PRO n 
2 1083 GLU n 
2 1084 SER n 
2 1085 PHE n 
2 1086 ARG n 
2 1087 VAL n 
2 1088 LEU n 
2 1089 VAL n 
2 1090 LYS n 
2 1091 GLU n 
2 1092 LEU n 
2 1093 GLN n 
2 1094 ALA n 
2 1095 LEU n 
2 1096 ALA n 
2 1097 LEU n 
2 1098 ASP n 
2 1099 VAL n 
2 1100 GLN n 
2 1101 THR n 
2 1102 LEU n 
2 1103 ASP n 
2 1104 GLU n 
2 1105 LYS n 
2 1106 ASP n 
2 1107 ASN n 
2 1108 PRO n 
2 1109 VAL n 
2 1110 ASP n 
2 1111 ILE n 
2 1112 PHE n 
2 1113 GLU n 
2 1114 GLY n 
2 1115 LEU n 
2 1116 ALA n 
2 1117 SER n 
2 1118 LYS n 
2 1119 ARG n 
3 1    MET n 
3 2    LYS n 
3 3    LYS n 
3 4    GLU n 
3 5    VAL n 
3 6    ARG n 
3 7    LYS n 
3 8    VAL n 
3 9    ARG n 
3 10   ILE n 
3 11   ALA n 
3 12   LEU n 
3 13   ALA n 
3 14   SER n 
3 15   PRO n 
3 16   GLU n 
3 17   LYS n 
3 18   ILE n 
3 19   ARG n 
3 20   SER n 
3 21   TRP n 
3 22   SER n 
3 23   TYR n 
3 24   GLY n 
3 25   GLU n 
3 26   VAL n 
3 27   GLU n 
3 28   LYS n 
3 29   PRO n 
3 30   GLU n 
3 31   THR n 
3 32   ILE n 
3 33   ASN n 
3 34   TYR n 
3 35   ARG n 
3 36   THR n 
3 37   LEU n 
3 38   LYS n 
3 39   PRO n 
3 40   GLU n 
3 41   ARG n 
3 42   ASP n 
3 43   GLY n 
3 44   LEU n 
3 45   PHE n 
3 46   ASP n 
3 47   GLU n 
3 48   ARG n 
3 49   ILE n 
3 50   PHE n 
3 51   GLY n 
3 52   PRO n 
3 53   ILE n 
3 54   LYS n 
3 55   ASP n 
3 56   TYR n 
3 57   GLU n 
3 58   CYS n 
3 59   ALA n 
3 60   CYS n 
3 61   GLY n 
3 62   LYS n 
3 63   TYR n 
3 64   LYS n 
3 65   ARG n 
3 66   GLN n 
3 67   ARG n 
3 68   PHE n 
3 69   GLU n 
3 70   GLY n 
3 71   LYS n 
3 72   VAL n 
3 73   CYS n 
3 74   GLU n 
3 75   ARG n 
3 76   CYS n 
3 77   GLY n 
3 78   VAL n 
3 79   GLU n 
3 80   VAL n 
3 81   THR n 
3 82   LYS n 
3 83   SER n 
3 84   ILE n 
3 85   VAL n 
3 86   ARG n 
3 87   ARG n 
3 88   TYR n 
3 89   ARG n 
3 90   MET n 
3 91   GLY n 
3 92   HIS n 
3 93   ILE n 
3 94   GLU n 
3 95   LEU n 
3 96   ALA n 
3 97   THR n 
3 98   PRO n 
3 99   ALA n 
3 100  ALA n 
3 101  HIS n 
3 102  ILE n 
3 103  TRP n 
3 104  PHE n 
3 105  VAL n 
3 106  LYS n 
3 107  ASP n 
3 108  VAL n 
3 109  PRO n 
3 110  SER n 
3 111  LYS n 
3 112  ILE n 
3 113  GLY n 
3 114  THR n 
3 115  LEU n 
3 116  LEU n 
3 117  ASP n 
3 118  LEU n 
3 119  SER n 
3 120  ALA n 
3 121  THR n 
3 122  GLU n 
3 123  LEU n 
3 124  GLU n 
3 125  GLN n 
3 126  VAL n 
3 127  LEU n 
3 128  TYR n 
3 129  PHE n 
3 130  SER n 
3 131  LYS n 
3 132  TYR n 
3 133  ILE n 
3 134  VAL n 
3 135  LEU n 
3 136  ASP n 
3 137  PRO n 
3 138  LYS n 
3 139  GLY n 
3 140  ALA n 
3 141  ILE n 
3 142  LEU n 
3 143  ASN n 
3 144  GLY n 
3 145  VAL n 
3 146  PRO n 
3 147  VAL n 
3 148  GLU n 
3 149  LYS n 
3 150  ARG n 
3 151  GLN n 
3 152  LEU n 
3 153  LEU n 
3 154  THR n 
3 155  ASP n 
3 156  GLU n 
3 157  GLU n 
3 158  TYR n 
3 159  ARG n 
3 160  GLU n 
3 161  LEU n 
3 162  ARG n 
3 163  TYR n 
3 164  GLY n 
3 165  LYS n 
3 166  GLN n 
3 167  GLU n 
3 168  THR n 
3 169  TYR n 
3 170  PRO n 
3 171  LEU n 
3 172  PRO n 
3 173  PRO n 
3 174  GLY n 
3 175  VAL n 
3 176  ASP n 
3 177  ALA n 
3 178  LEU n 
3 179  VAL n 
3 180  LYS n 
3 181  ASP n 
3 182  GLY n 
3 183  GLU n 
3 184  GLU n 
3 185  VAL n 
3 186  VAL n 
3 187  LYS n 
3 188  GLY n 
3 189  GLN n 
3 190  GLU n 
3 191  LEU n 
3 192  ALA n 
3 193  PRO n 
3 194  GLY n 
3 195  VAL n 
3 196  VAL n 
3 197  SER n 
3 198  ARG n 
3 199  LEU n 
3 200  ASP n 
3 201  GLY n 
3 202  VAL n 
3 203  ALA n 
3 204  LEU n 
3 205  TYR n 
3 206  ARG n 
3 207  PHE n 
3 208  PRO n 
3 209  ARG n 
3 210  ARG n 
3 211  VAL n 
3 212  ARG n 
3 213  VAL n 
3 214  GLU n 
3 215  TYR n 
3 216  VAL n 
3 217  LYS n 
3 218  LYS n 
3 219  GLU n 
3 220  ARG n 
3 221  ALA n 
3 222  GLY n 
3 223  LEU n 
3 224  ARG n 
3 225  LEU n 
3 226  PRO n 
3 227  LEU n 
3 228  ALA n 
3 229  ALA n 
3 230  TRP n 
3 231  VAL n 
3 232  GLU n 
3 233  LYS n 
3 234  GLU n 
3 235  ALA n 
3 236  TYR n 
3 237  LYS n 
3 238  PRO n 
3 239  GLY n 
3 240  GLU n 
3 241  ILE n 
3 242  LEU n 
3 243  ALA n 
3 244  GLU n 
3 245  LEU n 
3 246  PRO n 
3 247  GLU n 
3 248  PRO n 
3 249  TYR n 
3 250  LEU n 
3 251  PHE n 
3 252  ARG n 
3 253  ALA n 
3 254  GLU n 
3 255  GLU n 
3 256  GLU n 
3 257  GLY n 
3 258  VAL n 
3 259  VAL n 
3 260  GLU n 
3 261  LEU n 
3 262  LYS n 
3 263  GLU n 
3 264  LEU n 
3 265  GLU n 
3 266  GLU n 
3 267  GLY n 
3 268  ALA n 
3 269  PHE n 
3 270  LEU n 
3 271  VAL n 
3 272  LEU n 
3 273  ARG n 
3 274  ARG n 
3 275  GLU n 
3 276  ASP n 
3 277  GLU n 
3 278  PRO n 
3 279  VAL n 
3 280  ALA n 
3 281  THR n 
3 282  TYR n 
3 283  PHE n 
3 284  LEU n 
3 285  PRO n 
3 286  VAL n 
3 287  GLY n 
3 288  MET n 
3 289  THR n 
3 290  PRO n 
3 291  LEU n 
3 292  VAL n 
3 293  VAL n 
3 294  HIS n 
3 295  GLY n 
3 296  GLU n 
3 297  ILE n 
3 298  VAL n 
3 299  GLU n 
3 300  LYS n 
3 301  GLY n 
3 302  GLN n 
3 303  PRO n 
3 304  LEU n 
3 305  ALA n 
3 306  GLU n 
3 307  ALA n 
3 308  LYS n 
3 309  GLY n 
3 310  LEU n 
3 311  LEU n 
3 312  ARG n 
3 313  MET n 
3 314  PRO n 
3 315  ARG n 
3 316  GLN n 
3 317  VAL n 
3 318  ARG n 
3 319  ALA n 
3 320  ALA n 
3 321  GLN n 
3 322  VAL n 
3 323  GLU n 
3 324  ALA n 
3 325  GLU n 
3 326  GLU n 
3 327  GLU n 
3 328  GLY n 
3 329  GLU n 
3 330  THR n 
3 331  VAL n 
3 332  TYR n 
3 333  LEU n 
3 334  THR n 
3 335  LEU n 
3 336  PHE n 
3 337  LEU n 
3 338  GLU n 
3 339  TRP n 
3 340  THR n 
3 341  GLU n 
3 342  PRO n 
3 343  LYS n 
3 344  ASP n 
3 345  TYR n 
3 346  ARG n 
3 347  VAL n 
3 348  GLN n 
3 349  PRO n 
3 350  HIS n 
3 351  MET n 
3 352  ASN n 
3 353  VAL n 
3 354  VAL n 
3 355  VAL n 
3 356  PRO n 
3 357  GLU n 
3 358  GLY n 
3 359  ALA n 
3 360  ARG n 
3 361  VAL n 
3 362  GLU n 
3 363  ALA n 
3 364  GLY n 
3 365  ASP n 
3 366  LYS n 
3 367  ILE n 
3 368  VAL n 
3 369  ALA n 
3 370  ALA n 
3 371  ILE n 
3 372  ASP n 
3 373  PRO n 
3 374  GLU n 
3 375  GLU n 
3 376  GLU n 
3 377  VAL n 
3 378  ILE n 
3 379  ALA n 
3 380  GLU n 
3 381  ALA n 
3 382  GLU n 
3 383  GLY n 
3 384  VAL n 
3 385  VAL n 
3 386  HIS n 
3 387  LEU n 
3 388  HIS n 
3 389  GLU n 
3 390  PRO n 
3 391  ALA n 
3 392  SER n 
3 393  ILE n 
3 394  LEU n 
3 395  VAL n 
3 396  VAL n 
3 397  LYS n 
3 398  ALA n 
3 399  ARG n 
3 400  VAL n 
3 401  TYR n 
3 402  PRO n 
3 403  PHE n 
3 404  GLU n 
3 405  ASP n 
3 406  ASP n 
3 407  VAL n 
3 408  GLU n 
3 409  VAL n 
3 410  SER n 
3 411  THR n 
3 412  GLY n 
3 413  ASP n 
3 414  ARG n 
3 415  VAL n 
3 416  ALA n 
3 417  PRO n 
3 418  GLY n 
3 419  ASP n 
3 420  VAL n 
3 421  LEU n 
3 422  ALA n 
3 423  ASP n 
3 424  GLY n 
3 425  GLY n 
3 426  LYS n 
3 427  VAL n 
3 428  LYS n 
3 429  SER n 
3 430  ASP n 
3 431  VAL n 
3 432  TYR n 
3 433  GLY n 
3 434  ARG n 
3 435  VAL n 
3 436  GLU n 
3 437  VAL n 
3 438  ASP n 
3 439  LEU n 
3 440  VAL n 
3 441  ARG n 
3 442  ASN n 
3 443  VAL n 
3 444  VAL n 
3 445  ARG n 
3 446  VAL n 
3 447  VAL n 
3 448  GLU n 
3 449  SER n 
3 450  TYR n 
3 451  ASP n 
3 452  ILE n 
3 453  ASP n 
3 454  ALA n 
3 455  ARG n 
3 456  MET n 
3 457  GLY n 
3 458  ALA n 
3 459  GLU n 
3 460  ALA n 
3 461  ILE n 
3 462  GLN n 
3 463  GLN n 
3 464  LEU n 
3 465  LEU n 
3 466  LYS n 
3 467  GLU n 
3 468  LEU n 
3 469  ASP n 
3 470  LEU n 
3 471  GLU n 
3 472  ALA n 
3 473  LEU n 
3 474  GLU n 
3 475  LYS n 
3 476  GLU n 
3 477  LEU n 
3 478  LEU n 
3 479  GLU n 
3 480  GLU n 
3 481  MET n 
3 482  LYS n 
3 483  HIS n 
3 484  PRO n 
3 485  SER n 
3 486  ARG n 
3 487  ALA n 
3 488  ARG n 
3 489  ARG n 
3 490  ALA n 
3 491  LYS n 
3 492  ALA n 
3 493  ARG n 
3 494  LYS n 
3 495  ARG n 
3 496  LEU n 
3 497  GLU n 
3 498  VAL n 
3 499  VAL n 
3 500  ARG n 
3 501  ALA n 
3 502  PHE n 
3 503  LEU n 
3 504  ASP n 
3 505  SER n 
3 506  GLY n 
3 507  ASN n 
3 508  ARG n 
3 509  PRO n 
3 510  GLU n 
3 511  TRP n 
3 512  MET n 
3 513  ILE n 
3 514  LEU n 
3 515  GLU n 
3 516  ALA n 
3 517  VAL n 
3 518  PRO n 
3 519  VAL n 
3 520  LEU n 
3 521  PRO n 
3 522  PRO n 
3 523  ASP n 
3 524  LEU n 
3 525  ARG n 
3 526  PRO n 
3 527  MET n 
3 528  VAL n 
3 529  GLN n 
3 530  VAL n 
3 531  ASP n 
3 532  GLY n 
3 533  GLY n 
3 534  ARG n 
3 535  PHE n 
3 536  ALA n 
3 537  THR n 
3 538  SER n 
3 539  ASP n 
3 540  LEU n 
3 541  ASN n 
3 542  ASP n 
3 543  LEU n 
3 544  TYR n 
3 545  ARG n 
3 546  ARG n 
3 547  LEU n 
3 548  ILE n 
3 549  ASN n 
3 550  ARG n 
3 551  ASN n 
3 552  ASN n 
3 553  ARG n 
3 554  LEU n 
3 555  LYS n 
3 556  LYS n 
3 557  LEU n 
3 558  LEU n 
3 559  ALA n 
3 560  GLN n 
3 561  GLY n 
3 562  ALA n 
3 563  PRO n 
3 564  GLU n 
3 565  ILE n 
3 566  ILE n 
3 567  ILE n 
3 568  ARG n 
3 569  ASN n 
3 570  GLU n 
3 571  LYS n 
3 572  ARG n 
3 573  MET n 
3 574  LEU n 
3 575  GLN n 
3 576  GLU n 
3 577  ALA n 
3 578  VAL n 
3 579  ASP n 
3 580  ALA n 
3 581  LEU n 
3 582  LEU n 
3 583  ASP n 
3 584  ASN n 
3 585  GLY n 
3 586  ARG n 
3 587  ARG n 
3 588  GLY n 
3 589  ALA n 
3 590  PRO n 
3 591  VAL n 
3 592  THR n 
3 593  ASN n 
3 594  PRO n 
3 595  GLY n 
3 596  SER n 
3 597  ASP n 
3 598  ARG n 
3 599  PRO n 
3 600  LEU n 
3 601  ARG n 
3 602  SER n 
3 603  LEU n 
3 604  THR n 
3 605  ASP n 
3 606  ILE n 
3 607  LEU n 
3 608  SER n 
3 609  GLY n 
3 610  LYS n 
3 611  GLN n 
3 612  GLY n 
3 613  ARG n 
3 614  PHE n 
3 615  ARG n 
3 616  GLN n 
3 617  ASN n 
3 618  LEU n 
3 619  LEU n 
3 620  GLY n 
3 621  LYS n 
3 622  ARG n 
3 623  VAL n 
3 624  ASP n 
3 625  TYR n 
3 626  SER n 
3 627  GLY n 
3 628  ARG n 
3 629  SER n 
3 630  VAL n 
3 631  ILE n 
3 632  VAL n 
3 633  VAL n 
3 634  GLY n 
3 635  PRO n 
3 636  GLN n 
3 637  LEU n 
3 638  LYS n 
3 639  LEU n 
3 640  HIS n 
3 641  GLN n 
3 642  CYS n 
3 643  GLY n 
3 644  LEU n 
3 645  PRO n 
3 646  LYS n 
3 647  ARG n 
3 648  MET n 
3 649  ALA n 
3 650  LEU n 
3 651  GLU n 
3 652  LEU n 
3 653  PHE n 
3 654  LYS n 
3 655  PRO n 
3 656  PHE n 
3 657  LEU n 
3 658  LEU n 
3 659  LYS n 
3 660  LYS n 
3 661  MET n 
3 662  GLU n 
3 663  GLU n 
3 664  LYS n 
3 665  GLY n 
3 666  ILE n 
3 667  ALA n 
3 668  PRO n 
3 669  ASN n 
3 670  VAL n 
3 671  LYS n 
3 672  ALA n 
3 673  ALA n 
3 674  ARG n 
3 675  ARG n 
3 676  MET n 
3 677  LEU n 
3 678  GLU n 
3 679  ARG n 
3 680  GLN n 
3 681  ARG n 
3 682  ASP n 
3 683  ILE n 
3 684  LYS n 
3 685  ASP n 
3 686  GLU n 
3 687  VAL n 
3 688  TRP n 
3 689  ASP n 
3 690  ALA n 
3 691  LEU n 
3 692  GLU n 
3 693  GLU n 
3 694  VAL n 
3 695  ILE n 
3 696  HIS n 
3 697  GLY n 
3 698  LYS n 
3 699  VAL n 
3 700  VAL n 
3 701  LEU n 
3 702  LEU n 
3 703  ASN n 
3 704  ARG n 
3 705  ALA n 
3 706  PRO n 
3 707  THR n 
3 708  LEU n 
3 709  HIS n 
3 710  ARG n 
3 711  LEU n 
3 712  GLY n 
3 713  ILE n 
3 714  GLN n 
3 715  ALA n 
3 716  PHE n 
3 717  GLN n 
3 718  PRO n 
3 719  VAL n 
3 720  LEU n 
3 721  VAL n 
3 722  GLU n 
3 723  GLY n 
3 724  GLN n 
3 725  SER n 
3 726  ILE n 
3 727  GLN n 
3 728  LEU n 
3 729  HIS n 
3 730  PRO n 
3 731  LEU n 
3 732  VAL n 
3 733  CYS n 
3 734  GLU n 
3 735  ALA n 
3 736  PHE n 
3 737  ASN n 
3 738  ALA n 
3 739  ASP n 
3 740  PHE n 
3 741  ASP n 
3 742  GLY n 
3 743  ASP n 
3 744  GLN n 
3 745  MET n 
3 746  ALA n 
3 747  VAL n 
3 748  HIS n 
3 749  VAL n 
3 750  PRO n 
3 751  LEU n 
3 752  SER n 
3 753  SER n 
3 754  PHE n 
3 755  ALA n 
3 756  GLN n 
3 757  ALA n 
3 758  GLU n 
3 759  ALA n 
3 760  ARG n 
3 761  ILE n 
3 762  GLN n 
3 763  MET n 
3 764  LEU n 
3 765  SER n 
3 766  ALA n 
3 767  HIS n 
3 768  ASN n 
3 769  LEU n 
3 770  LEU n 
3 771  SER n 
3 772  PRO n 
3 773  ALA n 
3 774  SER n 
3 775  GLY n 
3 776  GLU n 
3 777  PRO n 
3 778  LEU n 
3 779  ALA n 
3 780  LYS n 
3 781  PRO n 
3 782  SER n 
3 783  ARG n 
3 784  ASP n 
3 785  ILE n 
3 786  ILE n 
3 787  LEU n 
3 788  GLY n 
3 789  LEU n 
3 790  TYR n 
3 791  TYR n 
3 792  ILE n 
3 793  THR n 
3 794  GLN n 
3 795  VAL n 
3 796  ARG n 
3 797  LYS n 
3 798  GLU n 
3 799  LYS n 
3 800  LYS n 
3 801  GLY n 
3 802  ALA n 
3 803  GLY n 
3 804  LEU n 
3 805  GLU n 
3 806  PHE n 
3 807  ALA n 
3 808  THR n 
3 809  PRO n 
3 810  GLU n 
3 811  GLU n 
3 812  ALA n 
3 813  LEU n 
3 814  ALA n 
3 815  ALA n 
3 816  HIS n 
3 817  GLU n 
3 818  ARG n 
3 819  GLY n 
3 820  GLU n 
3 821  VAL n 
3 822  ALA n 
3 823  LEU n 
3 824  ASN n 
3 825  ALA n 
3 826  PRO n 
3 827  ILE n 
3 828  LYS n 
3 829  VAL n 
3 830  ALA n 
3 831  GLY n 
3 832  ARG n 
3 833  GLU n 
3 834  THR n 
3 835  SER n 
3 836  VAL n 
3 837  GLY n 
3 838  ARG n 
3 839  LEU n 
3 840  LYS n 
3 841  TYR n 
3 842  VAL n 
3 843  PHE n 
3 844  ALA n 
3 845  ASN n 
3 846  PRO n 
3 847  ASP n 
3 848  GLU n 
3 849  ALA n 
3 850  LEU n 
3 851  LEU n 
3 852  ALA n 
3 853  VAL n 
3 854  ALA n 
3 855  HIS n 
3 856  GLY n 
3 857  ILE n 
3 858  VAL n 
3 859  ASP n 
3 860  LEU n 
3 861  GLN n 
3 862  ASP n 
3 863  VAL n 
3 864  VAL n 
3 865  THR n 
3 866  VAL n 
3 867  ARG n 
3 868  TYR n 
3 869  MET n 
3 870  GLY n 
3 871  LYS n 
3 872  ARG n 
3 873  LEU n 
3 874  GLU n 
3 875  THR n 
3 876  SER n 
3 877  PRO n 
3 878  GLY n 
3 879  ARG n 
3 880  ILE n 
3 881  LEU n 
3 882  PHE n 
3 883  ALA n 
3 884  ARG n 
3 885  ILE n 
3 886  VAL n 
3 887  ALA n 
3 888  GLU n 
3 889  ALA n 
3 890  VAL n 
3 891  GLU n 
3 892  ASP n 
3 893  GLU n 
3 894  LYS n 
3 895  VAL n 
3 896  ALA n 
3 897  TRP n 
3 898  GLU n 
3 899  LEU n 
3 900  ILE n 
3 901  GLN n 
3 902  LEU n 
3 903  ASP n 
3 904  VAL n 
3 905  PRO n 
3 906  GLN n 
3 907  GLU n 
3 908  LYS n 
3 909  ASN n 
3 910  SER n 
3 911  LEU n 
3 912  LYS n 
3 913  ASP n 
3 914  LEU n 
3 915  VAL n 
3 916  TYR n 
3 917  GLN n 
3 918  ALA n 
3 919  PHE n 
3 920  LEU n 
3 921  ARG n 
3 922  LEU n 
3 923  GLY n 
3 924  MET n 
3 925  GLU n 
3 926  LYS n 
3 927  THR n 
3 928  ALA n 
3 929  ARG n 
3 930  LEU n 
3 931  LEU n 
3 932  ASP n 
3 933  ALA n 
3 934  LEU n 
3 935  LYS n 
3 936  TYR n 
3 937  TYR n 
3 938  GLY n 
3 939  PHE n 
3 940  THR n 
3 941  PHE n 
3 942  SER n 
3 943  THR n 
3 944  THR n 
3 945  SER n 
3 946  GLY n 
3 947  ILE n 
3 948  THR n 
3 949  ILE n 
3 950  GLY n 
3 951  ILE n 
3 952  ASP n 
3 953  ASP n 
3 954  ALA n 
3 955  VAL n 
3 956  ILE n 
3 957  PRO n 
3 958  GLU n 
3 959  GLU n 
3 960  LYS n 
3 961  LYS n 
3 962  GLN n 
3 963  TYR n 
3 964  LEU n 
3 965  GLU n 
3 966  GLU n 
3 967  ALA n 
3 968  ASP n 
3 969  ARG n 
3 970  LYS n 
3 971  LEU n 
3 972  LEU n 
3 973  GLN n 
3 974  ILE n 
3 975  GLU n 
3 976  GLN n 
3 977  ALA n 
3 978  TYR n 
3 979  GLU n 
3 980  MET n 
3 981  GLY n 
3 982  PHE n 
3 983  LEU n 
3 984  THR n 
3 985  ASP n 
3 986  ARG n 
3 987  GLU n 
3 988  ARG n 
3 989  TYR n 
3 990  ASP n 
3 991  GLN n 
3 992  ILE n 
3 993  LEU n 
3 994  GLN n 
3 995  LEU n 
3 996  TRP n 
3 997  THR n 
3 998  GLU n 
3 999  THR n 
3 1000 THR n 
3 1001 GLU n 
3 1002 LYS n 
3 1003 VAL n 
3 1004 THR n 
3 1005 GLN n 
3 1006 ALA n 
3 1007 VAL n 
3 1008 PHE n 
3 1009 LYS n 
3 1010 ASN n 
3 1011 PHE n 
3 1012 GLU n 
3 1013 GLU n 
3 1014 ASN n 
3 1015 TYR n 
3 1016 PRO n 
3 1017 PHE n 
3 1018 ASN n 
3 1019 PRO n 
3 1020 LEU n 
3 1021 TYR n 
3 1022 VAL n 
3 1023 MET n 
3 1024 ALA n 
3 1025 GLN n 
3 1026 SER n 
3 1027 GLY n 
3 1028 ALA n 
3 1029 ARG n 
3 1030 GLY n 
3 1031 ASN n 
3 1032 PRO n 
3 1033 GLN n 
3 1034 GLN n 
3 1035 ILE n 
3 1036 ARG n 
3 1037 GLN n 
3 1038 LEU n 
3 1039 CYS n 
3 1040 GLY n 
3 1041 LEU n 
3 1042 ARG n 
3 1043 GLY n 
3 1044 LEU n 
3 1045 MET n 
3 1046 GLN n 
3 1047 LYS n 
3 1048 PRO n 
3 1049 SER n 
3 1050 GLY n 
3 1051 GLU n 
3 1052 THR n 
3 1053 PHE n 
3 1054 GLU n 
3 1055 VAL n 
3 1056 PRO n 
3 1057 VAL n 
3 1058 ARG n 
3 1059 SER n 
3 1060 SER n 
3 1061 PHE n 
3 1062 ARG n 
3 1063 GLU n 
3 1064 GLY n 
3 1065 LEU n 
3 1066 THR n 
3 1067 VAL n 
3 1068 LEU n 
3 1069 GLU n 
3 1070 TYR n 
3 1071 PHE n 
3 1072 ILE n 
3 1073 SER n 
3 1074 SER n 
3 1075 HIS n 
3 1076 GLY n 
3 1077 ALA n 
3 1078 ARG n 
3 1079 LYS n 
3 1080 GLY n 
3 1081 GLY n 
3 1082 ALA n 
3 1083 ASP n 
3 1084 THR n 
3 1085 ALA n 
3 1086 LEU n 
3 1087 ARG n 
3 1088 THR n 
3 1089 ALA n 
3 1090 ASP n 
3 1091 SER n 
3 1092 GLY n 
3 1093 TYR n 
3 1094 LEU n 
3 1095 THR n 
3 1096 ARG n 
3 1097 LYS n 
3 1098 LEU n 
3 1099 VAL n 
3 1100 ASP n 
3 1101 VAL n 
3 1102 THR n 
3 1103 HIS n 
3 1104 GLU n 
3 1105 ILE n 
3 1106 VAL n 
3 1107 VAL n 
3 1108 ARG n 
3 1109 GLU n 
3 1110 ALA n 
3 1111 ASP n 
3 1112 CYS n 
3 1113 GLY n 
3 1114 THR n 
3 1115 THR n 
3 1116 ASN n 
3 1117 TYR n 
3 1118 ILE n 
3 1119 SER n 
3 1120 VAL n 
3 1121 PRO n 
3 1122 LEU n 
3 1123 PHE n 
3 1124 GLN n 
3 1125 PRO n 
3 1126 ASP n 
3 1127 GLU n 
3 1128 VAL n 
3 1129 THR n 
3 1130 ARG n 
3 1131 SER n 
3 1132 LEU n 
3 1133 ARG n 
3 1134 LEU n 
3 1135 ARG n 
3 1136 LYS n 
3 1137 ARG n 
3 1138 ALA n 
3 1139 ASP n 
3 1140 ILE n 
3 1141 GLU n 
3 1142 ALA n 
3 1143 GLY n 
3 1144 LEU n 
3 1145 TYR n 
3 1146 GLY n 
3 1147 ARG n 
3 1148 VAL n 
3 1149 LEU n 
3 1150 ALA n 
3 1151 ARG n 
3 1152 GLU n 
3 1153 VAL n 
3 1154 GLU n 
3 1155 VAL n 
3 1156 LEU n 
3 1157 GLY n 
3 1158 VAL n 
3 1159 ARG n 
3 1160 LEU n 
3 1161 GLU n 
3 1162 GLU n 
3 1163 GLY n 
3 1164 ARG n 
3 1165 TYR n 
3 1166 LEU n 
3 1167 SER n 
3 1168 MET n 
3 1169 ASP n 
3 1170 ASP n 
3 1171 VAL n 
3 1172 HIS n 
3 1173 LEU n 
3 1174 LEU n 
3 1175 ILE n 
3 1176 LYS n 
3 1177 ALA n 
3 1178 ALA n 
3 1179 GLU n 
3 1180 ALA n 
3 1181 GLY n 
3 1182 GLU n 
3 1183 ILE n 
3 1184 GLN n 
3 1185 GLU n 
3 1186 VAL n 
3 1187 PRO n 
3 1188 VAL n 
3 1189 ARG n 
3 1190 SER n 
3 1191 PRO n 
3 1192 LEU n 
3 1193 THR n 
3 1194 CYS n 
3 1195 GLN n 
3 1196 THR n 
3 1197 ARG n 
3 1198 TYR n 
3 1199 GLY n 
3 1200 VAL n 
3 1201 CYS n 
3 1202 GLN n 
3 1203 LYS n 
3 1204 CYS n 
3 1205 TYR n 
3 1206 GLY n 
3 1207 TYR n 
3 1208 ASP n 
3 1209 LEU n 
3 1210 SER n 
3 1211 MET n 
3 1212 ALA n 
3 1213 ARG n 
3 1214 PRO n 
3 1215 VAL n 
3 1216 SER n 
3 1217 ILE n 
3 1218 GLY n 
3 1219 GLU n 
3 1220 ALA n 
3 1221 VAL n 
3 1222 GLY n 
3 1223 ILE n 
3 1224 VAL n 
3 1225 ALA n 
3 1226 ALA n 
3 1227 GLN n 
3 1228 SER n 
3 1229 ILE n 
3 1230 GLY n 
3 1231 GLU n 
3 1232 PRO n 
3 1233 GLY n 
3 1234 THR n 
3 1235 GLN n 
3 1236 LEU n 
3 1237 THR n 
3 1238 MET n 
3 1239 ARG n 
3 1240 THR n 
3 1241 PHE n 
3 1242 HIS n 
3 1243 THR n 
3 1244 GLY n 
3 1245 GLY n 
3 1246 VAL n 
3 1247 ALA n 
3 1248 GLY n 
3 1249 ALA n 
3 1250 ALA n 
3 1251 ASP n 
3 1252 ILE n 
3 1253 THR n 
3 1254 GLN n 
3 1255 GLY n 
3 1256 LEU n 
3 1257 PRO n 
3 1258 ARG n 
3 1259 VAL n 
3 1260 ILE n 
3 1261 GLU n 
3 1262 LEU n 
3 1263 PHE n 
3 1264 GLU n 
3 1265 ALA n 
3 1266 ARG n 
3 1267 ARG n 
3 1268 PRO n 
3 1269 LYS n 
3 1270 ALA n 
3 1271 LYS n 
3 1272 ALA n 
3 1273 VAL n 
3 1274 ILE n 
3 1275 SER n 
3 1276 GLU n 
3 1277 ILE n 
3 1278 ASP n 
3 1279 GLY n 
3 1280 VAL n 
3 1281 VAL n 
3 1282 ARG n 
3 1283 ILE n 
3 1284 GLU n 
3 1285 GLU n 
3 1286 THR n 
3 1287 GLU n 
3 1288 GLU n 
3 1289 LYS n 
3 1290 LEU n 
3 1291 SER n 
3 1292 VAL n 
3 1293 PHE n 
3 1294 VAL n 
3 1295 GLU n 
3 1296 SER n 
3 1297 GLU n 
3 1298 GLY n 
3 1299 PHE n 
3 1300 SER n 
3 1301 LYS n 
3 1302 GLU n 
3 1303 TYR n 
3 1304 LYS n 
3 1305 LEU n 
3 1306 PRO n 
3 1307 LYS n 
3 1308 GLU n 
3 1309 ALA n 
3 1310 ARG n 
3 1311 LEU n 
3 1312 LEU n 
3 1313 VAL n 
3 1314 LYS n 
3 1315 ASP n 
3 1316 GLY n 
3 1317 ASP n 
3 1318 TYR n 
3 1319 VAL n 
3 1320 GLU n 
3 1321 ALA n 
3 1322 GLY n 
3 1323 GLN n 
3 1324 PRO n 
3 1325 LEU n 
3 1326 THR n 
3 1327 ARG n 
3 1328 GLY n 
3 1329 ALA n 
3 1330 ILE n 
3 1331 ASP n 
3 1332 PRO n 
3 1333 HIS n 
3 1334 GLN n 
3 1335 LEU n 
3 1336 LEU n 
3 1337 GLU n 
3 1338 ALA n 
3 1339 LYS n 
3 1340 GLY n 
3 1341 PRO n 
3 1342 GLU n 
3 1343 ALA n 
3 1344 VAL n 
3 1345 GLU n 
3 1346 ARG n 
3 1347 TYR n 
3 1348 LEU n 
3 1349 VAL n 
3 1350 GLU n 
3 1351 GLU n 
3 1352 ILE n 
3 1353 GLN n 
3 1354 LYS n 
3 1355 VAL n 
3 1356 TYR n 
3 1357 ARG n 
3 1358 ALA n 
3 1359 GLN n 
3 1360 GLY n 
3 1361 VAL n 
3 1362 LYS n 
3 1363 LEU n 
3 1364 HIS n 
3 1365 ASP n 
3 1366 LYS n 
3 1367 HIS n 
3 1368 ILE n 
3 1369 GLU n 
3 1370 ILE n 
3 1371 VAL n 
3 1372 VAL n 
3 1373 ARG n 
3 1374 GLN n 
3 1375 MET n 
3 1376 MET n 
3 1377 LYS n 
3 1378 TYR n 
3 1379 VAL n 
3 1380 GLU n 
3 1381 VAL n 
3 1382 THR n 
3 1383 ASP n 
3 1384 PRO n 
3 1385 GLY n 
3 1386 ASP n 
3 1387 SER n 
3 1388 ARG n 
3 1389 LEU n 
3 1390 LEU n 
3 1391 GLU n 
3 1392 GLY n 
3 1393 GLN n 
3 1394 VAL n 
3 1395 LEU n 
3 1396 GLU n 
3 1397 LYS n 
3 1398 TRP n 
3 1399 ASP n 
3 1400 VAL n 
3 1401 GLU n 
3 1402 ALA n 
3 1403 LEU n 
3 1404 ASN n 
3 1405 GLU n 
3 1406 ARG n 
3 1407 LEU n 
3 1408 ILE n 
3 1409 ALA n 
3 1410 GLU n 
3 1411 GLY n 
3 1412 LYS n 
3 1413 THR n 
3 1414 PRO n 
3 1415 VAL n 
3 1416 ALA n 
3 1417 TRP n 
3 1418 LYS n 
3 1419 PRO n 
3 1420 LEU n 
3 1421 LEU n 
3 1422 MET n 
3 1423 GLY n 
3 1424 VAL n 
3 1425 THR n 
3 1426 LYS n 
3 1427 SER n 
3 1428 ALA n 
3 1429 LEU n 
3 1430 SER n 
3 1431 THR n 
3 1432 LYS n 
3 1433 SER n 
3 1434 TRP n 
3 1435 LEU n 
3 1436 SER n 
3 1437 ALA n 
3 1438 ALA n 
3 1439 SER n 
3 1440 PHE n 
3 1441 GLN n 
3 1442 ASN n 
3 1443 THR n 
3 1444 THR n 
3 1445 HIS n 
3 1446 VAL n 
3 1447 LEU n 
3 1448 THR n 
3 1449 GLU n 
3 1450 ALA n 
3 1451 ALA n 
3 1452 ILE n 
3 1453 ALA n 
3 1454 GLY n 
3 1455 LYS n 
3 1456 LYS n 
3 1457 ASP n 
3 1458 GLU n 
3 1459 LEU n 
3 1460 ILE n 
3 1461 GLY n 
3 1462 LEU n 
3 1463 LYS n 
3 1464 GLU n 
3 1465 ASN n 
3 1466 VAL n 
3 1467 ILE n 
3 1468 LEU n 
3 1469 GLY n 
3 1470 ARG n 
3 1471 LEU n 
3 1472 ILE n 
3 1473 PRO n 
3 1474 ALA n 
3 1475 GLY n 
3 1476 THR n 
3 1477 GLY n 
3 1478 SER n 
3 1479 ASP n 
3 1480 PHE n 
3 1481 VAL n 
3 1482 ARG n 
3 1483 PHE n 
3 1484 THR n 
3 1485 GLN n 
3 1486 VAL n 
3 1487 VAL n 
3 1488 ASP n 
3 1489 GLN n 
3 1490 LYS n 
3 1491 THR n 
3 1492 LEU n 
3 1493 LYS n 
3 1494 ALA n 
3 1495 ILE n 
3 1496 GLU n 
3 1497 GLU n 
3 1498 ALA n 
3 1499 ARG n 
3 1500 LYS n 
3 1501 GLU n 
3 1502 ALA n 
3 1503 VAL n 
3 1504 GLU n 
3 1505 ALA n 
3 1506 LYS n 
3 1507 GLU n 
3 1508 ARG n 
3 1509 PRO n 
3 1510 ALA n 
3 1511 ALA n 
3 1512 ARG n 
3 1513 ARG n 
3 1514 GLY n 
3 1515 VAL n 
3 1516 LYS n 
3 1517 ARG n 
3 1518 GLU n 
3 1519 GLN n 
3 1520 PRO n 
3 1521 GLY n 
3 1522 LYS n 
3 1523 GLN n 
3 1524 ALA n 
4 1    MET n 
4 2    ALA n 
4 3    GLU n 
4 4    PRO n 
4 5    GLY n 
4 6    ILE n 
4 7    ASP n 
4 8    LYS n 
4 9    LEU n 
4 10   PHE n 
4 11   GLY n 
4 12   MET n 
4 13   VAL n 
4 14   ASP n 
4 15   SER n 
4 16   LYS n 
4 17   TYR n 
4 18   ARG n 
4 19   LEU n 
4 20   THR n 
4 21   VAL n 
4 22   VAL n 
4 23   VAL n 
4 24   ALA n 
4 25   LYS n 
4 26   ARG n 
4 27   ALA n 
4 28   GLN n 
4 29   GLN n 
4 30   LEU n 
4 31   LEU n 
4 32   ARG n 
4 33   HIS n 
4 34   GLY n 
4 35   PHE n 
4 36   LYS n 
4 37   ASN n 
4 38   THR n 
4 39   VAL n 
4 40   LEU n 
4 41   GLU n 
4 42   PRO n 
4 43   GLU n 
4 44   GLU n 
4 45   ARG n 
4 46   PRO n 
4 47   LYS n 
4 48   MET n 
4 49   GLN n 
4 50   THR n 
4 51   LEU n 
4 52   GLU n 
4 53   GLY n 
4 54   LEU n 
4 55   PHE n 
4 56   ASP n 
4 57   ASP n 
4 58   PRO n 
4 59   ASN n 
4 60   ALA n 
4 61   VAL n 
4 62   THR n 
4 63   TRP n 
4 64   ALA n 
4 65   MET n 
4 66   LYS n 
4 67   GLU n 
4 68   LEU n 
4 69   LEU n 
4 70   THR n 
4 71   GLY n 
4 72   ARG n 
4 73   LEU n 
4 74   VAL n 
4 75   PHE n 
4 76   GLY n 
4 77   GLU n 
4 78   ASN n 
4 79   LEU n 
4 80   VAL n 
4 81   PRO n 
4 82   GLU n 
4 83   ASP n 
4 84   ARG n 
4 85   LEU n 
4 86   GLN n 
4 87   LYS n 
4 88   GLU n 
4 89   MET n 
4 90   GLU n 
4 91   ARG n 
4 92   LEU n 
4 93   TYR n 
4 94   PRO n 
4 95   VAL n 
4 96   GLU n 
4 97   ARG n 
4 98   GLU n 
4 99   GLU n 
5 1    MET n 
5 2    GLY n 
5 3    SER n 
5 4    SER n 
5 5    HIS n 
5 6    HIS n 
5 7    HIS n 
5 8    HIS n 
5 9    HIS n 
5 10   HIS n 
5 11   SER n 
5 12   SER n 
5 13   GLY n 
5 14   LEU n 
5 15   VAL n 
5 16   PRO n 
5 17   ARG n 
5 18   GLY n 
5 19   SER n 
5 20   HIS n 
5 21   MET n 
5 22   LYS n 
5 23   LYS n 
5 24   SER n 
5 25   LYS n 
5 26   ARG n 
5 27   LYS n 
5 28   ASN n 
5 29   ALA n 
5 30   GLN n 
5 31   ALA n 
5 32   GLN n 
5 33   GLU n 
5 34   ALA n 
5 35   GLN n 
5 36   GLU n 
5 37   THR n 
5 38   GLU n 
5 39   VAL n 
5 40   LEU n 
5 41   VAL n 
5 42   GLN n 
5 43   GLU n 
5 44   GLU n 
5 45   ALA n 
5 46   GLU n 
5 47   GLU n 
5 48   LEU n 
5 49   PRO n 
5 50   GLU n 
5 51   PHE n 
5 52   PRO n 
5 53   GLU n 
5 54   GLY n 
5 55   GLU n 
5 56   PRO n 
5 57   ASP n 
5 58   PRO n 
5 59   ASP n 
5 60   LEU n 
5 61   GLU n 
5 62   ASP n 
5 63   PRO n 
5 64   ASP n 
5 65   LEU n 
5 66   THR n 
5 67   LEU n 
5 68   GLU n 
5 69   ASP n 
5 70   ASP n 
5 71   LEU n 
5 72   LEU n 
5 73   ASP n 
5 74   LEU n 
5 75   PRO n 
5 76   GLU n 
5 77   GLU n 
5 78   GLY n 
5 79   GLU n 
5 80   GLY n 
5 81   LEU n 
5 82   ASP n 
5 83   LEU n 
5 84   GLU n 
5 85   GLU n 
5 86   GLU n 
5 87   GLU n 
5 88   GLU n 
5 89   ASP n 
5 90   LEU n 
5 91   PRO n 
5 92   ILE n 
5 93   PRO n 
5 94   LYS n 
5 95   ILE n 
5 96   SER n 
5 97   THR n 
5 98   SER n 
5 99   ASP n 
5 100  PRO n 
5 101  VAL n 
5 102  ARG n 
5 103  GLN n 
5 104  TYR n 
5 105  LEU n 
5 106  HIS n 
5 107  GLU n 
5 108  ILE n 
5 109  GLY n 
5 110  GLN n 
5 111  VAL n 
5 112  PRO n 
5 113  LEU n 
5 114  LEU n 
5 115  THR n 
5 116  LEU n 
5 117  GLU n 
5 118  GLU n 
5 119  GLU n 
5 120  VAL n 
5 121  GLU n 
5 122  LEU n 
5 123  ALA n 
5 124  ARG n 
5 125  LYS n 
5 126  VAL n 
5 127  GLU n 
5 128  GLU n 
5 129  GLY n 
5 130  MET n 
5 131  GLU n 
5 132  ALA n 
5 133  ILE n 
5 134  LYS n 
5 135  LYS n 
5 136  LEU n 
5 137  SER n 
5 138  GLU n 
5 139  ILE n 
5 140  THR n 
5 141  GLY n 
5 142  LEU n 
5 143  ASP n 
5 144  PRO n 
5 145  ASP n 
5 146  LEU n 
5 147  ILE n 
5 148  ARG n 
5 149  GLU n 
5 150  VAL n 
5 151  VAL n 
5 152  ARG n 
5 153  ALA n 
5 154  LYS n 
5 155  ILE n 
5 156  LEU n 
5 157  GLY n 
5 158  SER n 
5 159  ALA n 
5 160  ARG n 
5 161  VAL n 
5 162  ARG n 
5 163  HIS n 
5 164  ILE n 
5 165  PRO n 
5 166  GLY n 
5 167  LEU n 
5 168  LYS n 
5 169  GLU n 
5 170  THR n 
5 171  LEU n 
5 172  ASP n 
5 173  PRO n 
5 174  LYS n 
5 175  THR n 
5 176  VAL n 
5 177  GLU n 
5 178  GLU n 
5 179  ILE n 
5 180  ASP n 
5 181  GLN n 
5 182  LYS n 
5 183  LEU n 
5 184  LYS n 
5 185  SER n 
5 186  LEU n 
5 187  PRO n 
5 188  LYS n 
5 189  GLU n 
5 190  HIS n 
5 191  LYS n 
5 192  ARG n 
5 193  TYR n 
5 194  LEU n 
5 195  HIS n 
5 196  ILE n 
5 197  ALA n 
5 198  ARG n 
5 199  GLU n 
5 200  GLY n 
5 201  GLU n 
5 202  ALA n 
5 203  ALA n 
5 204  ARG n 
5 205  GLN n 
5 206  HIS n 
5 207  LEU n 
5 208  ILE n 
5 209  GLU n 
5 210  ALA n 
5 211  ASN n 
5 212  LEU n 
5 213  ARG n 
5 214  LEU n 
5 215  VAL n 
5 216  VAL n 
5 217  SER n 
5 218  ILE n 
5 219  ALA n 
5 220  LYS n 
5 221  LYS n 
5 222  TYR n 
5 223  THR n 
5 224  GLY n 
5 225  ARG n 
5 226  GLY n 
5 227  LEU n 
5 228  SER n 
5 229  PHE n 
5 230  LEU n 
5 231  ASP n 
5 232  LEU n 
5 233  ILE n 
5 234  GLN n 
5 235  GLU n 
5 236  GLY n 
5 237  ASN n 
5 238  GLN n 
5 239  GLY n 
5 240  LEU n 
5 241  ILE n 
5 242  ARG n 
5 243  ALA n 
5 244  VAL n 
5 245  GLU n 
5 246  LYS n 
5 247  PHE n 
5 248  GLU n 
5 249  TYR n 
5 250  LYS n 
5 251  ARG n 
5 252  ARG n 
5 253  PHE n 
5 254  LYS n 
5 255  PHE n 
5 256  SER n 
5 257  THR n 
5 258  TYR n 
5 259  ALA n 
5 260  THR n 
5 261  TRP n 
5 262  TRP n 
5 263  ILE n 
5 264  ARG n 
5 265  GLN n 
5 266  ALA n 
5 267  ILE n 
5 268  ASN n 
5 269  ARG n 
5 270  ALA n 
5 271  ILE n 
5 272  ALA n 
5 273  ASP n 
5 274  GLN n 
5 275  ALA n 
5 276  ARG n 
5 277  THR n 
5 278  ILE n 
5 279  ARG n 
5 280  ILE n 
5 281  PRO n 
5 282  VAL n 
5 283  HIS n 
5 284  MET n 
5 285  VAL n 
5 286  GLU n 
5 287  THR n 
5 288  ILE n 
5 289  ASN n 
5 290  LYS n 
5 291  LEU n 
5 292  SER n 
5 293  ARG n 
5 294  THR n 
5 295  ALA n 
5 296  ARG n 
5 297  GLN n 
5 298  LEU n 
5 299  GLN n 
5 300  GLN n 
5 301  GLU n 
5 302  LEU n 
5 303  GLY n 
5 304  ARG n 
5 305  GLU n 
5 306  PRO n 
5 307  THR n 
5 308  TYR n 
5 309  GLU n 
5 310  GLU n 
5 311  ILE n 
5 312  ALA n 
5 313  GLU n 
5 314  ALA n 
5 315  MET n 
5 316  GLY n 
5 317  PRO n 
5 318  GLY n 
5 319  TRP n 
5 320  ASP n 
5 321  ALA n 
5 322  LYS n 
5 323  ARG n 
5 324  VAL n 
5 325  GLU n 
5 326  GLU n 
5 327  THR n 
5 328  LEU n 
5 329  LYS n 
5 330  ILE n 
5 331  ALA n 
5 332  GLN n 
5 333  GLU n 
5 334  PRO n 
5 335  VAL n 
5 336  SER n 
5 337  LEU n 
5 338  GLU n 
5 339  THR n 
5 340  PRO n 
5 341  ILE n 
5 342  GLY n 
5 343  ASP n 
5 344  GLU n 
5 345  LYS n 
5 346  ASP n 
5 347  SER n 
5 348  PHE n 
5 349  TYR n 
5 350  GLY n 
5 351  ASP n 
5 352  PHE n 
5 353  ILE n 
5 354  PRO n 
5 355  ASP n 
5 356  GLU n 
5 357  HIS n 
5 358  LEU n 
5 359  PRO n 
5 360  SER n 
5 361  PRO n 
5 362  VAL n 
5 363  ASP n 
5 364  ALA n 
5 365  ALA n 
5 366  THR n 
5 367  GLN n 
5 368  SER n 
5 369  LEU n 
5 370  LEU n 
5 371  SER n 
5 372  GLU n 
5 373  GLU n 
5 374  LEU n 
5 375  GLU n 
5 376  LYS n 
5 377  ALA n 
5 378  LEU n 
5 379  SER n 
5 380  LYS n 
5 381  LEU n 
5 382  SER n 
5 383  GLU n 
5 384  ARG n 
5 385  GLU n 
5 386  ALA n 
5 387  MET n 
5 388  VAL n 
5 389  LEU n 
5 390  LYS n 
5 391  LEU n 
5 392  ARG n 
5 393  LYS n 
5 394  GLY n 
5 395  LEU n 
5 396  ILE n 
5 397  ASP n 
5 398  GLY n 
5 399  ARG n 
5 400  GLU n 
5 401  HIS n 
5 402  THR n 
5 403  LEU n 
5 404  GLU n 
5 405  GLU n 
5 406  VAL n 
5 407  GLY n 
5 408  ALA n 
5 409  PHE n 
5 410  PHE n 
5 411  GLY n 
5 412  VAL n 
5 413  THR n 
5 414  ARG n 
5 415  GLU n 
5 416  ARG n 
5 417  ILE n 
5 418  ARG n 
5 419  GLN n 
5 420  ILE n 
5 421  GLU n 
5 422  ASN n 
5 423  LYS n 
5 424  ALA n 
5 425  LEU n 
5 426  ARG n 
5 427  LYS n 
5 428  LEU n 
5 429  LYS n 
5 430  TYR n 
5 431  HIS n 
5 432  GLU n 
5 433  SER n 
5 434  ARG n 
5 435  THR n 
5 436  ARG n 
5 437  LYS n 
5 438  LEU n 
5 439  ARG n 
5 440  ASP n 
5 441  PHE n 
5 442  LEU n 
5 443  ASP n 
6 1    DC  n 
6 2    DC  n 
6 3    DT  n 
6 4    DG  n 
6 5    DC  n 
6 6    DA  n 
6 7    DT  n 
6 8    DC  n 
6 9    DC  n 
6 10   DG  n 
6 11   DT  n 
6 12   DG  n 
6 13   DA  n 
6 14   DG  n 
6 15   DT  n 
6 16   DC  n 
6 17   DG  n 
6 18   DA  n 
6 19   DG  n 
7 1    DT  n 
7 2    DA  n 
7 3    DT  n 
7 4    DA  n 
7 5    DA  n 
7 6    DT  n 
7 7    DG  n 
7 8    DG  n 
7 9    DG  n 
7 10   DA  n 
7 11   DG  n 
7 12   DC  n 
7 13   DT  n 
7 14   DG  n 
7 15   DT  n 
7 16   DC  n 
7 17   DA  n 
7 18   DC  n 
7 19   DG  n 
7 20   DG  n 
7 21   DA  n 
7 22   DT  n 
7 23   DG  n 
7 24   DC  n 
7 25   DA  n 
7 26   DG  n 
7 27   DG  n 
# 
_entity_src_gen.entity_id                          5 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'rpoD, TTHA0532' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    HB8 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermus thermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     300852 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? ? 'Thermus thermophilus' 300852 ? ? HB8 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? 'Thermus thermophilus' 300852 ? ? HB8 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? ? 'Thermus thermophilus' 300852 ? ? HB8 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? 'Thermus thermophilus' 300852 ? ? HB8 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP RPOA_THET8   Q5SHR6 1 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
1 ? 
2 UNP RPOB_THET8   Q8RQE9 2 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
1 ? 
3 UNP RPOC_THET8   Q8RQE8 3 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
1 ? 
4 UNP RPOZ_THET8   Q8RQE7 4 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
1 ? 
5 UNP Q5SKW1_THET8 Q5SKW1 5 
;MKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEGLDLEEEEEDLPIPKISTSDP
VRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEID
QKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYAT
WWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETP
IGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQI
ENKALRKLKYHESRTRKLRDFLD
;
1 ? 
6 PDB 4G7H         4G7H   6 CCTGCATCCGTGAGTCGAG 1 ? 
7 PDB 4G7H         4G7H   7 TATAATGGGAGCTGTCACGGATGCAGG 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 4G7H A 1  ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
2  1 4G7H B 1  ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
3  2 4G7H C 1  ? 1119 ? Q8RQE9 1 ? 1119 ? 1 1119 
4  3 4G7H D 1  ? 1524 ? Q8RQE8 1 ? 1524 ? 1 1524 
5  4 4G7H E 1  ? 99   ? Q8RQE7 1 ? 99   ? 1 99   
6  5 4G7H F 21 ? 443  ? Q5SKW1 1 ? 423  ? 1 423  
7  1 4G7H K 1  ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
8  1 4G7H L 1  ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
9  2 4G7H M 1  ? 1119 ? Q8RQE9 1 ? 1119 ? 1 1119 
10 3 4G7H N 1  ? 1524 ? Q8RQE8 1 ? 1524 ? 1 1524 
11 4 4G7H O 1  ? 99   ? Q8RQE7 1 ? 99   ? 1 99   
12 5 4G7H P 21 ? 443  ? Q5SKW1 1 ? 423  ? 1 423  
13 6 4G7H G 1  ? 19   ? 4G7H   1 ? 19   ? 1 19   
14 6 4G7H Q 1  ? 19   ? 4G7H   1 ? 19   ? 1 19   
15 7 4G7H H 1  ? 27   ? 4G7H   1 ? 27   ? 1 27   
16 7 4G7H R 1  ? 27   ? 4G7H   1 ? 27   ? 1 27   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
6  4G7H MET F 1  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -19 1  
6  4G7H GLY F 2  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -18 2  
6  4G7H SER F 3  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -17 3  
6  4G7H SER F 4  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -16 4  
6  4G7H HIS F 5  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -15 5  
6  4G7H HIS F 6  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -14 6  
6  4G7H HIS F 7  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -13 7  
6  4G7H HIS F 8  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -12 8  
6  4G7H HIS F 9  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -11 9  
6  4G7H HIS F 10 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -10 10 
6  4G7H SER F 11 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -9  11 
6  4G7H SER F 12 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -8  12 
6  4G7H GLY F 13 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -7  13 
6  4G7H LEU F 14 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -6  14 
6  4G7H VAL F 15 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -5  15 
6  4G7H PRO F 16 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -4  16 
6  4G7H ARG F 17 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -3  17 
6  4G7H GLY F 18 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -2  18 
6  4G7H SER F 19 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -1  19 
6  4G7H HIS F 20 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' 0   20 
12 4G7H MET P 1  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -19 21 
12 4G7H GLY P 2  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -18 22 
12 4G7H SER P 3  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -17 23 
12 4G7H SER P 4  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -16 24 
12 4G7H HIS P 5  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -15 25 
12 4G7H HIS P 6  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -14 26 
12 4G7H HIS P 7  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -13 27 
12 4G7H HIS P 8  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -12 28 
12 4G7H HIS P 9  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -11 29 
12 4G7H HIS P 10 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -10 30 
12 4G7H SER P 11 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -9  31 
12 4G7H SER P 12 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -8  32 
12 4G7H GLY P 13 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -7  33 
12 4G7H LEU P 14 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -6  34 
12 4G7H VAL P 15 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -5  35 
12 4G7H PRO P 16 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -4  36 
12 4G7H ARG P 17 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -3  37 
12 4G7H GLY P 18 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -2  38 
12 4G7H SER P 19 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -1  39 
12 4G7H HIS P 20 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' 0   40 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.entry_id          4G7H 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.22 
_exptl_crystal.density_percent_sol   61.84 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.7 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;100 mM Tris-HCl, pH 8.7, 200 mM potassium chloride, 50 mM magnesium chloride, 10% PEG4000, VAPOR DIFFUSION, HANGING DROP, temperature 295.0K
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2012-03-21 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'double crystal Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.1 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4G7H 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.9 
_reflns.number_obs                   249337 
_reflns.number_all                   250138 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.101 
_reflns.pdbx_Rsym_value              0.101 
_reflns.pdbx_netI_over_sigmaI        11.2 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.9 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.90 
_reflns_shell.d_res_low              3.05 
_reflns_shell.percent_possible_all   99.1 
_reflns_shell.Rmerge_I_obs           0.667 
_reflns_shell.pdbx_Rsym_value        0.667 
_reflns_shell.meanI_over_sigI_obs    2.3 
_reflns_shell.pdbx_redundancy        4.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4G7H 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     249046 
_refine.ls_number_reflns_all                     249053 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.82 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             49.270 
_refine.ls_d_res_high                            2.900 
_refine.ls_percent_reflns_obs                    99.48 
_refine.ls_R_factor_obs                          0.1884 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1880 
_refine.ls_R_factor_R_free                       0.2259 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 0.88 
_refine.ls_number_reflns_R_free                  2204 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -5.6203 
_refine.aniso_B[2][2]                            24.6399 
_refine.aniso_B[3][3]                            -19.0196 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            6.6393 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.00 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1IW7' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.38 
_refine.pdbx_overall_phase_error                 26.17 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        55246 
_refine_hist.pdbx_number_atoms_nucleic_acid   1646 
_refine_hist.pdbx_number_atoms_ligand         14 
_refine_hist.number_atoms_solvent             514 
_refine_hist.number_atoms_total               57420 
_refine_hist.d_res_high                       2.900 
_refine_hist.d_res_low                        49.270 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.005  ? ? 58086 'X-RAY DIFFRACTION' ? 
f_angle_d          0.989  ? ? 78906 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 16.363 ? ? 22558 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.074  ? ? 8882  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 10066 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.pdbx_asym_id 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
1 C 3949 ?     ? POSITIONAL 1 1  'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 M 3949 0.097 ? POSITIONAL 1 2  'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 D 931  ?     ? POSITIONAL 2 3  'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 N 931  0.118 ? POSITIONAL 2 4  'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 D 4784 ?     ? POSITIONAL 3 5  'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 N 4784 0.152 ? POSITIONAL 3 6  'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 E 761  ?     ? POSITIONAL 4 7  'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 O 761  0.155 ? POSITIONAL 4 8  'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 C 2334 ?     ? POSITIONAL 5 9  'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 M 2334 0.070 ? POSITIONAL 5 10 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.9000 2.9630  15254 0.3090 99.00  0.4021 . . 136 . . . . 
'X-RAY DIFFRACTION' . 2.9630 3.0320  15217 0.2858 99.00  0.3397 . . 140 . . . . 
'X-RAY DIFFRACTION' . 3.0320 3.1078  15277 0.2720 99.00  0.2938 . . 130 . . . . 
'X-RAY DIFFRACTION' . 3.1078 3.1918  15279 0.2630 99.00  0.3286 . . 138 . . . . 
'X-RAY DIFFRACTION' . 3.1918 3.2857  15355 0.2530 99.00  0.2946 . . 136 . . . . 
'X-RAY DIFFRACTION' . 3.2857 3.3917  15347 0.2329 99.00  0.3007 . . 138 . . . . 
'X-RAY DIFFRACTION' . 3.3917 3.5129  15336 0.2155 99.00  0.2454 . . 140 . . . . 
'X-RAY DIFFRACTION' . 3.5129 3.6535  15401 0.2049 100.00 0.2845 . . 137 . . . . 
'X-RAY DIFFRACTION' . 3.6535 3.8197  15423 0.1933 100.00 0.2428 . . 137 . . . . 
'X-RAY DIFFRACTION' . 3.8197 4.0210  15455 0.1752 100.00 0.2115 . . 138 . . . . 
'X-RAY DIFFRACTION' . 4.0210 4.2728  15437 0.1616 100.00 0.1856 . . 135 . . . . 
'X-RAY DIFFRACTION' . 4.2728 4.6025  15467 0.1497 100.00 0.1799 . . 139 . . . . 
'X-RAY DIFFRACTION' . 4.6025 5.0653  15545 0.1489 100.00 0.2017 . . 140 . . . . 
'X-RAY DIFFRACTION' . 5.0653 5.7972  15602 0.1653 100.00 0.1864 . . 139 . . . . 
'X-RAY DIFFRACTION' . 5.7972 7.3001  15619 0.1758 100.00 0.2136 . . 141 . . . . 
'X-RAY DIFFRACTION' . 7.3001 49.2767 15828 0.1570 99.00  0.1687 . . 140 . . . . 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    4G7H 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 ? 1 
2 ? 1 
1 ? 2 
2 ? 2 
1 ? 3 
2 ? 3 
1 ? 4 
2 ? 4 
1 ? 5 
2 ? 5 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;chain 'C' and ((resseq 260:760))
;
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;chain 'M' and ((resseq 260:760))
;
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2 
;chain 'D' and ((resseq 100:215))
;
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2 
;chain 'N' and ((resseq 100:215))
;
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3 
;chain 'D' and ((resseq 340:950))
;
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3 
;chain 'N' and ((resseq 340:950))
;
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4 
;chain 'E'
;
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4 
;chain 'O'
;
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 5 
;chain 'C' and ((resseq 820:1118))
;
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 5 
;chain 'M' and ((resseq 820:1118))
;
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
4 ? 
5 ? 
# 
_struct.entry_id                  4G7H 
_struct.title                     'Crystal structure of Thermus thermophilus transcription initiation complex' 
_struct.pdbx_descriptor           
;DNA-directed RNA polymerase subunit alpha (E.C.2.7.7.6), DNA-directed RNA polymerase subunit beta (E.C.2.7.7.6), DNA-directed RNA polymerase subunit beta' (E.C.2.7.7.6), DNA-directed RNA polymerase subunit omega (E.C.2.7.7.6), RNA polymerase sigma factor
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4G7H 
_struct_keywords.pdbx_keywords   'TRANSCRIPTION, TRANSFERASE/DNA' 
_struct_keywords.text            
;protein-DNA complex, transcription initiation complex, RNAP-promoter complex, RNAP-promoter open complex, open complex, RPo, RNA polymerase, transcription initiation, transcription Initiation factor sigma A, promoter DNA, nucleoid, TRANSCRIPTION, TRANSFERASE-DNA complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 1  ? 
C  N N 2  ? 
D  N N 3  ? 
E  N N 4  ? 
F  N N 5  ? 
G  N N 6  ? 
H  N N 7  ? 
I  N N 1  ? 
J  N N 1  ? 
K  N N 2  ? 
L  N N 3  ? 
M  N N 4  ? 
N  N N 5  ? 
O  N N 6  ? 
P  N N 7  ? 
Q  N N 8  ? 
R  N N 9  ? 
S  N N 9  ? 
T  N N 8  ? 
U  N N 8  ? 
V  N N 8  ? 
W  N N 8  ? 
X  N N 8  ? 
Y  N N 9  ? 
Z  N N 9  ? 
AA N N 8  ? 
BA N N 8  ? 
CA N N 8  ? 
DA N N 8  ? 
EA N N 10 ? 
FA N N 10 ? 
GA N N 10 ? 
HA N N 10 ? 
IA N N 10 ? 
JA N N 10 ? 
KA N N 10 ? 
LA N N 10 ? 
MA N N 10 ? 
NA N N 10 ? 
OA N N 10 ? 
PA N N 10 ? 
QA N N 10 ? 
RA N N 10 ? 
SA N N 10 ? 
TA N N 10 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   GLY A 31   ? SER A 47   ? GLY A 31   SER A 47   1 ? 17 
HELX_P HELX_P2   2   ASP A 74   ? LYS A 83   ? ASP A 74   LYS A 83   1 ? 10 
HELX_P HELX_P3   3   ARG A 112  ? PHE A 114  ? ARG A 112  PHE A 114  5 ? 3  
HELX_P HELX_P4   4   PRO A 152  ? GLY A 157  ? PRO A 152  GLY A 157  1 ? 6  
HELX_P HELX_P5   5   THR A 206  ? TYR A 224  ? THR A 206  TYR A 224  1 ? 19 
HELX_P HELX_P6   6   GLY B 31   ? SER B 47   ? GLY B 31   SER B 47   1 ? 17 
HELX_P HELX_P7   7   ASP B 74   ? GLU B 84   ? ASP B 74   GLU B 84   1 ? 11 
HELX_P HELX_P8   8   PRO B 152  ? GLY B 157  ? PRO B 152  GLY B 157  1 ? 6  
HELX_P HELX_P9   9   THR B 206  ? THR B 223  ? THR B 206  THR B 223  1 ? 18 
HELX_P HELX_P10  10  TYR B 224  ? SER B 226  ? TYR B 224  SER B 226  5 ? 3  
HELX_P HELX_P11  11  THR C 19   ? GLN C 31   ? THR C 19   GLN C 31   1 ? 13 
HELX_P HELX_P12  12  PRO C 35   ? ARG C 39   ? PRO C 35   ARG C 39   5 ? 5  
HELX_P HELX_P13  13  VAL C 42   ? PHE C 52   ? VAL C 42   PHE C 52   1 ? 11 
HELX_P HELX_P14  14  PRO C 79   ? ASP C 87   ? PRO C 79   ASP C 87   1 ? 9  
HELX_P HELX_P15  15  LEU C 193  ? LEU C 200  ? LEU C 193  LEU C 200  1 ? 8  
HELX_P HELX_P16  16  ASP C 203  ? GLY C 212  ? ASP C 203  GLY C 212  1 ? 10 
HELX_P HELX_P17  17  GLU C 216  ? MET C 222  ? GLU C 216  MET C 222  1 ? 7  
HELX_P HELX_P18  18  ASP C 223  ? MET C 229  ? ASP C 223  MET C 229  1 ? 7  
HELX_P HELX_P19  19  ARG C 230  ? ARG C 243  ? ARG C 230  ARG C 243  1 ? 14 
HELX_P HELX_P20  20  LYS C 249  ? ILE C 261  ? LYS C 249  ILE C 261  1 ? 13 
HELX_P HELX_P21  21  GLY C 270  ? GLY C 282  ? GLY C 270  GLY C 282  1 ? 13 
HELX_P HELX_P22  22  VAL C 302  ? ALA C 315  ? VAL C 302  ALA C 315  1 ? 14 
HELX_P HELX_P23  23  THR C 335  ? MET C 359  ? THR C 335  MET C 359  1 ? 25 
HELX_P HELX_P24  24  THR C 368  ? VAL C 373  ? THR C 368  VAL C 373  1 ? 6  
HELX_P HELX_P25  25  SER C 375  ? SER C 389  ? SER C 375  SER C 389  1 ? 15 
HELX_P HELX_P26  26  ASN C 399  ? ARG C 408  ? ASN C 399  ARG C 408  1 ? 10 
HELX_P HELX_P27  27  GLY C 424  ? ASP C 429  ? GLY C 424  ASP C 429  1 ? 6  
HELX_P HELX_P28  28  HIS C 431  ? TYR C 435  ? HIS C 431  TYR C 435  5 ? 5  
HELX_P HELX_P29  29  THR C 487  ? ASP C 492  ? THR C 487  ASP C 492  1 ? 6  
HELX_P HELX_P30  30  SER C 525  ? VAL C 529  ? SER C 525  VAL C 529  5 ? 5  
HELX_P HELX_P31  31  SER C 535  ? PHE C 540  ? SER C 535  PHE C 540  5 ? 6  
HELX_P HELX_P32  32  ASN C 543  ? ILE C 547  ? ASN C 543  ILE C 547  5 ? 5  
HELX_P HELX_P33  33  PHE C 549  ? ASP C 553  ? PHE C 549  ASP C 553  5 ? 5  
HELX_P HELX_P34  34  ASP C 554  ? THR C 566  ? ASP C 554  THR C 566  1 ? 13 
HELX_P HELX_P35  35  LEU C 583  ? LEU C 592  ? LEU C 583  LEU C 592  1 ? 10 
HELX_P HELX_P36  36  ASN C 683  ? ALA C 687  ? ASN C 683  ALA C 687  5 ? 5  
HELX_P HELX_P37  37  GLU C 692  ? ARG C 697  ? GLU C 692  ARG C 697  1 ? 6  
HELX_P HELX_P38  38  SER C 730  ? ARG C 735  ? SER C 730  ARG C 735  1 ? 6  
HELX_P HELX_P39  39  THR C 768  ? GLY C 779  ? THR C 768  GLY C 779  1 ? 12 
HELX_P HELX_P40  40  PRO C 854  ? MET C 858  ? PRO C 854  MET C 858  5 ? 5  
HELX_P HELX_P41  41  ASN C 872  ? VAL C 876  ? ASN C 872  VAL C 876  5 ? 5  
HELX_P HELX_P42  42  LEU C 882  ? GLY C 898  ? LEU C 882  GLY C 898  1 ? 17 
HELX_P HELX_P43  43  LYS C 910  ? GLU C 932  ? LYS C 910  GLU C 932  1 ? 23 
HELX_P HELX_P44  44  ASP C 937  ? LEU C 950  ? ASP C 937  LEU C 950  1 ? 14 
HELX_P HELX_P45  45  THR C 958  ? LEU C 968  ? THR C 958  LEU C 968  1 ? 11 
HELX_P HELX_P46  46  MET C 1000 ? MET C 1005 ? MET C 1000 MET C 1005 1 ? 6  
HELX_P HELX_P47  47  GLY C 1023 ? PHE C 1027 ? GLY C 1023 PHE C 1027 5 ? 5  
HELX_P HELX_P48  48  GLY C 1033 ? GLY C 1044 ? GLY C 1033 GLY C 1044 1 ? 12 
HELX_P HELX_P49  49  ALA C 1045 ? THR C 1054 ? ALA C 1045 THR C 1054 1 ? 10 
HELX_P HELX_P50  50  ASP C 1059 ? GLY C 1073 ? ASP C 1059 GLY C 1073 1 ? 15 
HELX_P HELX_P51  51  PRO C 1082 ? LEU C 1095 ? PRO C 1082 LEU C 1095 1 ? 14 
HELX_P HELX_P52  52  SER D 14   ? TRP D 21   ? SER D 14   TRP D 21   1 ? 8  
HELX_P HELX_P53  53  ASP D 46   ? GLY D 51   ? ASP D 46   GLY D 51   1 ? 6  
HELX_P HELX_P54  54  LYS D 82   ? TYR D 88   ? LYS D 82   TYR D 88   5 ? 7  
HELX_P HELX_P55  55  ILE D 102  ? ASP D 107  ? ILE D 102  ASP D 107  1 ? 6  
HELX_P HELX_P56  56  SER D 110  ? ASP D 117  ? SER D 110  ASP D 117  1 ? 8  
HELX_P HELX_P57  57  SER D 119  ? TYR D 128  ? SER D 119  TYR D 128  1 ? 10 
HELX_P HELX_P58  58  THR D 154  ? GLY D 164  ? THR D 154  GLY D 164  1 ? 11 
HELX_P HELX_P59  59  ASP D 423  ? LYS D 426  ? ASP D 423  LYS D 426  5 ? 4  
HELX_P HELX_P60  60  MET D 456  ? GLU D 467  ? MET D 456  GLU D 467  1 ? 12 
HELX_P HELX_P61  61  ASP D 469  ? MET D 481  ? ASP D 469  MET D 481  1 ? 13 
HELX_P HELX_P62  62  SER D 485  ? GLY D 506  ? SER D 485  GLY D 506  1 ? 22 
HELX_P HELX_P63  63  ARG D 508  ? TRP D 511  ? ARG D 508  TRP D 511  5 ? 4  
HELX_P HELX_P64  64  PRO D 521  ? ARG D 525  ? PRO D 521  ARG D 525  5 ? 5  
HELX_P HELX_P65  65  SER D 538  ? GLN D 560  ? SER D 538  GLN D 560  1 ? 23 
HELX_P HELX_P66  66  PRO D 563  ? ASP D 583  ? PRO D 563  ASP D 583  1 ? 21 
HELX_P HELX_P67  67  SER D 602  ? SER D 608  ? SER D 602  SER D 608  1 ? 7  
HELX_P HELX_P68  68  GLY D 612  ? LEU D 618  ? GLY D 612  LEU D 618  1 ? 7  
HELX_P HELX_P69  69  LYS D 646  ? PHE D 653  ? LYS D 646  PHE D 653  1 ? 8  
HELX_P HELX_P70  70  PHE D 653  ? LYS D 664  ? PHE D 653  LYS D 664  1 ? 12 
HELX_P HELX_P71  71  ASN D 669  ? ARG D 679  ? ASN D 669  ARG D 679  1 ? 11 
HELX_P HELX_P72  72  GLN D 680  ? ILE D 683  ? GLN D 680  ILE D 683  5 ? 4  
HELX_P HELX_P73  73  ASP D 685  ? ILE D 695  ? ASP D 685  ILE D 695  1 ? 11 
HELX_P HELX_P74  74  HIS D 709  ? LEU D 711  ? HIS D 709  LEU D 711  5 ? 3  
HELX_P HELX_P75  75  HIS D 729  ? LEU D 731  ? HIS D 729  LEU D 731  5 ? 3  
HELX_P HELX_P76  76  VAL D 732  ? ASN D 737  ? VAL D 732  ASN D 737  1 ? 6  
HELX_P HELX_P77  77  SER D 752  ? GLN D 762  ? SER D 752  GLN D 762  1 ? 11 
HELX_P HELX_P78  78  LEU D 764  ? ASN D 768  ? LEU D 764  ASN D 768  5 ? 5  
HELX_P HELX_P79  79  ARG D 783  ? GLN D 794  ? ARG D 783  GLN D 794  1 ? 12 
HELX_P HELX_P80  80  THR D 808  ? ARG D 818  ? THR D 808  ARG D 818  1 ? 11 
HELX_P HELX_P81  81  VAL D 836  ? TYR D 841  ? VAL D 836  TYR D 841  1 ? 6  
HELX_P HELX_P82  82  ASN D 845  ? HIS D 855  ? ASN D 845  HIS D 855  1 ? 11 
HELX_P HELX_P83  83  SER D 876  ? GLU D 891  ? SER D 876  GLU D 891  1 ? 16 
HELX_P HELX_P84  84  ASP D 892  ? ILE D 900  ? ASP D 892  ILE D 900  1 ? 9  
HELX_P HELX_P85  85  GLU D 907  ? GLY D 923  ? GLU D 907  GLY D 923  1 ? 17 
HELX_P HELX_P86  86  GLY D 923  ? SER D 945  ? GLY D 923  SER D 945  1 ? 23 
HELX_P HELX_P87  87  GLY D 950  ? ALA D 954  ? GLY D 950  ALA D 954  5 ? 5  
HELX_P HELX_P88  88  GLU D 958  ? MET D 980  ? GLU D 958  MET D 980  1 ? 23 
HELX_P HELX_P89  89  THR D 984  ? TYR D 1015 ? THR D 984  TYR D 1015 1 ? 32 
HELX_P HELX_P90  90  ASN D 1018 ? SER D 1026 ? ASN D 1018 SER D 1026 1 ? 9  
HELX_P HELX_P91  91  ASN D 1031 ? GLY D 1040 ? ASN D 1031 GLY D 1040 1 ? 10 
HELX_P HELX_P92  92  THR D 1066 ? HIS D 1103 ? THR D 1066 HIS D 1103 1 ? 38 
HELX_P HELX_P93  93  LYS D 1136 ? TYR D 1145 ? LYS D 1136 TYR D 1145 1 ? 10 
HELX_P HELX_P94  94  SER D 1167 ? ALA D 1180 ? SER D 1167 ALA D 1180 1 ? 14 
HELX_P HELX_P95  95  GLN D 1202 ? GLY D 1206 ? GLN D 1202 GLY D 1206 1 ? 5  
HELX_P HELX_P96  96  ALA D 1220 ? GLU D 1231 ? ALA D 1220 GLU D 1231 1 ? 12 
HELX_P HELX_P97  97  PRO D 1232 ? LEU D 1236 ? PRO D 1232 LEU D 1236 5 ? 5  
HELX_P HELX_P98  98  GLN D 1254 ? GLU D 1264 ? GLN D 1254 GLU D 1264 1 ? 11 
HELX_P HELX_P99  99  ASP D 1331 ? GLY D 1340 ? ASP D 1331 GLY D 1340 1 ? 10 
HELX_P HELX_P100 100 GLY D 1340 ? GLN D 1359 ? GLY D 1340 GLN D 1359 1 ? 20 
HELX_P HELX_P101 101 HIS D 1364 ? MET D 1376 ? HIS D 1364 MET D 1376 1 ? 13 
HELX_P HELX_P102 102 LYS D 1397 ? ALA D 1409 ? LYS D 1397 ALA D 1409 1 ? 13 
HELX_P HELX_P103 103 GLY D 1423 ? SER D 1430 ? GLY D 1423 SER D 1430 1 ? 8  
HELX_P HELX_P104 104 SER D 1433 ? GLN D 1441 ? SER D 1433 GLN D 1441 1 ? 9  
HELX_P HELX_P105 105 ASN D 1442 ? GLY D 1454 ? ASN D 1442 GLY D 1454 1 ? 13 
HELX_P HELX_P106 106 GLY D 1461 ? GLY D 1469 ? GLY D 1461 GLY D 1469 1 ? 9  
HELX_P HELX_P107 107 ALA D 1474 ? SER D 1478 ? ALA D 1474 SER D 1478 5 ? 5  
HELX_P HELX_P108 108 GLN D 1489 ? GLU D 1501 ? GLN D 1489 GLU D 1501 1 ? 13 
HELX_P HELX_P109 109 GLY E 5    ? MET E 12   ? GLY E 5    MET E 12   1 ? 8  
HELX_P HELX_P110 110 SER E 15   ? GLY E 34   ? SER E 15   GLY E 34   1 ? 20 
HELX_P HELX_P111 111 ASN E 59   ? GLY E 71   ? ASN E 59   GLY E 71   1 ? 13 
HELX_P HELX_P112 112 PRO E 81   ? TYR E 93   ? PRO E 81   TYR E 93   1 ? 13 
HELX_P HELX_P113 113 ASP F 99   ? GLY F 109  ? ASP F 79   GLY F 89   1 ? 11 
HELX_P HELX_P114 114 THR F 115  ? GLY F 141  ? THR F 95   GLY F 121  1 ? 27 
HELX_P HELX_P115 115 ASP F 143  ? GLY F 157  ? ASP F 123  GLY F 137  1 ? 15 
HELX_P HELX_P116 116 ASP F 172  ? LYS F 184  ? ASP F 152  LYS F 164  1 ? 13 
HELX_P HELX_P117 117 PRO F 187  ? ASN F 211  ? PRO F 167  ASN F 191  1 ? 25 
HELX_P HELX_P118 118 ASN F 211  ? LYS F 220  ? ASN F 191  LYS F 200  1 ? 10 
HELX_P HELX_P119 119 LYS F 221  ? THR F 223  ? LYS F 201  THR F 203  5 ? 3  
HELX_P HELX_P120 120 SER F 228  ? PHE F 247  ? SER F 208  PHE F 227  1 ? 20 
HELX_P HELX_P121 121 GLU F 248  ? ARG F 252  ? GLU F 228  ARG F 232  5 ? 5  
HELX_P HELX_P122 122 LYS F 254  ? ALA F 275  ? LYS F 234  ALA F 255  1 ? 22 
HELX_P HELX_P123 123 PRO F 281  ? GLY F 303  ? PRO F 261  GLY F 283  1 ? 23 
HELX_P HELX_P124 124 THR F 307  ? GLY F 316  ? THR F 287  GLY F 296  1 ? 10 
HELX_P HELX_P125 125 ASP F 320  ? ALA F 331  ? ASP F 300  ALA F 311  1 ? 12 
HELX_P HELX_P126 126 GLY F 350  ? ILE F 353  ? GLY F 330  ILE F 333  5 ? 4  
HELX_P HELX_P127 127 SER F 360  ? SER F 379  ? SER F 340  SER F 359  1 ? 20 
HELX_P HELX_P128 128 SER F 382  ? LYS F 393  ? SER F 362  LYS F 373  1 ? 12 
HELX_P HELX_P129 129 THR F 402  ? GLY F 411  ? THR F 382  GLY F 391  1 ? 10 
HELX_P HELX_P130 130 THR F 413  ? ARG F 436  ? THR F 393  ARG F 416  1 ? 24 
HELX_P HELX_P131 131 LEU F 438  ? ASP F 443  ? LEU F 418  ASP F 423  5 ? 6  
HELX_P HELX_P132 132 GLY I 31   ? SER I 47   ? GLY K 31   SER K 47   1 ? 17 
HELX_P HELX_P133 133 ASP I 74   ? LYS I 83   ? ASP K 74   LYS K 83   1 ? 10 
HELX_P HELX_P134 134 ARG I 112  ? PHE I 114  ? ARG K 112  PHE K 114  5 ? 3  
HELX_P HELX_P135 135 PRO I 152  ? GLY I 157  ? PRO K 152  GLY K 157  1 ? 6  
HELX_P HELX_P136 136 THR I 206  ? TYR I 224  ? THR K 206  TYR K 224  1 ? 19 
HELX_P HELX_P137 137 GLY J 31   ? SER J 47   ? GLY L 31   SER L 47   1 ? 17 
HELX_P HELX_P138 138 ASP J 74   ? GLU J 84   ? ASP L 74   GLU L 84   1 ? 11 
HELX_P HELX_P139 139 PRO J 152  ? GLY J 157  ? PRO L 152  GLY L 157  1 ? 6  
HELX_P HELX_P140 140 THR J 206  ? THR J 223  ? THR L 206  THR L 223  1 ? 18 
HELX_P HELX_P141 141 TYR J 224  ? SER J 226  ? TYR L 224  SER L 226  5 ? 3  
HELX_P HELX_P142 142 THR K 19   ? GLN K 31   ? THR M 19   GLN M 31   1 ? 13 
HELX_P HELX_P143 143 PRO K 35   ? ARG K 39   ? PRO M 35   ARG M 39   5 ? 5  
HELX_P HELX_P144 144 VAL K 42   ? PHE K 52   ? VAL M 42   PHE M 52   1 ? 11 
HELX_P HELX_P145 145 PRO K 79   ? ASP K 87   ? PRO M 79   ASP M 87   1 ? 9  
HELX_P HELX_P146 146 LEU K 193  ? LEU K 200  ? LEU M 193  LEU M 200  1 ? 8  
HELX_P HELX_P147 147 ASP K 203  ? LEU K 211  ? ASP M 203  LEU M 211  1 ? 9  
HELX_P HELX_P148 148 GLU K 216  ? LEU K 221  ? GLU M 216  LEU M 221  1 ? 6  
HELX_P HELX_P149 149 ASP K 223  ? MET K 229  ? ASP M 223  MET M 229  1 ? 7  
HELX_P HELX_P150 150 ARG K 230  ? ARG K 243  ? ARG M 230  ARG M 243  1 ? 14 
HELX_P HELX_P151 151 ARG K 250  ? ILE K 261  ? ARG M 250  ILE M 261  1 ? 12 
HELX_P HELX_P152 152 GLY K 270  ? GLY K 282  ? GLY M 270  GLY M 282  1 ? 13 
HELX_P HELX_P153 153 VAL K 302  ? ALA K 315  ? VAL M 302  ALA M 315  1 ? 14 
HELX_P HELX_P154 154 THR K 335  ? MET K 359  ? THR M 335  MET M 359  1 ? 25 
HELX_P HELX_P155 155 THR K 368  ? VAL K 373  ? THR M 368  VAL M 373  1 ? 6  
HELX_P HELX_P156 156 SER K 375  ? SER K 389  ? SER M 375  SER M 389  1 ? 15 
HELX_P HELX_P157 157 ASN K 399  ? ARG K 408  ? ASN M 399  ARG M 408  1 ? 10 
HELX_P HELX_P158 158 GLY K 424  ? ASP K 429  ? GLY M 424  ASP M 429  1 ? 6  
HELX_P HELX_P159 159 HIS K 431  ? TYR K 435  ? HIS M 431  TYR M 435  5 ? 5  
HELX_P HELX_P160 160 THR K 487  ? ASP K 492  ? THR M 487  ASP M 492  1 ? 6  
HELX_P HELX_P161 161 SER K 525  ? VAL K 529  ? SER M 525  VAL M 529  5 ? 5  
HELX_P HELX_P162 162 SER K 535  ? PHE K 540  ? SER M 535  PHE M 540  5 ? 6  
HELX_P HELX_P163 163 ASN K 543  ? ILE K 547  ? ASN M 543  ILE M 547  5 ? 5  
HELX_P HELX_P164 164 PHE K 549  ? ASP K 553  ? PHE M 549  ASP M 553  5 ? 5  
HELX_P HELX_P165 165 ASP K 554  ? THR K 566  ? ASP M 554  THR M 566  1 ? 13 
HELX_P HELX_P166 166 LEU K 583  ? LEU K 592  ? LEU M 583  LEU M 592  1 ? 10 
HELX_P HELX_P167 167 ASN K 683  ? ALA K 687  ? ASN M 683  ALA M 687  5 ? 5  
HELX_P HELX_P168 168 GLU K 692  ? ARG K 697  ? GLU M 692  ARG M 697  1 ? 6  
HELX_P HELX_P169 169 SER K 730  ? ARG K 735  ? SER M 730  ARG M 735  1 ? 6  
HELX_P HELX_P170 170 THR K 768  ? GLY K 779  ? THR M 768  GLY M 779  1 ? 12 
HELX_P HELX_P171 171 PRO K 854  ? MET K 858  ? PRO M 854  MET M 858  5 ? 5  
HELX_P HELX_P172 172 ASN K 872  ? VAL K 876  ? ASN M 872  VAL M 876  5 ? 5  
HELX_P HELX_P173 173 LEU K 882  ? GLY K 898  ? LEU M 882  GLY M 898  1 ? 17 
HELX_P HELX_P174 174 LYS K 910  ? GLU K 932  ? LYS M 910  GLU M 932  1 ? 23 
HELX_P HELX_P175 175 ASP K 937  ? LEU K 950  ? ASP M 937  LEU M 950  1 ? 14 
HELX_P HELX_P176 176 THR K 958  ? LEU K 968  ? THR M 958  LEU M 968  1 ? 11 
HELX_P HELX_P177 177 MET K 1000 ? MET K 1005 ? MET M 1000 MET M 1005 1 ? 6  
HELX_P HELX_P178 178 GLY K 1023 ? PHE K 1027 ? GLY M 1023 PHE M 1027 5 ? 5  
HELX_P HELX_P179 179 GLY K 1033 ? GLY K 1044 ? GLY M 1033 GLY M 1044 1 ? 12 
HELX_P HELX_P180 180 ALA K 1045 ? THR K 1054 ? ALA M 1045 THR M 1054 1 ? 10 
HELX_P HELX_P181 181 ASP K 1059 ? GLY K 1073 ? ASP M 1059 GLY M 1073 1 ? 15 
HELX_P HELX_P182 182 PRO K 1082 ? LEU K 1095 ? PRO M 1082 LEU M 1095 1 ? 14 
HELX_P HELX_P183 183 SER L 14   ? TRP L 21   ? SER N 14   TRP N 21   1 ? 8  
HELX_P HELX_P184 184 LYS L 82   ? TYR L 88   ? LYS N 82   TYR N 88   5 ? 7  
HELX_P HELX_P185 185 ILE L 102  ? ASP L 107  ? ILE N 102  ASP N 107  1 ? 6  
HELX_P HELX_P186 186 SER L 110  ? ASP L 117  ? SER N 110  ASP N 117  1 ? 8  
HELX_P HELX_P187 187 SER L 119  ? TYR L 128  ? SER N 119  TYR N 128  1 ? 10 
HELX_P HELX_P188 188 THR L 154  ? GLY L 164  ? THR N 154  GLY N 164  1 ? 11 
HELX_P HELX_P189 189 ASP L 423  ? LYS L 426  ? ASP N 423  LYS N 426  5 ? 4  
HELX_P HELX_P190 190 MET L 456  ? GLU L 467  ? MET N 456  GLU N 467  1 ? 12 
HELX_P HELX_P191 191 ASP L 469  ? MET L 481  ? ASP N 469  MET N 481  1 ? 13 
HELX_P HELX_P192 192 SER L 485  ? GLY L 506  ? SER N 485  GLY N 506  1 ? 22 
HELX_P HELX_P193 193 ARG L 508  ? TRP L 511  ? ARG N 508  TRP N 511  5 ? 4  
HELX_P HELX_P194 194 PRO L 521  ? ARG L 525  ? PRO N 521  ARG N 525  5 ? 5  
HELX_P HELX_P195 195 SER L 538  ? GLN L 560  ? SER N 538  GLN N 560  1 ? 23 
HELX_P HELX_P196 196 PRO L 563  ? ASP L 583  ? PRO N 563  ASP N 583  1 ? 21 
HELX_P HELX_P197 197 SER L 602  ? SER L 608  ? SER N 602  SER N 608  1 ? 7  
HELX_P HELX_P198 198 GLY L 612  ? LEU L 618  ? GLY N 612  LEU N 618  1 ? 7  
HELX_P HELX_P199 199 LYS L 646  ? PHE L 653  ? LYS N 646  PHE N 653  1 ? 8  
HELX_P HELX_P200 200 PHE L 653  ? LYS L 664  ? PHE N 653  LYS N 664  1 ? 12 
HELX_P HELX_P201 201 ASN L 669  ? ARG L 679  ? ASN N 669  ARG N 679  1 ? 11 
HELX_P HELX_P202 202 GLN L 680  ? ILE L 683  ? GLN N 680  ILE N 683  5 ? 4  
HELX_P HELX_P203 203 ASP L 685  ? ILE L 695  ? ASP N 685  ILE N 695  1 ? 11 
HELX_P HELX_P204 204 HIS L 709  ? LEU L 711  ? HIS N 709  LEU N 711  5 ? 3  
HELX_P HELX_P205 205 HIS L 729  ? LEU L 731  ? HIS N 729  LEU N 731  5 ? 3  
HELX_P HELX_P206 206 VAL L 732  ? ASN L 737  ? VAL N 732  ASN N 737  1 ? 6  
HELX_P HELX_P207 207 SER L 752  ? GLN L 762  ? SER N 752  GLN N 762  1 ? 11 
HELX_P HELX_P208 208 LEU L 764  ? ASN L 768  ? LEU N 764  ASN N 768  5 ? 5  
HELX_P HELX_P209 209 ARG L 783  ? GLN L 794  ? ARG N 783  GLN N 794  1 ? 12 
HELX_P HELX_P210 210 THR L 808  ? ARG L 818  ? THR N 808  ARG N 818  1 ? 11 
HELX_P HELX_P211 211 VAL L 836  ? TYR L 841  ? VAL N 836  TYR N 841  1 ? 6  
HELX_P HELX_P212 212 ASN L 845  ? HIS L 855  ? ASN N 845  HIS N 855  1 ? 11 
HELX_P HELX_P213 213 SER L 876  ? GLU L 891  ? SER N 876  GLU N 891  1 ? 16 
HELX_P HELX_P214 214 ASP L 892  ? ILE L 900  ? ASP N 892  ILE N 900  1 ? 9  
HELX_P HELX_P215 215 GLU L 907  ? GLY L 923  ? GLU N 907  GLY N 923  1 ? 17 
HELX_P HELX_P216 216 GLY L 923  ? SER L 945  ? GLY N 923  SER N 945  1 ? 23 
HELX_P HELX_P217 217 GLY L 950  ? ALA L 954  ? GLY N 950  ALA N 954  5 ? 5  
HELX_P HELX_P218 218 GLU L 958  ? MET L 980  ? GLU N 958  MET N 980  1 ? 23 
HELX_P HELX_P219 219 THR L 984  ? TYR L 1015 ? THR N 984  TYR N 1015 1 ? 32 
HELX_P HELX_P220 220 ASN L 1018 ? SER L 1026 ? ASN N 1018 SER N 1026 1 ? 9  
HELX_P HELX_P221 221 ASN L 1031 ? GLY L 1040 ? ASN N 1031 GLY N 1040 1 ? 10 
HELX_P HELX_P222 222 THR L 1066 ? HIS L 1103 ? THR N 1066 HIS N 1103 1 ? 38 
HELX_P HELX_P223 223 LYS L 1136 ? TYR L 1145 ? LYS N 1136 TYR N 1145 1 ? 10 
HELX_P HELX_P224 224 SER L 1167 ? ALA L 1180 ? SER N 1167 ALA N 1180 1 ? 14 
HELX_P HELX_P225 225 GLN L 1202 ? GLY L 1206 ? GLN N 1202 GLY N 1206 1 ? 5  
HELX_P HELX_P226 226 ALA L 1220 ? GLU L 1231 ? ALA N 1220 GLU N 1231 1 ? 12 
HELX_P HELX_P227 227 PRO L 1232 ? LEU L 1236 ? PRO N 1232 LEU N 1236 5 ? 5  
HELX_P HELX_P228 228 GLN L 1254 ? GLU L 1264 ? GLN N 1254 GLU N 1264 1 ? 11 
HELX_P HELX_P229 229 ASP L 1331 ? GLY L 1340 ? ASP N 1331 GLY N 1340 1 ? 10 
HELX_P HELX_P230 230 GLY L 1340 ? GLN L 1359 ? GLY N 1340 GLN N 1359 1 ? 20 
HELX_P HELX_P231 231 HIS L 1364 ? MET L 1376 ? HIS N 1364 MET N 1376 1 ? 13 
HELX_P HELX_P232 232 LYS L 1397 ? GLU L 1410 ? LYS N 1397 GLU N 1410 1 ? 14 
HELX_P HELX_P233 233 GLY L 1423 ? SER L 1430 ? GLY N 1423 SER N 1430 1 ? 8  
HELX_P HELX_P234 234 SER L 1433 ? SER L 1439 ? SER N 1433 SER N 1439 1 ? 7  
HELX_P HELX_P235 235 ASN L 1442 ? GLY L 1454 ? ASN N 1442 GLY N 1454 1 ? 13 
HELX_P HELX_P236 236 GLY L 1461 ? LEU L 1468 ? GLY N 1461 LEU N 1468 1 ? 8  
HELX_P HELX_P237 237 ALA L 1474 ? SER L 1478 ? ALA N 1474 SER N 1478 5 ? 5  
HELX_P HELX_P238 238 GLN L 1489 ? ALA L 1502 ? GLN N 1489 ALA N 1502 1 ? 14 
HELX_P HELX_P239 239 GLY M 5    ? MET M 12   ? GLY O 5    MET O 12   1 ? 8  
HELX_P HELX_P240 240 SER M 15   ? GLY M 34   ? SER O 15   GLY O 34   1 ? 20 
HELX_P HELX_P241 241 ASN M 59   ? GLY M 71   ? ASN O 59   GLY O 71   1 ? 13 
HELX_P HELX_P242 242 PRO M 81   ? TYR M 93   ? PRO O 81   TYR O 93   1 ? 13 
HELX_P HELX_P243 243 ASP N 99   ? GLY N 109  ? ASP P 79   GLY P 89   1 ? 11 
HELX_P HELX_P244 244 THR N 115  ? GLY N 141  ? THR P 95   GLY P 121  1 ? 27 
HELX_P HELX_P245 245 ASP N 143  ? GLY N 157  ? ASP P 123  GLY P 137  1 ? 15 
HELX_P HELX_P246 246 ASP N 172  ? LYS N 184  ? ASP P 152  LYS P 164  1 ? 13 
HELX_P HELX_P247 247 PRO N 187  ? ASN N 211  ? PRO P 167  ASN P 191  1 ? 25 
HELX_P HELX_P248 248 ASN N 211  ? LYS N 220  ? ASN P 191  LYS P 200  1 ? 10 
HELX_P HELX_P249 249 LYS N 221  ? THR N 223  ? LYS P 201  THR P 203  5 ? 3  
HELX_P HELX_P250 250 SER N 228  ? PHE N 247  ? SER P 208  PHE P 227  1 ? 20 
HELX_P HELX_P251 251 GLU N 248  ? ARG N 252  ? GLU P 228  ARG P 232  5 ? 5  
HELX_P HELX_P252 252 LYS N 254  ? ALA N 275  ? LYS P 234  ALA P 255  1 ? 22 
HELX_P HELX_P253 253 PRO N 281  ? GLY N 303  ? PRO P 261  GLY P 283  1 ? 23 
HELX_P HELX_P254 254 THR N 307  ? MET N 315  ? THR P 287  MET P 295  1 ? 9  
HELX_P HELX_P255 255 ASP N 320  ? ALA N 331  ? ASP P 300  ALA P 311  1 ? 12 
HELX_P HELX_P256 256 GLY N 350  ? ILE N 353  ? GLY P 330  ILE P 333  5 ? 4  
HELX_P HELX_P257 257 SER N 360  ? SER N 379  ? SER P 340  SER P 359  1 ? 20 
HELX_P HELX_P258 258 SER N 382  ? LYS N 393  ? SER P 362  LYS P 373  1 ? 12 
HELX_P HELX_P259 259 THR N 402  ? GLY N 411  ? THR P 382  GLY P 391  1 ? 10 
HELX_P HELX_P260 260 THR N 413  ? ARG N 436  ? THR P 393  ARG P 416  1 ? 24 
HELX_P HELX_P261 261 LEU N 438  ? ASP N 443  ? LEU P 418  ASP P 423  5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? L LYS 840  O   ? ? ? 1_555 BA MG .  MG ? ? N LYS 840  N MG 2004 1_555 ? ? ? ? ? ? ?            2.060 ? 
metalc2  metalc ? ? D LYS 840  O   ? ? ? 1_555 U  MG .  MG ? ? D LYS 840  D MG 2004 1_555 ? ? ? ? ? ? ?            2.070 ? 
metalc3  metalc ? ? D ASP 739  OD1 ? ? ? 1_555 T  MG .  MG ? ? D ASP 739  D MG 2003 1_555 ? ? ? ? ? ? ?            2.162 ? 
metalc4  metalc ? ? D CYS 1204 SG  ? ? ? 1_555 R  ZN .  ZN ? ? D CYS 1204 D ZN 2001 1_555 ? ? ? ? ? ? ?            2.199 ? 
metalc5  metalc ? ? D ASP 741  OD1 ? ? ? 1_555 T  MG .  MG ? ? D ASP 741  D MG 2003 1_555 ? ? ? ? ? ? ?            2.201 ? 
metalc6  metalc ? ? L ASP 739  OD1 ? ? ? 1_555 AA MG .  MG ? ? N ASP 739  N MG 2003 1_555 ? ? ? ? ? ? ?            2.208 ? 
metalc7  metalc ? ? B ASP 183  OD2 ? ? ? 1_555 Q  MG .  MG ? ? B ASP 183  B MG 2001 1_555 ? ? ? ? ? ? ?            2.210 ? 
metalc8  metalc ? ? L CYS 60   SG  ? ? ? 1_555 Z  ZN .  ZN ? ? N CYS 60   N ZN 2002 1_555 ? ? ? ? ? ? ?            2.221 ? 
metalc9  metalc ? ? L ASP 741  OD1 ? ? ? 1_555 AA MG .  MG ? ? N ASP 741  N MG 2003 1_555 ? ? ? ? ? ? ?            2.224 ? 
metalc10 metalc ? ? D ASP 743  OD1 ? ? ? 1_555 T  MG .  MG ? ? D ASP 743  D MG 2003 1_555 ? ? ? ? ? ? ?            2.224 ? 
metalc11 metalc ? ? L CYS 1204 SG  ? ? ? 1_555 Y  ZN .  ZN ? ? N CYS 1204 N ZN 2001 1_555 ? ? ? ? ? ? ?            2.229 ? 
metalc12 metalc ? ? L CYS 76   SG  ? ? ? 1_555 Z  ZN .  ZN ? ? N CYS 76   N ZN 2002 1_555 ? ? ? ? ? ? ?            2.235 ? 
metalc13 metalc ? ? D CYS 1112 SG  ? ? ? 1_555 R  ZN .  ZN ? ? D CYS 1112 D ZN 2001 1_555 ? ? ? ? ? ? ?            2.236 ? 
metalc14 metalc ? ? D CYS 73   SG  ? ? ? 1_555 S  ZN .  ZN ? ? D CYS 73   D ZN 2002 1_555 ? ? ? ? ? ? ?            2.252 ? 
metalc15 metalc ? ? D CYS 76   SG  ? ? ? 1_555 S  ZN .  ZN ? ? D CYS 76   D ZN 2002 1_555 ? ? ? ? ? ? ?            2.265 ? 
metalc16 metalc ? ? L ASP 743  OD1 ? ? ? 1_555 AA MG .  MG ? ? N ASP 743  N MG 2003 1_555 ? ? ? ? ? ? ?            2.269 ? 
metalc17 metalc ? ? L CYS 1201 SG  ? ? ? 1_555 Y  ZN .  ZN ? ? N CYS 1201 N ZN 2001 1_555 ? ? ? ? ? ? ?            2.272 ? 
metalc18 metalc ? ? D CYS 60   SG  ? ? ? 1_555 S  ZN .  ZN ? ? D CYS 60   D ZN 2002 1_555 ? ? ? ? ? ? ?            2.297 ? 
metalc19 metalc ? ? F GLY 316  O   ? ? ? 1_555 W  MG .  MG ? ? F GLY 296  F MG 2001 1_555 ? ? ? ? ? ? ?            2.298 ? 
metalc20 metalc ? ? B ASP 193  OD1 ? ? ? 1_555 Q  MG .  MG ? ? B ASP 193  B MG 2001 1_555 ? ? ? ? ? ? ?            2.309 ? 
metalc21 metalc ? ? D CYS 58   SG  ? ? ? 1_555 S  ZN .  ZN ? ? D CYS 58   D ZN 2002 1_555 ? ? ? ? ? ? ?            2.316 ? 
metalc22 metalc ? ? L CYS 58   SG  ? ? ? 1_555 Z  ZN .  ZN ? ? N CYS 58   N ZN 2002 1_555 ? ? ? ? ? ? ?            2.332 ? 
metalc23 metalc ? ? L CYS 73   SG  ? ? ? 1_555 Z  ZN .  ZN ? ? N CYS 73   N ZN 2002 1_555 ? ? ? ? ? ? ?            2.333 ? 
metalc24 metalc ? ? D CYS 1201 SG  ? ? ? 1_555 R  ZN .  ZN ? ? D CYS 1201 D ZN 2001 1_555 ? ? ? ? ? ? ?            2.343 ? 
metalc25 metalc ? ? L CYS 1194 SG  ? ? ? 1_555 Y  ZN .  ZN ? ? N CYS 1194 N ZN 2001 1_555 ? ? ? ? ? ? ?            2.364 ? 
metalc26 metalc ? ? D CYS 1194 SG  ? ? ? 1_555 R  ZN .  ZN ? ? D CYS 1194 D ZN 2001 1_555 ? ? ? ? ? ? ?            2.381 ? 
metalc27 metalc ? ? L CYS 1112 SG  ? ? ? 1_555 Y  ZN .  ZN ? ? N CYS 1112 N ZN 2001 1_555 ? ? ? ? ? ? ?            2.391 ? 
metalc28 metalc ? ? F ALA 312  O   ? ? ? 1_555 W  MG .  MG ? ? F ALA 292  F MG 2001 1_555 ? ? ? ? ? ? ?            2.425 ? 
metalc29 metalc ? ? F TRP 319  O   ? ? ? 1_555 W  MG .  MG ? ? F TRP 299  F MG 2001 1_555 ? ? ? ? ? ? ?            2.495 ? 
metalc30 metalc ? ? L ILE 900  O   ? ? ? 1_555 CA MG .  MG ? ? N ILE 900  N MG 2005 1_555 ? ? ? ? ? ? ?            2.534 ? 
metalc31 metalc ? ? D ASP 741  OD2 ? ? ? 1_555 T  MG .  MG ? ? D ASP 741  D MG 2003 1_555 ? ? ? ? ? ? ?            2.834 ? 
metalc32 metalc ? ? L ASP 741  OD2 ? ? ? 1_555 AA MG .  MG ? ? N ASP 741  N MG 2003 1_555 ? ? ? ? ? ? ?            2.851 ? 
metalc33 metalc ? ? N TRP 319  O   ? ? ? 1_555 DA MG .  MG ? ? P TRP 299  P MG 2001 1_555 ? ? ? ? ? ? ?            2.939 ? 
metalc34 metalc ? ? L TRP 897  O   ? ? ? 1_555 CA MG .  MG ? ? N TRP 897  N MG 2005 1_555 ? ? ? ? ? ? ?            2.962 ? 
metalc35 metalc ? ? D ILE 900  O   ? ? ? 1_555 V  MG .  MG ? ? D ILE 900  D MG 2005 1_555 ? ? ? ? ? ? ?            2.986 ? 
hydrog1  hydrog ? ? G DG  4    N1  ? ? ? 1_555 H  DC 24 N3 ? ? G DG  4    H DC 24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? G DG  4    N2  ? ? ? 1_555 H  DC 24 O2 ? ? G DG  4    H DC 24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? G DG  4    O6  ? ? ? 1_555 H  DC 24 N4 ? ? G DG  4    H DC 24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? G DC  5    N3  ? ? ? 1_555 H  DG 23 N1 ? ? G DC  5    H DG 23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? G DC  5    N4  ? ? ? 1_555 H  DG 23 O6 ? ? G DC  5    H DG 23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? G DC  5    O2  ? ? ? 1_555 H  DG 23 N2 ? ? G DC  5    H DG 23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? G DA  6    N1  ? ? ? 1_555 H  DT 22 N3 ? ? G DA  6    H DT 22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? G DA  6    N6  ? ? ? 1_555 H  DT 22 O4 ? ? G DA  6    H DT 22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? G DT  7    N3  ? ? ? 1_555 H  DA 21 N1 ? ? G DT  7    H DA 21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? G DT  7    O4  ? ? ? 1_555 H  DA 21 N6 ? ? G DT  7    H DA 21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? G DC  8    N3  ? ? ? 1_555 H  DG 20 N1 ? ? G DC  8    H DG 20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? G DC  8    N4  ? ? ? 1_555 H  DG 20 O6 ? ? G DC  8    H DG 20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? G DC  8    O2  ? ? ? 1_555 H  DG 20 N2 ? ? G DC  8    H DG 20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? G DC  9    N3  ? ? ? 1_555 H  DG 19 N1 ? ? G DC  9    H DG 19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? G DC  9    N4  ? ? ? 1_555 H  DG 19 O6 ? ? G DC  9    H DG 19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? G DC  9    O2  ? ? ? 1_555 H  DG 19 N2 ? ? G DC  9    H DG 19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? G DG  10   N1  ? ? ? 1_555 H  DC 18 N3 ? ? G DG  10   H DC 18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? G DG  10   N2  ? ? ? 1_555 H  DC 18 O2 ? ? G DG  10   H DC 18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? G DG  10   O6  ? ? ? 1_555 H  DC 18 N4 ? ? G DG  10   H DC 18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? G DT  11   N3  ? ? ? 1_555 H  DA 17 N1 ? ? G DT  11   H DA 17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? G DT  11   O4  ? ? ? 1_555 H  DA 17 N6 ? ? G DT  11   H DA 17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? G DG  12   N1  ? ? ? 1_555 H  DC 16 N3 ? ? G DG  12   H DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? G DG  12   N2  ? ? ? 1_555 H  DC 16 O2 ? ? G DG  12   H DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? G DG  12   O6  ? ? ? 1_555 H  DC 16 N4 ? ? G DG  12   H DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? G DA  13   N1  ? ? ? 1_555 H  DT 15 N3 ? ? G DA  13   H DT 15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? G DA  13   N6  ? ? ? 1_555 H  DT 15 O4 ? ? G DA  13   H DT 15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? O DG  4    N1  ? ? ? 1_555 P  DC 24 N3 ? ? Q DG  4    R DC 24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? O DG  4    N2  ? ? ? 1_555 P  DC 24 O2 ? ? Q DG  4    R DC 24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? O DG  4    O6  ? ? ? 1_555 P  DC 24 N4 ? ? Q DG  4    R DC 24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? O DC  5    N3  ? ? ? 1_555 P  DG 23 N1 ? ? Q DC  5    R DG 23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? O DC  5    N4  ? ? ? 1_555 P  DG 23 O6 ? ? Q DC  5    R DG 23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? O DC  5    O2  ? ? ? 1_555 P  DG 23 N2 ? ? Q DC  5    R DG 23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? O DA  6    N1  ? ? ? 1_555 P  DT 22 N3 ? ? Q DA  6    R DT 22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? O DA  6    N6  ? ? ? 1_555 P  DT 22 O4 ? ? Q DA  6    R DT 22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? O DT  7    N3  ? ? ? 1_555 P  DA 21 N1 ? ? Q DT  7    R DA 21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? O DT  7    O4  ? ? ? 1_555 P  DA 21 N6 ? ? Q DT  7    R DA 21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? O DC  8    N3  ? ? ? 1_555 P  DG 20 N1 ? ? Q DC  8    R DG 20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? O DC  8    N4  ? ? ? 1_555 P  DG 20 O6 ? ? Q DC  8    R DG 20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? O DC  8    O2  ? ? ? 1_555 P  DG 20 N2 ? ? Q DC  8    R DG 20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? O DC  9    N3  ? ? ? 1_555 P  DG 19 N1 ? ? Q DC  9    R DG 19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? O DC  9    N4  ? ? ? 1_555 P  DG 19 O6 ? ? Q DC  9    R DG 19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? O DC  9    O2  ? ? ? 1_555 P  DG 19 N2 ? ? Q DC  9    R DG 19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? O DG  10   N1  ? ? ? 1_555 P  DC 18 N3 ? ? Q DG  10   R DC 18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? O DG  10   N2  ? ? ? 1_555 P  DC 18 O2 ? ? Q DG  10   R DC 18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? O DG  10   O6  ? ? ? 1_555 P  DC 18 N4 ? ? Q DG  10   R DC 18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? O DT  11   N3  ? ? ? 1_555 P  DA 17 N1 ? ? Q DT  11   R DA 17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? O DT  11   O4  ? ? ? 1_555 P  DA 17 N6 ? ? Q DT  11   R DA 17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? O DG  12   N1  ? ? ? 1_555 P  DC 16 N3 ? ? Q DG  12   R DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? O DG  12   N2  ? ? ? 1_555 P  DC 16 O2 ? ? Q DG  12   R DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? O DG  12   O6  ? ? ? 1_555 P  DC 16 N4 ? ? Q DG  12   R DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? O DA  13   N1  ? ? ? 1_555 P  DT 15 N3 ? ? Q DA  13   R DT 15   1_555 ? ? ? ? ? ? 'DA-DT PAIR' ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  GLU 26  A . ? GLU 26  A PRO 27  A ? PRO 27  A 1 -9.12  
2  GLU 26  B . ? GLU 26  B PRO 27  B ? PRO 27  B 1 -10.06 
3  PHE 52  C . ? PHE 52  C PRO 53  C ? PRO 53  C 1 1.65   
4  VAL 108 D . ? VAL 108 D PRO 109 D ? PRO 109 D 1 -8.24  
5  ALA 705 D . ? ALA 705 D PRO 706 D ? PRO 706 D 1 -0.54  
6  GLU 26  I . ? GLU 26  K PRO 27  I ? PRO 27  K 1 -9.21  
7  GLU 26  J . ? GLU 26  L PRO 27  J ? PRO 27  L 1 -10.13 
8  PHE 52  K . ? PHE 52  M PRO 53  K ? PRO 53  M 1 3.99   
9  VAL 108 L . ? VAL 108 N PRO 109 L ? PRO 109 N 1 -8.42  
10 ALA 705 L . ? ALA 705 N PRO 706 L ? PRO 706 N 1 -2.24  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 4 ? 
B  ? 4 ? 
C  ? 2 ? 
D  ? 2 ? 
E  ? 2 ? 
F  ? 4 ? 
G  ? 4 ? 
H  ? 2 ? 
I  ? 2 ? 
J  ? 2 ? 
K  ? 3 ? 
L  ? 3 ? 
M  ? 3 ? 
N  ? 4 ? 
O  ? 5 ? 
P  ? 2 ? 
Q  ? 3 ? 
R  ? 6 ? 
S  ? 2 ? 
T  ? 3 ? 
U  ? 4 ? 
V  ? 2 ? 
W  ? 2 ? 
X  ? 8 ? 
Y  ? 4 ? 
Z  ? 3 ? 
AA ? 2 ? 
AB ? 8 ? 
AC ? 2 ? 
AD ? 3 ? 
AE ? 3 ? 
AF ? 3 ? 
AG ? 2 ? 
AH ? 4 ? 
AI ? 2 ? 
AJ ? 5 ? 
AK ? 3 ? 
AL ? 3 ? 
AM ? 4 ? 
AN ? 3 ? 
AO ? 4 ? 
AP ? 2 ? 
AQ ? 3 ? 
AR ? 3 ? 
AS ? 3 ? 
AT ? 2 ? 
AU ? 2 ? 
AV ? 2 ? 
AW ? 2 ? 
AX ? 4 ? 
AY ? 3 ? 
AZ ? 2 ? 
BA ? 2 ? 
BB ? 2 ? 
BC ? 4 ? 
BD ? 4 ? 
BE ? 2 ? 
BF ? 2 ? 
BG ? 2 ? 
BH ? 4 ? 
BI ? 4 ? 
BJ ? 2 ? 
BK ? 2 ? 
BL ? 2 ? 
BM ? 3 ? 
BN ? 3 ? 
BO ? 3 ? 
BP ? 4 ? 
BQ ? 5 ? 
BR ? 2 ? 
BS ? 3 ? 
BT ? 6 ? 
BU ? 2 ? 
BV ? 3 ? 
BW ? 4 ? 
BX ? 2 ? 
BY ? 2 ? 
BZ ? 8 ? 
CA ? 4 ? 
CB ? 3 ? 
CC ? 2 ? 
CD ? 8 ? 
CE ? 2 ? 
CF ? 4 ? 
CG ? 3 ? 
CH ? 3 ? 
CI ? 2 ? 
CJ ? 4 ? 
CK ? 2 ? 
CL ? 5 ? 
CM ? 3 ? 
CN ? 3 ? 
CO ? 4 ? 
CP ? 3 ? 
CQ ? 4 ? 
CR ? 2 ? 
CS ? 3 ? 
CT ? 3 ? 
CU ? 3 ? 
CV ? 2 ? 
CW ? 2 ? 
CX ? 2 ? 
CY ? 2 ? 
CZ ? 2 ? 
DA ? 4 ? 
DB ? 3 ? 
DC ? 2 ? 
DD ? 2 ? 
DE ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
C  1 2 ? anti-parallel 
D  1 2 ? anti-parallel 
E  1 2 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? anti-parallel 
H  1 2 ? anti-parallel 
I  1 2 ? anti-parallel 
J  1 2 ? anti-parallel 
K  1 2 ? parallel      
K  2 3 ? parallel      
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? parallel      
N  3 4 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
O  3 4 ? anti-parallel 
O  4 5 ? anti-parallel 
P  1 2 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
R  3 4 ? parallel      
R  4 5 ? anti-parallel 
R  5 6 ? anti-parallel 
S  1 2 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
U  3 4 ? anti-parallel 
V  1 2 ? anti-parallel 
W  1 2 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
X  4 5 ? parallel      
X  5 6 ? anti-parallel 
X  6 7 ? parallel      
X  7 8 ? anti-parallel 
Y  1 2 ? anti-parallel 
Y  2 3 ? anti-parallel 
Y  3 4 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
AA 1 2 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AB 5 6 ? parallel      
AB 6 7 ? anti-parallel 
AB 7 8 ? parallel      
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AE 1 2 ? parallel      
AE 2 3 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AG 1 2 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AH 3 4 ? anti-parallel 
AI 1 2 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AJ 3 4 ? anti-parallel 
AJ 4 5 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? anti-parallel 
AL 1 2 ? anti-parallel 
AL 2 3 ? anti-parallel 
AM 1 2 ? anti-parallel 
AM 2 3 ? anti-parallel 
AM 3 4 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AO 1 2 ? anti-parallel 
AO 2 3 ? anti-parallel 
AO 3 4 ? anti-parallel 
AP 1 2 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AQ 2 3 ? parallel      
AR 1 2 ? parallel      
AR 2 3 ? anti-parallel 
AS 1 2 ? parallel      
AS 2 3 ? anti-parallel 
AT 1 2 ? parallel      
AU 1 2 ? anti-parallel 
AV 1 2 ? anti-parallel 
AW 1 2 ? anti-parallel 
AX 1 2 ? anti-parallel 
AX 2 3 ? anti-parallel 
AX 3 4 ? anti-parallel 
AY 1 2 ? anti-parallel 
AY 2 3 ? anti-parallel 
AZ 1 2 ? anti-parallel 
BA 1 2 ? anti-parallel 
BB 1 2 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BC 3 4 ? anti-parallel 
BD 1 2 ? anti-parallel 
BD 2 3 ? anti-parallel 
BD 3 4 ? anti-parallel 
BE 1 2 ? anti-parallel 
BF 1 2 ? anti-parallel 
BG 1 2 ? anti-parallel 
BH 1 2 ? anti-parallel 
BH 2 3 ? anti-parallel 
BH 3 4 ? anti-parallel 
BI 1 2 ? anti-parallel 
BI 2 3 ? anti-parallel 
BI 3 4 ? anti-parallel 
BJ 1 2 ? anti-parallel 
BK 1 2 ? anti-parallel 
BL 1 2 ? anti-parallel 
BM 1 2 ? parallel      
BM 2 3 ? parallel      
BN 1 2 ? anti-parallel 
BN 2 3 ? anti-parallel 
BO 1 2 ? anti-parallel 
BO 2 3 ? anti-parallel 
BP 1 2 ? anti-parallel 
BP 2 3 ? parallel      
BP 3 4 ? anti-parallel 
BQ 1 2 ? anti-parallel 
BQ 2 3 ? anti-parallel 
BQ 3 4 ? anti-parallel 
BQ 4 5 ? anti-parallel 
BR 1 2 ? anti-parallel 
BS 1 2 ? anti-parallel 
BS 2 3 ? anti-parallel 
BT 1 2 ? anti-parallel 
BT 2 3 ? anti-parallel 
BT 3 4 ? parallel      
BT 4 5 ? anti-parallel 
BT 5 6 ? anti-parallel 
BU 1 2 ? anti-parallel 
BV 1 2 ? anti-parallel 
BV 2 3 ? anti-parallel 
BW 1 2 ? anti-parallel 
BW 2 3 ? anti-parallel 
BW 3 4 ? anti-parallel 
BX 1 2 ? anti-parallel 
BY 1 2 ? anti-parallel 
BZ 1 2 ? anti-parallel 
BZ 2 3 ? anti-parallel 
BZ 3 4 ? anti-parallel 
BZ 4 5 ? parallel      
BZ 5 6 ? anti-parallel 
BZ 6 7 ? parallel      
BZ 7 8 ? anti-parallel 
CA 1 2 ? anti-parallel 
CA 2 3 ? anti-parallel 
CA 3 4 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? anti-parallel 
CC 1 2 ? anti-parallel 
CD 1 2 ? anti-parallel 
CD 2 3 ? anti-parallel 
CD 3 4 ? anti-parallel 
CD 4 5 ? anti-parallel 
CD 5 6 ? parallel      
CD 6 7 ? anti-parallel 
CD 7 8 ? parallel      
CE 1 2 ? anti-parallel 
CF 1 2 ? anti-parallel 
CF 2 3 ? anti-parallel 
CF 3 4 ? anti-parallel 
CG 1 2 ? parallel      
CG 2 3 ? anti-parallel 
CH 1 2 ? anti-parallel 
CH 2 3 ? anti-parallel 
CI 1 2 ? anti-parallel 
CJ 1 2 ? anti-parallel 
CJ 2 3 ? anti-parallel 
CJ 3 4 ? anti-parallel 
CK 1 2 ? anti-parallel 
CL 1 2 ? anti-parallel 
CL 2 3 ? anti-parallel 
CL 3 4 ? anti-parallel 
CL 4 5 ? anti-parallel 
CM 1 2 ? anti-parallel 
CM 2 3 ? anti-parallel 
CN 1 2 ? anti-parallel 
CN 2 3 ? anti-parallel 
CO 1 2 ? anti-parallel 
CO 2 3 ? anti-parallel 
CO 3 4 ? anti-parallel 
CP 1 2 ? anti-parallel 
CP 2 3 ? anti-parallel 
CQ 1 2 ? anti-parallel 
CQ 2 3 ? anti-parallel 
CQ 3 4 ? anti-parallel 
CR 1 2 ? anti-parallel 
CS 1 2 ? anti-parallel 
CS 2 3 ? parallel      
CT 1 2 ? parallel      
CT 2 3 ? anti-parallel 
CU 1 2 ? parallel      
CU 2 3 ? anti-parallel 
CV 1 2 ? parallel      
CW 1 2 ? anti-parallel 
CX 1 2 ? anti-parallel 
CY 1 2 ? anti-parallel 
CZ 1 2 ? parallel      
DA 1 2 ? anti-parallel 
DA 2 3 ? anti-parallel 
DA 3 4 ? anti-parallel 
DB 1 2 ? anti-parallel 
DB 2 3 ? anti-parallel 
DC 1 2 ? anti-parallel 
DD 1 2 ? anti-parallel 
DE 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 VAL A 10   ? GLN A 16   ? VAL A 10   GLN A 16   
A  2 TYR A 20   ? LEU A 28   ? TYR A 20   LEU A 28   
A  3 LEU A 192  ? THR A 201  ? LEU A 192  THR A 201  
A  4 VAL A 174  ? THR A 184  ? VAL A 174  THR A 184  
B  1 THR A 96   ? GLU A 104  ? THR A 96   GLU A 104  
B  2 ARG A 137  ? GLY A 147  ? ARG A 137  GLY A 147  
B  3 GLY A 50   ? ILE A 58   ? GLY A 50   ILE A 58   
B  4 ILE A 165  ? PRO A 166  ? ILE A 165  PRO A 166  
C  1 VAL A 87   ? PHE A 89   ? VAL A 87   PHE A 89   
C  2 VAL A 120  ? ILE A 122  ? VAL A 120  ILE A 122  
D  1 GLU A 108  ? LYS A 110  ? GLU A 108  LYS A 110  
D  2 HIS A 128  ? THR A 131  ? HIS A 128  THR A 131  
E  1 TYR A 150  ? VAL A 151  ? TYR A 150  VAL A 151  
E  2 ALA A 169  ? VAL A 170  ? ALA A 169  VAL A 170  
F  1 VAL B 10   ? GLN B 16   ? VAL B 10   GLN B 16   
F  2 TYR B 20   ? LEU B 28   ? TYR B 20   LEU B 28   
F  3 ARG B 189  ? THR B 201  ? ARG B 189  THR B 201  
F  4 VAL B 174  ? LEU B 186  ? VAL B 174  LEU B 186  
G  1 THR B 96   ? GLU B 104  ? THR B 96   GLU B 104  
G  2 ARG B 137  ? VAL B 148  ? ARG B 137  VAL B 148  
G  3 PRO B 49   ? ILE B 58   ? PRO B 49   ILE B 58   
G  4 ILE B 165  ? PRO B 166  ? ILE B 165  PRO B 166  
H  1 VAL B 87   ? PHE B 89   ? VAL B 87   PHE B 89   
H  2 VAL B 120  ? ILE B 122  ? VAL B 120  ILE B 122  
I  1 LYS B 107  ? VAL B 109  ? LYS B 107  VAL B 109  
I  2 ALA B 130  ? LEU B 132  ? ALA B 130  LEU B 132  
J  1 TYR B 150  ? VAL B 151  ? TYR B 150  VAL B 151  
J  2 ALA B 169  ? VAL B 170  ? ALA B 169  VAL B 170  
K  1 GLU C 2    ? ARG C 5    ? GLU C 2    ARG C 5    
K  2 GLN C 899  ? ILE C 902  ? GLN C 899  ILE C 902  
K  3 VAL C 579  ? MET C 580  ? VAL C 579  MET C 580  
L  1 VAL C 65   ? LEU C 73   ? VAL C 65   LEU C 73   
L  2 GLN C 91   ? ILE C 101  ? GLN C 91   ILE C 101  
L  3 ILE C 108  ? PRO C 119  ? ILE C 108  PRO C 119  
M  1 PHE C 127  ? ILE C 129  ? PHE C 127  ILE C 129  
M  2 ALA C 132  ? ILE C 136  ? ALA C 132  ILE C 136  
M  3 SER C 392  ? PHE C 394  ? SER C 392  PHE C 394  
N  1 ARG C 331  ? ARG C 334  ? ARG C 331  ARG C 334  
N  2 SER C 138  ? ARG C 142  ? SER C 138  ARG C 142  
N  3 ARG C 409  ? SER C 411  ? ARG C 409  SER C 411  
N  4 ILE C 452  ? SER C 454  ? ILE C 452  SER C 454  
O  1 GLY C 145  ? PRO C 150  ? GLY C 145  PRO C 150  
O  2 TYR C 158  ? ILE C 163  ? TYR C 158  ILE C 163  
O  3 ILE C 172  ? VAL C 176  ? ILE C 172  VAL C 176  
O  4 VAL C 182  ? VAL C 186  ? VAL C 182  VAL C 186  
O  5 ARG C 189  ? PRO C 192  ? ARG C 189  PRO C 192  
P  1 ALA C 291  ? GLU C 294  ? ALA C 291  GLU C 294  
P  2 GLU C 297  ? ASP C 300  ? GLU C 297  ASP C 300  
Q  1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
Q  2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
Q  3 VAL C 478  ? MET C 486  ? VAL C 478  MET C 486  
R  1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
R  2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
R  3 PHE C 531  ? ASP C 533  ? PHE C 531  ASP C 533  
R  4 THR C 495  ? ALA C 497  ? THR C 495  ALA C 497  
R  5 VAL C 513  ? ARG C 517  ? VAL C 513  ARG C 517  
R  6 GLU C 520  ? VAL C 524  ? GLU C 520  VAL C 524  
S  1 LEU C 503  ? GLU C 504  ? LEU C 503  GLU C 504  
S  2 ARG C 507  ? ILE C 508  ? ARG C 507  ILE C 508  
T  1 LEU C 595  ? TYR C 596  ? LEU C 595  TYR C 596  
T  2 LEU C 654  ? ASP C 657  ? LEU C 654  ASP C 657  
T  3 ARG C 640  ? PRO C 641  ? ARG C 640  PRO C 641  
U  1 LEU C 620  ? PRO C 624  ? LEU C 620  PRO C 624  
U  2 ARG C 610  ? TYR C 615  ? ARG C 610  TYR C 615  
U  3 GLY C 601  ? VAL C 606  ? GLY C 601  VAL C 606  
U  4 ARG C 648  ? VAL C 649  ? ARG C 648  VAL C 649  
V  1 TYR C 629  ? ARG C 630  ? TYR C 629  ARG C 630  
V  2 ALA C 636  ? LEU C 637  ? ALA C 636  LEU C 637  
W  1 SER C 661  ? GLU C 662  ? SER C 661  GLU C 662  
W  2 PHE C 665  ? LEU C 666  ? PHE C 665  LEU C 666  
X  1 LYS C 971  ? VAL C 972  ? LYS C 971  VAL C 972  
X  2 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
X  3 LYS C 838  ? ALA C 840  ? LYS C 838  ALA C 840  
X  4 LYS C 846  ? LEU C 853  ? LYS C 846  LEU C 853  
X  5 ILE C 688  ? SER C 691  ? ILE C 688  SER C 691  
X  6 VAL C 869  ? LEU C 871  ? VAL C 869  LEU C 871  
X  7 GLN C 670  ? ILE C 676  ? GLN C 670  ILE C 676  
X  8 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
Y  1 SER C 702  ? ARG C 713  ? SER C 702  ARG C 713  
Y  2 VAL C 819  ? ARG C 831  ? VAL C 819  ARG C 831  
Y  3 GLY C 798  ? LEU C 806  ? GLY C 798  LEU C 806  
Y  4 GLU C 748  ? VAL C 749  ? GLU C 748  VAL C 749  
Z  1 ARG C 721  ? ILE C 722  ? ARG C 721  ILE C 722  
Z  2 ARG C 758  ? PHE C 761  ? ARG C 758  PHE C 761  
Z  3 VAL C 785  ? ASP C 787  ? VAL C 785  ASP C 787  
AA 1 ILE C 754  ? VAL C 756  ? ILE C 754  VAL C 756  
AA 2 LEU C 790  ? ARG C 791  ? LEU C 790  ARG C 791  
AB 1 HIS C 1006 ? ARG C 1008 ? HIS C 1006 ARG C 1008 
AB 2 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AB 3 GLN D 744  ? HIS D 748  ? GLN D 744  HIS D 748  
AB 4 VAL D 700  ? ASN D 703  ? VAL D 700  ASN D 703  
AB 5 ILE D 713  ? VAL D 721  ? ILE D 713  VAL D 721  
AB 6 GLN D 641  ? PRO D 645  ? GLN D 641  PRO D 645  
AB 7 ILE D 726  ? LEU D 728  ? ILE D 726  LEU D 728  
AB 8 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AC 1 GLN C 1030 ? PHE C 1032 ? GLN C 1030 PHE C 1032 
AC 2 LYS D 621  ? VAL D 623  ? LYS D 621  VAL D 623  
AD 1 LEU C 1097 ? LEU C 1102 ? LEU C 1097 LEU C 1102 
AD 2 LYS D 7    ? LEU D 12   ? LYS D 7    LEU D 12   
AD 3 LYS D 1456 ? ASP D 1457 ? LYS D 1456 ASP D 1457 
AE 1 SER D 22   ? GLU D 25   ? SER D 22   GLU D 25   
AE 2 MET D 90   ? ALA D 100  ? MET D 90   ALA D 100  
AE 3 ILE D 513  ? VAL D 519  ? ILE D 513  VAL D 519  
AF 1 LEU D 152  ? LEU D 153  ? LEU D 152  LEU D 153  
AF 2 TYR D 132  ? ASP D 136  ? TYR D 132  ASP D 136  
AF 3 ASP D 453  ? ARG D 455  ? ASP D 453  ARG D 455  
AG 1 ILE D 141  ? LEU D 142  ? ILE D 141  LEU D 142  
AG 2 VAL D 145  ? PRO D 146  ? VAL D 145  PRO D 146  
AH 1 GLN D 166  ? PRO D 170  ? GLN D 166  PRO D 170  
AH 2 SER D 392  ? VAL D 396  ? SER D 392  VAL D 396  
AH 3 GLY D 201  ? TYR D 205  ? GLY D 201  TYR D 205  
AH 4 GLU D 184  ? VAL D 185  ? GLU D 184  VAL D 185  
AI 1 GLU D 190  ? ALA D 192  ? GLU D 190  ALA D 192  
AI 2 VAL D 195  ? VAL D 196  ? VAL D 195  VAL D 196  
AJ 1 VAL D 317  ? GLU D 327  ? VAL D 317  GLU D 327  
AJ 2 THR D 330  ? ARG D 346  ? THR D 330  ARG D 346  
AJ 3 PRO D 208  ? PRO D 226  ? PRO D 208  PRO D 226  
AJ 4 GLY D 383  ? PRO D 390  ? GLY D 383  PRO D 390  
AJ 5 ARG D 360  ? VAL D 361  ? ARG D 360  VAL D 361  
AK 1 ILE D 241  ? GLU D 244  ? ILE D 241  GLU D 244  
AK 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AK 3 TYR D 249  ? ARG D 252  ? TYR D 249  ARG D 252  
AL 1 ILE D 241  ? GLU D 244  ? ILE D 241  GLU D 244  
AL 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AL 3 VAL D 286  ? PRO D 290  ? VAL D 286  PRO D 290  
AM 1 GLU D 277  ? LEU D 284  ? GLU D 277  LEU D 284  
AM 2 ALA D 268  ? ARG D 274  ? ALA D 268  ARG D 274  
AM 3 GLY D 257  ? GLU D 263  ? GLY D 257  GLU D 263  
AM 4 ILE D 297  ? VAL D 298  ? ILE D 297  VAL D 298  
AN 1 ASN D 352  ? VAL D 353  ? ASN D 352  VAL D 353  
AN 2 LYS D 366  ? ALA D 369  ? LYS D 366  ALA D 369  
AN 3 VAL D 377  ? ILE D 378  ? VAL D 377  ILE D 378  
AO 1 ALA D 398  ? PRO D 402  ? ALA D 398  PRO D 402  
AO 2 VAL D 443  ? GLU D 448  ? VAL D 443  GLU D 448  
AO 3 GLY D 433  ? ASP D 438  ? GLY D 433  ASP D 438  
AO 4 ARG D 414  ? VAL D 415  ? ARG D 414  VAL D 415  
AP 1 VAL D 420  ? ALA D 422  ? VAL D 420  ALA D 422  
AP 2 VAL D 427  ? LYS D 428  ? VAL D 427  LYS D 428  
AQ 1 MET D 527  ? GLN D 529  ? MET D 527  GLN D 529  
AQ 2 PHE D 535  ? THR D 537  ? PHE D 535  THR D 537  
AQ 3 VAL F 335  ? SER F 336  ? VAL F 315  SER F 316  
AR 1 GLU D 805  ? PHE D 806  ? GLU D 805  PHE D 806  
AR 2 PRO D 826  ? VAL D 829  ? PRO D 826  VAL D 829  
AR 3 ARG D 832  ? SER D 835  ? ARG D 832  SER D 835  
AS 1 VAL D 842  ? PHE D 843  ? VAL D 842  PHE D 843  
AS 2 VAL D 864  ? TYR D 868  ? VAL D 864  TYR D 868  
AS 3 LYS D 871  ? THR D 875  ? LYS D 871  THR D 875  
AT 1 VAL D 1106 ? GLU D 1109 ? VAL D 1106 GLU D 1109 
AT 2 GLY D 1199 ? CYS D 1201 ? GLY D 1199 CYS D 1201 
AU 1 ILE D 1118 ? PRO D 1121 ? ILE D 1118 PRO D 1121 
AU 2 GLU D 1185 ? VAL D 1188 ? GLU D 1185 VAL D 1188 
AV 1 PHE D 1123 ? ASP D 1126 ? PHE D 1123 ASP D 1126 
AV 2 SER D 1131 ? LEU D 1134 ? SER D 1131 LEU D 1134 
AW 1 VAL D 1153 ? VAL D 1155 ? VAL D 1153 VAL D 1155 
AW 2 VAL D 1158 ? LEU D 1160 ? VAL D 1158 LEU D 1160 
AX 1 SER D 1300 ? LYS D 1304 ? SER D 1300 LYS D 1304 
AX 2 LEU D 1290 ? GLU D 1295 ? LEU D 1290 GLU D 1295 
AX 3 GLY D 1279 ? GLU D 1285 ? GLY D 1279 GLU D 1285 
AX 4 TYR D 1318 ? VAL D 1319 ? TYR D 1318 VAL D 1319 
AY 1 VAL D 1394 ? GLU D 1396 ? VAL D 1394 GLU D 1396 
AY 2 TYR D 1378 ? ASP D 1383 ? TYR D 1378 ASP D 1383 
AY 3 ALA D 1416 ? PRO D 1419 ? ALA D 1416 PRO D 1419 
AZ 1 GLN D 1485 ? ASP D 1488 ? GLN D 1485 ASP D 1488 
AZ 2 LEU E 73   ? GLY E 76   ? LEU E 73   GLY E 76   
BA 1 LYS E 47   ? GLN E 49   ? LYS E 47   GLN E 49   
BA 2 LEU E 54   ? ASP E 56   ? LEU E 54   ASP E 56   
BB 1 PRO F 340  ? ILE F 341  ? PRO F 320  ILE F 321  
BB 2 SER F 347  ? PHE F 348  ? SER F 327  PHE F 328  
BC 1 VAL I 10   ? GLN I 16   ? VAL K 10   GLN K 16   
BC 2 TYR I 20   ? LEU I 28   ? TYR K 20   LEU K 28   
BC 3 LEU I 192  ? THR I 201  ? LEU K 192  THR K 201  
BC 4 VAL I 174  ? THR I 184  ? VAL K 174  THR K 184  
BD 1 THR I 96   ? GLU I 104  ? THR K 96   GLU K 104  
BD 2 ARG I 137  ? GLY I 147  ? ARG K 137  GLY K 147  
BD 3 GLY I 50   ? ILE I 58   ? GLY K 50   ILE K 58   
BD 4 ILE I 165  ? PRO I 166  ? ILE K 165  PRO K 166  
BE 1 VAL I 87   ? PHE I 89   ? VAL K 87   PHE K 89   
BE 2 VAL I 120  ? ILE I 122  ? VAL K 120  ILE K 122  
BF 1 GLU I 108  ? LYS I 110  ? GLU K 108  LYS K 110  
BF 2 HIS I 128  ? THR I 131  ? HIS K 128  THR K 131  
BG 1 TYR I 150  ? VAL I 151  ? TYR K 150  VAL K 151  
BG 2 ALA I 169  ? VAL I 170  ? ALA K 169  VAL K 170  
BH 1 VAL J 10   ? GLN J 16   ? VAL L 10   GLN L 16   
BH 2 TYR J 20   ? LEU J 28   ? TYR L 20   LEU L 28   
BH 3 ARG J 189  ? THR J 201  ? ARG L 189  THR L 201  
BH 4 VAL J 174  ? LEU J 186  ? VAL L 174  LEU L 186  
BI 1 THR J 96   ? GLU J 104  ? THR L 96   GLU L 104  
BI 2 ARG J 137  ? VAL J 148  ? ARG L 137  VAL L 148  
BI 3 PRO J 49   ? ILE J 58   ? PRO L 49   ILE L 58   
BI 4 ILE J 165  ? PRO J 166  ? ILE L 165  PRO L 166  
BJ 1 VAL J 87   ? PHE J 89   ? VAL L 87   PHE L 89   
BJ 2 VAL J 120  ? ILE J 122  ? VAL L 120  ILE L 122  
BK 1 LYS J 107  ? LYS J 110  ? LYS L 107  LYS L 110  
BK 2 HIS J 128  ? LEU J 132  ? HIS L 128  LEU L 132  
BL 1 TYR J 150  ? VAL J 151  ? TYR L 150  VAL L 151  
BL 2 ALA J 169  ? VAL J 170  ? ALA L 169  VAL L 170  
BM 1 GLU K 2    ? ARG K 5    ? GLU M 2    ARG M 5    
BM 2 GLN K 899  ? ILE K 902  ? GLN M 899  ILE M 902  
BM 3 VAL K 579  ? MET K 580  ? VAL M 579  MET M 580  
BN 1 VAL K 65   ? LEU K 73   ? VAL M 65   LEU M 73   
BN 2 GLN K 91   ? ILE K 101  ? GLN M 91   ILE M 101  
BN 3 ILE K 108  ? PRO K 119  ? ILE M 108  PRO M 119  
BO 1 PHE K 127  ? ILE K 129  ? PHE M 127  ILE M 129  
BO 2 ALA K 132  ? ILE K 136  ? ALA M 132  ILE M 136  
BO 3 SER K 392  ? PHE K 394  ? SER M 392  PHE M 394  
BP 1 ARG K 331  ? ARG K 334  ? ARG M 331  ARG M 334  
BP 2 SER K 138  ? ARG K 142  ? SER M 138  ARG M 142  
BP 3 ARG K 409  ? SER K 411  ? ARG M 409  SER M 411  
BP 4 ILE K 452  ? SER K 454  ? ILE M 452  SER M 454  
BQ 1 GLY K 145  ? PRO K 150  ? GLY M 145  PRO M 150  
BQ 2 TYR K 158  ? ILE K 163  ? TYR M 158  ILE M 163  
BQ 3 ILE K 172  ? VAL K 176  ? ILE M 172  VAL M 176  
BQ 4 VAL K 182  ? VAL K 186  ? VAL M 182  VAL M 186  
BQ 5 ARG K 189  ? PRO K 192  ? ARG M 189  PRO M 192  
BR 1 ALA K 291  ? GLU K 294  ? ALA M 291  GLU M 294  
BR 2 GLU K 297  ? ASP K 300  ? GLU M 297  ASP M 300  
BS 1 ARG K 460  ? VAL K 461  ? ARG M 460  VAL M 461  
BS 2 ILE K 467  ? VAL K 475  ? ILE M 467  VAL M 475  
BS 3 VAL K 478  ? MET K 486  ? VAL M 478  MET M 486  
BT 1 ARG K 460  ? VAL K 461  ? ARG M 460  VAL M 461  
BT 2 ILE K 467  ? VAL K 475  ? ILE M 467  VAL M 475  
BT 3 PHE K 531  ? ASP K 533  ? PHE M 531  ASP M 533  
BT 4 THR K 495  ? ALA K 497  ? THR M 495  ALA M 497  
BT 5 VAL K 513  ? ARG K 517  ? VAL M 513  ARG M 517  
BT 6 GLU K 520  ? VAL K 524  ? GLU M 520  VAL M 524  
BU 1 LEU K 503  ? GLU K 504  ? LEU M 503  GLU M 504  
BU 2 ARG K 507  ? ILE K 508  ? ARG M 507  ILE M 508  
BV 1 LEU K 595  ? TYR K 596  ? LEU M 595  TYR M 596  
BV 2 LEU K 654  ? ASP K 657  ? LEU M 654  ASP M 657  
BV 3 ARG K 640  ? PRO K 641  ? ARG M 640  PRO M 641  
BW 1 LEU K 620  ? PRO K 624  ? LEU M 620  PRO M 624  
BW 2 ARG K 610  ? TYR K 615  ? ARG M 610  TYR M 615  
BW 3 GLY K 601  ? VAL K 606  ? GLY M 601  VAL M 606  
BW 4 ARG K 648  ? VAL K 649  ? ARG M 648  VAL M 649  
BX 1 TYR K 629  ? ARG K 630  ? TYR M 629  ARG M 630  
BX 2 ALA K 636  ? LEU K 637  ? ALA M 636  LEU M 637  
BY 1 SER K 661  ? GLU K 662  ? SER M 661  GLU M 662  
BY 2 PHE K 665  ? LEU K 666  ? PHE M 665  LEU M 666  
BZ 1 LYS K 971  ? VAL K 972  ? LYS M 971  VAL M 972  
BZ 2 ILE K 987  ? LYS K 996  ? ILE M 987  LYS M 996  
BZ 3 LYS K 838  ? ALA K 840  ? LYS M 838  ALA M 840  
BZ 4 LYS K 846  ? LEU K 853  ? LYS M 846  LEU M 853  
BZ 5 ILE K 688  ? SER K 691  ? ILE M 688  SER M 691  
BZ 6 VAL K 869  ? LEU K 871  ? VAL M 869  LEU M 871  
BZ 7 GLN K 670  ? ILE K 676  ? GLN M 670  ILE M 676  
BZ 8 ILE K 987  ? LYS K 996  ? ILE M 987  LYS M 996  
CA 1 SER K 702  ? ARG K 713  ? SER M 702  ARG M 713  
CA 2 VAL K 819  ? ARG K 831  ? VAL M 819  ARG M 831  
CA 3 GLY K 798  ? ARG K 807  ? GLY M 798  ARG M 807  
CA 4 GLU K 748  ? VAL K 749  ? GLU M 748  VAL M 749  
CB 1 ARG K 721  ? ILE K 722  ? ARG M 721  ILE M 722  
CB 2 ARG K 758  ? PHE K 761  ? ARG M 758  PHE M 761  
CB 3 VAL K 785  ? ASP K 787  ? VAL M 785  ASP M 787  
CC 1 ILE K 754  ? VAL K 756  ? ILE M 754  VAL M 756  
CC 2 LEU K 790  ? ARG K 791  ? LEU M 790  ARG M 791  
CD 1 HIS K 1006 ? ARG K 1008 ? HIS M 1006 ARG M 1008 
CD 2 SER L 626  ? VAL L 633  ? SER N 626  VAL N 633  
CD 3 GLN L 744  ? HIS L 748  ? GLN N 744  HIS N 748  
CD 4 VAL L 700  ? ASN L 703  ? VAL N 700  ASN N 703  
CD 5 ILE L 713  ? VAL L 721  ? ILE N 713  VAL N 721  
CD 6 GLN L 641  ? PRO L 645  ? GLN N 641  PRO N 645  
CD 7 ILE L 726  ? LEU L 728  ? ILE N 726  LEU N 728  
CD 8 SER L 626  ? VAL L 633  ? SER N 626  VAL N 633  
CE 1 GLN K 1030 ? PHE K 1032 ? GLN M 1030 PHE M 1032 
CE 2 LYS L 621  ? VAL L 623  ? LYS N 621  VAL N 623  
CF 1 PRO K 1108 ? VAL K 1109 ? PRO M 1108 VAL M 1109 
CF 2 LEU K 1097 ? LEU K 1102 ? LEU M 1097 LEU M 1102 
CF 3 LYS L 7    ? LEU L 12   ? LYS N 7    LEU N 12   
CF 4 LYS L 1456 ? ASP L 1457 ? LYS N 1456 ASP N 1457 
CG 1 SER L 22   ? GLU L 25   ? SER N 22   GLU N 25   
CG 2 MET L 90   ? ALA L 100  ? MET N 90   ALA N 100  
CG 3 ILE L 513  ? VAL L 519  ? ILE N 513  VAL N 519  
CH 1 LEU L 152  ? LEU L 153  ? LEU N 152  LEU N 153  
CH 2 TYR L 132  ? ASP L 136  ? TYR N 132  ASP N 136  
CH 3 ASP L 453  ? ARG L 455  ? ASP N 453  ARG N 455  
CI 1 ILE L 141  ? LEU L 142  ? ILE N 141  LEU N 142  
CI 2 VAL L 145  ? PRO L 146  ? VAL N 145  PRO N 146  
CJ 1 GLN L 166  ? PRO L 170  ? GLN N 166  PRO N 170  
CJ 2 SER L 392  ? VAL L 396  ? SER N 392  VAL N 396  
CJ 3 GLY L 201  ? TYR L 205  ? GLY N 201  TYR N 205  
CJ 4 GLU L 184  ? VAL L 185  ? GLU N 184  VAL N 185  
CK 1 GLU L 190  ? ALA L 192  ? GLU N 190  ALA N 192  
CK 2 VAL L 195  ? VAL L 196  ? VAL N 195  VAL N 196  
CL 1 ARG L 318  ? GLU L 327  ? ARG N 318  GLU N 327  
CL 2 THR L 330  ? ARG L 346  ? THR N 330  ARG N 346  
CL 3 PRO L 208  ? PRO L 226  ? PRO N 208  PRO N 226  
CL 4 GLY L 383  ? PRO L 390  ? GLY N 383  PRO N 390  
CL 5 ARG L 360  ? VAL L 361  ? ARG N 360  VAL N 361  
CM 1 ILE L 241  ? GLU L 244  ? ILE N 241  GLU N 244  
CM 2 PRO L 303  ? ARG L 312  ? PRO N 303  ARG N 312  
CM 3 TYR L 249  ? ARG L 252  ? TYR N 249  ARG N 252  
CN 1 ILE L 241  ? GLU L 244  ? ILE N 241  GLU N 244  
CN 2 PRO L 303  ? ARG L 312  ? PRO N 303  ARG N 312  
CN 3 VAL L 286  ? PRO L 290  ? VAL N 286  PRO N 290  
CO 1 GLU L 277  ? LEU L 284  ? GLU N 277  LEU N 284  
CO 2 ALA L 268  ? ARG L 274  ? ALA N 268  ARG N 274  
CO 3 GLY L 257  ? GLU L 263  ? GLY N 257  GLU N 263  
CO 4 ILE L 297  ? VAL L 298  ? ILE N 297  VAL N 298  
CP 1 ASN L 352  ? VAL L 353  ? ASN N 352  VAL N 353  
CP 2 LYS L 366  ? ALA L 369  ? LYS N 366  ALA N 369  
CP 3 VAL L 377  ? ILE L 378  ? VAL N 377  ILE N 378  
CQ 1 ALA L 398  ? PRO L 402  ? ALA N 398  PRO N 402  
CQ 2 VAL L 443  ? GLU L 448  ? VAL N 443  GLU N 448  
CQ 3 GLY L 433  ? ASP L 438  ? GLY N 433  ASP N 438  
CQ 4 ARG L 414  ? VAL L 415  ? ARG N 414  VAL N 415  
CR 1 VAL L 420  ? ALA L 422  ? VAL N 420  ALA N 422  
CR 2 VAL L 427  ? LYS L 428  ? VAL N 427  LYS N 428  
CS 1 MET L 527  ? GLN L 529  ? MET N 527  GLN N 529  
CS 2 PHE L 535  ? THR L 537  ? PHE N 535  THR N 537  
CS 3 VAL N 335  ? SER N 336  ? VAL P 315  SER P 316  
CT 1 GLU L 805  ? PHE L 806  ? GLU N 805  PHE N 806  
CT 2 PRO L 826  ? VAL L 829  ? PRO N 826  VAL N 829  
CT 3 ARG L 832  ? SER L 835  ? ARG N 832  SER N 835  
CU 1 VAL L 842  ? PHE L 843  ? VAL N 842  PHE N 843  
CU 2 VAL L 864  ? TYR L 868  ? VAL N 864  TYR N 868  
CU 3 LYS L 871  ? THR L 875  ? LYS N 871  THR N 875  
CV 1 VAL L 1106 ? GLU L 1109 ? VAL N 1106 GLU N 1109 
CV 2 GLY L 1199 ? CYS L 1201 ? GLY N 1199 CYS N 1201 
CW 1 ILE L 1118 ? PRO L 1121 ? ILE N 1118 PRO N 1121 
CW 2 GLU L 1185 ? VAL L 1188 ? GLU N 1185 VAL N 1188 
CX 1 PHE L 1123 ? PRO L 1125 ? PHE N 1123 PRO N 1125 
CX 2 LEU L 1132 ? LEU L 1134 ? LEU N 1132 LEU N 1134 
CY 1 VAL L 1153 ? VAL L 1155 ? VAL N 1153 VAL N 1155 
CY 2 VAL L 1158 ? LEU L 1160 ? VAL N 1158 LEU N 1160 
CZ 1 LYS L 1271 ? ALA L 1272 ? LYS N 1271 ALA N 1272 
CZ 2 ALA L 1329 ? ILE L 1330 ? ALA N 1329 ILE N 1330 
DA 1 SER L 1300 ? LEU L 1305 ? SER N 1300 LEU N 1305 
DA 2 LEU L 1290 ? GLU L 1295 ? LEU N 1290 GLU N 1295 
DA 3 GLY L 1279 ? GLU L 1285 ? GLY N 1279 GLU N 1285 
DA 4 TYR L 1318 ? VAL L 1319 ? TYR N 1318 VAL N 1319 
DB 1 VAL L 1394 ? GLU L 1396 ? VAL N 1394 GLU N 1396 
DB 2 TYR L 1378 ? ASP L 1383 ? TYR N 1378 ASP N 1383 
DB 3 ALA L 1416 ? PRO L 1419 ? ALA N 1416 PRO N 1419 
DC 1 GLN L 1485 ? ASP L 1488 ? GLN N 1485 ASP N 1488 
DC 2 LEU M 73   ? GLY M 76   ? LEU O 73   GLY O 76   
DD 1 LYS M 47   ? GLN M 49   ? LYS O 47   GLN O 49   
DD 2 LEU M 54   ? ASP M 56   ? LEU O 54   ASP O 56   
DE 1 PRO N 340  ? ILE N 341  ? PRO P 320  ILE P 321  
DE 2 SER N 347  ? PHE N 348  ? SER P 327  PHE P 328  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N ARG A 14   ? N ARG A 14   O GLU A 22   ? O GLU A 22   
A  2 3 N LEU A 28   ? N LEU A 28   O ASP A 193  ? O ASP A 193  
A  3 4 O LYS A 194  ? O LYS A 194  N GLU A 182  ? N GLU A 182  
B  1 2 N VAL A 97   ? N VAL A 97   O VAL A 144  ? O VAL A 144  
B  2 3 O ARG A 143  ? O ARG A 143  N THR A 54   ? N THR A 54   
B  3 4 N VAL A 56   ? N VAL A 56   O ILE A 165  ? O ILE A 165  
C  1 2 N ARG A 88   ? N ARG A 88   O GLU A 121  ? O GLU A 121  
D  1 2 N VAL A 109  ? N VAL A 109  O ILE A 129  ? O ILE A 129  
E  1 2 N VAL A 151  ? N VAL A 151  O ALA A 169  ? O ALA A 169  
F  1 2 N VAL B 10   ? N VAL B 10   O GLU B 26   ? O GLU B 26   
F  2 3 N LEU B 28   ? N LEU B 28   O ASP B 193  ? O ASP B 193  
F  3 4 O TRP B 200  ? O TRP B 200  N ARG B 175  ? N ARG B 175  
G  1 2 N VAL B 97   ? N VAL B 97   O VAL B 144  ? O VAL B 144  
G  2 3 O GLY B 147  ? O GLY B 147  N GLY B 50   ? N GLY B 50   
G  3 4 N VAL B 56   ? N VAL B 56   O ILE B 165  ? O ILE B 165  
H  1 2 N ARG B 88   ? N ARG B 88   O GLU B 121  ? O GLU B 121  
I  1 2 N VAL B 109  ? N VAL B 109  O ALA B 130  ? O ALA B 130  
J  1 2 N VAL B 151  ? N VAL B 151  O ALA B 169  ? O ALA B 169  
K  1 2 N LYS C 4    ? N LYS C 4    O ARG C 900  ? O ARG C 900  
K  2 3 O TYR C 901  ? O TYR C 901  N MET C 580  ? N MET C 580  
L  1 2 N GLU C 70   ? N GLU C 70   O ARG C 97   ? O ARG C 97   
L  2 3 N LEU C 100  ? N LEU C 100  O LYS C 109  ? O LYS C 109  
M  1 2 N PHE C 127  ? N PHE C 127  O ARG C 134  ? O ARG C 134  
M  2 3 N VAL C 135  ? N VAL C 135  O GLN C 393  ? O GLN C 393  
N  1 2 O ARG C 334  ? O ARG C 334  N GLN C 139  ? N GLN C 139  
N  2 3 N SER C 138  ? N SER C 138  O SER C 411  ? O SER C 411  
N  3 4 N ILE C 410  ? N ILE C 410  O THR C 453  ? O THR C 453  
O  1 2 N THR C 149  ? N THR C 149  O ILE C 159  ? O ILE C 159  
O  2 3 N ILE C 162  ? N ILE C 162  O ILE C 172  ? O ILE C 172  
O  3 4 N GLU C 175  ? N GLU C 175  O SER C 183  ? O SER C 183  
O  4 5 N VAL C 186  ? N VAL C 186  O ARG C 189  ? O ARG C 189  
P  1 2 N ARG C 292  ? N ARG C 292  O LYS C 299  ? O LYS C 299  
Q  1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
Q  2 3 N TYR C 471  ? N TYR C 471  O VAL C 484  ? O VAL C 484  
R  1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
R  2 3 N ARG C 472  ? N ARG C 472  O MET C 532  ? O MET C 532  
R  3 4 O PHE C 531  ? O PHE C 531  N ALA C 497  ? N ALA C 497  
R  4 5 N ILE C 496  ? N ILE C 496  O ARG C 516  ? O ARG C 516  
R  5 6 N VAL C 513  ? N VAL C 513  O VAL C 524  ? O VAL C 524  
S  1 2 N GLU C 504  ? N GLU C 504  O ARG C 507  ? O ARG C 507  
T  1 2 N LEU C 595  ? N LEU C 595  O LEU C 655  ? O LEU C 655  
T  2 3 O ASP C 657  ? O ASP C 657  N ARG C 640  ? N ARG C 640  
U  1 2 O TYR C 623  ? O TYR C 623  N ILE C 611  ? N ILE C 611  
U  2 3 O ARG C 614  ? O ARG C 614  N GLU C 602  ? N GLU C 602  
U  3 4 N GLY C 601  ? N GLY C 601  O VAL C 649  ? O VAL C 649  
V  1 2 N TYR C 629  ? N TYR C 629  O LEU C 637  ? O LEU C 637  
W  1 2 N GLU C 662  ? N GLU C 662  O PHE C 665  ? O PHE C 665  
X  1 2 N VAL C 972  ? N VAL C 972  O ILE C 987  ? O ILE C 987  
X  2 3 O MET C 995  ? O MET C 995  N ALA C 840  ? N ALA C 840  
X  3 4 N LEU C 839  ? N LEU C 839  O GLY C 847  ? O GLY C 847  
X  4 5 O VAL C 848  ? O VAL C 848  N ILE C 688  ? N ILE C 688  
X  5 6 N VAL C 689  ? N VAL C 689  O ILE C 870  ? O ILE C 870  
X  6 7 O VAL C 869  ? O VAL C 869  N ALA C 675  ? N ALA C 675  
X  7 8 N VAL C 674  ? N VAL C 674  O GLY C 990  ? O GLY C 990  
Y  1 2 N ALA C 712  ? N ALA C 712  O GLU C 821  ? O GLU C 821  
Y  2 3 O ARG C 824  ? O ARG C 824  N VAL C 804  ? N VAL C 804  
Y  3 4 O GLY C 798  ? O GLY C 798  N VAL C 749  ? N VAL C 749  
Z  1 2 N ARG C 721  ? N ARG C 721  O THR C 759  ? O THR C 759  
Z  2 3 N SER C 760  ? N SER C 760  O LYS C 786  ? O LYS C 786  
AA 1 2 N LEU C 755  ? N LEU C 755  O LEU C 790  ? O LEU C 790  
AB 1 2 N HIS C 1006 ? N HIS C 1006 O ARG D 628  ? O ARG D 628  
AB 2 3 N SER D 629  ? N SER D 629  O MET D 745  ? O MET D 745  
AB 3 4 O HIS D 748  ? O HIS D 748  N LEU D 701  ? N LEU D 701  
AB 4 5 N LEU D 702  ? N LEU D 702  O GLN D 714  ? O GLN D 714  
AB 5 6 O VAL D 719  ? O VAL D 719  N CYS D 642  ? N CYS D 642  
AB 6 7 N GLY D 643  ? N GLY D 643  O GLN D 727  ? O GLN D 727  
AB 7 8 O LEU D 728  ? O LEU D 728  N VAL D 632  ? N VAL D 632  
AC 1 2 N PHE C 1032 ? N PHE C 1032 O LYS D 621  ? O LYS D 621  
AD 1 2 N ASP C 1098 ? N ASP C 1098 O ALA D 11   ? O ALA D 11   
AD 2 3 N VAL D 8    ? N VAL D 8    O ASP D 1457 ? O ASP D 1457 
AE 1 2 N TYR D 23   ? N TYR D 23   O MET D 90   ? O MET D 90   
AE 2 3 N ALA D 99   ? N ALA D 99   O LEU D 514  ? O LEU D 514  
AF 1 2 O LEU D 153  ? O LEU D 153  N TYR D 132  ? N TYR D 132  
AF 2 3 N ASP D 136  ? N ASP D 136  O ASP D 453  ? O ASP D 453  
AG 1 2 N LEU D 142  ? N LEU D 142  O VAL D 145  ? O VAL D 145  
AH 1 2 N TYR D 169  ? N TYR D 169  O ILE D 393  ? O ILE D 393  
AH 2 3 O LEU D 394  ? O LEU D 394  N LEU D 204  ? N LEU D 204  
AH 3 4 O GLY D 201  ? O GLY D 201  N VAL D 185  ? N VAL D 185  
AI 1 2 N LEU D 191  ? N LEU D 191  O VAL D 195  ? O VAL D 195  
AJ 1 2 N ARG D 318  ? N ARG D 318  O GLU D 338  ? O GLU D 338  
AJ 2 3 O TRP D 339  ? O TRP D 339  N LYS D 217  ? N LYS D 217  
AJ 3 4 N ARG D 209  ? N ARG D 209  O GLU D 389  ? O GLU D 389  
AJ 4 5 O GLY D 383  ? O GLY D 383  N VAL D 361  ? N VAL D 361  
AK 1 2 N ALA D 243  ? N ALA D 243  O LEU D 311  ? O LEU D 311  
AK 2 3 O ALA D 307  ? O ALA D 307  N TYR D 249  ? N TYR D 249  
AL 1 2 N ALA D 243  ? N ALA D 243  O LEU D 311  ? O LEU D 311  
AL 2 3 O GLU D 306  ? O GLU D 306  N THR D 289  ? N THR D 289  
AM 1 2 O TYR D 282  ? O TYR D 282  N LEU D 270  ? N LEU D 270  
AM 2 3 O PHE D 269  ? O PHE D 269  N LYS D 262  ? N LYS D 262  
AM 3 4 N GLY D 257  ? N GLY D 257  O VAL D 298  ? O VAL D 298  
AN 1 2 N ASN D 352  ? N ASN D 352  O ALA D 369  ? O ALA D 369  
AN 2 3 N ILE D 367  ? N ILE D 367  O VAL D 377  ? O VAL D 377  
AO 1 2 N ARG D 399  ? N ARG D 399  O VAL D 446  ? O VAL D 446  
AO 2 3 O ARG D 445  ? O ARG D 445  N GLU D 436  ? N GLU D 436  
AO 3 4 O GLY D 433  ? O GLY D 433  N VAL D 415  ? N VAL D 415  
AP 1 2 N LEU D 421  ? N LEU D 421  O VAL D 427  ? O VAL D 427  
AQ 1 2 N VAL D 528  ? N VAL D 528  O ALA D 536  ? O ALA D 536  
AQ 2 3 N PHE D 535  ? N PHE D 535  O VAL F 335  ? O VAL F 315  
AR 1 2 N PHE D 806  ? N PHE D 806  O LYS D 828  ? O LYS D 828  
AR 2 3 N ILE D 827  ? N ILE D 827  O THR D 834  ? O THR D 834  
AS 1 2 N PHE D 843  ? N PHE D 843  O THR D 865  ? O THR D 865  
AS 2 3 N VAL D 866  ? N VAL D 866  O LEU D 873  ? O LEU D 873  
AT 1 2 N ARG D 1108 ? N ARG D 1108 O VAL D 1200 ? O VAL D 1200 
AU 1 2 N ILE D 1118 ? N ILE D 1118 O VAL D 1188 ? O VAL D 1188 
AV 1 2 N GLN D 1124 ? N GLN D 1124 O ARG D 1133 ? O ARG D 1133 
AW 1 2 N VAL D 1153 ? N VAL D 1153 O LEU D 1160 ? O LEU D 1160 
AX 1 2 O TYR D 1303 ? O TYR D 1303 N VAL D 1292 ? N VAL D 1292 
AX 2 3 O PHE D 1293 ? O PHE D 1293 N ARG D 1282 ? N ARG D 1282 
AX 3 4 N GLY D 1279 ? N GLY D 1279 O VAL D 1319 ? O VAL D 1319 
AY 1 2 O LEU D 1395 ? O LEU D 1395 N VAL D 1379 ? N VAL D 1379 
AY 2 3 N THR D 1382 ? N THR D 1382 O ALA D 1416 ? O ALA D 1416 
AZ 1 2 N GLN D 1485 ? N GLN D 1485 O GLY E 76   ? O GLY E 76   
BA 1 2 N MET E 48   ? N MET E 48   O PHE E 55   ? O PHE E 55   
BB 1 2 N ILE F 341  ? N ILE F 321  O SER F 347  ? O SER F 327  
BC 1 2 N ARG I 14   ? N ARG K 14   O GLU I 22   ? O GLU K 22   
BC 2 3 N LEU I 28   ? N LEU K 28   O ASP I 193  ? O ASP K 193  
BC 3 4 O LYS I 194  ? O LYS K 194  N GLU I 182  ? N GLU K 182  
BD 1 2 N VAL I 97   ? N VAL K 97   O VAL I 144  ? O VAL K 144  
BD 2 3 O ARG I 143  ? O ARG K 143  N THR I 54   ? N THR K 54   
BD 3 4 N VAL I 56   ? N VAL K 56   O ILE I 165  ? O ILE K 165  
BE 1 2 N ARG I 88   ? N ARG K 88   O GLU I 121  ? O GLU K 121  
BF 1 2 N VAL I 109  ? N VAL K 109  O ILE I 129  ? O ILE K 129  
BG 1 2 N VAL I 151  ? N VAL K 151  O ALA I 169  ? O ALA K 169  
BH 1 2 N VAL J 10   ? N VAL L 10   O GLU J 26   ? O GLU L 26   
BH 2 3 N LEU J 28   ? N LEU L 28   O ASP J 193  ? O ASP L 193  
BH 3 4 O ARG J 198  ? O ARG L 198  N ALA J 178  ? N ALA L 178  
BI 1 2 N VAL J 97   ? N VAL L 97   O VAL J 144  ? O VAL L 144  
BI 2 3 O GLY J 147  ? O GLY L 147  N GLY J 50   ? N GLY L 50   
BI 3 4 N VAL J 56   ? N VAL L 56   O ILE J 165  ? O ILE L 165  
BJ 1 2 N ARG J 88   ? N ARG L 88   O GLU J 121  ? O GLU L 121  
BK 1 2 N VAL J 109  ? N VAL L 109  O ALA J 130  ? O ALA L 130  
BL 1 2 N VAL J 151  ? N VAL L 151  O ALA J 169  ? O ALA L 169  
BM 1 2 N GLU K 2    ? N GLU M 2    O ARG K 900  ? O ARG M 900  
BM 2 3 O TYR K 901  ? O TYR M 901  N MET K 580  ? N MET M 580  
BN 1 2 N VAL K 65   ? N VAL M 65   O ILE K 101  ? O ILE M 101  
BN 2 3 N LEU K 94   ? N LEU M 94   O GLY K 116  ? O GLY M 116  
BO 1 2 N ILE K 129  ? N ILE M 129  O ALA K 132  ? O ALA M 132  
BO 2 3 N VAL K 135  ? N VAL M 135  O GLN K 393  ? O GLN M 393  
BP 1 2 O ARG K 334  ? O ARG M 334  N GLN K 139  ? N GLN M 139  
BP 2 3 N SER K 138  ? N SER M 138  O SER K 411  ? O SER M 411  
BP 3 4 N ILE K 410  ? N ILE M 410  O THR K 453  ? O THR M 453  
BQ 1 2 N THR K 149  ? N THR M 149  O ILE K 159  ? O ILE M 159  
BQ 2 3 N ILE K 162  ? N ILE M 162  O ILE K 172  ? O ILE M 172  
BQ 3 4 N GLU K 175  ? N GLU M 175  O SER K 183  ? O SER M 183  
BQ 4 5 N VAL K 186  ? N VAL M 186  O ARG K 189  ? O ARG M 189  
BR 1 2 N ARG K 292  ? N ARG M 292  O LYS K 299  ? O LYS M 299  
BS 1 2 N ARG K 460  ? N ARG M 460  O ARG K 468  ? O ARG M 468  
BS 2 3 N TYR K 471  ? N TYR M 471  O VAL K 484  ? O VAL M 484  
BT 1 2 N ARG K 460  ? N ARG M 460  O ARG K 468  ? O ARG M 468  
BT 2 3 N ARG K 472  ? N ARG M 472  O MET K 532  ? O MET M 532  
BT 3 4 O PHE K 531  ? O PHE M 531  N ALA K 497  ? N ALA M 497  
BT 4 5 N ILE K 496  ? N ILE M 496  O ARG K 516  ? O ARG M 516  
BT 5 6 N VAL K 513  ? N VAL M 513  O VAL K 524  ? O VAL M 524  
BU 1 2 N GLU K 504  ? N GLU M 504  O ARG K 507  ? O ARG M 507  
BV 1 2 N LEU K 595  ? N LEU M 595  O LEU K 655  ? O LEU M 655  
BV 2 3 O ASP K 657  ? O ASP M 657  N ARG K 640  ? N ARG M 640  
BW 1 2 O TYR K 623  ? O TYR M 623  N ILE K 611  ? N ILE M 611  
BW 2 3 O ARG K 614  ? O ARG M 614  N GLU K 602  ? N GLU M 602  
BW 3 4 N GLY K 601  ? N GLY M 601  O VAL K 649  ? O VAL M 649  
BX 1 2 N TYR K 629  ? N TYR M 629  O LEU K 637  ? O LEU M 637  
BY 1 2 N GLU K 662  ? N GLU M 662  O PHE K 665  ? O PHE M 665  
BZ 1 2 N VAL K 972  ? N VAL M 972  O ILE K 987  ? O ILE M 987  
BZ 2 3 O MET K 995  ? O MET M 995  N ALA K 840  ? N ALA M 840  
BZ 3 4 N LEU K 839  ? N LEU M 839  O GLY K 847  ? O GLY M 847  
BZ 4 5 O VAL K 848  ? O VAL M 848  N ILE K 688  ? N ILE M 688  
BZ 5 6 N VAL K 689  ? N VAL M 689  O ILE K 870  ? O ILE M 870  
BZ 6 7 O VAL K 869  ? O VAL M 869  N ALA K 675  ? N ALA M 675  
BZ 7 8 N VAL K 674  ? N VAL M 674  O GLY K 990  ? O GLY M 990  
CA 1 2 N SER K 702  ? N SER M 702  O ARG K 831  ? O ARG M 831  
CA 2 3 O ALA K 828  ? O ALA M 828  N ILE K 799  ? N ILE M 799  
CA 3 4 O GLY K 798  ? O GLY M 798  N VAL K 749  ? N VAL M 749  
CB 1 2 N ARG K 721  ? N ARG M 721  O THR K 759  ? O THR M 759  
CB 2 3 N SER K 760  ? N SER M 760  O LYS K 786  ? O LYS M 786  
CC 1 2 N LEU K 755  ? N LEU M 755  O LEU K 790  ? O LEU M 790  
CD 1 2 N HIS K 1006 ? N HIS M 1006 O ARG L 628  ? O ARG N 628  
CD 2 3 N SER L 629  ? N SER N 629  O MET L 745  ? O MET N 745  
CD 3 4 O HIS L 748  ? O HIS N 748  N LEU L 701  ? N LEU N 701  
CD 4 5 N LEU L 702  ? N LEU N 702  O GLN L 714  ? O GLN N 714  
CD 5 6 O VAL L 719  ? O VAL N 719  N CYS L 642  ? N CYS N 642  
CD 6 7 N GLY L 643  ? N GLY N 643  O GLN L 727  ? O GLN N 727  
CD 7 8 O LEU L 728  ? O LEU N 728  N VAL L 632  ? N VAL N 632  
CE 1 2 N PHE K 1032 ? N PHE M 1032 O LYS L 621  ? O LYS N 621  
CF 1 2 O VAL K 1109 ? O VAL M 1109 N THR K 1101 ? N THR M 1101 
CF 2 3 N ASP K 1098 ? N ASP M 1098 O ALA L 11   ? O ALA N 11   
CF 3 4 N VAL L 8    ? N VAL N 8    O ASP L 1457 ? O ASP N 1457 
CG 1 2 N TYR L 23   ? N TYR N 23   O MET L 90   ? O MET N 90   
CG 2 3 N ALA L 99   ? N ALA N 99   O LEU L 514  ? O LEU N 514  
CH 1 2 O LEU L 153  ? O LEU N 153  N TYR L 132  ? N TYR N 132  
CH 2 3 N ASP L 136  ? N ASP N 136  O ASP L 453  ? O ASP N 453  
CI 1 2 N LEU L 142  ? N LEU N 142  O VAL L 145  ? O VAL N 145  
CJ 1 2 N TYR L 169  ? N TYR N 169  O ILE L 393  ? O ILE N 393  
CJ 2 3 O LEU L 394  ? O LEU N 394  N LEU L 204  ? N LEU N 204  
CJ 3 4 O GLY L 201  ? O GLY N 201  N VAL L 185  ? N VAL N 185  
CK 1 2 N LEU L 191  ? N LEU N 191  O VAL L 195  ? O VAL N 195  
CL 1 2 N ARG L 318  ? N ARG N 318  O GLU L 338  ? O GLU N 338  
CL 2 3 O TRP L 339  ? O TRP N 339  N LYS L 217  ? N LYS N 217  
CL 3 4 N ARG L 209  ? N ARG N 209  O GLU L 389  ? O GLU N 389  
CL 4 5 O GLY L 383  ? O GLY N 383  N VAL L 361  ? N VAL N 361  
CM 1 2 N ALA L 243  ? N ALA N 243  O LEU L 311  ? O LEU N 311  
CM 2 3 O ALA L 307  ? O ALA N 307  N TYR L 249  ? N TYR N 249  
CN 1 2 N ALA L 243  ? N ALA N 243  O LEU L 311  ? O LEU N 311  
CN 2 3 O GLU L 306  ? O GLU N 306  N THR L 289  ? N THR N 289  
CO 1 2 O VAL L 279  ? O VAL N 279  N LEU L 272  ? N LEU N 272  
CO 2 3 O ARG L 273  ? O ARG N 273  N VAL L 258  ? N VAL N 258  
CO 3 4 N GLY L 257  ? N GLY N 257  O VAL L 298  ? O VAL N 298  
CP 1 2 N ASN L 352  ? N ASN N 352  O ALA L 369  ? O ALA N 369  
CP 2 3 N ILE L 367  ? N ILE N 367  O VAL L 377  ? O VAL N 377  
CQ 1 2 N ARG L 399  ? N ARG N 399  O VAL L 446  ? O VAL N 446  
CQ 2 3 O ARG L 445  ? O ARG N 445  N GLU L 436  ? N GLU N 436  
CQ 3 4 O GLY L 433  ? O GLY N 433  N VAL L 415  ? N VAL N 415  
CR 1 2 N LEU L 421  ? N LEU N 421  O VAL L 427  ? O VAL N 427  
CS 1 2 N VAL L 528  ? N VAL N 528  O ALA L 536  ? O ALA N 536  
CS 2 3 N PHE L 535  ? N PHE N 535  O VAL N 335  ? O VAL P 315  
CT 1 2 N PHE L 806  ? N PHE N 806  O LYS L 828  ? O LYS N 828  
CT 2 3 N ILE L 827  ? N ILE N 827  O THR L 834  ? O THR N 834  
CU 1 2 N PHE L 843  ? N PHE N 843  O THR L 865  ? O THR N 865  
CU 2 3 N VAL L 866  ? N VAL N 866  O LEU L 873  ? O LEU N 873  
CV 1 2 N ARG L 1108 ? N ARG N 1108 O VAL L 1200 ? O VAL N 1200 
CW 1 2 N ILE L 1118 ? N ILE N 1118 O VAL L 1188 ? O VAL N 1188 
CX 1 2 N GLN L 1124 ? N GLN N 1124 O ARG L 1133 ? O ARG N 1133 
CY 1 2 N VAL L 1153 ? N VAL N 1153 O LEU L 1160 ? O LEU N 1160 
CZ 1 2 N ALA L 1272 ? N ALA N 1272 O ALA L 1329 ? O ALA N 1329 
DA 1 2 O TYR L 1303 ? O TYR N 1303 N VAL L 1292 ? N VAL N 1292 
DA 2 3 O PHE L 1293 ? O PHE N 1293 N ARG L 1282 ? N ARG N 1282 
DA 3 4 N GLY L 1279 ? N GLY N 1279 O VAL L 1319 ? O VAL N 1319 
DB 1 2 O LEU L 1395 ? O LEU N 1395 N VAL L 1379 ? N VAL N 1379 
DB 2 3 N GLU L 1380 ? N GLU N 1380 O LYS L 1418 ? O LYS N 1418 
DC 1 2 N GLN L 1485 ? N GLN N 1485 O GLY M 76   ? O GLY O 76   
DD 1 2 N MET M 48   ? N MET O 48   O PHE M 55   ? O PHE O 55   
DE 1 2 N ILE N 341  ? N ILE P 321  O SER N 347  ? O SER P 327  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG B 2001' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN D 2001' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN D 2002' 
AC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG D 2003' 
AC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG D 2004' 
AC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG D 2005' 
AC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG F 2001' 
AC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG K 1001' 
AC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN N 2001' 
BC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN N 2002' 
BC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG N 2003' 
BC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MG N 2004' 
BC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG N 2005' 
BC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG P 2001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 ASP B 183  ? ASP B 183  . ? 1_555 ? 
2  AC1 4 ASP B 191  ? ASP B 191  . ? 1_555 ? 
3  AC1 4 LEU B 192  ? LEU B 192  . ? 1_555 ? 
4  AC1 4 ASP B 193  ? ASP B 193  . ? 1_555 ? 
5  AC2 4 CYS D 1112 ? CYS D 1112 . ? 1_555 ? 
6  AC2 4 CYS D 1194 ? CYS D 1194 . ? 1_555 ? 
7  AC2 4 CYS D 1201 ? CYS D 1201 . ? 1_555 ? 
8  AC2 4 CYS D 1204 ? CYS D 1204 . ? 1_555 ? 
9  AC3 4 CYS D 58   ? CYS D 58   . ? 1_555 ? 
10 AC3 4 CYS D 60   ? CYS D 60   . ? 1_555 ? 
11 AC3 4 CYS D 73   ? CYS D 73   . ? 1_555 ? 
12 AC3 4 CYS D 76   ? CYS D 76   . ? 1_555 ? 
13 AC4 3 ASP D 739  ? ASP D 739  . ? 1_555 ? 
14 AC4 3 ASP D 741  ? ASP D 741  . ? 1_555 ? 
15 AC4 3 ASP D 743  ? ASP D 743  . ? 1_555 ? 
16 AC5 3 GLU B 154  ? GLU B 154  . ? 1_555 ? 
17 AC5 3 ASP B 168  ? ASP B 168  . ? 1_555 ? 
18 AC5 3 LYS D 840  ? LYS D 840  . ? 1_555 ? 
19 AC6 3 TRP D 897  ? TRP D 897  . ? 1_555 ? 
20 AC6 3 GLU D 898  ? GLU D 898  . ? 1_555 ? 
21 AC6 3 ILE D 900  ? ILE D 900  . ? 1_555 ? 
22 AC7 3 ALA F 312  ? ALA F 292  . ? 1_555 ? 
23 AC7 3 GLY F 316  ? GLY F 296  . ? 1_555 ? 
24 AC7 3 TRP F 319  ? TRP F 299  . ? 1_555 ? 
25 AC8 5 THR I 51   ? THR K 51   . ? 1_555 ? 
26 AC8 5 VAL I 170  ? VAL K 170  . ? 1_555 ? 
27 AC8 5 PHE I 171  ? PHE K 171  . ? 1_555 ? 
28 AC8 5 SER I 172  ? SER K 172  . ? 1_555 ? 
29 AC8 5 ASP I 202  ? ASP K 202  . ? 1_555 ? 
30 AC9 4 CYS L 1112 ? CYS N 1112 . ? 1_555 ? 
31 AC9 4 CYS L 1194 ? CYS N 1194 . ? 1_555 ? 
32 AC9 4 CYS L 1201 ? CYS N 1201 . ? 1_555 ? 
33 AC9 4 CYS L 1204 ? CYS N 1204 . ? 1_555 ? 
34 BC1 4 CYS L 58   ? CYS N 58   . ? 1_555 ? 
35 BC1 4 CYS L 60   ? CYS N 60   . ? 1_555 ? 
36 BC1 4 CYS L 73   ? CYS N 73   . ? 1_555 ? 
37 BC1 4 CYS L 76   ? CYS N 76   . ? 1_555 ? 
38 BC2 3 ASP L 739  ? ASP N 739  . ? 1_555 ? 
39 BC2 3 ASP L 741  ? ASP N 741  . ? 1_555 ? 
40 BC2 3 ASP L 743  ? ASP N 743  . ? 1_555 ? 
41 BC3 1 LYS L 840  ? LYS N 840  . ? 1_555 ? 
42 BC4 3 TRP L 897  ? TRP N 897  . ? 1_555 ? 
43 BC4 3 GLU L 898  ? GLU N 898  . ? 1_555 ? 
44 BC4 3 ILE L 900  ? ILE N 900  . ? 1_555 ? 
45 BC5 3 ALA N 312  ? ALA P 292  . ? 1_555 ? 
46 BC5 3 GLY N 316  ? GLY P 296  . ? 1_555 ? 
47 BC5 3 TRP N 319  ? TRP P 299  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4G7H 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4G7H 
_atom_sites.fract_transf_matrix[1][1]   0.005389 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000788 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009563 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003397 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . SER A  1  4    ? 31.708  17.306  145.075 1.00 108.17 ? 4    SER A N     1 
ATOM   2     C  CA    . SER A  1  4    ? 31.762  16.212  144.111 1.00 120.35 ? 4    SER A CA    1 
ATOM   3     C  C     . SER A  1  4    ? 32.905  16.418  143.116 1.00 123.60 ? 4    SER A C     1 
ATOM   4     O  O     . SER A  1  4    ? 32.928  15.817  142.040 1.00 114.04 ? 4    SER A O     1 
ATOM   5     C  CB    . SER A  1  4    ? 30.426  16.078  143.372 1.00 116.06 ? 4    SER A CB    1 
ATOM   6     O  OG    . SER A  1  4    ? 30.340  14.838  142.689 1.00 109.71 ? 4    SER A OG    1 
ATOM   7     N  N     . LYS A  1  5    ? 33.851  17.274  143.487 1.00 122.06 ? 5    LYS A N     1 
ATOM   8     C  CA    . LYS A  1  5    ? 35.029  17.521  142.665 1.00 119.73 ? 5    LYS A CA    1 
ATOM   9     C  C     . LYS A  1  5    ? 36.177  16.607  143.093 1.00 118.58 ? 5    LYS A C     1 
ATOM   10    O  O     . LYS A  1  5    ? 36.530  16.553  144.274 1.00 119.22 ? 5    LYS A O     1 
ATOM   11    C  CB    . LYS A  1  5    ? 35.448  18.990  142.771 1.00 117.32 ? 5    LYS A CB    1 
ATOM   12    C  CG    . LYS A  1  5    ? 36.779  19.317  142.107 1.00 118.17 ? 5    LYS A CG    1 
ATOM   13    C  CD    . LYS A  1  5    ? 36.709  19.179  140.594 1.00 99.57  ? 5    LYS A CD    1 
ATOM   14    C  CE    . LYS A  1  5    ? 38.054  19.498  139.952 1.00 101.80 ? 5    LYS A CE    1 
ATOM   15    N  NZ    . LYS A  1  5    ? 38.517  20.887  140.245 1.00 89.60  ? 5    LYS A NZ    1 
ATOM   16    N  N     . LEU A  1  6    ? 36.748  15.885  142.132 1.00 102.16 ? 6    LEU A N     1 
ATOM   17    C  CA    . LEU A  1  6    ? 37.869  14.992  142.409 1.00 93.72  ? 6    LEU A CA    1 
ATOM   18    C  C     . LEU A  1  6    ? 39.105  15.804  142.797 1.00 91.81  ? 6    LEU A C     1 
ATOM   19    O  O     . LEU A  1  6    ? 39.250  16.960  142.402 1.00 91.49  ? 6    LEU A O     1 
ATOM   20    C  CB    . LEU A  1  6    ? 38.162  14.111  141.191 1.00 89.61  ? 6    LEU A CB    1 
ATOM   21    C  CG    . LEU A  1  6    ? 38.444  12.621  141.409 1.00 83.68  ? 6    LEU A CG    1 
ATOM   22    C  CD1   . LEU A  1  6    ? 39.843  12.386  141.948 1.00 90.73  ? 6    LEU A CD1   1 
ATOM   23    C  CD2   . LEU A  1  6    ? 37.409  12.002  142.326 1.00 89.11  ? 6    LEU A CD2   1 
ATOM   24    N  N     . LYS A  1  7    ? 39.994  15.193  143.569 1.00 88.54  ? 7    LYS A N     1 
ATOM   25    C  CA    . LYS A  1  7    ? 41.175  15.884  144.070 1.00 88.58  ? 7    LYS A CA    1 
ATOM   26    C  C     . LYS A  1  7    ? 42.437  15.252  143.500 1.00 80.19  ? 7    LYS A C     1 
ATOM   27    O  O     . LYS A  1  7    ? 42.412  14.099  143.069 1.00 76.47  ? 7    LYS A O     1 
ATOM   28    C  CB    . LYS A  1  7    ? 41.209  15.838  145.599 1.00 94.31  ? 7    LYS A CB    1 
ATOM   29    C  CG    . LYS A  1  7    ? 40.087  16.609  146.277 1.00 101.81 ? 7    LYS A CG    1 
ATOM   30    C  CD    . LYS A  1  7    ? 40.283  18.112  146.145 1.00 110.44 ? 7    LYS A CD    1 
ATOM   31    C  CE    . LYS A  1  7    ? 39.278  18.876  146.993 1.00 95.87  ? 7    LYS A CE    1 
ATOM   32    N  NZ    . LYS A  1  7    ? 39.542  20.340  146.980 1.00 90.46  ? 7    LYS A NZ    1 
ATOM   33    N  N     . ALA A  1  8    ? 43.534  16.010  143.509 1.00 74.93  ? 8    ALA A N     1 
ATOM   34    C  CA    . ALA A  1  8    ? 44.792  15.586  142.892 1.00 72.19  ? 8    ALA A CA    1 
ATOM   35    C  C     . ALA A  1  8    ? 45.196  14.168  143.300 1.00 78.22  ? 8    ALA A C     1 
ATOM   36    O  O     . ALA A  1  8    ? 45.234  13.843  144.486 1.00 85.04  ? 8    ALA A O     1 
ATOM   37    C  CB    . ALA A  1  8    ? 45.905  16.572  143.228 1.00 56.33  ? 8    ALA A CB    1 
ATOM   38    N  N     . PRO A  1  9    ? 45.477  13.315  142.301 1.00 79.58  ? 9    PRO A N     1 
ATOM   39    C  CA    . PRO A  1  9    ? 45.730  11.877  142.445 1.00 71.60  ? 9    PRO A CA    1 
ATOM   40    C  C     . PRO A  1  9    ? 47.134  11.550  142.932 1.00 70.24  ? 9    PRO A C     1 
ATOM   41    O  O     . PRO A  1  9    ? 48.056  12.354  142.772 1.00 68.00  ? 9    PRO A O     1 
ATOM   42    C  CB    . PRO A  1  9    ? 45.560  11.344  141.012 1.00 73.62  ? 9    PRO A CB    1 
ATOM   43    C  CG    . PRO A  1  9    ? 45.013  12.482  140.206 1.00 72.57  ? 9    PRO A CG    1 
ATOM   44    C  CD    . PRO A  1  9    ? 45.479  13.718  140.888 1.00 76.57  ? 9    PRO A CD    1 
ATOM   45    N  N     . VAL A  1  10   ? 47.283  10.362  143.511 1.00 73.69  ? 10   VAL A N     1 
ATOM   46    C  CA    . VAL A  1  10   ? 48.596  9.817   143.839 1.00 81.51  ? 10   VAL A CA    1 
ATOM   47    C  C     . VAL A  1  10   ? 49.357  9.422   142.572 1.00 70.53  ? 10   VAL A C     1 
ATOM   48    O  O     . VAL A  1  10   ? 48.803  8.796   141.644 1.00 69.95  ? 10   VAL A O     1 
ATOM   49    C  CB    . VAL A  1  10   ? 48.516  8.619   144.834 1.00 85.24  ? 10   VAL A CB    1 
ATOM   50    C  CG1   . VAL A  1  10   ? 47.879  9.059   146.141 1.00 93.73  ? 10   VAL A CG1   1 
ATOM   51    C  CG2   . VAL A  1  10   ? 47.743  7.445   144.244 1.00 80.96  ? 10   VAL A CG2   1 
ATOM   52    N  N     . PHE A  1  11   ? 50.625  9.820   142.548 1.00 68.60  ? 11   PHE A N     1 
ATOM   53    C  CA    . PHE A  1  11   ? 51.508  9.607   141.411 1.00 70.40  ? 11   PHE A CA    1 
ATOM   54    C  C     . PHE A  1  11   ? 52.623  8.639   141.794 1.00 70.23  ? 11   PHE A C     1 
ATOM   55    O  O     . PHE A  1  11   ? 53.547  8.994   142.521 1.00 73.20  ? 11   PHE A O     1 
ATOM   56    C  CB    . PHE A  1  11   ? 52.086  10.957  140.971 1.00 74.05  ? 11   PHE A CB    1 
ATOM   57    C  CG    . PHE A  1  11   ? 53.146  10.863  139.911 1.00 75.39  ? 11   PHE A CG    1 
ATOM   58    C  CD1   . PHE A  1  11   ? 54.324  11.577  140.034 1.00 80.34  ? 11   PHE A CD1   1 
ATOM   59    C  CD2   . PHE A  1  11   ? 52.965  10.072  138.789 1.00 75.17  ? 11   PHE A CD2   1 
ATOM   60    C  CE1   . PHE A  1  11   ? 55.304  11.503  139.061 1.00 78.69  ? 11   PHE A CE1   1 
ATOM   61    C  CE2   . PHE A  1  11   ? 53.940  9.994   137.809 1.00 73.10  ? 11   PHE A CE2   1 
ATOM   62    C  CZ    . PHE A  1  11   ? 55.111  10.712  137.947 1.00 75.61  ? 11   PHE A CZ    1 
ATOM   63    N  N     . THR A  1  12   ? 52.544  7.423   141.270 1.00 68.66  ? 12   THR A N     1 
ATOM   64    C  CA    . THR A  1  12   ? 53.481  6.361   141.624 1.00 63.74  ? 12   THR A CA    1 
ATOM   65    C  C     . THR A  1  12   ? 54.530  6.201   140.531 1.00 64.37  ? 12   THR A C     1 
ATOM   66    O  O     . THR A  1  12   ? 54.239  6.414   139.358 1.00 66.76  ? 12   THR A O     1 
ATOM   67    C  CB    . THR A  1  12   ? 52.743  5.024   141.791 1.00 66.78  ? 12   THR A CB    1 
ATOM   68    O  OG1   . THR A  1  12   ? 51.524  5.238   142.516 1.00 73.43  ? 12   THR A OG1   1 
ATOM   69    C  CG2   . THR A  1  12   ? 53.614  4.005   142.517 1.00 63.39  ? 12   THR A CG2   1 
ATOM   70    N  N     . VAL A  1  13   ? 55.751  5.843   140.914 1.00 62.67  ? 13   VAL A N     1 
ATOM   71    C  CA    . VAL A  1  13   ? 56.834  5.660   139.950 1.00 58.21  ? 13   VAL A CA    1 
ATOM   72    C  C     . VAL A  1  13   ? 57.609  4.367   140.205 1.00 60.87  ? 13   VAL A C     1 
ATOM   73    O  O     . VAL A  1  13   ? 58.181  4.180   141.279 1.00 73.84  ? 13   VAL A O     1 
ATOM   74    C  CB    . VAL A  1  13   ? 57.821  6.847   139.983 1.00 52.53  ? 13   VAL A CB    1 
ATOM   75    C  CG1   . VAL A  1  13   ? 59.061  6.527   139.191 1.00 53.24  ? 13   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A  1  13   ? 57.159  8.114   139.464 1.00 57.83  ? 13   VAL A CG2   1 
ATOM   77    N  N     . ARG A  1  14   ? 57.625  3.476   139.220 1.00 58.71  ? 14   ARG A N     1 
ATOM   78    C  CA    . ARG A  1  14   ? 58.383  2.232   139.327 1.00 62.61  ? 14   ARG A CA    1 
ATOM   79    C  C     . ARG A  1  14   ? 59.429  2.147   138.220 1.00 67.69  ? 14   ARG A C     1 
ATOM   80    O  O     . ARG A  1  14   ? 59.083  2.035   137.054 1.00 73.28  ? 14   ARG A O     1 
ATOM   81    C  CB    . ARG A  1  14   ? 57.446  1.024   139.240 1.00 61.86  ? 14   ARG A CB    1 
ATOM   82    C  CG    . ARG A  1  14   ? 56.319  1.038   140.255 1.00 68.78  ? 14   ARG A CG    1 
ATOM   83    C  CD    . ARG A  1  14   ? 55.524  -0.259  140.226 1.00 71.15  ? 14   ARG A CD    1 
ATOM   84    N  NE    . ARG A  1  14   ? 54.432  -0.230  139.257 1.00 70.82  ? 14   ARG A NE    1 
ATOM   85    C  CZ    . ARG A  1  14   ? 53.175  0.085   139.559 1.00 77.83  ? 14   ARG A CZ    1 
ATOM   86    N  NH1   . ARG A  1  14   ? 52.849  0.407   140.805 1.00 77.92  ? 14   ARG A NH1   1 
ATOM   87    N  NH2   . ARG A  1  14   ? 52.242  0.081   138.615 1.00 78.05  ? 14   ARG A NH2   1 
ATOM   88    N  N     . THR A  1  15   ? 60.707  2.188   138.575 1.00 70.05  ? 15   THR A N     1 
ATOM   89    C  CA    . THR A  1  15   ? 61.749  2.176   137.553 1.00 69.39  ? 15   THR A CA    1 
ATOM   90    C  C     . THR A  1  15   ? 62.692  0.975   137.637 1.00 74.93  ? 15   THR A C     1 
ATOM   91    O  O     . THR A  1  15   ? 63.080  0.542   138.726 1.00 75.42  ? 15   THR A O     1 
ATOM   92    C  CB    . THR A  1  15   ? 62.586  3.472   137.583 1.00 65.81  ? 15   THR A CB    1 
ATOM   93    O  OG1   . THR A  1  15   ? 63.442  3.466   138.732 1.00 71.48  ? 15   THR A OG1   1 
ATOM   94    C  CG2   . THR A  1  15   ? 61.682  4.694   137.622 1.00 53.90  ? 15   THR A CG2   1 
ATOM   95    N  N     . GLN A  1  16   ? 63.046  0.438   136.472 1.00 75.49  ? 16   GLN A N     1 
ATOM   96    C  CA    . GLN A  1  16   ? 64.121  -0.539  136.365 1.00 77.92  ? 16   GLN A CA    1 
ATOM   97    C  C     . GLN A  1  16   ? 65.256  0.075   135.566 1.00 73.93  ? 16   GLN A C     1 
ATOM   98    O  O     . GLN A  1  16   ? 65.130  0.271   134.359 1.00 79.17  ? 16   GLN A O     1 
ATOM   99    C  CB    . GLN A  1  16   ? 63.645  -1.808  135.661 1.00 74.06  ? 16   GLN A CB    1 
ATOM   100   C  CG    . GLN A  1  16   ? 62.447  -2.468  136.309 1.00 91.33  ? 16   GLN A CG    1 
ATOM   101   C  CD    . GLN A  1  16   ? 62.105  -3.794  135.662 1.00 104.49 ? 16   GLN A CD    1 
ATOM   102   O  OE1   . GLN A  1  16   ? 62.949  -4.415  135.012 1.00 103.27 ? 16   GLN A OE1   1 
ATOM   103   N  NE2   . GLN A  1  16   ? 60.862  -4.234  135.831 1.00 105.41 ? 16   GLN A NE2   1 
ATOM   104   N  N     . GLY A  1  17   ? 66.362  0.373   136.240 1.00 71.32  ? 17   GLY A N     1 
ATOM   105   C  CA    . GLY A  1  17   ? 67.517  0.963   135.590 1.00 68.55  ? 17   GLY A CA    1 
ATOM   106   C  C     . GLY A  1  17   ? 67.188  2.264   134.882 1.00 75.80  ? 17   GLY A C     1 
ATOM   107   O  O     . GLY A  1  17   ? 66.269  2.986   135.285 1.00 70.86  ? 17   GLY A O     1 
ATOM   108   N  N     . ARG A  1  18   ? 67.943  2.563   133.827 1.00 68.49  ? 18   ARG A N     1 
ATOM   109   C  CA    . ARG A  1  18   ? 67.690  3.752   133.023 1.00 68.52  ? 18   ARG A CA    1 
ATOM   110   C  C     . ARG A  1  18   ? 66.837  3.433   131.796 1.00 69.71  ? 18   ARG A C     1 
ATOM   111   O  O     . ARG A  1  18   ? 66.462  4.332   131.045 1.00 68.99  ? 18   ARG A O     1 
ATOM   112   C  CB    . ARG A  1  18   ? 69.012  4.373   132.570 1.00 74.70  ? 18   ARG A CB    1 
ATOM   113   C  CG    . ARG A  1  18   ? 69.990  4.685   133.687 1.00 60.46  ? 18   ARG A CG    1 
ATOM   114   C  CD    . ARG A  1  18   ? 71.277  5.302   133.131 1.00 67.65  ? 18   ARG A CD    1 
ATOM   115   N  NE    . ARG A  1  18   ? 71.031  6.495   132.322 1.00 61.91  ? 18   ARG A NE    1 
ATOM   116   C  CZ    . ARG A  1  18   ? 70.830  7.710   132.822 1.00 65.96  ? 18   ARG A CZ    1 
ATOM   117   N  NH1   . ARG A  1  18   ? 70.843  7.896   134.133 1.00 74.03  ? 18   ARG A NH1   1 
ATOM   118   N  NH2   . ARG A  1  18   ? 70.609  8.740   132.014 1.00 70.17  ? 18   ARG A NH2   1 
ATOM   119   N  N     . GLU A  1  19   ? 66.548  2.150   131.591 1.00 74.06  ? 19   GLU A N     1 
ATOM   120   C  CA    . GLU A  1  19   ? 65.871  1.687   130.377 1.00 75.06  ? 19   GLU A CA    1 
ATOM   121   C  C     . GLU A  1  19   ? 64.353  1.839   130.407 1.00 72.29  ? 19   GLU A C     1 
ATOM   122   O  O     . GLU A  1  19   ? 63.744  2.260   129.426 1.00 72.58  ? 19   GLU A O     1 
ATOM   123   C  CB    . GLU A  1  19   ? 66.203  0.214   130.104 1.00 82.53  ? 19   GLU A CB    1 
ATOM   124   C  CG    . GLU A  1  19   ? 67.655  -0.184  130.335 1.00 91.78  ? 19   GLU A CG    1 
ATOM   125   C  CD    . GLU A  1  19   ? 68.551  0.121   129.152 1.00 89.13  ? 19   GLU A CD    1 
ATOM   126   O  OE1   . GLU A  1  19   ? 68.539  1.277   128.676 1.00 86.77  ? 19   GLU A OE1   1 
ATOM   127   O  OE2   . GLU A  1  19   ? 69.268  -0.798  128.700 1.00 95.90  ? 19   GLU A OE2   1 
ATOM   128   N  N     . TYR A  1  20   ? 63.748  1.487   131.536 1.00 71.12  ? 20   TYR A N     1 
ATOM   129   C  CA    . TYR A  1  20   ? 62.306  1.283   131.601 1.00 62.47  ? 20   TYR A CA    1 
ATOM   130   C  C     . TYR A  1  20   ? 61.659  1.966   132.793 1.00 65.11  ? 20   TYR A C     1 
ATOM   131   O  O     . TYR A  1  20   ? 62.281  2.129   133.842 1.00 72.62  ? 20   TYR A O     1 
ATOM   132   C  CB    . TYR A  1  20   ? 62.014  -0.213  131.668 1.00 61.68  ? 20   TYR A CB    1 
ATOM   133   C  CG    . TYR A  1  20   ? 60.549  -0.558  131.776 1.00 63.15  ? 20   TYR A CG    1 
ATOM   134   C  CD1   . TYR A  1  20   ? 60.037  -1.157  132.919 1.00 69.93  ? 20   TYR A CD1   1 
ATOM   135   C  CD2   . TYR A  1  20   ? 59.676  -0.284  130.735 1.00 59.18  ? 20   TYR A CD2   1 
ATOM   136   C  CE1   . TYR A  1  20   ? 58.692  -1.479  133.016 1.00 68.74  ? 20   TYR A CE1   1 
ATOM   137   C  CE2   . TYR A  1  20   ? 58.338  -0.596  130.823 1.00 60.48  ? 20   TYR A CE2   1 
ATOM   138   C  CZ    . TYR A  1  20   ? 57.846  -1.195  131.962 1.00 65.85  ? 20   TYR A CZ    1 
ATOM   139   O  OH    . TYR A  1  20   ? 56.503  -1.506  132.030 1.00 65.09  ? 20   TYR A OH    1 
ATOM   140   N  N     . GLY A  1  21   ? 60.399  2.357   132.631 1.00 64.12  ? 21   GLY A N     1 
ATOM   141   C  CA    . GLY A  1  21   ? 59.644  2.895   133.746 1.00 62.35  ? 21   GLY A CA    1 
ATOM   142   C  C     . GLY A  1  21   ? 58.146  2.700   133.623 1.00 60.59  ? 21   GLY A C     1 
ATOM   143   O  O     . GLY A  1  21   ? 57.604  2.591   132.525 1.00 59.19  ? 21   GLY A O     1 
ATOM   144   N  N     . GLU A  1  22   ? 57.482  2.660   134.772 1.00 59.48  ? 22   GLU A N     1 
ATOM   145   C  CA    . GLU A  1  22   ? 56.034  2.584   134.850 1.00 59.12  ? 22   GLU A CA    1 
ATOM   146   C  C     . GLU A  1  22   ? 55.601  3.757   135.695 1.00 57.61  ? 22   GLU A C     1 
ATOM   147   O  O     . GLU A  1  22   ? 56.173  4.003   136.753 1.00 62.10  ? 22   GLU A O     1 
ATOM   148   C  CB    . GLU A  1  22   ? 55.587  1.275   135.496 1.00 55.72  ? 22   GLU A CB    1 
ATOM   149   C  CG    . GLU A  1  22   ? 56.039  0.044   134.744 1.00 59.74  ? 22   GLU A CG    1 
ATOM   150   C  CD    . GLU A  1  22   ? 55.452  -1.232  135.303 1.00 67.97  ? 22   GLU A CD    1 
ATOM   151   O  OE1   . GLU A  1  22   ? 54.679  -1.149  136.281 1.00 75.94  ? 22   GLU A OE1   1 
ATOM   152   O  OE2   . GLU A  1  22   ? 55.762  -2.319  134.767 1.00 66.33  ? 22   GLU A OE2   1 
ATOM   153   N  N     . PHE A  1  23   ? 54.619  4.509   135.214 1.00 55.10  ? 23   PHE A N     1 
ATOM   154   C  CA    . PHE A  1  23   ? 54.226  5.735   135.888 1.00 55.84  ? 23   PHE A CA    1 
ATOM   155   C  C     . PHE A  1  23   ? 52.718  5.761   136.093 1.00 63.46  ? 23   PHE A C     1 
ATOM   156   O  O     . PHE A  1  23   ? 51.958  5.848   135.133 1.00 61.49  ? 23   PHE A O     1 
ATOM   157   C  CB    . PHE A  1  23   ? 54.716  6.949   135.092 1.00 55.11  ? 23   PHE A CB    1 
ATOM   158   C  CG    . PHE A  1  23   ? 56.207  6.956   134.866 1.00 63.38  ? 23   PHE A CG    1 
ATOM   159   C  CD1   . PHE A  1  23   ? 57.042  7.709   135.672 1.00 64.65  ? 23   PHE A CD1   1 
ATOM   160   C  CD2   . PHE A  1  23   ? 56.776  6.188   133.859 1.00 63.08  ? 23   PHE A CD2   1 
ATOM   161   C  CE1   . PHE A  1  23   ? 58.415  7.704   135.471 1.00 63.98  ? 23   PHE A CE1   1 
ATOM   162   C  CE2   . PHE A  1  23   ? 58.143  6.174   133.659 1.00 60.29  ? 23   PHE A CE2   1 
ATOM   163   C  CZ    . PHE A  1  23   ? 58.962  6.935   134.464 1.00 62.34  ? 23   PHE A CZ    1 
ATOM   164   N  N     . VAL A  1  24   ? 52.286  5.691   137.349 1.00 63.54  ? 24   VAL A N     1 
ATOM   165   C  CA    . VAL A  1  24   ? 50.862  5.583   137.639 1.00 57.64  ? 24   VAL A CA    1 
ATOM   166   C  C     . VAL A  1  24   ? 50.275  6.893   138.145 1.00 57.44  ? 24   VAL A C     1 
ATOM   167   O  O     . VAL A  1  24   ? 50.931  7.658   138.848 1.00 63.58  ? 24   VAL A O     1 
ATOM   168   C  CB    . VAL A  1  24   ? 50.563  4.456   138.640 1.00 55.10  ? 24   VAL A CB    1 
ATOM   169   C  CG1   . VAL A  1  24   ? 49.099  4.038   138.538 1.00 54.76  ? 24   VAL A CG1   1 
ATOM   170   C  CG2   . VAL A  1  24   ? 51.462  3.266   138.376 1.00 52.77  ? 24   VAL A CG2   1 
ATOM   171   N  N     . LEU A  1  25   ? 49.039  7.152   137.743 1.00 52.38  ? 25   LEU A N     1 
ATOM   172   C  CA    . LEU A  1  25   ? 48.288  8.289   138.224 1.00 54.12  ? 25   LEU A CA    1 
ATOM   173   C  C     . LEU A  1  25   ? 46.900  7.766   138.575 1.00 64.20  ? 25   LEU A C     1 
ATOM   174   O  O     . LEU A  1  25   ? 46.175  7.276   137.688 1.00 65.96  ? 25   LEU A O     1 
ATOM   175   C  CB    . LEU A  1  25   ? 48.198  9.338   137.122 1.00 49.00  ? 25   LEU A CB    1 
ATOM   176   C  CG    . LEU A  1  25   ? 48.373  10.794  137.532 1.00 57.00  ? 25   LEU A CG    1 
ATOM   177   C  CD1   . LEU A  1  25   ? 49.730  11.003  138.155 1.00 55.41  ? 25   LEU A CD1   1 
ATOM   178   C  CD2   . LEU A  1  25   ? 48.193  11.696  136.330 1.00 59.88  ? 25   LEU A CD2   1 
ATOM   179   N  N     . GLU A  1  26   ? 46.548  7.801   139.864 1.00 69.03  ? 26   GLU A N     1 
ATOM   180   C  CA    . GLU A  1  26   ? 45.178  7.428   140.267 1.00 66.30  ? 26   GLU A CA    1 
ATOM   181   C  C     . GLU A  1  26   ? 44.668  8.115   141.534 1.00 66.59  ? 26   GLU A C     1 
ATOM   182   O  O     . GLU A  1  26   ? 45.455  8.484   142.392 1.00 65.99  ? 26   GLU A O     1 
ATOM   183   C  CB    . GLU A  1  26   ? 45.009  5.904   140.362 1.00 62.79  ? 26   GLU A CB    1 
ATOM   184   C  CG    . GLU A  1  26   ? 45.574  5.251   141.605 1.00 60.21  ? 26   GLU A CG    1 
ATOM   185   C  CD    . GLU A  1  26   ? 45.113  3.800   141.746 1.00 70.66  ? 26   GLU A CD    1 
ATOM   186   O  OE1   . GLU A  1  26   ? 43.895  3.545   141.586 1.00 67.24  ? 26   GLU A OE1   1 
ATOM   187   O  OE2   . GLU A  1  26   ? 45.964  2.917   142.009 1.00 60.71  ? 26   GLU A OE2   1 
ATOM   188   N  N     . PRO A  1  27   ? 43.341  8.275   141.665 1.00 67.78  ? 27   PRO A N     1 
ATOM   189   C  CA    . PRO A  1  27   ? 42.292  8.042   140.672 1.00 63.40  ? 27   PRO A CA    1 
ATOM   190   C  C     . PRO A  1  27   ? 42.145  9.236   139.740 1.00 64.80  ? 27   PRO A C     1 
ATOM   191   O  O     . PRO A  1  27   ? 42.470  10.366  140.128 1.00 60.84  ? 27   PRO A O     1 
ATOM   192   C  CB    . PRO A  1  27   ? 41.044  7.891   141.532 1.00 68.51  ? 27   PRO A CB    1 
ATOM   193   C  CG    . PRO A  1  27   ? 41.291  8.828   142.665 1.00 73.86  ? 27   PRO A CG    1 
ATOM   194   C  CD    . PRO A  1  27   ? 42.780  8.791   142.928 1.00 71.82  ? 27   PRO A CD    1 
ATOM   195   N  N     . LEU A  1  28   ? 41.647  8.983   138.532 1.00 63.78  ? 28   LEU A N     1 
ATOM   196   C  CA    . LEU A  1  28   ? 41.379  10.037  137.562 1.00 59.18  ? 28   LEU A CA    1 
ATOM   197   C  C     . LEU A  1  28   ? 39.924  9.949   137.126 1.00 59.09  ? 28   LEU A C     1 
ATOM   198   O  O     . LEU A  1  28   ? 39.347  8.854   137.087 1.00 56.55  ? 28   LEU A O     1 
ATOM   199   C  CB    . LEU A  1  28   ? 42.305  9.904   136.348 1.00 57.29  ? 28   LEU A CB    1 
ATOM   200   C  CG    . LEU A  1  28   ? 43.772  10.321  136.511 1.00 61.00  ? 28   LEU A CG    1 
ATOM   201   C  CD1   . LEU A  1  28   ? 44.646  9.663   135.448 1.00 61.21  ? 28   LEU A CD1   1 
ATOM   202   C  CD2   . LEU A  1  28   ? 43.924  11.840  136.459 1.00 60.40  ? 28   LEU A CD2   1 
ATOM   203   N  N     . GLU A  1  29   ? 39.336  11.100  136.806 1.00 55.43  ? 29   GLU A N     1 
ATOM   204   C  CA    . GLU A  1  29   ? 37.969  11.144  136.296 1.00 57.98  ? 29   GLU A CA    1 
ATOM   205   C  C     . GLU A  1  29   ? 37.832  10.283  135.043 1.00 64.14  ? 29   GLU A C     1 
ATOM   206   O  O     . GLU A  1  29   ? 38.773  10.169  134.257 1.00 61.36  ? 29   GLU A O     1 
ATOM   207   C  CB    . GLU A  1  29   ? 37.550  12.584  135.999 1.00 57.26  ? 29   GLU A CB    1 
ATOM   208   C  CG    . GLU A  1  29   ? 37.261  13.419  137.236 1.00 77.48  ? 29   GLU A CG    1 
ATOM   209   C  CD    . GLU A  1  29   ? 36.000  12.973  137.970 1.00 96.96  ? 29   GLU A CD    1 
ATOM   210   O  OE1   . GLU A  1  29   ? 35.201  12.212  137.378 1.00 99.29  ? 29   GLU A OE1   1 
ATOM   211   O  OE2   . GLU A  1  29   ? 35.808  13.383  139.138 1.00 94.18  ? 29   GLU A OE2   1 
ATOM   212   N  N     . ARG A  1  30   ? 36.664  9.675   134.868 1.00 64.73  ? 30   ARG A N     1 
ATOM   213   C  CA    . ARG A  1  30   ? 36.430  8.758   133.756 1.00 63.37  ? 30   ARG A CA    1 
ATOM   214   C  C     . ARG A  1  30   ? 36.769  9.383   132.402 1.00 68.21  ? 30   ARG A C     1 
ATOM   215   O  O     . ARG A  1  30   ? 36.330  10.491  132.084 1.00 65.16  ? 30   ARG A O     1 
ATOM   216   C  CB    . ARG A  1  30   ? 34.978  8.278   133.761 1.00 72.22  ? 30   ARG A CB    1 
ATOM   217   C  CG    . ARG A  1  30   ? 34.655  7.235   132.703 1.00 80.67  ? 30   ARG A CG    1 
ATOM   218   C  CD    . ARG A  1  30   ? 33.164  6.925   132.674 1.00 92.09  ? 30   ARG A CD    1 
ATOM   219   N  NE    . ARG A  1  30   ? 32.364  8.086   132.285 1.00 95.21  ? 30   ARG A NE    1 
ATOM   220   C  CZ    . ARG A  1  30   ? 31.826  8.257   131.080 1.00 89.36  ? 30   ARG A CZ    1 
ATOM   221   N  NH1   . ARG A  1  30   ? 31.994  7.337   130.138 1.00 86.06  ? 30   ARG A NH1   1 
ATOM   222   N  NH2   . ARG A  1  30   ? 31.114  9.347   130.820 1.00 73.94  ? 30   ARG A NH2   1 
ATOM   223   N  N     . GLY A  1  31   ? 37.566  8.665   131.617 1.00 69.92  ? 31   GLY A N     1 
ATOM   224   C  CA    . GLY A  1  31   ? 37.946  9.119   130.293 1.00 66.30  ? 31   GLY A CA    1 
ATOM   225   C  C     . GLY A  1  31   ? 39.233  9.921   130.255 1.00 62.36  ? 31   GLY A C     1 
ATOM   226   O  O     . GLY A  1  31   ? 39.750  10.218  129.179 1.00 60.23  ? 31   GLY A O     1 
ATOM   227   N  N     . PHE A  1  32   ? 39.753  10.280  131.425 1.00 62.87  ? 32   PHE A N     1 
ATOM   228   C  CA    . PHE A  1  32   ? 40.992  11.050  131.491 1.00 56.66  ? 32   PHE A CA    1 
ATOM   229   C  C     . PHE A  1  32   ? 42.201  10.142  131.343 1.00 53.12  ? 32   PHE A C     1 
ATOM   230   O  O     . PHE A  1  32   ? 43.334  10.610  131.196 1.00 53.03  ? 32   PHE A O     1 
ATOM   231   C  CB    . PHE A  1  32   ? 41.076  11.851  132.795 1.00 58.16  ? 32   PHE A CB    1 
ATOM   232   C  CG    . PHE A  1  32   ? 40.503  13.229  132.689 1.00 53.04  ? 32   PHE A CG    1 
ATOM   233   C  CD1   . PHE A  1  32   ? 39.137  13.428  132.755 1.00 53.02  ? 32   PHE A CD1   1 
ATOM   234   C  CD2   . PHE A  1  32   ? 41.329  14.325  132.509 1.00 51.60  ? 32   PHE A CD2   1 
ATOM   235   C  CE1   . PHE A  1  32   ? 38.607  14.696  132.649 1.00 54.81  ? 32   PHE A CE1   1 
ATOM   236   C  CE2   . PHE A  1  32   ? 40.803  15.598  132.399 1.00 46.06  ? 32   PHE A CE2   1 
ATOM   237   C  CZ    . PHE A  1  32   ? 39.443  15.785  132.472 1.00 48.04  ? 32   PHE A CZ    1 
ATOM   238   N  N     . GLY A  1  33   ? 41.948  8.838   131.383 1.00 55.90  ? 33   GLY A N     1 
ATOM   239   C  CA    . GLY A  1  33   ? 42.997  7.857   131.193 1.00 56.06  ? 33   GLY A CA    1 
ATOM   240   C  C     . GLY A  1  33   ? 43.642  8.037   129.838 1.00 58.01  ? 33   GLY A C     1 
ATOM   241   O  O     . GLY A  1  33   ? 44.855  8.207   129.741 1.00 57.49  ? 33   GLY A O     1 
ATOM   242   N  N     . VAL A  1  34   ? 42.827  8.017   128.788 1.00 57.15  ? 34   VAL A N     1 
ATOM   243   C  CA    . VAL A  1  34   ? 43.347  8.221   127.444 1.00 54.00  ? 34   VAL A CA    1 
ATOM   244   C  C     . VAL A  1  34   ? 43.568  9.701   127.132 1.00 53.60  ? 34   VAL A C     1 
ATOM   245   O  O     . VAL A  1  34   ? 44.432  10.041  126.322 1.00 61.50  ? 34   VAL A O     1 
ATOM   246   C  CB    . VAL A  1  34   ? 42.473  7.538   126.348 1.00 54.19  ? 34   VAL A CB    1 
ATOM   247   C  CG1   . VAL A  1  34   ? 41.586  6.464   126.953 1.00 54.77  ? 34   VAL A CG1   1 
ATOM   248   C  CG2   . VAL A  1  34   ? 41.649  8.553   125.596 1.00 46.33  ? 34   VAL A CG2   1 
ATOM   249   N  N     . THR A  1  35   ? 42.804  10.578  127.774 1.00 47.29  ? 35   THR A N     1 
ATOM   250   C  CA    . THR A  1  35   ? 42.959  12.011  127.537 1.00 46.93  ? 35   THR A CA    1 
ATOM   251   C  C     . THR A  1  35   ? 44.350  12.472  127.948 1.00 52.06  ? 35   THR A C     1 
ATOM   252   O  O     . THR A  1  35   ? 44.965  13.286  127.269 1.00 53.61  ? 35   THR A O     1 
ATOM   253   C  CB    . THR A  1  35   ? 41.901  12.845  128.273 1.00 47.18  ? 35   THR A CB    1 
ATOM   254   O  OG1   . THR A  1  35   ? 40.608  12.522  127.760 1.00 50.64  ? 35   THR A OG1   1 
ATOM   255   C  CG2   . THR A  1  35   ? 42.151  14.332  128.071 1.00 41.17  ? 35   THR A CG2   1 
ATOM   256   N  N     . LEU A  1  36   ? 44.842  11.969  129.073 1.00 54.16  ? 36   LEU A N     1 
ATOM   257   C  CA    . LEU A  1  36   ? 46.224  12.235  129.447 1.00 55.30  ? 36   LEU A CA    1 
ATOM   258   C  C     . LEU A  1  36   ? 47.214  11.292  128.766 1.00 55.88  ? 36   LEU A C     1 
ATOM   259   O  O     . LEU A  1  36   ? 48.266  11.716  128.290 1.00 48.13  ? 36   LEU A O     1 
ATOM   260   C  CB    . LEU A  1  36   ? 46.399  12.182  130.963 1.00 53.18  ? 36   LEU A CB    1 
ATOM   261   C  CG    . LEU A  1  36   ? 46.082  13.496  131.663 1.00 60.32  ? 36   LEU A CG    1 
ATOM   262   C  CD1   . LEU A  1  36   ? 46.559  13.444  133.104 1.00 73.33  ? 36   LEU A CD1   1 
ATOM   263   C  CD2   . LEU A  1  36   ? 46.721  14.660  130.913 1.00 59.11  ? 36   LEU A CD2   1 
ATOM   264   N  N     . GLY A  1  37   ? 46.861  10.012  128.726 1.00 57.99  ? 37   GLY A N     1 
ATOM   265   C  CA    . GLY A  1  37   ? 47.761  8.974   128.257 1.00 58.08  ? 37   GLY A CA    1 
ATOM   266   C  C     . GLY A  1  37   ? 48.202  9.122   126.814 1.00 58.59  ? 37   GLY A C     1 
ATOM   267   O  O     . GLY A  1  37   ? 49.381  8.960   126.495 1.00 56.92  ? 37   GLY A O     1 
ATOM   268   N  N     . ASN A  1  38   ? 47.256  9.425   125.934 1.00 53.71  ? 38   ASN A N     1 
ATOM   269   C  CA    . ASN A  1  38   ? 47.559  9.478   124.509 1.00 54.10  ? 38   ASN A CA    1 
ATOM   270   C  C     . ASN A  1  38   ? 48.471  10.607  124.011 1.00 49.59  ? 38   ASN A C     1 
ATOM   271   O  O     . ASN A  1  38   ? 49.439  10.338  123.309 1.00 53.37  ? 38   ASN A O     1 
ATOM   272   C  CB    . ASN A  1  38   ? 46.286  9.385   123.673 1.00 59.04  ? 38   ASN A CB    1 
ATOM   273   C  CG    . ASN A  1  38   ? 46.563  8.941   122.264 1.00 54.92  ? 38   ASN A CG    1 
ATOM   274   O  OD1   . ASN A  1  38   ? 47.057  7.833   122.037 1.00 49.82  ? 38   ASN A OD1   1 
ATOM   275   N  ND2   . ASN A  1  38   ? 46.243  9.797   121.302 1.00 55.09  ? 38   ASN A ND2   1 
ATOM   276   N  N     . PRO A  1  39   ? 48.169  11.868  124.359 1.00 48.95  ? 39   PRO A N     1 
ATOM   277   C  CA    . PRO A  1  39   ? 49.023  12.957  123.880 1.00 49.68  ? 39   PRO A CA    1 
ATOM   278   C  C     . PRO A  1  39   ? 50.444  12.799  124.384 1.00 52.07  ? 39   PRO A C     1 
ATOM   279   O  O     . PRO A  1  39   ? 51.388  13.211  123.708 1.00 52.76  ? 39   PRO A O     1 
ATOM   280   C  CB    . PRO A  1  39   ? 48.400  14.200  124.519 1.00 48.49  ? 39   PRO A CB    1 
ATOM   281   C  CG    . PRO A  1  39   ? 47.046  13.817  124.844 1.00 47.39  ? 39   PRO A CG    1 
ATOM   282   C  CD    . PRO A  1  39   ? 47.066  12.377  125.183 1.00 53.76  ? 39   PRO A CD    1 
ATOM   283   N  N     . LEU A  1  40   ? 50.595  12.216  125.568 1.00 49.04  ? 40   LEU A N     1 
ATOM   284   C  CA    . LEU A  1  40   ? 51.928  11.978  126.097 1.00 52.66  ? 40   LEU A CA    1 
ATOM   285   C  C     . LEU A  1  40   ? 52.638  10.905  125.273 1.00 50.57  ? 40   LEU A C     1 
ATOM   286   O  O     . LEU A  1  40   ? 53.818  11.044  124.967 1.00 48.04  ? 40   LEU A O     1 
ATOM   287   C  CB    . LEU A  1  40   ? 51.890  11.623  127.588 1.00 51.08  ? 40   LEU A CB    1 
ATOM   288   C  CG    . LEU A  1  40   ? 51.522  12.774  128.535 1.00 51.19  ? 40   LEU A CG    1 
ATOM   289   C  CD1   . LEU A  1  40   ? 51.505  12.298  129.976 1.00 51.36  ? 40   LEU A CD1   1 
ATOM   290   C  CD2   . LEU A  1  40   ? 52.468  13.961  128.370 1.00 47.92  ? 40   LEU A CD2   1 
ATOM   291   N  N     . ARG A  1  41   ? 51.916  9.853   124.890 1.00 48.62  ? 41   ARG A N     1 
ATOM   292   C  CA    . ARG A  1  41   ? 52.497  8.815   124.039 1.00 47.97  ? 41   ARG A CA    1 
ATOM   293   C  C     . ARG A  1  41   ? 52.966  9.413   122.728 1.00 49.92  ? 41   ARG A C     1 
ATOM   294   O  O     . ARG A  1  41   ? 54.066  9.122   122.260 1.00 51.78  ? 41   ARG A O     1 
ATOM   295   C  CB    . ARG A  1  41   ? 51.499  7.696   123.746 1.00 45.05  ? 41   ARG A CB    1 
ATOM   296   C  CG    . ARG A  1  41   ? 52.077  6.596   122.874 1.00 42.97  ? 41   ARG A CG    1 
ATOM   297   C  CD    . ARG A  1  41   ? 51.086  5.471   122.643 1.00 49.08  ? 41   ARG A CD    1 
ATOM   298   N  NE    . ARG A  1  41   ? 51.669  4.376   121.869 1.00 52.02  ? 41   ARG A NE    1 
ATOM   299   C  CZ    . ARG A  1  41   ? 51.657  4.304   120.539 1.00 52.08  ? 41   ARG A CZ    1 
ATOM   300   N  NH1   . ARG A  1  41   ? 51.087  5.266   119.821 1.00 48.44  ? 41   ARG A NH1   1 
ATOM   301   N  NH2   . ARG A  1  41   ? 52.214  3.267   119.924 1.00 46.29  ? 41   ARG A NH2   1 
ATOM   302   N  N     . ARG A  1  42   ? 52.128  10.258  122.141 1.00 44.66  ? 42   ARG A N     1 
ATOM   303   C  CA    . ARG A  1  42   ? 52.461  10.892  120.876 1.00 46.89  ? 42   ARG A CA    1 
ATOM   304   C  C     . ARG A  1  42   ? 53.701  11.779  120.998 1.00 48.04  ? 42   ARG A C     1 
ATOM   305   O  O     . ARG A  1  42   ? 54.619  11.690  120.182 1.00 51.60  ? 42   ARG A O     1 
ATOM   306   C  CB    . ARG A  1  42   ? 51.256  11.663  120.327 1.00 45.79  ? 42   ARG A CB    1 
ATOM   307   C  CG    . ARG A  1  42   ? 50.097  10.752  119.931 1.00 42.65  ? 42   ARG A CG    1 
ATOM   308   C  CD    . ARG A  1  42   ? 48.893  11.530  119.442 1.00 42.76  ? 42   ARG A CD    1 
ATOM   309   N  NE    . ARG A  1  42   ? 49.221  12.448  118.356 1.00 51.88  ? 42   ARG A NE    1 
ATOM   310   C  CZ    . ARG A  1  42   ? 49.419  12.078  117.093 1.00 52.11  ? 42   ARG A CZ    1 
ATOM   311   N  NH1   . ARG A  1  42   ? 49.337  10.800  116.744 1.00 50.27  ? 42   ARG A NH1   1 
ATOM   312   N  NH2   . ARG A  1  42   ? 49.706  12.988  116.175 1.00 51.97  ? 42   ARG A NH2   1 
ATOM   313   N  N     . ILE A  1  43   ? 53.739  12.613  122.029 1.00 47.34  ? 43   ILE A N     1 
ATOM   314   C  CA    . ILE A  1  43   ? 54.874  13.500  122.232 1.00 48.58  ? 43   ILE A CA    1 
ATOM   315   C  C     . ILE A  1  43   ? 56.136  12.702  122.546 1.00 47.92  ? 43   ILE A C     1 
ATOM   316   O  O     . ILE A  1  43   ? 57.226  13.041  122.085 1.00 48.88  ? 43   ILE A O     1 
ATOM   317   C  CB    . ILE A  1  43   ? 54.584  14.535  123.330 1.00 46.51  ? 43   ILE A CB    1 
ATOM   318   C  CG1   . ILE A  1  43   ? 53.440  15.443  122.891 1.00 45.77  ? 43   ILE A CG1   1 
ATOM   319   C  CG2   . ILE A  1  43   ? 55.804  15.388  123.602 1.00 47.49  ? 43   ILE A CG2   1 
ATOM   320   C  CD1   . ILE A  1  43   ? 52.828  16.238  123.998 1.00 45.59  ? 43   ILE A CD1   1 
ATOM   321   N  N     . LEU A  1  44   ? 55.982  11.627  123.310 1.00 49.37  ? 44   LEU A N     1 
ATOM   322   C  CA    . LEU A  1  44   ? 57.117  10.779  123.671 1.00 50.99  ? 44   LEU A CA    1 
ATOM   323   C  C     . LEU A  1  44   ? 57.724  10.087  122.457 1.00 50.17  ? 44   LEU A C     1 
ATOM   324   O  O     . LEU A  1  44   ? 58.942  9.923   122.365 1.00 49.40  ? 44   LEU A O     1 
ATOM   325   C  CB    . LEU A  1  44   ? 56.705  9.727   124.701 1.00 49.74  ? 44   LEU A CB    1 
ATOM   326   C  CG    . LEU A  1  44   ? 56.476  10.193  126.138 1.00 49.63  ? 44   LEU A CG    1 
ATOM   327   C  CD1   . LEU A  1  44   ? 55.655  9.150   126.869 1.00 48.64  ? 44   LEU A CD1   1 
ATOM   328   C  CD2   . LEU A  1  44   ? 57.789  10.442  126.846 1.00 48.52  ? 44   LEU A CD2   1 
ATOM   329   N  N     . LEU A  1  45   ? 56.871  9.673   121.529 1.00 53.33  ? 45   LEU A N     1 
ATOM   330   C  CA    . LEU A  1  45   ? 57.331  8.946   120.355 1.00 43.38  ? 45   LEU A CA    1 
ATOM   331   C  C     . LEU A  1  45   ? 57.942  9.878   119.322 1.00 47.03  ? 45   LEU A C     1 
ATOM   332   O  O     . LEU A  1  45   ? 58.755  9.456   118.498 1.00 53.74  ? 45   LEU A O     1 
ATOM   333   C  CB    . LEU A  1  45   ? 56.190  8.134   119.744 1.00 37.28  ? 45   LEU A CB    1 
ATOM   334   C  CG    . LEU A  1  45   ? 55.847  6.884   120.553 1.00 41.50  ? 45   LEU A CG    1 
ATOM   335   C  CD1   . LEU A  1  45   ? 54.650  6.144   119.977 1.00 40.51  ? 45   LEU A CD1   1 
ATOM   336   C  CD2   . LEU A  1  45   ? 57.063  5.977   120.649 1.00 40.02  ? 45   LEU A CD2   1 
ATOM   337   N  N     . SER A  1  46   ? 57.572  11.152  119.385 1.00 45.07  ? 46   SER A N     1 
ATOM   338   C  CA    . SER A  1  46   ? 57.991  12.117  118.374 1.00 47.00  ? 46   SER A CA    1 
ATOM   339   C  C     . SER A  1  46   ? 59.026  13.147  118.835 1.00 51.53  ? 46   SER A C     1 
ATOM   340   O  O     . SER A  1  46   ? 60.131  13.208  118.298 1.00 62.69  ? 46   SER A O     1 
ATOM   341   C  CB    . SER A  1  46   ? 56.773  12.830  117.788 1.00 50.61  ? 46   SER A CB    1 
ATOM   342   O  OG    . SER A  1  46   ? 56.140  13.648  118.753 1.00 51.29  ? 46   SER A OG    1 
ATOM   343   N  N     . SER A  1  47   ? 58.653  13.955  119.823 1.00 52.05  ? 47   SER A N     1 
ATOM   344   C  CA    . SER A  1  47   ? 59.340  15.215  120.109 1.00 53.68  ? 47   SER A CA    1 
ATOM   345   C  C     . SER A  1  47   ? 60.446  15.210  121.174 1.00 52.06  ? 47   SER A C     1 
ATOM   346   O  O     . SER A  1  47   ? 60.999  16.267  121.489 1.00 52.64  ? 47   SER A O     1 
ATOM   347   C  CB    . SER A  1  47   ? 58.304  16.291  120.442 1.00 55.14  ? 47   SER A CB    1 
ATOM   348   O  OG    . SER A  1  47   ? 57.308  16.348  119.431 1.00 62.22  ? 47   SER A OG    1 
ATOM   349   N  N     . ILE A  1  48   ? 60.772  14.043  121.721 1.00 49.11  ? 48   ILE A N     1 
ATOM   350   C  CA    . ILE A  1  48   ? 61.804  13.955  122.761 1.00 52.29  ? 48   ILE A CA    1 
ATOM   351   C  C     . ILE A  1  48   ? 63.219  13.942  122.180 1.00 56.14  ? 48   ILE A C     1 
ATOM   352   O  O     . ILE A  1  48   ? 63.596  13.004  121.476 1.00 61.32  ? 48   ILE A O     1 
ATOM   353   C  CB    . ILE A  1  48   ? 61.611  12.706  123.664 1.00 55.37  ? 48   ILE A CB    1 
ATOM   354   C  CG1   . ILE A  1  48   ? 60.247  12.744  124.360 1.00 50.04  ? 48   ILE A CG1   1 
ATOM   355   C  CG2   . ILE A  1  48   ? 62.726  12.601  124.690 1.00 56.93  ? 48   ILE A CG2   1 
ATOM   356   C  CD1   . ILE A  1  48   ? 59.923  14.079  124.999 1.00 45.45  ? 48   ILE A CD1   1 
ATOM   357   N  N     . PRO A  1  49   ? 64.007  14.989  122.475 1.00 58.51  ? 49   PRO A N     1 
ATOM   358   C  CA    . PRO A  1  49   ? 65.380  15.127  121.973 1.00 58.51  ? 49   PRO A CA    1 
ATOM   359   C  C     . PRO A  1  49   ? 66.283  13.976  122.401 1.00 56.14  ? 49   PRO A C     1 
ATOM   360   O  O     . PRO A  1  49   ? 66.023  13.345  123.429 1.00 55.28  ? 49   PRO A O     1 
ATOM   361   C  CB    . PRO A  1  49   ? 65.854  16.435  122.613 1.00 54.39  ? 49   PRO A CB    1 
ATOM   362   C  CG    . PRO A  1  49   ? 64.602  17.210  122.830 1.00 55.61  ? 49   PRO A CG    1 
ATOM   363   C  CD    . PRO A  1  49   ? 63.579  16.182  123.224 1.00 59.64  ? 49   PRO A CD    1 
ATOM   364   N  N     . GLY A  1  50   ? 67.336  13.727  121.625 1.00 53.19  ? 50   GLY A N     1 
ATOM   365   C  CA    . GLY A  1  50   ? 68.229  12.607  121.861 1.00 54.07  ? 50   GLY A CA    1 
ATOM   366   C  C     . GLY A  1  50   ? 69.539  12.745  121.108 1.00 58.07  ? 50   GLY A C     1 
ATOM   367   O  O     . GLY A  1  50   ? 69.889  13.827  120.633 1.00 58.75  ? 50   GLY A O     1 
ATOM   368   N  N     . THR A  1  51   ? 70.285  11.650  121.019 1.00 58.44  ? 51   THR A N     1 
ATOM   369   C  CA    . THR A  1  51   ? 71.524  11.650  120.252 1.00 64.31  ? 51   THR A CA    1 
ATOM   370   C  C     . THR A  1  51   ? 71.586  10.510  119.236 1.00 64.00  ? 51   THR A C     1 
ATOM   371   O  O     . THR A  1  51   ? 71.054  9.420   119.468 1.00 64.71  ? 51   THR A O     1 
ATOM   372   C  CB    . THR A  1  51   ? 72.759  11.560  121.164 1.00 63.53  ? 51   THR A CB    1 
ATOM   373   O  OG1   . THR A  1  51   ? 72.690  10.360  121.946 1.00 52.92  ? 51   THR A OG1   1 
ATOM   374   C  CG2   . THR A  1  51   ? 72.846  12.778  122.078 1.00 59.79  ? 51   THR A CG2   1 
ATOM   375   N  N     . ALA A  1  52   ? 72.235  10.775  118.107 1.00 58.68  ? 52   ALA A N     1 
ATOM   376   C  CA    . ALA A  1  52   ? 72.458  9.758   117.088 1.00 55.18  ? 52   ALA A CA    1 
ATOM   377   C  C     . ALA A  1  52   ? 73.717  10.075  116.293 1.00 50.59  ? 52   ALA A C     1 
ATOM   378   O  O     . ALA A  1  52   ? 74.066  11.246  116.135 1.00 50.91  ? 52   ALA A O     1 
ATOM   379   C  CB    . ALA A  1  52   ? 71.265  9.672   116.167 1.00 56.00  ? 52   ALA A CB    1 
ATOM   380   N  N     . VAL A  1  53   ? 74.397  9.037   115.799 1.00 49.87  ? 53   VAL A N     1 
ATOM   381   C  CA    . VAL A  1  53   ? 75.512  9.233   114.878 1.00 50.55  ? 53   VAL A CA    1 
ATOM   382   C  C     . VAL A  1  53   ? 74.980  9.938   113.643 1.00 49.72  ? 53   VAL A C     1 
ATOM   383   O  O     . VAL A  1  53   ? 74.075  9.423   112.981 1.00 46.63  ? 53   VAL A O     1 
ATOM   384   C  CB    . VAL A  1  53   ? 76.070  7.878   114.402 1.00 48.46  ? 53   VAL A CB    1 
ATOM   385   C  CG1   . VAL A  1  53   ? 77.082  8.077   113.286 1.00 51.15  ? 53   VAL A CG1   1 
ATOM   386   C  CG2   . VAL A  1  53   ? 76.682  7.113   115.558 1.00 60.55  ? 53   VAL A CG2   1 
ATOM   387   N  N     . THR A  1  54   ? 75.510  11.124  113.344 1.00 46.61  ? 54   THR A N     1 
ATOM   388   C  CA    . THR A  1  54   ? 75.141  11.809  112.108 1.00 47.28  ? 54   THR A CA    1 
ATOM   389   C  C     . THR A  1  54   ? 76.141  11.666  110.965 1.00 52.31  ? 54   THR A C     1 
ATOM   390   O  O     . THR A  1  54   ? 75.802  11.945  109.812 1.00 53.08  ? 54   THR A O     1 
ATOM   391   C  CB    . THR A  1  54   ? 74.848  13.309  112.333 1.00 50.00  ? 54   THR A CB    1 
ATOM   392   O  OG1   . THR A  1  54   ? 76.037  13.976  112.771 1.00 50.93  ? 54   THR A OG1   1 
ATOM   393   C  CG2   . THR A  1  54   ? 73.748  13.487  113.366 1.00 55.73  ? 54   THR A CG2   1 
ATOM   394   N  N     . SER A  1  55   ? 77.361  11.220  111.266 1.00 55.08  ? 55   SER A N     1 
ATOM   395   C  CA    . SER A  1  55   ? 78.370  11.120  110.200 1.00 52.85  ? 55   SER A CA    1 
ATOM   396   C  C     . SER A  1  55   ? 79.482  10.110  110.481 1.00 52.96  ? 55   SER A C     1 
ATOM   397   O  O     . SER A  1  55   ? 79.794  9.829   111.628 1.00 53.88  ? 55   SER A O     1 
ATOM   398   C  CB    . SER A  1  55   ? 78.965  12.499  109.894 1.00 49.36  ? 55   SER A CB    1 
ATOM   399   O  OG    . SER A  1  55   ? 79.818  12.448  108.765 1.00 54.24  ? 55   SER A OG    1 
ATOM   400   N  N     . VAL A  1  56   ? 80.084  9.566   109.430 1.00 48.23  ? 56   VAL A N     1 
ATOM   401   C  CA    . VAL A  1  56   ? 81.187  8.622   109.596 1.00 51.83  ? 56   VAL A CA    1 
ATOM   402   C  C     . VAL A  1  56   ? 82.302  8.870   108.579 1.00 59.98  ? 56   VAL A C     1 
ATOM   403   O  O     . VAL A  1  56   ? 82.043  9.035   107.385 1.00 57.54  ? 56   VAL A O     1 
ATOM   404   C  CB    . VAL A  1  56   ? 80.728  7.150   109.458 1.00 53.33  ? 56   VAL A CB    1 
ATOM   405   C  CG1   . VAL A  1  56   ? 81.912  6.211   109.603 1.00 56.16  ? 56   VAL A CG1   1 
ATOM   406   C  CG2   . VAL A  1  56   ? 79.683  6.809   110.493 1.00 60.33  ? 56   VAL A CG2   1 
ATOM   407   N  N     . TYR A  1  57   ? 83.541  8.909   109.058 1.00 59.25  ? 57   TYR A N     1 
ATOM   408   C  CA    . TYR A  1  57   ? 84.690  8.901   108.167 1.00 55.43  ? 57   TYR A CA    1 
ATOM   409   C  C     . TYR A  1  57   ? 85.563  7.695   108.455 1.00 58.12  ? 57   TYR A C     1 
ATOM   410   O  O     . TYR A  1  57   ? 86.121  7.583   109.533 1.00 62.50  ? 57   TYR A O     1 
ATOM   411   C  CB    . TYR A  1  57   ? 85.528  10.166  108.310 1.00 57.94  ? 57   TYR A CB    1 
ATOM   412   C  CG    . TYR A  1  57   ? 86.906  10.007  107.704 1.00 69.11  ? 57   TYR A CG    1 
ATOM   413   C  CD1   . TYR A  1  57   ? 87.082  9.990   106.324 1.00 71.29  ? 57   TYR A CD1   1 
ATOM   414   C  CD2   . TYR A  1  57   ? 88.029  9.855   108.509 1.00 70.15  ? 57   TYR A CD2   1 
ATOM   415   C  CE1   . TYR A  1  57   ? 88.340  9.839   105.766 1.00 76.05  ? 57   TYR A CE1   1 
ATOM   416   C  CE2   . TYR A  1  57   ? 89.288  9.698   107.959 1.00 72.92  ? 57   TYR A CE2   1 
ATOM   417   C  CZ    . TYR A  1  57   ? 89.438  9.691   106.590 1.00 77.07  ? 57   TYR A CZ    1 
ATOM   418   O  OH    . TYR A  1  57   ? 90.691  9.537   106.044 1.00 82.29  ? 57   TYR A OH    1 
ATOM   419   N  N     . ILE A  1  58   ? 85.684  6.794   107.490 1.00 60.45  ? 58   ILE A N     1 
ATOM   420   C  CA    . ILE A  1  58   ? 86.578  5.658   107.632 1.00 60.62  ? 58   ILE A CA    1 
ATOM   421   C  C     . ILE A  1  58   ? 87.773  5.897   106.726 1.00 67.41  ? 58   ILE A C     1 
ATOM   422   O  O     . ILE A  1  58   ? 87.605  6.307   105.581 1.00 69.16  ? 58   ILE A O     1 
ATOM   423   C  CB    . ILE A  1  58   ? 85.879  4.342   107.259 1.00 58.35  ? 58   ILE A CB    1 
ATOM   424   C  CG1   . ILE A  1  58   ? 84.558  4.217   108.025 1.00 61.47  ? 58   ILE A CG1   1 
ATOM   425   C  CG2   . ILE A  1  58   ? 86.783  3.155   107.545 1.00 57.29  ? 58   ILE A CG2   1 
ATOM   426   C  CD1   . ILE A  1  58   ? 83.785  2.946   107.738 1.00 57.22  ? 58   ILE A CD1   1 
ATOM   427   N  N     . GLU A  1  59   ? 88.976  5.666   107.244 1.00 67.24  ? 59   GLU A N     1 
ATOM   428   C  CA    . GLU A  1  59   ? 90.187  5.936   106.483 1.00 68.34  ? 59   GLU A CA    1 
ATOM   429   C  C     . GLU A  1  59   ? 90.316  4.952   105.328 1.00 69.50  ? 59   GLU A C     1 
ATOM   430   O  O     . GLU A  1  59   ? 90.036  3.762   105.487 1.00 66.37  ? 59   GLU A O     1 
ATOM   431   C  CB    . GLU A  1  59   ? 91.421  5.865   107.383 1.00 81.65  ? 59   GLU A CB    1 
ATOM   432   C  CG    . GLU A  1  59   ? 92.707  6.301   106.699 1.00 90.42  ? 59   GLU A CG    1 
ATOM   433   C  CD    . GLU A  1  59   ? 93.942  6.036   107.540 1.00 99.71  ? 59   GLU A CD    1 
ATOM   434   O  OE1   . GLU A  1  59   ? 93.798  5.848   108.768 1.00 93.89  ? 59   GLU A OE1   1 
ATOM   435   O  OE2   . GLU A  1  59   ? 95.056  6.011   106.971 1.00 108.89 ? 59   GLU A OE2   1 
ATOM   436   N  N     . ASP A  1  60   ? 90.735  5.468   104.172 1.00 72.60  ? 60   ASP A N     1 
ATOM   437   C  CA    . ASP A  1  60   ? 90.849  4.692   102.932 1.00 70.67  ? 60   ASP A CA    1 
ATOM   438   C  C     . ASP A  1  60   ? 89.499  4.166   102.433 1.00 64.54  ? 60   ASP A C     1 
ATOM   439   O  O     . ASP A  1  60   ? 89.419  3.095   101.826 1.00 59.26  ? 60   ASP A O     1 
ATOM   440   C  CB    . ASP A  1  60   ? 91.869  3.555   103.076 1.00 78.99  ? 60   ASP A CB    1 
ATOM   441   C  CG    . ASP A  1  60   ? 93.290  4.064   103.269 1.00 86.83  ? 60   ASP A CG    1 
ATOM   442   O  OD1   . ASP A  1  60   ? 93.617  5.142   102.726 1.00 88.56  ? 60   ASP A OD1   1 
ATOM   443   O  OD2   . ASP A  1  60   ? 94.080  3.388   103.962 1.00 89.44  ? 60   ASP A OD2   1 
ATOM   444   N  N     . VAL A  1  61   ? 88.444  4.931   102.703 1.00 59.95  ? 61   VAL A N     1 
ATOM   445   C  CA    . VAL A  1  61   ? 87.100  4.623   102.229 1.00 54.04  ? 61   VAL A CA    1 
ATOM   446   C  C     . VAL A  1  61   ? 86.492  5.908   101.676 1.00 58.10  ? 61   VAL A C     1 
ATOM   447   O  O     . VAL A  1  61   ? 86.368  6.901   102.398 1.00 59.91  ? 61   VAL A O     1 
ATOM   448   C  CB    . VAL A  1  61   ? 86.212  4.046   103.357 1.00 50.12  ? 61   VAL A CB    1 
ATOM   449   C  CG1   . VAL A  1  61   ? 84.750  4.105   102.977 1.00 44.65  ? 61   VAL A CG1   1 
ATOM   450   C  CG2   . VAL A  1  61   ? 86.617  2.618   103.671 1.00 56.22  ? 61   VAL A CG2   1 
ATOM   451   N  N     . LEU A  1  62   ? 86.160  5.899   100.385 1.00 54.97  ? 62   LEU A N     1 
ATOM   452   C  CA    . LEU A  1  62   ? 85.686  7.106   99.707  1.00 51.20  ? 62   LEU A CA    1 
ATOM   453   C  C     . LEU A  1  62   ? 84.176  7.333   99.770  1.00 50.94  ? 62   LEU A C     1 
ATOM   454   O  O     . LEU A  1  62   ? 83.701  8.458   99.586  1.00 50.58  ? 62   LEU A O     1 
ATOM   455   C  CB    . LEU A  1  62   ? 86.142  7.079   98.252  1.00 47.62  ? 62   LEU A CB    1 
ATOM   456   C  CG    . LEU A  1  62   ? 87.656  7.072   98.059  1.00 43.41  ? 62   LEU A CG    1 
ATOM   457   C  CD1   . LEU A  1  62   ? 88.017  6.655   96.644  1.00 48.46  ? 62   LEU A CD1   1 
ATOM   458   C  CD2   . LEU A  1  62   ? 88.213  8.443   98.372  1.00 50.24  ? 62   LEU A CD2   1 
ATOM   459   N  N     . HIS A  1  63   ? 83.427  6.272   100.057 1.00 45.49  ? 63   HIS A N     1 
ATOM   460   C  CA    . HIS A  1  63   ? 81.972  6.344   100.040 1.00 46.48  ? 63   HIS A CA    1 
ATOM   461   C  C     . HIS A  1  63   ? 81.349  5.099   100.660 1.00 48.45  ? 63   HIS A C     1 
ATOM   462   O  O     . HIS A  1  63   ? 82.052  4.137   100.966 1.00 46.12  ? 63   HIS A O     1 
ATOM   463   C  CB    . HIS A  1  63   ? 81.472  6.508   98.605  1.00 49.00  ? 63   HIS A CB    1 
ATOM   464   C  CG    . HIS A  1  63   ? 81.957  5.442   97.674  1.00 46.50  ? 63   HIS A CG    1 
ATOM   465   N  ND1   . HIS A  1  63   ? 81.488  4.146   97.718  1.00 45.56  ? 63   HIS A ND1   1 
ATOM   466   C  CD2   . HIS A  1  63   ? 82.881  5.476   96.686  1.00 47.36  ? 63   HIS A CD2   1 
ATOM   467   C  CE1   . HIS A  1  63   ? 82.099  3.427   96.793  1.00 46.92  ? 63   HIS A CE1   1 
ATOM   468   N  NE2   . HIS A  1  63   ? 82.950  4.211   96.153  1.00 52.20  ? 63   HIS A NE2   1 
ATOM   469   N  N     . GLU A  1  64   ? 80.022  5.106   100.785 1.00 47.69  ? 64   GLU A N     1 
ATOM   470   C  CA    . GLU A  1  64   ? 79.295  4.070   101.523 1.00 46.86  ? 64   GLU A CA    1 
ATOM   471   C  C     . GLU A  1  64   ? 79.381  2.697   100.862 1.00 48.15  ? 64   GLU A C     1 
ATOM   472   O  O     . GLU A  1  64   ? 79.278  1.663   101.520 1.00 46.55  ? 64   GLU A O     1 
ATOM   473   C  CB    . GLU A  1  64   ? 77.828  4.478   101.694 1.00 46.25  ? 64   GLU A CB    1 
ATOM   474   C  CG    . GLU A  1  64   ? 77.003  3.511   102.528 1.00 56.24  ? 64   GLU A CG    1 
ATOM   475   C  CD    . GLU A  1  64   ? 75.710  4.125   103.042 1.00 67.52  ? 64   GLU A CD    1 
ATOM   476   O  OE1   . GLU A  1  64   ? 75.451  5.309   102.736 1.00 73.29  ? 64   GLU A OE1   1 
ATOM   477   O  OE2   . GLU A  1  64   ? 74.956  3.424   103.754 1.00 63.41  ? 64   GLU A OE2   1 
ATOM   478   N  N     . PHE A  1  65   ? 79.591  2.696   99.554  1.00 52.80  ? 65   PHE A N     1 
ATOM   479   C  CA    . PHE A  1  65   ? 79.528  1.475   98.763  1.00 51.58  ? 65   PHE A CA    1 
ATOM   480   C  C     . PHE A  1  65   ? 80.878  0.793   98.680  1.00 56.44  ? 65   PHE A C     1 
ATOM   481   O  O     . PHE A  1  65   ? 81.066  -0.152  97.912  1.00 56.03  ? 65   PHE A O     1 
ATOM   482   C  CB    . PHE A  1  65   ? 78.939  1.772   97.393  1.00 46.24  ? 65   PHE A CB    1 
ATOM   483   C  CG    . PHE A  1  65   ? 77.618  2.467   97.471  1.00 43.27  ? 65   PHE A CG    1 
ATOM   484   C  CD1   . PHE A  1  65   ? 77.543  3.851   97.418  1.00 44.32  ? 65   PHE A CD1   1 
ATOM   485   C  CD2   . PHE A  1  65   ? 76.454  1.741   97.653  1.00 44.02  ? 65   PHE A CD2   1 
ATOM   486   C  CE1   . PHE A  1  65   ? 76.325  4.498   97.511  1.00 44.11  ? 65   PHE A CE1   1 
ATOM   487   C  CE2   . PHE A  1  65   ? 75.232  2.383   97.753  1.00 47.45  ? 65   PHE A CE2   1 
ATOM   488   C  CZ    . PHE A  1  65   ? 75.168  3.764   97.680  1.00 44.89  ? 65   PHE A CZ    1 
ATOM   489   N  N     . SER A  1  66   ? 81.820  1.313   99.462  1.00 56.33  ? 66   SER A N     1 
ATOM   490   C  CA    . SER A  1  66   ? 83.150  0.736   99.573  1.00 53.92  ? 66   SER A CA    1 
ATOM   491   C  C     . SER A  1  66   ? 83.164  -0.553  100.397 1.00 50.12  ? 66   SER A C     1 
ATOM   492   O  O     . SER A  1  66   ? 82.150  -0.996  100.919 1.00 45.27  ? 66   SER A O     1 
ATOM   493   C  CB    . SER A  1  66   ? 84.116  1.751   100.192 1.00 56.51  ? 66   SER A CB    1 
ATOM   494   O  OG    . SER A  1  66   ? 84.206  2.939   99.421  1.00 56.24  ? 66   SER A OG    1 
ATOM   495   N  N     . THR A  1  67   ? 84.343  -1.150  100.493 1.00 60.95  ? 67   THR A N     1 
ATOM   496   C  CA    . THR A  1  67   ? 84.549  -2.365  101.258 1.00 53.78  ? 67   THR A CA    1 
ATOM   497   C  C     . THR A  1  67   ? 85.992  -2.312  101.760 1.00 55.94  ? 67   THR A C     1 
ATOM   498   O  O     . THR A  1  67   ? 86.876  -1.829  101.056 1.00 62.88  ? 67   THR A O     1 
ATOM   499   C  CB    . THR A  1  67   ? 84.278  -3.603  100.381 1.00 50.98  ? 67   THR A CB    1 
ATOM   500   O  OG1   . THR A  1  67   ? 84.840  -4.767  100.985 1.00 57.08  ? 67   THR A OG1   1 
ATOM   501   C  CG2   . THR A  1  67   ? 84.889  -3.417  99.011  1.00 59.15  ? 67   THR A CG2   1 
ATOM   502   N  N     . ILE A  1  68   ? 86.226  -2.773  102.982 1.00 57.73  ? 68   ILE A N     1 
ATOM   503   C  CA    . ILE A  1  68   ? 87.537  -2.610  103.618 1.00 59.89  ? 68   ILE A CA    1 
ATOM   504   C  C     . ILE A  1  68   ? 88.322  -3.915  103.689 1.00 59.21  ? 68   ILE A C     1 
ATOM   505   O  O     . ILE A  1  68   ? 87.811  -4.916  104.181 1.00 61.78  ? 68   ILE A O     1 
ATOM   506   C  CB    . ILE A  1  68   ? 87.408  -2.032  105.042 1.00 59.16  ? 68   ILE A CB    1 
ATOM   507   C  CG1   . ILE A  1  68   ? 86.455  -0.835  105.052 1.00 61.10  ? 68   ILE A CG1   1 
ATOM   508   C  CG2   . ILE A  1  68   ? 88.768  -1.634  105.572 1.00 55.86  ? 68   ILE A CG2   1 
ATOM   509   C  CD1   . ILE A  1  68   ? 86.152  -0.302  106.431 1.00 51.24  ? 68   ILE A CD1   1 
ATOM   510   N  N     . PRO A  1  69   ? 89.567  -3.911  103.187 1.00 62.53  ? 69   PRO A N     1 
ATOM   511   C  CA    . PRO A  1  69   ? 90.413  -5.110  103.251 1.00 56.01  ? 69   PRO A CA    1 
ATOM   512   C  C     . PRO A  1  69   ? 90.671  -5.512  104.697 1.00 58.01  ? 69   PRO A C     1 
ATOM   513   O  O     . PRO A  1  69   ? 90.990  -4.661  105.534 1.00 58.81  ? 69   PRO A O     1 
ATOM   514   C  CB    . PRO A  1  69   ? 91.716  -4.656  102.590 1.00 50.23  ? 69   PRO A CB    1 
ATOM   515   C  CG    . PRO A  1  69   ? 91.343  -3.469  101.764 1.00 55.78  ? 69   PRO A CG    1 
ATOM   516   C  CD    . PRO A  1  69   ? 90.249  -2.788  102.524 1.00 60.61  ? 69   PRO A CD    1 
ATOM   517   N  N     . GLY A  1  70   ? 90.517  -6.798  104.992 1.00 58.15  ? 70   GLY A N     1 
ATOM   518   C  CA    . GLY A  1  70   ? 90.703  -7.291  106.346 1.00 59.75  ? 70   GLY A CA    1 
ATOM   519   C  C     . GLY A  1  70   ? 89.423  -7.289  107.159 1.00 62.10  ? 70   GLY A C     1 
ATOM   520   O  O     . GLY A  1  70   ? 89.320  -7.984  108.164 1.00 63.31  ? 70   GLY A O     1 
ATOM   521   N  N     . VAL A  1  71   ? 88.442  -6.505  106.719 1.00 62.81  ? 71   VAL A N     1 
ATOM   522   C  CA    . VAL A  1  71   ? 87.173  -6.380  107.427 1.00 55.15  ? 71   VAL A CA    1 
ATOM   523   C  C     . VAL A  1  71   ? 86.096  -7.240  106.769 1.00 57.46  ? 71   VAL A C     1 
ATOM   524   O  O     . VAL A  1  71   ? 86.030  -7.324  105.545 1.00 60.51  ? 71   VAL A O     1 
ATOM   525   C  CB    . VAL A  1  71   ? 86.716  -4.911  107.472 1.00 53.65  ? 71   VAL A CB    1 
ATOM   526   C  CG1   . VAL A  1  71   ? 85.420  -4.776  108.247 1.00 55.87  ? 71   VAL A CG1   1 
ATOM   527   C  CG2   . VAL A  1  71   ? 87.794  -4.050  108.096 1.00 56.28  ? 71   VAL A CG2   1 
ATOM   528   N  N     . LYS A  1  72   ? 85.266  -7.891  107.582 1.00 56.57  ? 72   LYS A N     1 
ATOM   529   C  CA    . LYS A  1  72   ? 84.201  -8.749  107.067 1.00 57.68  ? 72   LYS A CA    1 
ATOM   530   C  C     . LYS A  1  72   ? 83.008  -7.948  106.546 1.00 57.71  ? 72   LYS A C     1 
ATOM   531   O  O     . LYS A  1  72   ? 82.490  -8.221  105.462 1.00 58.41  ? 72   LYS A O     1 
ATOM   532   C  CB    . LYS A  1  72   ? 83.730  -9.732  108.138 1.00 53.29  ? 72   LYS A CB    1 
ATOM   533   C  CG    . LYS A  1  72   ? 82.699  -10.717 107.631 1.00 56.18  ? 72   LYS A CG    1 
ATOM   534   C  CD    . LYS A  1  72   ? 82.108  -11.572 108.741 1.00 51.34  ? 72   LYS A CD    1 
ATOM   535   C  CE    . LYS A  1  72   ? 81.191  -12.638 108.150 1.00 54.42  ? 72   LYS A CE    1 
ATOM   536   N  NZ    . LYS A  1  72   ? 80.278  -13.278 109.135 1.00 54.76  ? 72   LYS A NZ    1 
ATOM   537   N  N     . GLU A  1  73   ? 82.578  -6.964  107.331 1.00 57.55  ? 73   GLU A N     1 
ATOM   538   C  CA    . GLU A  1  73   ? 81.421  -6.137  106.997 1.00 54.50  ? 73   GLU A CA    1 
ATOM   539   C  C     . GLU A  1  73   ? 81.748  -5.083  105.941 1.00 53.98  ? 73   GLU A C     1 
ATOM   540   O  O     . GLU A  1  73   ? 82.808  -4.466  105.982 1.00 55.86  ? 73   GLU A O     1 
ATOM   541   C  CB    . GLU A  1  73   ? 80.883  -5.443  108.257 1.00 51.32  ? 73   GLU A CB    1 
ATOM   542   C  CG    . GLU A  1  73   ? 80.125  -6.348  109.214 1.00 56.58  ? 73   GLU A CG    1 
ATOM   543   C  CD    . GLU A  1  73   ? 81.032  -7.151  110.133 1.00 63.12  ? 73   GLU A CD    1 
ATOM   544   O  OE1   . GLU A  1  73   ? 82.260  -6.937  110.092 1.00 60.02  ? 73   GLU A OE1   1 
ATOM   545   O  OE2   . GLU A  1  73   ? 80.513  -7.994  110.901 1.00 68.31  ? 73   GLU A OE2   1 
ATOM   546   N  N     . ASP A  1  74   ? 80.835  -4.886  104.994 1.00 54.84  ? 74   ASP A N     1 
ATOM   547   C  CA    . ASP A  1  74   ? 80.929  -3.769  104.056 1.00 55.08  ? 74   ASP A CA    1 
ATOM   548   C  C     . ASP A  1  74   ? 80.558  -2.480  104.781 1.00 53.76  ? 74   ASP A C     1 
ATOM   549   O  O     . ASP A  1  74   ? 79.931  -2.526  105.836 1.00 51.12  ? 74   ASP A O     1 
ATOM   550   C  CB    . ASP A  1  74   ? 80.024  -3.990  102.836 1.00 58.21  ? 74   ASP A CB    1 
ATOM   551   C  CG    . ASP A  1  74   ? 78.612  -4.410  103.215 1.00 68.57  ? 74   ASP A CG    1 
ATOM   552   O  OD1   . ASP A  1  74   ? 77.735  -3.526  103.313 1.00 75.09  ? 74   ASP A OD1   1 
ATOM   553   O  OD2   . ASP A  1  74   ? 78.377  -5.624  103.413 1.00 72.62  ? 74   ASP A OD2   1 
ATOM   554   N  N     . VAL A  1  75   ? 80.952  -1.337  104.226 1.00 51.29  ? 75   VAL A N     1 
ATOM   555   C  CA    . VAL A  1  75   ? 80.708  -0.046  104.873 1.00 50.90  ? 75   VAL A CA    1 
ATOM   556   C  C     . VAL A  1  75   ? 79.221  0.195   105.176 1.00 52.26  ? 75   VAL A C     1 
ATOM   557   O  O     . VAL A  1  75   ? 78.873  0.776   106.204 1.00 48.47  ? 75   VAL A O     1 
ATOM   558   C  CB    . VAL A  1  75   ? 81.296  1.118   104.046 1.00 42.36  ? 75   VAL A CB    1 
ATOM   559   C  CG1   . VAL A  1  75   ? 80.949  2.467   104.664 1.00 39.44  ? 75   VAL A CG1   1 
ATOM   560   C  CG2   . VAL A  1  75   ? 82.793  0.960   103.934 1.00 47.33  ? 75   VAL A CG2   1 
ATOM   561   N  N     . VAL A  1  76   ? 78.351  -0.276  104.288 1.00 55.19  ? 76   VAL A N     1 
ATOM   562   C  CA    . VAL A  1  76   ? 76.912  -0.146  104.485 1.00 53.47  ? 76   VAL A CA    1 
ATOM   563   C  C     . VAL A  1  76   ? 76.484  -0.830  105.779 1.00 55.44  ? 76   VAL A C     1 
ATOM   564   O  O     . VAL A  1  76   ? 75.743  -0.251  106.582 1.00 53.82  ? 76   VAL A O     1 
ATOM   565   C  CB    . VAL A  1  76   ? 76.117  -0.742  103.304 1.00 53.47  ? 76   VAL A CB    1 
ATOM   566   C  CG1   . VAL A  1  76   ? 74.626  -0.658  103.568 1.00 51.63  ? 76   VAL A CG1   1 
ATOM   567   C  CG2   . VAL A  1  76   ? 76.467  -0.024  102.015 1.00 53.91  ? 76   VAL A CG2   1 
ATOM   568   N  N     . GLU A  1  77   ? 76.965  -2.054  105.985 1.00 54.29  ? 77   GLU A N     1 
ATOM   569   C  CA    . GLU A  1  77   ? 76.639  -2.803  107.199 1.00 55.74  ? 77   GLU A CA    1 
ATOM   570   C  C     . GLU A  1  77   ? 77.251  -2.176  108.449 1.00 52.15  ? 77   GLU A C     1 
ATOM   571   O  O     . GLU A  1  77   ? 76.630  -2.159  109.508 1.00 54.94  ? 77   GLU A O     1 
ATOM   572   C  CB    . GLU A  1  77   ? 77.069  -4.267  107.083 1.00 56.37  ? 77   GLU A CB    1 
ATOM   573   C  CG    . GLU A  1  77   ? 76.736  -5.094  108.324 1.00 48.38  ? 77   GLU A CG    1 
ATOM   574   C  CD    . GLU A  1  77   ? 76.815  -6.596  108.073 1.00 65.04  ? 77   GLU A CD    1 
ATOM   575   O  OE1   . GLU A  1  77   ? 76.286  -7.359  108.914 1.00 59.15  ? 77   GLU A OE1   1 
ATOM   576   O  OE2   . GLU A  1  77   ? 77.400  -7.009  107.040 1.00 66.24  ? 77   GLU A OE2   1 
ATOM   577   N  N     . ILE A  1  78   ? 78.470  -1.661  108.321 1.00 54.20  ? 78   ILE A N     1 
ATOM   578   C  CA    . ILE A  1  78   ? 79.145  -1.001  109.433 1.00 52.06  ? 78   ILE A CA    1 
ATOM   579   C  C     . ILE A  1  78   ? 78.363  0.222   109.896 1.00 51.46  ? 78   ILE A C     1 
ATOM   580   O  O     . ILE A  1  78   ? 78.142  0.408   111.089 1.00 50.72  ? 78   ILE A O     1 
ATOM   581   C  CB    . ILE A  1  78   ? 80.583  -0.588  109.060 1.00 51.76  ? 78   ILE A CB    1 
ATOM   582   C  CG1   . ILE A  1  78   ? 81.463  -1.829  108.899 1.00 53.42  ? 78   ILE A CG1   1 
ATOM   583   C  CG2   . ILE A  1  78   ? 81.166  0.349   110.110 1.00 48.65  ? 78   ILE A CG2   1 
ATOM   584   C  CD1   . ILE A  1  78   ? 82.863  -1.521  108.427 1.00 52.67  ? 78   ILE A CD1   1 
ATOM   585   N  N     . ILE A  1  79   ? 77.940  1.047   108.944 1.00 51.08  ? 79   ILE A N     1 
ATOM   586   C  CA    . ILE A  1  79   ? 77.148  2.230   109.252 1.00 50.18  ? 79   ILE A CA    1 
ATOM   587   C  C     . ILE A  1  79   ? 75.787  1.827   109.818 1.00 53.09  ? 79   ILE A C     1 
ATOM   588   O  O     . ILE A  1  79   ? 75.255  2.475   110.729 1.00 54.10  ? 79   ILE A O     1 
ATOM   589   C  CB    . ILE A  1  79   ? 77.000  3.131   108.010 1.00 46.41  ? 79   ILE A CB    1 
ATOM   590   C  CG1   . ILE A  1  79   ? 78.350  3.764   107.674 1.00 44.91  ? 79   ILE A CG1   1 
ATOM   591   C  CG2   . ILE A  1  79   ? 75.971  4.218   108.243 1.00 45.72  ? 79   ILE A CG2   1 
ATOM   592   C  CD1   . ILE A  1  79   ? 78.329  4.618   106.443 1.00 50.67  ? 79   ILE A CD1   1 
ATOM   593   N  N     . LEU A  1  80   ? 75.243  0.734   109.292 1.00 51.62  ? 80   LEU A N     1 
ATOM   594   C  CA    . LEU A  1  80   ? 74.003  0.162   109.810 1.00 48.21  ? 80   LEU A CA    1 
ATOM   595   C  C     . LEU A  1  80   ? 74.154  -0.192  111.285 1.00 50.44  ? 80   LEU A C     1 
ATOM   596   O  O     . LEU A  1  80   ? 73.211  -0.051  112.062 1.00 51.66  ? 80   LEU A O     1 
ATOM   597   C  CB    . LEU A  1  80   ? 73.624  -1.088  109.015 1.00 45.14  ? 80   LEU A CB    1 
ATOM   598   C  CG    . LEU A  1  80   ? 72.190  -1.204  108.503 1.00 37.54  ? 80   LEU A CG    1 
ATOM   599   C  CD1   . LEU A  1  80   ? 71.755  0.081   107.823 1.00 38.81  ? 80   LEU A CD1   1 
ATOM   600   C  CD2   . LEU A  1  80   ? 72.092  -2.375  107.551 1.00 38.87  ? 80   LEU A CD2   1 
ATOM   601   N  N     . ASN A  1  81   ? 75.347  -0.654  111.657 1.00 53.00  ? 81   ASN A N     1 
ATOM   602   C  CA    . ASN A  1  81   ? 75.669  -0.964  113.049 1.00 51.59  ? 81   ASN A CA    1 
ATOM   603   C  C     . ASN A  1  81   ? 75.899  0.285   113.894 1.00 52.79  ? 81   ASN A C     1 
ATOM   604   O  O     . ASN A  1  81   ? 75.482  0.345   115.043 1.00 53.88  ? 81   ASN A O     1 
ATOM   605   C  CB    . ASN A  1  81   ? 76.883  -1.886  113.123 1.00 50.61  ? 81   ASN A CB    1 
ATOM   606   C  CG    . ASN A  1  81   ? 76.618  -3.242  112.498 1.00 52.20  ? 81   ASN A CG    1 
ATOM   607   O  OD1   . ASN A  1  81   ? 75.464  -3.632  112.309 1.00 50.05  ? 81   ASN A OD1   1 
ATOM   608   N  ND2   . ASN A  1  81   ? 77.685  -3.973  112.178 1.00 47.43  ? 81   ASN A ND2   1 
ATOM   609   N  N     . LEU A  1  82   ? 76.552  1.286   113.314 1.00 54.54  ? 82   LEU A N     1 
ATOM   610   C  CA    . LEU A  1  82   ? 76.772  2.563   113.984 1.00 52.48  ? 82   LEU A CA    1 
ATOM   611   C  C     . LEU A  1  82   ? 75.465  3.316   114.239 1.00 56.94  ? 82   LEU A C     1 
ATOM   612   O  O     . LEU A  1  82   ? 75.402  4.192   115.101 1.00 61.59  ? 82   LEU A O     1 
ATOM   613   C  CB    . LEU A  1  82   ? 77.723  3.434   113.166 1.00 51.22  ? 82   LEU A CB    1 
ATOM   614   C  CG    . LEU A  1  82   ? 79.145  2.892   113.058 1.00 55.35  ? 82   LEU A CG    1 
ATOM   615   C  CD1   . LEU A  1  82   ? 79.907  3.570   111.925 1.00 57.32  ? 82   LEU A CD1   1 
ATOM   616   C  CD2   . LEU A  1  82   ? 79.862  3.077   114.382 1.00 55.05  ? 82   LEU A CD2   1 
ATOM   617   N  N     . LYS A  1  83   ? 74.423  2.984   113.487 1.00 56.01  ? 83   LYS A N     1 
ATOM   618   C  CA    . LYS A  1  83   ? 73.114  3.580   113.737 1.00 62.15  ? 83   LYS A CA    1 
ATOM   619   C  C     . LYS A  1  83   ? 72.484  3.041   115.027 1.00 59.71  ? 83   LYS A C     1 
ATOM   620   O  O     . LYS A  1  83   ? 71.500  3.591   115.526 1.00 64.22  ? 83   LYS A O     1 
ATOM   621   C  CB    . LYS A  1  83   ? 72.179  3.364   112.541 1.00 57.24  ? 83   LYS A CB    1 
ATOM   622   C  CG    . LYS A  1  83   ? 72.384  4.362   111.422 1.00 52.45  ? 83   LYS A CG    1 
ATOM   623   C  CD    . LYS A  1  83   ? 71.514  4.043   110.221 1.00 63.41  ? 83   LYS A CD    1 
ATOM   624   C  CE    . LYS A  1  83   ? 70.033  4.189   110.543 1.00 63.63  ? 83   LYS A CE    1 
ATOM   625   N  NZ    . LYS A  1  83   ? 69.185  3.966   109.335 1.00 63.59  ? 83   LYS A NZ    1 
ATOM   626   N  N     . GLU A  1  84   ? 73.056  1.966   115.560 1.00 53.62  ? 84   GLU A N     1 
ATOM   627   C  CA    . GLU A  1  84   ? 72.546  1.358   116.782 1.00 61.56  ? 84   GLU A CA    1 
ATOM   628   C  C     . GLU A  1  84   ? 73.259  1.882   118.029 1.00 61.80  ? 84   GLU A C     1 
ATOM   629   O  O     . GLU A  1  84   ? 72.905  1.533   119.153 1.00 63.26  ? 84   GLU A O     1 
ATOM   630   C  CB    . GLU A  1  84   ? 72.656  -0.167  116.704 1.00 59.05  ? 84   GLU A CB    1 
ATOM   631   C  CG    . GLU A  1  84   ? 71.825  -0.779  115.598 1.00 68.87  ? 84   GLU A CG    1 
ATOM   632   C  CD    . GLU A  1  84   ? 70.359  -0.383  115.682 1.00 86.74  ? 84   GLU A CD    1 
ATOM   633   O  OE1   . GLU A  1  84   ? 69.822  -0.317  116.811 1.00 89.07  ? 84   GLU A OE1   1 
ATOM   634   O  OE2   . GLU A  1  84   ? 69.746  -0.132  114.620 1.00 90.14  ? 84   GLU A OE2   1 
ATOM   635   N  N     . LEU A  1  85   ? 74.252  2.734   117.820 1.00 56.57  ? 85   LEU A N     1 
ATOM   636   C  CA    . LEU A  1  85   ? 75.064  3.255   118.906 1.00 56.63  ? 85   LEU A CA    1 
ATOM   637   C  C     . LEU A  1  85   ? 74.287  4.243   119.777 1.00 58.09  ? 85   LEU A C     1 
ATOM   638   O  O     . LEU A  1  85   ? 73.738  5.225   119.278 1.00 55.57  ? 85   LEU A O     1 
ATOM   639   C  CB    . LEU A  1  85   ? 76.305  3.931   118.326 1.00 58.58  ? 85   LEU A CB    1 
ATOM   640   C  CG    . LEU A  1  85   ? 77.393  4.393   119.290 1.00 52.53  ? 85   LEU A CG    1 
ATOM   641   C  CD1   . LEU A  1  85   ? 78.098  3.198   119.895 1.00 52.66  ? 85   LEU A CD1   1 
ATOM   642   C  CD2   . LEU A  1  85   ? 78.374  5.290   118.565 1.00 60.48  ? 85   LEU A CD2   1 
ATOM   643   N  N     . VAL A  1  86   ? 74.248  3.979   121.082 1.00 60.25  ? 86   VAL A N     1 
ATOM   644   C  CA    . VAL A  1  86   ? 73.571  4.869   122.023 1.00 58.18  ? 86   VAL A CA    1 
ATOM   645   C  C     . VAL A  1  86   ? 74.587  5.695   122.802 1.00 57.60  ? 86   VAL A C     1 
ATOM   646   O  O     . VAL A  1  86   ? 75.394  5.151   123.551 1.00 58.18  ? 86   VAL A O     1 
ATOM   647   C  CB    . VAL A  1  86   ? 72.720  4.088   123.024 1.00 55.02  ? 86   VAL A CB    1 
ATOM   648   C  CG1   . VAL A  1  86   ? 71.907  5.050   123.874 1.00 64.63  ? 86   VAL A CG1   1 
ATOM   649   C  CG2   . VAL A  1  86   ? 71.812  3.112   122.303 1.00 53.25  ? 86   VAL A CG2   1 
ATOM   650   N  N     . VAL A  1  87   ? 74.546  7.010   122.627 1.00 56.82  ? 87   VAL A N     1 
ATOM   651   C  CA    . VAL A  1  87   ? 75.571  7.872   123.202 1.00 58.56  ? 87   VAL A CA    1 
ATOM   652   C  C     . VAL A  1  87   ? 74.969  8.954   124.079 1.00 64.78  ? 87   VAL A C     1 
ATOM   653   O  O     . VAL A  1  87   ? 74.261  9.837   123.594 1.00 63.32  ? 87   VAL A O     1 
ATOM   654   C  CB    . VAL A  1  87   ? 76.417  8.556   122.111 1.00 66.02  ? 87   VAL A CB    1 
ATOM   655   C  CG1   . VAL A  1  87   ? 77.427  9.500   122.744 1.00 63.67  ? 87   VAL A CG1   1 
ATOM   656   C  CG2   . VAL A  1  87   ? 77.108  7.522   121.240 1.00 63.16  ? 87   VAL A CG2   1 
ATOM   657   N  N     . ARG A  1  88   ? 75.278  8.887   125.369 1.00 70.23  ? 88   ARG A N     1 
ATOM   658   C  CA    . ARG A  1  88   ? 74.754  9.821   126.353 1.00 64.50  ? 88   ARG A CA    1 
ATOM   659   C  C     . ARG A  1  88   ? 75.717  10.972  126.595 1.00 64.18  ? 88   ARG A C     1 
ATOM   660   O  O     . ARG A  1  88   ? 76.897  10.755  126.872 1.00 66.22  ? 88   ARG A O     1 
ATOM   661   C  CB    . ARG A  1  88   ? 74.496  9.088   127.664 1.00 66.97  ? 88   ARG A CB    1 
ATOM   662   C  CG    . ARG A  1  88   ? 74.045  9.984   128.796 1.00 72.39  ? 88   ARG A CG    1 
ATOM   663   C  CD    . ARG A  1  88   ? 74.064  9.228   130.108 1.00 71.47  ? 88   ARG A CD    1 
ATOM   664   N  NE    . ARG A  1  88   ? 73.583  10.048  131.214 1.00 80.85  ? 88   ARG A NE    1 
ATOM   665   C  CZ    . ARG A  1  88   ? 73.626  9.677   132.489 1.00 76.49  ? 88   ARG A CZ    1 
ATOM   666   N  NH1   . ARG A  1  88   ? 74.136  8.498   132.825 1.00 70.49  ? 88   ARG A NH1   1 
ATOM   667   N  NH2   . ARG A  1  88   ? 73.164  10.491  133.427 1.00 78.34  ? 88   ARG A NH2   1 
ATOM   668   N  N     . PHE A  1  89   ? 75.209  12.195  126.482 1.00 64.97  ? 89   PHE A N     1 
ATOM   669   C  CA    . PHE A  1  89   ? 75.991  13.382  126.800 1.00 67.87  ? 89   PHE A CA    1 
ATOM   670   C  C     . PHE A  1  89   ? 75.686  13.811  128.229 1.00 80.85  ? 89   PHE A C     1 
ATOM   671   O  O     . PHE A  1  89   ? 74.546  14.155  128.546 1.00 82.36  ? 89   PHE A O     1 
ATOM   672   C  CB    . PHE A  1  89   ? 75.660  14.540  125.856 1.00 68.75  ? 89   PHE A CB    1 
ATOM   673   C  CG    . PHE A  1  89   ? 76.083  14.317  124.433 1.00 76.55  ? 89   PHE A CG    1 
ATOM   674   C  CD1   . PHE A  1  89   ? 76.792  13.182  124.064 1.00 76.29  ? 89   PHE A CD1   1 
ATOM   675   C  CD2   . PHE A  1  89   ? 75.774  15.254  123.458 1.00 80.71  ? 89   PHE A CD2   1 
ATOM   676   C  CE1   . PHE A  1  89   ? 77.177  12.985  122.746 1.00 72.48  ? 89   PHE A CE1   1 
ATOM   677   C  CE2   . PHE A  1  89   ? 76.160  15.066  122.139 1.00 77.11  ? 89   PHE A CE2   1 
ATOM   678   C  CZ    . PHE A  1  89   ? 76.861  13.930  121.782 1.00 71.55  ? 89   PHE A CZ    1 
ATOM   679   N  N     . LEU A  1  90   ? 76.703  13.792  129.086 1.00 81.98  ? 90   LEU A N     1 
ATOM   680   C  CA    . LEU A  1  90   ? 76.537  14.187  130.482 1.00 75.18  ? 90   LEU A CA    1 
ATOM   681   C  C     . LEU A  1  90   ? 76.374  15.701  130.625 1.00 74.53  ? 90   LEU A C     1 
ATOM   682   O  O     . LEU A  1  90   ? 75.559  16.174  131.415 1.00 70.38  ? 90   LEU A O     1 
ATOM   683   C  CB    . LEU A  1  90   ? 77.706  13.685  131.336 1.00 72.48  ? 90   LEU A CB    1 
ATOM   684   C  CG    . LEU A  1  90   ? 77.728  12.199  131.713 1.00 67.91  ? 90   LEU A CG    1 
ATOM   685   C  CD1   . LEU A  1  90   ? 76.345  11.744  132.122 1.00 66.10  ? 90   LEU A CD1   1 
ATOM   686   C  CD2   . LEU A  1  90   ? 78.253  11.329  130.584 1.00 73.89  ? 90   LEU A CD2   1 
ATOM   687   N  N     . ASN A  1  91   ? 77.147  16.457  129.854 1.00 81.16  ? 91   ASN A N     1 
ATOM   688   C  CA    . ASN A  1  91   ? 77.035  17.909  129.854 1.00 86.61  ? 91   ASN A CA    1 
ATOM   689   C  C     . ASN A  1  91   ? 75.957  18.390  128.880 1.00 91.42  ? 91   ASN A C     1 
ATOM   690   O  O     . ASN A  1  91   ? 76.067  18.188  127.673 1.00 91.03  ? 91   ASN A O     1 
ATOM   691   C  CB    . ASN A  1  91   ? 78.387  18.543  129.516 1.00 92.65  ? 91   ASN A CB    1 
ATOM   692   C  CG    . ASN A  1  91   ? 78.357  20.060  129.576 1.00 99.46  ? 91   ASN A CG    1 
ATOM   693   O  OD1   . ASN A  1  91   ? 77.406  20.659  130.079 1.00 101.39 ? 91   ASN A OD1   1 
ATOM   694   N  ND2   . ASN A  1  91   ? 79.412  20.690  129.068 1.00 107.12 ? 91   ASN A ND2   1 
ATOM   695   N  N     . PRO A  1  92   ? 74.905  19.030  129.412 1.00 93.08  ? 92   PRO A N     1 
ATOM   696   C  CA    . PRO A  1  92   ? 73.770  19.522  128.623 1.00 91.57  ? 92   PRO A CA    1 
ATOM   697   C  C     . PRO A  1  92   ? 74.149  20.597  127.611 1.00 89.17  ? 92   PRO A C     1 
ATOM   698   O  O     . PRO A  1  92   ? 73.391  20.840  126.677 1.00 97.68  ? 92   PRO A O     1 
ATOM   699   C  CB    . PRO A  1  92   ? 72.844  20.124  129.685 1.00 90.84  ? 92   PRO A CB    1 
ATOM   700   C  CG    . PRO A  1  92   ? 73.193  19.406  130.938 1.00 90.23  ? 92   PRO A CG    1 
ATOM   701   C  CD    . PRO A  1  92   ? 74.675  19.194  130.857 1.00 89.96  ? 92   PRO A CD    1 
ATOM   702   N  N     . SER A  1  93   ? 75.298  21.235  127.793 1.00 90.65  ? 93   SER A N     1 
ATOM   703   C  CA    . SER A  1  93   ? 75.713  22.301  126.890 1.00 94.54  ? 93   SER A CA    1 
ATOM   704   C  C     . SER A  1  93   ? 76.386  21.737  125.643 1.00 94.72  ? 93   SER A C     1 
ATOM   705   O  O     . SER A  1  93   ? 76.669  22.466  124.693 1.00 89.32  ? 93   SER A O     1 
ATOM   706   C  CB    . SER A  1  93   ? 76.663  23.263  127.606 1.00 96.75  ? 93   SER A CB    1 
ATOM   707   O  OG    . SER A  1  93   ? 76.077  23.768  128.793 1.00 101.27 ? 93   SER A OG    1 
ATOM   708   N  N     . LEU A  1  94   ? 76.620  20.429  125.646 1.00 94.25  ? 94   LEU A N     1 
ATOM   709   C  CA    . LEU A  1  94   ? 77.401  19.779  124.600 1.00 90.63  ? 94   LEU A CA    1 
ATOM   710   C  C     . LEU A  1  94   ? 76.513  19.258  123.475 1.00 86.71  ? 94   LEU A C     1 
ATOM   711   O  O     . LEU A  1  94   ? 75.756  18.309  123.664 1.00 88.81  ? 94   LEU A O     1 
ATOM   712   C  CB    . LEU A  1  94   ? 78.174  18.613  125.214 1.00 85.51  ? 94   LEU A CB    1 
ATOM   713   C  CG    . LEU A  1  94   ? 78.997  17.752  124.267 1.00 76.23  ? 94   LEU A CG    1 
ATOM   714   C  CD1   . LEU A  1  94   ? 80.111  18.585  123.666 1.00 73.24  ? 94   LEU A CD1   1 
ATOM   715   C  CD2   . LEU A  1  94   ? 79.548  16.556  125.017 1.00 74.20  ? 94   LEU A CD2   1 
ATOM   716   N  N     . GLN A  1  95   ? 76.595  19.888  122.307 1.00 82.65  ? 95   GLN A N     1 
ATOM   717   C  CA    . GLN A  1  95   ? 75.761  19.479  121.181 1.00 83.93  ? 95   GLN A CA    1 
ATOM   718   C  C     . GLN A  1  95   ? 76.396  18.531  120.154 1.00 77.05  ? 95   GLN A C     1 
ATOM   719   O  O     . GLN A  1  95   ? 75.690  17.965  119.319 1.00 81.51  ? 95   GLN A O     1 
ATOM   720   C  CB    . GLN A  1  95   ? 75.162  20.710  120.497 1.00 85.10  ? 95   GLN A CB    1 
ATOM   721   C  CG    . GLN A  1  95   ? 74.209  21.479  121.402 1.00 98.27  ? 95   GLN A CG    1 
ATOM   722   C  CD    . GLN A  1  95   ? 73.675  22.744  120.762 1.00 116.83 ? 95   GLN A CD    1 
ATOM   723   O  OE1   . GLN A  1  95   ? 73.532  22.823  119.542 1.00 132.64 ? 95   GLN A OE1   1 
ATOM   724   N  NE2   . GLN A  1  95   ? 73.381  23.746  121.584 1.00 105.36 ? 95   GLN A NE2   1 
ATOM   725   N  N     . THR A  1  96   ? 77.710  18.342  120.214 1.00 80.42  ? 96   THR A N     1 
ATOM   726   C  CA    . THR A  1  96   ? 78.377  17.467  119.245 1.00 73.18  ? 96   THR A CA    1 
ATOM   727   C  C     . THR A  1  96   ? 79.656  16.812  119.765 1.00 67.15  ? 96   THR A C     1 
ATOM   728   O  O     . THR A  1  96   ? 80.437  17.431  120.485 1.00 69.28  ? 96   THR A O     1 
ATOM   729   C  CB    . THR A  1  96   ? 78.692  18.212  117.928 1.00 73.26  ? 96   THR A CB    1 
ATOM   730   O  OG1   . THR A  1  96   ? 79.440  17.352  117.058 1.00 71.75  ? 96   THR A OG1   1 
ATOM   731   C  CG2   . THR A  1  96   ? 79.497  19.475  118.203 1.00 72.77  ? 96   THR A CG2   1 
ATOM   732   N  N     . VAL A  1  97   ? 79.875  15.561  119.374 1.00 67.67  ? 97   VAL A N     1 
ATOM   733   C  CA    . VAL A  1  97   ? 81.073  14.827  119.775 1.00 66.55  ? 97   VAL A CA    1 
ATOM   734   C  C     . VAL A  1  97   ? 81.602  14.023  118.596 1.00 67.13  ? 97   VAL A C     1 
ATOM   735   O  O     . VAL A  1  97   ? 80.823  13.466  117.829 1.00 69.94  ? 97   VAL A O     1 
ATOM   736   C  CB    . VAL A  1  97   ? 80.773  13.849  120.933 1.00 60.45  ? 97   VAL A CB    1 
ATOM   737   C  CG1   . VAL A  1  97   ? 81.989  13.019  121.269 1.00 61.14  ? 97   VAL A CG1   1 
ATOM   738   C  CG2   . VAL A  1  97   ? 80.318  14.602  122.156 1.00 72.92  ? 97   VAL A CG2   1 
ATOM   739   N  N     . THR A  1  98   ? 82.919  13.968  118.438 1.00 66.82  ? 98   THR A N     1 
ATOM   740   C  CA    . THR A  1  98   ? 83.502  13.065  117.457 1.00 64.57  ? 98   THR A CA    1 
ATOM   741   C  C     . THR A  1  98   ? 84.257  11.930  118.139 1.00 62.69  ? 98   THR A C     1 
ATOM   742   O  O     . THR A  1  98   ? 85.316  12.140  118.725 1.00 67.74  ? 98   THR A O     1 
ATOM   743   C  CB    . THR A  1  98   ? 84.440  13.794  116.484 1.00 66.12  ? 98   THR A CB    1 
ATOM   744   O  OG1   . THR A  1  98   ? 83.708  14.806  115.780 1.00 70.21  ? 98   THR A OG1   1 
ATOM   745   C  CG2   . THR A  1  98   ? 85.027  12.807  115.484 1.00 64.74  ? 98   THR A CG2   1 
ATOM   746   N  N     . LEU A  1  99   ? 83.699  10.727  118.056 1.00 63.71  ? 99   LEU A N     1 
ATOM   747   C  CA    . LEU A  1  99   ? 84.337  9.531   118.592 1.00 62.37  ? 99   LEU A CA    1 
ATOM   748   C  C     . LEU A  1  99   ? 85.406  9.015   117.630 1.00 63.20  ? 99   LEU A C     1 
ATOM   749   O  O     . LEU A  1  99   ? 85.213  9.008   116.416 1.00 58.60  ? 99   LEU A O     1 
ATOM   750   C  CB    . LEU A  1  99   ? 83.299  8.433   118.844 1.00 58.40  ? 99   LEU A CB    1 
ATOM   751   C  CG    . LEU A  1  99   ? 82.521  8.424   120.164 1.00 65.20  ? 99   LEU A CG    1 
ATOM   752   C  CD1   . LEU A  1  99   ? 81.667  9.662   120.323 1.00 58.78  ? 99   LEU A CD1   1 
ATOM   753   C  CD2   . LEU A  1  99   ? 81.659  7.174   120.256 1.00 66.80  ? 99   LEU A CD2   1 
ATOM   754   N  N     . LEU A  1  100  ? 86.534  8.580   118.178 1.00 69.80  ? 100  LEU A N     1 
ATOM   755   C  CA    . LEU A  1  100  ? 87.611  8.030   117.366 1.00 57.49  ? 100  LEU A CA    1 
ATOM   756   C  C     . LEU A  1  100  ? 87.817  6.557   117.678 1.00 60.27  ? 100  LEU A C     1 
ATOM   757   O  O     . LEU A  1  100  ? 87.728  6.138   118.829 1.00 66.95  ? 100  LEU A O     1 
ATOM   758   C  CB    . LEU A  1  100  ? 88.901  8.816   117.588 1.00 49.65  ? 100  LEU A CB    1 
ATOM   759   C  CG    . LEU A  1  100  ? 88.803  10.272  117.123 1.00 58.10  ? 100  LEU A CG    1 
ATOM   760   C  CD1   . LEU A  1  100  ? 89.092  11.230  118.260 1.00 52.50  ? 100  LEU A CD1   1 
ATOM   761   C  CD2   . LEU A  1  100  ? 89.735  10.530  115.947 1.00 77.01  ? 100  LEU A CD2   1 
ATOM   762   N  N     . LEU A  1  101  ? 88.075  5.769   116.643 1.00 62.88  ? 101  LEU A N     1 
ATOM   763   C  CA    . LEU A  1  101  ? 88.309  4.345   116.818 1.00 60.45  ? 101  LEU A CA    1 
ATOM   764   C  C     . LEU A  1  101  ? 89.483  3.917   115.959 1.00 65.80  ? 101  LEU A C     1 
ATOM   765   O  O     . LEU A  1  101  ? 89.547  4.249   114.780 1.00 69.55  ? 101  LEU A O     1 
ATOM   766   C  CB    . LEU A  1  101  ? 87.061  3.548   116.439 1.00 58.50  ? 101  LEU A CB    1 
ATOM   767   C  CG    . LEU A  1  101  ? 87.027  2.055   116.777 1.00 66.51  ? 101  LEU A CG    1 
ATOM   768   C  CD1   . LEU A  1  101  ? 85.603  1.629   117.108 1.00 73.01  ? 101  LEU A CD1   1 
ATOM   769   C  CD2   . LEU A  1  101  ? 87.573  1.205   115.639 1.00 61.44  ? 101  LEU A CD2   1 
ATOM   770   N  N     . LYS A  1  102  ? 90.423  3.199   116.560 1.00 66.99  ? 102  LYS A N     1 
ATOM   771   C  CA    . LYS A  1  102  ? 91.508  2.578   115.814 1.00 65.04  ? 102  LYS A CA    1 
ATOM   772   C  C     . LYS A  1  102  ? 91.659  1.148   116.297 1.00 66.19  ? 102  LYS A C     1 
ATOM   773   O  O     . LYS A  1  102  ? 91.876  0.905   117.483 1.00 80.77  ? 102  LYS A O     1 
ATOM   774   C  CB    . LYS A  1  102  ? 92.823  3.339   115.997 1.00 67.98  ? 102  LYS A CB    1 
ATOM   775   C  CG    . LYS A  1  102  ? 92.840  4.733   115.384 1.00 78.13  ? 102  LYS A CG    1 
ATOM   776   C  CD    . LYS A  1  102  ? 94.268  5.259   115.249 1.00 88.98  ? 102  LYS A CD    1 
ATOM   777   C  CE    . LYS A  1  102  ? 94.304  6.643   114.607 1.00 99.60  ? 102  LYS A CE    1 
ATOM   778   N  NZ    . LYS A  1  102  ? 93.544  7.656   115.402 1.00 92.07  ? 102  LYS A NZ    1 
ATOM   779   N  N     . ALA A  1  103  ? 91.526  0.202   115.378 1.00 65.47  ? 103  ALA A N     1 
ATOM   780   C  CA    . ALA A  1  103  ? 91.602  -1.207  115.728 1.00 64.84  ? 103  ALA A CA    1 
ATOM   781   C  C     . ALA A  1  103  ? 92.301  -1.988  114.634 1.00 71.06  ? 103  ALA A C     1 
ATOM   782   O  O     . ALA A  1  103  ? 92.273  -1.595  113.465 1.00 77.55  ? 103  ALA A O     1 
ATOM   783   C  CB    . ALA A  1  103  ? 90.211  -1.765  115.968 1.00 65.42  ? 103  ALA A CB    1 
ATOM   784   N  N     . GLU A  1  104  ? 92.942  -3.088  115.017 1.00 68.92  ? 104  GLU A N     1 
ATOM   785   C  CA    . GLU A  1  104  ? 93.539  -3.994  114.044 1.00 73.47  ? 104  GLU A CA    1 
ATOM   786   C  C     . GLU A  1  104  ? 93.558  -5.437  114.526 1.00 67.09  ? 104  GLU A C     1 
ATOM   787   O  O     . GLU A  1  104  ? 92.976  -5.766  115.562 1.00 71.17  ? 104  GLU A O     1 
ATOM   788   C  CB    . GLU A  1  104  ? 94.952  -3.547  113.650 1.00 87.84  ? 104  GLU A CB    1 
ATOM   789   C  CG    . GLU A  1  104  ? 95.559  -2.456  114.517 1.00 90.53  ? 104  GLU A CG    1 
ATOM   790   C  CD    . GLU A  1  104  ? 96.990  -2.142  114.126 1.00 108.83 ? 104  GLU A CD    1 
ATOM   791   O  OE1   . GLU A  1  104  ? 97.903  -2.465  114.914 1.00 118.49 ? 104  GLU A OE1   1 
ATOM   792   O  OE2   . GLU A  1  104  ? 97.202  -1.578  113.031 1.00 112.08 ? 104  GLU A OE2   1 
ATOM   793   N  N     . GLY A  1  105  ? 94.209  -6.295  113.746 1.00 66.16  ? 105  GLY A N     1 
ATOM   794   C  CA    . GLY A  1  105  ? 94.444  -7.677  114.123 1.00 65.75  ? 105  GLY A CA    1 
ATOM   795   C  C     . GLY A  1  105  ? 93.164  -8.474  114.209 1.00 71.63  ? 105  GLY A C     1 
ATOM   796   O  O     . GLY A  1  105  ? 92.087  -7.937  113.969 1.00 78.21  ? 105  GLY A O     1 
ATOM   797   N  N     . PRO A  1  106  ? 93.274  -9.762  114.562 1.00 73.47  ? 106  PRO A N     1 
ATOM   798   C  CA    . PRO A  1  106  ? 92.106  -10.645 114.678 1.00 77.28  ? 106  PRO A CA    1 
ATOM   799   C  C     . PRO A  1  106  ? 91.214  -10.282 115.858 1.00 75.54  ? 106  PRO A C     1 
ATOM   800   O  O     . PRO A  1  106  ? 91.206  -11.010 116.849 1.00 92.19  ? 106  PRO A O     1 
ATOM   801   C  CB    . PRO A  1  106  ? 92.728  -12.028 114.913 1.00 72.88  ? 106  PRO A CB    1 
ATOM   802   C  CG    . PRO A  1  106  ? 94.121  -11.916 114.408 1.00 80.51  ? 106  PRO A CG    1 
ATOM   803   C  CD    . PRO A  1  106  ? 94.539  -10.502 114.672 1.00 71.47  ? 106  PRO A CD    1 
ATOM   804   N  N     . LYS A  1  107  ? 90.471  -9.185  115.752 1.00 67.99  ? 107  LYS A N     1 
ATOM   805   C  CA    . LYS A  1  107  ? 89.566  -8.784  116.825 1.00 77.32  ? 107  LYS A CA    1 
ATOM   806   C  C     . LYS A  1  107  ? 88.154  -8.468  116.336 1.00 71.32  ? 107  LYS A C     1 
ATOM   807   O  O     . LYS A  1  107  ? 87.950  -8.071  115.193 1.00 70.60  ? 107  LYS A O     1 
ATOM   808   C  CB    . LYS A  1  107  ? 90.131  -7.582  117.585 1.00 78.11  ? 107  LYS A CB    1 
ATOM   809   C  CG    . LYS A  1  107  ? 89.703  -6.229  117.046 1.00 70.09  ? 107  LYS A CG    1 
ATOM   810   C  CD    . LYS A  1  107  ? 89.963  -5.145  118.080 1.00 71.93  ? 107  LYS A CD    1 
ATOM   811   C  CE    . LYS A  1  107  ? 89.292  -5.489  119.401 1.00 71.92  ? 107  LYS A CE    1 
ATOM   812   N  NZ    . LYS A  1  107  ? 89.727  -4.589  120.501 1.00 82.23  ? 107  LYS A NZ    1 
ATOM   813   N  N     . GLU A  1  108  ? 87.176  -8.645  117.215 1.00 70.97  ? 108  GLU A N     1 
ATOM   814   C  CA    . GLU A  1  108  ? 85.824  -8.222  116.907 1.00 68.15  ? 108  GLU A CA    1 
ATOM   815   C  C     . GLU A  1  108  ? 85.561  -6.912  117.620 1.00 64.72  ? 108  GLU A C     1 
ATOM   816   O  O     . GLU A  1  108  ? 85.357  -6.889  118.830 1.00 68.62  ? 108  GLU A O     1 
ATOM   817   C  CB    . GLU A  1  108  ? 84.826  -9.269  117.382 1.00 67.00  ? 108  GLU A CB    1 
ATOM   818   C  CG    . GLU A  1  108  ? 85.026  -10.624 116.750 1.00 75.78  ? 108  GLU A CG    1 
ATOM   819   C  CD    . GLU A  1  108  ? 84.046  -11.644 117.277 1.00 88.79  ? 108  GLU A CD    1 
ATOM   820   O  OE1   . GLU A  1  108  ? 83.217  -11.280 118.139 1.00 89.67  ? 108  GLU A OE1   1 
ATOM   821   O  OE2   . GLU A  1  108  ? 84.104  -12.809 116.831 1.00 109.20 ? 108  GLU A OE2   1 
ATOM   822   N  N     . VAL A  1  109  ? 85.531  -5.827  116.855 1.00 60.88  ? 109  VAL A N     1 
ATOM   823   C  CA    . VAL A  1  109  ? 85.396  -4.490  117.414 1.00 60.51  ? 109  VAL A CA    1 
ATOM   824   C  C     . VAL A  1  109  ? 84.002  -4.258  117.986 1.00 64.01  ? 109  VAL A C     1 
ATOM   825   O  O     . VAL A  1  109  ? 83.000  -4.500  117.316 1.00 66.03  ? 109  VAL A O     1 
ATOM   826   C  CB    . VAL A  1  109  ? 85.688  -3.419  116.354 1.00 53.54  ? 109  VAL A CB    1 
ATOM   827   C  CG1   . VAL A  1  109  ? 85.713  -2.036  116.986 1.00 55.94  ? 109  VAL A CG1   1 
ATOM   828   C  CG2   . VAL A  1  109  ? 87.002  -3.718  115.669 1.00 51.62  ? 109  VAL A CG2   1 
ATOM   829   N  N     . LYS A  1  110  ? 83.946  -3.801  119.232 1.00 63.44  ? 110  LYS A N     1 
ATOM   830   C  CA    . LYS A  1  110  ? 82.682  -3.436  119.850 1.00 62.65  ? 110  LYS A CA    1 
ATOM   831   C  C     . LYS A  1  110  ? 82.680  -1.935  120.098 1.00 65.98  ? 110  LYS A C     1 
ATOM   832   O  O     . LYS A  1  110  ? 83.667  -1.254  119.816 1.00 62.67  ? 110  LYS A O     1 
ATOM   833   C  CB    . LYS A  1  110  ? 82.473  -4.194  121.159 1.00 61.16  ? 110  LYS A CB    1 
ATOM   834   C  CG    . LYS A  1  110  ? 82.780  -5.676  121.068 1.00 60.97  ? 110  LYS A CG    1 
ATOM   835   C  CD    . LYS A  1  110  ? 81.803  -6.414  120.175 1.00 61.77  ? 110  LYS A CD    1 
ATOM   836   C  CE    . LYS A  1  110  ? 82.145  -7.897  120.120 1.00 66.42  ? 110  LYS A CE    1 
ATOM   837   N  NZ    . LYS A  1  110  ? 81.185  -8.686  119.299 1.00 68.47  ? 110  LYS A NZ    1 
ATOM   838   N  N     . ALA A  1  111  ? 81.608  -1.427  120.669 1.00 65.33  ? 111  ALA A N     1 
ATOM   839   C  CA    . ALA A  1  111  ? 81.508  -0.016  120.965 1.00 61.85  ? 111  ALA A CA    1 
ATOM   840   C  C     . ALA A  1  111  ? 82.467  0.389   122.061 1.00 72.86  ? 111  ALA A C     1 
ATOM   841   O  O     . ALA A  1  111  ? 82.764  1.555   122.224 1.00 73.03  ? 111  ALA A O     1 
ATOM   842   C  CB    . ALA A  1  111  ? 80.092  0.347   121.327 1.00 67.22  ? 111  ALA A CB    1 
ATOM   843   N  N     . ARG A  1  112  ? 82.950  -0.593  122.809 1.00 77.37  ? 112  ARG A N     1 
ATOM   844   C  CA    . ARG A  1  112  ? 83.849  -0.372  123.930 1.00 68.92  ? 112  ARG A CA    1 
ATOM   845   C  C     . ARG A  1  112  ? 85.057  0.315   123.392 1.00 73.89  ? 112  ARG A C     1 
ATOM   846   O  O     . ARG A  1  112  ? 85.627  1.187   124.018 1.00 74.92  ? 112  ARG A O     1 
ATOM   847   C  CB    . ARG A  1  112  ? 84.369  -1.707  124.438 1.00 66.26  ? 112  ARG A CB    1 
ATOM   848   C  CG    . ARG A  1  112  ? 83.530  -2.430  125.458 1.00 68.57  ? 112  ARG A CG    1 
ATOM   849   C  CD    . ARG A  1  112  ? 83.807  -3.920  125.395 1.00 65.07  ? 112  ARG A CD    1 
ATOM   850   N  NE    . ARG A  1  112  ? 82.681  -4.673  125.914 1.00 77.20  ? 112  ARG A NE    1 
ATOM   851   C  CZ    . ARG A  1  112  ? 81.984  -4.300  126.976 1.00 89.71  ? 112  ARG A CZ    1 
ATOM   852   N  NH1   . ARG A  1  112  ? 80.963  -5.023  127.396 1.00 93.85  ? 112  ARG A NH1   1 
ATOM   853   N  NH2   . ARG A  1  112  ? 82.314  -3.197  127.621 1.00 81.23  ? 112  ARG A NH2   1 
ATOM   854   N  N     . ASP A  1  113  ? 85.450  -0.109  122.209 1.00 73.86  ? 113  ASP A N     1 
ATOM   855   C  CA    . ASP A  1  113  ? 86.735  0.207   121.639 1.00 69.46  ? 113  ASP A CA    1 
ATOM   856   C  C     . ASP A  1  113  ? 86.877  1.653   121.242 1.00 69.46  ? 113  ASP A C     1 
ATOM   857   O  O     . ASP A  1  113  ? 87.953  2.105   120.911 1.00 65.84  ? 113  ASP A O     1 
ATOM   858   C  CB    . ASP A  1  113  ? 87.028  -0.736  120.500 1.00 65.44  ? 113  ASP A CB    1 
ATOM   859   C  CG    . ASP A  1  113  ? 86.996  -2.163  120.944 1.00 70.51  ? 113  ASP A CG    1 
ATOM   860   O  OD1   . ASP A  1  113  ? 87.343  -2.419  122.099 1.00 75.46  ? 113  ASP A OD1   1 
ATOM   861   O  OD2   . ASP A  1  113  ? 86.616  -3.034  120.163 1.00 70.44  ? 113  ASP A OD2   1 
ATOM   862   N  N     . PHE A  1  114  ? 85.782  2.382   121.243 1.00 70.82  ? 114  PHE A N     1 
ATOM   863   C  CA    . PHE A  1  114  ? 85.899  3.810   121.001 1.00 72.46  ? 114  PHE A CA    1 
ATOM   864   C  C     . PHE A  1  114  ? 86.750  4.450   122.084 1.00 70.93  ? 114  PHE A C     1 
ATOM   865   O  O     . PHE A  1  114  ? 86.576  4.160   123.267 1.00 69.65  ? 114  PHE A O     1 
ATOM   866   C  CB    . PHE A  1  114  ? 84.519  4.468   120.988 1.00 78.89  ? 114  PHE A CB    1 
ATOM   867   C  CG    . PHE A  1  114  ? 83.793  4.323   119.685 1.00 75.11  ? 114  PHE A CG    1 
ATOM   868   C  CD1   . PHE A  1  114  ? 82.666  3.527   119.587 1.00 73.37  ? 114  PHE A CD1   1 
ATOM   869   C  CD2   . PHE A  1  114  ? 84.243  4.982   118.555 1.00 68.77  ? 114  PHE A CD2   1 
ATOM   870   C  CE1   . PHE A  1  114  ? 82.000  3.397   118.389 1.00 69.25  ? 114  PHE A CE1   1 
ATOM   871   C  CE2   . PHE A  1  114  ? 83.582  4.851   117.354 1.00 65.13  ? 114  PHE A CE2   1 
ATOM   872   C  CZ    . PHE A  1  114  ? 82.459  4.060   117.270 1.00 64.54  ? 114  PHE A CZ    1 
ATOM   873   N  N     . LEU A  1  115  ? 87.668  5.320   121.678 1.00 72.59  ? 115  LEU A N     1 
ATOM   874   C  CA    . LEU A  1  115  ? 88.487  6.055   122.636 1.00 77.00  ? 115  LEU A CA    1 
ATOM   875   C  C     . LEU A  1  115  ? 87.621  6.986   123.474 1.00 76.78  ? 115  LEU A C     1 
ATOM   876   O  O     . LEU A  1  115  ? 86.924  7.845   122.930 1.00 76.35  ? 115  LEU A O     1 
ATOM   877   C  CB    . LEU A  1  115  ? 89.596  6.837   121.929 1.00 78.57  ? 115  LEU A CB    1 
ATOM   878   C  CG    . LEU A  1  115  ? 90.747  5.989   121.377 1.00 81.04  ? 115  LEU A CG    1 
ATOM   879   C  CD1   . LEU A  1  115  ? 91.805  6.862   120.711 1.00 80.49  ? 115  LEU A CD1   1 
ATOM   880   C  CD2   . LEU A  1  115  ? 91.361  5.135   122.482 1.00 78.75  ? 115  LEU A CD2   1 
ATOM   881   N  N     . PRO A  1  116  ? 87.666  6.808   124.806 1.00 80.32  ? 116  PRO A N     1 
ATOM   882   C  CA    . PRO A  1  116  ? 86.827  7.508   125.786 1.00 76.38  ? 116  PRO A CA    1 
ATOM   883   C  C     . PRO A  1  116  ? 86.965  9.022   125.721 1.00 76.29  ? 116  PRO A C     1 
ATOM   884   O  O     . PRO A  1  116  ? 88.074  9.538   125.595 1.00 77.71  ? 116  PRO A O     1 
ATOM   885   C  CB    . PRO A  1  116  ? 87.357  6.992   127.125 1.00 63.01  ? 116  PRO A CB    1 
ATOM   886   C  CG    . PRO A  1  116  ? 87.935  5.662   126.812 1.00 63.47  ? 116  PRO A CG    1 
ATOM   887   C  CD    . PRO A  1  116  ? 88.560  5.835   125.460 1.00 78.29  ? 116  PRO A CD    1 
ATOM   888   N  N     . VAL A  1  117  ? 85.834  9.715   125.799 1.00 76.34  ? 117  VAL A N     1 
ATOM   889   C  CA    . VAL A  1  117  ? 85.807  11.171  125.788 1.00 80.75  ? 117  VAL A CA    1 
ATOM   890   C  C     . VAL A  1  117  ? 85.057  11.642  127.026 1.00 91.77  ? 117  VAL A C     1 
ATOM   891   O  O     . VAL A  1  117  ? 84.089  11.005  127.447 1.00 95.90  ? 117  VAL A O     1 
ATOM   892   C  CB    . VAL A  1  117  ? 85.121  11.713  124.512 1.00 79.59  ? 117  VAL A CB    1 
ATOM   893   C  CG1   . VAL A  1  117  ? 85.045  13.234  124.531 1.00 81.13  ? 117  VAL A CG1   1 
ATOM   894   C  CG2   . VAL A  1  117  ? 85.858  11.234  123.270 1.00 78.78  ? 117  VAL A CG2   1 
ATOM   895   N  N     . ALA A  1  118  ? 85.513  12.742  127.620 1.00 98.28  ? 118  ALA A N     1 
ATOM   896   C  CA    . ALA A  1  118  ? 84.902  13.274  128.837 1.00 101.47 ? 118  ALA A CA    1 
ATOM   897   C  C     . ALA A  1  118  ? 83.452  13.708  128.622 1.00 93.21  ? 118  ALA A C     1 
ATOM   898   O  O     . ALA A  1  118  ? 83.096  14.219  127.554 1.00 87.27  ? 118  ALA A O     1 
ATOM   899   C  CB    . ALA A  1  118  ? 85.727  14.431  129.382 1.00 102.88 ? 118  ALA A CB    1 
ATOM   900   N  N     . ASP A  1  119  ? 82.631  13.499  129.650 1.00 86.39  ? 119  ASP A N     1 
ATOM   901   C  CA    . ASP A  1  119  ? 81.206  13.834  129.619 1.00 88.03  ? 119  ASP A CA    1 
ATOM   902   C  C     . ASP A  1  119  ? 80.442  13.078  128.539 1.00 80.92  ? 119  ASP A C     1 
ATOM   903   O  O     . ASP A  1  119  ? 79.404  13.545  128.069 1.00 79.03  ? 119  ASP A O     1 
ATOM   904   C  CB    . ASP A  1  119  ? 80.984  15.343  129.447 1.00 92.71  ? 119  ASP A CB    1 
ATOM   905   C  CG    . ASP A  1  119  ? 81.433  16.145  130.655 1.00 98.88  ? 119  ASP A CG    1 
ATOM   906   O  OD1   . ASP A  1  119  ? 81.642  15.546  131.735 1.00 93.03  ? 119  ASP A OD1   1 
ATOM   907   O  OD2   . ASP A  1  119  ? 81.564  17.382  130.522 1.00 92.30  ? 119  ASP A OD2   1 
ATOM   908   N  N     . VAL A  1  120  ? 80.956  11.916  128.145 1.00 74.58  ? 120  VAL A N     1 
ATOM   909   C  CA    . VAL A  1  120  ? 80.304  11.101  127.124 1.00 72.17  ? 120  VAL A CA    1 
ATOM   910   C  C     . VAL A  1  120  ? 80.311  9.626   127.508 1.00 68.17  ? 120  VAL A C     1 
ATOM   911   O  O     . VAL A  1  120  ? 81.374  9.033   127.698 1.00 74.60  ? 120  VAL A O     1 
ATOM   912   C  CB    . VAL A  1  120  ? 80.993  11.256  125.749 1.00 68.34  ? 120  VAL A CB    1 
ATOM   913   C  CG1   . VAL A  1  120  ? 80.418  10.263  124.756 1.00 57.99  ? 120  VAL A CG1   1 
ATOM   914   C  CG2   . VAL A  1  120  ? 80.858  12.682  125.230 1.00 65.08  ? 120  VAL A CG2   1 
ATOM   915   N  N     . GLU A  1  121  ? 79.129  9.027   127.602 1.00 59.45  ? 121  GLU A N     1 
ATOM   916   C  CA    . GLU A  1  121  ? 79.032  7.628   128.001 1.00 62.94  ? 121  GLU A CA    1 
ATOM   917   C  C     . GLU A  1  121  ? 78.341  6.773   126.941 1.00 64.38  ? 121  GLU A C     1 
ATOM   918   O  O     . GLU A  1  121  ? 77.263  7.119   126.467 1.00 63.76  ? 121  GLU A O     1 
ATOM   919   C  CB    . GLU A  1  121  ? 78.289  7.504   129.336 1.00 66.03  ? 121  GLU A CB    1 
ATOM   920   C  CG    . GLU A  1  121  ? 78.134  6.067   129.828 1.00 68.63  ? 121  GLU A CG    1 
ATOM   921   C  CD    . GLU A  1  121  ? 77.162  5.936   130.983 1.00 73.28  ? 121  GLU A CD    1 
ATOM   922   O  OE1   . GLU A  1  121  ? 76.687  6.979   131.486 1.00 78.35  ? 121  GLU A OE1   1 
ATOM   923   O  OE2   . GLU A  1  121  ? 76.873  4.786   131.382 1.00 69.62  ? 121  GLU A OE2   1 
ATOM   924   N  N     . ILE A  1  122  ? 78.951  5.644   126.590 1.00 61.30  ? 122  ILE A N     1 
ATOM   925   C  CA    . ILE A  1  122  ? 78.346  4.732   125.625 1.00 60.50  ? 122  ILE A CA    1 
ATOM   926   C  C     . ILE A  1  122  ? 77.489  3.707   126.359 1.00 59.84  ? 122  ILE A C     1 
ATOM   927   O  O     . ILE A  1  122  ? 77.996  2.847   127.081 1.00 61.49  ? 122  ILE A O     1 
ATOM   928   C  CB    . ILE A  1  122  ? 79.408  4.011   124.756 1.00 62.23  ? 122  ILE A CB    1 
ATOM   929   C  CG1   . ILE A  1  122  ? 79.921  4.936   123.649 1.00 56.81  ? 122  ILE A CG1   1 
ATOM   930   C  CG2   . ILE A  1  122  ? 78.834  2.738   124.135 1.00 61.43  ? 122  ILE A CG2   1 
ATOM   931   C  CD1   . ILE A  1  122  ? 81.002  5.892   124.090 1.00 59.64  ? 122  ILE A CD1   1 
ATOM   932   N  N     . MET A  1  123  ? 76.181  3.806   126.154 1.00 58.93  ? 123  MET A N     1 
ATOM   933   C  CA    . MET A  1  123  ? 75.218  3.017   126.910 1.00 59.51  ? 123  MET A CA    1 
ATOM   934   C  C     . MET A  1  123  ? 75.188  1.551   126.497 1.00 59.07  ? 123  MET A C     1 
ATOM   935   O  O     . MET A  1  123  ? 74.719  0.700   127.251 1.00 62.56  ? 123  MET A O     1 
ATOM   936   C  CB    . MET A  1  123  ? 73.824  3.630   126.780 1.00 63.02  ? 123  MET A CB    1 
ATOM   937   C  CG    . MET A  1  123  ? 73.792  5.134   127.008 1.00 67.33  ? 123  MET A CG    1 
ATOM   938   S  SD    . MET A  1  123  ? 74.314  5.598   128.669 1.00 76.65  ? 123  MET A SD    1 
ATOM   939   C  CE    . MET A  1  123  ? 73.279  4.510   129.649 1.00 68.86  ? 123  MET A CE    1 
ATOM   940   N  N     . ASN A  1  124  ? 75.676  1.256   125.296 1.00 64.73  ? 124  ASN A N     1 
ATOM   941   C  CA    . ASN A  1  124  ? 75.752  -0.128  124.832 1.00 67.52  ? 124  ASN A CA    1 
ATOM   942   C  C     . ASN A  1  124  ? 77.138  -0.490  124.317 1.00 69.15  ? 124  ASN A C     1 
ATOM   943   O  O     . ASN A  1  124  ? 77.362  -0.585  123.114 1.00 72.40  ? 124  ASN A O     1 
ATOM   944   C  CB    . ASN A  1  124  ? 74.677  -0.426  123.782 1.00 63.08  ? 124  ASN A CB    1 
ATOM   945   C  CG    . ASN A  1  124  ? 74.704  0.541   122.610 1.00 57.76  ? 124  ASN A CG    1 
ATOM   946   O  OD1   . ASN A  1  124  ? 75.294  1.626   122.679 1.00 53.51  ? 124  ASN A OD1   1 
ATOM   947   N  ND2   . ASN A  1  124  ? 74.051  0.150   121.524 1.00 57.86  ? 124  ASN A ND2   1 
ATOM   948   N  N     . PRO A  1  125  ? 78.074  -0.673  125.220 1.00 70.43  ? 125  PRO A N     1 
ATOM   949   C  CA    . PRO A  1  125  ? 79.443  -0.923  124.817 1.00 69.95  ? 125  PRO A CA    1 
ATOM   950   C  C     . PRO A  1  125  ? 79.580  -2.303  124.225 1.00 68.72  ? 125  PRO A C     1 
ATOM   951   O  O     . PRO A  1  125  ? 80.633  -2.675  123.761 1.00 69.27  ? 125  PRO A O     1 
ATOM   952   C  CB    . PRO A  1  125  ? 80.205  -0.829  126.137 1.00 73.36  ? 125  PRO A CB    1 
ATOM   953   C  CG    . PRO A  1  125  ? 79.178  -0.713  127.214 1.00 61.75  ? 125  PRO A CG    1 
ATOM   954   C  CD    . PRO A  1  125  ? 77.866  -1.060  126.611 1.00 63.50  ? 125  PRO A CD    1 
ATOM   955   N  N     . ASP A  1  126  ? 78.509  -3.062  124.234 1.00 68.24  ? 126  ASP A N     1 
ATOM   956   C  CA    . ASP A  1  126  ? 78.575  -4.417  123.739 1.00 80.17  ? 126  ASP A CA    1 
ATOM   957   C  C     . ASP A  1  126  ? 78.194  -4.518  122.272 1.00 81.13  ? 126  ASP A C     1 
ATOM   958   O  O     . ASP A  1  126  ? 78.318  -5.573  121.665 1.00 75.77  ? 126  ASP A O     1 
ATOM   959   C  CB    . ASP A  1  126  ? 77.659  -5.306  124.560 1.00 88.11  ? 126  ASP A CB    1 
ATOM   960   C  CG    . ASP A  1  126  ? 78.414  -6.312  125.372 1.00 103.40 ? 126  ASP A CG    1 
ATOM   961   O  OD1   . ASP A  1  126  ? 78.213  -7.519  125.153 1.00 111.79 ? 126  ASP A OD1   1 
ATOM   962   O  OD2   . ASP A  1  126  ? 79.214  -5.897  126.230 1.00 108.59 ? 126  ASP A OD2   1 
ATOM   963   N  N     . LEU A  1  127  ? 77.722  -3.419  121.711 1.00 70.48  ? 127  LEU A N     1 
ATOM   964   C  CA    . LEU A  1  127  ? 77.283  -3.400  120.332 1.00 67.72  ? 127  LEU A CA    1 
ATOM   965   C  C     . LEU A  1  127  ? 78.405  -3.767  119.386 1.00 71.28  ? 127  LEU A C     1 
ATOM   966   O  O     . LEU A  1  127  ? 79.466  -3.175  119.432 1.00 68.79  ? 127  LEU A O     1 
ATOM   967   C  CB    . LEU A  1  127  ? 76.769  -2.014  119.986 1.00 65.90  ? 127  LEU A CB    1 
ATOM   968   C  CG    . LEU A  1  127  ? 76.438  -1.765  118.529 1.00 55.66  ? 127  LEU A CG    1 
ATOM   969   C  CD1   . LEU A  1  127  ? 75.017  -2.186  118.266 1.00 53.78  ? 127  LEU A CD1   1 
ATOM   970   C  CD2   . LEU A  1  127  ? 76.614  -0.308  118.200 1.00 53.04  ? 127  LEU A CD2   1 
ATOM   971   N  N     . HIS A  1  128  ? 78.154  -4.735  118.515 1.00 69.65  ? 128  HIS A N     1 
ATOM   972   C  CA    . HIS A  1  128  ? 79.138  -5.165  117.524 1.00 66.55  ? 128  HIS A CA    1 
ATOM   973   C  C     . HIS A  1  128  ? 79.242  -4.117  116.429 1.00 62.98  ? 128  HIS A C     1 
ATOM   974   O  O     . HIS A  1  128  ? 78.238  -3.554  115.997 1.00 64.32  ? 128  HIS A O     1 
ATOM   975   C  CB    . HIS A  1  128  ? 78.760  -6.525  116.928 1.00 64.50  ? 128  HIS A CB    1 
ATOM   976   C  CG    . HIS A  1  128  ? 79.795  -7.093  116.005 1.00 71.55  ? 128  HIS A CG    1 
ATOM   977   N  ND1   . HIS A  1  128  ? 80.102  -6.526  114.786 1.00 73.52  ? 128  HIS A ND1   1 
ATOM   978   C  CD2   . HIS A  1  128  ? 80.585  -8.188  116.117 1.00 82.07  ? 128  HIS A CD2   1 
ATOM   979   C  CE1   . HIS A  1  128  ? 81.041  -7.241  114.192 1.00 71.64  ? 128  HIS A CE1   1 
ATOM   980   N  NE2   . HIS A  1  128  ? 81.352  -8.254  114.979 1.00 76.65  ? 128  HIS A NE2   1 
ATOM   981   N  N     . ILE A  1  129  ? 80.461  -3.850  115.982 1.00 62.57  ? 129  ILE A N     1 
ATOM   982   C  CA    . ILE A  1  129  ? 80.671  -2.867  114.932 1.00 61.29  ? 129  ILE A CA    1 
ATOM   983   C  C     . ILE A  1  129  ? 81.248  -3.506  113.674 1.00 62.82  ? 129  ILE A C     1 
ATOM   984   O  O     . ILE A  1  129  ? 80.615  -3.485  112.619 1.00 64.39  ? 129  ILE A O     1 
ATOM   985   C  CB    . ILE A  1  129  ? 81.523  -1.693  115.415 1.00 58.40  ? 129  ILE A CB    1 
ATOM   986   C  CG1   . ILE A  1  129  ? 80.741  -0.906  116.466 1.00 54.02  ? 129  ILE A CG1   1 
ATOM   987   C  CG2   . ILE A  1  129  ? 81.906  -0.794  114.248 1.00 57.91  ? 129  ILE A CG2   1 
ATOM   988   C  CD1   . ILE A  1  129  ? 81.386  0.385   116.853 1.00 62.09  ? 129  ILE A CD1   1 
ATOM   989   N  N     . ALA A  1  130  ? 82.444  -4.072  113.779 1.00 59.73  ? 130  ALA A N     1 
ATOM   990   C  CA    . ALA A  1  130  ? 83.025  -4.793  112.654 1.00 61.90  ? 130  ALA A CA    1 
ATOM   991   C  C     . ALA A  1  130  ? 83.844  -5.989  113.122 1.00 64.49  ? 130  ALA A C     1 
ATOM   992   O  O     . ALA A  1  130  ? 84.457  -5.949  114.182 1.00 70.27  ? 130  ALA A O     1 
ATOM   993   C  CB    . ALA A  1  130  ? 83.881  -3.861  111.810 1.00 58.33  ? 130  ALA A CB    1 
ATOM   994   N  N     . THR A  1  131  ? 83.837  -7.058  112.334 1.00 64.09  ? 131  THR A N     1 
ATOM   995   C  CA    . THR A  1  131  ? 84.718  -8.192  112.582 1.00 60.64  ? 131  THR A CA    1 
ATOM   996   C  C     . THR A  1  131  ? 86.000  -8.022  111.772 1.00 61.07  ? 131  THR A C     1 
ATOM   997   O  O     . THR A  1  131  ? 85.964  -7.945  110.548 1.00 63.08  ? 131  THR A O     1 
ATOM   998   C  CB    . THR A  1  131  ? 84.048  -9.534  112.220 1.00 60.68  ? 131  THR A CB    1 
ATOM   999   O  OG1   . THR A  1  131  ? 83.048  -9.857  113.197 1.00 67.73  ? 131  THR A OG1   1 
ATOM   1000  C  CG2   . THR A  1  131  ? 85.078  -10.647 112.179 1.00 58.73  ? 131  THR A CG2   1 
ATOM   1001  N  N     . LEU A  1  132  ? 87.132  -7.956  112.462 1.00 66.44  ? 132  LEU A N     1 
ATOM   1002  C  CA    . LEU A  1  132  ? 88.417  -7.768  111.801 1.00 58.73  ? 132  LEU A CA    1 
ATOM   1003  C  C     . LEU A  1  132  ? 89.241  -9.052  111.765 1.00 60.67  ? 132  LEU A C     1 
ATOM   1004  O  O     . LEU A  1  132  ? 89.120  -9.925  112.625 1.00 59.45  ? 132  LEU A O     1 
ATOM   1005  C  CB    . LEU A  1  132  ? 89.211  -6.620  112.426 1.00 56.26  ? 132  LEU A CB    1 
ATOM   1006  C  CG    . LEU A  1  132  ? 88.963  -5.224  111.851 1.00 58.23  ? 132  LEU A CG    1 
ATOM   1007  C  CD1   . LEU A  1  132  ? 87.519  -4.781  112.048 1.00 55.18  ? 132  LEU A CD1   1 
ATOM   1008  C  CD2   . LEU A  1  132  ? 89.922  -4.212  112.462 1.00 60.20  ? 132  LEU A CD2   1 
ATOM   1009  N  N     . GLU A  1  133  ? 90.067  -9.153  110.737 1.00 62.85  ? 133  GLU A N     1 
ATOM   1010  C  CA    . GLU A  1  133  ? 90.808  -10.355 110.421 1.00 60.74  ? 133  GLU A CA    1 
ATOM   1011  C  C     . GLU A  1  133  ? 92.276  -9.941  110.419 1.00 66.89  ? 133  GLU A C     1 
ATOM   1012  O  O     . GLU A  1  133  ? 92.571  -8.745  110.447 1.00 65.01  ? 133  GLU A O     1 
ATOM   1013  C  CB    . GLU A  1  133  ? 90.351  -10.831 109.045 1.00 65.49  ? 133  GLU A CB    1 
ATOM   1014  C  CG    . GLU A  1  133  ? 91.049  -12.024 108.451 1.00 70.03  ? 133  GLU A CG    1 
ATOM   1015  C  CD    . GLU A  1  133  ? 90.902  -12.048 106.943 1.00 70.91  ? 133  GLU A CD    1 
ATOM   1016  O  OE1   . GLU A  1  133  ? 91.073  -10.985 106.306 1.00 69.68  ? 133  GLU A OE1   1 
ATOM   1017  O  OE2   . GLU A  1  133  ? 90.597  -13.122 106.397 1.00 72.30  ? 133  GLU A OE2   1 
ATOM   1018  N  N     . GLU A  1  134  ? 93.191  -10.909 110.428 1.00 70.56  ? 134  GLU A N     1 
ATOM   1019  C  CA    . GLU A  1  134  ? 94.619  -10.609 110.426 1.00 72.25  ? 134  GLU A CA    1 
ATOM   1020  C  C     . GLU A  1  134  ? 94.969  -9.665  109.278 1.00 71.59  ? 134  GLU A C     1 
ATOM   1021  O  O     . GLU A  1  134  ? 94.708  -9.960  108.111 1.00 66.45  ? 134  GLU A O     1 
ATOM   1022  C  CB    . GLU A  1  134  ? 95.424  -11.904 110.274 1.00 83.75  ? 134  GLU A CB    1 
ATOM   1023  C  CG    . GLU A  1  134  ? 96.173  -12.342 111.523 1.00 92.94  ? 134  GLU A CG    1 
ATOM   1024  C  CD    . GLU A  1  134  ? 97.317  -11.408 111.881 1.00 102.40 ? 134  GLU A CD    1 
ATOM   1025  O  OE1   . GLU A  1  134  ? 97.655  -11.314 113.083 1.00 94.85  ? 134  GLU A OE1   1 
ATOM   1026  O  OE2   . GLU A  1  134  ? 97.883  -10.774 110.962 1.00 98.90  ? 134  GLU A OE2   1 
ATOM   1027  N  N     . GLY A  1  135  ? 95.574  -8.533  109.617 1.00 68.16  ? 135  GLY A N     1 
ATOM   1028  C  CA    . GLY A  1  135  ? 95.895  -7.522  108.628 1.00 65.91  ? 135  GLY A CA    1 
ATOM   1029  C  C     . GLY A  1  135  ? 94.784  -6.506  108.456 1.00 66.96  ? 135  GLY A C     1 
ATOM   1030  O  O     . GLY A  1  135  ? 94.954  -5.492  107.775 1.00 65.70  ? 135  GLY A O     1 
ATOM   1031  N  N     . GLY A  1  136  ? 93.636  -6.784  109.065 1.00 70.54  ? 136  GLY A N     1 
ATOM   1032  C  CA    . GLY A  1  136  ? 92.509  -5.870  109.024 1.00 67.66  ? 136  GLY A CA    1 
ATOM   1033  C  C     . GLY A  1  136  ? 92.754  -4.615  109.833 1.00 66.83  ? 136  GLY A C     1 
ATOM   1034  O  O     . GLY A  1  136  ? 93.087  -4.686  111.009 1.00 73.18  ? 136  GLY A O     1 
ATOM   1035  N  N     . ARG A  1  137  ? 92.581  -3.461  109.205 1.00 68.68  ? 137  ARG A N     1 
ATOM   1036  C  CA    . ARG A  1  137  ? 92.804  -2.195  109.882 1.00 73.63  ? 137  ARG A CA    1 
ATOM   1037  C  C     . ARG A  1  137  ? 91.573  -1.316  109.775 1.00 70.08  ? 137  ARG A C     1 
ATOM   1038  O  O     . ARG A  1  137  ? 91.177  -0.926  108.680 1.00 77.53  ? 137  ARG A O     1 
ATOM   1039  C  CB    . ARG A  1  137  ? 94.004  -1.467  109.278 1.00 81.99  ? 137  ARG A CB    1 
ATOM   1040  C  CG    . ARG A  1  137  ? 95.327  -2.193  109.434 1.00 97.80  ? 137  ARG A CG    1 
ATOM   1041  C  CD    . ARG A  1  137  ? 96.452  -1.385  108.810 1.00 117.75 ? 137  ARG A CD    1 
ATOM   1042  N  NE    . ARG A  1  137  ? 96.380  0.021   109.201 1.00 133.75 ? 137  ARG A NE    1 
ATOM   1043  C  CZ    . ARG A  1  137  ? 96.932  0.524   110.301 1.00 131.65 ? 137  ARG A CZ    1 
ATOM   1044  N  NH1   . ARG A  1  137  ? 97.607  -0.266  111.127 1.00 127.68 ? 137  ARG A NH1   1 
ATOM   1045  N  NH2   . ARG A  1  137  ? 96.812  1.817   110.576 1.00 123.54 ? 137  ARG A NH2   1 
ATOM   1046  N  N     . LEU A  1  138  ? 90.970  -0.997  110.912 1.00 64.74  ? 138  LEU A N     1 
ATOM   1047  C  CA    . LEU A  1  138  ? 89.818  -0.112  110.909 1.00 61.35  ? 138  LEU A CA    1 
ATOM   1048  C  C     . LEU A  1  138  ? 90.104  1.148   111.718 1.00 61.92  ? 138  LEU A C     1 
ATOM   1049  O  O     . LEU A  1  138  ? 90.257  1.094   112.933 1.00 69.75  ? 138  LEU A O     1 
ATOM   1050  C  CB    . LEU A  1  138  ? 88.594  -0.841  111.459 1.00 66.78  ? 138  LEU A CB    1 
ATOM   1051  C  CG    . LEU A  1  138  ? 87.260  -0.100  111.402 1.00 63.57  ? 138  LEU A CG    1 
ATOM   1052  C  CD1   . LEU A  1  138  ? 86.977  0.393   109.995 1.00 58.03  ? 138  LEU A CD1   1 
ATOM   1053  C  CD2   . LEU A  1  138  ? 86.153  -1.012  111.881 1.00 57.60  ? 138  LEU A CD2   1 
ATOM   1054  N  N     . ASN A  1  139  ? 90.188  2.282   111.036 1.00 62.01  ? 139  ASN A N     1 
ATOM   1055  C  CA    . ASN A  1  139  ? 90.417  3.554   111.704 1.00 62.91  ? 139  ASN A CA    1 
ATOM   1056  C  C     . ASN A  1  139  ? 89.369  4.570   111.269 1.00 65.70  ? 139  ASN A C     1 
ATOM   1057  O  O     . ASN A  1  139  ? 89.372  5.018   110.122 1.00 69.60  ? 139  ASN A O     1 
ATOM   1058  C  CB    . ASN A  1  139  ? 91.830  4.057   111.389 1.00 66.71  ? 139  ASN A CB    1 
ATOM   1059  C  CG    . ASN A  1  139  ? 92.035  5.521   111.754 1.00 76.52  ? 139  ASN A CG    1 
ATOM   1060  O  OD1   . ASN A  1  139  ? 91.426  6.036   112.693 1.00 76.48  ? 139  ASN A OD1   1 
ATOM   1061  N  ND2   . ASN A  1  139  ? 92.902  6.198   111.005 1.00 80.05  ? 139  ASN A ND2   1 
ATOM   1062  N  N     . MET A  1  140  ? 88.490  4.956   112.189 1.00 62.98  ? 140  MET A N     1 
ATOM   1063  C  CA    . MET A  1  140  ? 87.392  5.853   111.840 1.00 63.29  ? 140  MET A CA    1 
ATOM   1064  C  C     . MET A  1  140  ? 87.068  6.937   112.858 1.00 57.02  ? 140  MET A C     1 
ATOM   1065  O  O     . MET A  1  140  ? 87.472  6.873   114.016 1.00 62.63  ? 140  MET A O     1 
ATOM   1066  C  CB    . MET A  1  140  ? 86.122  5.064   111.515 1.00 62.39  ? 140  MET A CB    1 
ATOM   1067  C  CG    . MET A  1  140  ? 85.701  4.067   112.567 1.00 64.08  ? 140  MET A CG    1 
ATOM   1068  S  SD    . MET A  1  140  ? 84.184  3.240   112.061 1.00 65.82  ? 140  MET A SD    1 
ATOM   1069  C  CE    . MET A  1  140  ? 84.171  1.832   113.167 1.00 73.44  ? 140  MET A CE    1 
ATOM   1070  N  N     . GLU A  1  141  ? 86.331  7.936   112.387 1.00 52.76  ? 141  GLU A N     1 
ATOM   1071  C  CA    . GLU A  1  141  ? 85.838  9.027   113.207 1.00 59.31  ? 141  GLU A CA    1 
ATOM   1072  C  C     . GLU A  1  141  ? 84.337  9.141   112.996 1.00 63.20  ? 141  GLU A C     1 
ATOM   1073  O  O     . GLU A  1  141  ? 83.884  9.479   111.900 1.00 59.42  ? 141  GLU A O     1 
ATOM   1074  C  CB    . GLU A  1  141  ? 86.487  10.342  112.788 1.00 57.81  ? 141  GLU A CB    1 
ATOM   1075  C  CG    . GLU A  1  141  ? 87.988  10.286  112.641 1.00 65.93  ? 141  GLU A CG    1 
ATOM   1076  C  CD    . GLU A  1  141  ? 88.552  11.590  112.122 1.00 78.95  ? 141  GLU A CD    1 
ATOM   1077  O  OE1   . GLU A  1  141  ? 87.750  12.510  111.843 1.00 74.65  ? 141  GLU A OE1   1 
ATOM   1078  O  OE2   . GLU A  1  141  ? 89.792  11.696  111.996 1.00 81.57  ? 141  GLU A OE2   1 
ATOM   1079  N  N     . VAL A  1  142  ? 83.558  8.868   114.037 1.00 59.21  ? 142  VAL A N     1 
ATOM   1080  C  CA    . VAL A  1  142  ? 82.113  8.997   113.920 1.00 54.76  ? 142  VAL A CA    1 
ATOM   1081  C  C     . VAL A  1  142  ? 81.582  10.215  114.680 1.00 56.23  ? 142  VAL A C     1 
ATOM   1082  O  O     . VAL A  1  142  ? 81.832  10.383  115.868 1.00 58.26  ? 142  VAL A O     1 
ATOM   1083  C  CB    . VAL A  1  142  ? 81.369  7.671   114.268 1.00 54.16  ? 142  VAL A CB    1 
ATOM   1084  C  CG1   . VAL A  1  142  ? 82.357  6.581   114.624 1.00 53.10  ? 142  VAL A CG1   1 
ATOM   1085  C  CG2   . VAL A  1  142  ? 80.322  7.866   115.360 1.00 55.51  ? 142  VAL A CG2   1 
ATOM   1086  N  N     . ARG A  1  143  ? 80.888  11.087  113.958 1.00 55.43  ? 143  ARG A N     1 
ATOM   1087  C  CA    . ARG A  1  143  ? 80.279  12.266  114.545 1.00 51.05  ? 143  ARG A CA    1 
ATOM   1088  C  C     . ARG A  1  143  ? 78.865  11.979  115.028 1.00 55.65  ? 143  ARG A C     1 
ATOM   1089  O  O     . ARG A  1  143  ? 77.973  11.601  114.241 1.00 57.99  ? 143  ARG A O     1 
ATOM   1090  C  CB    . ARG A  1  143  ? 80.269  13.428  113.559 1.00 51.67  ? 143  ARG A CB    1 
ATOM   1091  C  CG    . ARG A  1  143  ? 79.314  14.536  113.952 1.00 54.66  ? 143  ARG A CG    1 
ATOM   1092  C  CD    . ARG A  1  143  ? 79.617  15.820  113.206 1.00 55.41  ? 143  ARG A CD    1 
ATOM   1093  N  NE    . ARG A  1  143  ? 78.582  16.825  113.418 1.00 59.30  ? 143  ARG A NE    1 
ATOM   1094  C  CZ    . ARG A  1  143  ? 78.636  18.063  112.942 1.00 65.21  ? 143  ARG A CZ    1 
ATOM   1095  N  NH1   . ARG A  1  143  ? 79.685  18.454  112.232 1.00 72.26  ? 143  ARG A NH1   1 
ATOM   1096  N  NH2   . ARG A  1  143  ? 77.645  18.912  113.177 1.00 65.95  ? 143  ARG A NH2   1 
ATOM   1097  N  N     . VAL A  1  144  ? 78.699  12.167  116.337 1.00 62.04  ? 144  VAL A N     1 
ATOM   1098  C  CA    . VAL A  1  144  ? 77.443  12.017  117.056 1.00 57.26  ? 144  VAL A CA    1 
ATOM   1099  C  C     . VAL A  1  144  ? 76.923  13.397  117.445 1.00 57.30  ? 144  VAL A C     1 
ATOM   1100  O  O     . VAL A  1  144  ? 77.664  14.212  117.995 1.00 62.99  ? 144  VAL A O     1 
ATOM   1101  C  CB    . VAL A  1  144  ? 77.655  11.211  118.354 1.00 52.88  ? 144  VAL A CB    1 
ATOM   1102  C  CG1   . VAL A  1  144  ? 76.370  11.137  119.151 1.00 55.22  ? 144  VAL A CG1   1 
ATOM   1103  C  CG2   . VAL A  1  144  ? 78.182  9.817   118.046 1.00 52.74  ? 144  VAL A CG2   1 
ATOM   1104  N  N     . ASP A  1  145  ? 75.650  13.655  117.164 1.00 58.05  ? 145  ASP A N     1 
ATOM   1105  C  CA    . ASP A  1  145  ? 75.037  14.950  117.448 1.00 61.80  ? 145  ASP A CA    1 
ATOM   1106  C  C     . ASP A  1  145  ? 73.800  14.805  118.324 1.00 64.98  ? 145  ASP A C     1 
ATOM   1107  O  O     . ASP A  1  145  ? 73.245  13.713  118.466 1.00 63.18  ? 145  ASP A O     1 
ATOM   1108  C  CB    . ASP A  1  145  ? 74.630  15.649  116.148 1.00 59.17  ? 145  ASP A CB    1 
ATOM   1109  C  CG    . ASP A  1  145  ? 75.800  16.285  115.431 1.00 65.85  ? 145  ASP A CG    1 
ATOM   1110  O  OD1   . ASP A  1  145  ? 76.949  16.100  115.880 1.00 71.57  ? 145  ASP A OD1   1 
ATOM   1111  O  OD2   . ASP A  1  145  ? 75.570  16.964  114.408 1.00 66.51  ? 145  ASP A OD2   1 
ATOM   1112  N  N     . ARG A  1  146  ? 73.374  15.916  118.913 1.00 66.21  ? 146  ARG A N     1 
ATOM   1113  C  CA    . ARG A  1  146  ? 72.094  15.969  119.600 1.00 64.39  ? 146  ARG A CA    1 
ATOM   1114  C  C     . ARG A  1  146  ? 71.086  16.604  118.652 1.00 65.52  ? 146  ARG A C     1 
ATOM   1115  O  O     . ARG A  1  146  ? 71.395  17.585  117.970 1.00 67.08  ? 146  ARG A O     1 
ATOM   1116  C  CB    . ARG A  1  146  ? 72.198  16.776  120.896 1.00 69.06  ? 146  ARG A CB    1 
ATOM   1117  C  CG    . ARG A  1  146  ? 70.881  16.911  121.637 1.00 82.77  ? 146  ARG A CG    1 
ATOM   1118  C  CD    . ARG A  1  146  ? 71.011  17.762  122.894 1.00 101.82 ? 146  ARG A CD    1 
ATOM   1119  N  NE    . ARG A  1  146  ? 71.457  16.999  124.059 1.00 96.14  ? 146  ARG A NE    1 
ATOM   1120  C  CZ    . ARG A  1  146  ? 72.599  17.217  124.705 1.00 91.58  ? 146  ARG A CZ    1 
ATOM   1121  N  NH1   . ARG A  1  146  ? 73.417  18.178  124.296 1.00 89.90  ? 146  ARG A NH1   1 
ATOM   1122  N  NH2   . ARG A  1  146  ? 72.922  16.478  125.761 1.00 82.10  ? 146  ARG A NH2   1 
ATOM   1123  N  N     . GLY A  1  147  ? 69.889  16.032  118.594 1.00 63.58  ? 147  GLY A N     1 
ATOM   1124  C  CA    . GLY A  1  147  ? 68.849  16.530  117.713 1.00 60.18  ? 147  GLY A CA    1 
ATOM   1125  C  C     . GLY A  1  147  ? 67.505  15.917  118.042 1.00 56.43  ? 147  GLY A C     1 
ATOM   1126  O  O     . GLY A  1  147  ? 67.382  15.158  119.000 1.00 55.51  ? 147  GLY A O     1 
ATOM   1127  N  N     . VAL A  1  148  ? 66.491  16.244  117.251 1.00 58.87  ? 148  VAL A N     1 
ATOM   1128  C  CA    . VAL A  1  148  ? 65.159  15.717  117.508 1.00 63.48  ? 148  VAL A CA    1 
ATOM   1129  C  C     . VAL A  1  148  ? 64.598  14.962  116.311 1.00 61.82  ? 148  VAL A C     1 
ATOM   1130  O  O     . VAL A  1  148  ? 64.869  15.301  115.164 1.00 56.55  ? 148  VAL A O     1 
ATOM   1131  C  CB    . VAL A  1  148  ? 64.164  16.830  117.884 1.00 63.50  ? 148  VAL A CB    1 
ATOM   1132  C  CG1   . VAL A  1  148  ? 63.078  16.266  118.791 1.00 57.08  ? 148  VAL A CG1   1 
ATOM   1133  C  CG2   . VAL A  1  148  ? 64.884  17.991  118.559 1.00 67.48  ? 148  VAL A CG2   1 
ATOM   1134  N  N     . GLY A  1  149  ? 63.805  13.935  116.592 1.00 68.85  ? 149  GLY A N     1 
ATOM   1135  C  CA    . GLY A  1  149  ? 63.096  13.215  115.552 1.00 61.22  ? 149  GLY A CA    1 
ATOM   1136  C  C     . GLY A  1  149  ? 63.979  12.395  114.635 1.00 53.79  ? 149  GLY A C     1 
ATOM   1137  O  O     . GLY A  1  149  ? 65.055  11.938  115.021 1.00 55.21  ? 149  GLY A O     1 
ATOM   1138  N  N     . TYR A  1  150  ? 63.506  12.203  113.410 1.00 62.20  ? 150  TYR A N     1 
ATOM   1139  C  CA    . TYR A  1  150  ? 64.215  11.411  112.412 1.00 58.73  ? 150  TYR A CA    1 
ATOM   1140  C  C     . TYR A  1  150  ? 64.662  12.304  111.257 1.00 54.54  ? 150  TYR A C     1 
ATOM   1141  O  O     . TYR A  1  150  ? 63.842  12.800  110.484 1.00 55.60  ? 150  TYR A O     1 
ATOM   1142  C  CB    . TYR A  1  150  ? 63.308  10.273  111.924 1.00 57.44  ? 150  TYR A CB    1 
ATOM   1143  C  CG    . TYR A  1  150  ? 63.773  9.557   110.677 1.00 61.40  ? 150  TYR A CG    1 
ATOM   1144  C  CD1   . TYR A  1  150  ? 64.854  8.684   110.709 1.00 62.58  ? 150  TYR A CD1   1 
ATOM   1145  C  CD2   . TYR A  1  150  ? 63.114  9.737   109.469 1.00 60.78  ? 150  TYR A CD2   1 
ATOM   1146  C  CE1   . TYR A  1  150  ? 65.275  8.020   109.566 1.00 53.76  ? 150  TYR A CE1   1 
ATOM   1147  C  CE2   . TYR A  1  150  ? 63.528  9.082   108.324 1.00 62.84  ? 150  TYR A CE2   1 
ATOM   1148  C  CZ    . TYR A  1  150  ? 64.606  8.224   108.379 1.00 59.14  ? 150  TYR A CZ    1 
ATOM   1149  O  OH    . TYR A  1  150  ? 65.011  7.571   107.237 1.00 63.83  ? 150  TYR A OH    1 
ATOM   1150  N  N     . VAL A  1  151  ? 65.967  12.523  111.157 1.00 58.91  ? 151  VAL A N     1 
ATOM   1151  C  CA    . VAL A  1  151  ? 66.520  13.339  110.082 1.00 56.10  ? 151  VAL A CA    1 
ATOM   1152  C  C     . VAL A  1  151  ? 67.386  12.493  109.157 1.00 52.18  ? 151  VAL A C     1 
ATOM   1153  O  O     . VAL A  1  151  ? 68.497  12.107  109.525 1.00 49.92  ? 151  VAL A O     1 
ATOM   1154  C  CB    . VAL A  1  151  ? 67.366  14.490  110.641 1.00 51.28  ? 151  VAL A CB    1 
ATOM   1155  C  CG1   . VAL A  1  151  ? 67.948  15.312  109.511 1.00 48.74  ? 151  VAL A CG1   1 
ATOM   1156  C  CG2   . VAL A  1  151  ? 66.527  15.357  111.569 1.00 51.74  ? 151  VAL A CG2   1 
ATOM   1157  N  N     . PRO A  1  152  ? 66.882  12.212  107.945 1.00 56.97  ? 152  PRO A N     1 
ATOM   1158  C  CA    . PRO A  1  152  ? 67.583  11.365  106.975 1.00 56.05  ? 152  PRO A CA    1 
ATOM   1159  C  C     . PRO A  1  152  ? 68.862  12.018  106.492 1.00 51.09  ? 152  PRO A C     1 
ATOM   1160  O  O     . PRO A  1  152  ? 68.957  13.245  106.474 1.00 51.04  ? 152  PRO A O     1 
ATOM   1161  C  CB    . PRO A  1  152  ? 66.588  11.261  105.816 1.00 53.62  ? 152  PRO A CB    1 
ATOM   1162  C  CG    . PRO A  1  152  ? 65.272  11.603  106.408 1.00 53.09  ? 152  PRO A CG    1 
ATOM   1163  C  CD    . PRO A  1  152  ? 65.564  12.632  107.446 1.00 55.10  ? 152  PRO A CD    1 
ATOM   1164  N  N     . ALA A  1  153  ? 69.828  11.197  106.099 1.00 55.19  ? 153  ALA A N     1 
ATOM   1165  C  CA    . ALA A  1  153  ? 71.122  11.687  105.643 1.00 55.10  ? 153  ALA A CA    1 
ATOM   1166  C  C     . ALA A  1  153  ? 71.007  12.720  104.520 1.00 54.16  ? 153  ALA A C     1 
ATOM   1167  O  O     . ALA A  1  153  ? 71.762  13.685  104.485 1.00 59.19  ? 153  ALA A O     1 
ATOM   1168  C  CB    . ALA A  1  153  ? 72.003  10.530  105.222 1.00 50.77  ? 153  ALA A CB    1 
ATOM   1169  N  N     . GLU A  1  154  ? 70.053  12.527  103.618 1.00 54.17  ? 154  GLU A N     1 
ATOM   1170  C  CA    . GLU A  1  154  ? 69.847  13.467  102.522 1.00 59.90  ? 154  GLU A CA    1 
ATOM   1171  C  C     . GLU A  1  154  ? 69.486  14.858  103.036 1.00 61.77  ? 154  GLU A C     1 
ATOM   1172  O  O     . GLU A  1  154  ? 69.850  15.861  102.428 1.00 70.59  ? 154  GLU A O     1 
ATOM   1173  C  CB    . GLU A  1  154  ? 68.758  12.967  101.569 1.00 66.99  ? 154  GLU A CB    1 
ATOM   1174  C  CG    . GLU A  1  154  ? 68.892  11.504  101.166 1.00 82.14  ? 154  GLU A CG    1 
ATOM   1175  C  CD    . GLU A  1  154  ? 68.232  10.556  102.163 1.00 93.98  ? 154  GLU A CD    1 
ATOM   1176  O  OE1   . GLU A  1  154  ? 67.049  10.204  101.946 1.00 109.52 ? 154  GLU A OE1   1 
ATOM   1177  O  OE2   . GLU A  1  154  ? 68.892  10.166  103.160 1.00 72.68  ? 154  GLU A OE2   1 
ATOM   1178  N  N     . LYS A  1  155  ? 68.770  14.914  104.154 1.00 62.33  ? 155  LYS A N     1 
ATOM   1179  C  CA    . LYS A  1  155  ? 68.362  16.190  104.736 1.00 63.22  ? 155  LYS A CA    1 
ATOM   1180  C  C     . LYS A  1  155  ? 69.525  16.973  105.341 1.00 67.31  ? 155  LYS A C     1 
ATOM   1181  O  O     . LYS A  1  155  ? 69.760  18.124  104.973 1.00 75.21  ? 155  LYS A O     1 
ATOM   1182  C  CB    . LYS A  1  155  ? 67.282  15.977  105.801 1.00 57.24  ? 155  LYS A CB    1 
ATOM   1183  C  CG    . LYS A  1  155  ? 65.864  16.006  105.270 1.00 73.91  ? 155  LYS A CG    1 
ATOM   1184  C  CD    . LYS A  1  155  ? 65.455  17.416  104.868 1.00 99.12  ? 155  LYS A CD    1 
ATOM   1185  C  CE    . LYS A  1  155  ? 64.107  17.423  104.151 1.00 116.29 ? 155  LYS A CE    1 
ATOM   1186  N  NZ    . LYS A  1  155  ? 64.159  16.717  102.833 1.00 105.91 ? 155  LYS A NZ    1 
ATOM   1187  N  N     . HIS A  1  156  ? 70.254  16.350  106.265 1.00 62.21  ? 156  HIS A N     1 
ATOM   1188  C  CA    . HIS A  1  156  ? 71.316  17.056  106.980 1.00 60.22  ? 156  HIS A CA    1 
ATOM   1189  C  C     . HIS A  1  156  ? 72.631  17.168  106.206 1.00 65.03  ? 156  HIS A C     1 
ATOM   1190  O  O     . HIS A  1  156  ? 73.308  18.195  106.277 1.00 69.92  ? 156  HIS A O     1 
ATOM   1191  C  CB    . HIS A  1  156  ? 71.526  16.494  108.397 1.00 59.12  ? 156  HIS A CB    1 
ATOM   1192  C  CG    . HIS A  1  156  ? 71.991  15.069  108.445 1.00 55.52  ? 156  HIS A CG    1 
ATOM   1193  N  ND1   . HIS A  1  156  ? 73.284  14.694  108.147 1.00 53.95  ? 156  HIS A ND1   1 
ATOM   1194  C  CD2   . HIS A  1  156  ? 71.347  13.934  108.810 1.00 51.77  ? 156  HIS A CD2   1 
ATOM   1195  C  CE1   . HIS A  1  156  ? 73.410  13.388  108.304 1.00 52.78  ? 156  HIS A CE1   1 
ATOM   1196  N  NE2   . HIS A  1  156  ? 72.249  12.904  108.705 1.00 48.66  ? 156  HIS A NE2   1 
ATOM   1197  N  N     . GLY A  1  157  ? 72.975  16.116  105.466 1.00 63.05  ? 157  GLY A N     1 
ATOM   1198  C  CA    . GLY A  1  157  ? 74.176  16.088  104.646 1.00 58.20  ? 157  GLY A CA    1 
ATOM   1199  C  C     . GLY A  1  157  ? 75.432  16.440  105.413 1.00 63.34  ? 157  GLY A C     1 
ATOM   1200  O  O     . GLY A  1  157  ? 76.317  17.117  104.894 1.00 75.82  ? 157  GLY A O     1 
ATOM   1201  N  N     . ILE A  1  158  ? 75.512  15.979  106.655 1.00 65.11  ? 158  ILE A N     1 
ATOM   1202  C  CA    . ILE A  1  158  ? 76.606  16.362  107.538 1.00 66.36  ? 158  ILE A CA    1 
ATOM   1203  C  C     . ILE A  1  158  ? 77.898  15.642  107.182 1.00 67.30  ? 158  ILE A C     1 
ATOM   1204  O  O     . ILE A  1  158  ? 77.969  14.412  107.200 1.00 66.47  ? 158  ILE A O     1 
ATOM   1205  C  CB    . ILE A  1  158  ? 76.263  16.077  109.013 1.00 64.19  ? 158  ILE A CB    1 
ATOM   1206  C  CG1   . ILE A  1  158  ? 75.128  16.987  109.484 1.00 57.93  ? 158  ILE A CG1   1 
ATOM   1207  C  CG2   . ILE A  1  158  ? 77.491  16.259  109.892 1.00 58.20  ? 158  ILE A CG2   1 
ATOM   1208  C  CD1   . ILE A  1  158  ? 74.652  16.671  110.881 1.00 55.48  ? 158  ILE A CD1   1 
ATOM   1209  N  N     . LYS A  1  159  ? 78.921  16.425  106.863 1.00 68.96  ? 159  LYS A N     1 
ATOM   1210  C  CA    . LYS A  1  159  ? 80.240  15.886  106.575 1.00 71.48  ? 159  LYS A CA    1 
ATOM   1211  C  C     . LYS A  1  159  ? 81.309  16.710  107.281 1.00 79.12  ? 159  LYS A C     1 
ATOM   1212  O  O     . LYS A  1  159  ? 81.444  17.911  107.032 1.00 82.08  ? 159  LYS A O     1 
ATOM   1213  C  CB    . LYS A  1  159  ? 80.487  15.865  105.064 1.00 69.45  ? 159  LYS A CB    1 
ATOM   1214  C  CG    . LYS A  1  159  ? 79.568  14.916  104.324 1.00 66.38  ? 159  LYS A CG    1 
ATOM   1215  C  CD    . LYS A  1  159  ? 79.512  15.210  102.840 1.00 71.32  ? 159  LYS A CD    1 
ATOM   1216  C  CE    . LYS A  1  159  ? 80.635  14.530  102.082 1.00 68.05  ? 159  LYS A CE    1 
ATOM   1217  N  NZ    . LYS A  1  159  ? 80.358  14.539  100.615 1.00 70.10  ? 159  LYS A NZ    1 
ATOM   1218  N  N     . ASP A  1  160  ? 82.061  16.064  108.169 1.00 73.25  ? 160  ASP A N     1 
ATOM   1219  C  CA    . ASP A  1  160  ? 83.183  16.720  108.831 1.00 74.32  ? 160  ASP A CA    1 
ATOM   1220  C  C     . ASP A  1  160  ? 84.362  16.896  107.874 1.00 72.89  ? 160  ASP A C     1 
ATOM   1221  O  O     . ASP A  1  160  ? 85.095  17.881  107.952 1.00 73.79  ? 160  ASP A O     1 
ATOM   1222  C  CB    . ASP A  1  160  ? 83.614  15.941  110.076 1.00 86.44  ? 160  ASP A CB    1 
ATOM   1223  C  CG    . ASP A  1  160  ? 82.837  16.346  111.319 1.00 80.98  ? 160  ASP A CG    1 
ATOM   1224  O  OD1   . ASP A  1  160  ? 82.139  17.385  111.272 1.00 71.13  ? 160  ASP A OD1   1 
ATOM   1225  O  OD2   . ASP A  1  160  ? 82.937  15.634  112.346 1.00 72.12  ? 160  ASP A OD2   1 
ATOM   1226  N  N     . ARG A  1  161  ? 84.541  15.938  106.971 1.00 74.65  ? 161  ARG A N     1 
ATOM   1227  C  CA    . ARG A  1  161  ? 85.587  16.037  105.961 1.00 74.14  ? 161  ARG A CA    1 
ATOM   1228  C  C     . ARG A  1  161  ? 85.120  15.544  104.585 1.00 73.88  ? 161  ARG A C     1 
ATOM   1229  O  O     . ARG A  1  161  ? 83.955  15.192  104.405 1.00 74.54  ? 161  ARG A O     1 
ATOM   1230  C  CB    . ARG A  1  161  ? 86.841  15.295  106.416 1.00 71.99  ? 161  ARG A CB    1 
ATOM   1231  C  CG    . ARG A  1  161  ? 86.649  13.813  106.636 1.00 70.13  ? 161  ARG A CG    1 
ATOM   1232  C  CD    . ARG A  1  161  ? 87.968  13.177  106.999 1.00 73.73  ? 161  ARG A CD    1 
ATOM   1233  N  NE    . ARG A  1  161  ? 88.417  13.596  108.320 1.00 81.06  ? 161  ARG A NE    1 
ATOM   1234  C  CZ    . ARG A  1  161  ? 89.664  13.469  108.760 1.00 87.08  ? 161  ARG A CZ    1 
ATOM   1235  N  NH1   . ARG A  1  161  ? 90.594  12.940  107.976 1.00 76.96  ? 161  ARG A NH1   1 
ATOM   1236  N  NH2   . ARG A  1  161  ? 89.982  13.880  109.983 1.00 87.50  ? 161  ARG A NH2   1 
ATOM   1237  N  N     . ILE A  1  162  ? 86.036  15.524  103.620 1.00 73.40  ? 162  ILE A N     1 
ATOM   1238  C  CA    . ILE A  1  162  ? 85.698  15.235  102.227 1.00 71.96  ? 162  ILE A CA    1 
ATOM   1239  C  C     . ILE A  1  162  ? 85.146  13.824  101.995 1.00 69.41  ? 162  ILE A C     1 
ATOM   1240  O  O     . ILE A  1  162  ? 84.146  13.647  101.294 1.00 72.87  ? 162  ILE A O     1 
ATOM   1241  C  CB    . ILE A  1  162  ? 86.907  15.488  101.298 1.00 74.26  ? 162  ILE A CB    1 
ATOM   1242  C  CG1   . ILE A  1  162  ? 87.300  16.966  101.335 1.00 82.54  ? 162  ILE A CG1   1 
ATOM   1243  C  CG2   . ILE A  1  162  ? 86.591  15.064  99.868  1.00 68.29  ? 162  ILE A CG2   1 
ATOM   1244  C  CD1   . ILE A  1  162  ? 86.259  17.892  100.731 1.00 88.42  ? 162  ILE A CD1   1 
ATOM   1245  N  N     . ASN A  1  163  ? 85.786  12.825  102.590 1.00 63.91  ? 163  ASN A N     1 
ATOM   1246  C  CA    . ASN A  1  163  ? 85.377  11.436  102.393 1.00 62.77  ? 163  ASN A CA    1 
ATOM   1247  C  C     . ASN A  1  163  ? 84.328  10.974  103.397 1.00 64.08  ? 163  ASN A C     1 
ATOM   1248  O  O     . ASN A  1  163  ? 83.987  9.791   103.458 1.00 59.46  ? 163  ASN A O     1 
ATOM   1249  C  CB    . ASN A  1  163  ? 86.586  10.500  102.424 1.00 70.43  ? 163  ASN A CB    1 
ATOM   1250  C  CG    . ASN A  1  163  ? 87.522  10.715  101.253 1.00 74.57  ? 163  ASN A CG    1 
ATOM   1251  O  OD1   . ASN A  1  163  ? 87.125  11.240  100.208 1.00 74.79  ? 163  ASN A OD1   1 
ATOM   1252  N  ND2   . ASN A  1  163  ? 88.775  10.303  101.417 1.00 75.27  ? 163  ASN A ND2   1 
ATOM   1253  N  N     . ALA A  1  164  ? 83.843  11.909  104.206 1.00 67.89  ? 164  ALA A N     1 
ATOM   1254  C  CA    . ALA A  1  164  ? 82.845  11.603  105.219 1.00 58.44  ? 164  ALA A CA    1 
ATOM   1255  C  C     . ALA A  1  164  ? 81.525  11.153  104.597 1.00 58.57  ? 164  ALA A C     1 
ATOM   1256  O  O     . ALA A  1  164  ? 81.083  11.684  103.579 1.00 59.63  ? 164  ALA A O     1 
ATOM   1257  C  CB    . ALA A  1  164  ? 82.627  12.800  106.118 1.00 62.57  ? 164  ALA A CB    1 
ATOM   1258  N  N     . ILE A  1  165  ? 80.904  10.166  105.230 1.00 53.36  ? 165  ILE A N     1 
ATOM   1259  C  CA    . ILE A  1  165  ? 79.628  9.624   104.789 1.00 51.00  ? 165  ILE A CA    1 
ATOM   1260  C  C     . ILE A  1  165  ? 78.508  10.043  105.743 1.00 52.52  ? 165  ILE A C     1 
ATOM   1261  O  O     . ILE A  1  165  ? 78.467  9.581   106.883 1.00 53.95  ? 165  ILE A O     1 
ATOM   1262  C  CB    . ILE A  1  165  ? 79.690  8.090   104.775 1.00 48.65  ? 165  ILE A CB    1 
ATOM   1263  C  CG1   . ILE A  1  165  ? 80.823  7.613   103.862 1.00 46.10  ? 165  ILE A CG1   1 
ATOM   1264  C  CG2   . ILE A  1  165  ? 78.347  7.497   104.373 1.00 46.15  ? 165  ILE A CG2   1 
ATOM   1265  C  CD1   . ILE A  1  165  ? 81.121  6.136   103.983 1.00 41.34  ? 165  ILE A CD1   1 
ATOM   1266  N  N     . PRO A  1  166  ? 77.605  10.930  105.289 1.00 52.36  ? 166  PRO A N     1 
ATOM   1267  C  CA    . PRO A  1  166  ? 76.456  11.306  106.117 1.00 52.93  ? 166  PRO A CA    1 
ATOM   1268  C  C     . PRO A  1  166  ? 75.624  10.085  106.498 1.00 52.79  ? 166  PRO A C     1 
ATOM   1269  O  O     . PRO A  1  166  ? 75.448  9.181   105.679 1.00 53.91  ? 166  PRO A O     1 
ATOM   1270  C  CB    . PRO A  1  166  ? 75.659  12.230  105.198 1.00 49.98  ? 166  PRO A CB    1 
ATOM   1271  C  CG    . PRO A  1  166  ? 76.677  12.835  104.323 1.00 51.64  ? 166  PRO A CG    1 
ATOM   1272  C  CD    . PRO A  1  166  ? 77.682  11.746  104.066 1.00 51.51  ? 166  PRO A CD    1 
ATOM   1273  N  N     . VAL A  1  167  ? 75.137  10.055  107.734 1.00 52.45  ? 167  VAL A N     1 
ATOM   1274  C  CA    . VAL A  1  167  ? 74.378  8.912   108.222 1.00 50.23  ? 167  VAL A CA    1 
ATOM   1275  C  C     . VAL A  1  167  ? 72.984  9.336   108.669 1.00 50.44  ? 167  VAL A C     1 
ATOM   1276  O  O     . VAL A  1  167  ? 72.811  10.423  109.228 1.00 46.34  ? 167  VAL A O     1 
ATOM   1277  C  CB    . VAL A  1  167  ? 75.113  8.217   109.385 1.00 47.14  ? 167  VAL A CB    1 
ATOM   1278  C  CG1   . VAL A  1  167  ? 74.346  6.992   109.858 1.00 47.68  ? 167  VAL A CG1   1 
ATOM   1279  C  CG2   . VAL A  1  167  ? 76.513  7.824   108.957 1.00 46.27  ? 167  VAL A CG2   1 
ATOM   1280  N  N     . ASP A  1  168  ? 71.995  8.485   108.390 1.00 54.98  ? 168  ASP A N     1 
ATOM   1281  C  CA    . ASP A  1  168  ? 70.631  8.678   108.879 1.00 55.09  ? 168  ASP A CA    1 
ATOM   1282  C  C     . ASP A  1  168  ? 70.596  8.777   110.392 1.00 51.36  ? 168  ASP A C     1 
ATOM   1283  O  O     . ASP A  1  168  ? 71.103  7.901   111.096 1.00 56.11  ? 168  ASP A O     1 
ATOM   1284  C  CB    . ASP A  1  168  ? 69.736  7.519   108.450 1.00 58.64  ? 168  ASP A CB    1 
ATOM   1285  C  CG    . ASP A  1  168  ? 69.418  7.545   106.974 1.00 62.37  ? 168  ASP A CG    1 
ATOM   1286  O  OD1   . ASP A  1  168  ? 69.331  8.653   106.400 1.00 58.35  ? 168  ASP A OD1   1 
ATOM   1287  O  OD2   . ASP A  1  168  ? 69.250  6.454   106.393 1.00 67.27  ? 168  ASP A OD2   1 
ATOM   1288  N  N     . ALA A  1  169  ? 69.982  9.841   110.892 1.00 49.29  ? 169  ALA A N     1 
ATOM   1289  C  CA    . ALA A  1  169  ? 69.924  10.057  112.328 1.00 47.96  ? 169  ALA A CA    1 
ATOM   1290  C  C     . ALA A  1  169  ? 68.524  9.842   112.879 1.00 49.53  ? 169  ALA A C     1 
ATOM   1291  O  O     . ALA A  1  169  ? 67.610  10.621  112.606 1.00 49.48  ? 169  ALA A O     1 
ATOM   1292  C  CB    . ALA A  1  169  ? 70.420  11.451  112.672 1.00 50.26  ? 169  ALA A CB    1 
ATOM   1293  N  N     . VAL A  1  170  ? 68.362  8.791   113.674 1.00 49.28  ? 170  VAL A N     1 
ATOM   1294  C  CA    . VAL A  1  170  ? 67.141  8.648   114.439 1.00 55.05  ? 170  VAL A CA    1 
ATOM   1295  C  C     . VAL A  1  170  ? 67.515  9.153   115.814 1.00 52.84  ? 170  VAL A C     1 
ATOM   1296  O  O     . VAL A  1  170  ? 68.171  8.455   116.584 1.00 61.24  ? 170  VAL A O     1 
ATOM   1297  C  CB    . VAL A  1  170  ? 66.725  7.176   114.564 1.00 48.66  ? 170  VAL A CB    1 
ATOM   1298  C  CG1   . VAL A  1  170  ? 65.390  7.065   115.273 1.00 44.22  ? 170  VAL A CG1   1 
ATOM   1299  C  CG2   . VAL A  1  170  ? 66.668  6.523   113.200 1.00 53.18  ? 170  VAL A CG2   1 
ATOM   1300  N  N     . PHE A  1  171  ? 67.064  10.358  116.138 1.00 51.58  ? 171  PHE A N     1 
ATOM   1301  C  CA    . PHE A  1  171  ? 67.528  11.030  117.344 1.00 57.69  ? 171  PHE A CA    1 
ATOM   1302  C  C     . PHE A  1  171  ? 66.838  10.521  118.602 1.00 58.86  ? 171  PHE A C     1 
ATOM   1303  O  O     . PHE A  1  171  ? 67.488  10.305  119.625 1.00 58.04  ? 171  PHE A O     1 
ATOM   1304  C  CB    . PHE A  1  171  ? 67.357  12.543  117.218 1.00 53.63  ? 171  PHE A CB    1 
ATOM   1305  C  CG    . PHE A  1  171  ? 68.380  13.192  116.339 1.00 54.49  ? 171  PHE A CG    1 
ATOM   1306  C  CD1   . PHE A  1  171  ? 69.731  13.067  116.620 1.00 55.12  ? 171  PHE A CD1   1 
ATOM   1307  C  CD2   . PHE A  1  171  ? 67.994  13.939  115.238 1.00 56.07  ? 171  PHE A CD2   1 
ATOM   1308  C  CE1   . PHE A  1  171  ? 70.679  13.670  115.814 1.00 56.21  ? 171  PHE A CE1   1 
ATOM   1309  C  CE2   . PHE A  1  171  ? 68.939  14.548  114.429 1.00 52.83  ? 171  PHE A CE2   1 
ATOM   1310  C  CZ    . PHE A  1  171  ? 70.281  14.414  114.718 1.00 48.71  ? 171  PHE A CZ    1 
ATOM   1311  N  N     . SER A  1  172  ? 65.528  10.307  118.498 1.00 56.21  ? 172  SER A N     1 
ATOM   1312  C  CA    . SER A  1  172  ? 64.687  9.985   119.639 1.00 57.59  ? 172  SER A CA    1 
ATOM   1313  C  C     . SER A  1  172  ? 65.257  8.836   120.461 1.00 62.75  ? 172  SER A C     1 
ATOM   1314  O  O     . SER A  1  172  ? 65.539  7.759   119.926 1.00 59.84  ? 172  SER A O     1 
ATOM   1315  C  CB    . SER A  1  172  ? 63.268  9.644   119.171 1.00 60.31  ? 172  SER A CB    1 
ATOM   1316  O  OG    . SER A  1  172  ? 62.474  9.147   120.238 1.00 55.81  ? 172  SER A OG    1 
ATOM   1317  N  N     . PRO A  1  173  ? 65.478  9.094   121.761 1.00 62.11  ? 173  PRO A N     1 
ATOM   1318  C  CA    . PRO A  1  173  ? 65.927  8.129   122.766 1.00 59.53  ? 173  PRO A CA    1 
ATOM   1319  C  C     . PRO A  1  173  ? 64.819  7.156   123.149 1.00 57.38  ? 173  PRO A C     1 
ATOM   1320  O  O     . PRO A  1  173  ? 65.109  6.100   123.707 1.00 56.17  ? 173  PRO A O     1 
ATOM   1321  C  CB    . PRO A  1  173  ? 66.289  9.014   123.954 1.00 57.45  ? 173  PRO A CB    1 
ATOM   1322  C  CG    . PRO A  1  173  ? 65.364  10.165  123.834 1.00 59.83  ? 173  PRO A CG    1 
ATOM   1323  C  CD    . PRO A  1  173  ? 65.214  10.415  122.359 1.00 62.12  ? 173  PRO A CD    1 
ATOM   1324  N  N     . VAL A  1  174  ? 63.570  7.506   122.855 1.00 56.12  ? 174  VAL A N     1 
ATOM   1325  C  CA    . VAL A  1  174  ? 62.442  6.673   123.265 1.00 57.68  ? 174  VAL A CA    1 
ATOM   1326  C  C     . VAL A  1  174  ? 62.236  5.483   122.330 1.00 55.59  ? 174  VAL A C     1 
ATOM   1327  O  O     . VAL A  1  174  ? 61.949  5.653   121.146 1.00 60.63  ? 174  VAL A O     1 
ATOM   1328  C  CB    . VAL A  1  174  ? 61.133  7.480   123.312 1.00 48.77  ? 174  VAL A CB    1 
ATOM   1329  C  CG1   . VAL A  1  174  ? 60.003  6.599   123.794 1.00 50.58  ? 174  VAL A CG1   1 
ATOM   1330  C  CG2   . VAL A  1  174  ? 61.285  8.698   124.203 1.00 50.69  ? 174  VAL A CG2   1 
ATOM   1331  N  N     . ARG A  1  175  ? 62.380  4.279   122.874 1.00 53.24  ? 175  ARG A N     1 
ATOM   1332  C  CA    . ARG A  1  175  ? 62.131  3.059   122.118 1.00 47.20  ? 175  ARG A CA    1 
ATOM   1333  C  C     . ARG A  1  175  ? 60.655  2.660   122.062 1.00 47.27  ? 175  ARG A C     1 
ATOM   1334  O  O     . ARG A  1  175  ? 60.162  2.266   121.009 1.00 48.04  ? 175  ARG A O     1 
ATOM   1335  C  CB    . ARG A  1  175  ? 62.987  1.905   122.646 1.00 48.01  ? 175  ARG A CB    1 
ATOM   1336  C  CG    . ARG A  1  175  ? 64.476  2.191   122.590 1.00 56.04  ? 175  ARG A CG    1 
ATOM   1337  C  CD    . ARG A  1  175  ? 65.305  0.935   122.357 1.00 64.30  ? 175  ARG A CD    1 
ATOM   1338  N  NE    . ARG A  1  175  ? 66.718  1.257   122.148 1.00 86.58  ? 175  ARG A NE    1 
ATOM   1339  C  CZ    . ARG A  1  175  ? 67.226  1.737   121.012 1.00 90.34  ? 175  ARG A CZ    1 
ATOM   1340  N  NH1   . ARG A  1  175  ? 66.441  1.961   119.964 1.00 88.39  ? 175  ARG A NH1   1 
ATOM   1341  N  NH2   . ARG A  1  175  ? 68.524  2.001   120.922 1.00 83.82  ? 175  ARG A NH2   1 
ATOM   1342  N  N     . ARG A  1  176  ? 59.948  2.749   123.185 1.00 56.00  ? 176  ARG A N     1 
ATOM   1343  C  CA    . ARG A  1  176  ? 58.536  2.340   123.180 1.00 51.97  ? 176  ARG A CA    1 
ATOM   1344  C  C     . ARG A  1  176  ? 57.676  3.056   124.222 1.00 55.08  ? 176  ARG A C     1 
ATOM   1345  O  O     . ARG A  1  176  ? 58.149  3.394   125.303 1.00 57.41  ? 176  ARG A O     1 
ATOM   1346  C  CB    . ARG A  1  176  ? 58.419  0.818   123.343 1.00 50.63  ? 176  ARG A CB    1 
ATOM   1347  C  CG    . ARG A  1  176  ? 56.995  0.286   123.363 1.00 55.20  ? 176  ARG A CG    1 
ATOM   1348  C  CD    . ARG A  1  176  ? 56.852  -0.955  122.503 1.00 59.22  ? 176  ARG A CD    1 
ATOM   1349  N  NE    . ARG A  1  176  ? 57.736  -2.030  122.939 1.00 62.37  ? 176  ARG A NE    1 
ATOM   1350  C  CZ    . ARG A  1  176  ? 57.373  -3.001  123.768 1.00 72.20  ? 176  ARG A CZ    1 
ATOM   1351  N  NH1   . ARG A  1  176  ? 56.138  -3.035  124.248 1.00 70.33  ? 176  ARG A NH1   1 
ATOM   1352  N  NH2   . ARG A  1  176  ? 58.242  -3.942  124.113 1.00 83.05  ? 176  ARG A NH2   1 
ATOM   1353  N  N     . VAL A  1  177  ? 56.410  3.294   123.887 1.00 57.05  ? 177  VAL A N     1 
ATOM   1354  C  CA    . VAL A  1  177  ? 55.457  3.859   124.840 1.00 54.63  ? 177  VAL A CA    1 
ATOM   1355  C  C     . VAL A  1  177  ? 54.115  3.139   124.775 1.00 53.74  ? 177  VAL A C     1 
ATOM   1356  O  O     . VAL A  1  177  ? 53.496  3.048   123.713 1.00 54.00  ? 177  VAL A O     1 
ATOM   1357  C  CB    . VAL A  1  177  ? 55.193  5.355   124.590 1.00 53.09  ? 177  VAL A CB    1 
ATOM   1358  C  CG1   . VAL A  1  177  ? 54.268  5.899   125.666 1.00 50.53  ? 177  VAL A CG1   1 
ATOM   1359  C  CG2   . VAL A  1  177  ? 56.497  6.141   124.550 1.00 50.15  ? 177  VAL A CG2   1 
ATOM   1360  N  N     . ALA A  1  178  ? 53.666  2.626   125.912 1.00 56.23  ? 178  ALA A N     1 
ATOM   1361  C  CA    . ALA A  1  178  ? 52.319  2.076   126.004 1.00 55.78  ? 178  ALA A CA    1 
ATOM   1362  C  C     . ALA A  1  178  ? 51.633  2.690   127.212 1.00 60.00  ? 178  ALA A C     1 
ATOM   1363  O  O     . ALA A  1  178  ? 52.302  3.207   128.104 1.00 61.19  ? 178  ALA A O     1 
ATOM   1364  C  CB    . ALA A  1  178  ? 52.366  0.567   126.127 1.00 51.48  ? 178  ALA A CB    1 
ATOM   1365  N  N     . PHE A  1  179  ? 50.305  2.672   127.240 1.00 62.34  ? 179  PHE A N     1 
ATOM   1366  C  CA    . PHE A  1  179  ? 49.607  3.053   128.466 1.00 54.85  ? 179  PHE A CA    1 
ATOM   1367  C  C     . PHE A  1  179  ? 48.358  2.229   128.768 1.00 60.61  ? 179  PHE A C     1 
ATOM   1368  O  O     . PHE A  1  179  ? 47.501  2.013   127.912 1.00 59.65  ? 179  PHE A O     1 
ATOM   1369  C  CB    . PHE A  1  179  ? 49.348  4.569   128.561 1.00 53.63  ? 179  PHE A CB    1 
ATOM   1370  C  CG    . PHE A  1  179  ? 48.304  5.087   127.612 1.00 55.43  ? 179  PHE A CG    1 
ATOM   1371  C  CD1   . PHE A  1  179  ? 46.960  5.038   127.937 1.00 58.20  ? 179  PHE A CD1   1 
ATOM   1372  C  CD2   . PHE A  1  179  ? 48.670  5.667   126.414 1.00 59.34  ? 179  PHE A CD2   1 
ATOM   1373  C  CE1   . PHE A  1  179  ? 46.002  5.527   127.072 1.00 58.08  ? 179  PHE A CE1   1 
ATOM   1374  C  CE2   . PHE A  1  179  ? 47.713  6.154   125.546 1.00 62.48  ? 179  PHE A CE2   1 
ATOM   1375  C  CZ    . PHE A  1  179  ? 46.379  6.091   125.882 1.00 55.92  ? 179  PHE A CZ    1 
ATOM   1376  N  N     . GLN A  1  180  ? 48.282  1.771   130.011 1.00 67.78  ? 180  GLN A N     1 
ATOM   1377  C  CA    . GLN A  1  180  ? 47.157  0.998   130.497 1.00 61.95  ? 180  GLN A CA    1 
ATOM   1378  C  C     . GLN A  1  180  ? 46.129  1.929   131.140 1.00 55.51  ? 180  GLN A C     1 
ATOM   1379  O  O     . GLN A  1  180  ? 46.486  2.881   131.841 1.00 54.74  ? 180  GLN A O     1 
ATOM   1380  C  CB    . GLN A  1  180  ? 47.652  -0.020  131.522 1.00 64.56  ? 180  GLN A CB    1 
ATOM   1381  C  CG    . GLN A  1  180  ? 46.738  -1.208  131.724 1.00 74.16  ? 180  GLN A CG    1 
ATOM   1382  C  CD    . GLN A  1  180  ? 46.956  -2.283  130.684 1.00 84.23  ? 180  GLN A CD    1 
ATOM   1383  O  OE1   . GLN A  1  180  ? 47.766  -2.122  129.765 1.00 76.79  ? 180  GLN A OE1   1 
ATOM   1384  N  NE2   . GLN A  1  180  ? 46.238  -3.394  130.824 1.00 88.98  ? 180  GLN A NE2   1 
ATOM   1385  N  N     . VAL A  1  181  ? 44.856  1.665   130.876 1.00 51.33  ? 181  VAL A N     1 
ATOM   1386  C  CA    . VAL A  1  181  ? 43.772  2.330   131.585 1.00 53.64  ? 181  VAL A CA    1 
ATOM   1387  C  C     . VAL A  1  181  ? 42.939  1.269   132.293 1.00 59.74  ? 181  VAL A C     1 
ATOM   1388  O  O     . VAL A  1  181  ? 42.274  0.451   131.645 1.00 57.22  ? 181  VAL A O     1 
ATOM   1389  C  CB    . VAL A  1  181  ? 42.872  3.146   130.637 1.00 53.27  ? 181  VAL A CB    1 
ATOM   1390  C  CG1   . VAL A  1  181  ? 41.638  3.632   131.374 1.00 58.16  ? 181  VAL A CG1   1 
ATOM   1391  C  CG2   . VAL A  1  181  ? 43.635  4.323   130.054 1.00 53.34  ? 181  VAL A CG2   1 
ATOM   1392  N  N     . GLU A  1  182  ? 42.975  1.274   133.623 1.00 66.42  ? 182  GLU A N     1 
ATOM   1393  C  CA    . GLU A  1  182  ? 42.259  0.251   134.388 1.00 68.94  ? 182  GLU A CA    1 
ATOM   1394  C  C     . GLU A  1  182  ? 41.159  0.847   135.260 1.00 65.17  ? 182  GLU A C     1 
ATOM   1395  O  O     . GLU A  1  182  ? 41.188  2.030   135.572 1.00 64.15  ? 182  GLU A O     1 
ATOM   1396  C  CB    . GLU A  1  182  ? 43.231  -0.564  135.234 1.00 62.79  ? 182  GLU A CB    1 
ATOM   1397  C  CG    . GLU A  1  182  ? 44.191  -1.399  134.425 1.00 69.55  ? 182  GLU A CG    1 
ATOM   1398  C  CD    . GLU A  1  182  ? 45.337  -1.927  135.261 1.00 85.65  ? 182  GLU A CD    1 
ATOM   1399  O  OE1   . GLU A  1  182  ? 45.244  -3.084  135.726 1.00 85.55  ? 182  GLU A OE1   1 
ATOM   1400  O  OE2   . GLU A  1  182  ? 46.327  -1.184  135.455 1.00 83.86  ? 182  GLU A OE2   1 
ATOM   1401  N  N     . ASP A  1  183  ? 40.181  0.030   135.639 1.00 66.67  ? 183  ASP A N     1 
ATOM   1402  C  CA    . ASP A  1  183  ? 39.080  0.512   136.472 1.00 74.06  ? 183  ASP A CA    1 
ATOM   1403  C  C     . ASP A  1  183  ? 39.506  0.738   137.923 1.00 69.69  ? 183  ASP A C     1 
ATOM   1404  O  O     . ASP A  1  183  ? 40.345  0.009   138.452 1.00 66.64  ? 183  ASP A O     1 
ATOM   1405  C  CB    . ASP A  1  183  ? 37.893  -0.450  136.417 1.00 71.69  ? 183  ASP A CB    1 
ATOM   1406  C  CG    . ASP A  1  183  ? 36.563  0.265   136.549 1.00 80.63  ? 183  ASP A CG    1 
ATOM   1407  O  OD1   . ASP A  1  183  ? 36.575  1.476   136.859 1.00 85.12  ? 183  ASP A OD1   1 
ATOM   1408  O  OD2   . ASP A  1  183  ? 35.510  -0.377  136.348 1.00 83.20  ? 183  ASP A OD2   1 
ATOM   1409  N  N     . THR A  1  184  ? 38.924  1.758   138.553 1.00 70.58  ? 184  THR A N     1 
ATOM   1410  C  CA    . THR A  1  184  ? 39.193  2.083   139.956 1.00 73.66  ? 184  THR A CA    1 
ATOM   1411  C  C     . THR A  1  184  ? 38.044  2.881   140.590 1.00 78.80  ? 184  THR A C     1 
ATOM   1412  O  O     . THR A  1  184  ? 37.175  3.425   139.885 1.00 81.76  ? 184  THR A O     1 
ATOM   1413  C  CB    . THR A  1  184  ? 40.535  2.843   140.130 1.00 68.29  ? 184  THR A CB    1 
ATOM   1414  O  OG1   . THR A  1  184  ? 41.152  2.459   141.363 1.00 72.23  ? 184  THR A OG1   1 
ATOM   1415  C  CG2   . THR A  1  184  ? 40.327  4.353   140.121 1.00 67.44  ? 184  THR A CG2   1 
ATOM   1416  N  N     . ARG A  1  185  ? 38.039  2.937   141.921 1.00 82.46  ? 185  ARG A N     1 
ATOM   1417  C  CA    . ARG A  1  185  ? 36.987  3.628   142.663 1.00 88.13  ? 185  ARG A CA    1 
ATOM   1418  C  C     . ARG A  1  185  ? 37.527  4.386   143.875 1.00 83.89  ? 185  ARG A C     1 
ATOM   1419  O  O     . ARG A  1  185  ? 38.543  4.002   144.454 1.00 74.09  ? 185  ARG A O     1 
ATOM   1420  C  CB    . ARG A  1  185  ? 35.914  2.631   143.113 1.00 92.43  ? 185  ARG A CB    1 
ATOM   1421  C  CG    . ARG A  1  185  ? 36.419  1.549   144.058 1.00 92.90  ? 185  ARG A CG    1 
ATOM   1422  C  CD    . ARG A  1  185  ? 35.351  0.493   144.303 1.00 106.88 ? 185  ARG A CD    1 
ATOM   1423  N  NE    . ARG A  1  185  ? 34.077  1.088   144.701 1.00 124.40 ? 185  ARG A NE    1 
ATOM   1424  C  CZ    . ARG A  1  185  ? 32.974  0.392   144.958 1.00 130.57 ? 185  ARG A CZ    1 
ATOM   1425  N  NH1   . ARG A  1  185  ? 32.987  -0.931  144.862 1.00 132.63 ? 185  ARG A NH1   1 
ATOM   1426  N  NH2   . ARG A  1  185  ? 31.856  1.018   145.312 1.00 118.06 ? 185  ARG A NH2   1 
ATOM   1427  N  N     . LEU A  1  186  ? 36.858  5.483   144.227 1.00 89.52  ? 186  LEU A N     1 
ATOM   1428  C  CA    . LEU A  1  186  ? 37.100  6.170   145.494 1.00 94.61  ? 186  LEU A CA    1 
ATOM   1429  C  C     . LEU A  1  186  ? 36.063  5.704   146.522 1.00 109.68 ? 186  LEU A C     1 
ATOM   1430  O  O     . LEU A  1  186  ? 35.964  6.231   147.631 1.00 107.59 ? 186  LEU A O     1 
ATOM   1431  C  CB    . LEU A  1  186  ? 37.083  7.688   145.317 1.00 94.55  ? 186  LEU A CB    1 
ATOM   1432  C  CG    . LEU A  1  186  ? 37.978  8.478   146.280 1.00 94.13  ? 186  LEU A CG    1 
ATOM   1433  C  CD1   . LEU A  1  186  ? 39.120  7.631   146.820 1.00 84.80  ? 186  LEU A CD1   1 
ATOM   1434  C  CD2   . LEU A  1  186  ? 38.519  9.734   145.611 1.00 100.25 ? 186  LEU A CD2   1 
ATOM   1435  N  N     . GLY A  1  187  ? 35.329  4.674   146.139 1.00 113.29 ? 187  GLY A N     1 
ATOM   1436  C  CA    . GLY A  1  187  ? 34.561  3.848   147.039 1.00 99.85  ? 187  GLY A CA    1 
ATOM   1437  C  C     . GLY A  1  187  ? 33.257  4.551   147.209 1.00 111.83 ? 187  GLY A C     1 
ATOM   1438  O  O     . GLY A  1  187  ? 32.285  4.003   147.705 1.00 125.92 ? 187  GLY A O     1 
ATOM   1439  N  N     . GLN A  1  188  ? 33.242  5.786   146.747 1.00 110.36 ? 188  GLN A N     1 
ATOM   1440  C  CA    . GLN A  1  188  ? 32.037  6.565   146.716 1.00 117.18 ? 188  GLN A CA    1 
ATOM   1441  C  C     . GLN A  1  188  ? 31.526  6.469   145.306 1.00 114.99 ? 188  GLN A C     1 
ATOM   1442  O  O     . GLN A  1  188  ? 30.334  6.335   145.061 1.00 105.50 ? 188  GLN A O     1 
ATOM   1443  C  CB    . GLN A  1  188  ? 32.374  8.012   147.051 1.00 119.40 ? 188  GLN A CB    1 
ATOM   1444  C  CG    . GLN A  1  188  ? 31.168  8.895   147.298 1.00 125.76 ? 188  GLN A CG    1 
ATOM   1445  C  CD    . GLN A  1  188  ? 30.553  9.399   146.014 1.00 126.36 ? 188  GLN A CD    1 
ATOM   1446  O  OE1   . GLN A  1  188  ? 30.070  8.615   145.196 1.00 125.85 ? 188  GLN A OE1   1 
ATOM   1447  N  NE2   . GLN A  1  188  ? 30.568  10.715  145.827 1.00 114.97 ? 188  GLN A NE2   1 
ATOM   1448  N  N     . ARG A  1  189  ? 32.475  6.499   144.381 1.00 114.69 ? 189  ARG A N     1 
ATOM   1449  C  CA    . ARG A  1  189  ? 32.202  6.643   142.971 1.00 98.56  ? 189  ARG A CA    1 
ATOM   1450  C  C     . ARG A  1  189  ? 32.896  5.554   142.216 1.00 89.14  ? 189  ARG A C     1 
ATOM   1451  O  O     . ARG A  1  189  ? 33.949  5.087   142.607 1.00 88.02  ? 189  ARG A O     1 
ATOM   1452  C  CB    . ARG A  1  189  ? 32.729  7.979   142.501 1.00 84.99  ? 189  ARG A CB    1 
ATOM   1453  C  CG    . ARG A  1  189  ? 33.647  8.608   143.516 1.00 94.23  ? 189  ARG A CG    1 
ATOM   1454  C  CD    . ARG A  1  189  ? 33.742  10.088  143.276 1.00 89.20  ? 189  ARG A CD    1 
ATOM   1455  N  NE    . ARG A  1  189  ? 33.354  10.393  141.917 1.00 91.65  ? 189  ARG A NE    1 
ATOM   1456  C  CZ    . ARG A  1  189  ? 33.380  11.612  141.408 1.00 105.61 ? 189  ARG A CZ    1 
ATOM   1457  N  NH1   . ARG A  1  189  ? 33.770  12.626  142.164 1.00 103.73 ? 189  ARG A NH1   1 
ATOM   1458  N  NH2   . ARG A  1  189  ? 33.015  11.816  140.153 1.00 98.07  ? 189  ARG A NH2   1 
ATOM   1459  N  N     . THR A  1  190  ? 32.298  5.164   141.111 1.00 89.08  ? 190  THR A N     1 
ATOM   1460  C  CA    . THR A  1  190  ? 32.754  4.022   140.367 1.00 100.16 ? 190  THR A CA    1 
ATOM   1461  C  C     . THR A  1  190  ? 32.993  4.410   138.932 1.00 95.45  ? 190  THR A C     1 
ATOM   1462  O  O     . THR A  1  190  ? 32.601  5.479   138.491 1.00 91.73  ? 190  THR A O     1 
ATOM   1463  C  CB    . THR A  1  190  ? 31.738  2.885   140.411 1.00 94.08  ? 190  THR A CB    1 
ATOM   1464  O  OG1   . THR A  1  190  ? 30.449  3.396   140.071 1.00 87.46  ? 190  THR A OG1   1 
ATOM   1465  C  CG2   . THR A  1  190  ? 31.696  2.299   141.791 1.00 84.26  ? 190  THR A CG2   1 
ATOM   1466  N  N     . ASP A  1  191  ? 33.699  3.558   138.218 1.00 85.65  ? 191  ASP A N     1 
ATOM   1467  C  CA    . ASP A  1  191  ? 34.073  3.885   136.848 1.00 88.57  ? 191  ASP A CA    1 
ATOM   1468  C  C     . ASP A  1  191  ? 35.118  5.001   136.782 1.00 82.12  ? 191  ASP A C     1 
ATOM   1469  O  O     . ASP A  1  191  ? 35.206  5.717   135.786 1.00 80.97  ? 191  ASP A O     1 
ATOM   1470  C  CB    . ASP A  1  191  ? 32.835  4.250   136.015 1.00 99.83  ? 191  ASP A CB    1 
ATOM   1471  C  CG    . ASP A  1  191  ? 33.024  3.986   134.522 1.00 109.74 ? 191  ASP A CG    1 
ATOM   1472  O  OD1   . ASP A  1  191  ? 34.164  3.688   134.094 1.00 97.90  ? 191  ASP A OD1   1 
ATOM   1473  O  OD2   . ASP A  1  191  ? 32.025  4.085   133.774 1.00 110.65 ? 191  ASP A OD2   1 
ATOM   1474  N  N     . LEU A  1  192  ? 35.936  5.115   137.810 1.00 78.92  ? 192  LEU A N     1 
ATOM   1475  C  CA    . LEU A  1  192  ? 37.099  5.982   137.766 1.00 74.51  ? 192  LEU A CA    1 
ATOM   1476  C  C     . LEU A  1  192  ? 38.220  5.321   136.972 1.00 71.39  ? 192  LEU A C     1 
ATOM   1477  O  O     . LEU A  1  192  ? 38.192  4.124   136.756 1.00 71.33  ? 192  LEU A O     1 
ATOM   1478  C  CB    . LEU A  1  192  ? 37.562  6.317   139.172 1.00 74.51  ? 192  LEU A CB    1 
ATOM   1479  C  CG    . LEU A  1  192  ? 36.715  7.345   139.892 1.00 69.57  ? 192  LEU A CG    1 
ATOM   1480  C  CD1   . LEU A  1  192  ? 37.579  8.090   140.880 1.00 69.27  ? 192  LEU A CD1   1 
ATOM   1481  C  CD2   . LEU A  1  192  ? 36.107  8.301   138.894 1.00 62.25  ? 192  LEU A CD2   1 
ATOM   1482  N  N     . ASP A  1  193  ? 39.198  6.108   136.540 1.00 66.71  ? 193  ASP A N     1 
ATOM   1483  C  CA    . ASP A  1  193  ? 40.271  5.639   135.668 1.00 67.62  ? 193  ASP A CA    1 
ATOM   1484  C  C     . ASP A  1  193  ? 41.605  5.604   136.367 1.00 64.90  ? 193  ASP A C     1 
ATOM   1485  O  O     . ASP A  1  193  ? 41.983  6.569   136.989 1.00 66.36  ? 193  ASP A O     1 
ATOM   1486  C  CB    . ASP A  1  193  ? 40.450  6.612   134.511 1.00 62.11  ? 193  ASP A CB    1 
ATOM   1487  C  CG    . ASP A  1  193  ? 39.527  6.351   133.382 1.00 66.79  ? 193  ASP A CG    1 
ATOM   1488  O  OD1   . ASP A  1  193  ? 38.862  5.313   133.374 1.00 72.81  ? 193  ASP A OD1   1 
ATOM   1489  O  OD2   . ASP A  1  193  ? 39.462  7.196   132.490 1.00 67.69  ? 193  ASP A OD2   1 
ATOM   1490  N  N     . LYS A  1  194  ? 42.344  4.517   136.231 1.00 61.87  ? 194  LYS A N     1 
ATOM   1491  C  CA    . LYS A  1  194  ? 43.712  4.488   136.722 1.00 64.36  ? 194  LYS A CA    1 
ATOM   1492  C  C     . LYS A  1  194  ? 44.680  4.419   135.554 1.00 68.44  ? 194  LYS A C     1 
ATOM   1493  O  O     . LYS A  1  194  ? 44.622  3.491   134.773 1.00 65.73  ? 194  LYS A O     1 
ATOM   1494  C  CB    . LYS A  1  194  ? 43.899  3.280   137.616 1.00 65.04  ? 194  LYS A CB    1 
ATOM   1495  C  CG    . LYS A  1  194  ? 45.325  2.824   137.774 1.00 61.66  ? 194  LYS A CG    1 
ATOM   1496  C  CD    . LYS A  1  194  ? 45.350  1.383   138.226 1.00 59.34  ? 194  LYS A CD    1 
ATOM   1497  C  CE    . LYS A  1  194  ? 46.621  1.062   138.972 1.00 62.68  ? 194  LYS A CE    1 
ATOM   1498  N  NZ    . LYS A  1  194  ? 46.591  -0.325  139.492 1.00 68.13  ? 194  LYS A NZ    1 
ATOM   1499  N  N     . LEU A  1  195  ? 45.585  5.385   135.446 1.00 65.29  ? 195  LEU A N     1 
ATOM   1500  C  CA    . LEU A  1  195  ? 46.423  5.493   134.255 1.00 57.37  ? 195  LEU A CA    1 
ATOM   1501  C  C     . LEU A  1  195  ? 47.856  5.042   134.501 1.00 56.52  ? 195  LEU A C     1 
ATOM   1502  O  O     . LEU A  1  195  ? 48.504  5.504   135.431 1.00 59.15  ? 195  LEU A O     1 
ATOM   1503  C  CB    . LEU A  1  195  ? 46.437  6.935   133.754 1.00 56.74  ? 195  LEU A CB    1 
ATOM   1504  C  CG    . LEU A  1  195  ? 47.483  7.214   132.674 1.00 52.95  ? 195  LEU A CG    1 
ATOM   1505  C  CD1   . LEU A  1  195  ? 47.171  6.408   131.418 1.00 56.14  ? 195  LEU A CD1   1 
ATOM   1506  C  CD2   . LEU A  1  195  ? 47.568  8.704   132.368 1.00 50.07  ? 195  LEU A CD2   1 
ATOM   1507  N  N     . THR A  1  196  ? 48.365  4.155   133.656 1.00 61.07  ? 196  THR A N     1 
ATOM   1508  C  CA    . THR A  1  196  ? 49.750  3.720   133.804 1.00 59.40  ? 196  THR A CA    1 
ATOM   1509  C  C     . THR A  1  196  ? 50.549  3.862   132.511 1.00 63.14  ? 196  THR A C     1 
ATOM   1510  O  O     . THR A  1  196  ? 50.277  3.178   131.531 1.00 64.13  ? 196  THR A O     1 
ATOM   1511  C  CB    . THR A  1  196  ? 49.829  2.264   134.270 1.00 60.60  ? 196  THR A CB    1 
ATOM   1512  O  OG1   . THR A  1  196  ? 48.772  2.001   135.203 1.00 67.62  ? 196  THR A OG1   1 
ATOM   1513  C  CG2   . THR A  1  196  ? 51.176  1.996   134.918 1.00 59.52  ? 196  THR A CG2   1 
ATOM   1514  N  N     . LEU A  1  197  ? 51.545  4.743   132.524 1.00 60.39  ? 197  LEU A N     1 
ATOM   1515  C  CA    . LEU A  1  197  ? 52.409  4.967   131.372 1.00 53.87  ? 197  LEU A CA    1 
ATOM   1516  C  C     . LEU A  1  197  ? 53.661  4.105   131.447 1.00 57.84  ? 197  LEU A C     1 
ATOM   1517  O  O     . LEU A  1  197  ? 54.515  4.322   132.306 1.00 62.25  ? 197  LEU A O     1 
ATOM   1518  C  CB    . LEU A  1  197  ? 52.837  6.431   131.315 1.00 52.88  ? 197  LEU A CB    1 
ATOM   1519  C  CG    . LEU A  1  197  ? 51.916  7.441   130.637 1.00 58.80  ? 197  LEU A CG    1 
ATOM   1520  C  CD1   . LEU A  1  197  ? 52.477  8.841   130.811 1.00 60.26  ? 197  LEU A CD1   1 
ATOM   1521  C  CD2   . LEU A  1  197  ? 51.763  7.111   129.166 1.00 58.77  ? 197  LEU A CD2   1 
ATOM   1522  N  N     . ARG A  1  198  ? 53.773  3.139   130.542 1.00 53.87  ? 198  ARG A N     1 
ATOM   1523  C  CA    . ARG A  1  198  ? 54.982  2.337   130.416 1.00 52.65  ? 198  ARG A CA    1 
ATOM   1524  C  C     . ARG A  1  198  ? 55.874  2.928   129.334 1.00 54.49  ? 198  ARG A C     1 
ATOM   1525  O  O     . ARG A  1  198  ? 55.436  3.142   128.203 1.00 57.36  ? 198  ARG A O     1 
ATOM   1526  C  CB    . ARG A  1  198  ? 54.637  0.895   130.076 1.00 51.53  ? 198  ARG A CB    1 
ATOM   1527  C  CG    . ARG A  1  198  ? 53.358  0.433   130.693 1.00 53.09  ? 198  ARG A CG    1 
ATOM   1528  C  CD    . ARG A  1  198  ? 53.496  -0.979  131.126 1.00 55.87  ? 198  ARG A CD    1 
ATOM   1529  N  NE    . ARG A  1  198  ? 53.225  -1.965  130.140 1.00 54.89  ? 198  ARG A NE    1 
ATOM   1530  C  CZ    . ARG A  1  198  ? 53.785  -3.153  129.955 1.00 67.25  ? 198  ARG A CZ    1 
ATOM   1531  N  NH1   . ARG A  1  198  ? 53.281  -3.856  128.963 1.00 76.27  ? 198  ARG A NH1   1 
ATOM   1532  N  NH2   . ARG A  1  198  ? 54.797  -3.642  130.672 1.00 62.50  ? 198  ARG A NH2   1 
ATOM   1533  N  N     . ILE A  1  199  ? 57.127  3.190   129.694 1.00 56.25  ? 199  ILE A N     1 
ATOM   1534  C  CA    . ILE A  1  199  ? 58.072  3.861   128.811 1.00 48.94  ? 199  ILE A CA    1 
ATOM   1535  C  C     . ILE A  1  199  ? 59.414  3.136   128.755 1.00 56.83  ? 199  ILE A C     1 
ATOM   1536  O  O     . ILE A  1  199  ? 60.102  3.005   129.774 1.00 61.98  ? 199  ILE A O     1 
ATOM   1537  C  CB    . ILE A  1  199  ? 58.331  5.300   129.282 1.00 48.24  ? 199  ILE A CB    1 
ATOM   1538  C  CG1   . ILE A  1  199  ? 57.075  6.152   129.124 1.00 48.47  ? 199  ILE A CG1   1 
ATOM   1539  C  CG2   . ILE A  1  199  ? 59.477  5.917   128.513 1.00 50.26  ? 199  ILE A CG2   1 
ATOM   1540  C  CD1   . ILE A  1  199  ? 57.260  7.567   129.600 1.00 47.74  ? 199  ILE A CD1   1 
ATOM   1541  N  N     . TRP A  1  200  ? 59.776  2.667   127.561 1.00 57.22  ? 200  TRP A N     1 
ATOM   1542  C  CA    . TRP A  1  200  ? 61.088  2.083   127.310 1.00 53.38  ? 200  TRP A CA    1 
ATOM   1543  C  C     . TRP A  1  200  ? 61.981  3.063   126.552 1.00 57.20  ? 200  TRP A C     1 
ATOM   1544  O  O     . TRP A  1  200  ? 61.545  3.694   125.575 1.00 54.41  ? 200  TRP A O     1 
ATOM   1545  C  CB    . TRP A  1  200  ? 60.966  0.833   126.457 1.00 48.30  ? 200  TRP A CB    1 
ATOM   1546  C  CG    . TRP A  1  200  ? 60.266  -0.326  127.058 1.00 46.88  ? 200  TRP A CG    1 
ATOM   1547  C  CD1   . TRP A  1  200  ? 60.840  -1.463  127.547 1.00 43.26  ? 200  TRP A CD1   1 
ATOM   1548  C  CD2   . TRP A  1  200  ? 58.851  -0.505  127.176 1.00 54.13  ? 200  TRP A CD2   1 
ATOM   1549  N  NE1   . TRP A  1  200  ? 59.870  -2.333  127.979 1.00 48.75  ? 200  TRP A NE1   1 
ATOM   1550  C  CE2   . TRP A  1  200  ? 58.639  -1.770  127.762 1.00 54.31  ? 200  TRP A CE2   1 
ATOM   1551  C  CE3   . TRP A  1  200  ? 57.743  0.283   126.853 1.00 53.93  ? 200  TRP A CE3   1 
ATOM   1552  C  CZ2   . TRP A  1  200  ? 57.362  -2.265  128.033 1.00 54.65  ? 200  TRP A CZ2   1 
ATOM   1553  C  CZ3   . TRP A  1  200  ? 56.475  -0.210  127.122 1.00 55.60  ? 200  TRP A CZ3   1 
ATOM   1554  C  CH2   . TRP A  1  200  ? 56.296  -1.472  127.706 1.00 56.82  ? 200  TRP A CH2   1 
ATOM   1555  N  N     . THR A  1  201  ? 63.243  3.133   126.973 1.00 60.93  ? 201  THR A N     1 
ATOM   1556  C  CA    . THR A  1  201  ? 64.218  4.078   126.436 1.00 59.77  ? 201  THR A CA    1 
ATOM   1557  C  C     . THR A  1  201  ? 65.570  3.386   126.196 1.00 66.60  ? 201  THR A C     1 
ATOM   1558  O  O     . THR A  1  201  ? 65.803  2.285   126.696 1.00 72.07  ? 201  THR A O     1 
ATOM   1559  C  CB    . THR A  1  201  ? 64.392  5.259   127.410 1.00 60.96  ? 201  THR A CB    1 
ATOM   1560  O  OG1   . THR A  1  201  ? 63.103  5.673   127.873 1.00 67.80  ? 201  THR A OG1   1 
ATOM   1561  C  CG2   . THR A  1  201  ? 65.025  6.429   126.726 1.00 67.89  ? 201  THR A CG2   1 
ATOM   1562  N  N     . ASP A  1  202  ? 66.450  4.022   125.421 1.00 63.98  ? 202  ASP A N     1 
ATOM   1563  C  CA    . ASP A  1  202  ? 67.782  3.480   125.141 1.00 63.84  ? 202  ASP A CA    1 
ATOM   1564  C  C     . ASP A  1  202  ? 68.781  3.715   126.276 1.00 71.44  ? 202  ASP A C     1 
ATOM   1565  O  O     . ASP A  1  202  ? 69.898  3.188   126.254 1.00 69.87  ? 202  ASP A O     1 
ATOM   1566  C  CB    . ASP A  1  202  ? 68.346  4.030   123.820 1.00 66.80  ? 202  ASP A CB    1 
ATOM   1567  C  CG    . ASP A  1  202  ? 68.456  5.558   123.800 1.00 64.95  ? 202  ASP A CG    1 
ATOM   1568  O  OD1   . ASP A  1  202  ? 68.358  6.197   124.867 1.00 63.56  ? 202  ASP A OD1   1 
ATOM   1569  O  OD2   . ASP A  1  202  ? 68.655  6.122   122.699 1.00 67.14  ? 202  ASP A OD2   1 
ATOM   1570  N  N     . GLY A  1  203  ? 68.382  4.519   127.256 1.00 69.42  ? 203  GLY A N     1 
ATOM   1571  C  CA    . GLY A  1  203  ? 69.227  4.786   128.403 1.00 68.40  ? 203  GLY A CA    1 
ATOM   1572  C  C     . GLY A  1  203  ? 69.937  6.125   128.350 1.00 64.91  ? 203  GLY A C     1 
ATOM   1573  O  O     . GLY A  1  203  ? 70.436  6.602   129.365 1.00 65.92  ? 203  GLY A O     1 
ATOM   1574  N  N     . SER A  1  204  ? 69.997  6.732   127.171 1.00 65.62  ? 204  SER A N     1 
ATOM   1575  C  CA    . SER A  1  204  ? 70.640  8.035   127.045 1.00 68.78  ? 204  SER A CA    1 
ATOM   1576  C  C     . SER A  1  204  ? 69.847  9.067   127.839 1.00 63.85  ? 204  SER A C     1 
ATOM   1577  O  O     . SER A  1  204  ? 70.419  9.938   128.497 1.00 65.30  ? 204  SER A O     1 
ATOM   1578  C  CB    . SER A  1  204  ? 70.794  8.450   125.577 1.00 61.34  ? 204  SER A CB    1 
ATOM   1579  O  OG    . SER A  1  204  ? 69.545  8.491   124.912 1.00 69.11  ? 204  SER A OG    1 
ATOM   1580  N  N     . VAL A  1  205  ? 68.525  8.970   127.771 1.00 57.95  ? 205  VAL A N     1 
ATOM   1581  C  CA    . VAL A  1  205  ? 67.687  9.684   128.720 1.00 65.47  ? 205  VAL A CA    1 
ATOM   1582  C  C     . VAL A  1  205  ? 66.804  8.683   129.454 1.00 65.52  ? 205  VAL A C     1 
ATOM   1583  O  O     . VAL A  1  205  ? 66.559  7.579   128.978 1.00 62.10  ? 205  VAL A O     1 
ATOM   1584  C  CB    . VAL A  1  205  ? 66.849  10.816  128.082 1.00 56.80  ? 205  VAL A CB    1 
ATOM   1585  C  CG1   . VAL A  1  205  ? 67.579  11.418  126.891 1.00 50.51  ? 205  VAL A CG1   1 
ATOM   1586  C  CG2   . VAL A  1  205  ? 65.477  10.317  127.698 1.00 57.43  ? 205  VAL A CG2   1 
ATOM   1587  N  N     . THR A  1  206  ? 66.362  9.069   130.640 1.00 68.48  ? 206  THR A N     1 
ATOM   1588  C  CA    . THR A  1  206  ? 65.619  8.180   131.508 1.00 64.40  ? 206  THR A CA    1 
ATOM   1589  C  C     . THR A  1  206  ? 64.135  8.299   131.195 1.00 60.46  ? 206  THR A C     1 
ATOM   1590  O  O     . THR A  1  206  ? 63.671  9.383   130.839 1.00 62.25  ? 206  THR A O     1 
ATOM   1591  C  CB    . THR A  1  206  ? 65.947  8.517   132.980 1.00 68.89  ? 206  THR A CB    1 
ATOM   1592  O  OG1   . THR A  1  206  ? 67.110  7.778   133.380 1.00 68.12  ? 206  THR A OG1   1 
ATOM   1593  C  CG2   . THR A  1  206  ? 64.787  8.208   133.922 1.00 73.56  ? 206  THR A CG2   1 
ATOM   1594  N  N     . PRO A  1  207  ? 63.395  7.179   131.289 1.00 54.99  ? 207  PRO A N     1 
ATOM   1595  C  CA    . PRO A  1  207  ? 61.944  7.189   131.080 1.00 56.53  ? 207  PRO A CA    1 
ATOM   1596  C  C     . PRO A  1  207  ? 61.274  8.322   131.851 1.00 59.88  ? 207  PRO A C     1 
ATOM   1597  O  O     . PRO A  1  207  ? 60.386  8.983   131.312 1.00 58.42  ? 207  PRO A O     1 
ATOM   1598  C  CB    . PRO A  1  207  ? 61.508  5.832   131.637 1.00 53.64  ? 207  PRO A CB    1 
ATOM   1599  C  CG    . PRO A  1  207  ? 62.676  4.946   131.379 1.00 49.39  ? 207  PRO A CG    1 
ATOM   1600  C  CD    . PRO A  1  207  ? 63.901  5.817   131.531 1.00 57.90  ? 207  PRO A CD    1 
ATOM   1601  N  N     . LEU A  1  208  ? 61.716  8.561   133.082 1.00 57.93  ? 208  LEU A N     1 
ATOM   1602  C  CA    . LEU A  1  208  ? 61.208  9.685   133.855 1.00 61.08  ? 208  LEU A CA    1 
ATOM   1603  C  C     . LEU A  1  208  ? 61.569  11.028  133.216 1.00 60.00  ? 208  LEU A C     1 
ATOM   1604  O  O     . LEU A  1  208  ? 60.712  11.905  133.084 1.00 60.48  ? 208  LEU A O     1 
ATOM   1605  C  CB    . LEU A  1  208  ? 61.704  9.623   135.299 1.00 70.90  ? 208  LEU A CB    1 
ATOM   1606  C  CG    . LEU A  1  208  ? 61.277  10.762  136.232 1.00 60.03  ? 208  LEU A CG    1 
ATOM   1607  C  CD1   . LEU A  1  208  ? 59.767  10.897  136.302 1.00 52.28  ? 208  LEU A CD1   1 
ATOM   1608  C  CD2   . LEU A  1  208  ? 61.848  10.519  137.606 1.00 60.18  ? 208  LEU A CD2   1 
ATOM   1609  N  N     . GLU A  1  209  ? 62.830  11.185  132.819 1.00 60.90  ? 209  GLU A N     1 
ATOM   1610  C  CA    . GLU A  1  209  ? 63.272  12.407  132.147 1.00 62.24  ? 209  GLU A CA    1 
ATOM   1611  C  C     . GLU A  1  209  ? 62.438  12.640  130.893 1.00 62.46  ? 209  GLU A C     1 
ATOM   1612  O  O     . GLU A  1  209  ? 61.992  13.762  130.618 1.00 61.31  ? 209  GLU A O     1 
ATOM   1613  C  CB    . GLU A  1  209  ? 64.751  12.314  131.779 1.00 63.50  ? 209  GLU A CB    1 
ATOM   1614  C  CG    . GLU A  1  209  ? 65.666  12.020  132.954 1.00 64.39  ? 209  GLU A CG    1 
ATOM   1615  C  CD    . GLU A  1  209  ? 67.117  11.853  132.540 1.00 77.25  ? 209  GLU A CD    1 
ATOM   1616  O  OE1   . GLU A  1  209  ? 67.867  11.158  133.259 1.00 81.71  ? 209  GLU A OE1   1 
ATOM   1617  O  OE2   . GLU A  1  209  ? 67.512  12.420  131.499 1.00 80.67  ? 209  GLU A OE2   1 
ATOM   1618  N  N     . ALA A  1  210  ? 62.220  11.558  130.149 1.00 63.35  ? 210  ALA A N     1 
ATOM   1619  C  CA    . ALA A  1  210  ? 61.381  11.585  128.957 1.00 60.36  ? 210  ALA A CA    1 
ATOM   1620  C  C     . ALA A  1  210  ? 59.989  12.114  129.283 1.00 58.07  ? 210  ALA A C     1 
ATOM   1621  O  O     . ALA A  1  210  ? 59.540  13.092  128.690 1.00 51.83  ? 210  ALA A O     1 
ATOM   1622  C  CB    . ALA A  1  210  ? 61.288  10.198  128.351 1.00 57.80  ? 210  ALA A CB    1 
ATOM   1623  N  N     . LEU A  1  211  ? 59.327  11.468  130.242 1.00 59.73  ? 211  LEU A N     1 
ATOM   1624  C  CA    . LEU A  1  211  ? 57.982  11.853  130.670 1.00 58.14  ? 211  LEU A CA    1 
ATOM   1625  C  C     . LEU A  1  211  ? 57.902  13.323  131.075 1.00 57.88  ? 211  LEU A C     1 
ATOM   1626  O  O     . LEU A  1  211  ? 56.952  14.026  130.722 1.00 56.15  ? 211  LEU A O     1 
ATOM   1627  C  CB    . LEU A  1  211  ? 57.516  10.962  131.822 1.00 57.93  ? 211  LEU A CB    1 
ATOM   1628  C  CG    . LEU A  1  211  ? 56.213  11.345  132.528 1.00 62.97  ? 211  LEU A CG    1 
ATOM   1629  C  CD1   . LEU A  1  211  ? 55.047  11.446  131.546 1.00 53.82  ? 211  LEU A CD1   1 
ATOM   1630  C  CD2   . LEU A  1  211  ? 55.899  10.344  133.639 1.00 65.02  ? 211  LEU A CD2   1 
ATOM   1631  N  N     . ASN A  1  212  ? 58.906  13.787  131.807 1.00 55.12  ? 212  ASN A N     1 
ATOM   1632  C  CA    . ASN A  1  212  ? 58.933  15.177  132.228 1.00 57.02  ? 212  ASN A CA    1 
ATOM   1633  C  C     . ASN A  1  212  ? 59.062  16.137  131.047 1.00 58.29  ? 212  ASN A C     1 
ATOM   1634  O  O     . ASN A  1  212  ? 58.348  17.146  130.973 1.00 56.45  ? 212  ASN A O     1 
ATOM   1635  C  CB    . ASN A  1  212  ? 60.026  15.401  133.275 1.00 59.63  ? 212  ASN A CB    1 
ATOM   1636  C  CG    . ASN A  1  212  ? 59.688  14.748  134.609 1.00 59.68  ? 212  ASN A CG    1 
ATOM   1637  O  OD1   . ASN A  1  212  ? 58.536  14.770  135.043 1.00 58.87  ? 212  ASN A OD1   1 
ATOM   1638  N  ND2   . ASN A  1  212  ? 60.686  14.151  135.256 1.00 57.91  ? 212  ASN A ND2   1 
ATOM   1639  N  N     . GLN A  1  213  ? 59.946  15.809  130.110 1.00 58.86  ? 213  GLN A N     1 
ATOM   1640  C  CA    . GLN A  1  213  ? 60.100  16.636  128.918 1.00 55.19  ? 213  GLN A CA    1 
ATOM   1641  C  C     . GLN A  1  213  ? 58.823  16.656  128.077 1.00 54.50  ? 213  GLN A C     1 
ATOM   1642  O  O     . GLN A  1  213  ? 58.431  17.700  127.549 1.00 52.86  ? 213  GLN A O     1 
ATOM   1643  C  CB    . GLN A  1  213  ? 61.278  16.158  128.084 1.00 55.15  ? 213  GLN A CB    1 
ATOM   1644  C  CG    . GLN A  1  213  ? 62.602  16.231  128.809 1.00 61.35  ? 213  GLN A CG    1 
ATOM   1645  C  CD    . GLN A  1  213  ? 63.759  15.806  127.934 1.00 69.18  ? 213  GLN A CD    1 
ATOM   1646  O  OE1   . GLN A  1  213  ? 64.035  16.431  126.907 1.00 68.74  ? 213  GLN A OE1   1 
ATOM   1647  N  NE2   . GLN A  1  213  ? 64.439  14.733  128.328 1.00 65.98  ? 213  GLN A NE2   1 
ATOM   1648  N  N     . ALA A  1  214  ? 58.172  15.500  127.974 1.00 51.27  ? 214  ALA A N     1 
ATOM   1649  C  CA    . ALA A  1  214  ? 56.914  15.372  127.243 1.00 52.11  ? 214  ALA A CA    1 
ATOM   1650  C  C     . ALA A  1  214  ? 55.835  16.264  127.848 1.00 58.77  ? 214  ALA A C     1 
ATOM   1651  O  O     . ALA A  1  214  ? 55.189  17.054  127.140 1.00 54.00  ? 214  ALA A O     1 
ATOM   1652  C  CB    . ALA A  1  214  ? 56.456  13.919  127.235 1.00 48.60  ? 214  ALA A CB    1 
ATOM   1653  N  N     . VAL A  1  215  ? 55.654  16.133  129.163 1.00 60.05  ? 215  VAL A N     1 
ATOM   1654  C  CA    . VAL A  1  215  ? 54.693  16.949  129.899 1.00 58.43  ? 215  VAL A CA    1 
ATOM   1655  C  C     . VAL A  1  215  ? 54.975  18.440  129.708 1.00 56.35  ? 215  VAL A C     1 
ATOM   1656  O  O     . VAL A  1  215  ? 54.056  19.231  129.458 1.00 54.89  ? 215  VAL A O     1 
ATOM   1657  C  CB    . VAL A  1  215  ? 54.677  16.605  131.408 1.00 57.88  ? 215  VAL A CB    1 
ATOM   1658  C  CG1   . VAL A  1  215  ? 53.821  17.595  132.164 1.00 53.11  ? 215  VAL A CG1   1 
ATOM   1659  C  CG2   . VAL A  1  215  ? 54.157  15.191  131.632 1.00 55.65  ? 215  VAL A CG2   1 
ATOM   1660  N  N     . GLU A  1  216  ? 56.245  18.820  129.805 1.00 52.45  ? 216  GLU A N     1 
ATOM   1661  C  CA    . GLU A  1  216  ? 56.621  20.214  129.601 1.00 53.74  ? 216  GLU A CA    1 
ATOM   1662  C  C     . GLU A  1  216  ? 56.288  20.701  128.186 1.00 60.50  ? 216  GLU A C     1 
ATOM   1663  O  O     . GLU A  1  216  ? 55.838  21.839  128.000 1.00 62.62  ? 216  GLU A O     1 
ATOM   1664  C  CB    . GLU A  1  216  ? 58.098  20.435  129.938 1.00 54.32  ? 216  GLU A CB    1 
ATOM   1665  C  CG    . GLU A  1  216  ? 58.626  21.839  129.632 1.00 60.90  ? 216  GLU A CG    1 
ATOM   1666  C  CD    . GLU A  1  216  ? 57.876  22.956  130.353 1.00 76.89  ? 216  GLU A CD    1 
ATOM   1667  O  OE1   . GLU A  1  216  ? 57.209  22.698  131.388 1.00 72.80  ? 216  GLU A OE1   1 
ATOM   1668  O  OE2   . GLU A  1  216  ? 57.962  24.109  129.870 1.00 75.77  ? 216  GLU A OE2   1 
ATOM   1669  N  N     . ILE A  1  217  ? 56.494  19.831  127.197 1.00 58.33  ? 217  ILE A N     1 
ATOM   1670  C  CA    . ILE A  1  217  ? 56.129  20.138  125.813 1.00 59.56  ? 217  ILE A CA    1 
ATOM   1671  C  C     . ILE A  1  217  ? 54.625  20.387  125.676 1.00 54.79  ? 217  ILE A C     1 
ATOM   1672  O  O     . ILE A  1  217  ? 54.200  21.389  125.093 1.00 53.32  ? 217  ILE A O     1 
ATOM   1673  C  CB    . ILE A  1  217  ? 56.564  19.014  124.843 1.00 56.12  ? 217  ILE A CB    1 
ATOM   1674  C  CG1   . ILE A  1  217  ? 58.078  19.044  124.644 1.00 51.23  ? 217  ILE A CG1   1 
ATOM   1675  C  CG2   . ILE A  1  217  ? 55.867  19.151  123.496 1.00 46.01  ? 217  ILE A CG2   1 
ATOM   1676  C  CD1   . ILE A  1  217  ? 58.636  17.788  124.000 1.00 48.64  ? 217  ILE A CD1   1 
ATOM   1677  N  N     . LEU A  1  218  ? 53.824  19.479  126.224 1.00 47.72  ? 218  LEU A N     1 
ATOM   1678  C  CA    . LEU A  1  218  ? 52.374  19.617  126.133 1.00 54.13  ? 218  LEU A CA    1 
ATOM   1679  C  C     . LEU A  1  218  ? 51.896  20.899  126.817 1.00 58.19  ? 218  LEU A C     1 
ATOM   1680  O  O     . LEU A  1  218  ? 51.048  21.623  126.284 1.00 53.60  ? 218  LEU A O     1 
ATOM   1681  C  CB    . LEU A  1  218  ? 51.676  18.388  126.725 1.00 53.74  ? 218  LEU A CB    1 
ATOM   1682  C  CG    . LEU A  1  218  ? 50.149  18.281  126.622 1.00 45.20  ? 218  LEU A CG    1 
ATOM   1683  C  CD1   . LEU A  1  218  ? 49.627  18.725  125.271 1.00 39.90  ? 218  LEU A CD1   1 
ATOM   1684  C  CD2   . LEU A  1  218  ? 49.726  16.851  126.886 1.00 46.75  ? 218  LEU A CD2   1 
ATOM   1685  N  N     . ARG A  1  219  ? 52.463  21.172  127.990 1.00 59.60  ? 219  ARG A N     1 
ATOM   1686  C  CA    . ARG A  1  219  ? 52.136  22.364  128.763 1.00 57.84  ? 219  ARG A CA    1 
ATOM   1687  C  C     . ARG A  1  219  ? 52.420  23.621  127.949 1.00 58.91  ? 219  ARG A C     1 
ATOM   1688  O  O     . ARG A  1  219  ? 51.536  24.469  127.724 1.00 58.39  ? 219  ARG A O     1 
ATOM   1689  C  CB    . ARG A  1  219  ? 52.965  22.383  130.043 1.00 55.85  ? 219  ARG A CB    1 
ATOM   1690  C  CG    . ARG A  1  219  ? 52.729  23.598  130.918 1.00 60.62  ? 219  ARG A CG    1 
ATOM   1691  C  CD    . ARG A  1  219  ? 54.026  24.117  131.528 1.00 53.82  ? 219  ARG A CD    1 
ATOM   1692  N  NE    . ARG A  1  219  ? 54.119  25.559  131.338 1.00 56.84  ? 219  ARG A NE    1 
ATOM   1693  C  CZ    . ARG A  1  219  ? 55.085  26.165  130.661 1.00 56.64  ? 219  ARG A CZ    1 
ATOM   1694  N  NH1   . ARG A  1  219  ? 55.079  27.485  130.527 1.00 56.38  ? 219  ARG A NH1   1 
ATOM   1695  N  NH2   . ARG A  1  219  ? 56.061  25.453  130.126 1.00 60.41  ? 219  ARG A NH2   1 
ATOM   1696  N  N     . GLU A  1  220  ? 53.664  23.723  127.498 1.00 59.22  ? 220  GLU A N     1 
ATOM   1697  C  CA    . GLU A  1  220  ? 54.091  24.842  126.677 1.00 62.80  ? 220  GLU A CA    1 
ATOM   1698  C  C     . GLU A  1  220  ? 53.203  24.989  125.443 1.00 65.32  ? 220  GLU A C     1 
ATOM   1699  O  O     . GLU A  1  220  ? 52.965  26.097  124.970 1.00 63.97  ? 220  GLU A O     1 
ATOM   1700  C  CB    . GLU A  1  220  ? 55.550  24.664  126.267 1.00 68.54  ? 220  GLU A CB    1 
ATOM   1701  C  CG    . GLU A  1  220  ? 56.105  25.805  125.438 1.00 79.68  ? 220  GLU A CG    1 
ATOM   1702  C  CD    . GLU A  1  220  ? 57.500  25.516  124.933 1.00 97.04  ? 220  GLU A CD    1 
ATOM   1703  O  OE1   . GLU A  1  220  ? 58.342  25.064  125.741 1.00 103.03 ? 220  GLU A OE1   1 
ATOM   1704  O  OE2   . GLU A  1  220  ? 57.746  25.730  123.726 1.00 103.22 ? 220  GLU A OE2   1 
ATOM   1705  N  N     . HIS A  1  221  ? 52.704  23.872  124.924 1.00 62.62  ? 221  HIS A N     1 
ATOM   1706  C  CA    . HIS A  1  221  ? 51.796  23.938  123.787 1.00 61.26  ? 221  HIS A CA    1 
ATOM   1707  C  C     . HIS A  1  221  ? 50.464  24.541  124.184 1.00 61.02  ? 221  HIS A C     1 
ATOM   1708  O  O     . HIS A  1  221  ? 49.890  25.333  123.438 1.00 58.12  ? 221  HIS A O     1 
ATOM   1709  C  CB    . HIS A  1  221  ? 51.598  22.567  123.148 1.00 61.69  ? 221  HIS A CB    1 
ATOM   1710  C  CG    . HIS A  1  221  ? 52.495  22.322  121.975 1.00 64.37  ? 221  HIS A CG    1 
ATOM   1711  N  ND1   . HIS A  1  221  ? 53.778  21.835  122.108 1.00 56.73  ? 221  HIS A ND1   1 
ATOM   1712  C  CD2   . HIS A  1  221  ? 52.301  22.520  120.651 1.00 59.04  ? 221  HIS A CD2   1 
ATOM   1713  C  CE1   . HIS A  1  221  ? 54.330  21.731  120.914 1.00 57.73  ? 221  HIS A CE1   1 
ATOM   1714  N  NE2   . HIS A  1  221  ? 53.456  22.140  120.012 1.00 66.33  ? 221  HIS A NE2   1 
ATOM   1715  N  N     . LEU A  1  222  ? 49.982  24.169  125.366 1.00 64.14  ? 222  LEU A N     1 
ATOM   1716  C  CA    . LEU A  1  222  ? 48.750  24.740  125.894 1.00 59.89  ? 222  LEU A CA    1 
ATOM   1717  C  C     . LEU A  1  222  ? 48.887  26.249  126.085 1.00 61.92  ? 222  LEU A C     1 
ATOM   1718  O  O     . LEU A  1  222  ? 47.901  26.983  125.995 1.00 61.69  ? 222  LEU A O     1 
ATOM   1719  C  CB    . LEU A  1  222  ? 48.357  24.056  127.200 1.00 54.94  ? 222  LEU A CB    1 
ATOM   1720  C  CG    . LEU A  1  222  ? 47.933  22.594  127.053 1.00 59.63  ? 222  LEU A CG    1 
ATOM   1721  C  CD1   . LEU A  1  222  ? 47.728  21.933  128.406 1.00 53.43  ? 222  LEU A CD1   1 
ATOM   1722  C  CD2   . LEU A  1  222  ? 46.671  22.502  126.222 1.00 56.61  ? 222  LEU A CD2   1 
ATOM   1723  N  N     . THR A  1  223  ? 50.114  26.704  126.336 1.00 61.03  ? 223  THR A N     1 
ATOM   1724  C  CA    . THR A  1  223  ? 50.407  28.139  126.395 1.00 58.06  ? 223  THR A CA    1 
ATOM   1725  C  C     . THR A  1  223  ? 49.937  28.912  125.155 1.00 69.47  ? 223  THR A C     1 
ATOM   1726  O  O     . THR A  1  223  ? 49.467  30.045  125.266 1.00 72.44  ? 223  THR A O     1 
ATOM   1727  C  CB    . THR A  1  223  ? 51.915  28.385  126.590 1.00 62.15  ? 223  THR A CB    1 
ATOM   1728  O  OG1   . THR A  1  223  ? 52.304  27.954  127.898 1.00 65.85  ? 223  THR A OG1   1 
ATOM   1729  C  CG2   . THR A  1  223  ? 52.275  29.854  126.404 1.00 65.07  ? 223  THR A CG2   1 
ATOM   1730  N  N     . TYR A  1  224  ? 50.046  28.287  123.983 1.00 75.80  ? 224  TYR A N     1 
ATOM   1731  C  CA    . TYR A  1  224  ? 49.789  28.959  122.700 1.00 73.15  ? 224  TYR A CA    1 
ATOM   1732  C  C     . TYR A  1  224  ? 48.351  29.442  122.510 1.00 72.76  ? 224  TYR A C     1 
ATOM   1733  O  O     . TYR A  1  224  ? 48.079  30.260  121.631 1.00 80.02  ? 224  TYR A O     1 
ATOM   1734  C  CB    . TYR A  1  224  ? 50.178  28.054  121.526 1.00 67.00  ? 224  TYR A CB    1 
ATOM   1735  C  CG    . TYR A  1  224  ? 51.623  27.607  121.532 1.00 70.08  ? 224  TYR A CG    1 
ATOM   1736  C  CD1   . TYR A  1  224  ? 52.638  28.466  121.932 1.00 69.65  ? 224  TYR A CD1   1 
ATOM   1737  C  CD2   . TYR A  1  224  ? 51.972  26.319  121.142 1.00 72.73  ? 224  TYR A CD2   1 
ATOM   1738  C  CE1   . TYR A  1  224  ? 53.963  28.056  121.939 1.00 72.21  ? 224  TYR A CE1   1 
ATOM   1739  C  CE2   . TYR A  1  224  ? 53.293  25.899  121.148 1.00 69.68  ? 224  TYR A CE2   1 
ATOM   1740  C  CZ    . TYR A  1  224  ? 54.285  26.772  121.546 1.00 70.70  ? 224  TYR A CZ    1 
ATOM   1741  O  OH    . TYR A  1  224  ? 55.600  26.359  121.554 1.00 70.12  ? 224  TYR A OH    1 
ATOM   1742  N  N     . PHE A  1  225  ? 47.436  28.946  123.336 1.00 74.32  ? 225  PHE A N     1 
ATOM   1743  C  CA    . PHE A  1  225  ? 46.021  29.289  123.208 1.00 80.09  ? 225  PHE A CA    1 
ATOM   1744  C  C     . PHE A  1  225  ? 45.697  30.628  123.863 1.00 84.98  ? 225  PHE A C     1 
ATOM   1745  O  O     . PHE A  1  225  ? 44.546  31.065  123.870 1.00 86.83  ? 225  PHE A O     1 
ATOM   1746  C  CB    . PHE A  1  225  ? 45.139  28.186  123.801 1.00 72.31  ? 225  PHE A CB    1 
ATOM   1747  C  CG    . PHE A  1  225  ? 45.063  26.946  122.954 1.00 75.16  ? 225  PHE A CG    1 
ATOM   1748  C  CD1   . PHE A  1  225  ? 45.979  25.918  123.121 1.00 73.00  ? 225  PHE A CD1   1 
ATOM   1749  C  CD2   . PHE A  1  225  ? 44.074  26.807  121.990 1.00 73.20  ? 225  PHE A CD2   1 
ATOM   1750  C  CE1   . PHE A  1  225  ? 45.911  24.773  122.339 1.00 71.56  ? 225  PHE A CE1   1 
ATOM   1751  C  CE2   . PHE A  1  225  ? 44.000  25.666  121.205 1.00 64.17  ? 225  PHE A CE2   1 
ATOM   1752  C  CZ    . PHE A  1  225  ? 44.918  24.648  121.378 1.00 65.95  ? 225  PHE A CZ    1 
ATOM   1753  N  N     . SER A  1  226  ? 46.720  31.268  124.417 1.00 86.70  ? 226  SER A N     1 
ATOM   1754  C  CA    . SER A  1  226  ? 46.540  32.501  125.172 1.00 94.14  ? 226  SER A CA    1 
ATOM   1755  C  C     . SER A  1  226  ? 46.063  33.701  124.343 1.00 109.88 ? 226  SER A C     1 
ATOM   1756  O  O     . SER A  1  226  ? 45.014  34.274  124.640 1.00 108.14 ? 226  SER A O     1 
ATOM   1757  C  CB    . SER A  1  226  ? 47.831  32.855  125.918 1.00 97.12  ? 226  SER A CB    1 
ATOM   1758  O  OG    . SER A  1  226  ? 48.926  32.959  125.024 1.00 99.04  ? 226  SER A OG    1 
ATOM   1759  N  N     . ASN A  1  227  ? 46.815  34.068  123.306 1.00 106.11 ? 227  ASN A N     1 
ATOM   1760  C  CA    . ASN A  1  227  ? 46.561  35.324  122.591 1.00 105.10 ? 227  ASN A CA    1 
ATOM   1761  C  C     . ASN A  1  227  ? 45.691  35.174  121.347 1.00 105.28 ? 227  ASN A C     1 
ATOM   1762  O  O     . ASN A  1  227  ? 46.151  34.665  120.326 1.00 116.01 ? 227  ASN A O     1 
ATOM   1763  C  CB    . ASN A  1  227  ? 47.882  36.004  122.215 1.00 113.50 ? 227  ASN A CB    1 
ATOM   1764  C  CG    . ASN A  1  227  ? 48.741  36.323  123.427 1.00 122.17 ? 227  ASN A CG    1 
ATOM   1765  O  OD1   . ASN A  1  227  ? 48.231  36.509  124.532 1.00 112.06 ? 227  ASN A OD1   1 
ATOM   1766  N  ND2   . ASN A  1  227  ? 50.053  36.390  123.222 1.00 126.38 ? 227  ASN A ND2   1 
ATOM   1767  N  N     . PRO A  1  228  ? 44.430  35.631  121.430 1.00 102.32 ? 228  PRO A N     1 
ATOM   1768  C  CA    . PRO A  1  228  ? 43.411  35.528  120.377 1.00 99.67  ? 228  PRO A CA    1 
ATOM   1769  C  C     . PRO A  1  228  ? 43.592  36.534  119.243 1.00 100.76 ? 228  PRO A C     1 
ATOM   1770  O  O     . PRO A  1  228  ? 44.403  37.454  119.362 1.00 100.26 ? 228  PRO A O     1 
ATOM   1771  C  CB    . PRO A  1  228  ? 42.098  35.810  121.122 1.00 94.03  ? 228  PRO A CB    1 
ATOM   1772  C  CG    . PRO A  1  228  ? 42.457  35.849  122.586 1.00 102.98 ? 228  PRO A CG    1 
ATOM   1773  C  CD    . PRO A  1  228  ? 43.880  36.289  122.622 1.00 103.80 ? 228  PRO A CD    1 
ATOM   1774  N  N     . GLN A  1  229  ? 42.855  36.326  118.151 1.00 95.22  ? 229  GLN A N     1 
ATOM   1775  C  CA    . GLN A  1  229  ? 42.814  37.257  117.026 1.00 86.29  ? 229  GLN A CA    1 
ATOM   1776  C  C     . GLN A  1  229  ? 41.625  36.948  116.117 1.00 77.61  ? 229  GLN A C     1 
ATOM   1777  O  O     . GLN A  1  229  ? 40.829  37.831  115.792 1.00 70.42  ? 229  GLN A O     1 
ATOM   1778  C  CB    . GLN A  1  229  ? 44.118  37.203  116.225 1.00 91.57  ? 229  GLN A CB    1 
ATOM   1779  C  CG    . GLN A  1  229  ? 44.965  38.471  116.321 1.00 100.03 ? 229  GLN A CG    1 
ATOM   1780  C  CD    . GLN A  1  229  ? 46.246  38.272  117.115 1.00 107.80 ? 229  GLN A CD    1 
ATOM   1781  O  OE1   . GLN A  1  229  ? 47.049  37.392  116.808 1.00 113.27 ? 229  GLN A OE1   1 
ATOM   1782  N  NE2   . GLN A  1  229  ? 46.439  39.090  118.146 1.00 105.26 ? 229  GLN A NE2   1 
ATOM   1783  N  N     . LYS B  1  7    ? 58.299  28.502  115.351 1.00 94.44  ? 7    LYS B N     1 
ATOM   1784  C  CA    . LYS B  1  7    ? 57.914  29.757  115.985 1.00 107.81 ? 7    LYS B CA    1 
ATOM   1785  C  C     . LYS B  1  7    ? 56.752  29.560  116.945 1.00 109.81 ? 7    LYS B C     1 
ATOM   1786  O  O     . LYS B  1  7    ? 56.258  28.447  117.120 1.00 106.73 ? 7    LYS B O     1 
ATOM   1787  C  CB    . LYS B  1  7    ? 57.516  30.788  114.933 1.00 110.90 ? 7    LYS B CB    1 
ATOM   1788  C  CG    . LYS B  1  7    ? 58.601  31.099  113.922 1.00 128.87 ? 7    LYS B CG    1 
ATOM   1789  C  CD    . LYS B  1  7    ? 58.179  32.218  112.975 1.00 137.14 ? 7    LYS B CD    1 
ATOM   1790  C  CE    . LYS B  1  7    ? 58.351  33.602  113.603 1.00 134.80 ? 7    LYS B CE    1 
ATOM   1791  N  NZ    . LYS B  1  7    ? 57.361  33.914  114.678 1.00 115.86 ? 7    LYS B NZ    1 
ATOM   1792  N  N     . ALA B  1  8    ? 56.318  30.654  117.564 1.00 109.23 ? 8    ALA B N     1 
ATOM   1793  C  CA    . ALA B  1  8    ? 55.138  30.634  118.417 1.00 97.96  ? 8    ALA B CA    1 
ATOM   1794  C  C     . ALA B  1  8    ? 53.892  30.774  117.552 1.00 85.20  ? 8    ALA B C     1 
ATOM   1795  O  O     . ALA B  1  8    ? 53.688  31.806  116.913 1.00 83.48  ? 8    ALA B O     1 
ATOM   1796  C  CB    . ALA B  1  8    ? 55.203  31.748  119.453 1.00 98.46  ? 8    ALA B CB    1 
ATOM   1797  N  N     . PRO B  1  9    ? 53.057  29.724  117.530 1.00 78.63  ? 9    PRO B N     1 
ATOM   1798  C  CA    . PRO B  1  9    ? 51.852  29.639  116.700 1.00 74.68  ? 9    PRO B CA    1 
ATOM   1799  C  C     . PRO B  1  9    ? 50.926  30.826  116.899 1.00 70.95  ? 9    PRO B C     1 
ATOM   1800  O  O     . PRO B  1  9    ? 50.866  31.374  117.996 1.00 78.22  ? 9    PRO B O     1 
ATOM   1801  C  CB    . PRO B  1  9    ? 51.166  28.373  117.220 1.00 70.32  ? 9    PRO B CB    1 
ATOM   1802  C  CG    . PRO B  1  9    ? 52.269  27.545  117.758 1.00 74.47  ? 9    PRO B CG    1 
ATOM   1803  C  CD    . PRO B  1  9    ? 53.244  28.514  118.350 1.00 82.44  ? 9    PRO B CD    1 
ATOM   1804  N  N     . VAL B  1  10   ? 50.220  31.219  115.845 1.00 65.08  ? 10   VAL B N     1 
ATOM   1805  C  CA    . VAL B  1  10   ? 49.158  32.203  115.986 1.00 69.98  ? 10   VAL B CA    1 
ATOM   1806  C  C     . VAL B  1  10   ? 47.791  31.551  116.211 1.00 75.92  ? 10   VAL B C     1 
ATOM   1807  O  O     . VAL B  1  10   ? 47.434  30.528  115.585 1.00 72.55  ? 10   VAL B O     1 
ATOM   1808  C  CB    . VAL B  1  10   ? 49.105  33.213  114.818 1.00 67.44  ? 10   VAL B CB    1 
ATOM   1809  C  CG1   . VAL B  1  10   ? 50.413  33.980  114.734 1.00 67.76  ? 10   VAL B CG1   1 
ATOM   1810  C  CG2   . VAL B  1  10   ? 48.797  32.515  113.503 1.00 80.82  ? 10   VAL B CG2   1 
ATOM   1811  N  N     . PHE B  1  11   ? 47.056  32.169  117.132 1.00 78.90  ? 11   PHE B N     1 
ATOM   1812  C  CA    . PHE B  1  11   ? 45.753  31.714  117.587 1.00 73.93  ? 11   PHE B CA    1 
ATOM   1813  C  C     . PHE B  1  11   ? 44.715  32.732  117.126 1.00 76.40  ? 11   PHE B C     1 
ATOM   1814  O  O     . PHE B  1  11   ? 44.837  33.921  117.409 1.00 80.67  ? 11   PHE B O     1 
ATOM   1815  C  CB    . PHE B  1  11   ? 45.778  31.594  119.112 1.00 74.26  ? 11   PHE B CB    1 
ATOM   1816  C  CG    . PHE B  1  11   ? 44.487  31.126  119.717 1.00 86.53  ? 11   PHE B CG    1 
ATOM   1817  C  CD1   . PHE B  1  11   ? 43.974  29.874  119.416 1.00 81.90  ? 11   PHE B CD1   1 
ATOM   1818  C  CD2   . PHE B  1  11   ? 43.800  31.928  120.616 1.00 91.30  ? 11   PHE B CD2   1 
ATOM   1819  C  CE1   . PHE B  1  11   ? 42.788  29.442  119.985 1.00 81.05  ? 11   PHE B CE1   1 
ATOM   1820  C  CE2   . PHE B  1  11   ? 42.617  31.502  121.187 1.00 82.12  ? 11   PHE B CE2   1 
ATOM   1821  C  CZ    . PHE B  1  11   ? 42.111  30.256  120.872 1.00 79.91  ? 11   PHE B CZ    1 
ATOM   1822  N  N     . THR B  1  12   ? 43.707  32.262  116.399 1.00 73.96  ? 12   THR B N     1 
ATOM   1823  C  CA    . THR B  1  12   ? 42.762  33.146  115.725 1.00 73.53  ? 12   THR B CA    1 
ATOM   1824  C  C     . THR B  1  12   ? 41.331  32.762  116.047 1.00 75.58  ? 12   THR B C     1 
ATOM   1825  O  O     . THR B  1  12   ? 40.969  31.588  115.978 1.00 73.26  ? 12   THR B O     1 
ATOM   1826  C  CB    . THR B  1  12   ? 42.942  33.081  114.206 1.00 72.62  ? 12   THR B CB    1 
ATOM   1827  O  OG1   . THR B  1  12   ? 44.320  33.295  113.882 1.00 77.78  ? 12   THR B OG1   1 
ATOM   1828  C  CG2   . THR B  1  12   ? 42.086  34.135  113.521 1.00 73.79  ? 12   THR B CG2   1 
ATOM   1829  N  N     . VAL B  1  13   ? 40.513  33.756  116.381 1.00 76.94  ? 13   VAL B N     1 
ATOM   1830  C  CA    . VAL B  1  13   ? 39.163  33.495  116.861 1.00 71.90  ? 13   VAL B CA    1 
ATOM   1831  C  C     . VAL B  1  13   ? 38.095  34.134  115.980 1.00 73.51  ? 13   VAL B C     1 
ATOM   1832  O  O     . VAL B  1  13   ? 38.237  35.273  115.534 1.00 74.45  ? 13   VAL B O     1 
ATOM   1833  C  CB    . VAL B  1  13   ? 38.992  33.986  118.308 1.00 68.01  ? 13   VAL B CB    1 
ATOM   1834  C  CG1   . VAL B  1  13   ? 37.650  33.553  118.852 1.00 75.23  ? 13   VAL B CG1   1 
ATOM   1835  C  CG2   . VAL B  1  13   ? 40.113  33.452  119.185 1.00 70.79  ? 13   VAL B CG2   1 
ATOM   1836  N  N     . ARG B  1  14   ? 37.036  33.376  115.715 1.00 73.98  ? 14   ARG B N     1 
ATOM   1837  C  CA    . ARG B  1  14   ? 35.884  33.884  114.983 1.00 78.26  ? 14   ARG B CA    1 
ATOM   1838  C  C     . ARG B  1  14   ? 34.604  33.433  115.688 1.00 79.69  ? 14   ARG B C     1 
ATOM   1839  O  O     . ARG B  1  14   ? 34.328  32.240  115.771 1.00 75.47  ? 14   ARG B O     1 
ATOM   1840  C  CB    . ARG B  1  14   ? 35.935  33.376  113.540 1.00 85.42  ? 14   ARG B CB    1 
ATOM   1841  C  CG    . ARG B  1  14   ? 34.745  33.737  112.664 1.00 95.10  ? 14   ARG B CG    1 
ATOM   1842  C  CD    . ARG B  1  14   ? 35.012  33.345  111.210 1.00 102.20 ? 14   ARG B CD    1 
ATOM   1843  N  NE    . ARG B  1  14   ? 35.893  32.180  111.115 1.00 113.67 ? 14   ARG B NE    1 
ATOM   1844  C  CZ    . ARG B  1  14   ? 37.057  32.164  110.467 1.00 118.71 ? 14   ARG B CZ    1 
ATOM   1845  N  NH1   . ARG B  1  14   ? 37.485  33.250  109.834 1.00 103.36 ? 14   ARG B NH1   1 
ATOM   1846  N  NH2   . ARG B  1  14   ? 37.791  31.056  110.444 1.00 109.02 ? 14   ARG B NH2   1 
ATOM   1847  N  N     . THR B  1  15   ? 33.820  34.382  116.195 1.00 90.78  ? 15   THR B N     1 
ATOM   1848  C  CA    . THR B  1  15   ? 32.666  34.034  117.029 1.00 98.54  ? 15   THR B CA    1 
ATOM   1849  C  C     . THR B  1  15   ? 31.324  34.505  116.478 1.00 97.94  ? 15   THR B C     1 
ATOM   1850  O  O     . THR B  1  15   ? 31.229  35.565  115.857 1.00 101.16 ? 15   THR B O     1 
ATOM   1851  C  CB    . THR B  1  15   ? 32.794  34.605  118.463 1.00 86.61  ? 15   THR B CB    1 
ATOM   1852  O  OG1   . THR B  1  15   ? 32.589  36.023  118.434 1.00 91.65  ? 15   THR B OG1   1 
ATOM   1853  C  CG2   . THR B  1  15   ? 34.158  34.299  119.052 1.00 71.76  ? 15   THR B CG2   1 
ATOM   1854  N  N     . GLN B  1  16   ? 30.289  33.703  116.714 1.00 93.29  ? 16   GLN B N     1 
ATOM   1855  C  CA    . GLN B  1  16   ? 28.916  34.130  116.477 1.00 104.38 ? 16   GLN B CA    1 
ATOM   1856  C  C     . GLN B  1  16   ? 28.116  34.059  117.773 1.00 97.70  ? 16   GLN B C     1 
ATOM   1857  O  O     . GLN B  1  16   ? 27.805  32.972  118.263 1.00 87.37  ? 16   GLN B O     1 
ATOM   1858  C  CB    . GLN B  1  16   ? 28.246  33.255  115.420 1.00 109.77 ? 16   GLN B CB    1 
ATOM   1859  C  CG    . GLN B  1  16   ? 28.811  33.405  114.025 1.00 116.43 ? 16   GLN B CG    1 
ATOM   1860  C  CD    . GLN B  1  16   ? 27.970  32.682  112.993 1.00 134.99 ? 16   GLN B CD    1 
ATOM   1861  O  OE1   . GLN B  1  16   ? 26.802  32.368  113.237 1.00 137.05 ? 16   GLN B OE1   1 
ATOM   1862  N  NE2   . GLN B  1  16   ? 28.558  32.409  111.833 1.00 131.23 ? 16   GLN B NE2   1 
ATOM   1863  N  N     . GLY B  1  17   ? 27.762  35.223  118.304 1.00 99.73  ? 17   GLY B N     1 
ATOM   1864  C  CA    . GLY B  1  17   ? 27.035  35.305  119.557 1.00 85.94  ? 17   GLY B CA    1 
ATOM   1865  C  C     . GLY B  1  17   ? 27.749  34.595  120.690 1.00 84.51  ? 17   GLY B C     1 
ATOM   1866  O  O     . GLY B  1  17   ? 28.983  34.524  120.726 1.00 76.41  ? 17   GLY B O     1 
ATOM   1867  N  N     . ARG B  1  18   ? 26.963  34.078  121.627 1.00 79.64  ? 18   ARG B N     1 
ATOM   1868  C  CA    . ARG B  1  18   ? 27.506  33.328  122.748 1.00 77.54  ? 18   ARG B CA    1 
ATOM   1869  C  C     . ARG B  1  18   ? 27.437  31.812  122.543 1.00 78.54  ? 18   ARG B C     1 
ATOM   1870  O  O     . ARG B  1  18   ? 27.904  31.052  123.390 1.00 76.79  ? 18   ARG B O     1 
ATOM   1871  C  CB    . ARG B  1  18   ? 26.777  33.718  124.039 1.00 83.45  ? 18   ARG B CB    1 
ATOM   1872  C  CG    . ARG B  1  18   ? 26.933  35.185  124.443 1.00 78.14  ? 18   ARG B CG    1 
ATOM   1873  C  CD    . ARG B  1  18   ? 26.131  35.516  125.703 1.00 73.09  ? 18   ARG B CD    1 
ATOM   1874  N  NE    . ARG B  1  18   ? 26.378  34.563  126.783 1.00 67.85  ? 18   ARG B NE    1 
ATOM   1875  C  CZ    . ARG B  1  18   ? 27.432  34.610  127.592 1.00 75.12  ? 18   ARG B CZ    1 
ATOM   1876  N  NH1   . ARG B  1  18   ? 27.581  33.700  128.545 1.00 74.98  ? 18   ARG B NH1   1 
ATOM   1877  N  NH2   . ARG B  1  18   ? 28.343  35.565  127.446 1.00 71.61  ? 18   ARG B NH2   1 
ATOM   1878  N  N     . GLU B  1  19   ? 26.823  31.368  121.447 1.00 79.80  ? 19   GLU B N     1 
ATOM   1879  C  CA    . GLU B  1  19   ? 26.647  29.928  121.227 1.00 76.71  ? 19   GLU B CA    1 
ATOM   1880  C  C     . GLU B  1  19   ? 27.602  29.193  120.261 1.00 68.90  ? 19   GLU B C     1 
ATOM   1881  O  O     . GLU B  1  19   ? 27.548  27.968  120.166 1.00 65.00  ? 19   GLU B O     1 
ATOM   1882  C  CB    . GLU B  1  19   ? 25.189  29.634  120.863 1.00 72.05  ? 19   GLU B CB    1 
ATOM   1883  C  CG    . GLU B  1  19   ? 24.199  30.197  121.872 1.00 78.10  ? 19   GLU B CG    1 
ATOM   1884  C  CD    . GLU B  1  19   ? 22.753  29.969  121.474 1.00 87.03  ? 19   GLU B CD    1 
ATOM   1885  O  OE1   . GLU B  1  19   ? 21.875  30.686  121.997 1.00 82.56  ? 19   GLU B OE1   1 
ATOM   1886  O  OE2   . GLU B  1  19   ? 22.492  29.072  120.643 1.00 93.22  ? 19   GLU B OE2   1 
ATOM   1887  N  N     . TYR B  1  20   ? 28.476  29.913  119.561 1.00 70.71  ? 20   TYR B N     1 
ATOM   1888  C  CA    . TYR B  1  20   ? 29.352  29.257  118.581 1.00 69.27  ? 20   TYR B CA    1 
ATOM   1889  C  C     . TYR B  1  20   ? 30.685  29.958  118.346 1.00 70.57  ? 20   TYR B C     1 
ATOM   1890  O  O     . TYR B  1  20   ? 30.751  31.186  118.288 1.00 72.96  ? 20   TYR B O     1 
ATOM   1891  C  CB    . TYR B  1  20   ? 28.633  29.082  117.237 1.00 70.01  ? 20   TYR B CB    1 
ATOM   1892  C  CG    . TYR B  1  20   ? 29.507  28.481  116.154 1.00 73.70  ? 20   TYR B CG    1 
ATOM   1893  C  CD1   . TYR B  1  20   ? 30.000  29.258  115.113 1.00 77.63  ? 20   TYR B CD1   1 
ATOM   1894  C  CD2   . TYR B  1  20   ? 29.852  27.138  116.184 1.00 74.45  ? 20   TYR B CD2   1 
ATOM   1895  C  CE1   . TYR B  1  20   ? 30.808  28.705  114.127 1.00 71.42  ? 20   TYR B CE1   1 
ATOM   1896  C  CE2   . TYR B  1  20   ? 30.658  26.581  115.207 1.00 71.50  ? 20   TYR B CE2   1 
ATOM   1897  C  CZ    . TYR B  1  20   ? 31.133  27.363  114.180 1.00 72.72  ? 20   TYR B CZ    1 
ATOM   1898  O  OH    . TYR B  1  20   ? 31.931  26.788  113.209 1.00 70.33  ? 20   TYR B OH    1 
ATOM   1899  N  N     . GLY B  1  21   ? 31.741  29.171  118.167 1.00 66.42  ? 21   GLY B N     1 
ATOM   1900  C  CA    . GLY B  1  21   ? 33.032  29.748  117.845 1.00 67.44  ? 21   GLY B CA    1 
ATOM   1901  C  C     . GLY B  1  21   ? 33.977  28.841  117.080 1.00 69.01  ? 21   GLY B C     1 
ATOM   1902  O  O     . GLY B  1  21   ? 33.906  27.610  117.176 1.00 70.29  ? 21   GLY B O     1 
ATOM   1903  N  N     . GLU B  1  22   ? 34.875  29.473  116.327 1.00 68.78  ? 22   GLU B N     1 
ATOM   1904  C  CA    . GLU B  1  22   ? 35.916  28.784  115.575 1.00 64.11  ? 22   GLU B CA    1 
ATOM   1905  C  C     . GLU B  1  22   ? 37.271  29.304  116.001 1.00 62.86  ? 22   GLU B C     1 
ATOM   1906  O  O     . GLU B  1  22   ? 37.483  30.515  116.109 1.00 65.56  ? 22   GLU B O     1 
ATOM   1907  C  CB    . GLU B  1  22   ? 35.764  29.024  114.082 1.00 70.97  ? 22   GLU B CB    1 
ATOM   1908  C  CG    . GLU B  1  22   ? 34.449  28.577  113.512 1.00 83.67  ? 22   GLU B CG    1 
ATOM   1909  C  CD    . GLU B  1  22   ? 34.425  28.682  112.006 1.00 96.15  ? 22   GLU B CD    1 
ATOM   1910  O  OE1   . GLU B  1  22   ? 35.520  28.677  111.399 1.00 101.06 ? 22   GLU B OE1   1 
ATOM   1911  O  OE2   . GLU B  1  22   ? 33.317  28.776  111.436 1.00 91.88  ? 22   GLU B OE2   1 
ATOM   1912  N  N     . PHE B  1  23   ? 38.192  28.379  116.224 1.00 56.98  ? 23   PHE B N     1 
ATOM   1913  C  CA    . PHE B  1  23   ? 39.496  28.709  116.765 1.00 62.79  ? 23   PHE B CA    1 
ATOM   1914  C  C     . PHE B  1  23   ? 40.573  28.017  115.952 1.00 65.19  ? 23   PHE B C     1 
ATOM   1915  O  O     . PHE B  1  23   ? 40.615  26.792  115.871 1.00 64.10  ? 23   PHE B O     1 
ATOM   1916  C  CB    . PHE B  1  23   ? 39.567  28.291  118.235 1.00 60.69  ? 23   PHE B CB    1 
ATOM   1917  C  CG    . PHE B  1  23   ? 38.372  28.719  119.029 1.00 64.99  ? 23   PHE B CG    1 
ATOM   1918  C  CD1   . PHE B  1  23   ? 38.313  29.986  119.584 1.00 65.18  ? 23   PHE B CD1   1 
ATOM   1919  C  CD2   . PHE B  1  23   ? 37.292  27.866  119.193 1.00 64.52  ? 23   PHE B CD2   1 
ATOM   1920  C  CE1   . PHE B  1  23   ? 37.207  30.389  120.299 1.00 64.65  ? 23   PHE B CE1   1 
ATOM   1921  C  CE2   . PHE B  1  23   ? 36.183  28.262  119.904 1.00 62.90  ? 23   PHE B CE2   1 
ATOM   1922  C  CZ    . PHE B  1  23   ? 36.140  29.526  120.459 1.00 69.58  ? 23   PHE B CZ    1 
ATOM   1923  N  N     . VAL B  1  24   ? 41.440  28.808  115.340 1.00 62.96  ? 24   VAL B N     1 
ATOM   1924  C  CA    . VAL B  1  24   ? 42.467  28.253  114.485 1.00 60.79  ? 24   VAL B CA    1 
ATOM   1925  C  C     . VAL B  1  24   ? 43.841  28.483  115.086 1.00 66.03  ? 24   VAL B C     1 
ATOM   1926  O  O     . VAL B  1  24   ? 44.212  29.611  115.395 1.00 72.36  ? 24   VAL B O     1 
ATOM   1927  C  CB    . VAL B  1  24   ? 42.409  28.862  113.078 1.00 64.29  ? 24   VAL B CB    1 
ATOM   1928  C  CG1   . VAL B  1  24   ? 43.561  28.346  112.233 1.00 71.68  ? 24   VAL B CG1   1 
ATOM   1929  C  CG2   . VAL B  1  24   ? 41.073  28.545  112.420 1.00 64.51  ? 24   VAL B CG2   1 
ATOM   1930  N  N     . LEU B  1  25   ? 44.591  27.402  115.258 1.00 62.24  ? 25   LEU B N     1 
ATOM   1931  C  CA    . LEU B  1  25   ? 45.949  27.494  115.762 1.00 64.40  ? 25   LEU B CA    1 
ATOM   1932  C  C     . LEU B  1  25   ? 46.902  26.978  114.695 1.00 69.85  ? 25   LEU B C     1 
ATOM   1933  O  O     . LEU B  1  25   ? 46.850  25.793  114.340 1.00 65.41  ? 25   LEU B O     1 
ATOM   1934  C  CB    . LEU B  1  25   ? 46.091  26.674  117.043 1.00 58.46  ? 25   LEU B CB    1 
ATOM   1935  C  CG    . LEU B  1  25   ? 47.416  26.784  117.794 1.00 59.80  ? 25   LEU B CG    1 
ATOM   1936  C  CD1   . LEU B  1  25   ? 47.728  28.235  118.116 1.00 68.61  ? 25   LEU B CD1   1 
ATOM   1937  C  CD2   . LEU B  1  25   ? 47.360  25.952  119.060 1.00 63.12  ? 25   LEU B CD2   1 
ATOM   1938  N  N     . GLU B  1  26   ? 47.725  27.872  114.142 1.00 73.66  ? 26   GLU B N     1 
ATOM   1939  C  CA    . GLU B  1  26   ? 48.753  27.449  113.176 1.00 67.66  ? 26   GLU B CA    1 
ATOM   1940  C  C     . GLU B  1  26   ? 49.995  28.341  113.184 1.00 66.99  ? 26   GLU B C     1 
ATOM   1941  O  O     . GLU B  1  26   ? 49.908  29.504  113.550 1.00 73.85  ? 26   GLU B O     1 
ATOM   1942  C  CB    . GLU B  1  26   ? 48.172  27.363  111.759 1.00 67.88  ? 26   GLU B CB    1 
ATOM   1943  C  CG    . GLU B  1  26   ? 47.725  28.690  111.169 1.00 72.99  ? 26   GLU B CG    1 
ATOM   1944  C  CD    . GLU B  1  26   ? 47.414  28.589  109.680 1.00 90.44  ? 26   GLU B CD    1 
ATOM   1945  O  OE1   . GLU B  1  26   ? 48.297  28.141  108.911 1.00 85.93  ? 26   GLU B OE1   1 
ATOM   1946  O  OE2   . GLU B  1  26   ? 46.287  28.952  109.277 1.00 89.11  ? 26   GLU B OE2   1 
ATOM   1947  N  N     . PRO B  1  27   ? 51.155  27.813  112.757 1.00 60.39  ? 27   PRO B N     1 
ATOM   1948  C  CA    . PRO B  1  27   ? 51.539  26.436  112.437 1.00 55.31  ? 27   PRO B CA    1 
ATOM   1949  C  C     . PRO B  1  27   ? 51.918  25.624  113.673 1.00 59.36  ? 27   PRO B C     1 
ATOM   1950  O  O     . PRO B  1  27   ? 52.393  26.188  114.655 1.00 60.16  ? 27   PRO B O     1 
ATOM   1951  C  CB    . PRO B  1  27   ? 52.774  26.630  111.568 1.00 55.65  ? 27   PRO B CB    1 
ATOM   1952  C  CG    . PRO B  1  27   ? 53.406  27.843  112.131 1.00 52.81  ? 27   PRO B CG    1 
ATOM   1953  C  CD    . PRO B  1  27   ? 52.271  28.746  112.518 1.00 56.94  ? 27   PRO B CD    1 
ATOM   1954  N  N     . LEU B  1  28   ? 51.734  24.310  113.606 1.00 59.08  ? 28   LEU B N     1 
ATOM   1955  C  CA    . LEU B  1  28   ? 52.167  23.410  114.669 1.00 56.05  ? 28   LEU B CA    1 
ATOM   1956  C  C     . LEU B  1  28   ? 53.098  22.379  114.062 1.00 55.79  ? 28   LEU B C     1 
ATOM   1957  O  O     . LEU B  1  28   ? 52.991  22.069  112.881 1.00 56.58  ? 28   LEU B O     1 
ATOM   1958  C  CB    . LEU B  1  28   ? 50.972  22.694  115.297 1.00 54.92  ? 28   LEU B CB    1 
ATOM   1959  C  CG    . LEU B  1  28   ? 49.882  23.544  115.941 1.00 49.32  ? 28   LEU B CG    1 
ATOM   1960  C  CD1   . LEU B  1  28   ? 48.713  22.664  116.349 1.00 55.05  ? 28   LEU B CD1   1 
ATOM   1961  C  CD2   . LEU B  1  28   ? 50.439  24.284  117.136 1.00 53.62  ? 28   LEU B CD2   1 
ATOM   1962  N  N     . GLU B  1  29   ? 53.998  21.833  114.871 1.00 59.82  ? 29   GLU B N     1 
ATOM   1963  C  CA    . GLU B  1  29   ? 54.908  20.807  114.389 1.00 63.09  ? 29   GLU B CA    1 
ATOM   1964  C  C     . GLU B  1  29   ? 54.082  19.595  113.985 1.00 62.73  ? 29   GLU B C     1 
ATOM   1965  O  O     . GLU B  1  29   ? 52.952  19.440  114.439 1.00 60.51  ? 29   GLU B O     1 
ATOM   1966  C  CB    . GLU B  1  29   ? 55.927  20.438  115.468 1.00 67.39  ? 29   GLU B CB    1 
ATOM   1967  C  CG    . GLU B  1  29   ? 57.148  19.698  114.938 1.00 87.44  ? 29   GLU B CG    1 
ATOM   1968  C  CD    . GLU B  1  29   ? 57.864  20.459  113.828 1.00 99.88  ? 29   GLU B CD    1 
ATOM   1969  O  OE1   . GLU B  1  29   ? 57.856  19.979  112.669 1.00 90.57  ? 29   GLU B OE1   1 
ATOM   1970  O  OE2   . GLU B  1  29   ? 58.439  21.533  114.116 1.00 98.18  ? 29   GLU B OE2   1 
ATOM   1971  N  N     . ARG B  1  30   ? 54.629  18.754  113.114 1.00 67.29  ? 30   ARG B N     1 
ATOM   1972  C  CA    . ARG B  1  30   ? 53.865  17.644  112.558 1.00 65.34  ? 30   ARG B CA    1 
ATOM   1973  C  C     . ARG B  1  30   ? 53.266  16.738  113.633 1.00 58.78  ? 30   ARG B C     1 
ATOM   1974  O  O     . ARG B  1  30   ? 53.973  16.245  114.508 1.00 62.92  ? 30   ARG B O     1 
ATOM   1975  C  CB    . ARG B  1  30   ? 54.727  16.819  111.599 1.00 59.27  ? 30   ARG B CB    1 
ATOM   1976  C  CG    . ARG B  1  30   ? 54.005  15.614  111.036 1.00 56.42  ? 30   ARG B CG    1 
ATOM   1977  C  CD    . ARG B  1  30   ? 54.919  14.731  110.219 1.00 61.09  ? 30   ARG B CD    1 
ATOM   1978  N  NE    . ARG B  1  30   ? 55.815  13.918  111.035 1.00 61.37  ? 30   ARG B NE    1 
ATOM   1979  C  CZ    . ARG B  1  30   ? 56.671  13.031  110.534 1.00 61.93  ? 30   ARG B CZ    1 
ATOM   1980  N  NH1   . ARG B  1  30   ? 56.741  12.846  109.222 1.00 70.49  ? 30   ARG B NH1   1 
ATOM   1981  N  NH2   . ARG B  1  30   ? 57.455  12.328  111.338 1.00 49.81  ? 30   ARG B NH2   1 
ATOM   1982  N  N     . GLY B  1  31   ? 51.954  16.535  113.553 1.00 56.71  ? 31   GLY B N     1 
ATOM   1983  C  CA    . GLY B  1  31   ? 51.251  15.630  114.443 1.00 60.03  ? 31   GLY B CA    1 
ATOM   1984  C  C     . GLY B  1  31   ? 50.541  16.315  115.594 1.00 61.15  ? 31   GLY B C     1 
ATOM   1985  O  O     . GLY B  1  31   ? 49.608  15.763  116.176 1.00 62.19  ? 31   GLY B O     1 
ATOM   1986  N  N     . PHE B  1  32   ? 50.970  17.530  115.919 1.00 62.08  ? 32   PHE B N     1 
ATOM   1987  C  CA    . PHE B  1  32   ? 50.486  18.206  117.119 1.00 58.68  ? 32   PHE B CA    1 
ATOM   1988  C  C     . PHE B  1  32   ? 49.046  18.684  117.032 1.00 59.12  ? 32   PHE B C     1 
ATOM   1989  O  O     . PHE B  1  32   ? 48.416  18.944  118.057 1.00 62.49  ? 32   PHE B O     1 
ATOM   1990  C  CB    . PHE B  1  32   ? 51.419  19.350  117.524 1.00 58.28  ? 32   PHE B CB    1 
ATOM   1991  C  CG    . PHE B  1  32   ? 52.534  18.914  118.427 1.00 62.64  ? 32   PHE B CG    1 
ATOM   1992  C  CD1   . PHE B  1  32   ? 53.738  18.477  117.902 1.00 61.96  ? 32   PHE B CD1   1 
ATOM   1993  C  CD2   . PHE B  1  32   ? 52.364  18.910  119.801 1.00 63.31  ? 32   PHE B CD2   1 
ATOM   1994  C  CE1   . PHE B  1  32   ? 54.760  18.061  118.733 1.00 63.50  ? 32   PHE B CE1   1 
ATOM   1995  C  CE2   . PHE B  1  32   ? 53.381  18.492  120.639 1.00 63.72  ? 32   PHE B CE2   1 
ATOM   1996  C  CZ    . PHE B  1  32   ? 54.581  18.067  120.104 1.00 67.13  ? 32   PHE B CZ    1 
ATOM   1997  N  N     . GLY B  1  33   ? 48.527  18.791  115.816 1.00 55.73  ? 33   GLY B N     1 
ATOM   1998  C  CA    . GLY B  1  33   ? 47.147  19.190  115.620 1.00 52.90  ? 33   GLY B CA    1 
ATOM   1999  C  C     . GLY B  1  33   ? 46.172  18.254  116.308 1.00 53.50  ? 33   GLY B C     1 
ATOM   2000  O  O     . GLY B  1  33   ? 45.236  18.700  116.968 1.00 53.13  ? 33   GLY B O     1 
ATOM   2001  N  N     . VAL B  1  34   ? 46.385  16.951  116.153 1.00 55.86  ? 34   VAL B N     1 
ATOM   2002  C  CA    . VAL B  1  34   ? 45.511  15.971  116.788 1.00 56.68  ? 34   VAL B CA    1 
ATOM   2003  C  C     . VAL B  1  34   ? 45.907  15.740  118.244 1.00 53.36  ? 34   VAL B C     1 
ATOM   2004  O  O     . VAL B  1  34   ? 45.081  15.328  119.064 1.00 57.78  ? 34   VAL B O     1 
ATOM   2005  C  CB    . VAL B  1  34   ? 45.485  14.635  116.002 1.00 56.90  ? 34   VAL B CB    1 
ATOM   2006  C  CG1   . VAL B  1  34   ? 45.851  14.882  114.554 1.00 55.69  ? 34   VAL B CG1   1 
ATOM   2007  C  CG2   . VAL B  1  34   ? 46.429  13.612  116.611 1.00 54.04  ? 34   VAL B CG2   1 
ATOM   2008  N  N     . THR B  1  35   ? 47.164  16.040  118.562 1.00 53.82  ? 35   THR B N     1 
ATOM   2009  C  CA    . THR B  1  35   ? 47.679  15.908  119.922 1.00 57.34  ? 35   THR B CA    1 
ATOM   2010  C  C     . THR B  1  35   ? 47.013  16.919  120.857 1.00 56.12  ? 35   THR B C     1 
ATOM   2011  O  O     . THR B  1  35   ? 46.683  16.595  121.997 1.00 51.49  ? 35   THR B O     1 
ATOM   2012  C  CB    . THR B  1  35   ? 49.223  16.056  119.968 1.00 55.75  ? 35   THR B CB    1 
ATOM   2013  O  OG1   . THR B  1  35   ? 49.834  14.869  119.443 1.00 54.89  ? 35   THR B OG1   1 
ATOM   2014  C  CG2   . THR B  1  35   ? 49.709  16.264  121.393 1.00 49.19  ? 35   THR B CG2   1 
ATOM   2015  N  N     . LEU B  1  36   ? 46.825  18.145  120.377 1.00 53.88  ? 36   LEU B N     1 
ATOM   2016  C  CA    . LEU B  1  36   ? 46.053  19.130  121.122 1.00 46.36  ? 36   LEU B CA    1 
ATOM   2017  C  C     . LEU B  1  36   ? 44.563  18.910  120.922 1.00 49.64  ? 36   LEU B C     1 
ATOM   2018  O  O     . LEU B  1  36   ? 43.783  18.975  121.865 1.00 56.09  ? 36   LEU B O     1 
ATOM   2019  C  CB    . LEU B  1  36   ? 46.426  20.544  120.691 1.00 44.82  ? 36   LEU B CB    1 
ATOM   2020  C  CG    . LEU B  1  36   ? 47.909  20.873  120.843 1.00 52.18  ? 36   LEU B CG    1 
ATOM   2021  C  CD1   . LEU B  1  36   ? 48.180  22.330  120.496 1.00 53.71  ? 36   LEU B CD1   1 
ATOM   2022  C  CD2   . LEU B  1  36   ? 48.374  20.548  122.249 1.00 48.84  ? 36   LEU B CD2   1 
ATOM   2023  N  N     . GLY B  1  37   ? 44.174  18.637  119.686 1.00 50.43  ? 37   GLY B N     1 
ATOM   2024  C  CA    . GLY B  1  37   ? 42.768  18.549  119.330 1.00 50.61  ? 37   GLY B CA    1 
ATOM   2025  C  C     . GLY B  1  37   ? 41.958  17.492  120.052 1.00 46.47  ? 37   GLY B C     1 
ATOM   2026  O  O     . GLY B  1  37   ? 40.843  17.757  120.480 1.00 49.08  ? 37   GLY B O     1 
ATOM   2027  N  N     . ASN B  1  38   ? 42.498  16.287  120.182 1.00 48.93  ? 38   ASN B N     1 
ATOM   2028  C  CA    . ASN B  1  38   ? 41.737  15.217  120.827 1.00 52.60  ? 38   ASN B CA    1 
ATOM   2029  C  C     . ASN B  1  38   ? 41.421  15.418  122.311 1.00 54.86  ? 38   ASN B C     1 
ATOM   2030  O  O     . ASN B  1  38   ? 40.262  15.283  122.702 1.00 52.44  ? 38   ASN B O     1 
ATOM   2031  C  CB    . ASN B  1  38   ? 42.345  13.834  120.557 1.00 53.82  ? 38   ASN B CB    1 
ATOM   2032  C  CG    . ASN B  1  38   ? 41.882  13.255  119.237 1.00 56.32  ? 38   ASN B CG    1 
ATOM   2033  O  OD1   . ASN B  1  38   ? 40.693  13.305  118.913 1.00 52.57  ? 38   ASN B OD1   1 
ATOM   2034  N  ND2   . ASN B  1  38   ? 42.819  12.723  118.456 1.00 56.78  ? 38   ASN B ND2   1 
ATOM   2035  N  N     . PRO B  1  39   ? 42.439  15.735  123.140 1.00 57.48  ? 39   PRO B N     1 
ATOM   2036  C  CA    . PRO B  1  39   ? 42.189  15.949  124.572 1.00 54.75  ? 39   PRO B CA    1 
ATOM   2037  C  C     . PRO B  1  39   ? 41.217  17.083  124.816 1.00 51.74  ? 39   PRO B C     1 
ATOM   2038  O  O     . PRO B  1  39   ? 40.304  16.927  125.623 1.00 51.14  ? 39   PRO B O     1 
ATOM   2039  C  CB    . PRO B  1  39   ? 43.560  16.357  125.112 1.00 48.21  ? 39   PRO B CB    1 
ATOM   2040  C  CG    . PRO B  1  39   ? 44.503  15.799  124.177 1.00 48.12  ? 39   PRO B CG    1 
ATOM   2041  C  CD    . PRO B  1  39   ? 43.872  15.845  122.833 1.00 55.30  ? 39   PRO B CD    1 
ATOM   2042  N  N     . LEU B  1  40   ? 41.413  18.202  124.128 1.00 50.42  ? 40   LEU B N     1 
ATOM   2043  C  CA    . LEU B  1  40   ? 40.529  19.343  124.290 1.00 50.24  ? 40   LEU B CA    1 
ATOM   2044  C  C     . LEU B  1  40   ? 39.090  18.950  124.004 1.00 52.43  ? 40   LEU B C     1 
ATOM   2045  O  O     . LEU B  1  40   ? 38.183  19.328  124.737 1.00 53.24  ? 40   LEU B O     1 
ATOM   2046  C  CB    . LEU B  1  40   ? 40.961  20.506  123.401 1.00 44.04  ? 40   LEU B CB    1 
ATOM   2047  C  CG    . LEU B  1  40   ? 42.302  21.127  123.801 1.00 54.91  ? 40   LEU B CG    1 
ATOM   2048  C  CD1   . LEU B  1  40   ? 42.521  22.458  123.101 1.00 57.09  ? 40   LEU B CD1   1 
ATOM   2049  C  CD2   . LEU B  1  40   ? 42.399  21.286  125.312 1.00 50.93  ? 40   LEU B CD2   1 
ATOM   2050  N  N     . ARG B  1  41   ? 38.885  18.164  122.956 1.00 53.74  ? 41   ARG B N     1 
ATOM   2051  C  CA    . ARG B  1  41   ? 37.537  17.729  122.609 1.00 56.48  ? 41   ARG B CA    1 
ATOM   2052  C  C     . ARG B  1  41   ? 36.941  16.814  123.679 1.00 52.09  ? 41   ARG B C     1 
ATOM   2053  O  O     . ARG B  1  41   ? 35.780  16.970  124.057 1.00 52.13  ? 41   ARG B O     1 
ATOM   2054  C  CB    . ARG B  1  41   ? 37.512  17.036  121.244 1.00 52.19  ? 41   ARG B CB    1 
ATOM   2055  C  CG    . ARG B  1  41   ? 36.156  16.457  120.921 1.00 52.71  ? 41   ARG B CG    1 
ATOM   2056  C  CD    . ARG B  1  41   ? 36.116  15.704  119.613 1.00 47.75  ? 41   ARG B CD    1 
ATOM   2057  N  NE    . ARG B  1  41   ? 34.755  15.252  119.349 1.00 53.91  ? 41   ARG B NE    1 
ATOM   2058  C  CZ    . ARG B  1  41   ? 34.265  14.091  119.772 1.00 56.68  ? 41   ARG B CZ    1 
ATOM   2059  N  NH1   . ARG B  1  41   ? 35.043  13.258  120.462 1.00 47.30  ? 41   ARG B NH1   1 
ATOM   2060  N  NH2   . ARG B  1  41   ? 33.003  13.763  119.499 1.00 40.33  ? 41   ARG B NH2   1 
ATOM   2061  N  N     . ARG B  1  42   ? 37.739  15.863  124.156 1.00 47.84  ? 42   ARG B N     1 
ATOM   2062  C  CA    . ARG B  1  42   ? 37.298  14.932  125.188 1.00 48.34  ? 42   ARG B CA    1 
ATOM   2063  C  C     . ARG B  1  42   ? 36.893  15.696  126.440 1.00 51.83  ? 42   ARG B C     1 
ATOM   2064  O  O     . ARG B  1  42   ? 35.869  15.408  127.049 1.00 52.12  ? 42   ARG B O     1 
ATOM   2065  C  CB    . ARG B  1  42   ? 38.399  13.921  125.520 1.00 44.74  ? 42   ARG B CB    1 
ATOM   2066  C  CG    . ARG B  1  42   ? 38.645  12.896  124.435 1.00 48.32  ? 42   ARG B CG    1 
ATOM   2067  C  CD    . ARG B  1  42   ? 39.760  11.933  124.797 1.00 42.30  ? 42   ARG B CD    1 
ATOM   2068  N  NE    . ARG B  1  42   ? 39.379  11.017  125.865 1.00 40.60  ? 42   ARG B NE    1 
ATOM   2069  C  CZ    . ARG B  1  42   ? 38.696  9.890   125.681 1.00 49.32  ? 42   ARG B CZ    1 
ATOM   2070  N  NH1   . ARG B  1  42   ? 38.323  9.521   124.466 1.00 38.20  ? 42   ARG B NH1   1 
ATOM   2071  N  NH2   . ARG B  1  42   ? 38.400  9.114   126.715 1.00 55.97  ? 42   ARG B NH2   1 
ATOM   2072  N  N     . ILE B  1  43   ? 37.704  16.682  126.805 1.00 50.85  ? 43   ILE B N     1 
ATOM   2073  C  CA    . ILE B  1  43   ? 37.443  17.519  127.964 1.00 47.69  ? 43   ILE B CA    1 
ATOM   2074  C  C     . ILE B  1  43   ? 36.225  18.414  127.738 1.00 57.13  ? 43   ILE B C     1 
ATOM   2075  O  O     . ILE B  1  43   ? 35.295  18.421  128.549 1.00 62.46  ? 43   ILE B O     1 
ATOM   2076  C  CB    . ILE B  1  43   ? 38.674  18.366  128.305 1.00 42.25  ? 43   ILE B CB    1 
ATOM   2077  C  CG1   . ILE B  1  43   ? 39.796  17.459  128.824 1.00 43.16  ? 43   ILE B CG1   1 
ATOM   2078  C  CG2   . ILE B  1  43   ? 38.325  19.439  129.312 1.00 44.59  ? 43   ILE B CG2   1 
ATOM   2079  C  CD1   . ILE B  1  43   ? 41.134  18.155  128.987 1.00 42.83  ? 43   ILE B CD1   1 
ATOM   2080  N  N     . LEU B  1  44   ? 36.219  19.145  126.626 1.00 55.09  ? 44   LEU B N     1 
ATOM   2081  C  CA    . LEU B  1  44   ? 35.120  20.055  126.296 1.00 53.85  ? 44   LEU B CA    1 
ATOM   2082  C  C     . LEU B  1  44   ? 33.753  19.380  126.317 1.00 56.37  ? 44   LEU B C     1 
ATOM   2083  O  O     . LEU B  1  44   ? 32.742  20.029  126.572 1.00 65.58  ? 44   LEU B O     1 
ATOM   2084  C  CB    . LEU B  1  44   ? 35.346  20.695  124.927 1.00 56.86  ? 44   LEU B CB    1 
ATOM   2085  C  CG    . LEU B  1  44   ? 36.341  21.849  124.846 1.00 57.48  ? 44   LEU B CG    1 
ATOM   2086  C  CD1   . LEU B  1  44   ? 36.813  22.013  123.420 1.00 57.03  ? 44   LEU B CD1   1 
ATOM   2087  C  CD2   . LEU B  1  44   ? 35.705  23.130  125.342 1.00 64.69  ? 44   LEU B CD2   1 
ATOM   2088  N  N     . LEU B  1  45   ? 33.719  18.091  126.002 1.00 53.75  ? 45   LEU B N     1 
ATOM   2089  C  CA    . LEU B  1  45   ? 32.485  17.318  126.095 1.00 55.94  ? 45   LEU B CA    1 
ATOM   2090  C  C     . LEU B  1  45   ? 32.180  16.775  127.498 1.00 61.03  ? 45   LEU B C     1 
ATOM   2091  O  O     . LEU B  1  45   ? 31.027  16.778  127.929 1.00 62.90  ? 45   LEU B O     1 
ATOM   2092  C  CB    . LEU B  1  45   ? 32.480  16.183  125.066 1.00 55.03  ? 45   LEU B CB    1 
ATOM   2093  C  CG    . LEU B  1  45   ? 32.368  16.608  123.596 1.00 59.08  ? 45   LEU B CG    1 
ATOM   2094  C  CD1   . LEU B  1  45   ? 32.460  15.405  122.663 1.00 48.04  ? 45   LEU B CD1   1 
ATOM   2095  C  CD2   . LEU B  1  45   ? 31.077  17.373  123.350 1.00 56.49  ? 45   LEU B CD2   1 
ATOM   2096  N  N     . SER B  1  46   ? 33.200  16.246  128.172 1.00 54.35  ? 46   SER B N     1 
ATOM   2097  C  CA    . SER B  1  46   ? 33.023  15.629  129.491 1.00 55.06  ? 46   SER B CA    1 
ATOM   2098  C  C     . SER B  1  46   ? 33.094  16.520  130.752 1.00 62.81  ? 46   SER B C     1 
ATOM   2099  O  O     . SER B  1  46   ? 32.284  16.379  131.669 1.00 57.33  ? 46   SER B O     1 
ATOM   2100  C  CB    . SER B  1  46   ? 33.973  14.435  129.647 1.00 55.66  ? 46   SER B CB    1 
ATOM   2101  O  OG    . SER B  1  46   ? 35.323  14.855  129.754 1.00 55.64  ? 46   SER B OG    1 
ATOM   2102  N  N     . SER B  1  47   ? 34.094  17.393  130.817 1.00 62.24  ? 47   SER B N     1 
ATOM   2103  C  CA    . SER B  1  47   ? 34.419  18.087  132.069 1.00 56.27  ? 47   SER B CA    1 
ATOM   2104  C  C     . SER B  1  47   ? 33.984  19.541  132.282 1.00 57.37  ? 47   SER B C     1 
ATOM   2105  O  O     . SER B  1  47   ? 34.282  20.116  133.324 1.00 61.77  ? 47   SER B O     1 
ATOM   2106  C  CB    . SER B  1  47   ? 35.909  17.936  132.380 1.00 63.76  ? 47   SER B CB    1 
ATOM   2107  O  OG    . SER B  1  47   ? 36.218  16.578  132.630 1.00 63.75  ? 47   SER B OG    1 
ATOM   2108  N  N     . ILE B  1  48   ? 33.324  20.155  131.309 1.00 66.16  ? 48   ILE B N     1 
ATOM   2109  C  CA    . ILE B  1  48   ? 32.970  21.569  131.451 1.00 66.18  ? 48   ILE B CA    1 
ATOM   2110  C  C     . ILE B  1  48   ? 31.728  21.733  132.319 1.00 64.03  ? 48   ILE B C     1 
ATOM   2111  O  O     . ILE B  1  48   ? 30.667  21.200  131.993 1.00 62.83  ? 48   ILE B O     1 
ATOM   2112  C  CB    . ILE B  1  48   ? 32.767  22.270  130.087 1.00 66.63  ? 48   ILE B CB    1 
ATOM   2113  C  CG1   . ILE B  1  48   ? 34.028  22.149  129.225 1.00 65.67  ? 48   ILE B CG1   1 
ATOM   2114  C  CG2   . ILE B  1  48   ? 32.438  23.735  130.292 1.00 59.74  ? 48   ILE B CG2   1 
ATOM   2115  C  CD1   . ILE B  1  48   ? 35.225  22.922  129.757 1.00 59.11  ? 48   ILE B CD1   1 
ATOM   2116  N  N     . PRO B  1  49   ? 31.869  22.463  133.440 1.00 71.82  ? 49   PRO B N     1 
ATOM   2117  C  CA    . PRO B  1  49   ? 30.826  22.662  134.457 1.00 62.57  ? 49   PRO B CA    1 
ATOM   2118  C  C     . PRO B  1  49   ? 29.589  23.379  133.925 1.00 59.67  ? 49   PRO B C     1 
ATOM   2119  O  O     . PRO B  1  49   ? 29.707  24.464  133.351 1.00 55.09  ? 49   PRO B O     1 
ATOM   2120  C  CB    . PRO B  1  49   ? 31.524  23.543  135.497 1.00 53.55  ? 49   PRO B CB    1 
ATOM   2121  C  CG    . PRO B  1  49   ? 32.974  23.265  135.319 1.00 62.04  ? 49   PRO B CG    1 
ATOM   2122  C  CD    . PRO B  1  49   ? 33.140  23.092  133.839 1.00 72.33  ? 49   PRO B CD    1 
ATOM   2123  N  N     . GLY B  1  50   ? 28.420  22.787  134.162 1.00 59.93  ? 50   GLY B N     1 
ATOM   2124  C  CA    . GLY B  1  50   ? 27.158  23.315  133.674 1.00 59.14  ? 50   GLY B CA    1 
ATOM   2125  C  C     . GLY B  1  50   ? 25.989  22.857  134.530 1.00 69.62  ? 50   GLY B C     1 
ATOM   2126  O  O     . GLY B  1  50   ? 26.183  22.230  135.568 1.00 76.20  ? 50   GLY B O     1 
ATOM   2127  N  N     . THR B  1  51   ? 24.770  23.176  134.104 1.00 65.87  ? 51   THR B N     1 
ATOM   2128  C  CA    . THR B  1  51   ? 23.581  22.848  134.883 1.00 59.45  ? 51   THR B CA    1 
ATOM   2129  C  C     . THR B  1  51   ? 22.569  22.030  134.080 1.00 60.27  ? 51   THR B C     1 
ATOM   2130  O  O     . THR B  1  51   ? 22.503  22.139  132.857 1.00 72.13  ? 51   THR B O     1 
ATOM   2131  C  CB    . THR B  1  51   ? 22.881  24.123  135.379 1.00 66.52  ? 51   THR B CB    1 
ATOM   2132  O  OG1   . THR B  1  51   ? 21.967  24.589  134.377 1.00 66.92  ? 51   THR B OG1   1 
ATOM   2133  C  CG2   . THR B  1  51   ? 23.904  25.214  135.683 1.00 69.18  ? 51   THR B CG2   1 
ATOM   2134  N  N     . ALA B  1  52   ? 21.766  21.228  134.774 1.00 62.80  ? 52   ALA B N     1 
ATOM   2135  C  CA    . ALA B  1  52   ? 20.766  20.385  134.121 1.00 59.67  ? 52   ALA B CA    1 
ATOM   2136  C  C     . ALA B  1  52   ? 19.553  20.056  135.002 1.00 62.30  ? 52   ALA B C     1 
ATOM   2137  O  O     . ALA B  1  52   ? 19.648  20.019  136.226 1.00 64.83  ? 52   ALA B O     1 
ATOM   2138  C  CB    . ALA B  1  52   ? 21.412  19.103  133.644 1.00 55.72  ? 52   ALA B CB    1 
ATOM   2139  N  N     . VAL B  1  53   ? 18.420  19.787  134.365 1.00 56.80  ? 53   VAL B N     1 
ATOM   2140  C  CA    . VAL B  1  53   ? 17.258  19.286  135.073 1.00 60.20  ? 53   VAL B CA    1 
ATOM   2141  C  C     . VAL B  1  53   ? 17.429  17.786  135.301 1.00 66.74  ? 53   VAL B C     1 
ATOM   2142  O  O     . VAL B  1  53   ? 17.451  17.003  134.350 1.00 69.84  ? 53   VAL B O     1 
ATOM   2143  C  CB    . VAL B  1  53   ? 15.984  19.517  134.234 1.00 62.94  ? 53   VAL B CB    1 
ATOM   2144  C  CG1   . VAL B  1  53   ? 14.814  18.688  134.762 1.00 68.96  ? 53   VAL B CG1   1 
ATOM   2145  C  CG2   . VAL B  1  53   ? 15.639  21.000  134.182 1.00 61.44  ? 53   VAL B CG2   1 
ATOM   2146  N  N     . THR B  1  54   ? 17.554  17.386  136.564 1.00 72.47  ? 54   THR B N     1 
ATOM   2147  C  CA    . THR B  1  54   ? 17.718  15.971  136.893 1.00 76.45  ? 54   THR B CA    1 
ATOM   2148  C  C     . THR B  1  54   ? 16.460  15.213  137.343 1.00 71.71  ? 54   THR B C     1 
ATOM   2149  O  O     . THR B  1  54   ? 16.433  13.981  137.320 1.00 68.41  ? 54   THR B O     1 
ATOM   2150  C  CB    . THR B  1  54   ? 18.784  15.807  137.987 1.00 80.66  ? 54   THR B CB    1 
ATOM   2151  O  OG1   . THR B  1  54   ? 18.464  16.667  139.085 1.00 74.97  ? 54   THR B OG1   1 
ATOM   2152  C  CG2   . THR B  1  54   ? 20.158  16.186  137.455 1.00 77.89  ? 54   THR B CG2   1 
ATOM   2153  N  N     . SER B  1  55   ? 15.417  15.938  137.733 1.00 75.46  ? 55   SER B N     1 
ATOM   2154  C  CA    . SER B  1  55   ? 14.225  15.290  138.281 1.00 76.17  ? 55   SER B CA    1 
ATOM   2155  C  C     . SER B  1  55   ? 12.991  16.159  138.113 1.00 71.43  ? 55   SER B C     1 
ATOM   2156  O  O     . SER B  1  55   ? 13.086  17.379  138.148 1.00 68.54  ? 55   SER B O     1 
ATOM   2157  C  CB    . SER B  1  55   ? 14.427  14.945  139.760 1.00 75.95  ? 55   SER B CB    1 
ATOM   2158  O  OG    . SER B  1  55   ? 13.647  13.822  140.135 1.00 79.39  ? 55   SER B OG    1 
ATOM   2159  N  N     . VAL B  1  56   ? 11.831  15.535  137.943 1.00 73.82  ? 56   VAL B N     1 
ATOM   2160  C  CA    . VAL B  1  56   ? 10.598  16.297  137.775 1.00 76.05  ? 56   VAL B CA    1 
ATOM   2161  C  C     . VAL B  1  56   ? 9.389   15.660  138.451 1.00 80.89  ? 56   VAL B C     1 
ATOM   2162  O  O     . VAL B  1  56   ? 9.159   14.453  138.326 1.00 79.28  ? 56   VAL B O     1 
ATOM   2163  C  CB    . VAL B  1  56   ? 10.315  16.579  136.285 1.00 68.45  ? 56   VAL B CB    1 
ATOM   2164  C  CG1   . VAL B  1  56   ? 8.832   16.502  135.968 1.00 66.86  ? 56   VAL B CG1   1 
ATOM   2165  C  CG2   . VAL B  1  56   ? 10.867  17.933  135.917 1.00 75.50  ? 56   VAL B CG2   1 
ATOM   2166  N  N     . TYR B  1  57   ? 8.633   16.481  139.179 1.00 79.30  ? 57   TYR B N     1 
ATOM   2167  C  CA    . TYR B  1  57   ? 7.363   16.050  139.750 1.00 77.86  ? 57   TYR B CA    1 
ATOM   2168  C  C     . TYR B  1  57   ? 6.224   16.847  139.130 1.00 76.20  ? 57   TYR B C     1 
ATOM   2169  O  O     . TYR B  1  57   ? 6.232   18.072  139.161 1.00 74.96  ? 57   TYR B O     1 
ATOM   2170  C  CB    . TYR B  1  57   ? 7.356   16.212  141.278 1.00 92.27  ? 57   TYR B CB    1 
ATOM   2171  C  CG    . TYR B  1  57   ? 6.005   15.934  141.914 1.00 98.79  ? 57   TYR B CG    1 
ATOM   2172  C  CD1   . TYR B  1  57   ? 5.565   14.629  142.121 1.00 96.74  ? 57   TYR B CD1   1 
ATOM   2173  C  CD2   . TYR B  1  57   ? 5.168   16.976  142.301 1.00 91.46  ? 57   TYR B CD2   1 
ATOM   2174  C  CE1   . TYR B  1  57   ? 4.331   14.369  142.690 1.00 95.17  ? 57   TYR B CE1   1 
ATOM   2175  C  CE2   . TYR B  1  57   ? 3.932   16.727  142.871 1.00 96.51  ? 57   TYR B CE2   1 
ATOM   2176  C  CZ    . TYR B  1  57   ? 3.518   15.422  143.065 1.00 101.63 ? 57   TYR B CZ    1 
ATOM   2177  O  OH    . TYR B  1  57   ? 2.288   15.173  143.636 1.00 95.56  ? 57   TYR B OH    1 
ATOM   2178  N  N     . ILE B  1  58   ? 5.255   16.143  138.554 1.00 80.52  ? 58   ILE B N     1 
ATOM   2179  C  CA    . ILE B  1  58   ? 4.043   16.772  138.039 1.00 90.64  ? 58   ILE B CA    1 
ATOM   2180  C  C     . ILE B  1  58   ? 2.860   16.200  138.804 1.00 97.84  ? 58   ILE B C     1 
ATOM   2181  O  O     . ILE B  1  58   ? 2.723   14.978  138.908 1.00 95.32  ? 58   ILE B O     1 
ATOM   2182  C  CB    . ILE B  1  58   ? 3.854   16.522  136.536 1.00 89.69  ? 58   ILE B CB    1 
ATOM   2183  C  CG1   . ILE B  1  58   ? 5.128   16.890  135.771 1.00 88.66  ? 58   ILE B CG1   1 
ATOM   2184  C  CG2   . ILE B  1  58   ? 2.671   17.321  136.011 1.00 88.29  ? 58   ILE B CG2   1 
ATOM   2185  C  CD1   . ILE B  1  58   ? 5.095   16.512  134.305 1.00 82.15  ? 58   ILE B CD1   1 
ATOM   2186  N  N     . GLU B  1  59   ? 2.002   17.087  139.309 1.00 99.42  ? 59   GLU B N     1 
ATOM   2187  C  CA    . GLU B  1  59   ? 1.065   16.758  140.387 1.00 108.58 ? 59   GLU B CA    1 
ATOM   2188  C  C     . GLU B  1  59   ? 0.284   15.451  140.238 1.00 109.95 ? 59   GLU B C     1 
ATOM   2189  O  O     . GLU B  1  59   ? 0.464   14.523  141.029 1.00 114.88 ? 59   GLU B O     1 
ATOM   2190  C  CB    . GLU B  1  59   ? 0.100   17.918  140.663 1.00 113.67 ? 59   GLU B CB    1 
ATOM   2191  C  CG    . GLU B  1  59   ? -0.795  17.667  141.875 1.00 115.19 ? 59   GLU B CG    1 
ATOM   2192  C  CD    . GLU B  1  59   ? -1.649  18.860  142.253 1.00 118.04 ? 59   GLU B CD    1 
ATOM   2193  O  OE1   . GLU B  1  59   ? -1.482  19.937  141.642 1.00 116.95 ? 59   GLU B OE1   1 
ATOM   2194  O  OE2   . GLU B  1  59   ? -2.488  18.719  143.169 1.00 120.57 ? 59   GLU B OE2   1 
ATOM   2195  N  N     . ASP B  1  60   ? -0.582  15.372  139.236 1.00 98.22  ? 60   ASP B N     1 
ATOM   2196  C  CA    . ASP B  1  60   ? -1.452  14.208  139.111 1.00 105.25 ? 60   ASP B CA    1 
ATOM   2197  C  C     . ASP B  1  60   ? -0.822  13.108  138.263 1.00 105.19 ? 60   ASP B C     1 
ATOM   2198  O  O     . ASP B  1  60   ? -1.444  12.077  138.002 1.00 105.85 ? 60   ASP B O     1 
ATOM   2199  C  CB    . ASP B  1  60   ? -2.825  14.614  138.568 1.00 119.61 ? 60   ASP B CB    1 
ATOM   2200  C  CG    . ASP B  1  60   ? -3.598  15.501  139.538 1.00 120.84 ? 60   ASP B CG    1 
ATOM   2201  O  OD1   . ASP B  1  60   ? -3.581  15.216  140.757 1.00 109.79 ? 60   ASP B OD1   1 
ATOM   2202  O  OD2   . ASP B  1  60   ? -4.217  16.486  139.080 1.00 120.83 ? 60   ASP B OD2   1 
ATOM   2203  N  N     . VAL B  1  61   ? 0.422   13.335  137.848 1.00 105.31 ? 61   VAL B N     1 
ATOM   2204  C  CA    . VAL B  1  61   ? 1.140   12.401  136.988 1.00 98.14  ? 61   VAL B CA    1 
ATOM   2205  C  C     . VAL B  1  61   ? 1.860   11.321  137.785 1.00 96.43  ? 61   VAL B C     1 
ATOM   2206  O  O     . VAL B  1  61   ? 2.709   11.622  138.626 1.00 95.37  ? 61   VAL B O     1 
ATOM   2207  C  CB    . VAL B  1  61   ? 2.165   13.138  136.116 1.00 97.04  ? 61   VAL B CB    1 
ATOM   2208  C  CG1   . VAL B  1  61   ? 3.036   12.143  135.374 1.00 105.45 ? 61   VAL B CG1   1 
ATOM   2209  C  CG2   . VAL B  1  61   ? 1.456   14.066  135.145 1.00 90.13  ? 61   VAL B CG2   1 
ATOM   2210  N  N     . LEU B  1  62   ? 1.512   10.064  137.522 1.00 99.66  ? 62   LEU B N     1 
ATOM   2211  C  CA    . LEU B  1  62   ? 2.117   8.941   138.237 1.00 107.41 ? 62   LEU B CA    1 
ATOM   2212  C  C     . LEU B  1  62   ? 3.502   8.562   137.711 1.00 110.87 ? 62   LEU B C     1 
ATOM   2213  O  O     . LEU B  1  62   ? 4.438   8.401   138.493 1.00 106.98 ? 62   LEU B O     1 
ATOM   2214  C  CB    . LEU B  1  62   ? 1.195   7.714   138.238 1.00 112.31 ? 62   LEU B CB    1 
ATOM   2215  C  CG    . LEU B  1  62   ? -0.245  7.941   138.725 1.00 117.32 ? 62   LEU B CG    1 
ATOM   2216  C  CD1   . LEU B  1  62   ? -1.098  6.674   138.857 1.00 119.81 ? 62   LEU B CD1   1 
ATOM   2217  C  CD2   . LEU B  1  62   ? -0.413  8.909   139.906 1.00 108.58 ? 62   LEU B CD2   1 
ATOM   2218  N  N     . HIS B  1  63   ? 3.632   8.428   136.392 1.00 121.63 ? 63   HIS B N     1 
ATOM   2219  C  CA    . HIS B  1  63   ? 4.911   8.042   135.784 1.00 119.35 ? 63   HIS B CA    1 
ATOM   2220  C  C     . HIS B  1  63   ? 5.223   8.751   134.458 1.00 113.42 ? 63   HIS B C     1 
ATOM   2221  O  O     . HIS B  1  63   ? 4.484   9.631   134.020 1.00 110.49 ? 63   HIS B O     1 
ATOM   2222  C  CB    . HIS B  1  63   ? 5.018   6.516   135.629 1.00 120.23 ? 63   HIS B CB    1 
ATOM   2223  C  CG    . HIS B  1  63   ? 3.869   5.891   134.895 1.00 124.02 ? 63   HIS B CG    1 
ATOM   2224  N  ND1   . HIS B  1  63   ? 3.736   5.954   133.525 1.00 119.75 ? 63   HIS B ND1   1 
ATOM   2225  C  CD2   . HIS B  1  63   ? 2.809   5.177   135.344 1.00 126.86 ? 63   HIS B CD2   1 
ATOM   2226  C  CE1   . HIS B  1  63   ? 2.640   5.312   133.161 1.00 122.49 ? 63   HIS B CE1   1 
ATOM   2227  N  NE2   . HIS B  1  63   ? 2.059   4.832   134.245 1.00 128.28 ? 63   HIS B NE2   1 
ATOM   2228  N  N     . GLU B  1  64   ? 6.325   8.347   133.829 1.00 113.66 ? 64   GLU B N     1 
ATOM   2229  C  CA    . GLU B  1  64   ? 6.880   9.043   132.666 1.00 108.79 ? 64   GLU B CA    1 
ATOM   2230  C  C     . GLU B  1  64   ? 6.039   8.931   131.391 1.00 108.17 ? 64   GLU B C     1 
ATOM   2231  O  O     . GLU B  1  64   ? 5.972   9.869   130.596 1.00 106.44 ? 64   GLU B O     1 
ATOM   2232  C  CB    . GLU B  1  64   ? 8.308   8.551   132.397 1.00 106.38 ? 64   GLU B CB    1 
ATOM   2233  C  CG    . GLU B  1  64   ? 9.029   9.270   131.260 1.00 112.03 ? 64   GLU B CG    1 
ATOM   2234  C  CD    . GLU B  1  64   ? 10.482  8.840   131.114 1.00 108.13 ? 64   GLU B CD    1 
ATOM   2235  O  OE1   . GLU B  1  64   ? 11.192  9.431   130.272 1.00 107.64 ? 64   GLU B OE1   1 
ATOM   2236  O  OE2   . GLU B  1  64   ? 10.916  7.917   131.838 1.00 102.04 ? 64   GLU B OE2   1 
ATOM   2237  N  N     . PHE B  1  65   ? 5.402   7.784   131.196 1.00 109.22 ? 65   PHE B N     1 
ATOM   2238  C  CA    . PHE B  1  65   ? 4.652   7.536   129.968 1.00 109.77 ? 65   PHE B CA    1 
ATOM   2239  C  C     . PHE B  1  65   ? 3.174   7.892   130.093 1.00 115.00 ? 65   PHE B C     1 
ATOM   2240  O  O     . PHE B  1  65   ? 2.388   7.651   129.179 1.00 114.19 ? 65   PHE B O     1 
ATOM   2241  C  CB    . PHE B  1  65   ? 4.841   6.089   129.518 1.00 111.66 ? 65   PHE B CB    1 
ATOM   2242  C  CG    . PHE B  1  65   ? 6.279   5.708   129.344 1.00 115.07 ? 65   PHE B CG    1 
ATOM   2243  C  CD1   . PHE B  1  65   ? 6.976   6.093   128.212 1.00 112.70 ? 65   PHE B CD1   1 
ATOM   2244  C  CD2   . PHE B  1  65   ? 6.943   4.990   130.324 1.00 119.05 ? 65   PHE B CD2   1 
ATOM   2245  C  CE1   . PHE B  1  65   ? 8.305   5.756   128.053 1.00 107.43 ? 65   PHE B CE1   1 
ATOM   2246  C  CE2   . PHE B  1  65   ? 8.275   4.649   130.172 1.00 116.78 ? 65   PHE B CE2   1 
ATOM   2247  C  CZ    . PHE B  1  65   ? 8.956   5.032   129.034 1.00 110.71 ? 65   PHE B CZ    1 
ATOM   2248  N  N     . SER B  1  66   ? 2.806   8.465   131.234 1.00 119.60 ? 66   SER B N     1 
ATOM   2249  C  CA    . SER B  1  66   ? 1.434   8.893   131.476 1.00 116.58 ? 66   SER B CA    1 
ATOM   2250  C  C     . SER B  1  66   ? 1.051   10.061  130.573 1.00 109.77 ? 66   SER B C     1 
ATOM   2251  O  O     . SER B  1  66   ? 1.914   10.756  130.035 1.00 104.13 ? 66   SER B O     1 
ATOM   2252  C  CB    . SER B  1  66   ? 1.254   9.296   132.942 1.00 118.05 ? 66   SER B CB    1 
ATOM   2253  O  OG    . SER B  1  66   ? 1.614   8.239   133.815 1.00 116.50 ? 66   SER B OG    1 
ATOM   2254  N  N     . THR B  1  67   ? -0.250  10.264  130.399 1.00 111.85 ? 67   THR B N     1 
ATOM   2255  C  CA    . THR B  1  67   ? -0.741  11.413  129.653 1.00 112.41 ? 67   THR B CA    1 
ATOM   2256  C  C     . THR B  1  67   ? -1.463  12.385  130.584 1.00 109.18 ? 67   THR B C     1 
ATOM   2257  O  O     . THR B  1  67   ? -2.122  11.974  131.539 1.00 103.22 ? 67   THR B O     1 
ATOM   2258  C  CB    . THR B  1  67   ? -1.669  10.992  128.494 1.00 108.88 ? 67   THR B CB    1 
ATOM   2259  O  OG1   . THR B  1  67   ? -2.231  12.159  127.878 1.00 115.56 ? 67   THR B OG1   1 
ATOM   2260  C  CG2   . THR B  1  67   ? -2.790  10.094  129.001 1.00 98.22  ? 67   THR B CG2   1 
ATOM   2261  N  N     . ILE B  1  68   ? -1.318  13.676  130.308 1.00 108.10 ? 68   ILE B N     1 
ATOM   2262  C  CA    . ILE B  1  68   ? -1.957  14.705  131.114 1.00 99.53  ? 68   ILE B CA    1 
ATOM   2263  C  C     . ILE B  1  68   ? -3.228  15.206  130.443 1.00 108.69 ? 68   ILE B C     1 
ATOM   2264  O  O     . ILE B  1  68   ? -3.193  15.670  129.299 1.00 103.64 ? 68   ILE B O     1 
ATOM   2265  C  CB    . ILE B  1  68   ? -1.023  15.901  131.345 1.00 95.86  ? 68   ILE B CB    1 
ATOM   2266  C  CG1   . ILE B  1  68   ? 0.284   15.443  131.985 1.00 97.61  ? 68   ILE B CG1   1 
ATOM   2267  C  CG2   . ILE B  1  68   ? -1.700  16.945  132.213 1.00 94.85  ? 68   ILE B CG2   1 
ATOM   2268  C  CD1   . ILE B  1  68   ? 1.230   16.581  132.292 1.00 106.03 ? 68   ILE B CD1   1 
ATOM   2269  N  N     . PRO B  1  69   ? -4.363  15.099  131.150 1.00 114.37 ? 69   PRO B N     1 
ATOM   2270  C  CA    . PRO B  1  69   ? -5.636  15.642  130.664 1.00 102.83 ? 69   PRO B CA    1 
ATOM   2271  C  C     . PRO B  1  69   ? -5.617  17.168  130.690 1.00 93.72  ? 69   PRO B C     1 
ATOM   2272  O  O     . PRO B  1  69   ? -5.175  17.754  131.679 1.00 89.83  ? 69   PRO B O     1 
ATOM   2273  C  CB    . PRO B  1  69   ? -6.655  15.107  131.679 1.00 99.04  ? 69   PRO B CB    1 
ATOM   2274  C  CG    . PRO B  1  69   ? -5.953  13.984  132.400 1.00 92.36  ? 69   PRO B CG    1 
ATOM   2275  C  CD    . PRO B  1  69   ? -4.520  14.388  132.431 1.00 97.28  ? 69   PRO B CD    1 
ATOM   2276  N  N     . GLY B  1  70   ? -6.088  17.799  129.619 1.00 93.60  ? 70   GLY B N     1 
ATOM   2277  C  CA    . GLY B  1  70   ? -6.122  19.250  129.545 1.00 102.01 ? 70   GLY B CA    1 
ATOM   2278  C  C     . GLY B  1  70   ? -4.834  19.853  129.014 1.00 106.87 ? 70   GLY B C     1 
ATOM   2279  O  O     . GLY B  1  70   ? -4.767  21.046  128.710 1.00 106.45 ? 70   GLY B O     1 
ATOM   2280  N  N     . VAL B  1  71   ? -3.803  19.022  128.912 1.00 107.39 ? 71   VAL B N     1 
ATOM   2281  C  CA    . VAL B  1  71   ? -2.538  19.436  128.324 1.00 102.95 ? 71   VAL B CA    1 
ATOM   2282  C  C     . VAL B  1  71   ? -2.259  18.606  127.073 1.00 99.48  ? 71   VAL B C     1 
ATOM   2283  O  O     . VAL B  1  71   ? -2.364  17.376  127.095 1.00 94.99  ? 71   VAL B O     1 
ATOM   2284  C  CB    . VAL B  1  71   ? -1.376  19.295  129.324 1.00 96.78  ? 71   VAL B CB    1 
ATOM   2285  C  CG1   . VAL B  1  71   ? -0.065  19.682  128.670 1.00 97.54  ? 71   VAL B CG1   1 
ATOM   2286  C  CG2   . VAL B  1  71   ? -1.628  20.157  130.547 1.00 97.34  ? 71   VAL B CG2   1 
ATOM   2287  N  N     . LYS B  1  72   ? -1.924  19.287  125.981 1.00 97.95  ? 72   LYS B N     1 
ATOM   2288  C  CA    . LYS B  1  72   ? -1.676  18.631  124.700 1.00 102.81 ? 72   LYS B CA    1 
ATOM   2289  C  C     . LYS B  1  72   ? -0.487  17.668  124.737 1.00 94.48  ? 72   LYS B C     1 
ATOM   2290  O  O     . LYS B  1  72   ? -0.629  16.482  124.437 1.00 96.86  ? 72   LYS B O     1 
ATOM   2291  C  CB    . LYS B  1  72   ? -1.471  19.675  123.600 1.00 100.28 ? 72   LYS B CB    1 
ATOM   2292  C  CG    . LYS B  1  72   ? -1.162  19.083  122.237 1.00 109.38 ? 72   LYS B CG    1 
ATOM   2293  C  CD    . LYS B  1  72   ? -0.968  20.170  121.192 1.00 117.78 ? 72   LYS B CD    1 
ATOM   2294  C  CE    . LYS B  1  72   ? -0.677  19.572  119.826 1.00 113.67 ? 72   LYS B CE    1 
ATOM   2295  N  NZ    . LYS B  1  72   ? -0.566  20.626  118.783 1.00 123.19 ? 72   LYS B NZ    1 
ATOM   2296  N  N     . GLU B  1  73   ? 0.681   18.188  125.103 1.00 82.58  ? 73   GLU B N     1 
ATOM   2297  C  CA    . GLU B  1  73   ? 1.886   17.377  125.231 1.00 78.46  ? 73   GLU B CA    1 
ATOM   2298  C  C     . GLU B  1  73   ? 1.698   16.256  126.240 1.00 82.53  ? 73   GLU B C     1 
ATOM   2299  O  O     . GLU B  1  73   ? 0.990   16.421  127.230 1.00 96.07  ? 73   GLU B O     1 
ATOM   2300  C  CB    . GLU B  1  73   ? 3.060   18.245  125.685 1.00 80.95  ? 73   GLU B CB    1 
ATOM   2301  C  CG    . GLU B  1  73   ? 3.525   19.275  124.671 1.00 88.61  ? 73   GLU B CG    1 
ATOM   2302  C  CD    . GLU B  1  73   ? 2.685   20.532  124.679 1.00 91.16  ? 73   GLU B CD    1 
ATOM   2303  O  OE1   . GLU B  1  73   ? 1.597   20.514  125.288 1.00 97.10  ? 73   GLU B OE1   1 
ATOM   2304  O  OE2   . GLU B  1  73   ? 3.117   21.540  124.080 1.00 88.01  ? 73   GLU B OE2   1 
ATOM   2305  N  N     . ASP B  1  74   ? 2.325   15.111  125.990 1.00 79.56  ? 74   ASP B N     1 
ATOM   2306  C  CA    . ASP B  1  74   ? 2.403   14.073  127.010 1.00 86.42  ? 74   ASP B CA    1 
ATOM   2307  C  C     . ASP B  1  74   ? 3.564   14.393  127.944 1.00 85.86  ? 74   ASP B C     1 
ATOM   2308  O  O     . ASP B  1  74   ? 4.259   15.391  127.751 1.00 77.72  ? 74   ASP B O     1 
ATOM   2309  C  CB    . ASP B  1  74   ? 2.541   12.671  126.398 1.00 88.58  ? 74   ASP B CB    1 
ATOM   2310  C  CG    . ASP B  1  74   ? 3.595   12.600  125.302 1.00 88.38  ? 74   ASP B CG    1 
ATOM   2311  O  OD1   . ASP B  1  74   ? 4.697   13.167  125.477 1.00 83.85  ? 74   ASP B OD1   1 
ATOM   2312  O  OD2   . ASP B  1  74   ? 3.317   11.966  124.260 1.00 82.16  ? 74   ASP B OD2   1 
ATOM   2313  N  N     . VAL B  1  75   ? 3.768   13.553  128.953 1.00 87.58  ? 75   VAL B N     1 
ATOM   2314  C  CA    . VAL B  1  75   ? 4.803   13.807  129.946 1.00 87.35  ? 75   VAL B CA    1 
ATOM   2315  C  C     . VAL B  1  75   ? 6.186   13.812  129.301 1.00 80.58  ? 75   VAL B C     1 
ATOM   2316  O  O     . VAL B  1  75   ? 7.026   14.660  129.613 1.00 73.75  ? 75   VAL B O     1 
ATOM   2317  C  CB    . VAL B  1  75   ? 4.747   12.771  131.084 1.00 96.14  ? 75   VAL B CB    1 
ATOM   2318  C  CG1   . VAL B  1  75   ? 5.896   12.978  132.058 1.00 94.03  ? 75   VAL B CG1   1 
ATOM   2319  C  CG2   . VAL B  1  75   ? 3.413   12.857  131.806 1.00 91.82  ? 75   VAL B CG2   1 
ATOM   2320  N  N     . VAL B  1  76   ? 6.395   12.874  128.380 1.00 84.02  ? 76   VAL B N     1 
ATOM   2321  C  CA    . VAL B  1  76   ? 7.666   12.721  127.673 1.00 78.84  ? 76   VAL B CA    1 
ATOM   2322  C  C     . VAL B  1  76   ? 8.111   14.001  126.962 1.00 74.79  ? 76   VAL B C     1 
ATOM   2323  O  O     . VAL B  1  76   ? 9.260   14.438  127.104 1.00 70.42  ? 76   VAL B O     1 
ATOM   2324  C  CB    . VAL B  1  76   ? 7.583   11.590  126.632 1.00 73.30  ? 76   VAL B CB    1 
ATOM   2325  C  CG1   . VAL B  1  76   ? 8.933   11.382  125.973 1.00 74.51  ? 76   VAL B CG1   1 
ATOM   2326  C  CG2   . VAL B  1  76   ? 7.094   10.300  127.281 1.00 81.79  ? 76   VAL B CG2   1 
ATOM   2327  N  N     . GLU B  1  77   ? 7.197   14.593  126.200 1.00 72.92  ? 77   GLU B N     1 
ATOM   2328  C  CA    . GLU B  1  77   ? 7.490   15.811  125.452 1.00 72.73  ? 77   GLU B CA    1 
ATOM   2329  C  C     . GLU B  1  77   ? 7.875   16.948  126.392 1.00 72.34  ? 77   GLU B C     1 
ATOM   2330  O  O     . GLU B  1  77   ? 8.802   17.714  126.115 1.00 71.80  ? 77   GLU B O     1 
ATOM   2331  C  CB    . GLU B  1  77   ? 6.293   16.212  124.585 1.00 72.76  ? 77   GLU B CB    1 
ATOM   2332  C  CG    . GLU B  1  77   ? 6.543   17.418  123.679 1.00 82.06  ? 77   GLU B CG    1 
ATOM   2333  C  CD    . GLU B  1  77   ? 7.481   17.115  122.514 1.00 83.74  ? 77   GLU B CD    1 
ATOM   2334  O  OE1   . GLU B  1  77   ? 8.348   17.966  122.217 1.00 78.83  ? 77   GLU B OE1   1 
ATOM   2335  O  OE2   . GLU B  1  77   ? 7.344   16.038  121.890 1.00 72.01  ? 77   GLU B OE2   1 
ATOM   2336  N  N     . ILE B  1  78   ? 7.165   17.043  127.512 1.00 73.00  ? 78   ILE B N     1 
ATOM   2337  C  CA    . ILE B  1  78   ? 7.444   18.065  128.508 1.00 72.42  ? 78   ILE B CA    1 
ATOM   2338  C  C     . ILE B  1  78   ? 8.845   17.870  129.070 1.00 67.71  ? 78   ILE B C     1 
ATOM   2339  O  O     . ILE B  1  78   ? 9.620   18.822  129.181 1.00 63.05  ? 78   ILE B O     1 
ATOM   2340  C  CB    . ILE B  1  78   ? 6.420   18.023  129.658 1.00 80.79  ? 78   ILE B CB    1 
ATOM   2341  C  CG1   . ILE B  1  78   ? 4.998   18.107  129.107 1.00 81.34  ? 78   ILE B CG1   1 
ATOM   2342  C  CG2   . ILE B  1  78   ? 6.673   19.156  130.641 1.00 70.99  ? 78   ILE B CG2   1 
ATOM   2343  C  CD1   . ILE B  1  78   ? 3.936   17.812  130.132 1.00 82.45  ? 78   ILE B CD1   1 
ATOM   2344  N  N     . ILE B  1  79   ? 9.165   16.627  129.416 1.00 66.94  ? 79   ILE B N     1 
ATOM   2345  C  CA    . ILE B  1  79   ? 10.485  16.294  129.939 1.00 69.30  ? 79   ILE B CA    1 
ATOM   2346  C  C     . ILE B  1  79   ? 11.580  16.697  128.954 1.00 71.83  ? 79   ILE B C     1 
ATOM   2347  O  O     . ILE B  1  79   ? 12.605  17.259  129.348 1.00 69.14  ? 79   ILE B O     1 
ATOM   2348  C  CB    . ILE B  1  79   ? 10.597  14.790  130.255 1.00 75.34  ? 79   ILE B CB    1 
ATOM   2349  C  CG1   . ILE B  1  79   ? 9.668   14.419  131.410 1.00 71.88  ? 79   ILE B CG1   1 
ATOM   2350  C  CG2   . ILE B  1  79   ? 12.024  14.416  130.606 1.00 75.47  ? 79   ILE B CG2   1 
ATOM   2351  C  CD1   . ILE B  1  79   ? 9.650   12.940  131.725 1.00 80.53  ? 79   ILE B CD1   1 
ATOM   2352  N  N     . LEU B  1  80   ? 11.347  16.410  127.673 1.00 73.40  ? 80   LEU B N     1 
ATOM   2353  C  CA    . LEU B  1  80   ? 12.261  16.801  126.598 1.00 64.79  ? 80   LEU B CA    1 
ATOM   2354  C  C     . LEU B  1  80   ? 12.482  18.313  126.567 1.00 66.67  ? 80   LEU B C     1 
ATOM   2355  O  O     . LEU B  1  80   ? 13.628  18.793  126.619 1.00 67.81  ? 80   LEU B O     1 
ATOM   2356  C  CB    . LEU B  1  80   ? 11.716  16.328  125.250 1.00 65.41  ? 80   LEU B CB    1 
ATOM   2357  C  CG    . LEU B  1  80   ? 12.196  14.998  124.660 1.00 58.99  ? 80   LEU B CG    1 
ATOM   2358  C  CD1   . LEU B  1  80   ? 12.790  14.085  125.713 1.00 61.16  ? 80   LEU B CD1   1 
ATOM   2359  C  CD2   . LEU B  1  80   ? 11.054  14.301  123.936 1.00 60.51  ? 80   LEU B CD2   1 
ATOM   2360  N  N     . ASN B  1  81   ? 11.382  19.062  126.488 1.00 65.92  ? 81   ASN B N     1 
ATOM   2361  C  CA    . ASN B  1  81   ? 11.448  20.523  126.530 1.00 69.02  ? 81   ASN B CA    1 
ATOM   2362  C  C     . ASN B  1  81   ? 12.248  21.018  127.738 1.00 71.71  ? 81   ASN B C     1 
ATOM   2363  O  O     . ASN B  1  81   ? 13.008  21.989  127.648 1.00 66.08  ? 81   ASN B O     1 
ATOM   2364  C  CB    . ASN B  1  81   ? 10.043  21.134  126.526 1.00 67.98  ? 81   ASN B CB    1 
ATOM   2365  C  CG    . ASN B  1  81   ? 9.310   20.901  125.219 1.00 77.56  ? 81   ASN B CG    1 
ATOM   2366  O  OD1   . ASN B  1  81   ? 8.252   20.271  125.189 1.00 77.02  ? 81   ASN B OD1   1 
ATOM   2367  N  ND2   . ASN B  1  81   ? 9.872   21.413  124.126 1.00 82.46  ? 81   ASN B ND2   1 
ATOM   2368  N  N     . LEU B  1  82   ? 12.086  20.326  128.862 1.00 71.59  ? 82   LEU B N     1 
ATOM   2369  C  CA    . LEU B  1  82   ? 12.837  20.643  130.067 1.00 72.66  ? 82   LEU B CA    1 
ATOM   2370  C  C     . LEU B  1  82   ? 14.324  20.364  129.896 1.00 71.09  ? 82   LEU B C     1 
ATOM   2371  O  O     . LEU B  1  82   ? 15.159  21.100  130.425 1.00 71.44  ? 82   LEU B O     1 
ATOM   2372  C  CB    . LEU B  1  82   ? 12.288  19.866  131.258 1.00 78.41  ? 82   LEU B CB    1 
ATOM   2373  C  CG    . LEU B  1  82   ? 10.906  20.324  131.721 1.00 76.41  ? 82   LEU B CG    1 
ATOM   2374  C  CD1   . LEU B  1  82   ? 10.299  19.301  132.658 1.00 62.66  ? 82   LEU B CD1   1 
ATOM   2375  C  CD2   . LEU B  1  82   ? 11.009  21.685  132.387 1.00 73.19  ? 82   LEU B CD2   1 
ATOM   2376  N  N     . LYS B  1  83   ? 14.652  19.299  129.165 1.00 71.62  ? 83   LYS B N     1 
ATOM   2377  C  CA    . LYS B  1  83   ? 16.044  19.006  128.844 1.00 67.39  ? 83   LYS B CA    1 
ATOM   2378  C  C     . LYS B  1  83   ? 16.626  20.165  128.049 1.00 71.71  ? 83   LYS B C     1 
ATOM   2379  O  O     . LYS B  1  83   ? 17.820  20.459  128.144 1.00 65.31  ? 83   LYS B O     1 
ATOM   2380  C  CB    . LYS B  1  83   ? 16.170  17.724  128.028 1.00 59.79  ? 83   LYS B CB    1 
ATOM   2381  C  CG    . LYS B  1  83   ? 15.893  16.445  128.779 1.00 59.69  ? 83   LYS B CG    1 
ATOM   2382  C  CD    . LYS B  1  83   ? 16.051  15.258  127.848 1.00 57.74  ? 83   LYS B CD    1 
ATOM   2383  C  CE    . LYS B  1  83   ? 15.876  13.943  128.571 1.00 67.99  ? 83   LYS B CE    1 
ATOM   2384  N  NZ    . LYS B  1  83   ? 16.028  12.797  127.638 1.00 69.75  ? 83   LYS B NZ    1 
ATOM   2385  N  N     . GLU B  1  84   ? 15.776  20.831  127.270 1.00 69.86  ? 84   GLU B N     1 
ATOM   2386  C  CA    . GLU B  1  84   ? 16.246  21.976  126.491 1.00 74.23  ? 84   GLU B CA    1 
ATOM   2387  C  C     . GLU B  1  84   ? 16.387  23.271  127.302 1.00 75.67  ? 84   GLU B C     1 
ATOM   2388  O  O     . GLU B  1  84   ? 16.924  24.262  126.806 1.00 76.94  ? 84   GLU B O     1 
ATOM   2389  C  CB    . GLU B  1  84   ? 15.377  22.194  125.247 1.00 77.78  ? 84   GLU B CB    1 
ATOM   2390  C  CG    . GLU B  1  84   ? 15.441  21.043  124.260 1.00 75.27  ? 84   GLU B CG    1 
ATOM   2391  C  CD    . GLU B  1  84   ? 15.117  21.464  122.844 1.00 93.32  ? 84   GLU B CD    1 
ATOM   2392  O  OE1   . GLU B  1  84   ? 14.935  22.679  122.614 1.00 97.65  ? 84   GLU B OE1   1 
ATOM   2393  O  OE2   . GLU B  1  84   ? 15.048  20.580  121.961 1.00 97.71  ? 84   GLU B OE2   1 
ATOM   2394  N  N     . LEU B  1  85   ? 15.925  23.257  128.549 1.00 79.08  ? 85   LEU B N     1 
ATOM   2395  C  CA    . LEU B  1  85   ? 15.992  24.446  129.402 1.00 81.03  ? 85   LEU B CA    1 
ATOM   2396  C  C     . LEU B  1  85   ? 17.427  24.797  129.819 1.00 74.66  ? 85   LEU B C     1 
ATOM   2397  O  O     . LEU B  1  85   ? 18.137  23.963  130.383 1.00 74.56  ? 85   LEU B O     1 
ATOM   2398  C  CB    . LEU B  1  85   ? 15.110  24.253  130.639 1.00 80.81  ? 85   LEU B CB    1 
ATOM   2399  C  CG    . LEU B  1  85   ? 15.075  25.356  131.698 1.00 76.54  ? 85   LEU B CG    1 
ATOM   2400  C  CD1   . LEU B  1  85   ? 14.461  26.629  131.137 1.00 78.05  ? 85   LEU B CD1   1 
ATOM   2401  C  CD2   . LEU B  1  85   ? 14.309  24.875  132.918 1.00 80.21  ? 85   LEU B CD2   1 
ATOM   2402  N  N     . VAL B  1  86   ? 17.844  26.033  129.550 1.00 68.58  ? 86   VAL B N     1 
ATOM   2403  C  CA    . VAL B  1  86   ? 19.201  26.474  129.869 1.00 71.64  ? 86   VAL B CA    1 
ATOM   2404  C  C     . VAL B  1  86   ? 19.225  27.396  131.081 1.00 74.59  ? 86   VAL B C     1 
ATOM   2405  O  O     . VAL B  1  86   ? 18.775  28.538  131.010 1.00 78.93  ? 86   VAL B O     1 
ATOM   2406  C  CB    . VAL B  1  86   ? 19.838  27.218  128.680 1.00 80.33  ? 86   VAL B CB    1 
ATOM   2407  C  CG1   . VAL B  1  86   ? 21.265  27.649  129.016 1.00 69.98  ? 86   VAL B CG1   1 
ATOM   2408  C  CG2   . VAL B  1  86   ? 19.807  26.345  127.436 1.00 80.05  ? 86   VAL B CG2   1 
ATOM   2409  N  N     . VAL B  1  87   ? 19.774  26.900  132.185 1.00 77.10  ? 87   VAL B N     1 
ATOM   2410  C  CA    . VAL B  1  87   ? 19.747  27.628  133.453 1.00 78.39  ? 87   VAL B CA    1 
ATOM   2411  C  C     . VAL B  1  87   ? 21.145  28.016  133.928 1.00 78.32  ? 87   VAL B C     1 
ATOM   2412  O  O     . VAL B  1  87   ? 22.057  27.190  133.958 1.00 78.18  ? 87   VAL B O     1 
ATOM   2413  C  CB    . VAL B  1  87   ? 19.029  26.808  134.544 1.00 72.84  ? 87   VAL B CB    1 
ATOM   2414  C  CG1   . VAL B  1  87   ? 19.156  27.484  135.897 1.00 79.20  ? 87   VAL B CG1   1 
ATOM   2415  C  CG2   . VAL B  1  87   ? 17.565  26.603  134.170 1.00 71.80  ? 87   VAL B CG2   1 
ATOM   2416  N  N     . ARG B  1  88   ? 21.304  29.280  134.302 1.00 79.73  ? 88   ARG B N     1 
ATOM   2417  C  CA    . ARG B  1  88   ? 22.602  29.819  134.680 1.00 85.62  ? 88   ARG B CA    1 
ATOM   2418  C  C     . ARG B  1  88   ? 22.621  30.226  136.154 1.00 93.53  ? 88   ARG B C     1 
ATOM   2419  O  O     . ARG B  1  88   ? 21.924  31.159  136.555 1.00 94.97  ? 88   ARG B O     1 
ATOM   2420  C  CB    . ARG B  1  88   ? 22.911  31.025  133.796 1.00 80.64  ? 88   ARG B CB    1 
ATOM   2421  C  CG    . ARG B  1  88   ? 24.258  31.681  134.007 1.00 83.34  ? 88   ARG B CG    1 
ATOM   2422  C  CD    . ARG B  1  88   ? 24.402  32.814  133.004 1.00 92.54  ? 88   ARG B CD    1 
ATOM   2423  N  NE    . ARG B  1  88   ? 25.688  33.497  133.072 1.00 96.22  ? 88   ARG B NE    1 
ATOM   2424  C  CZ    . ARG B  1  88   ? 26.039  34.490  132.259 1.00 101.25 ? 88   ARG B CZ    1 
ATOM   2425  N  NH1   . ARG B  1  88   ? 25.197  34.906  131.321 1.00 95.87  ? 88   ARG B NH1   1 
ATOM   2426  N  NH2   . ARG B  1  88   ? 27.229  35.065  132.381 1.00 96.64  ? 88   ARG B NH2   1 
ATOM   2427  N  N     . PHE B  1  89   ? 23.413  29.523  136.961 1.00 87.81  ? 89   PHE B N     1 
ATOM   2428  C  CA    . PHE B  1  89   ? 23.543  29.865  138.373 1.00 81.22  ? 89   PHE B CA    1 
ATOM   2429  C  C     . PHE B  1  89   ? 24.525  31.019  138.531 1.00 87.32  ? 89   PHE B C     1 
ATOM   2430  O  O     . PHE B  1  89   ? 25.699  30.898  138.182 1.00 90.14  ? 89   PHE B O     1 
ATOM   2431  C  CB    . PHE B  1  89   ? 24.041  28.667  139.192 1.00 81.53  ? 89   PHE B CB    1 
ATOM   2432  C  CG    . PHE B  1  89   ? 23.044  27.545  139.321 1.00 76.10  ? 89   PHE B CG    1 
ATOM   2433  C  CD1   . PHE B  1  89   ? 21.746  27.679  138.847 1.00 76.89  ? 89   PHE B CD1   1 
ATOM   2434  C  CD2   . PHE B  1  89   ? 23.409  26.354  139.933 1.00 73.70  ? 89   PHE B CD2   1 
ATOM   2435  C  CE1   . PHE B  1  89   ? 20.832  26.638  138.972 1.00 73.98  ? 89   PHE B CE1   1 
ATOM   2436  C  CE2   . PHE B  1  89   ? 22.501  25.311  140.063 1.00 76.83  ? 89   PHE B CE2   1 
ATOM   2437  C  CZ    . PHE B  1  89   ? 21.210  25.453  139.582 1.00 72.42  ? 89   PHE B CZ    1 
ATOM   2438  N  N     . LEU B  1  90   ? 24.045  32.133  139.071 1.00 89.58  ? 90   LEU B N     1 
ATOM   2439  C  CA    . LEU B  1  90   ? 24.891  33.299  139.295 1.00 89.41  ? 90   LEU B CA    1 
ATOM   2440  C  C     . LEU B  1  90   ? 25.743  33.138  140.554 1.00 94.90  ? 90   LEU B C     1 
ATOM   2441  O  O     . LEU B  1  90   ? 26.820  33.722  140.664 1.00 91.42  ? 90   LEU B O     1 
ATOM   2442  C  CB    . LEU B  1  90   ? 24.037  34.561  139.385 1.00 93.42  ? 90   LEU B CB    1 
ATOM   2443  C  CG    . LEU B  1  90   ? 23.183  34.854  138.151 1.00 91.60  ? 90   LEU B CG    1 
ATOM   2444  C  CD1   . LEU B  1  90   ? 22.244  36.018  138.414 1.00 99.84  ? 90   LEU B CD1   1 
ATOM   2445  C  CD2   . LEU B  1  90   ? 24.070  35.138  136.950 1.00 99.13  ? 90   LEU B CD2   1 
ATOM   2446  N  N     . ASN B  1  91   ? 25.248  32.343  141.500 1.00 100.66 ? 91   ASN B N     1 
ATOM   2447  C  CA    . ASN B  1  91   ? 25.967  32.059  142.739 1.00 96.09  ? 91   ASN B CA    1 
ATOM   2448  C  C     . ASN B  1  91   ? 26.950  30.912  142.542 1.00 91.05  ? 91   ASN B C     1 
ATOM   2449  O  O     . ASN B  1  91   ? 26.541  29.772  142.327 1.00 90.07  ? 91   ASN B O     1 
ATOM   2450  C  CB    . ASN B  1  91   ? 24.977  31.710  143.856 1.00 98.20  ? 91   ASN B CB    1 
ATOM   2451  C  CG    . ASN B  1  91   ? 25.618  31.710  145.238 1.00 103.98 ? 91   ASN B CG    1 
ATOM   2452  O  OD1   . ASN B  1  91   ? 26.840  31.620  145.380 1.00 99.68  ? 91   ASN B OD1   1 
ATOM   2453  N  ND2   . ASN B  1  91   ? 24.785  31.806  146.269 1.00 105.85 ? 91   ASN B ND2   1 
ATOM   2454  N  N     . PRO B  1  92   ? 28.254  31.212  142.629 1.00 91.17  ? 92   PRO B N     1 
ATOM   2455  C  CA    . PRO B  1  92   ? 29.331  30.236  142.418 1.00 95.74  ? 92   PRO B CA    1 
ATOM   2456  C  C     . PRO B  1  92   ? 29.201  28.992  143.298 1.00 95.08  ? 92   PRO B C     1 
ATOM   2457  O  O     . PRO B  1  92   ? 29.670  27.918  142.919 1.00 94.91  ? 92   PRO B O     1 
ATOM   2458  C  CB    . PRO B  1  92   ? 30.587  31.020  142.811 1.00 91.88  ? 92   PRO B CB    1 
ATOM   2459  C  CG    . PRO B  1  92   ? 30.236  32.439  142.544 1.00 89.87  ? 92   PRO B CG    1 
ATOM   2460  C  CD    . PRO B  1  92   ? 28.781  32.562  142.898 1.00 92.70  ? 92   PRO B CD    1 
ATOM   2461  N  N     . SER B  1  93   ? 28.567  29.141  144.456 1.00 98.04  ? 93   SER B N     1 
ATOM   2462  C  CA    . SER B  1  93   ? 28.472  28.054  145.425 1.00 99.75  ? 93   SER B CA    1 
ATOM   2463  C  C     . SER B  1  93   ? 27.167  27.263  145.323 1.00 97.77  ? 93   SER B C     1 
ATOM   2464  O  O     . SER B  1  93   ? 26.964  26.296  146.059 1.00 96.04  ? 93   SER B O     1 
ATOM   2465  C  CB    . SER B  1  93   ? 28.636  28.604  146.842 1.00 93.52  ? 93   SER B CB    1 
ATOM   2466  O  OG    . SER B  1  93   ? 29.842  29.336  146.963 1.00 97.83  ? 93   SER B OG    1 
ATOM   2467  N  N     . LEU B  1  94   ? 26.292  27.662  144.403 1.00 91.24  ? 94   LEU B N     1 
ATOM   2468  C  CA    . LEU B  1  94   ? 24.968  27.060  144.316 1.00 81.57  ? 94   LEU B CA    1 
ATOM   2469  C  C     . LEU B  1  94   ? 25.038  25.711  143.615 1.00 81.10  ? 94   LEU B C     1 
ATOM   2470  O  O     . LEU B  1  94   ? 25.379  25.636  142.438 1.00 88.69  ? 94   LEU B O     1 
ATOM   2471  C  CB    . LEU B  1  94   ? 24.036  27.976  143.525 1.00 82.53  ? 94   LEU B CB    1 
ATOM   2472  C  CG    . LEU B  1  94   ? 22.602  28.119  144.038 1.00 77.43  ? 94   LEU B CG    1 
ATOM   2473  C  CD1   . LEU B  1  94   ? 21.642  28.831  143.095 1.00 69.27  ? 94   LEU B CD1   1 
ATOM   2474  C  CD2   . LEU B  1  94   ? 22.015  26.863  144.650 1.00 76.98  ? 94   LEU B CD2   1 
ATOM   2475  N  N     . GLN B  1  95   ? 24.700  24.647  144.335 1.00 78.04  ? 95   GLN B N     1 
ATOM   2476  C  CA    . GLN B  1  95   ? 24.774  23.301  143.776 1.00 72.96  ? 95   GLN B CA    1 
ATOM   2477  C  C     . GLN B  1  95   ? 23.452  22.704  143.290 1.00 71.46  ? 95   GLN B C     1 
ATOM   2478  O  O     . GLN B  1  95   ? 23.455  21.632  142.684 1.00 72.83  ? 95   GLN B O     1 
ATOM   2479  C  CB    . GLN B  1  95   ? 25.443  22.353  144.775 1.00 73.61  ? 95   GLN B CB    1 
ATOM   2480  C  CG    . GLN B  1  95   ? 26.928  22.614  144.966 1.00 88.43  ? 95   GLN B CG    1 
ATOM   2481  C  CD    . GLN B  1  95   ? 27.750  22.218  143.748 1.00 108.65 ? 95   GLN B CD    1 
ATOM   2482  O  OE1   . GLN B  1  95   ? 27.424  21.252  143.050 1.00 107.71 ? 95   GLN B OE1   1 
ATOM   2483  N  NE2   . GLN B  1  95   ? 28.819  22.967  143.483 1.00 104.26 ? 95   GLN B NE2   1 
ATOM   2484  N  N     . THR B  1  96   ? 22.339  23.398  143.530 1.00 73.14  ? 96   THR B N     1 
ATOM   2485  C  CA    . THR B  1  96   ? 21.015  22.916  143.110 1.00 75.45  ? 96   THR B CA    1 
ATOM   2486  C  C     . THR B  1  96   ? 19.874  23.866  143.467 1.00 66.95  ? 96   THR B C     1 
ATOM   2487  O  O     . THR B  1  96   ? 19.994  24.676  144.377 1.00 68.98  ? 96   THR B O     1 
ATOM   2488  C  CB    . THR B  1  96   ? 20.667  21.541  143.729 1.00 71.98  ? 96   THR B CB    1 
ATOM   2489  O  OG1   . THR B  1  96   ? 19.287  21.246  143.487 1.00 68.37  ? 96   THR B OG1   1 
ATOM   2490  C  CG2   . THR B  1  96   ? 20.915  21.545  145.226 1.00 70.51  ? 96   THR B CG2   1 
ATOM   2491  N  N     . VAL B  1  97   ? 18.755  23.733  142.755 1.00 62.56  ? 97   VAL B N     1 
ATOM   2492  C  CA    . VAL B  1  97   ? 17.586  24.597  142.926 1.00 65.69  ? 97   VAL B CA    1 
ATOM   2493  C  C     . VAL B  1  97   ? 16.339  23.812  142.528 1.00 72.09  ? 97   VAL B C     1 
ATOM   2494  O  O     . VAL B  1  97   ? 16.413  22.928  141.679 1.00 70.44  ? 97   VAL B O     1 
ATOM   2495  C  CB    . VAL B  1  97   ? 17.650  25.871  142.024 1.00 69.11  ? 97   VAL B CB    1 
ATOM   2496  C  CG1   . VAL B  1  97   ? 16.437  26.762  142.247 1.00 75.23  ? 97   VAL B CG1   1 
ATOM   2497  C  CG2   . VAL B  1  97   ? 18.916  26.677  142.268 1.00 72.52  ? 97   VAL B CG2   1 
ATOM   2498  N  N     . THR B  1  98   ? 15.199  24.113  143.142 1.00 76.03  ? 98   THR B N     1 
ATOM   2499  C  CA    . THR B  1  98   ? 13.927  23.620  142.625 1.00 77.25  ? 98   THR B CA    1 
ATOM   2500  C  C     . THR B  1  98   ? 13.106  24.775  142.050 1.00 81.21  ? 98   THR B C     1 
ATOM   2501  O  O     . THR B  1  98   ? 12.823  25.754  142.735 1.00 91.16  ? 98   THR B O     1 
ATOM   2502  C  CB    . THR B  1  98   ? 13.107  22.856  143.687 1.00 74.81  ? 98   THR B CB    1 
ATOM   2503  O  OG1   . THR B  1  98   ? 13.820  21.680  144.095 1.00 73.05  ? 98   THR B OG1   1 
ATOM   2504  C  CG2   . THR B  1  98   ? 11.756  22.443  143.116 1.00 76.60  ? 98   THR B CG2   1 
ATOM   2505  N  N     . LEU B  1  99   ? 12.751  24.664  140.776 1.00 84.76  ? 99   LEU B N     1 
ATOM   2506  C  CA    . LEU B  1  99   ? 11.916  25.661  140.126 1.00 84.93  ? 99   LEU B CA    1 
ATOM   2507  C  C     . LEU B  1  99   ? 10.471  25.191  140.165 1.00 86.08  ? 99   LEU B C     1 
ATOM   2508  O  O     . LEU B  1  99   ? 10.181  24.023  139.897 1.00 83.68  ? 99   LEU B O     1 
ATOM   2509  C  CB    . LEU B  1  99   ? 12.359  25.872  138.676 1.00 90.38  ? 99   LEU B CB    1 
ATOM   2510  C  CG    . LEU B  1  99   ? 13.380  26.972  138.377 1.00 88.73  ? 99   LEU B CG    1 
ATOM   2511  C  CD1   . LEU B  1  99   ? 14.658  26.777  139.171 1.00 72.30  ? 99   LEU B CD1   1 
ATOM   2512  C  CD2   . LEU B  1  99   ? 13.675  27.018  136.883 1.00 97.00  ? 99   LEU B CD2   1 
ATOM   2513  N  N     . LEU B  1  100  ? 9.564   26.098  140.505 1.00 86.72  ? 100  LEU B N     1 
ATOM   2514  C  CA    . LEU B  1  100  ? 8.158   25.735  140.602 1.00 85.39  ? 100  LEU B CA    1 
ATOM   2515  C  C     . LEU B  1  100  ? 7.358   26.393  139.496 1.00 84.12  ? 100  LEU B C     1 
ATOM   2516  O  O     . LEU B  1  100  ? 7.617   27.541  139.125 1.00 82.38  ? 100  LEU B O     1 
ATOM   2517  C  CB    . LEU B  1  100  ? 7.577   26.123  141.966 1.00 87.99  ? 100  LEU B CB    1 
ATOM   2518  C  CG    . LEU B  1  100  ? 8.144   25.435  143.211 1.00 84.98  ? 100  LEU B CG    1 
ATOM   2519  C  CD1   . LEU B  1  100  ? 9.235   26.287  143.850 1.00 84.32  ? 100  LEU B CD1   1 
ATOM   2520  C  CD2   . LEU B  1  100  ? 7.036   25.120  144.207 1.00 92.78  ? 100  LEU B CD2   1 
ATOM   2521  N  N     . LEU B  1  101  ? 6.391   25.654  138.964 1.00 81.59  ? 101  LEU B N     1 
ATOM   2522  C  CA    . LEU B  1  101  ? 5.464   26.217  137.996 1.00 86.30  ? 101  LEU B CA    1 
ATOM   2523  C  C     . LEU B  1  101  ? 4.037   25.729  138.217 1.00 92.77  ? 101  LEU B C     1 
ATOM   2524  O  O     . LEU B  1  101  ? 3.778   24.527  138.299 1.00 87.05  ? 101  LEU B O     1 
ATOM   2525  C  CB    . LEU B  1  101  ? 5.913   25.905  136.571 1.00 94.40  ? 101  LEU B CB    1 
ATOM   2526  C  CG    . LEU B  1  101  ? 5.029   26.520  135.488 1.00 92.62  ? 101  LEU B CG    1 
ATOM   2527  C  CD1   . LEU B  1  101  ? 5.882   27.316  134.521 1.00 95.06  ? 101  LEU B CD1   1 
ATOM   2528  C  CD2   . LEU B  1  101  ? 4.231   25.443  134.763 1.00 83.37  ? 101  LEU B CD2   1 
ATOM   2529  N  N     . LYS B  1  102  ? 3.114   26.678  138.316 1.00 98.43  ? 102  LYS B N     1 
ATOM   2530  C  CA    . LYS B  1  102  ? 1.695   26.374  138.405 1.00 93.70  ? 102  LYS B CA    1 
ATOM   2531  C  C     . LYS B  1  102  ? 0.948   27.312  137.473 1.00 94.23  ? 102  LYS B C     1 
ATOM   2532  O  O     . LYS B  1  102  ? 1.070   28.533  137.580 1.00 92.74  ? 102  LYS B O     1 
ATOM   2533  C  CB    . LYS B  1  102  ? 1.196   26.537  139.841 1.00 100.62 ? 102  LYS B CB    1 
ATOM   2534  C  CG    . LYS B  1  102  ? 1.845   25.579  140.828 1.00 106.11 ? 102  LYS B CG    1 
ATOM   2535  C  CD    . LYS B  1  102  ? 1.695   26.049  142.267 1.00 111.05 ? 102  LYS B CD    1 
ATOM   2536  C  CE    . LYS B  1  102  ? 2.529   25.188  143.211 1.00 119.17 ? 102  LYS B CE    1 
ATOM   2537  N  NZ    . LYS B  1  102  ? 2.534   25.710  144.607 1.00 109.48 ? 102  LYS B NZ    1 
ATOM   2538  N  N     . ALA B  1  103  ? 0.195   26.736  136.542 1.00 96.10  ? 103  ALA B N     1 
ATOM   2539  C  CA    . ALA B  1  103  ? -0.587  27.524  135.595 1.00 103.45 ? 103  ALA B CA    1 
ATOM   2540  C  C     . ALA B  1  103  ? -1.749  26.694  135.069 1.00 111.93 ? 103  ALA B C     1 
ATOM   2541  O  O     . ALA B  1  103  ? -1.764  25.473  135.232 1.00 107.01 ? 103  ALA B O     1 
ATOM   2542  C  CB    . ALA B  1  103  ? 0.285   28.020  134.453 1.00 100.61 ? 103  ALA B CB    1 
ATOM   2543  N  N     . GLU B  1  104  ? -2.725  27.352  134.451 1.00 113.01 ? 104  GLU B N     1 
ATOM   2544  C  CA    . GLU B  1  104  ? -3.909  26.648  133.971 1.00 107.90 ? 104  GLU B CA    1 
ATOM   2545  C  C     . GLU B  1  104  ? -4.671  27.402  132.888 1.00 110.54 ? 104  GLU B C     1 
ATOM   2546  O  O     . GLU B  1  104  ? -4.259  28.480  132.453 1.00 110.94 ? 104  GLU B O     1 
ATOM   2547  C  CB    . GLU B  1  104  ? -4.844  26.352  135.141 1.00 118.96 ? 104  GLU B CB    1 
ATOM   2548  C  CG    . GLU B  1  104  ? -5.147  27.562  136.005 1.00 118.88 ? 104  GLU B CG    1 
ATOM   2549  C  CD    . GLU B  1  104  ? -6.160  27.259  137.086 1.00 127.16 ? 104  GLU B CD    1 
ATOM   2550  O  OE1   . GLU B  1  104  ? -6.020  27.804  138.201 1.00 134.87 ? 104  GLU B OE1   1 
ATOM   2551  O  OE2   . GLU B  1  104  ? -7.098  26.477  136.817 1.00 121.92 ? 104  GLU B OE2   1 
ATOM   2552  N  N     . GLY B  1  105  ? -5.788  26.818  132.460 1.00 114.78 ? 105  GLY B N     1 
ATOM   2553  C  CA    . GLY B  1  105  ? -6.660  27.438  131.480 1.00 119.07 ? 105  GLY B CA    1 
ATOM   2554  C  C     . GLY B  1  105  ? -6.031  27.467  130.104 1.00 123.96 ? 105  GLY B C     1 
ATOM   2555  O  O     . GLY B  1  105  ? -5.030  26.795  129.866 1.00 130.22 ? 105  GLY B O     1 
ATOM   2556  N  N     . PRO B  1  106  ? -6.611  28.253  129.189 1.00 128.72 ? 106  PRO B N     1 
ATOM   2557  C  CA    . PRO B  1  106  ? -6.113  28.365  127.813 1.00 129.49 ? 106  PRO B CA    1 
ATOM   2558  C  C     . PRO B  1  106  ? -4.836  29.199  127.732 1.00 129.57 ? 106  PRO B C     1 
ATOM   2559  O  O     . PRO B  1  106  ? -4.898  30.396  127.444 1.00 127.92 ? 106  PRO B O     1 
ATOM   2560  C  CB    . PRO B  1  106  ? -7.261  29.070  127.088 1.00 131.79 ? 106  PRO B CB    1 
ATOM   2561  C  CG    . PRO B  1  106  ? -7.937  29.865  128.152 1.00 138.25 ? 106  PRO B CG    1 
ATOM   2562  C  CD    . PRO B  1  106  ? -7.831  29.047  129.406 1.00 134.92 ? 106  PRO B CD    1 
ATOM   2563  N  N     . LYS B  1  107  ? -3.691  28.576  127.999 1.00 123.57 ? 107  LYS B N     1 
ATOM   2564  C  CA    . LYS B  1  107  ? -2.420  29.295  127.980 1.00 119.01 ? 107  LYS B CA    1 
ATOM   2565  C  C     . LYS B  1  107  ? -1.259  28.419  127.516 1.00 117.12 ? 107  LYS B C     1 
ATOM   2566  O  O     . LYS B  1  107  ? -1.192  27.238  127.853 1.00 113.29 ? 107  LYS B O     1 
ATOM   2567  C  CB    . LYS B  1  107  ? -2.113  29.867  129.368 1.00 123.41 ? 107  LYS B CB    1 
ATOM   2568  C  CG    . LYS B  1  107  ? -0.821  30.672  129.446 1.00 115.80 ? 107  LYS B CG    1 
ATOM   2569  C  CD    . LYS B  1  107  ? -0.483  31.043  130.879 1.00 112.06 ? 107  LYS B CD    1 
ATOM   2570  C  CE    . LYS B  1  107  ? 0.788   31.871  130.949 1.00 101.71 ? 107  LYS B CE    1 
ATOM   2571  N  NZ    . LYS B  1  107  ? 1.131   32.220  132.355 1.00 103.70 ? 107  LYS B NZ    1 
ATOM   2572  N  N     . GLU B  1  108  ? -0.347  29.010  126.747 1.00 115.43 ? 108  GLU B N     1 
ATOM   2573  C  CA    . GLU B  1  108  ? 0.883   28.334  126.346 1.00 109.77 ? 108  GLU B CA    1 
ATOM   2574  C  C     . GLU B  1  108  ? 2.027   28.687  127.290 1.00 111.83 ? 108  GLU B C     1 
ATOM   2575  O  O     . GLU B  1  108  ? 2.477   29.834  127.340 1.00 111.14 ? 108  GLU B O     1 
ATOM   2576  C  CB    . GLU B  1  108  ? 1.259   28.698  124.913 1.00 106.38 ? 108  GLU B CB    1 
ATOM   2577  C  CG    . GLU B  1  108  ? 0.284   28.181  123.877 1.00 118.74 ? 108  GLU B CG    1 
ATOM   2578  C  CD    . GLU B  1  108  ? 0.792   28.366  122.463 1.00 129.43 ? 108  GLU B CD    1 
ATOM   2579  O  OE1   . GLU B  1  108  ? 1.969   28.756  122.299 1.00 126.51 ? 108  GLU B OE1   1 
ATOM   2580  O  OE2   . GLU B  1  108  ? 0.013   28.121  121.518 1.00 131.40 ? 108  GLU B OE2   1 
ATOM   2581  N  N     . VAL B  1  109  ? 2.501   27.687  128.026 1.00 105.63 ? 109  VAL B N     1 
ATOM   2582  C  CA    . VAL B  1  109  ? 3.493   27.898  129.073 1.00 102.62 ? 109  VAL B CA    1 
ATOM   2583  C  C     . VAL B  1  109  ? 4.915   28.019  128.529 1.00 101.88 ? 109  VAL B C     1 
ATOM   2584  O  O     . VAL B  1  109  ? 5.430   27.098  127.895 1.00 97.49  ? 109  VAL B O     1 
ATOM   2585  C  CB    . VAL B  1  109  ? 3.460   26.757  130.107 1.00 96.99  ? 109  VAL B CB    1 
ATOM   2586  C  CG1   . VAL B  1  109  ? 4.391   27.067  131.260 1.00 94.46  ? 109  VAL B CG1   1 
ATOM   2587  C  CG2   . VAL B  1  109  ? 2.047   26.535  130.611 1.00 101.03 ? 109  VAL B CG2   1 
ATOM   2588  N  N     . LYS B  1  110  ? 5.547   29.157  128.798 1.00 104.33 ? 110  LYS B N     1 
ATOM   2589  C  CA    . LYS B  1  110  ? 6.937   29.384  128.420 1.00 96.77  ? 110  LYS B CA    1 
ATOM   2590  C  C     . LYS B  1  110  ? 7.850   29.179  129.627 1.00 94.60  ? 110  LYS B C     1 
ATOM   2591  O  O     . LYS B  1  110  ? 7.395   28.778  130.695 1.00 93.63  ? 110  LYS B O     1 
ATOM   2592  C  CB    . LYS B  1  110  ? 7.117   30.789  127.839 1.00 100.85 ? 110  LYS B CB    1 
ATOM   2593  C  CG    . LYS B  1  110  ? 6.211   31.092  126.651 1.00 99.67  ? 110  LYS B CG    1 
ATOM   2594  C  CD    . LYS B  1  110  ? 6.384   30.063  125.542 1.00 99.86  ? 110  LYS B CD    1 
ATOM   2595  C  CE    . LYS B  1  110  ? 5.488   30.367  124.348 1.00 105.95 ? 110  LYS B CE    1 
ATOM   2596  N  NZ    . LYS B  1  110  ? 5.612   29.338  123.275 1.00 98.36  ? 110  LYS B NZ    1 
ATOM   2597  N  N     . ALA B  1  111  ? 9.129   29.450  129.434 1.00 97.62  ? 111  ALA B N     1 
ATOM   2598  C  CA    . ALA B  1  111  ? 10.122  29.388  130.492 1.00 97.78  ? 111  ALA B CA    1 
ATOM   2599  C  C     . ALA B  1  111  ? 9.944   30.427  131.578 1.00 102.34 ? 111  ALA B C     1 
ATOM   2600  O  O     . ALA B  1  111  ? 10.147  30.148  132.746 1.00 105.03 ? 111  ALA B O     1 
ATOM   2601  C  CB    . ALA B  1  111  ? 11.517  29.475  129.908 1.00 95.56  ? 111  ALA B CB    1 
ATOM   2602  N  N     . ARG B  1  112  ? 9.571   31.634  131.187 1.00 104.36 ? 112  ARG B N     1 
ATOM   2603  C  CA    . ARG B  1  112  ? 9.533   32.761  132.106 1.00 105.37 ? 112  ARG B CA    1 
ATOM   2604  C  C     . ARG B  1  112  ? 8.564   32.480  133.229 1.00 102.37 ? 112  ARG B C     1 
ATOM   2605  O  O     . ARG B  1  112  ? 8.732   32.947  134.343 1.00 95.03  ? 112  ARG B O     1 
ATOM   2606  C  CB    . ARG B  1  112  ? 9.124   34.031  131.376 1.00 106.15 ? 112  ARG B CB    1 
ATOM   2607  C  CG    . ARG B  1  112  ? 8.246   33.793  130.167 1.00 109.54 ? 112  ARG B CG    1 
ATOM   2608  C  CD    . ARG B  1  112  ? 8.099   35.064  129.358 1.00 115.59 ? 112  ARG B CD    1 
ATOM   2609  N  NE    . ARG B  1  112  ? 8.594   34.918  127.996 1.00 117.83 ? 112  ARG B NE    1 
ATOM   2610  C  CZ    . ARG B  1  112  ? 9.605   35.615  127.494 1.00 113.89 ? 112  ARG B CZ    1 
ATOM   2611  N  NH1   . ARG B  1  112  ? 9.989   35.421  126.244 1.00 111.34 ? 112  ARG B NH1   1 
ATOM   2612  N  NH2   . ARG B  1  112  ? 10.233  36.502  128.246 1.00 108.85 ? 112  ARG B NH2   1 
ATOM   2613  N  N     . ASP B  1  113  ? 7.555   31.690  132.921 1.00 101.32 ? 113  ASP B N     1 
ATOM   2614  C  CA    . ASP B  1  113  ? 6.472   31.415  133.829 1.00 96.91  ? 113  ASP B CA    1 
ATOM   2615  C  C     . ASP B  1  113  ? 6.985   30.753  135.087 1.00 104.15 ? 113  ASP B C     1 
ATOM   2616  O  O     . ASP B  1  113  ? 6.318   30.757  136.108 1.00 106.27 ? 113  ASP B O     1 
ATOM   2617  C  CB    . ASP B  1  113  ? 5.454   30.522  133.153 1.00 95.46  ? 113  ASP B CB    1 
ATOM   2618  C  CG    . ASP B  1  113  ? 4.842   31.174  131.951 1.00 108.00 ? 113  ASP B CG    1 
ATOM   2619  O  OD1   . ASP B  1  113  ? 5.086   32.377  131.748 1.00 111.20 ? 113  ASP B OD1   1 
ATOM   2620  O  OD2   . ASP B  1  113  ? 4.117   30.496  131.206 1.00 107.19 ? 113  ASP B OD2   1 
ATOM   2621  N  N     . PHE B  1  114  ? 8.147   30.135  135.013 1.00 101.47 ? 114  PHE B N     1 
ATOM   2622  C  CA    . PHE B  1  114  ? 8.713   29.534  136.212 1.00 101.71 ? 114  PHE B CA    1 
ATOM   2623  C  C     . PHE B  1  114  ? 8.877   30.609  137.277 1.00 102.26 ? 114  PHE B C     1 
ATOM   2624  O  O     . PHE B  1  114  ? 9.293   31.730  136.973 1.00 96.33  ? 114  PHE B O     1 
ATOM   2625  C  CB    . PHE B  1  114  ? 10.065  28.874  135.918 1.00 101.79 ? 114  PHE B CB    1 
ATOM   2626  C  CG    . PHE B  1  114  ? 9.955   27.468  135.392 1.00 101.31 ? 114  PHE B CG    1 
ATOM   2627  C  CD1   . PHE B  1  114  ? 9.461   26.451  136.196 1.00 90.17  ? 114  PHE B CD1   1 
ATOM   2628  C  CD2   . PHE B  1  114  ? 10.356  27.160  134.102 1.00 96.81  ? 114  PHE B CD2   1 
ATOM   2629  C  CE1   . PHE B  1  114  ? 9.357   25.155  135.722 1.00 84.15  ? 114  PHE B CE1   1 
ATOM   2630  C  CE2   . PHE B  1  114  ? 10.256  25.866  133.623 1.00 91.35  ? 114  PHE B CE2   1 
ATOM   2631  C  CZ    . PHE B  1  114  ? 9.754   24.862  134.437 1.00 88.39  ? 114  PHE B CZ    1 
ATOM   2632  N  N     . LEU B  1  115  ? 8.545   30.269  138.519 1.00 96.83  ? 115  LEU B N     1 
ATOM   2633  C  CA    . LEU B  1  115  ? 8.659   31.219  139.620 1.00 95.15  ? 115  LEU B CA    1 
ATOM   2634  C  C     . LEU B  1  115  ? 10.113  31.604  139.854 1.00 92.52  ? 115  LEU B C     1 
ATOM   2635  O  O     . LEU B  1  115  ? 10.942  30.748  140.175 1.00 90.92  ? 115  LEU B O     1 
ATOM   2636  C  CB    . LEU B  1  115  ? 8.037   30.655  140.898 1.00 100.37 ? 115  LEU B CB    1 
ATOM   2637  C  CG    . LEU B  1  115  ? 6.516   30.478  140.864 1.00 104.21 ? 115  LEU B CG    1 
ATOM   2638  C  CD1   . LEU B  1  115  ? 5.997   29.994  142.211 1.00 101.05 ? 115  LEU B CD1   1 
ATOM   2639  C  CD2   . LEU B  1  115  ? 5.823   31.769  140.440 1.00 87.59  ? 115  LEU B CD2   1 
ATOM   2640  N  N     . PRO B  1  116  ? 10.420  32.902  139.691 1.00 88.00  ? 116  PRO B N     1 
ATOM   2641  C  CA    . PRO B  1  116  ? 11.772  33.467  139.779 1.00 80.62  ? 116  PRO B CA    1 
ATOM   2642  C  C     . PRO B  1  116  ? 12.494  33.056  141.054 1.00 85.89  ? 116  PRO B C     1 
ATOM   2643  O  O     . PRO B  1  116  ? 11.907  33.075  142.136 1.00 97.17  ? 116  PRO B O     1 
ATOM   2644  C  CB    . PRO B  1  116  ? 11.519  34.976  139.794 1.00 75.05  ? 116  PRO B CB    1 
ATOM   2645  C  CG    . PRO B  1  116  ? 10.229  35.141  139.072 1.00 87.85  ? 116  PRO B CG    1 
ATOM   2646  C  CD    . PRO B  1  116  ? 9.405   33.940  139.431 1.00 83.25  ? 116  PRO B CD    1 
ATOM   2647  N  N     . VAL B  1  117  ? 13.758  32.676  140.917 1.00 83.46  ? 117  VAL B N     1 
ATOM   2648  C  CA    . VAL B  1  117  ? 14.578  32.306  142.061 1.00 80.28  ? 117  VAL B CA    1 
ATOM   2649  C  C     . VAL B  1  117  ? 15.832  33.176  142.076 1.00 83.31  ? 117  VAL B C     1 
ATOM   2650  O  O     . VAL B  1  117  ? 16.388  33.492  141.026 1.00 88.42  ? 117  VAL B O     1 
ATOM   2651  C  CB    . VAL B  1  117  ? 14.947  30.808  142.025 1.00 80.07  ? 117  VAL B CB    1 
ATOM   2652  C  CG1   . VAL B  1  117  ? 15.812  30.437  143.215 1.00 74.38  ? 117  VAL B CG1   1 
ATOM   2653  C  CG2   . VAL B  1  117  ? 13.683  29.949  141.994 1.00 74.62  ? 117  VAL B CG2   1 
ATOM   2654  N  N     . ALA B  1  118  ? 16.258  33.579  143.269 1.00 90.94  ? 118  ALA B N     1 
ATOM   2655  C  CA    . ALA B  1  118  ? 17.401  34.475  143.422 1.00 104.00 ? 118  ALA B CA    1 
ATOM   2656  C  C     . ALA B  1  118  ? 18.702  33.863  142.903 1.00 101.38 ? 118  ALA B C     1 
ATOM   2657  O  O     . ALA B  1  118  ? 19.036  32.722  143.235 1.00 98.51  ? 118  ALA B O     1 
ATOM   2658  C  CB    . ALA B  1  118  ? 17.552  34.891  144.881 1.00 107.74 ? 118  ALA B CB    1 
ATOM   2659  N  N     . ASP B  1  119  ? 19.423  34.638  142.093 1.00 98.29  ? 119  ASP B N     1 
ATOM   2660  C  CA    . ASP B  1  119  ? 20.689  34.215  141.485 1.00 103.12 ? 119  ASP B CA    1 
ATOM   2661  C  C     . ASP B  1  119  ? 20.532  33.018  140.541 1.00 95.76  ? 119  ASP B C     1 
ATOM   2662  O  O     . ASP B  1  119  ? 21.482  32.275  140.292 1.00 92.23  ? 119  ASP B O     1 
ATOM   2663  C  CB    . ASP B  1  119  ? 21.751  33.935  142.557 1.00 108.82 ? 119  ASP B CB    1 
ATOM   2664  C  CG    . ASP B  1  119  ? 22.159  35.185  143.315 1.00 112.87 ? 119  ASP B CG    1 
ATOM   2665  O  OD1   . ASP B  1  119  ? 21.452  36.209  143.198 1.00 104.66 ? 119  ASP B OD1   1 
ATOM   2666  O  OD2   . ASP B  1  119  ? 23.183  35.141  144.030 1.00 121.63 ? 119  ASP B OD2   1 
ATOM   2667  N  N     . VAL B  1  120  ? 19.324  32.846  140.017 1.00 92.78  ? 120  VAL B N     1 
ATOM   2668  C  CA    . VAL B  1  120  ? 19.057  31.830  139.011 1.00 90.47  ? 120  VAL B CA    1 
ATOM   2669  C  C     . VAL B  1  120  ? 18.544  32.519  137.754 1.00 97.65  ? 120  VAL B C     1 
ATOM   2670  O  O     . VAL B  1  120  ? 17.442  33.070  137.746 1.00 93.28  ? 120  VAL B O     1 
ATOM   2671  C  CB    . VAL B  1  120  ? 18.015  30.807  139.503 1.00 87.98  ? 120  VAL B CB    1 
ATOM   2672  C  CG1   . VAL B  1  120  ? 17.567  29.905  138.366 1.00 86.67  ? 120  VAL B CG1   1 
ATOM   2673  C  CG2   . VAL B  1  120  ? 18.582  29.985  140.643 1.00 87.18  ? 120  VAL B CG2   1 
ATOM   2674  N  N     . GLU B  1  121  ? 19.349  32.487  136.695 1.00 99.73  ? 121  GLU B N     1 
ATOM   2675  C  CA    . GLU B  1  121  ? 19.011  33.172  135.452 1.00 94.44  ? 121  GLU B CA    1 
ATOM   2676  C  C     . GLU B  1  121  ? 18.504  32.197  134.399 1.00 90.16  ? 121  GLU B C     1 
ATOM   2677  O  O     . GLU B  1  121  ? 19.153  31.194  134.108 1.00 88.41  ? 121  GLU B O     1 
ATOM   2678  C  CB    . GLU B  1  121  ? 20.225  33.936  134.914 1.00 91.06  ? 121  GLU B CB    1 
ATOM   2679  C  CG    . GLU B  1  121  ? 19.977  34.655  133.596 1.00 90.45  ? 121  GLU B CG    1 
ATOM   2680  C  CD    . GLU B  1  121  ? 21.184  35.451  133.128 1.00 102.93 ? 121  GLU B CD    1 
ATOM   2681  O  OE1   . GLU B  1  121  ? 21.101  36.080  132.050 1.00 108.98 ? 121  GLU B OE1   1 
ATOM   2682  O  OE2   . GLU B  1  121  ? 22.215  35.448  133.838 1.00 97.50  ? 121  GLU B OE2   1 
ATOM   2683  N  N     . ILE B  1  122  ? 17.340  32.493  133.832 1.00 89.35  ? 122  ILE B N     1 
ATOM   2684  C  CA    . ILE B  1  122  ? 16.820  31.687  132.737 1.00 89.24  ? 122  ILE B CA    1 
ATOM   2685  C  C     . ILE B  1  122  ? 17.215  32.291  131.386 1.00 84.22  ? 122  ILE B C     1 
ATOM   2686  O  O     . ILE B  1  122  ? 16.745  33.365  131.009 1.00 77.70  ? 122  ILE B O     1 
ATOM   2687  C  CB    . ILE B  1  122  ? 15.303  31.495  132.848 1.00 77.07  ? 122  ILE B CB    1 
ATOM   2688  C  CG1   . ILE B  1  122  ? 14.995  30.594  134.046 1.00 79.89  ? 122  ILE B CG1   1 
ATOM   2689  C  CG2   . ILE B  1  122  ? 14.743  30.893  131.566 1.00 78.09  ? 122  ILE B CG2   1 
ATOM   2690  C  CD1   . ILE B  1  122  ? 13.539  30.195  134.164 1.00 99.77  ? 122  ILE B CD1   1 
ATOM   2691  N  N     . MET B  1  123  ? 18.085  31.578  130.673 1.00 86.11  ? 123  MET B N     1 
ATOM   2692  C  CA    . MET B  1  123  ? 18.704  32.071  129.446 1.00 82.86  ? 123  MET B CA    1 
ATOM   2693  C  C     . MET B  1  123  ? 17.733  32.104  128.270 1.00 80.96  ? 123  MET B C     1 
ATOM   2694  O  O     . MET B  1  123  ? 17.796  33.001  127.432 1.00 76.59  ? 123  MET B O     1 
ATOM   2695  C  CB    . MET B  1  123  ? 19.914  31.207  129.084 1.00 77.80  ? 123  MET B CB    1 
ATOM   2696  C  CG    . MET B  1  123  ? 20.983  31.137  130.162 1.00 76.20  ? 123  MET B CG    1 
ATOM   2697  S  SD    . MET B  1  123  ? 21.908  32.674  130.333 1.00 83.46  ? 123  MET B SD    1 
ATOM   2698  C  CE    . MET B  1  123  ? 22.744  32.764  128.754 1.00 83.01  ? 123  MET B CE    1 
ATOM   2699  N  N     . ASN B  1  124  ? 16.834  31.127  128.221 1.00 81.83  ? 124  ASN B N     1 
ATOM   2700  C  CA    . ASN B  1  124  ? 15.905  30.981  127.107 1.00 79.61  ? 124  ASN B CA    1 
ATOM   2701  C  C     . ASN B  1  124  ? 14.445  31.019  127.548 1.00 89.22  ? 124  ASN B C     1 
ATOM   2702  O  O     . ASN B  1  124  ? 13.735  30.022  127.415 1.00 88.27  ? 124  ASN B O     1 
ATOM   2703  C  CB    . ASN B  1  124  ? 16.177  29.657  126.393 1.00 81.01  ? 124  ASN B CB    1 
ATOM   2704  C  CG    . ASN B  1  124  ? 16.351  28.499  127.364 1.00 79.94  ? 124  ASN B CG    1 
ATOM   2705  O  OD1   . ASN B  1  124  ? 17.011  28.634  128.393 1.00 79.23  ? 124  ASN B OD1   1 
ATOM   2706  N  ND2   . ASN B  1  124  ? 15.748  27.360  127.047 1.00 75.57  ? 124  ASN B ND2   1 
ATOM   2707  N  N     . PRO B  1  125  ? 13.981  32.181  128.043 1.00 94.49  ? 125  PRO B N     1 
ATOM   2708  C  CA    . PRO B  1  125  ? 12.658  32.294  128.672 1.00 96.41  ? 125  PRO B CA    1 
ATOM   2709  C  C     . PRO B  1  125  ? 11.500  32.038  127.709 1.00 99.91  ? 125  PRO B C     1 
ATOM   2710  O  O     . PRO B  1  125  ? 10.382  31.759  128.152 1.00 95.70  ? 125  PRO B O     1 
ATOM   2711  C  CB    . PRO B  1  125  ? 12.630  33.748  129.150 1.00 98.09  ? 125  PRO B CB    1 
ATOM   2712  C  CG    . PRO B  1  125  ? 13.533  34.461  128.213 1.00 94.00  ? 125  PRO B CG    1 
ATOM   2713  C  CD    . PRO B  1  125  ? 14.640  33.494  127.918 1.00 92.71  ? 125  PRO B CD    1 
ATOM   2714  N  N     . ASP B  1  126  ? 11.771  32.125  126.411 1.00 101.77 ? 126  ASP B N     1 
ATOM   2715  C  CA    . ASP B  1  126  ? 10.738  31.953  125.394 1.00 102.63 ? 126  ASP B CA    1 
ATOM   2716  C  C     . ASP B  1  126  ? 10.533  30.483  125.039 1.00 98.58  ? 126  ASP B C     1 
ATOM   2717  O  O     . ASP B  1  126  ? 9.690   30.149  124.201 1.00 89.60  ? 126  ASP B O     1 
ATOM   2718  C  CB    . ASP B  1  126  ? 11.097  32.747  124.139 1.00 104.29 ? 126  ASP B CB    1 
ATOM   2719  C  CG    . ASP B  1  126  ? 11.434  34.192  124.444 1.00 114.40 ? 126  ASP B CG    1 
ATOM   2720  O  OD1   . ASP B  1  126  ? 10.521  35.043  124.378 1.00 122.28 ? 126  ASP B OD1   1 
ATOM   2721  O  OD2   . ASP B  1  126  ? 12.610  34.475  124.757 1.00 111.86 ? 126  ASP B OD2   1 
ATOM   2722  N  N     . LEU B  1  127  ? 11.311  29.613  125.681 1.00 97.82  ? 127  LEU B N     1 
ATOM   2723  C  CA    . LEU B  1  127  ? 11.218  28.175  125.445 1.00 94.93  ? 127  LEU B CA    1 
ATOM   2724  C  C     . LEU B  1  127  ? 9.840   27.633  125.805 1.00 90.28  ? 127  LEU B C     1 
ATOM   2725  O  O     . LEU B  1  127  ? 9.342   27.847  126.906 1.00 94.08  ? 127  LEU B O     1 
ATOM   2726  C  CB    . LEU B  1  127  ? 12.301  27.421  126.224 1.00 85.57  ? 127  LEU B CB    1 
ATOM   2727  C  CG    . LEU B  1  127  ? 12.166  25.894  126.256 1.00 87.83  ? 127  LEU B CG    1 
ATOM   2728  C  CD1   . LEU B  1  127  ? 12.171  25.301  124.850 1.00 97.34  ? 127  LEU B CD1   1 
ATOM   2729  C  CD2   . LEU B  1  127  ? 13.264  25.270  127.102 1.00 83.31  ? 127  LEU B CD2   1 
ATOM   2730  N  N     . HIS B  1  128  ? 9.231   26.930  124.863 1.00 83.00  ? 128  HIS B N     1 
ATOM   2731  C  CA    . HIS B  1  128  ? 7.932   26.326  125.081 1.00 85.54  ? 128  HIS B CA    1 
ATOM   2732  C  C     . HIS B  1  128  ? 8.055   25.122  126.013 1.00 90.35  ? 128  HIS B C     1 
ATOM   2733  O  O     . HIS B  1  128  ? 9.024   24.364  125.932 1.00 91.67  ? 128  HIS B O     1 
ATOM   2734  C  CB    . HIS B  1  128  ? 7.342   25.902  123.739 1.00 91.46  ? 128  HIS B CB    1 
ATOM   2735  C  CG    . HIS B  1  128  ? 5.988   25.280  123.839 1.00 91.03  ? 128  HIS B CG    1 
ATOM   2736  N  ND1   . HIS B  1  128  ? 4.934   25.894  124.481 1.00 96.40  ? 128  HIS B ND1   1 
ATOM   2737  C  CD2   . HIS B  1  128  ? 5.509   24.102  123.373 1.00 98.02  ? 128  HIS B CD2   1 
ATOM   2738  C  CE1   . HIS B  1  128  ? 3.869   25.119  124.412 1.00 101.99 ? 128  HIS B CE1   1 
ATOM   2739  N  NE2   . HIS B  1  128  ? 4.188   24.026  123.741 1.00 96.95  ? 128  HIS B NE2   1 
ATOM   2740  N  N     . ILE B  1  129  ? 7.082   24.960  126.907 1.00 88.88  ? 129  ILE B N     1 
ATOM   2741  C  CA    . ILE B  1  129  ? 7.012   23.777  127.764 1.00 88.53  ? 129  ILE B CA    1 
ATOM   2742  C  C     . ILE B  1  129  ? 5.791   22.923  127.427 1.00 90.28  ? 129  ILE B C     1 
ATOM   2743  O  O     . ILE B  1  129  ? 5.924   21.762  127.040 1.00 93.14  ? 129  ILE B O     1 
ATOM   2744  C  CB    . ILE B  1  129  ? 7.012   24.114  129.271 1.00 85.37  ? 129  ILE B CB    1 
ATOM   2745  C  CG1   . ILE B  1  129  ? 8.420   24.482  129.749 1.00 77.15  ? 129  ILE B CG1   1 
ATOM   2746  C  CG2   . ILE B  1  129  ? 6.535   22.917  130.075 1.00 85.71  ? 129  ILE B CG2   1 
ATOM   2747  C  CD1   . ILE B  1  129  ? 8.816   25.908  129.486 1.00 84.51  ? 129  ILE B CD1   1 
ATOM   2748  N  N     . ALA B  1  130  ? 4.602   23.489  127.600 1.00 89.91  ? 130  ALA B N     1 
ATOM   2749  C  CA    . ALA B  1  130  ? 3.380   22.794  127.221 1.00 91.45  ? 130  ALA B CA    1 
ATOM   2750  C  C     . ALA B  1  130  ? 2.259   23.768  126.886 1.00 96.71  ? 130  ALA B C     1 
ATOM   2751  O  O     . ALA B  1  130  ? 2.253   24.904  127.358 1.00 97.61  ? 130  ALA B O     1 
ATOM   2752  C  CB    . ALA B  1  130  ? 2.948   21.844  128.320 1.00 81.52  ? 130  ALA B CB    1 
ATOM   2753  N  N     . THR B  1  131  ? 1.323   23.324  126.053 1.00 103.68 ? 131  THR B N     1 
ATOM   2754  C  CA    . THR B  1  131  ? 0.114   24.094  125.789 1.00 106.47 ? 131  THR B CA    1 
ATOM   2755  C  C     . THR B  1  131  ? -1.020  23.548  126.643 1.00 105.54 ? 131  THR B C     1 
ATOM   2756  O  O     . THR B  1  131  ? -1.263  22.339  126.683 1.00 97.27  ? 131  THR B O     1 
ATOM   2757  C  CB    . THR B  1  131  ? -0.315  24.051  124.305 1.00 105.69 ? 131  THR B CB    1 
ATOM   2758  O  OG1   . THR B  1  131  ? -0.630  22.704  123.931 1.00 107.49 ? 131  THR B OG1   1 
ATOM   2759  C  CG2   . THR B  1  131  ? 0.782   24.589  123.402 1.00 100.36 ? 131  THR B CG2   1 
ATOM   2760  N  N     . LEU B  1  132  ? -1.706  24.451  127.331 1.00 113.04 ? 132  LEU B N     1 
ATOM   2761  C  CA    . LEU B  1  132  ? -2.814  24.081  128.195 1.00 113.44 ? 132  LEU B CA    1 
ATOM   2762  C  C     . LEU B  1  132  ? -4.116  24.617  127.619 1.00 115.64 ? 132  LEU B C     1 
ATOM   2763  O  O     . LEU B  1  132  ? -4.212  25.796  127.265 1.00 113.13 ? 132  LEU B O     1 
ATOM   2764  C  CB    . LEU B  1  132  ? -2.595  24.620  129.608 1.00 108.54 ? 132  LEU B CB    1 
ATOM   2765  C  CG    . LEU B  1  132  ? -1.720  23.809  130.568 1.00 105.26 ? 132  LEU B CG    1 
ATOM   2766  C  CD1   . LEU B  1  132  ? -0.297  23.658  130.062 1.00 106.43 ? 132  LEU B CD1   1 
ATOM   2767  C  CD2   . LEU B  1  132  ? -1.724  24.453  131.942 1.00 111.33 ? 132  LEU B CD2   1 
ATOM   2768  N  N     . GLU B  1  133  ? -5.109  23.741  127.518 1.00 115.62 ? 133  GLU B N     1 
ATOM   2769  C  CA    . GLU B  1  133  ? -6.414  24.113  126.989 1.00 125.32 ? 133  GLU B CA    1 
ATOM   2770  C  C     . GLU B  1  133  ? -7.333  24.560  128.119 1.00 131.30 ? 133  GLU B C     1 
ATOM   2771  O  O     . GLU B  1  133  ? -6.904  24.696  129.266 1.00 127.68 ? 133  GLU B O     1 
ATOM   2772  C  CB    . GLU B  1  133  ? -7.048  22.927  126.267 1.00 120.86 ? 133  GLU B CB    1 
ATOM   2773  C  CG    . GLU B  1  133  ? -6.095  22.165  125.375 1.00 118.80 ? 133  GLU B CG    1 
ATOM   2774  C  CD    . GLU B  1  133  ? -6.295  20.667  125.474 1.00 119.93 ? 133  GLU B CD    1 
ATOM   2775  O  OE1   . GLU B  1  133  ? -6.934  20.219  126.450 1.00 112.39 ? 133  GLU B OE1   1 
ATOM   2776  O  OE2   . GLU B  1  133  ? -5.817  19.939  124.579 1.00 124.14 ? 133  GLU B OE2   1 
ATOM   2777  N  N     . GLU B  1  134  ? -8.600  24.780  127.789 1.00 131.21 ? 134  GLU B N     1 
ATOM   2778  C  CA    . GLU B  1  134  ? -9.586  25.151  128.790 1.00 130.57 ? 134  GLU B CA    1 
ATOM   2779  C  C     . GLU B  1  134  ? -9.719  24.042  129.824 1.00 125.41 ? 134  GLU B C     1 
ATOM   2780  O  O     . GLU B  1  134  ? -9.948  22.883  129.478 1.00 121.08 ? 134  GLU B O     1 
ATOM   2781  C  CB    . GLU B  1  134  ? -10.940 25.415  128.132 1.00 138.78 ? 134  GLU B CB    1 
ATOM   2782  C  CG    . GLU B  1  134  ? -10.921 26.507  127.072 1.00 141.03 ? 134  GLU B CG    1 
ATOM   2783  C  CD    . GLU B  1  134  ? -10.829 27.904  127.661 1.00 148.66 ? 134  GLU B CD    1 
ATOM   2784  O  OE1   . GLU B  1  134  ? -10.729 28.872  126.875 1.00 144.25 ? 134  GLU B OE1   1 
ATOM   2785  O  OE2   . GLU B  1  134  ? -10.864 28.039  128.904 1.00 146.82 ? 134  GLU B OE2   1 
ATOM   2786  N  N     . GLY B  1  135  ? -9.565  24.403  131.094 1.00 123.94 ? 135  GLY B N     1 
ATOM   2787  C  CA    . GLY B  1  135  ? -9.705  23.446  132.176 1.00 120.91 ? 135  GLY B CA    1 
ATOM   2788  C  C     . GLY B  1  135  ? -8.498  22.544  132.347 1.00 123.35 ? 135  GLY B C     1 
ATOM   2789  O  O     . GLY B  1  135  ? -8.538  21.587  133.122 1.00 114.95 ? 135  GLY B O     1 
ATOM   2790  N  N     . GLY B  1  136  ? -7.431  22.828  131.605 1.00 123.39 ? 136  GLY B N     1 
ATOM   2791  C  CA    . GLY B  1  136  ? -6.180  22.113  131.780 1.00 112.70 ? 136  GLY B CA    1 
ATOM   2792  C  C     . GLY B  1  136  ? -5.361  22.720  132.900 1.00 104.38 ? 136  GLY B C     1 
ATOM   2793  O  O     . GLY B  1  136  ? -5.309  23.941  133.042 1.00 97.84  ? 136  GLY B O     1 
ATOM   2794  N  N     . ARG B  1  137  ? -4.691  21.874  133.675 1.00 100.66 ? 137  ARG B N     1 
ATOM   2795  C  CA    . ARG B  1  137  ? -3.974  22.343  134.855 1.00 106.96 ? 137  ARG B CA    1 
ATOM   2796  C  C     . ARG B  1  137  ? -2.584  21.730  134.982 1.00 105.76 ? 137  ARG B C     1 
ATOM   2797  O  O     . ARG B  1  137  ? -2.423  20.507  134.958 1.00 100.65 ? 137  ARG B O     1 
ATOM   2798  C  CB    . ARG B  1  137  ? -4.796  22.073  136.121 1.00 121.81 ? 137  ARG B CB    1 
ATOM   2799  C  CG    . ARG B  1  137  ? -6.024  22.972  136.268 1.00 125.61 ? 137  ARG B CG    1 
ATOM   2800  C  CD    . ARG B  1  137  ? -7.023  22.424  137.278 1.00 122.00 ? 137  ARG B CD    1 
ATOM   2801  N  NE    . ARG B  1  137  ? -6.435  22.239  138.602 1.00 138.56 ? 137  ARG B NE    1 
ATOM   2802  C  CZ    . ARG B  1  137  ? -6.414  23.171  139.550 1.00 138.17 ? 137  ARG B CZ    1 
ATOM   2803  N  NH1   . ARG B  1  137  ? -6.946  24.364  139.322 1.00 138.54 ? 137  ARG B NH1   1 
ATOM   2804  N  NH2   . ARG B  1  137  ? -5.858  22.910  140.726 1.00 132.66 ? 137  ARG B NH2   1 
ATOM   2805  N  N     . LEU B  1  138  ? -1.584  22.596  135.119 1.00 106.40 ? 138  LEU B N     1 
ATOM   2806  C  CA    . LEU B  1  138  ? -0.197  22.165  135.241 1.00 107.80 ? 138  LEU B CA    1 
ATOM   2807  C  C     . LEU B  1  138  ? 0.442   22.647  136.541 1.00 99.43  ? 138  LEU B C     1 
ATOM   2808  O  O     . LEU B  1  138  ? 0.640   23.849  136.748 1.00 95.60  ? 138  LEU B O     1 
ATOM   2809  C  CB    . LEU B  1  138  ? 0.624   22.656  134.047 1.00 109.71 ? 138  LEU B CB    1 
ATOM   2810  C  CG    . LEU B  1  138  ? 2.000   22.015  133.865 1.00 105.06 ? 138  LEU B CG    1 
ATOM   2811  C  CD1   . LEU B  1  138  ? 1.862   20.525  133.567 1.00 90.53  ? 138  LEU B CD1   1 
ATOM   2812  C  CD2   . LEU B  1  138  ? 2.778   22.726  132.767 1.00 98.27  ? 138  LEU B CD2   1 
ATOM   2813  N  N     . ASN B  1  139  ? 0.763   21.693  137.408 1.00 89.45  ? 139  ASN B N     1 
ATOM   2814  C  CA    . ASN B  1  139  ? 1.427   21.976  138.669 1.00 100.87 ? 139  ASN B CA    1 
ATOM   2815  C  C     . ASN B  1  139  ? 2.656   21.084  138.774 1.00 96.51  ? 139  ASN B C     1 
ATOM   2816  O  O     . ASN B  1  139  ? 2.527   19.864  138.893 1.00 96.51  ? 139  ASN B O     1 
ATOM   2817  C  CB    . ASN B  1  139  ? 0.463   21.695  139.826 1.00 110.03 ? 139  ASN B CB    1 
ATOM   2818  C  CG    . ASN B  1  139  ? 0.941   22.263  141.151 1.00 106.52 ? 139  ASN B CG    1 
ATOM   2819  O  OD1   . ASN B  1  139  ? 2.139   22.334  141.420 1.00 108.44 ? 139  ASN B OD1   1 
ATOM   2820  N  ND2   . ASN B  1  139  ? -0.004  22.669  141.990 1.00 109.56 ? 139  ASN B ND2   1 
ATOM   2821  N  N     . MET B  1  140  ? 3.843   21.684  138.736 1.00 93.69  ? 140  MET B N     1 
ATOM   2822  C  CA    . MET B  1  140  ? 5.076   20.898  138.712 1.00 89.78  ? 140  MET B CA    1 
ATOM   2823  C  C     . MET B  1  140  ? 6.307   21.559  139.342 1.00 85.44  ? 140  MET B C     1 
ATOM   2824  O  O     . MET B  1  140  ? 6.446   22.788  139.365 1.00 78.32  ? 140  MET B O     1 
ATOM   2825  C  CB    . MET B  1  140  ? 5.408   20.450  137.283 1.00 90.57  ? 140  MET B CB    1 
ATOM   2826  C  CG    . MET B  1  140  ? 5.934   21.559  136.380 1.00 98.41  ? 140  MET B CG    1 
ATOM   2827  S  SD    . MET B  1  140  ? 6.795   20.932  134.918 1.00 90.98  ? 140  MET B SD    1 
ATOM   2828  C  CE    . MET B  1  140  ? 5.454   20.112  134.062 1.00 88.89  ? 140  MET B CE    1 
ATOM   2829  N  N     . GLU B  1  141  ? 7.194   20.709  139.849 1.00 86.13  ? 141  GLU B N     1 
ATOM   2830  C  CA    . GLU B  1  141  ? 8.480   21.129  140.383 1.00 89.74  ? 141  GLU B CA    1 
ATOM   2831  C  C     . GLU B  1  141  ? 9.589   20.463  139.581 1.00 86.17  ? 141  GLU B C     1 
ATOM   2832  O  O     . GLU B  1  141  ? 9.569   19.244  139.375 1.00 82.12  ? 141  GLU B O     1 
ATOM   2833  C  CB    . GLU B  1  141  ? 8.615   20.717  141.850 1.00 97.46  ? 141  GLU B CB    1 
ATOM   2834  C  CG    . GLU B  1  141  ? 7.628   21.372  142.797 1.00 105.82 ? 141  GLU B CG    1 
ATOM   2835  C  CD    . GLU B  1  141  ? 7.857   20.961  144.244 1.00 119.23 ? 141  GLU B CD    1 
ATOM   2836  O  OE1   . GLU B  1  141  ? 8.703   20.071  144.490 1.00 108.76 ? 141  GLU B OE1   1 
ATOM   2837  O  OE2   . GLU B  1  141  ? 7.191   21.531  145.136 1.00 125.05 ? 141  GLU B OE2   1 
ATOM   2838  N  N     . VAL B  1  142  ? 10.551  21.263  139.126 1.00 80.21  ? 142  VAL B N     1 
ATOM   2839  C  CA    . VAL B  1  142  ? 11.702  20.734  138.405 1.00 78.01  ? 142  VAL B CA    1 
ATOM   2840  C  C     . VAL B  1  142  ? 12.987  20.932  139.216 1.00 75.95  ? 142  VAL B C     1 
ATOM   2841  O  O     . VAL B  1  142  ? 13.215  21.987  139.806 1.00 75.51  ? 142  VAL B O     1 
ATOM   2842  C  CB    . VAL B  1  142  ? 11.827  21.331  136.969 1.00 83.93  ? 142  VAL B CB    1 
ATOM   2843  C  CG1   . VAL B  1  142  ? 10.459  21.420  136.303 1.00 78.69  ? 142  VAL B CG1   1 
ATOM   2844  C  CG2   . VAL B  1  142  ? 12.485  22.702  136.985 1.00 85.99  ? 142  VAL B CG2   1 
ATOM   2845  N  N     . ARG B  1  143  ? 13.808  19.890  139.257 1.00 76.80  ? 143  ARG B N     1 
ATOM   2846  C  CA    . ARG B  1  143  ? 15.048  19.881  140.024 1.00 75.27  ? 143  ARG B CA    1 
ATOM   2847  C  C     . ARG B  1  143  ? 16.244  20.174  139.113 1.00 74.08  ? 143  ARG B C     1 
ATOM   2848  O  O     . ARG B  1  143  ? 16.508  19.436  138.165 1.00 68.92  ? 143  ARG B O     1 
ATOM   2849  C  CB    . ARG B  1  143  ? 15.211  18.521  140.711 1.00 72.13  ? 143  ARG B CB    1 
ATOM   2850  C  CG    . ARG B  1  143  ? 16.600  18.233  141.263 1.00 75.53  ? 143  ARG B CG    1 
ATOM   2851  C  CD    . ARG B  1  143  ? 16.867  18.974  142.554 1.00 79.15  ? 143  ARG B CD    1 
ATOM   2852  N  NE    . ARG B  1  143  ? 18.202  18.696  143.080 1.00 84.35  ? 143  ARG B NE    1 
ATOM   2853  C  CZ    . ARG B  1  143  ? 18.525  17.614  143.782 1.00 83.63  ? 143  ARG B CZ    1 
ATOM   2854  N  NH1   . ARG B  1  143  ? 17.609  16.690  144.041 1.00 86.43  ? 143  ARG B NH1   1 
ATOM   2855  N  NH2   . ARG B  1  143  ? 19.765  17.452  144.224 1.00 69.31  ? 143  ARG B NH2   1 
ATOM   2856  N  N     . VAL B  1  144  ? 16.961  21.254  139.407 1.00 67.49  ? 144  VAL B N     1 
ATOM   2857  C  CA    . VAL B  1  144  ? 18.071  21.704  138.576 1.00 66.99  ? 144  VAL B CA    1 
ATOM   2858  C  C     . VAL B  1  144  ? 19.398  21.682  139.332 1.00 72.22  ? 144  VAL B C     1 
ATOM   2859  O  O     . VAL B  1  144  ? 19.597  22.442  140.279 1.00 73.03  ? 144  VAL B O     1 
ATOM   2860  C  CB    . VAL B  1  144  ? 17.821  23.129  138.028 1.00 65.96  ? 144  VAL B CB    1 
ATOM   2861  C  CG1   . VAL B  1  144  ? 19.085  23.699  137.395 1.00 66.72  ? 144  VAL B CG1   1 
ATOM   2862  C  CG2   . VAL B  1  144  ? 16.672  23.122  137.035 1.00 61.67  ? 144  VAL B CG2   1 
ATOM   2863  N  N     . ASP B  1  145  ? 20.313  20.824  138.887 1.00 77.21  ? 145  ASP B N     1 
ATOM   2864  C  CA    . ASP B  1  145  ? 21.594  20.648  139.563 1.00 76.50  ? 145  ASP B CA    1 
ATOM   2865  C  C     . ASP B  1  145  ? 22.770  21.133  138.730 1.00 74.85  ? 145  ASP B C     1 
ATOM   2866  O  O     . ASP B  1  145  ? 22.710  21.167  137.505 1.00 72.62  ? 145  ASP B O     1 
ATOM   2867  C  CB    . ASP B  1  145  ? 21.823  19.175  139.899 1.00 78.82  ? 145  ASP B CB    1 
ATOM   2868  C  CG    . ASP B  1  145  ? 20.957  18.696  141.036 1.00 89.31  ? 145  ASP B CG    1 
ATOM   2869  O  OD1   . ASP B  1  145  ? 19.840  18.209  140.760 1.00 89.24  ? 145  ASP B OD1   1 
ATOM   2870  O  OD2   . ASP B  1  145  ? 21.397  18.801  142.203 1.00 93.65  ? 145  ASP B OD2   1 
ATOM   2871  N  N     . ARG B  1  146  ? 23.842  21.508  139.415 1.00 76.87  ? 146  ARG B N     1 
ATOM   2872  C  CA    . ARG B  1  146  ? 25.107  21.804  138.767 1.00 74.86  ? 146  ARG B CA    1 
ATOM   2873  C  C     . ARG B  1  146  ? 25.899  20.506  138.617 1.00 74.78  ? 146  ARG B C     1 
ATOM   2874  O  O     . ARG B  1  146  ? 25.950  19.690  139.539 1.00 81.27  ? 146  ARG B O     1 
ATOM   2875  C  CB    . ARG B  1  146  ? 25.885  22.822  139.596 1.00 80.01  ? 146  ARG B CB    1 
ATOM   2876  C  CG    . ARG B  1  146  ? 27.354  22.929  139.257 1.00 82.76  ? 146  ARG B CG    1 
ATOM   2877  C  CD    . ARG B  1  146  ? 27.995  24.035  140.067 1.00 86.12  ? 146  ARG B CD    1 
ATOM   2878  N  NE    . ARG B  1  146  ? 27.431  25.335  139.720 1.00 89.33  ? 146  ARG B NE    1 
ATOM   2879  C  CZ    . ARG B  1  146  ? 27.661  26.455  140.396 1.00 90.85  ? 146  ARG B CZ    1 
ATOM   2880  N  NH1   . ARG B  1  146  ? 28.442  26.436  141.468 1.00 93.95  ? 146  ARG B NH1   1 
ATOM   2881  N  NH2   . ARG B  1  146  ? 27.106  27.594  140.003 1.00 87.53  ? 146  ARG B NH2   1 
ATOM   2882  N  N     . GLY B  1  147  ? 26.500  20.305  137.449 1.00 76.42  ? 147  GLY B N     1 
ATOM   2883  C  CA    . GLY B  1  147  ? 27.280  19.105  137.193 1.00 75.44  ? 147  GLY B CA    1 
ATOM   2884  C  C     . GLY B  1  147  ? 28.084  19.176  135.908 1.00 67.22  ? 147  GLY B C     1 
ATOM   2885  O  O     . GLY B  1  147  ? 28.179  20.231  135.277 1.00 66.75  ? 147  GLY B O     1 
ATOM   2886  N  N     . VAL B  1  148  ? 28.679  18.050  135.523 1.00 67.04  ? 148  VAL B N     1 
ATOM   2887  C  CA    . VAL B  1  148  ? 29.430  17.973  134.269 1.00 63.09  ? 148  VAL B CA    1 
ATOM   2888  C  C     . VAL B  1  148  ? 29.043  16.749  133.440 1.00 62.88  ? 148  VAL B C     1 
ATOM   2889  O  O     . VAL B  1  148  ? 28.629  15.719  133.979 1.00 64.92  ? 148  VAL B O     1 
ATOM   2890  C  CB    . VAL B  1  148  ? 30.955  17.926  134.504 1.00 54.64  ? 148  VAL B CB    1 
ATOM   2891  C  CG1   . VAL B  1  148  ? 31.429  19.164  135.255 1.00 57.61  ? 148  VAL B CG1   1 
ATOM   2892  C  CG2   . VAL B  1  148  ? 31.346  16.643  135.229 1.00 40.77  ? 148  VAL B CG2   1 
ATOM   2893  N  N     . GLY B  1  149  ? 29.179  16.865  132.125 1.00 54.12  ? 149  GLY B N     1 
ATOM   2894  C  CA    . GLY B  1  149  ? 28.981  15.726  131.254 1.00 49.03  ? 149  GLY B CA    1 
ATOM   2895  C  C     . GLY B  1  149  ? 27.531  15.381  130.991 1.00 48.72  ? 149  GLY B C     1 
ATOM   2896  O  O     . GLY B  1  149  ? 26.689  16.262  130.827 1.00 55.39  ? 149  GLY B O     1 
ATOM   2897  N  N     . TYR B  1  150  ? 27.254  14.087  130.903 1.00 38.97  ? 150  TYR B N     1 
ATOM   2898  C  CA    . TYR B  1  150  ? 25.907  13.600  130.642 1.00 53.92  ? 150  TYR B CA    1 
ATOM   2899  C  C     . TYR B  1  150  ? 25.620  12.391  131.529 1.00 63.21  ? 150  TYR B C     1 
ATOM   2900  O  O     . TYR B  1  150  ? 26.310  11.373  131.452 1.00 59.05  ? 150  TYR B O     1 
ATOM   2901  C  CB    . TYR B  1  150  ? 25.759  13.244  129.159 1.00 51.24  ? 150  TYR B CB    1 
ATOM   2902  C  CG    . TYR B  1  150  ? 24.403  12.732  128.728 1.00 56.56  ? 150  TYR B CG    1 
ATOM   2903  C  CD1   . TYR B  1  150  ? 23.435  13.602  128.235 1.00 62.83  ? 150  TYR B CD1   1 
ATOM   2904  C  CD2   . TYR B  1  150  ? 24.102  11.377  128.776 1.00 55.91  ? 150  TYR B CD2   1 
ATOM   2905  C  CE1   . TYR B  1  150  ? 22.192  13.139  127.822 1.00 60.04  ? 150  TYR B CE1   1 
ATOM   2906  C  CE2   . TYR B  1  150  ? 22.866  10.905  128.368 1.00 61.10  ? 150  TYR B CE2   1 
ATOM   2907  C  CZ    . TYR B  1  150  ? 21.915  11.790  127.891 1.00 60.70  ? 150  TYR B CZ    1 
ATOM   2908  O  OH    . TYR B  1  150  ? 20.685  11.322  127.482 1.00 55.24  ? 150  TYR B OH    1 
ATOM   2909  N  N     . VAL B  1  151  ? 24.613  12.507  132.387 1.00 63.84  ? 151  VAL B N     1 
ATOM   2910  C  CA    . VAL B  1  151  ? 24.214  11.381  133.218 1.00 64.91  ? 151  VAL B CA    1 
ATOM   2911  C  C     . VAL B  1  151  ? 22.786  10.947  132.909 1.00 67.73  ? 151  VAL B C     1 
ATOM   2912  O  O     . VAL B  1  151  ? 21.844  11.718  133.111 1.00 65.84  ? 151  VAL B O     1 
ATOM   2913  C  CB    . VAL B  1  151  ? 24.358  11.696  134.716 1.00 63.01  ? 151  VAL B CB    1 
ATOM   2914  C  CG1   . VAL B  1  151  ? 24.066  10.453  135.539 1.00 59.25  ? 151  VAL B CG1   1 
ATOM   2915  C  CG2   . VAL B  1  151  ? 25.762  12.210  135.011 1.00 59.12  ? 151  VAL B CG2   1 
ATOM   2916  N  N     . PRO B  1  152  ? 22.624  9.710   132.407 1.00 67.39  ? 152  PRO B N     1 
ATOM   2917  C  CA    . PRO B  1  152  ? 21.297  9.144   132.130 1.00 67.41  ? 152  PRO B CA    1 
ATOM   2918  C  C     . PRO B  1  152  ? 20.457  9.114   133.403 1.00 72.26  ? 152  PRO B C     1 
ATOM   2919  O  O     . PRO B  1  152  ? 21.020  9.117   134.499 1.00 70.65  ? 152  PRO B O     1 
ATOM   2920  C  CB    . PRO B  1  152  ? 21.611  7.713   131.677 1.00 64.82  ? 152  PRO B CB    1 
ATOM   2921  C  CG    . PRO B  1  152  ? 23.023  7.754   131.221 1.00 61.42  ? 152  PRO B CG    1 
ATOM   2922  C  CD    . PRO B  1  152  ? 23.712  8.776   132.070 1.00 56.46  ? 152  PRO B CD    1 
ATOM   2923  N  N     . ALA B  1  153  ? 19.135  9.088   133.260 1.00 76.24  ? 153  ALA B N     1 
ATOM   2924  C  CA    . ALA B  1  153  ? 18.229  9.145   134.408 1.00 73.68  ? 153  ALA B CA    1 
ATOM   2925  C  C     . ALA B  1  153  ? 18.481  8.021   135.409 1.00 74.02  ? 153  ALA B C     1 
ATOM   2926  O  O     . ALA B  1  153  ? 18.573  8.256   136.613 1.00 73.00  ? 153  ALA B O     1 
ATOM   2927  C  CB    . ALA B  1  153  ? 16.783  9.120   133.940 1.00 73.34  ? 153  ALA B CB    1 
ATOM   2928  N  N     . GLU B  1  154  ? 18.606  6.805   134.894 1.00 72.80  ? 154  GLU B N     1 
ATOM   2929  C  CA    . GLU B  1  154  ? 18.806  5.623   135.722 1.00 73.01  ? 154  GLU B CA    1 
ATOM   2930  C  C     . GLU B  1  154  ? 20.134  5.636   136.490 1.00 72.88  ? 154  GLU B C     1 
ATOM   2931  O  O     . GLU B  1  154  ? 20.296  4.909   137.465 1.00 73.28  ? 154  GLU B O     1 
ATOM   2932  C  CB    . GLU B  1  154  ? 18.707  4.357   134.862 1.00 73.24  ? 154  GLU B CB    1 
ATOM   2933  C  CG    . GLU B  1  154  ? 17.387  4.212   134.095 1.00 80.69  ? 154  GLU B CG    1 
ATOM   2934  C  CD    . GLU B  1  154  ? 17.358  5.003   132.792 1.00 94.28  ? 154  GLU B CD    1 
ATOM   2935  O  OE1   . GLU B  1  154  ? 18.388  5.629   132.455 1.00 93.00  ? 154  GLU B OE1   1 
ATOM   2936  O  OE2   . GLU B  1  154  ? 16.308  4.997   132.105 1.00 92.22  ? 154  GLU B OE2   1 
ATOM   2937  N  N     . LYS B  1  155  ? 21.086  6.443   136.035 1.00 78.21  ? 155  LYS B N     1 
ATOM   2938  C  CA    . LYS B  1  155  ? 22.404  6.524   136.673 1.00 77.42  ? 155  LYS B CA    1 
ATOM   2939  C  C     . LYS B  1  155  ? 22.529  7.449   137.895 1.00 75.49  ? 155  LYS B C     1 
ATOM   2940  O  O     . LYS B  1  155  ? 23.256  7.128   138.834 1.00 75.70  ? 155  LYS B O     1 
ATOM   2941  C  CB    . LYS B  1  155  ? 23.499  6.825   135.643 1.00 75.67  ? 155  LYS B CB    1 
ATOM   2942  C  CG    . LYS B  1  155  ? 23.902  5.610   134.814 1.00 84.13  ? 155  LYS B CG    1 
ATOM   2943  C  CD    . LYS B  1  155  ? 24.477  4.513   135.702 1.00 97.94  ? 155  LYS B CD    1 
ATOM   2944  C  CE    . LYS B  1  155  ? 24.673  3.207   134.943 1.00 104.31 ? 155  LYS B CE    1 
ATOM   2945  N  NZ    . LYS B  1  155  ? 23.375  2.549   134.611 1.00 90.66  ? 155  LYS B NZ    1 
ATOM   2946  N  N     . HIS B  1  156  ? 21.875  8.609   137.867 1.00 75.12  ? 156  HIS B N     1 
ATOM   2947  C  CA    . HIS B  1  156  ? 21.865  9.491   139.039 1.00 76.49  ? 156  HIS B CA    1 
ATOM   2948  C  C     . HIS B  1  156  ? 20.806  9.056   140.055 1.00 89.04  ? 156  HIS B C     1 
ATOM   2949  O  O     . HIS B  1  156  ? 21.042  9.077   141.272 1.00 73.16  ? 156  HIS B O     1 
ATOM   2950  C  CB    . HIS B  1  156  ? 21.694  10.968  138.650 1.00 69.18  ? 156  HIS B CB    1 
ATOM   2951  C  CG    . HIS B  1  156  ? 20.434  11.262  137.894 1.00 74.60  ? 156  HIS B CG    1 
ATOM   2952  N  ND1   . HIS B  1  156  ? 19.188  11.244  138.481 1.00 78.26  ? 156  HIS B ND1   1 
ATOM   2953  C  CD2   . HIS B  1  156  ? 20.231  11.599  136.598 1.00 78.49  ? 156  HIS B CD2   1 
ATOM   2954  C  CE1   . HIS B  1  156  ? 18.272  11.544  137.579 1.00 80.16  ? 156  HIS B CE1   1 
ATOM   2955  N  NE2   . HIS B  1  156  ? 18.879  11.766  136.427 1.00 78.32  ? 156  HIS B NE2   1 
ATOM   2956  N  N     . GLY B  1  157  ? 19.643  8.667   139.531 1.00 90.83  ? 157  GLY B N     1 
ATOM   2957  C  CA    . GLY B  1  157  ? 18.535  8.160   140.322 1.00 89.65  ? 157  GLY B CA    1 
ATOM   2958  C  C     . GLY B  1  157  ? 18.123  9.018   141.503 1.00 102.67 ? 157  GLY B C     1 
ATOM   2959  O  O     . GLY B  1  157  ? 18.016  8.517   142.625 1.00 113.81 ? 157  GLY B O     1 
ATOM   2960  N  N     . ILE B  1  158  ? 17.896  10.308  141.272 1.00 97.52  ? 158  ILE B N     1 
ATOM   2961  C  CA    . ILE B  1  158  ? 17.470  11.167  142.371 1.00 102.65 ? 158  ILE B CA    1 
ATOM   2962  C  C     . ILE B  1  158  ? 15.971  11.429  142.409 1.00 103.79 ? 158  ILE B C     1 
ATOM   2963  O  O     . ILE B  1  158  ? 15.342  11.736  141.392 1.00 93.09  ? 158  ILE B O     1 
ATOM   2964  C  CB    . ILE B  1  158  ? 18.264  12.492  142.473 1.00 95.75  ? 158  ILE B CB    1 
ATOM   2965  C  CG1   . ILE B  1  158  ? 18.600  13.052  141.099 1.00 84.83  ? 158  ILE B CG1   1 
ATOM   2966  C  CG2   . ILE B  1  158  ? 19.540  12.282  143.274 1.00 106.70 ? 158  ILE B CG2   1 
ATOM   2967  C  CD1   . ILE B  1  158  ? 19.582  14.202  141.163 1.00 84.04  ? 158  ILE B CD1   1 
ATOM   2968  N  N     . LYS B  1  159  ? 15.421  11.276  143.611 1.00 107.14 ? 159  LYS B N     1 
ATOM   2969  C  CA    . LYS B  1  159  ? 14.027  11.563  143.903 1.00 102.33 ? 159  LYS B CA    1 
ATOM   2970  C  C     . LYS B  1  159  ? 13.944  12.493  145.108 1.00 106.23 ? 159  LYS B C     1 
ATOM   2971  O  O     . LYS B  1  159  ? 14.388  12.145  146.203 1.00 104.29 ? 159  LYS B O     1 
ATOM   2972  C  CB    . LYS B  1  159  ? 13.268  10.269  144.201 1.00 92.49  ? 159  LYS B CB    1 
ATOM   2973  C  CG    . LYS B  1  159  ? 12.617  9.624   142.991 1.00 96.33  ? 159  LYS B CG    1 
ATOM   2974  C  CD    . LYS B  1  159  ? 11.887  8.344   143.380 1.00 106.05 ? 159  LYS B CD    1 
ATOM   2975  C  CE    . LYS B  1  159  ? 10.943  7.882   142.277 1.00 115.59 ? 159  LYS B CE    1 
ATOM   2976  N  NZ    . LYS B  1  159  ? 11.630  7.740   140.960 1.00 98.78  ? 159  LYS B NZ    1 
ATOM   2977  N  N     . ASP B  1  160  ? 13.394  13.685  144.899 1.00 106.76 ? 160  ASP B N     1 
ATOM   2978  C  CA    . ASP B  1  160  ? 13.090  14.581  146.006 1.00 110.21 ? 160  ASP B CA    1 
ATOM   2979  C  C     . ASP B  1  160  ? 11.883  14.028  146.755 1.00 103.65 ? 160  ASP B C     1 
ATOM   2980  O  O     . ASP B  1  160  ? 11.772  14.163  147.974 1.00 101.56 ? 160  ASP B O     1 
ATOM   2981  C  CB    . ASP B  1  160  ? 12.779  15.988  145.492 1.00 116.44 ? 160  ASP B CB    1 
ATOM   2982  C  CG    . ASP B  1  160  ? 14.027  16.787  145.170 1.00 110.49 ? 160  ASP B CG    1 
ATOM   2983  O  OD1   . ASP B  1  160  ? 15.122  16.409  145.648 1.00 105.03 ? 160  ASP B OD1   1 
ATOM   2984  O  OD2   . ASP B  1  160  ? 13.901  17.804  144.450 1.00 96.72  ? 160  ASP B OD2   1 
ATOM   2985  N  N     . ARG B  1  161  ? 10.982  13.402  146.002 1.00 99.52  ? 161  ARG B N     1 
ATOM   2986  C  CA    . ARG B  1  161  ? 9.785   12.786  146.553 1.00 92.93  ? 161  ARG B CA    1 
ATOM   2987  C  C     . ARG B  1  161  ? 9.370   11.611  145.676 1.00 95.66  ? 161  ARG B C     1 
ATOM   2988  O  O     . ARG B  1  161  ? 9.979   11.358  144.642 1.00 102.32 ? 161  ARG B O     1 
ATOM   2989  C  CB    . ARG B  1  161  ? 8.651   13.806  146.596 1.00 91.96  ? 161  ARG B CB    1 
ATOM   2990  C  CG    . ARG B  1  161  ? 8.132   14.202  145.228 1.00 92.57  ? 161  ARG B CG    1 
ATOM   2991  C  CD    . ARG B  1  161  ? 6.970   15.171  145.339 1.00 95.24  ? 161  ARG B CD    1 
ATOM   2992  N  NE    . ARG B  1  161  ? 7.393   16.461  145.873 1.00 101.74 ? 161  ARG B NE    1 
ATOM   2993  C  CZ    . ARG B  1  161  ? 6.556   17.408  146.282 1.00 99.80  ? 161  ARG B CZ    1 
ATOM   2994  N  NH1   . ARG B  1  161  ? 5.249   17.203  146.223 1.00 94.00  ? 161  ARG B NH1   1 
ATOM   2995  N  NH2   . ARG B  1  161  ? 7.023   18.556  146.755 1.00 100.82 ? 161  ARG B NH2   1 
ATOM   2996  N  N     . ILE B  1  162  ? 8.331   10.893  146.085 1.00 96.43  ? 162  ILE B N     1 
ATOM   2997  C  CA    . ILE B  1  162  ? 7.785   9.831   145.249 1.00 103.93 ? 162  ILE B CA    1 
ATOM   2998  C  C     . ILE B  1  162  ? 6.958   10.459  144.130 1.00 103.63 ? 162  ILE B C     1 
ATOM   2999  O  O     . ILE B  1  162  ? 6.548   11.618  144.237 1.00 102.53 ? 162  ILE B O     1 
ATOM   3000  C  CB    . ILE B  1  162  ? 6.945   8.824   146.064 1.00 103.44 ? 162  ILE B CB    1 
ATOM   3001  C  CG1   . ILE B  1  162  ? 6.750   7.517   145.285 1.00 108.71 ? 162  ILE B CG1   1 
ATOM   3002  C  CG2   . ILE B  1  162  ? 5.613   9.436   146.446 1.00 95.19  ? 162  ILE B CG2   1 
ATOM   3003  C  CD1   . ILE B  1  162  ? 8.010   7.001   144.602 1.00 106.81 ? 162  ILE B CD1   1 
ATOM   3004  N  N     . ASN B  1  163  ? 6.742   9.696   143.059 1.00 102.73 ? 163  ASN B N     1 
ATOM   3005  C  CA    . ASN B  1  163  ? 6.070   10.166  141.841 1.00 104.85 ? 163  ASN B CA    1 
ATOM   3006  C  C     . ASN B  1  163  ? 6.912   11.146  141.031 1.00 99.92  ? 163  ASN B C     1 
ATOM   3007  O  O     . ASN B  1  163  ? 6.525   11.543  139.930 1.00 93.84  ? 163  ASN B O     1 
ATOM   3008  C  CB    . ASN B  1  163  ? 4.679   10.750  142.123 1.00 100.20 ? 163  ASN B CB    1 
ATOM   3009  C  CG    . ASN B  1  163  ? 3.656   9.686   142.451 1.00 106.22 ? 163  ASN B CG    1 
ATOM   3010  O  OD1   . ASN B  1  163  ? 3.923   8.489   142.329 1.00 104.21 ? 163  ASN B OD1   1 
ATOM   3011  N  ND2   . ASN B  1  163  ? 2.467   10.118  142.858 1.00 108.41 ? 163  ASN B ND2   1 
ATOM   3012  N  N     . ALA B  1  164  ? 8.058   11.534  141.584 1.00 98.53  ? 164  ALA B N     1 
ATOM   3013  C  CA    . ALA B  1  164  ? 9.009   12.375  140.870 1.00 96.90  ? 164  ALA B CA    1 
ATOM   3014  C  C     . ALA B  1  164  ? 9.698   11.555  139.784 1.00 92.27  ? 164  ALA B C     1 
ATOM   3015  O  O     . ALA B  1  164  ? 10.171  10.442  140.034 1.00 87.40  ? 164  ALA B O     1 
ATOM   3016  C  CB    . ALA B  1  164  ? 10.035  12.971  141.831 1.00 85.87  ? 164  ALA B CB    1 
ATOM   3017  N  N     . ILE B  1  165  ? 9.739   12.105  138.574 1.00 85.19  ? 165  ILE B N     1 
ATOM   3018  C  CA    . ILE B  1  165  ? 10.349  11.418  137.442 1.00 86.42  ? 165  ILE B CA    1 
ATOM   3019  C  C     . ILE B  1  165  ? 11.782  11.893  137.212 1.00 79.35  ? 165  ILE B C     1 
ATOM   3020  O  O     . ILE B  1  165  ? 12.020  13.086  137.007 1.00 73.61  ? 165  ILE B O     1 
ATOM   3021  C  CB    . ILE B  1  165  ? 9.540   11.637  136.155 1.00 85.25  ? 165  ILE B CB    1 
ATOM   3022  C  CG1   . ILE B  1  165  ? 8.050   11.420  136.422 1.00 90.10  ? 165  ILE B CG1   1 
ATOM   3023  C  CG2   . ILE B  1  165  ? 10.038  10.713  135.059 1.00 83.38  ? 165  ILE B CG2   1 
ATOM   3024  C  CD1   . ILE B  1  165  ? 7.178   11.635  135.212 1.00 95.99  ? 165  ILE B CD1   1 
ATOM   3025  N  N     . PRO B  1  166  ? 12.745  10.958  137.257 1.00 77.08  ? 166  PRO B N     1 
ATOM   3026  C  CA    . PRO B  1  166  ? 14.147  11.312  137.014 1.00 76.76  ? 166  PRO B CA    1 
ATOM   3027  C  C     . PRO B  1  166  ? 14.390  11.613  135.533 1.00 73.29  ? 166  PRO B C     1 
ATOM   3028  O  O     . PRO B  1  166  ? 13.855  10.926  134.658 1.00 65.52  ? 166  PRO B O     1 
ATOM   3029  C  CB    . PRO B  1  166  ? 14.904  10.056  137.454 1.00 73.40  ? 166  PRO B CB    1 
ATOM   3030  C  CG    . PRO B  1  166  ? 13.929  8.943   137.261 1.00 68.30  ? 166  PRO B CG    1 
ATOM   3031  C  CD    . PRO B  1  166  ? 12.566  9.519   137.521 1.00 71.45  ? 166  PRO B CD    1 
ATOM   3032  N  N     . VAL B  1  167  ? 15.194  12.636  135.262 1.00 69.61  ? 167  VAL B N     1 
ATOM   3033  C  CA    . VAL B  1  167  ? 15.416  13.101  133.898 1.00 75.11  ? 167  VAL B CA    1 
ATOM   3034  C  C     . VAL B  1  167  ? 16.873  12.906  133.486 1.00 77.37  ? 167  VAL B C     1 
ATOM   3035  O  O     . VAL B  1  167  ? 17.777  13.103  134.303 1.00 71.78  ? 167  VAL B O     1 
ATOM   3036  C  CB    . VAL B  1  167  ? 15.036  14.593  133.762 1.00 73.14  ? 167  VAL B CB    1 
ATOM   3037  C  CG1   . VAL B  1  167  ? 15.404  15.136  132.383 1.00 66.68  ? 167  VAL B CG1   1 
ATOM   3038  C  CG2   . VAL B  1  167  ? 13.560  14.776  134.033 1.00 70.89  ? 167  VAL B CG2   1 
ATOM   3039  N  N     . ASP B  1  168  ? 17.091  12.501  132.232 1.00 76.90  ? 168  ASP B N     1 
ATOM   3040  C  CA    . ASP B  1  168  ? 18.440  12.404  131.676 1.00 68.07  ? 168  ASP B CA    1 
ATOM   3041  C  C     . ASP B  1  168  ? 19.101  13.775  131.806 1.00 61.23  ? 168  ASP B C     1 
ATOM   3042  O  O     . ASP B  1  168  ? 18.565  14.784  131.347 1.00 65.24  ? 168  ASP B O     1 
ATOM   3043  C  CB    . ASP B  1  168  ? 18.385  11.957  130.210 1.00 64.78  ? 168  ASP B CB    1 
ATOM   3044  C  CG    . ASP B  1  168  ? 17.717  10.590  130.029 1.00 76.22  ? 168  ASP B CG    1 
ATOM   3045  O  OD1   . ASP B  1  168  ? 18.077  9.642   130.758 1.00 77.29  ? 168  ASP B OD1   1 
ATOM   3046  O  OD2   . ASP B  1  168  ? 16.831  10.458  129.155 1.00 81.76  ? 168  ASP B OD2   1 
ATOM   3047  N  N     . ALA B  1  169  ? 20.258  13.816  132.452 1.00 57.93  ? 169  ALA B N     1 
ATOM   3048  C  CA    . ALA B  1  169  ? 20.849  15.096  132.827 1.00 62.55  ? 169  ALA B CA    1 
ATOM   3049  C  C     . ALA B  1  169  ? 21.867  15.578  131.807 1.00 66.16  ? 169  ALA B C     1 
ATOM   3050  O  O     . ALA B  1  169  ? 22.966  15.024  131.710 1.00 63.50  ? 169  ALA B O     1 
ATOM   3051  C  CB    . ALA B  1  169  ? 21.502  14.988  134.195 1.00 61.25  ? 169  ALA B CB    1 
ATOM   3052  N  N     . VAL B  1  170  ? 21.536  16.642  131.081 1.00 62.57  ? 170  VAL B N     1 
ATOM   3053  C  CA    . VAL B  1  170  ? 22.502  17.165  130.136 1.00 60.97  ? 170  VAL B CA    1 
ATOM   3054  C  C     . VAL B  1  170  ? 23.167  18.351  130.804 1.00 57.37  ? 170  VAL B C     1 
ATOM   3055  O  O     . VAL B  1  170  ? 22.688  19.486  130.722 1.00 54.62  ? 170  VAL B O     1 
ATOM   3056  C  CB    . VAL B  1  170  ? 21.789  17.659  128.860 1.00 59.72  ? 170  VAL B CB    1 
ATOM   3057  C  CG1   . VAL B  1  170  ? 22.796  18.162  127.836 1.00 65.61  ? 170  VAL B CG1   1 
ATOM   3058  C  CG2   . VAL B  1  170  ? 20.917  16.552  128.269 1.00 59.45  ? 170  VAL B CG2   1 
ATOM   3059  N  N     . PHE B  1  171  ? 24.332  18.086  131.384 1.00 53.80  ? 171  PHE B N     1 
ATOM   3060  C  CA    . PHE B  1  171  ? 25.039  19.091  132.159 1.00 62.63  ? 171  PHE B CA    1 
ATOM   3061  C  C     . PHE B  1  171  ? 25.832  19.991  131.246 1.00 65.49  ? 171  PHE B C     1 
ATOM   3062  O  O     . PHE B  1  171  ? 25.823  21.214  131.403 1.00 66.68  ? 171  PHE B O     1 
ATOM   3063  C  CB    . PHE B  1  171  ? 25.974  18.445  133.187 1.00 64.34  ? 171  PHE B CB    1 
ATOM   3064  C  CG    . PHE B  1  171  ? 25.261  17.831  134.360 1.00 68.63  ? 171  PHE B CG    1 
ATOM   3065  C  CD1   . PHE B  1  171  ? 24.494  18.612  135.208 1.00 70.26  ? 171  PHE B CD1   1 
ATOM   3066  C  CD2   . PHE B  1  171  ? 25.366  16.476  134.623 1.00 67.05  ? 171  PHE B CD2   1 
ATOM   3067  C  CE1   . PHE B  1  171  ? 23.838  18.051  136.285 1.00 71.14  ? 171  PHE B CE1   1 
ATOM   3068  C  CE2   . PHE B  1  171  ? 24.712  15.911  135.702 1.00 66.03  ? 171  PHE B CE2   1 
ATOM   3069  C  CZ    . PHE B  1  171  ? 23.948  16.699  136.531 1.00 66.34  ? 171  PHE B CZ    1 
ATOM   3070  N  N     . SER B  1  172  ? 26.495  19.364  130.276 1.00 63.06  ? 172  SER B N     1 
ATOM   3071  C  CA    . SER B  1  172  ? 27.472  20.037  129.433 1.00 59.82  ? 172  SER B CA    1 
ATOM   3072  C  C     . SER B  1  172  ? 26.870  21.263  128.767 1.00 55.19  ? 172  SER B C     1 
ATOM   3073  O  O     . SER B  1  172  ? 25.885  21.160  128.038 1.00 59.45  ? 172  SER B O     1 
ATOM   3074  C  CB    . SER B  1  172  ? 28.022  19.069  128.376 1.00 66.70  ? 172  SER B CB    1 
ATOM   3075  O  OG    . SER B  1  172  ? 29.156  19.606  127.707 1.00 61.52  ? 172  SER B OG    1 
ATOM   3076  N  N     . PRO B  1  173  ? 27.455  22.437  129.038 1.00 52.17  ? 173  PRO B N     1 
ATOM   3077  C  CA    . PRO B  1  173  ? 27.038  23.656  128.349 1.00 57.10  ? 173  PRO B CA    1 
ATOM   3078  C  C     . PRO B  1  173  ? 27.458  23.560  126.890 1.00 60.24  ? 173  PRO B C     1 
ATOM   3079  O  O     . PRO B  1  173  ? 26.880  24.221  126.033 1.00 61.56  ? 173  PRO B O     1 
ATOM   3080  C  CB    . PRO B  1  173  ? 27.832  24.747  129.066 1.00 57.47  ? 173  PRO B CB    1 
ATOM   3081  C  CG    . PRO B  1  173  ? 29.041  24.059  129.571 1.00 51.52  ? 173  PRO B CG    1 
ATOM   3082  C  CD    . PRO B  1  173  ? 28.604  22.670  129.931 1.00 54.32  ? 173  PRO B CD    1 
ATOM   3083  N  N     . VAL B  1  174  ? 28.458  22.725  126.623 1.00 61.94  ? 174  VAL B N     1 
ATOM   3084  C  CA    . VAL B  1  174  ? 28.924  22.474  125.269 1.00 63.23  ? 174  VAL B CA    1 
ATOM   3085  C  C     . VAL B  1  174  ? 28.000  21.475  124.570 1.00 64.48  ? 174  VAL B C     1 
ATOM   3086  O  O     . VAL B  1  174  ? 27.850  20.332  125.016 1.00 60.46  ? 174  VAL B O     1 
ATOM   3087  C  CB    . VAL B  1  174  ? 30.352  21.913  125.289 1.00 56.68  ? 174  VAL B CB    1 
ATOM   3088  C  CG1   . VAL B  1  174  ? 30.761  21.470  123.904 1.00 60.62  ? 174  VAL B CG1   1 
ATOM   3089  C  CG2   . VAL B  1  174  ? 31.322  22.950  125.844 1.00 52.28  ? 174  VAL B CG2   1 
ATOM   3090  N  N     . ARG B  1  175  ? 27.362  21.926  123.492 1.00 63.91  ? 175  ARG B N     1 
ATOM   3091  C  CA    . ARG B  1  175  ? 26.471  21.079  122.703 1.00 64.68  ? 175  ARG B CA    1 
ATOM   3092  C  C     . ARG B  1  175  ? 27.213  20.230  121.673 1.00 67.20  ? 175  ARG B C     1 
ATOM   3093  O  O     . ARG B  1  175  ? 26.808  19.097  121.376 1.00 59.91  ? 175  ARG B O     1 
ATOM   3094  C  CB    . ARG B  1  175  ? 25.381  21.915  122.028 1.00 64.10  ? 175  ARG B CB    1 
ATOM   3095  C  CG    . ARG B  1  175  ? 24.518  22.676  123.009 1.00 75.17  ? 175  ARG B CG    1 
ATOM   3096  C  CD    . ARG B  1  175  ? 23.138  22.974  122.452 1.00 83.65  ? 175  ARG B CD    1 
ATOM   3097  N  NE    . ARG B  1  175  ? 22.258  23.486  123.498 1.00 98.50  ? 175  ARG B NE    1 
ATOM   3098  C  CZ    . ARG B  1  175  ? 21.620  22.723  124.383 1.00 94.52  ? 175  ARG B CZ    1 
ATOM   3099  N  NH1   . ARG B  1  175  ? 21.755  21.402  124.352 1.00 82.13  ? 175  ARG B NH1   1 
ATOM   3100  N  NH2   . ARG B  1  175  ? 20.843  23.284  125.300 1.00 89.61  ? 175  ARG B NH2   1 
ATOM   3101  N  N     . ARG B  1  176  ? 28.276  20.791  121.100 1.00 66.90  ? 176  ARG B N     1 
ATOM   3102  C  CA    . ARG B  1  176  ? 29.034  20.060  120.087 1.00 61.01  ? 176  ARG B CA    1 
ATOM   3103  C  C     . ARG B  1  176  ? 30.491  20.503  119.975 1.00 60.75  ? 176  ARG B C     1 
ATOM   3104  O  O     . ARG B  1  176  ? 30.811  21.673  120.190 1.00 60.74  ? 176  ARG B O     1 
ATOM   3105  C  CB    . ARG B  1  176  ? 28.330  20.168  118.728 1.00 64.54  ? 176  ARG B CB    1 
ATOM   3106  C  CG    . ARG B  1  176  ? 29.015  19.421  117.596 1.00 67.82  ? 176  ARG B CG    1 
ATOM   3107  C  CD    . ARG B  1  176  ? 28.014  18.929  116.579 1.00 68.06  ? 176  ARG B CD    1 
ATOM   3108  N  NE    . ARG B  1  176  ? 27.857  19.817  115.431 1.00 73.39  ? 176  ARG B NE    1 
ATOM   3109  C  CZ    . ARG B  1  176  ? 28.334  19.558  114.217 1.00 69.63  ? 176  ARG B CZ    1 
ATOM   3110  N  NH1   . ARG B  1  176  ? 29.009  18.441  113.993 1.00 71.73  ? 176  ARG B NH1   1 
ATOM   3111  N  NH2   . ARG B  1  176  ? 28.138  20.416  113.227 1.00 67.39  ? 176  ARG B NH2   1 
ATOM   3112  N  N     . VAL B  1  177  ? 31.371  19.561  119.641 1.00 59.53  ? 177  VAL B N     1 
ATOM   3113  C  CA    . VAL B  1  177  ? 32.755  19.886  119.301 1.00 63.11  ? 177  VAL B CA    1 
ATOM   3114  C  C     . VAL B  1  177  ? 33.220  19.140  118.058 1.00 60.05  ? 177  VAL B C     1 
ATOM   3115  O  O     . VAL B  1  177  ? 33.169  17.909  118.000 1.00 58.79  ? 177  VAL B O     1 
ATOM   3116  C  CB    . VAL B  1  177  ? 33.737  19.538  120.429 1.00 60.65  ? 177  VAL B CB    1 
ATOM   3117  C  CG1   . VAL B  1  177  ? 35.167  19.825  119.974 1.00 56.73  ? 177  VAL B CG1   1 
ATOM   3118  C  CG2   . VAL B  1  177  ? 33.408  20.311  121.681 1.00 58.47  ? 177  VAL B CG2   1 
ATOM   3119  N  N     . ALA B  1  178  ? 33.686  19.889  117.066 1.00 62.18  ? 178  ALA B N     1 
ATOM   3120  C  CA    . ALA B  1  178  ? 34.269  19.282  115.877 1.00 58.65  ? 178  ALA B CA    1 
ATOM   3121  C  C     . ALA B  1  178  ? 35.664  19.846  115.672 1.00 52.68  ? 178  ALA B C     1 
ATOM   3122  O  O     . ALA B  1  178  ? 35.862  21.046  115.788 1.00 51.92  ? 178  ALA B O     1 
ATOM   3123  C  CB    . ALA B  1  178  ? 33.402  19.562  114.661 1.00 60.24  ? 178  ALA B CB    1 
ATOM   3124  N  N     . PHE B  1  179  ? 36.640  18.995  115.382 1.00 51.07  ? 179  PHE B N     1 
ATOM   3125  C  CA    . PHE B  1  179  ? 37.972  19.512  115.074 1.00 58.16  ? 179  PHE B CA    1 
ATOM   3126  C  C     . PHE B  1  179  ? 38.604  18.885  113.826 1.00 56.65  ? 179  PHE B C     1 
ATOM   3127  O  O     . PHE B  1  179  ? 38.416  17.702  113.535 1.00 54.84  ? 179  PHE B O     1 
ATOM   3128  C  CB    . PHE B  1  179  ? 38.908  19.444  116.296 1.00 53.58  ? 179  PHE B CB    1 
ATOM   3129  C  CG    . PHE B  1  179  ? 39.652  18.143  116.438 1.00 55.14  ? 179  PHE B CG    1 
ATOM   3130  C  CD1   . PHE B  1  179  ? 40.943  18.005  115.936 1.00 51.72  ? 179  PHE B CD1   1 
ATOM   3131  C  CD2   . PHE B  1  179  ? 39.072  17.066  117.093 1.00 53.54  ? 179  PHE B CD2   1 
ATOM   3132  C  CE1   . PHE B  1  179  ? 41.633  16.813  116.071 1.00 48.61  ? 179  PHE B CE1   1 
ATOM   3133  C  CE2   . PHE B  1  179  ? 39.758  15.868  117.236 1.00 54.20  ? 179  PHE B CE2   1 
ATOM   3134  C  CZ    . PHE B  1  179  ? 41.040  15.742  116.723 1.00 52.35  ? 179  PHE B CZ    1 
ATOM   3135  N  N     . GLN B  1  180  ? 39.351  19.697  113.088 1.00 59.04  ? 180  GLN B N     1 
ATOM   3136  C  CA    . GLN B  1  180  ? 39.969  19.247  111.848 1.00 63.75  ? 180  GLN B CA    1 
ATOM   3137  C  C     . GLN B  1  180  ? 41.410  19.723  111.766 1.00 58.98  ? 180  GLN B C     1 
ATOM   3138  O  O     . GLN B  1  180  ? 41.701  20.898  111.971 1.00 61.36  ? 180  GLN B O     1 
ATOM   3139  C  CB    . GLN B  1  180  ? 39.180  19.749  110.635 1.00 60.89  ? 180  GLN B CB    1 
ATOM   3140  C  CG    . GLN B  1  180  ? 39.565  19.091  109.325 1.00 77.96  ? 180  GLN B CG    1 
ATOM   3141  C  CD    . GLN B  1  180  ? 38.733  19.592  108.155 1.00 96.09  ? 180  GLN B CD    1 
ATOM   3142  O  OE1   . GLN B  1  180  ? 37.959  20.544  108.288 1.00 93.88  ? 180  GLN B OE1   1 
ATOM   3143  N  NE2   . GLN B  1  180  ? 38.887  18.948  107.000 1.00 84.27  ? 180  GLN B NE2   1 
ATOM   3144  N  N     . VAL B  1  181  ? 42.312  18.795  111.481 1.00 60.31  ? 181  VAL B N     1 
ATOM   3145  C  CA    . VAL B  1  181  ? 43.710  19.131  111.285 1.00 58.38  ? 181  VAL B CA    1 
ATOM   3146  C  C     . VAL B  1  181  ? 44.002  19.058  109.797 1.00 64.44  ? 181  VAL B C     1 
ATOM   3147  O  O     . VAL B  1  181  ? 43.568  18.126  109.117 1.00 66.79  ? 181  VAL B O     1 
ATOM   3148  C  CB    . VAL B  1  181  ? 44.632  18.149  112.028 1.00 57.69  ? 181  VAL B CB    1 
ATOM   3149  C  CG1   . VAL B  1  181  ? 46.085  18.576  111.898 1.00 58.60  ? 181  VAL B CG1   1 
ATOM   3150  C  CG2   . VAL B  1  181  ? 44.237  18.060  113.484 1.00 58.62  ? 181  VAL B CG2   1 
ATOM   3151  N  N     . GLU B  1  182  ? 44.717  20.046  109.276 1.00 63.94  ? 182  GLU B N     1 
ATOM   3152  C  CA    . GLU B  1  182  ? 45.112  19.971  107.875 1.00 65.61  ? 182  GLU B CA    1 
ATOM   3153  C  C     . GLU B  1  182  ? 46.557  20.397  107.649 1.00 67.72  ? 182  GLU B C     1 
ATOM   3154  O  O     . GLU B  1  182  ? 47.113  21.170  108.425 1.00 65.60  ? 182  GLU B O     1 
ATOM   3155  C  CB    . GLU B  1  182  ? 44.139  20.746  106.981 1.00 65.83  ? 182  GLU B CB    1 
ATOM   3156  C  CG    . GLU B  1  182  ? 44.019  22.224  107.276 1.00 69.86  ? 182  GLU B CG    1 
ATOM   3157  C  CD    . GLU B  1  182  ? 42.764  22.819  106.662 1.00 84.90  ? 182  GLU B CD    1 
ATOM   3158  O  OE1   . GLU B  1  182  ? 41.735  22.101  106.611 1.00 74.20  ? 182  GLU B OE1   1 
ATOM   3159  O  OE2   . GLU B  1  182  ? 42.811  23.992  106.226 1.00 80.73  ? 182  GLU B OE2   1 
ATOM   3160  N  N     . ASP B  1  183  ? 47.171  19.866  106.596 1.00 72.67  ? 183  ASP B N     1 
ATOM   3161  C  CA    . ASP B  1  183  ? 48.567  20.174  106.317 1.00 72.18  ? 183  ASP B CA    1 
ATOM   3162  C  C     . ASP B  1  183  ? 48.737  21.642  105.967 1.00 67.30  ? 183  ASP B C     1 
ATOM   3163  O  O     . ASP B  1  183  ? 47.845  22.267  105.395 1.00 70.68  ? 183  ASP B O     1 
ATOM   3164  C  CB    . ASP B  1  183  ? 49.136  19.272  105.218 1.00 72.80  ? 183  ASP B CB    1 
ATOM   3165  C  CG    . ASP B  1  183  ? 49.662  17.945  105.760 1.00 93.66  ? 183  ASP B CG    1 
ATOM   3166  O  OD1   . ASP B  1  183  ? 49.574  16.930  105.035 1.00 103.59 ? 183  ASP B OD1   1 
ATOM   3167  O  OD2   . ASP B  1  183  ? 50.165  17.915  106.910 1.00 94.15  ? 183  ASP B OD2   1 
ATOM   3168  N  N     . THR B  1  184  ? 49.884  22.189  106.345 1.00 68.41  ? 184  THR B N     1 
ATOM   3169  C  CA    . THR B  1  184  ? 50.194  23.587  106.097 1.00 74.63  ? 184  THR B CA    1 
ATOM   3170  C  C     . THR B  1  184  ? 51.705  23.724  105.983 1.00 73.49  ? 184  THR B C     1 
ATOM   3171  O  O     . THR B  1  184  ? 52.459  22.840  106.427 1.00 72.34  ? 184  THR B O     1 
ATOM   3172  C  CB    . THR B  1  184  ? 49.643  24.509  107.215 1.00 68.12  ? 184  THR B CB    1 
ATOM   3173  O  OG1   . THR B  1  184  ? 49.577  25.859  106.746 1.00 77.63  ? 184  THR B OG1   1 
ATOM   3174  C  CG2   . THR B  1  184  ? 50.521  24.448  108.454 1.00 61.01  ? 184  THR B CG2   1 
ATOM   3175  N  N     . ARG B  1  185  ? 52.145  24.824  105.381 1.00 78.60  ? 185  ARG B N     1 
ATOM   3176  C  CA    . ARG B  1  185  ? 53.564  25.007  105.111 1.00 92.88  ? 185  ARG B CA    1 
ATOM   3177  C  C     . ARG B  1  185  ? 54.115  26.362  105.552 1.00 94.60  ? 185  ARG B C     1 
ATOM   3178  O  O     . ARG B  1  185  ? 53.497  27.404  105.332 1.00 93.47  ? 185  ARG B O     1 
ATOM   3179  C  CB    . ARG B  1  185  ? 53.871  24.760  103.626 1.00 103.64 ? 185  ARG B CB    1 
ATOM   3180  C  CG    . ARG B  1  185  ? 53.239  25.751  102.660 1.00 104.01 ? 185  ARG B CG    1 
ATOM   3181  C  CD    . ARG B  1  185  ? 53.687  25.479  101.229 1.00 108.59 ? 185  ARG B CD    1 
ATOM   3182  N  NE    . ARG B  1  185  ? 53.506  26.645  100.370 1.00 112.09 ? 185  ARG B NE    1 
ATOM   3183  C  CZ    . ARG B  1  185  ? 54.437  27.573  100.165 1.00 116.48 ? 185  ARG B CZ    1 
ATOM   3184  N  NH1   . ARG B  1  185  ? 55.623  27.468  100.759 1.00 109.12 ? 185  ARG B NH1   1 
ATOM   3185  N  NH2   . ARG B  1  185  ? 54.185  28.605  99.367  1.00 98.59  ? 185  ARG B NH2   1 
ATOM   3186  N  N     . LEU B  1  186  ? 55.274  26.324  106.202 1.00 94.26  ? 186  LEU B N     1 
ATOM   3187  C  CA    . LEU B  1  186  ? 56.047  27.524  106.479 1.00 103.37 ? 186  LEU B CA    1 
ATOM   3188  C  C     . LEU B  1  186  ? 57.360  27.393  105.724 1.00 110.00 ? 186  LEU B C     1 
ATOM   3189  O  O     . LEU B  1  186  ? 58.214  26.584  106.093 1.00 104.91 ? 186  LEU B O     1 
ATOM   3190  C  CB    . LEU B  1  186  ? 56.329  27.648  107.977 1.00 109.17 ? 186  LEU B CB    1 
ATOM   3191  C  CG    . LEU B  1  186  ? 56.551  29.022  108.628 1.00 112.49 ? 186  LEU B CG    1 
ATOM   3192  C  CD1   . LEU B  1  186  ? 57.299  28.864  109.952 1.00 99.88  ? 186  LEU B CD1   1 
ATOM   3193  C  CD2   . LEU B  1  186  ? 57.269  30.016  107.718 1.00 118.73 ? 186  LEU B CD2   1 
ATOM   3194  N  N     . GLY B  1  187  ? 57.527  28.198  104.680 1.00 114.83 ? 187  GLY B N     1 
ATOM   3195  C  CA    . GLY B  1  187  ? 58.729  28.133  103.874 1.00 116.30 ? 187  GLY B CA    1 
ATOM   3196  C  C     . GLY B  1  187  ? 58.893  26.778  103.215 1.00 119.00 ? 187  GLY B C     1 
ATOM   3197  O  O     . GLY B  1  187  ? 58.036  26.335  102.445 1.00 108.05 ? 187  GLY B O     1 
ATOM   3198  N  N     . GLN B  1  188  ? 60.014  26.129  103.516 1.00 126.72 ? 188  GLN B N     1 
ATOM   3199  C  CA    . GLN B  1  188  ? 60.348  24.826  102.947 1.00 134.20 ? 188  GLN B CA    1 
ATOM   3200  C  C     . GLN B  1  188  ? 59.593  23.655  103.585 1.00 134.13 ? 188  GLN B C     1 
ATOM   3201  O  O     . GLN B  1  188  ? 59.368  22.636  102.928 1.00 133.71 ? 188  GLN B O     1 
ATOM   3202  C  CB    . GLN B  1  188  ? 61.861  24.574  103.022 1.00 135.13 ? 188  GLN B CB    1 
ATOM   3203  C  CG    . GLN B  1  188  ? 62.432  24.555  104.437 1.00 140.16 ? 188  GLN B CG    1 
ATOM   3204  C  CD    . GLN B  1  188  ? 62.663  25.947  104.999 1.00 147.87 ? 188  GLN B CD    1 
ATOM   3205  O  OE1   . GLN B  1  188  ? 62.880  26.902  104.251 1.00 151.07 ? 188  GLN B OE1   1 
ATOM   3206  N  NE2   . GLN B  1  188  ? 62.611  26.071  106.323 1.00 133.53 ? 188  GLN B NE2   1 
ATOM   3207  N  N     . ARG B  1  189  ? 59.201  23.789  104.852 1.00 126.82 ? 189  ARG B N     1 
ATOM   3208  C  CA    . ARG B  1  189  ? 58.513  22.697  105.538 1.00 116.45 ? 189  ARG B CA    1 
ATOM   3209  C  C     . ARG B  1  189  ? 57.047  22.676  105.131 1.00 108.44 ? 189  ARG B C     1 
ATOM   3210  O  O     . ARG B  1  189  ? 56.315  23.622  105.413 1.00 100.76 ? 189  ARG B O     1 
ATOM   3211  C  CB    . ARG B  1  189  ? 58.577  22.896  107.052 1.00 108.43 ? 189  ARG B CB    1 
ATOM   3212  C  CG    . ARG B  1  189  ? 59.898  23.410  107.590 1.00 113.49 ? 189  ARG B CG    1 
ATOM   3213  C  CD    . ARG B  1  189  ? 59.651  24.284  108.811 1.00 109.50 ? 189  ARG B CD    1 
ATOM   3214  N  NE    . ARG B  1  189  ? 60.652  24.106  109.861 1.00 113.42 ? 189  ARG B NE    1 
ATOM   3215  C  CZ    . ARG B  1  189  ? 60.511  23.283  110.898 1.00 109.05 ? 189  ARG B CZ    1 
ATOM   3216  N  NH1   . ARG B  1  189  ? 61.470  23.191  111.809 1.00 101.26 ? 189  ARG B NH1   1 
ATOM   3217  N  NH2   . ARG B  1  189  ? 59.411  22.551  111.026 1.00 100.08 ? 189  ARG B NH2   1 
ATOM   3218  N  N     . THR B  1  190  ? 56.619  21.597  104.480 1.00 106.79 ? 190  THR B N     1 
ATOM   3219  C  CA    . THR B  1  190  ? 55.215  21.442  104.093 1.00 111.08 ? 190  THR B CA    1 
ATOM   3220  C  C     . THR B  1  190  ? 54.442  20.534  105.058 1.00 101.53 ? 190  THR B C     1 
ATOM   3221  O  O     . THR B  1  190  ? 53.234  20.328  104.909 1.00 96.33  ? 190  THR B O     1 
ATOM   3222  C  CB    . THR B  1  190  ? 55.073  20.912  102.641 1.00 107.33 ? 190  THR B CB    1 
ATOM   3223  O  OG1   . THR B  1  190  ? 56.122  21.452  101.827 1.00 114.69 ? 190  THR B OG1   1 
ATOM   3224  C  CG2   . THR B  1  190  ? 53.719  21.304  102.040 1.00 96.96  ? 190  THR B CG2   1 
ATOM   3225  N  N     . ASP B  1  191  ? 55.138  19.998  106.053 1.00 88.19  ? 191  ASP B N     1 
ATOM   3226  C  CA    . ASP B  1  191  ? 54.558  18.955  106.886 1.00 77.69  ? 191  ASP B CA    1 
ATOM   3227  C  C     . ASP B  1  191  ? 53.827  19.489  108.118 1.00 80.65  ? 191  ASP B C     1 
ATOM   3228  O  O     . ASP B  1  191  ? 53.366  18.713  108.955 1.00 75.27  ? 191  ASP B O     1 
ATOM   3229  C  CB    . ASP B  1  191  ? 55.628  17.943  107.298 1.00 77.48  ? 191  ASP B CB    1 
ATOM   3230  C  CG    . ASP B  1  191  ? 55.119  16.511  107.244 1.00 93.88  ? 191  ASP B CG    1 
ATOM   3231  O  OD1   . ASP B  1  191  ? 53.880  16.322  107.247 1.00 96.03  ? 191  ASP B OD1   1 
ATOM   3232  O  OD2   . ASP B  1  191  ? 55.953  15.575  107.201 1.00 84.62  ? 191  ASP B OD2   1 
ATOM   3233  N  N     . LEU B  1  192  ? 53.714  20.808  108.225 1.00 79.79  ? 192  LEU B N     1 
ATOM   3234  C  CA    . LEU B  1  192  ? 53.199  21.407  109.452 1.00 65.33  ? 192  LEU B CA    1 
ATOM   3235  C  C     . LEU B  1  192  ? 51.695  21.190  109.619 1.00 66.26  ? 192  LEU B C     1 
ATOM   3236  O  O     . LEU B  1  192  ? 51.000  20.860  108.659 1.00 69.30  ? 192  LEU B O     1 
ATOM   3237  C  CB    . LEU B  1  192  ? 53.565  22.891  109.521 1.00 64.19  ? 192  LEU B CB    1 
ATOM   3238  C  CG    . LEU B  1  192  ? 55.068  23.156  109.401 1.00 66.37  ? 192  LEU B CG    1 
ATOM   3239  C  CD1   . LEU B  1  192  ? 55.378  24.627  109.573 1.00 70.80  ? 192  LEU B CD1   1 
ATOM   3240  C  CD2   . LEU B  1  192  ? 55.846  22.322  110.402 1.00 67.29  ? 192  LEU B CD2   1 
ATOM   3241  N  N     . ASP B  1  193  ? 51.209  21.342  110.849 1.00 65.78  ? 193  ASP B N     1 
ATOM   3242  C  CA    . ASP B  1  193  ? 49.796  21.135  111.159 1.00 59.54  ? 193  ASP B CA    1 
ATOM   3243  C  C     . ASP B  1  193  ? 49.048  22.447  111.361 1.00 55.23  ? 193  ASP B C     1 
ATOM   3244  O  O     . ASP B  1  193  ? 49.592  23.415  111.883 1.00 55.77  ? 193  ASP B O     1 
ATOM   3245  C  CB    . ASP B  1  193  ? 49.640  20.263  112.406 1.00 57.65  ? 193  ASP B CB    1 
ATOM   3246  C  CG    . ASP B  1  193  ? 49.634  18.774  112.092 1.00 64.33  ? 193  ASP B CG    1 
ATOM   3247  O  OD1   . ASP B  1  193  ? 50.069  18.382  110.982 1.00 75.10  ? 193  ASP B OD1   1 
ATOM   3248  O  OD2   . ASP B  1  193  ? 49.193  17.991  112.963 1.00 63.17  ? 193  ASP B OD2   1 
ATOM   3249  N  N     . LYS B  1  194  ? 47.795  22.469  110.929 1.00 53.86  ? 194  LYS B N     1 
ATOM   3250  C  CA    . LYS B  1  194  ? 46.916  23.595  111.187 1.00 52.46  ? 194  LYS B CA    1 
ATOM   3251  C  C     . LYS B  1  194  ? 45.673  23.058  111.859 1.00 58.20  ? 194  LYS B C     1 
ATOM   3252  O  O     . LYS B  1  194  ? 44.963  22.212  111.291 1.00 58.77  ? 194  LYS B O     1 
ATOM   3253  C  CB    . LYS B  1  194  ? 46.535  24.310  109.896 1.00 54.02  ? 194  LYS B CB    1 
ATOM   3254  C  CG    . LYS B  1  194  ? 45.443  25.339  110.072 1.00 54.55  ? 194  LYS B CG    1 
ATOM   3255  C  CD    . LYS B  1  194  ? 45.020  25.927  108.743 1.00 63.13  ? 194  LYS B CD    1 
ATOM   3256  C  CE    . LYS B  1  194  ? 43.814  26.831  108.901 1.00 68.31  ? 194  LYS B CE    1 
ATOM   3257  N  NZ    . LYS B  1  194  ? 43.427  27.460  107.614 1.00 72.17  ? 194  LYS B NZ    1 
ATOM   3258  N  N     . LEU B  1  195  ? 45.419  23.551  113.069 1.00 57.31  ? 195  LEU B N     1 
ATOM   3259  C  CA    . LEU B  1  195  ? 44.326  23.047  113.893 1.00 57.66  ? 195  LEU B CA    1 
ATOM   3260  C  C     . LEU B  1  195  ? 43.098  23.953  113.842 1.00 55.44  ? 195  LEU B C     1 
ATOM   3261  O  O     . LEU B  1  195  ? 43.188  25.149  114.103 1.00 60.46  ? 195  LEU B O     1 
ATOM   3262  C  CB    . LEU B  1  195  ? 44.800  22.871  115.337 1.00 60.20  ? 195  LEU B CB    1 
ATOM   3263  C  CG    . LEU B  1  195  ? 43.764  22.466  116.384 1.00 53.60  ? 195  LEU B CG    1 
ATOM   3264  C  CD1   . LEU B  1  195  ? 43.032  21.204  115.973 1.00 54.52  ? 195  LEU B CD1   1 
ATOM   3265  C  CD2   . LEU B  1  195  ? 44.457  22.267  117.710 1.00 53.00  ? 195  LEU B CD2   1 
ATOM   3266  N  N     . THR B  1  196  ? 41.955  23.373  113.496 1.00 53.11  ? 196  THR B N     1 
ATOM   3267  C  CA    . THR B  1  196  ? 40.697  24.111  113.466 1.00 58.02  ? 196  THR B CA    1 
ATOM   3268  C  C     . THR B  1  196  ? 39.714  23.486  114.444 1.00 59.87  ? 196  THR B C     1 
ATOM   3269  O  O     . THR B  1  196  ? 39.377  22.307  114.335 1.00 56.47  ? 196  THR B O     1 
ATOM   3270  C  CB    . THR B  1  196  ? 40.076  24.137  112.055 1.00 61.96  ? 196  THR B CB    1 
ATOM   3271  O  OG1   . THR B  1  196  ? 40.816  25.037  111.220 1.00 65.72  ? 196  THR B OG1   1 
ATOM   3272  C  CG2   . THR B  1  196  ? 38.629  24.590  112.117 1.00 59.51  ? 196  THR B CG2   1 
ATOM   3273  N  N     . LEU B  1  197  ? 39.265  24.259  115.419 1.00 61.04  ? 197  LEU B N     1 
ATOM   3274  C  CA    . LEU B  1  197  ? 38.405  23.747  116.469 1.00 57.96  ? 197  LEU B CA    1 
ATOM   3275  C  C     . LEU B  1  197  ? 37.082  24.456  116.411 1.00 60.50  ? 197  LEU B C     1 
ATOM   3276  O  O     . LEU B  1  197  ? 37.047  25.658  116.334 1.00 65.06  ? 197  LEU B O     1 
ATOM   3277  C  CB    . LEU B  1  197  ? 39.057  24.013  117.809 1.00 54.62  ? 197  LEU B CB    1 
ATOM   3278  C  CG    . LEU B  1  197  ? 38.737  23.165  119.024 1.00 57.80  ? 197  LEU B CG    1 
ATOM   3279  C  CD1   . LEU B  1  197  ? 38.149  21.835  118.637 1.00 57.81  ? 197  LEU B CD1   1 
ATOM   3280  C  CD2   . LEU B  1  197  ? 39.996  22.958  119.828 1.00 50.33  ? 197  LEU B CD2   1 
ATOM   3281  N  N     . ARG B  1  198  ? 35.987  23.721  116.422 1.00 54.99  ? 198  ARG B N     1 
ATOM   3282  C  CA    . ARG B  1  198  ? 34.696  24.360  116.361 1.00 60.29  ? 198  ARG B CA    1 
ATOM   3283  C  C     . ARG B  1  198  ? 33.861  23.983  117.548 1.00 66.35  ? 198  ARG B C     1 
ATOM   3284  O  O     . ARG B  1  198  ? 33.628  22.822  117.769 1.00 68.51  ? 198  ARG B O     1 
ATOM   3285  C  CB    . ARG B  1  198  ? 33.974  23.920  115.108 1.00 64.28  ? 198  ARG B CB    1 
ATOM   3286  C  CG    . ARG B  1  198  ? 34.659  24.328  113.826 1.00 67.81  ? 198  ARG B CG    1 
ATOM   3287  C  CD    . ARG B  1  198  ? 34.331  23.363  112.711 1.00 67.01  ? 198  ARG B CD    1 
ATOM   3288  N  NE    . ARG B  1  198  ? 33.099  23.723  112.037 1.00 64.33  ? 198  ARG B NE    1 
ATOM   3289  C  CZ    . ARG B  1  198  ? 32.316  22.855  111.419 1.00 71.05  ? 198  ARG B CZ    1 
ATOM   3290  N  NH1   . ARG B  1  198  ? 31.211  23.269  110.834 1.00 70.87  ? 198  ARG B NH1   1 
ATOM   3291  N  NH2   . ARG B  1  198  ? 32.635  21.575  111.391 1.00 62.78  ? 198  ARG B NH2   1 
ATOM   3292  N  N     . ILE B  1  199  ? 33.370  24.968  118.284 1.00 70.10  ? 199  ILE B N     1 
ATOM   3293  C  CA    . ILE B  1  199  ? 32.615  24.711  119.502 1.00 66.02  ? 199  ILE B CA    1 
ATOM   3294  C  C     . ILE B  1  199  ? 31.217  25.307  119.521 1.00 66.42  ? 199  ILE B C     1 
ATOM   3295  O  O     . ILE B  1  199  ? 31.034  26.470  119.237 1.00 66.29  ? 199  ILE B O     1 
ATOM   3296  C  CB    . ILE B  1  199  ? 33.370  25.235  120.719 1.00 62.27  ? 199  ILE B CB    1 
ATOM   3297  C  CG1   . ILE B  1  199  ? 34.842  24.901  120.597 1.00 65.58  ? 199  ILE B CG1   1 
ATOM   3298  C  CG2   . ILE B  1  199  ? 32.842  24.605  121.982 1.00 63.12  ? 199  ILE B CG2   1 
ATOM   3299  C  CD1   . ILE B  1  199  ? 35.498  24.622  121.918 1.00 61.86  ? 199  ILE B CD1   1 
ATOM   3300  N  N     . TRP B  1  200  ? 30.241  24.489  119.880 1.00 64.86  ? 200  TRP B N     1 
ATOM   3301  C  CA    . TRP B  1  200  ? 28.850  24.902  120.029 1.00 65.61  ? 200  TRP B CA    1 
ATOM   3302  C  C     . TRP B  1  200  ? 28.410  24.746  121.484 1.00 70.45  ? 200  TRP B C     1 
ATOM   3303  O  O     . TRP B  1  200  ? 28.423  23.627  122.024 1.00 68.39  ? 200  TRP B O     1 
ATOM   3304  C  CB    . TRP B  1  200  ? 27.933  24.023  119.177 1.00 63.16  ? 200  TRP B CB    1 
ATOM   3305  C  CG    . TRP B  1  200  ? 28.012  24.210  117.687 1.00 68.34  ? 200  TRP B CG    1 
ATOM   3306  C  CD1   . TRP B  1  200  ? 27.200  24.990  116.917 1.00 67.24  ? 200  TRP B CD1   1 
ATOM   3307  C  CD2   . TRP B  1  200  ? 28.921  23.566  116.783 1.00 67.64  ? 200  TRP B CD2   1 
ATOM   3308  N  NE1   . TRP B  1  200  ? 27.556  24.887  115.595 1.00 65.98  ? 200  TRP B NE1   1 
ATOM   3309  C  CE2   . TRP B  1  200  ? 28.609  24.019  115.486 1.00 64.85  ? 200  TRP B CE2   1 
ATOM   3310  C  CE3   . TRP B  1  200  ? 29.975  22.661  116.947 1.00 67.97  ? 200  TRP B CE3   1 
ATOM   3311  C  CZ2   . TRP B  1  200  ? 29.311  23.596  114.360 1.00 61.28  ? 200  TRP B CZ2   1 
ATOM   3312  C  CZ3   . TRP B  1  200  ? 30.669  22.240  115.827 1.00 68.73  ? 200  TRP B CZ3   1 
ATOM   3313  C  CH2   . TRP B  1  200  ? 30.335  22.709  114.551 1.00 65.19  ? 200  TRP B CH2   1 
ATOM   3314  N  N     . THR B  1  201  ? 28.000  25.855  122.103 1.00 73.39  ? 201  THR B N     1 
ATOM   3315  C  CA    . THR B  1  201  ? 27.450  25.839  123.461 1.00 69.33  ? 201  THR B CA    1 
ATOM   3316  C  C     . THR B  1  201  ? 25.984  26.263  123.515 1.00 72.15  ? 201  THR B C     1 
ATOM   3317  O  O     . THR B  1  201  ? 25.391  26.615  122.494 1.00 73.32  ? 201  THR B O     1 
ATOM   3318  C  CB    . THR B  1  201  ? 28.239  26.754  124.421 1.00 71.45  ? 201  THR B CB    1 
ATOM   3319  O  OG1   . THR B  1  201  ? 28.363  28.063  123.850 1.00 78.06  ? 201  THR B OG1   1 
ATOM   3320  C  CG2   . THR B  1  201  ? 29.621  26.183  124.702 1.00 69.18  ? 201  THR B CG2   1 
ATOM   3321  N  N     . ASP B  1  202  ? 25.413  26.239  124.721 1.00 77.79  ? 202  ASP B N     1 
ATOM   3322  C  CA    . ASP B  1  202  ? 24.012  26.616  124.932 1.00 76.40  ? 202  ASP B CA    1 
ATOM   3323  C  C     . ASP B  1  202  ? 23.835  28.092  125.300 1.00 75.16  ? 202  ASP B C     1 
ATOM   3324  O  O     . ASP B  1  202  ? 22.720  28.546  125.558 1.00 78.89  ? 202  ASP B O     1 
ATOM   3325  C  CB    . ASP B  1  202  ? 23.326  25.702  125.964 1.00 67.77  ? 202  ASP B CB    1 
ATOM   3326  C  CG    . ASP B  1  202  ? 24.051  25.664  127.303 1.00 71.79  ? 202  ASP B CG    1 
ATOM   3327  O  OD1   . ASP B  1  202  ? 24.795  26.617  127.618 1.00 70.99  ? 202  ASP B OD1   1 
ATOM   3328  O  OD2   . ASP B  1  202  ? 23.867  24.674  128.049 1.00 67.39  ? 202  ASP B OD2   1 
ATOM   3329  N  N     . GLY B  1  203  ? 24.939  28.833  125.324 1.00 75.19  ? 203  GLY B N     1 
ATOM   3330  C  CA    . GLY B  1  203  ? 24.889  30.265  125.553 1.00 73.86  ? 203  GLY B CA    1 
ATOM   3331  C  C     . GLY B  1  203  ? 25.230  30.672  126.973 1.00 76.87  ? 203  GLY B C     1 
ATOM   3332  O  O     . GLY B  1  203  ? 25.613  31.821  127.218 1.00 73.06  ? 203  GLY B O     1 
ATOM   3333  N  N     . SER B  1  204  ? 25.088  29.736  127.909 1.00 78.20  ? 204  SER B N     1 
ATOM   3334  C  CA    . SER B  1  204  ? 25.425  29.991  129.307 1.00 75.02  ? 204  SER B CA    1 
ATOM   3335  C  C     . SER B  1  204  ? 26.933  30.187  129.449 1.00 74.14  ? 204  SER B C     1 
ATOM   3336  O  O     . SER B  1  204  ? 27.402  31.199  129.976 1.00 72.85  ? 204  SER B O     1 
ATOM   3337  C  CB    . SER B  1  204  ? 24.937  28.847  130.198 1.00 69.04  ? 204  SER B CB    1 
ATOM   3338  O  OG    . SER B  1  204  ? 25.545  27.621  129.842 1.00 68.64  ? 204  SER B OG    1 
ATOM   3339  N  N     . VAL B  1  205  ? 27.691  29.211  128.967 1.00 77.58  ? 205  VAL B N     1 
ATOM   3340  C  CA    . VAL B  1  205  ? 29.132  29.359  128.838 1.00 71.52  ? 205  VAL B CA    1 
ATOM   3341  C  C     . VAL B  1  205  ? 29.439  29.748  127.396 1.00 71.99  ? 205  VAL B C     1 
ATOM   3342  O  O     . VAL B  1  205  ? 28.862  29.197  126.458 1.00 71.82  ? 205  VAL B O     1 
ATOM   3343  C  CB    . VAL B  1  205  ? 29.870  28.055  129.197 1.00 63.75  ? 205  VAL B CB    1 
ATOM   3344  C  CG1   . VAL B  1  205  ? 31.362  28.260  129.137 1.00 68.48  ? 205  VAL B CG1   1 
ATOM   3345  C  CG2   . VAL B  1  205  ? 29.466  27.583  130.582 1.00 78.83  ? 205  VAL B CG2   1 
ATOM   3346  N  N     . THR B  1  206  ? 30.330  30.715  127.222 1.00 71.94  ? 206  THR B N     1 
ATOM   3347  C  CA    . THR B  1  206  ? 30.747  31.131  125.889 1.00 72.64  ? 206  THR B CA    1 
ATOM   3348  C  C     . THR B  1  206  ? 31.766  30.122  125.335 1.00 72.68  ? 206  THR B C     1 
ATOM   3349  O  O     . THR B  1  206  ? 32.497  29.498  126.106 1.00 70.24  ? 206  THR B O     1 
ATOM   3350  C  CB    . THR B  1  206  ? 31.289  32.588  125.915 1.00 74.37  ? 206  THR B CB    1 
ATOM   3351  O  OG1   . THR B  1  206  ? 30.496  33.411  125.049 1.00 74.25  ? 206  THR B OG1   1 
ATOM   3352  C  CG2   . THR B  1  206  ? 32.754  32.664  125.501 1.00 66.59  ? 206  THR B CG2   1 
ATOM   3353  N  N     . PRO B  1  207  ? 31.790  29.929  124.002 1.00 73.00  ? 207  PRO B N     1 
ATOM   3354  C  CA    . PRO B  1  207  ? 32.702  28.959  123.383 1.00 68.55  ? 207  PRO B CA    1 
ATOM   3355  C  C     . PRO B  1  207  ? 34.158  29.205  123.761 1.00 64.35  ? 207  PRO B C     1 
ATOM   3356  O  O     . PRO B  1  207  ? 34.872  28.262  124.112 1.00 64.29  ? 207  PRO B O     1 
ATOM   3357  C  CB    . PRO B  1  207  ? 32.499  29.202  121.888 1.00 68.45  ? 207  PRO B CB    1 
ATOM   3358  C  CG    . PRO B  1  207  ? 31.107  29.708  121.790 1.00 71.66  ? 207  PRO B CG    1 
ATOM   3359  C  CD    . PRO B  1  207  ? 30.930  30.578  122.998 1.00 74.44  ? 207  PRO B CD    1 
ATOM   3360  N  N     . LEU B  1  208  ? 34.588  30.460  123.704 1.00 59.89  ? 208  LEU B N     1 
ATOM   3361  C  CA    . LEU B  1  208  ? 35.935  30.806  124.136 1.00 61.18  ? 208  LEU B CA    1 
ATOM   3362  C  C     . LEU B  1  208  ? 36.134  30.473  125.620 1.00 67.25  ? 208  LEU B C     1 
ATOM   3363  O  O     . LEU B  1  208  ? 37.197  29.986  126.020 1.00 65.46  ? 208  LEU B O     1 
ATOM   3364  C  CB    . LEU B  1  208  ? 36.230  32.281  123.849 1.00 56.29  ? 208  LEU B CB    1 
ATOM   3365  C  CG    . LEU B  1  208  ? 37.582  32.848  124.291 1.00 65.63  ? 208  LEU B CG    1 
ATOM   3366  C  CD1   . LEU B  1  208  ? 38.732  31.925  123.915 1.00 66.45  ? 208  LEU B CD1   1 
ATOM   3367  C  CD2   . LEU B  1  208  ? 37.790  34.227  123.685 1.00 67.85  ? 208  LEU B CD2   1 
ATOM   3368  N  N     . GLU B  1  209  ? 35.104  30.721  126.426 1.00 68.32  ? 209  GLU B N     1 
ATOM   3369  C  CA    . GLU B  1  209  ? 35.143  30.377  127.843 1.00 70.12  ? 209  GLU B CA    1 
ATOM   3370  C  C     . GLU B  1  209  ? 35.343  28.875  128.012 1.00 64.97  ? 209  GLU B C     1 
ATOM   3371  O  O     . GLU B  1  209  ? 36.252  28.444  128.720 1.00 61.56  ? 209  GLU B O     1 
ATOM   3372  C  CB    . GLU B  1  209  ? 33.865  30.831  128.561 1.00 76.27  ? 209  GLU B CB    1 
ATOM   3373  C  CG    . GLU B  1  209  ? 33.784  32.329  128.860 1.00 82.67  ? 209  GLU B CG    1 
ATOM   3374  C  CD    . GLU B  1  209  ? 32.381  32.776  129.268 1.00 81.62  ? 209  GLU B CD    1 
ATOM   3375  O  OE1   . GLU B  1  209  ? 32.131  34.002  129.322 1.00 70.16  ? 209  GLU B OE1   1 
ATOM   3376  O  OE2   . GLU B  1  209  ? 31.524  31.901  129.528 1.00 80.87  ? 209  GLU B OE2   1 
ATOM   3377  N  N     . ALA B  1  210  ? 34.500  28.090  127.344 1.00 64.14  ? 210  ALA B N     1 
ATOM   3378  C  CA    . ALA B  1  210  ? 34.585  26.631  127.397 1.00 64.00  ? 210  ALA B CA    1 
ATOM   3379  C  C     . ALA B  1  210  ? 35.984  26.140  127.029 1.00 63.05  ? 210  ALA B C     1 
ATOM   3380  O  O     . ALA B  1  210  ? 36.564  25.301  127.727 1.00 59.62  ? 210  ALA B O     1 
ATOM   3381  C  CB    . ALA B  1  210  ? 33.536  26.002  126.487 1.00 53.55  ? 210  ALA B CB    1 
ATOM   3382  N  N     . LEU B  1  211  ? 36.521  26.680  125.937 1.00 59.75  ? 211  LEU B N     1 
ATOM   3383  C  CA    . LEU B  1  211  ? 37.870  26.341  125.497 1.00 61.02  ? 211  LEU B CA    1 
ATOM   3384  C  C     . LEU B  1  211  ? 38.913  26.632  126.577 1.00 62.45  ? 211  LEU B C     1 
ATOM   3385  O  O     . LEU B  1  211  ? 39.686  25.747  126.960 1.00 59.87  ? 211  LEU B O     1 
ATOM   3386  C  CB    . LEU B  1  211  ? 38.219  27.089  124.207 1.00 65.70  ? 211  LEU B CB    1 
ATOM   3387  C  CG    . LEU B  1  211  ? 39.647  26.908  123.683 1.00 58.71  ? 211  LEU B CG    1 
ATOM   3388  C  CD1   . LEU B  1  211  ? 39.948  25.439  123.438 1.00 49.55  ? 211  LEU B CD1   1 
ATOM   3389  C  CD2   . LEU B  1  211  ? 39.874  27.733  122.420 1.00 57.28  ? 211  LEU B CD2   1 
ATOM   3390  N  N     . ASN B  1  212  ? 38.926  27.869  127.069 1.00 64.39  ? 212  ASN B N     1 
ATOM   3391  C  CA    . ASN B  1  212  ? 39.864  28.267  128.120 1.00 64.83  ? 212  ASN B CA    1 
ATOM   3392  C  C     . ASN B  1  212  ? 39.785  27.389  129.377 1.00 60.67  ? 212  ASN B C     1 
ATOM   3393  O  O     . ASN B  1  212  ? 40.810  27.028  129.975 1.00 54.66  ? 212  ASN B O     1 
ATOM   3394  C  CB    . ASN B  1  212  ? 39.687  29.747  128.466 1.00 63.58  ? 212  ASN B CB    1 
ATOM   3395  C  CG    . ASN B  1  212  ? 40.168  30.658  127.356 1.00 63.86  ? 212  ASN B CG    1 
ATOM   3396  O  OD1   . ASN B  1  212  ? 41.085  30.310  126.613 1.00 67.33  ? 212  ASN B OD1   1 
ATOM   3397  N  ND2   . ASN B  1  212  ? 39.552  31.828  127.235 1.00 64.21  ? 212  ASN B ND2   1 
ATOM   3398  N  N     . GLN B  1  213  ? 38.562  27.034  129.759 1.00 57.61  ? 213  GLN B N     1 
ATOM   3399  C  CA    . GLN B  1  213  ? 38.348  26.137  130.882 1.00 64.14  ? 213  GLN B CA    1 
ATOM   3400  C  C     . GLN B  1  213  ? 38.952  24.771  130.592 1.00 62.88  ? 213  GLN B C     1 
ATOM   3401  O  O     . GLN B  1  213  ? 39.574  24.161  131.466 1.00 58.09  ? 213  GLN B O     1 
ATOM   3402  C  CB    . GLN B  1  213  ? 36.857  25.992  131.186 1.00 64.15  ? 213  GLN B CB    1 
ATOM   3403  C  CG    . GLN B  1  213  ? 36.207  27.240  131.755 1.00 60.74  ? 213  GLN B CG    1 
ATOM   3404  C  CD    . GLN B  1  213  ? 34.749  27.016  132.106 1.00 66.51  ? 213  GLN B CD    1 
ATOM   3405  O  OE1   . GLN B  1  213  ? 34.364  25.927  132.539 1.00 69.24  ? 213  GLN B OE1   1 
ATOM   3406  N  NE2   . GLN B  1  213  ? 33.927  28.042  131.912 1.00 71.10  ? 213  GLN B NE2   1 
ATOM   3407  N  N     . ALA B  1  214  ? 38.771  24.301  129.360 1.00 60.21  ? 214  ALA B N     1 
ATOM   3408  C  CA    . ALA B  1  214  ? 39.293  23.000  128.956 1.00 54.80  ? 214  ALA B CA    1 
ATOM   3409  C  C     . ALA B  1  214  ? 40.822  22.950  128.998 1.00 56.09  ? 214  ALA B C     1 
ATOM   3410  O  O     . ALA B  1  214  ? 41.406  22.019  129.580 1.00 52.47  ? 214  ALA B O     1 
ATOM   3411  C  CB    . ALA B  1  214  ? 38.782  22.635  127.584 1.00 56.91  ? 214  ALA B CB    1 
ATOM   3412  N  N     . VAL B  1  215  ? 41.471  23.945  128.390 1.00 54.22  ? 215  VAL B N     1 
ATOM   3413  C  CA    . VAL B  1  215  ? 42.932  24.006  128.450 1.00 55.99  ? 215  VAL B CA    1 
ATOM   3414  C  C     . VAL B  1  215  ? 43.410  24.098  129.894 1.00 58.39  ? 215  VAL B C     1 
ATOM   3415  O  O     . VAL B  1  215  ? 44.397  23.457  130.261 1.00 51.23  ? 215  VAL B O     1 
ATOM   3416  C  CB    . VAL B  1  215  ? 43.561  25.147  127.588 1.00 56.05  ? 215  VAL B CB    1 
ATOM   3417  C  CG1   . VAL B  1  215  ? 43.815  24.673  126.174 1.00 66.45  ? 215  VAL B CG1   1 
ATOM   3418  C  CG2   . VAL B  1  215  ? 42.696  26.371  127.572 1.00 56.37  ? 215  VAL B CG2   1 
ATOM   3419  N  N     . GLU B  1  216  ? 42.695  24.876  130.709 1.00 64.11  ? 216  GLU B N     1 
ATOM   3420  C  CA    . GLU B  1  216  ? 43.030  25.003  132.128 1.00 60.14  ? 216  GLU B CA    1 
ATOM   3421  C  C     . GLU B  1  216  ? 42.995  23.653  132.842 1.00 58.50  ? 216  GLU B C     1 
ATOM   3422  O  O     . GLU B  1  216  ? 43.956  23.273  133.524 1.00 59.78  ? 216  GLU B O     1 
ATOM   3423  C  CB    . GLU B  1  216  ? 42.092  25.989  132.819 1.00 62.41  ? 216  GLU B CB    1 
ATOM   3424  C  CG    . GLU B  1  216  ? 42.240  26.028  134.333 1.00 74.24  ? 216  GLU B CG    1 
ATOM   3425  C  CD    . GLU B  1  216  ? 43.647  26.383  134.791 1.00 81.90  ? 216  GLU B CD    1 
ATOM   3426  O  OE1   . GLU B  1  216  ? 44.052  25.898  135.870 1.00 81.05  ? 216  GLU B OE1   1 
ATOM   3427  O  OE2   . GLU B  1  216  ? 44.343  27.148  134.085 1.00 83.39  ? 216  GLU B OE2   1 
ATOM   3428  N  N     . ILE B  1  217  ? 41.884  22.937  132.671 1.00 54.15  ? 217  ILE B N     1 
ATOM   3429  C  CA    . ILE B  1  217  ? 41.735  21.581  133.192 1.00 54.95  ? 217  ILE B CA    1 
ATOM   3430  C  C     . ILE B  1  217  ? 42.910  20.706  132.782 1.00 60.70  ? 217  ILE B C     1 
ATOM   3431  O  O     . ILE B  1  217  ? 43.474  19.982  133.614 1.00 62.61  ? 217  ILE B O     1 
ATOM   3432  C  CB    . ILE B  1  217  ? 40.436  20.918  132.689 1.00 50.48  ? 217  ILE B CB    1 
ATOM   3433  C  CG1   . ILE B  1  217  ? 39.210  21.643  133.247 1.00 43.98  ? 217  ILE B CG1   1 
ATOM   3434  C  CG2   . ILE B  1  217  ? 40.409  19.433  133.054 1.00 44.65  ? 217  ILE B CG2   1 
ATOM   3435  C  CD1   . ILE B  1  217  ? 37.891  21.065  132.783 1.00 47.81  ? 217  ILE B CD1   1 
ATOM   3436  N  N     . LEU B  1  218  ? 43.289  20.790  131.504 1.00 61.63  ? 218  LEU B N     1 
ATOM   3437  C  CA    . LEU B  1  218  ? 44.389  19.972  130.996 1.00 57.49  ? 218  LEU B CA    1 
ATOM   3438  C  C     . LEU B  1  218  ? 45.742  20.316  131.636 1.00 59.65  ? 218  LEU B C     1 
ATOM   3439  O  O     . LEU B  1  218  ? 46.498  19.417  132.020 1.00 58.65  ? 218  LEU B O     1 
ATOM   3440  C  CB    . LEU B  1  218  ? 44.470  20.048  129.473 1.00 59.15  ? 218  LEU B CB    1 
ATOM   3441  C  CG    . LEU B  1  218  ? 45.447  19.057  128.833 1.00 60.64  ? 218  LEU B CG    1 
ATOM   3442  C  CD1   . LEU B  1  218  ? 45.092  17.623  129.214 1.00 53.38  ? 218  LEU B CD1   1 
ATOM   3443  C  CD2   . LEU B  1  218  ? 45.478  19.227  127.324 1.00 52.41  ? 218  LEU B CD2   1 
ATOM   3444  N  N     . ARG B  1  219  ? 46.037  21.609  131.755 1.00 57.89  ? 219  ARG B N     1 
ATOM   3445  C  CA    . ARG B  1  219  ? 47.279  22.065  132.382 1.00 59.71  ? 219  ARG B CA    1 
ATOM   3446  C  C     . ARG B  1  219  ? 47.362  21.558  133.815 1.00 65.97  ? 219  ARG B C     1 
ATOM   3447  O  O     . ARG B  1  219  ? 48.382  20.981  134.249 1.00 61.30  ? 219  ARG B O     1 
ATOM   3448  C  CB    . ARG B  1  219  ? 47.343  23.594  132.384 1.00 56.59  ? 219  ARG B CB    1 
ATOM   3449  C  CG    . ARG B  1  219  ? 48.649  24.160  132.924 1.00 61.42  ? 219  ARG B CG    1 
ATOM   3450  C  CD    . ARG B  1  219  ? 48.481  25.609  133.357 1.00 69.22  ? 219  ARG B CD    1 
ATOM   3451  N  NE    . ARG B  1  219  ? 47.359  25.745  134.279 1.00 76.59  ? 219  ARG B NE    1 
ATOM   3452  C  CZ    . ARG B  1  219  ? 47.420  25.463  135.578 1.00 72.81  ? 219  ARG B CZ    1 
ATOM   3453  N  NH1   . ARG B  1  219  ? 48.555  25.037  136.120 1.00 66.67  ? 219  ARG B NH1   1 
ATOM   3454  N  NH2   . ARG B  1  219  ? 46.343  25.604  136.337 1.00 70.47  ? 219  ARG B NH2   1 
ATOM   3455  N  N     . GLU B  1  220  ? 46.267  21.783  134.538 1.00 66.47  ? 220  GLU B N     1 
ATOM   3456  C  CA    . GLU B  1  220  ? 46.145  21.341  135.915 1.00 64.32  ? 220  GLU B CA    1 
ATOM   3457  C  C     . GLU B  1  220  ? 46.414  19.844  136.014 1.00 62.49  ? 220  GLU B C     1 
ATOM   3458  O  O     . GLU B  1  220  ? 47.178  19.402  136.872 1.00 62.33  ? 220  GLU B O     1 
ATOM   3459  C  CB    . GLU B  1  220  ? 44.757  21.680  136.456 1.00 74.06  ? 220  GLU B CB    1 
ATOM   3460  C  CG    . GLU B  1  220  ? 44.559  21.329  137.920 1.00 81.38  ? 220  GLU B CG    1 
ATOM   3461  C  CD    . GLU B  1  220  ? 43.212  21.778  138.443 1.00 99.36  ? 220  GLU B CD    1 
ATOM   3462  O  OE1   . GLU B  1  220  ? 42.470  22.439  137.681 1.00 93.00  ? 220  GLU B OE1   1 
ATOM   3463  O  OE2   . GLU B  1  220  ? 42.899  21.471  139.614 1.00 103.92 ? 220  GLU B OE2   1 
ATOM   3464  N  N     . HIS B  1  221  ? 45.802  19.068  135.125 1.00 58.22  ? 221  HIS B N     1 
ATOM   3465  C  CA    . HIS B  1  221  ? 46.067  17.632  135.080 1.00 61.92  ? 221  HIS B CA    1 
ATOM   3466  C  C     . HIS B  1  221  ? 47.533  17.307  134.774 1.00 66.49  ? 221  HIS B C     1 
ATOM   3467  O  O     . HIS B  1  221  ? 48.049  16.270  135.197 1.00 61.61  ? 221  HIS B O     1 
ATOM   3468  C  CB    . HIS B  1  221  ? 45.154  16.941  134.073 1.00 59.06  ? 221  HIS B CB    1 
ATOM   3469  C  CG    . HIS B  1  221  ? 43.896  16.403  134.675 1.00 64.13  ? 221  HIS B CG    1 
ATOM   3470  N  ND1   . HIS B  1  221  ? 42.767  17.173  134.852 1.00 64.16  ? 221  HIS B ND1   1 
ATOM   3471  C  CD2   . HIS B  1  221  ? 43.591  15.172  135.149 1.00 68.26  ? 221  HIS B CD2   1 
ATOM   3472  C  CE1   . HIS B  1  221  ? 41.820  16.439  135.408 1.00 64.45  ? 221  HIS B CE1   1 
ATOM   3473  N  NE2   . HIS B  1  221  ? 42.293  15.220  135.598 1.00 67.69  ? 221  HIS B NE2   1 
ATOM   3474  N  N     . LEU B  1  222  ? 48.202  18.191  134.039 1.00 64.64  ? 222  LEU B N     1 
ATOM   3475  C  CA    . LEU B  1  222  ? 49.619  18.005  133.758 1.00 61.37  ? 222  LEU B CA    1 
ATOM   3476  C  C     . LEU B  1  222  ? 50.459  18.199  135.016 1.00 62.25  ? 222  LEU B C     1 
ATOM   3477  O  O     . LEU B  1  222  ? 51.523  17.588  135.166 1.00 59.68  ? 222  LEU B O     1 
ATOM   3478  C  CB    . LEU B  1  222  ? 50.087  18.948  132.649 1.00 67.21  ? 222  LEU B CB    1 
ATOM   3479  C  CG    . LEU B  1  222  ? 49.565  18.625  131.249 1.00 62.09  ? 222  LEU B CG    1 
ATOM   3480  C  CD1   . LEU B  1  222  ? 50.200  19.541  130.217 1.00 56.01  ? 222  LEU B CD1   1 
ATOM   3481  C  CD2   . LEU B  1  222  ? 49.821  17.162  130.914 1.00 62.58  ? 222  LEU B CD2   1 
ATOM   3482  N  N     . THR B  1  223  ? 49.983  19.045  135.928 1.00 70.25  ? 223  THR B N     1 
ATOM   3483  C  CA    . THR B  1  223  ? 50.695  19.241  137.200 1.00 62.58  ? 223  THR B CA    1 
ATOM   3484  C  C     . THR B  1  223  ? 50.737  17.996  138.106 1.00 61.96  ? 223  THR B C     1 
ATOM   3485  O  O     . THR B  1  223  ? 51.557  17.922  139.014 1.00 66.54  ? 223  THR B O     1 
ATOM   3486  C  CB    . THR B  1  223  ? 50.102  20.397  138.014 1.00 54.01  ? 223  THR B CB    1 
ATOM   3487  O  OG1   . THR B  1  223  ? 48.770  20.057  138.411 1.00 64.15  ? 223  THR B OG1   1 
ATOM   3488  C  CG2   . THR B  1  223  ? 50.074  21.674  137.197 1.00 55.55  ? 223  THR B CG2   1 
ATOM   3489  N  N     . TYR B  1  224  ? 49.875  17.016  137.842 1.00 60.86  ? 224  TYR B N     1 
ATOM   3490  C  CA    . TYR B  1  224  ? 49.755  15.815  138.676 1.00 58.10  ? 224  TYR B CA    1 
ATOM   3491  C  C     . TYR B  1  224  ? 50.949  14.863  138.585 1.00 64.10  ? 224  TYR B C     1 
ATOM   3492  O  O     . TYR B  1  224  ? 50.979  13.821  139.237 1.00 67.81  ? 224  TYR B O     1 
ATOM   3493  C  CB    . TYR B  1  224  ? 48.471  15.054  138.343 1.00 62.61  ? 224  TYR B CB    1 
ATOM   3494  C  CG    . TYR B  1  224  ? 47.201  15.829  138.629 1.00 69.26  ? 224  TYR B CG    1 
ATOM   3495  C  CD1   . TYR B  1  224  ? 47.209  16.940  139.467 1.00 68.28  ? 224  TYR B CD1   1 
ATOM   3496  C  CD2   . TYR B  1  224  ? 45.994  15.453  138.057 1.00 72.19  ? 224  TYR B CD2   1 
ATOM   3497  C  CE1   . TYR B  1  224  ? 46.050  17.650  139.727 1.00 67.34  ? 224  TYR B CE1   1 
ATOM   3498  C  CE2   . TYR B  1  224  ? 44.830  16.153  138.316 1.00 73.54  ? 224  TYR B CE2   1 
ATOM   3499  C  CZ    . TYR B  1  224  ? 44.863  17.251  139.150 1.00 72.34  ? 224  TYR B CZ    1 
ATOM   3500  O  OH    . TYR B  1  224  ? 43.703  17.950  139.402 1.00 74.06  ? 224  TYR B OH    1 
ATOM   3501  N  N     . PHE B  1  225  ? 51.906  15.203  137.734 1.00 71.48  ? 225  PHE B N     1 
ATOM   3502  C  CA    . PHE B  1  225  ? 53.117  14.408  137.565 1.00 71.68  ? 225  PHE B CA    1 
ATOM   3503  C  C     . PHE B  1  225  ? 54.250  14.854  138.487 1.00 78.68  ? 225  PHE B C     1 
ATOM   3504  O  O     . PHE B  1  225  ? 55.401  14.461  138.304 1.00 79.79  ? 225  PHE B O     1 
ATOM   3505  C  CB    . PHE B  1  225  ? 53.526  14.341  136.095 1.00 68.86  ? 225  PHE B CB    1 
ATOM   3506  C  CG    . PHE B  1  225  ? 52.565  13.541  135.254 1.00 63.83  ? 225  PHE B CG    1 
ATOM   3507  C  CD1   . PHE B  1  225  ? 51.538  14.165  134.559 1.00 59.29  ? 225  PHE B CD1   1 
ATOM   3508  C  CD2   . PHE B  1  225  ? 52.663  12.159  135.192 1.00 60.47  ? 225  PHE B CD2   1 
ATOM   3509  C  CE1   . PHE B  1  225  ? 50.642  13.427  133.797 1.00 53.45  ? 225  PHE B CE1   1 
ATOM   3510  C  CE2   . PHE B  1  225  ? 51.768  11.417  134.434 1.00 55.63  ? 225  PHE B CE2   1 
ATOM   3511  C  CZ    . PHE B  1  225  ? 50.757  12.052  133.737 1.00 48.99  ? 225  PHE B CZ    1 
ATOM   3512  N  N     . SER B  1  226  ? 53.909  15.720  139.440 1.00 85.87  ? 226  SER B N     1 
ATOM   3513  C  CA    . SER B  1  226  ? 54.864  16.325  140.374 1.00 91.92  ? 226  SER B CA    1 
ATOM   3514  C  C     . SER B  1  226  ? 55.400  15.427  141.505 1.00 96.93  ? 226  SER B C     1 
ATOM   3515  O  O     . SER B  1  226  ? 56.603  15.168  141.579 1.00 98.17  ? 226  SER B O     1 
ATOM   3516  C  CB    . SER B  1  226  ? 54.269  17.601  140.980 1.00 93.57  ? 226  SER B CB    1 
ATOM   3517  O  OG    . SER B  1  226  ? 54.081  18.602  139.993 1.00 89.43  ? 226  SER B OG    1 
ATOM   3518  N  N     . ASN B  1  227  ? 54.525  14.981  142.402 1.00 91.40  ? 227  ASN B N     1 
ATOM   3519  C  CA    . ASN B  1  227  ? 54.987  14.338  143.636 1.00 99.91  ? 227  ASN B CA    1 
ATOM   3520  C  C     . ASN B  1  227  ? 54.766  12.829  143.746 1.00 98.53  ? 227  ASN B C     1 
ATOM   3521  O  O     . ASN B  1  227  ? 53.627  12.371  143.867 1.00 95.50  ? 227  ASN B O     1 
ATOM   3522  C  CB    . ASN B  1  227  ? 54.371  15.029  144.857 1.00 111.86 ? 227  ASN B CB    1 
ATOM   3523  C  CG    . ASN B  1  227  ? 55.373  15.881  145.613 1.00 119.79 ? 227  ASN B CG    1 
ATOM   3524  O  OD1   . ASN B  1  227  ? 56.436  16.223  145.092 1.00 112.23 ? 227  ASN B OD1   1 
ATOM   3525  N  ND2   . ASN B  1  227  ? 55.037  16.228  146.852 1.00 122.10 ? 227  ASN B ND2   1 
ATOM   3526  N  N     . PRO B  1  228  ? 55.863  12.052  143.714 1.00 94.66  ? 228  PRO B N     1 
ATOM   3527  C  CA    . PRO B  1  228  ? 55.822  10.610  143.989 1.00 87.62  ? 228  PRO B CA    1 
ATOM   3528  C  C     . PRO B  1  228  ? 55.793  10.314  145.488 1.00 87.20  ? 228  PRO B C     1 
ATOM   3529  O  O     . PRO B  1  228  ? 55.055  9.422   145.916 1.00 81.50  ? 228  PRO B O     1 
ATOM   3530  C  CB    . PRO B  1  228  ? 57.133  10.095  143.380 1.00 77.41  ? 228  PRO B CB    1 
ATOM   3531  C  CG    . PRO B  1  228  ? 57.607  11.202  142.466 1.00 81.80  ? 228  PRO B CG    1 
ATOM   3532  C  CD    . PRO B  1  228  ? 57.152  12.458  143.134 1.00 85.51  ? 228  PRO B CD    1 
ATOM   3533  N  N     . MET C  2  1    ? 66.609  -19.176 114.942 1.00 117.62 ? 1    MET C N     1 
ATOM   3534  C  CA    . MET C  2  1    ? 65.254  -19.412 115.423 1.00 107.77 ? 1    MET C CA    1 
ATOM   3535  C  C     . MET C  2  1    ? 64.739  -20.755 114.923 1.00 111.78 ? 1    MET C C     1 
ATOM   3536  O  O     . MET C  2  1    ? 65.266  -21.315 113.959 1.00 113.94 ? 1    MET C O     1 
ATOM   3537  C  CB    . MET C  2  1    ? 64.322  -18.297 114.952 1.00 104.17 ? 1    MET C CB    1 
ATOM   3538  C  CG    . MET C  2  1    ? 63.874  -18.443 113.508 1.00 98.49  ? 1    MET C CG    1 
ATOM   3539  S  SD    . MET C  2  1    ? 63.605  -16.851 112.718 1.00 114.73 ? 1    MET C SD    1 
ATOM   3540  C  CE    . MET C  2  1    ? 65.297  -16.286 112.512 1.00 91.90  ? 1    MET C CE    1 
ATOM   3541  N  N     . GLU C  2  2    ? 63.702  -21.264 115.578 1.00 101.17 ? 2    GLU C N     1 
ATOM   3542  C  CA    . GLU C  2  2    ? 63.108  -22.540 115.198 1.00 100.90 ? 2    GLU C CA    1 
ATOM   3543  C  C     . GLU C  2  2    ? 62.392  -22.436 113.845 1.00 89.55  ? 2    GLU C C     1 
ATOM   3544  O  O     . GLU C  2  2    ? 61.834  -21.392 113.507 1.00 81.14  ? 2    GLU C O     1 
ATOM   3545  C  CB    . GLU C  2  2    ? 62.145  -23.010 116.292 1.00 94.69  ? 2    GLU C CB    1 
ATOM   3546  C  CG    . GLU C  2  2    ? 61.611  -24.419 116.102 1.00 99.75  ? 2    GLU C CG    1 
ATOM   3547  C  CD    . GLU C  2  2    ? 61.710  -25.248 117.366 1.00 118.37 ? 2    GLU C CD    1 
ATOM   3548  O  OE1   . GLU C  2  2    ? 62.827  -25.707 117.690 1.00 124.69 ? 2    GLU C OE1   1 
ATOM   3549  O  OE2   . GLU C  2  2    ? 60.674  -25.436 118.039 1.00 121.82 ? 2    GLU C OE2   1 
ATOM   3550  N  N     . ILE C  2  3    ? 62.434  -23.511 113.063 1.00 81.08  ? 3    ILE C N     1 
ATOM   3551  C  CA    . ILE C  2  3    ? 61.692  -23.574 111.810 1.00 69.08  ? 3    ILE C CA    1 
ATOM   3552  C  C     . ILE C  2  3    ? 60.803  -24.806 111.817 1.00 69.23  ? 3    ILE C C     1 
ATOM   3553  O  O     . ILE C  2  3    ? 61.301  -25.928 111.782 1.00 73.78  ? 3    ILE C O     1 
ATOM   3554  C  CB    . ILE C  2  3    ? 62.629  -23.689 110.599 1.00 68.97  ? 3    ILE C CB    1 
ATOM   3555  C  CG1   . ILE C  2  3    ? 63.711  -22.603 110.633 1.00 81.16  ? 3    ILE C CG1   1 
ATOM   3556  C  CG2   . ILE C  2  3    ? 61.828  -23.633 109.311 1.00 60.27  ? 3    ILE C CG2   1 
ATOM   3557  C  CD1   . ILE C  2  3    ? 63.230  -21.225 110.229 1.00 77.99  ? 3    ILE C CD1   1 
ATOM   3558  N  N     . LYS C  2  4    ? 59.491  -24.598 111.844 1.00 63.93  ? 4    LYS C N     1 
ATOM   3559  C  CA    . LYS C  2  4    ? 58.543  -25.705 111.925 1.00 59.26  ? 4    LYS C CA    1 
ATOM   3560  C  C     . LYS C  2  4    ? 57.910  -26.000 110.566 1.00 59.96  ? 4    LYS C C     1 
ATOM   3561  O  O     . LYS C  2  4    ? 57.243  -25.143 109.992 1.00 66.16  ? 4    LYS C O     1 
ATOM   3562  C  CB    . LYS C  2  4    ? 57.458  -25.390 112.957 1.00 59.78  ? 4    LYS C CB    1 
ATOM   3563  C  CG    . LYS C  2  4    ? 56.515  -26.550 113.242 1.00 73.49  ? 4    LYS C CG    1 
ATOM   3564  C  CD    . LYS C  2  4    ? 55.566  -26.230 114.391 1.00 86.61  ? 4    LYS C CD    1 
ATOM   3565  C  CE    . LYS C  2  4    ? 54.760  -27.457 114.816 1.00 95.10  ? 4    LYS C CE    1 
ATOM   3566  N  NZ    . LYS C  2  4    ? 53.917  -28.004 113.711 1.00 90.31  ? 4    LYS C NZ    1 
ATOM   3567  N  N     . ARG C  2  5    ? 58.113  -27.208 110.048 1.00 52.65  ? 5    ARG C N     1 
ATOM   3568  C  CA    . ARG C  2  5    ? 57.562  -27.558 108.740 1.00 61.33  ? 5    ARG C CA    1 
ATOM   3569  C  C     . ARG C  2  5    ? 56.364  -28.503 108.825 1.00 62.73  ? 5    ARG C C     1 
ATOM   3570  O  O     . ARG C  2  5    ? 56.379  -29.480 109.569 1.00 59.68  ? 5    ARG C O     1 
ATOM   3571  C  CB    . ARG C  2  5    ? 58.641  -28.145 107.823 1.00 64.41  ? 5    ARG C CB    1 
ATOM   3572  C  CG    . ARG C  2  5    ? 59.295  -29.413 108.339 1.00 73.10  ? 5    ARG C CG    1 
ATOM   3573  C  CD    . ARG C  2  5    ? 60.329  -29.935 107.353 1.00 80.44  ? 5    ARG C CD    1 
ATOM   3574  N  NE    . ARG C  2  5    ? 59.783  -30.059 106.003 1.00 92.01  ? 5    ARG C NE    1 
ATOM   3575  C  CZ    . ARG C  2  5    ? 60.395  -29.613 104.909 1.00 93.18  ? 5    ARG C CZ    1 
ATOM   3576  N  NH1   . ARG C  2  5    ? 61.578  -29.014 105.008 1.00 71.97  ? 5    ARG C NH1   1 
ATOM   3577  N  NH2   . ARG C  2  5    ? 59.827  -29.766 103.716 1.00 79.07  ? 5    ARG C NH2   1 
ATOM   3578  N  N     . PHE C  2  6    ? 55.326  -28.207 108.051 1.00 58.42  ? 6    PHE C N     1 
ATOM   3579  C  CA    . PHE C  2  6    ? 54.130  -29.033 108.060 1.00 60.34  ? 6    PHE C CA    1 
ATOM   3580  C  C     . PHE C  2  6    ? 54.126  -30.031 106.902 1.00 69.23  ? 6    PHE C C     1 
ATOM   3581  O  O     . PHE C  2  6    ? 55.036  -30.060 106.075 1.00 74.59  ? 6    PHE C O     1 
ATOM   3582  C  CB    . PHE C  2  6    ? 52.870  -28.166 107.984 1.00 61.10  ? 6    PHE C CB    1 
ATOM   3583  C  CG    . PHE C  2  6    ? 52.758  -27.138 109.079 1.00 61.53  ? 6    PHE C CG    1 
ATOM   3584  C  CD1   . PHE C  2  6    ? 52.012  -27.397 110.218 1.00 66.45  ? 6    PHE C CD1   1 
ATOM   3585  C  CD2   . PHE C  2  6    ? 53.378  -25.903 108.957 1.00 54.97  ? 6    PHE C CD2   1 
ATOM   3586  C  CE1   . PHE C  2  6    ? 51.898  -26.452 111.221 1.00 63.55  ? 6    PHE C CE1   1 
ATOM   3587  C  CE2   . PHE C  2  6    ? 53.270  -24.952 109.951 1.00 56.15  ? 6    PHE C CE2   1 
ATOM   3588  C  CZ    . PHE C  2  6    ? 52.528  -25.227 111.087 1.00 68.48  ? 6    PHE C CZ    1 
ATOM   3589  N  N     . GLY C  2  7    ? 53.086  -30.854 106.873 1.00 78.56  ? 7    GLY C N     1 
ATOM   3590  C  CA    . GLY C  2  7    ? 52.791  -31.737 105.760 1.00 86.48  ? 7    GLY C CA    1 
ATOM   3591  C  C     . GLY C  2  7    ? 53.339  -33.146 105.874 1.00 91.11  ? 7    GLY C C     1 
ATOM   3592  O  O     . GLY C  2  7    ? 54.462  -33.359 106.336 1.00 89.85  ? 7    GLY C O     1 
ATOM   3593  N  N     . ARG C  2  8    ? 52.542  -34.108 105.417 1.00 92.23  ? 8    ARG C N     1 
ATOM   3594  C  CA    . ARG C  2  8    ? 52.906  -35.521 105.488 1.00 100.34 ? 8    ARG C CA    1 
ATOM   3595  C  C     . ARG C  2  8    ? 53.425  -36.143 104.189 1.00 101.45 ? 8    ARG C C     1 
ATOM   3596  O  O     . ARG C  2  8    ? 53.840  -37.301 104.183 1.00 109.17 ? 8    ARG C O     1 
ATOM   3597  C  CB    . ARG C  2  8    ? 51.737  -36.342 106.048 1.00 111.55 ? 8    ARG C CB    1 
ATOM   3598  C  CG    . ARG C  2  8    ? 50.401  -36.071 105.376 1.00 114.32 ? 8    ARG C CG    1 
ATOM   3599  C  CD    . ARG C  2  8    ? 49.235  -36.552 106.235 1.00 132.14 ? 8    ARG C CD    1 
ATOM   3600  N  NE    . ARG C  2  8    ? 48.460  -37.607 105.584 1.00 146.88 ? 8    ARG C NE    1 
ATOM   3601  C  CZ    . ARG C  2  8    ? 48.477  -38.887 105.947 1.00 146.51 ? 8    ARG C CZ    1 
ATOM   3602  N  NH1   . ARG C  2  8    ? 49.228  -39.282 106.967 1.00 148.67 ? 8    ARG C NH1   1 
ATOM   3603  N  NH2   . ARG C  2  8    ? 47.737  -39.773 105.292 1.00 122.17 ? 8    ARG C NH2   1 
ATOM   3604  N  N     . ILE C  2  9    ? 53.417  -35.384 103.096 1.00 104.84 ? 9    ILE C N     1 
ATOM   3605  C  CA    . ILE C  2  9    ? 53.817  -35.940 101.801 1.00 100.76 ? 9    ILE C CA    1 
ATOM   3606  C  C     . ILE C  2  9    ? 55.333  -36.091 101.689 1.00 94.29  ? 9    ILE C C     1 
ATOM   3607  O  O     . ILE C  2  9    ? 56.078  -35.123 101.837 1.00 87.84  ? 9    ILE C O     1 
ATOM   3608  C  CB    . ILE C  2  9    ? 53.278  -35.113 100.607 1.00 95.94  ? 9    ILE C CB    1 
ATOM   3609  C  CG1   . ILE C  2  9    ? 51.759  -35.274 100.483 1.00 97.02  ? 9    ILE C CG1   1 
ATOM   3610  C  CG2   . ILE C  2  9    ? 53.945  -35.548 99.316  1.00 87.37  ? 9    ILE C CG2   1 
ATOM   3611  C  CD1   . ILE C  2  9    ? 51.177  -34.735 99.180  1.00 76.56  ? 9    ILE C CD1   1 
ATOM   3612  N  N     . ARG C  2  10   ? 55.775  -37.318 101.431 1.00 94.75  ? 10   ARG C N     1 
ATOM   3613  C  CA    . ARG C  2  10   ? 57.194  -37.619 101.290 1.00 101.56 ? 10   ARG C CA    1 
ATOM   3614  C  C     . ARG C  2  10   ? 57.551  -37.674 99.808  1.00 99.29  ? 10   ARG C C     1 
ATOM   3615  O  O     . ARG C  2  10   ? 57.026  -38.511 99.072  1.00 99.96  ? 10   ARG C O     1 
ATOM   3616  C  CB    . ARG C  2  10   ? 57.516  -38.960 101.967 1.00 108.15 ? 10   ARG C CB    1 
ATOM   3617  C  CG    . ARG C  2  10   ? 58.994  -39.189 102.294 1.00 109.58 ? 10   ARG C CG    1 
ATOM   3618  C  CD    . ARG C  2  10   ? 59.676  -40.154 101.319 1.00 101.79 ? 10   ARG C CD    1 
ATOM   3619  N  NE    . ARG C  2  10   ? 59.077  -41.488 101.325 1.00 105.88 ? 10   ARG C NE    1 
ATOM   3620  C  CZ    . ARG C  2  10   ? 59.560  -42.530 100.653 1.00 100.47 ? 10   ARG C CZ    1 
ATOM   3621  N  NH1   . ARG C  2  10   ? 58.948  -43.707 100.710 1.00 97.83  ? 10   ARG C NH1   1 
ATOM   3622  N  NH2   . ARG C  2  10   ? 60.660  -42.398 99.924  1.00 92.51  ? 10   ARG C NH2   1 
ATOM   3623  N  N     . GLU C  2  11   ? 58.430  -36.779 99.363  1.00 96.73  ? 11   GLU C N     1 
ATOM   3624  C  CA    . GLU C  2  11   ? 58.834  -36.769 97.957  1.00 88.66  ? 11   GLU C CA    1 
ATOM   3625  C  C     . GLU C  2  11   ? 60.059  -37.642 97.731  1.00 76.38  ? 11   GLU C C     1 
ATOM   3626  O  O     . GLU C  2  11   ? 61.143  -37.357 98.237  1.00 69.97  ? 11   GLU C O     1 
ATOM   3627  C  CB    . GLU C  2  11   ? 59.082  -35.346 97.449  1.00 81.35  ? 11   GLU C CB    1 
ATOM   3628  C  CG    . GLU C  2  11   ? 59.419  -34.337 98.530  1.00 93.78  ? 11   GLU C CG    1 
ATOM   3629  C  CD    . GLU C  2  11   ? 58.371  -33.243 98.637  1.00 95.39  ? 11   GLU C CD    1 
ATOM   3630  O  OE1   . GLU C  2  11   ? 58.554  -32.323 99.463  1.00 110.27 ? 11   GLU C OE1   1 
ATOM   3631  O  OE2   . GLU C  2  11   ? 57.363  -33.307 97.895  1.00 78.88  ? 11   GLU C OE2   1 
ATOM   3632  N  N     . VAL C  2  12   ? 59.867  -38.702 96.954  1.00 73.45  ? 12   VAL C N     1 
ATOM   3633  C  CA    . VAL C  2  12   ? 60.902  -39.703 96.731  1.00 71.08  ? 12   VAL C CA    1 
ATOM   3634  C  C     . VAL C  2  12   ? 62.115  -39.163 95.989  1.00 68.09  ? 12   VAL C C     1 
ATOM   3635  O  O     . VAL C  2  12   ? 63.203  -39.731 96.078  1.00 71.12  ? 12   VAL C O     1 
ATOM   3636  C  CB    . VAL C  2  12   ? 60.344  -40.893 95.951  1.00 73.00  ? 12   VAL C CB    1 
ATOM   3637  C  CG1   . VAL C  2  12   ? 59.360  -41.649 96.808  1.00 81.00  ? 12   VAL C CG1   1 
ATOM   3638  C  CG2   . VAL C  2  12   ? 59.681  -40.411 94.681  1.00 75.56  ? 12   VAL C CG2   1 
ATOM   3639  N  N     . ILE C  2  13   ? 61.925  -38.074 95.250  1.00 69.02  ? 13   ILE C N     1 
ATOM   3640  C  CA    . ILE C  2  13   ? 63.010  -37.460 94.494  1.00 60.00  ? 13   ILE C CA    1 
ATOM   3641  C  C     . ILE C  2  13   ? 63.031  -35.947 94.698  1.00 56.13  ? 13   ILE C C     1 
ATOM   3642  O  O     . ILE C  2  13   ? 61.986  -35.329 94.870  1.00 58.83  ? 13   ILE C O     1 
ATOM   3643  C  CB    . ILE C  2  13   ? 62.883  -37.770 92.992  1.00 57.10  ? 13   ILE C CB    1 
ATOM   3644  C  CG1   . ILE C  2  13   ? 61.510  -37.342 92.475  1.00 59.12  ? 13   ILE C CG1   1 
ATOM   3645  C  CG2   . ILE C  2  13   ? 63.093  -39.252 92.734  1.00 57.92  ? 13   ILE C CG2   1 
ATOM   3646  C  CD1   . ILE C  2  13   ? 61.391  -37.401 90.970  1.00 57.36  ? 13   ILE C CD1   1 
ATOM   3647  N  N     . PRO C  2  14   ? 64.231  -35.348 94.704  1.00 52.60  ? 14   PRO C N     1 
ATOM   3648  C  CA    . PRO C  2  14   ? 64.373  -33.889 94.767  1.00 50.37  ? 14   PRO C CA    1 
ATOM   3649  C  C     . PRO C  2  14   ? 64.094  -33.235 93.417  1.00 56.25  ? 14   PRO C C     1 
ATOM   3650  O  O     . PRO C  2  14   ? 64.086  -33.915 92.384  1.00 56.74  ? 14   PRO C O     1 
ATOM   3651  C  CB    . PRO C  2  14   ? 65.845  -33.707 95.120  1.00 49.06  ? 14   PRO C CB    1 
ATOM   3652  C  CG    . PRO C  2  14   ? 66.510  -34.879 94.488  1.00 43.83  ? 14   PRO C CG    1 
ATOM   3653  C  CD    . PRO C  2  14   ? 65.538  -36.024 94.635  1.00 51.11  ? 14   PRO C CD    1 
ATOM   3654  N  N     . LEU C  2  15   ? 63.862  -31.926 93.435  1.00 56.82  ? 15   LEU C N     1 
ATOM   3655  C  CA    . LEU C  2  15   ? 63.747  -31.145 92.208  1.00 55.96  ? 15   LEU C CA    1 
ATOM   3656  C  C     . LEU C  2  15   ? 64.996  -31.339 91.354  1.00 55.15  ? 15   LEU C C     1 
ATOM   3657  O  O     . LEU C  2  15   ? 66.106  -31.405 91.882  1.00 54.05  ? 15   LEU C O     1 
ATOM   3658  C  CB    . LEU C  2  15   ? 63.590  -29.663 92.549  1.00 54.98  ? 15   LEU C CB    1 
ATOM   3659  C  CG    . LEU C  2  15   ? 62.259  -28.963 92.289  1.00 50.32  ? 15   LEU C CG    1 
ATOM   3660  C  CD1   . LEU C  2  15   ? 61.113  -29.844 92.677  1.00 52.44  ? 15   LEU C CD1   1 
ATOM   3661  C  CD2   . LEU C  2  15   ? 62.213  -27.677 93.085  1.00 52.95  ? 15   LEU C CD2   1 
ATOM   3662  N  N     . PRO C  2  16   ? 64.820  -31.429 90.027  1.00 56.03  ? 16   PRO C N     1 
ATOM   3663  C  CA    . PRO C  2  16   ? 65.921  -31.603 89.073  1.00 52.51  ? 16   PRO C CA    1 
ATOM   3664  C  C     . PRO C  2  16   ? 66.813  -30.375 89.073  1.00 53.74  ? 16   PRO C C     1 
ATOM   3665  O  O     . PRO C  2  16   ? 66.437  -29.363 89.663  1.00 53.10  ? 16   PRO C O     1 
ATOM   3666  C  CB    . PRO C  2  16   ? 65.202  -31.720 87.725  1.00 50.73  ? 16   PRO C CB    1 
ATOM   3667  C  CG    . PRO C  2  16   ? 63.801  -32.066 88.054  1.00 54.60  ? 16   PRO C CG    1 
ATOM   3668  C  CD    . PRO C  2  16   ? 63.516  -31.382 89.349  1.00 54.64  ? 16   PRO C CD    1 
ATOM   3669  N  N     . PRO C  2  17   ? 68.003  -30.468 88.461  1.00 60.08  ? 17   PRO C N     1 
ATOM   3670  C  CA    . PRO C  2  17   ? 68.742  -29.211 88.313  1.00 59.79  ? 17   PRO C CA    1 
ATOM   3671  C  C     . PRO C  2  17   ? 67.862  -28.254 87.522  1.00 57.66  ? 17   PRO C C     1 
ATOM   3672  O  O     . PRO C  2  17   ? 67.419  -28.592 86.419  1.00 53.11  ? 17   PRO C O     1 
ATOM   3673  C  CB    . PRO C  2  17   ? 69.956  -29.618 87.472  1.00 56.89  ? 17   PRO C CB    1 
ATOM   3674  C  CG    . PRO C  2  17   ? 70.083  -31.100 87.667  1.00 49.46  ? 17   PRO C CG    1 
ATOM   3675  C  CD    . PRO C  2  17   ? 68.694  -31.611 87.840  1.00 53.57  ? 17   PRO C CD    1 
ATOM   3676  N  N     . LEU C  2  18   ? 67.629  -27.067 88.073  1.00 54.71  ? 18   LEU C N     1 
ATOM   3677  C  CA    . LEU C  2  18   ? 66.563  -26.202 87.571  1.00 51.98  ? 18   LEU C CA    1 
ATOM   3678  C  C     . LEU C  2  18   ? 66.856  -25.529 86.225  1.00 52.93  ? 18   LEU C C     1 
ATOM   3679  O  O     . LEU C  2  18   ? 65.933  -25.291 85.442  1.00 52.02  ? 18   LEU C O     1 
ATOM   3680  C  CB    . LEU C  2  18   ? 66.139  -25.193 88.644  1.00 47.96  ? 18   LEU C CB    1 
ATOM   3681  C  CG    . LEU C  2  18   ? 65.396  -25.879 89.801  1.00 50.36  ? 18   LEU C CG    1 
ATOM   3682  C  CD1   . LEU C  2  18   ? 64.973  -24.901 90.887  1.00 41.58  ? 18   LEU C CD1   1 
ATOM   3683  C  CD2   . LEU C  2  18   ? 64.192  -26.656 89.280  1.00 47.16  ? 18   LEU C CD2   1 
ATOM   3684  N  N     . THR C  2  19   ? 68.132  -25.243 85.962  1.00 48.54  ? 19   THR C N     1 
ATOM   3685  C  CA    . THR C  2  19   ? 68.571  -24.675 84.685  1.00 46.73  ? 19   THR C CA    1 
ATOM   3686  C  C     . THR C  2  19   ? 69.038  -25.729 83.675  1.00 50.05  ? 19   THR C C     1 
ATOM   3687  O  O     . THR C  2  19   ? 69.609  -25.388 82.633  1.00 42.95  ? 19   THR C O     1 
ATOM   3688  C  CB    . THR C  2  19   ? 69.672  -23.614 84.857  1.00 48.03  ? 19   THR C CB    1 
ATOM   3689  O  OG1   . THR C  2  19   ? 70.730  -24.145 85.661  1.00 56.22  ? 19   THR C OG1   1 
ATOM   3690  C  CG2   . THR C  2  19   ? 69.113  -22.365 85.511  1.00 49.88  ? 19   THR C CG2   1 
ATOM   3691  N  N     . GLU C  2  20   ? 68.837  -27.003 84.004  1.00 52.40  ? 20   GLU C N     1 
ATOM   3692  C  CA    . GLU C  2  20   ? 69.292  -28.095 83.144  1.00 48.91  ? 20   GLU C CA    1 
ATOM   3693  C  C     . GLU C  2  20   ? 68.736  -28.038 81.725  1.00 48.88  ? 20   GLU C C     1 
ATOM   3694  O  O     . GLU C  2  20   ? 69.382  -28.519 80.794  1.00 55.83  ? 20   GLU C O     1 
ATOM   3695  C  CB    . GLU C  2  20   ? 68.982  -29.459 83.765  1.00 55.28  ? 20   GLU C CB    1 
ATOM   3696  C  CG    . GLU C  2  20   ? 67.607  -29.988 83.439  1.00 68.11  ? 20   GLU C CG    1 
ATOM   3697  C  CD    . GLU C  2  20   ? 67.403  -31.416 83.897  1.00 75.47  ? 20   GLU C CD    1 
ATOM   3698  O  OE1   . GLU C  2  20   ? 68.350  -32.227 83.770  1.00 72.93  ? 20   GLU C OE1   1 
ATOM   3699  O  OE2   . GLU C  2  20   ? 66.290  -31.721 84.382  1.00 72.50  ? 20   GLU C OE2   1 
ATOM   3700  N  N     . ILE C  2  21   ? 67.551  -27.453 81.557  1.00 50.05  ? 21   ILE C N     1 
ATOM   3701  C  CA    . ILE C  2  21   ? 66.952  -27.310 80.227  1.00 48.17  ? 21   ILE C CA    1 
ATOM   3702  C  C     . ILE C  2  21   ? 67.858  -26.495 79.292  1.00 44.91  ? 21   ILE C C     1 
ATOM   3703  O  O     . ILE C  2  21   ? 67.895  -26.722 78.082  1.00 44.52  ? 21   ILE C O     1 
ATOM   3704  C  CB    . ILE C  2  21   ? 65.524  -26.696 80.296  1.00 40.37  ? 21   ILE C CB    1 
ATOM   3705  C  CG1   . ILE C  2  21   ? 64.883  -26.657 78.905  1.00 36.96  ? 21   ILE C CG1   1 
ATOM   3706  C  CG2   . ILE C  2  21   ? 65.548  -25.315 80.937  1.00 36.58  ? 21   ILE C CG2   1 
ATOM   3707  C  CD1   . ILE C  2  21   ? 63.494  -26.061 78.875  1.00 33.68  ? 21   ILE C CD1   1 
ATOM   3708  N  N     . GLN C  2  22   ? 68.600  -25.561 79.877  1.00 43.16  ? 22   GLN C N     1 
ATOM   3709  C  CA    . GLN C  2  22   ? 69.566  -24.747 79.156  1.00 40.27  ? 22   GLN C CA    1 
ATOM   3710  C  C     . GLN C  2  22   ? 70.904  -25.479 79.046  1.00 40.68  ? 22   GLN C C     1 
ATOM   3711  O  O     . GLN C  2  22   ? 71.382  -25.802 77.948  1.00 39.88  ? 22   GLN C O     1 
ATOM   3712  C  CB    . GLN C  2  22   ? 69.754  -23.427 79.899  1.00 39.36  ? 22   GLN C CB    1 
ATOM   3713  C  CG    . GLN C  2  22   ? 68.566  -22.493 79.802  1.00 37.50  ? 22   GLN C CG    1 
ATOM   3714  C  CD    . GLN C  2  22   ? 68.532  -21.757 78.481  1.00 43.68  ? 22   GLN C CD    1 
ATOM   3715  O  OE1   . GLN C  2  22   ? 69.553  -21.251 78.011  1.00 44.20  ? 22   GLN C OE1   1 
ATOM   3716  N  NE2   . GLN C  2  22   ? 67.362  -21.699 77.867  1.00 43.08  ? 22   GLN C NE2   1 
ATOM   3717  N  N     . VAL C  2  23   ? 71.486  -25.734 80.213  1.00 46.36  ? 23   VAL C N     1 
ATOM   3718  C  CA    . VAL C  2  23   ? 72.798  -26.363 80.370  1.00 44.79  ? 23   VAL C CA    1 
ATOM   3719  C  C     . VAL C  2  23   ? 73.019  -27.683 79.605  1.00 44.20  ? 23   VAL C C     1 
ATOM   3720  O  O     . VAL C  2  23   ? 73.990  -27.817 78.855  1.00 41.70  ? 23   VAL C O     1 
ATOM   3721  C  CB    . VAL C  2  23   ? 73.095  -26.573 81.867  1.00 34.00  ? 23   VAL C CB    1 
ATOM   3722  C  CG1   . VAL C  2  23   ? 74.279  -27.490 82.056  1.00 42.65  ? 23   VAL C CG1   1 
ATOM   3723  C  CG2   . VAL C  2  23   ? 73.335  -25.237 82.537  1.00 35.09  ? 23   VAL C CG2   1 
ATOM   3724  N  N     . GLU C  2  24   ? 72.128  -28.652 79.794  1.00 45.35  ? 24   GLU C N     1 
ATOM   3725  C  CA    . GLU C  2  24   ? 72.282  -29.943 79.133  1.00 47.39  ? 24   GLU C CA    1 
ATOM   3726  C  C     . GLU C  2  24   ? 72.103  -29.841 77.632  1.00 46.16  ? 24   GLU C C     1 
ATOM   3727  O  O     . GLU C  2  24   ? 72.775  -30.539 76.862  1.00 47.31  ? 24   GLU C O     1 
ATOM   3728  C  CB    . GLU C  2  24   ? 71.320  -30.979 79.713  1.00 53.18  ? 24   GLU C CB    1 
ATOM   3729  C  CG    . GLU C  2  24   ? 71.840  -31.599 81.002  1.00 68.45  ? 24   GLU C CG    1 
ATOM   3730  C  CD    . GLU C  2  24   ? 73.304  -32.014 80.886  1.00 71.02  ? 24   GLU C CD    1 
ATOM   3731  O  OE1   . GLU C  2  24   ? 74.130  -31.518 81.688  1.00 65.13  ? 24   GLU C OE1   1 
ATOM   3732  O  OE2   . GLU C  2  24   ? 73.627  -32.828 79.986  1.00 63.63  ? 24   GLU C OE2   1 
ATOM   3733  N  N     . SER C  2  25   ? 71.195  -28.961 77.229  1.00 47.10  ? 25   SER C N     1 
ATOM   3734  C  CA    . SER C  2  25   ? 70.912  -28.721 75.821  1.00 40.12  ? 25   SER C CA    1 
ATOM   3735  C  C     . SER C  2  25   ? 72.151  -28.212 75.108  1.00 42.02  ? 25   SER C C     1 
ATOM   3736  O  O     . SER C  2  25   ? 72.539  -28.735 74.054  1.00 43.51  ? 25   SER C O     1 
ATOM   3737  C  CB    . SER C  2  25   ? 69.775  -27.709 75.675  1.00 38.69  ? 25   SER C CB    1 
ATOM   3738  O  OG    . SER C  2  25   ? 69.713  -27.201 74.355  1.00 44.10  ? 25   SER C OG    1 
ATOM   3739  N  N     . TYR C  2  26   ? 72.780  -27.192 75.686  1.00 40.94  ? 26   TYR C N     1 
ATOM   3740  C  CA    . TYR C  2  26   ? 73.944  -26.613 75.040  1.00 36.60  ? 26   TYR C CA    1 
ATOM   3741  C  C     . TYR C  2  26   ? 75.139  -27.568 75.105  1.00 43.47  ? 26   TYR C C     1 
ATOM   3742  O  O     . TYR C  2  26   ? 75.921  -27.670 74.141  1.00 43.34  ? 26   TYR C O     1 
ATOM   3743  C  CB    . TYR C  2  26   ? 74.286  -25.251 75.636  1.00 33.97  ? 26   TYR C CB    1 
ATOM   3744  C  CG    . TYR C  2  26   ? 74.898  -24.315 74.622  1.00 38.80  ? 26   TYR C CG    1 
ATOM   3745  C  CD1   . TYR C  2  26   ? 74.194  -23.951 73.479  1.00 37.56  ? 26   TYR C CD1   1 
ATOM   3746  C  CD2   . TYR C  2  26   ? 76.179  -23.800 74.797  1.00 36.30  ? 26   TYR C CD2   1 
ATOM   3747  C  CE1   . TYR C  2  26   ? 74.743  -23.100 72.538  1.00 38.18  ? 26   TYR C CE1   1 
ATOM   3748  C  CE2   . TYR C  2  26   ? 76.737  -22.945 73.863  1.00 36.22  ? 26   TYR C CE2   1 
ATOM   3749  C  CZ    . TYR C  2  26   ? 76.012  -22.602 72.734  1.00 39.61  ? 26   TYR C CZ    1 
ATOM   3750  O  OH    . TYR C  2  26   ? 76.550  -21.754 71.798  1.00 38.43  ? 26   TYR C OH    1 
ATOM   3751  N  N     . ARG C  2  27   ? 75.267  -28.276 76.229  1.00 37.77  ? 27   ARG C N     1 
ATOM   3752  C  CA    . ARG C  2  27   ? 76.340  -29.251 76.380  1.00 41.37  ? 27   ARG C CA    1 
ATOM   3753  C  C     . ARG C  2  27   ? 76.258  -30.275 75.255  1.00 46.92  ? 27   ARG C C     1 
ATOM   3754  O  O     . ARG C  2  27   ? 77.262  -30.580 74.605  1.00 49.87  ? 27   ARG C O     1 
ATOM   3755  C  CB    . ARG C  2  27   ? 76.272  -29.951 77.739  1.00 43.17  ? 27   ARG C CB    1 
ATOM   3756  C  CG    . ARG C  2  27   ? 77.597  -30.570 78.191  1.00 44.60  ? 27   ARG C CG    1 
ATOM   3757  C  CD    . ARG C  2  27   ? 77.420  -31.525 79.368  1.00 59.59  ? 27   ARG C CD    1 
ATOM   3758  N  NE    . ARG C  2  27   ? 76.304  -32.446 79.152  1.00 74.64  ? 27   ARG C NE    1 
ATOM   3759  C  CZ    . ARG C  2  27   ? 76.320  -33.475 78.305  1.00 78.08  ? 27   ARG C CZ    1 
ATOM   3760  N  NH1   . ARG C  2  27   ? 77.400  -33.732 77.576  1.00 78.50  ? 27   ARG C NH1   1 
ATOM   3761  N  NH2   . ARG C  2  27   ? 75.246  -34.246 78.180  1.00 79.65  ? 27   ARG C NH2   1 
ATOM   3762  N  N     . ARG C  2  28   ? 75.052  -30.782 75.021  1.00 45.24  ? 28   ARG C N     1 
ATOM   3763  C  CA    . ARG C  2  28   ? 74.822  -31.754 73.961  1.00 46.19  ? 28   ARG C CA    1 
ATOM   3764  C  C     . ARG C  2  28   ? 75.078  -31.151 72.581  1.00 49.92  ? 28   ARG C C     1 
ATOM   3765  O  O     . ARG C  2  28   ? 75.573  -31.831 71.678  1.00 48.67  ? 28   ARG C O     1 
ATOM   3766  C  CB    . ARG C  2  28   ? 73.400  -32.320 74.050  1.00 51.49  ? 28   ARG C CB    1 
ATOM   3767  C  CG    . ARG C  2  28   ? 73.034  -33.295 72.933  1.00 60.66  ? 28   ARG C CG    1 
ATOM   3768  C  CD    . ARG C  2  28   ? 72.299  -34.508 73.489  1.00 82.71  ? 28   ARG C CD    1 
ATOM   3769  N  NE    . ARG C  2  28   ? 73.053  -35.144 74.570  1.00 100.77 ? 28   ARG C NE    1 
ATOM   3770  C  CZ    . ARG C  2  28   ? 73.904  -36.155 74.403  1.00 99.95  ? 28   ARG C CZ    1 
ATOM   3771  N  NH1   . ARG C  2  28   ? 74.112  -36.662 73.190  1.00 83.86  ? 28   ARG C NH1   1 
ATOM   3772  N  NH2   . ARG C  2  28   ? 74.545  -36.662 75.453  1.00 85.94  ? 28   ARG C NH2   1 
ATOM   3773  N  N     . ALA C  2  29   ? 74.751  -29.873 72.419  1.00 47.44  ? 29   ALA C N     1 
ATOM   3774  C  CA    . ALA C  2  29   ? 74.957  -29.214 71.132  1.00 43.39  ? 29   ALA C CA    1 
ATOM   3775  C  C     . ALA C  2  29   ? 76.438  -29.058 70.756  1.00 47.45  ? 29   ALA C C     1 
ATOM   3776  O  O     . ALA C  2  29   ? 76.816  -29.312 69.613  1.00 43.32  ? 29   ALA C O     1 
ATOM   3777  C  CB    . ALA C  2  29   ? 74.255  -27.869 71.103  1.00 37.02  ? 29   ALA C CB    1 
ATOM   3778  N  N     . LEU C  2  30   ? 77.267  -28.630 71.708  1.00 45.91  ? 30   LEU C N     1 
ATOM   3779  C  CA    . LEU C  2  30   ? 78.688  -28.414 71.428  1.00 43.72  ? 30   LEU C CA    1 
ATOM   3780  C  C     . LEU C  2  30   ? 79.552  -29.677 71.452  1.00 48.38  ? 30   LEU C C     1 
ATOM   3781  O  O     . LEU C  2  30   ? 80.522  -29.768 70.697  1.00 48.11  ? 30   LEU C O     1 
ATOM   3782  C  CB    . LEU C  2  30   ? 79.294  -27.379 72.373  1.00 40.96  ? 30   LEU C CB    1 
ATOM   3783  C  CG    . LEU C  2  30   ? 78.700  -25.977 72.340  1.00 39.76  ? 30   LEU C CG    1 
ATOM   3784  C  CD1   . LEU C  2  30   ? 79.553  -25.029 73.167  1.00 40.14  ? 30   LEU C CD1   1 
ATOM   3785  C  CD2   . LEU C  2  30   ? 78.556  -25.494 70.916  1.00 35.90  ? 30   LEU C CD2   1 
ATOM   3786  N  N     . GLN C  2  31   ? 79.219  -30.624 72.333  1.00 49.98  ? 31   GLN C N     1 
ATOM   3787  C  CA    . GLN C  2  31   ? 80.011  -31.847 72.517  1.00 48.65  ? 31   GLN C CA    1 
ATOM   3788  C  C     . GLN C  2  31   ? 81.494  -31.529 72.679  1.00 50.80  ? 31   GLN C C     1 
ATOM   3789  O  O     . GLN C  2  31   ? 82.351  -32.222 72.123  1.00 49.62  ? 31   GLN C O     1 
ATOM   3790  C  CB    . GLN C  2  31   ? 79.820  -32.803 71.337  1.00 45.76  ? 31   GLN C CB    1 
ATOM   3791  C  CG    . GLN C  2  31   ? 78.827  -33.914 71.580  1.00 45.00  ? 31   GLN C CG    1 
ATOM   3792  C  CD    . GLN C  2  31   ? 78.635  -34.782 70.353  1.00 47.90  ? 31   GLN C CD    1 
ATOM   3793  O  OE1   . GLN C  2  31   ? 78.621  -36.010 70.443  1.00 50.86  ? 31   GLN C OE1   1 
ATOM   3794  N  NE2   . GLN C  2  31   ? 78.485  -34.148 69.198  1.00 44.16  ? 31   GLN C NE2   1 
ATOM   3795  N  N     . ALA C  2  32   ? 81.784  -30.469 73.431  1.00 51.55  ? 32   ALA C N     1 
ATOM   3796  C  CA    . ALA C  2  32   ? 83.144  -29.961 73.554  1.00 50.27  ? 32   ALA C CA    1 
ATOM   3797  C  C     . ALA C  2  32   ? 84.028  -30.885 74.376  1.00 58.72  ? 32   ALA C C     1 
ATOM   3798  O  O     . ALA C  2  32   ? 85.211  -31.054 74.068  1.00 65.82  ? 32   ALA C O     1 
ATOM   3799  C  CB    . ALA C  2  32   ? 83.142  -28.559 74.143  1.00 40.22  ? 32   ALA C CB    1 
ATOM   3800  N  N     . ASP C  2  33   ? 83.448  -31.489 75.410  1.00 57.31  ? 33   ASP C N     1 
ATOM   3801  C  CA    . ASP C  2  33   ? 84.205  -32.352 76.319  1.00 69.11  ? 33   ASP C CA    1 
ATOM   3802  C  C     . ASP C  2  33   ? 84.314  -33.804 75.839  1.00 63.93  ? 33   ASP C C     1 
ATOM   3803  O  O     . ASP C  2  33   ? 84.938  -34.642 76.490  1.00 71.39  ? 33   ASP C O     1 
ATOM   3804  C  CB    . ASP C  2  33   ? 83.636  -32.278 77.743  1.00 78.53  ? 33   ASP C CB    1 
ATOM   3805  C  CG    . ASP C  2  33   ? 84.104  -31.037 78.496  1.00 91.21  ? 33   ASP C CG    1 
ATOM   3806  O  OD1   . ASP C  2  33   ? 84.440  -30.026 77.836  1.00 80.20  ? 33   ASP C OD1   1 
ATOM   3807  O  OD2   . ASP C  2  33   ? 84.139  -31.076 79.747  1.00 97.01  ? 33   ASP C OD2   1 
ATOM   3808  N  N     . VAL C  2  34   ? 83.710  -34.091 74.695  1.00 60.29  ? 34   VAL C N     1 
ATOM   3809  C  CA    . VAL C  2  34   ? 83.865  -35.388 74.051  1.00 60.46  ? 34   VAL C CA    1 
ATOM   3810  C  C     . VAL C  2  34   ? 85.025  -35.318 73.063  1.00 54.94  ? 34   VAL C C     1 
ATOM   3811  O  O     . VAL C  2  34   ? 85.108  -34.373 72.283  1.00 54.13  ? 34   VAL C O     1 
ATOM   3812  C  CB    . VAL C  2  34   ? 82.583  -35.781 73.294  1.00 54.07  ? 34   VAL C CB    1 
ATOM   3813  C  CG1   . VAL C  2  34   ? 82.770  -37.096 72.534  1.00 51.52  ? 34   VAL C CG1   1 
ATOM   3814  C  CG2   . VAL C  2  34   ? 81.419  -35.865 74.259  1.00 50.62  ? 34   VAL C CG2   1 
ATOM   3815  N  N     . PRO C  2  35   ? 85.942  -36.301 73.116  1.00 58.99  ? 35   PRO C N     1 
ATOM   3816  C  CA    . PRO C  2  35   ? 87.007  -36.400 72.109  1.00 57.93  ? 35   PRO C CA    1 
ATOM   3817  C  C     . PRO C  2  35   ? 86.425  -36.698 70.729  1.00 56.78  ? 35   PRO C C     1 
ATOM   3818  O  O     . PRO C  2  35   ? 85.587  -37.586 70.605  1.00 62.68  ? 35   PRO C O     1 
ATOM   3819  C  CB    . PRO C  2  35   ? 87.858  -37.574 72.608  1.00 56.42  ? 35   PRO C CB    1 
ATOM   3820  C  CG    . PRO C  2  35   ? 86.983  -38.318 73.560  1.00 60.14  ? 35   PRO C CG    1 
ATOM   3821  C  CD    . PRO C  2  35   ? 86.114  -37.288 74.194  1.00 64.57  ? 35   PRO C CD    1 
ATOM   3822  N  N     . PRO C  2  36   ? 86.882  -35.972 69.700  1.00 50.84  ? 36   PRO C N     1 
ATOM   3823  C  CA    . PRO C  2  36   ? 86.294  -35.925 68.356  1.00 53.15  ? 36   PRO C CA    1 
ATOM   3824  C  C     . PRO C  2  36   ? 85.895  -37.271 67.762  1.00 59.77  ? 36   PRO C C     1 
ATOM   3825  O  O     . PRO C  2  36   ? 84.837  -37.366 67.146  1.00 63.50  ? 36   PRO C O     1 
ATOM   3826  C  CB    . PRO C  2  36   ? 87.422  -35.316 67.524  1.00 51.00  ? 36   PRO C CB    1 
ATOM   3827  C  CG    . PRO C  2  36   ? 88.076  -34.370 68.472  1.00 56.27  ? 36   PRO C CG    1 
ATOM   3828  C  CD    . PRO C  2  36   ? 87.950  -34.969 69.858  1.00 54.29  ? 36   PRO C CD    1 
ATOM   3829  N  N     . GLU C  2  37   ? 86.715  -38.296 67.940  1.00 66.26  ? 37   GLU C N     1 
ATOM   3830  C  CA    . GLU C  2  37   ? 86.410  -39.601 67.367  1.00 70.06  ? 37   GLU C CA    1 
ATOM   3831  C  C     . GLU C  2  37   ? 85.184  -40.252 68.025  1.00 70.41  ? 37   GLU C C     1 
ATOM   3832  O  O     . GLU C  2  37   ? 84.510  -41.086 67.417  1.00 74.09  ? 37   GLU C O     1 
ATOM   3833  C  CB    . GLU C  2  37   ? 87.630  -40.523 67.453  1.00 68.76  ? 37   GLU C CB    1 
ATOM   3834  C  CG    . GLU C  2  37   ? 88.155  -40.760 68.868  1.00 71.18  ? 37   GLU C CG    1 
ATOM   3835  C  CD    . GLU C  2  37   ? 89.100  -39.666 69.347  1.00 77.15  ? 37   GLU C CD    1 
ATOM   3836  O  OE1   . GLU C  2  37   ? 89.525  -38.830 68.514  1.00 67.81  ? 37   GLU C OE1   1 
ATOM   3837  O  OE2   . GLU C  2  37   ? 89.418  -39.646 70.559  1.00 79.04  ? 37   GLU C OE2   1 
ATOM   3838  N  N     . LYS C  2  38   ? 84.902  -39.856 69.263  1.00 63.11  ? 38   LYS C N     1 
ATOM   3839  C  CA    . LYS C  2  38   ? 83.807  -40.426 70.055  1.00 68.64  ? 38   LYS C CA    1 
ATOM   3840  C  C     . LYS C  2  38   ? 82.489  -39.626 70.009  1.00 69.57  ? 38   LYS C C     1 
ATOM   3841  O  O     . LYS C  2  38   ? 81.531  -39.941 70.725  1.00 64.00  ? 38   LYS C O     1 
ATOM   3842  C  CB    . LYS C  2  38   ? 84.261  -40.666 71.508  1.00 67.50  ? 38   LYS C CB    1 
ATOM   3843  C  CG    . LYS C  2  38   ? 85.084  -41.942 71.681  1.00 69.82  ? 38   LYS C CG    1 
ATOM   3844  C  CD    . LYS C  2  38   ? 86.097  -41.839 72.811  1.00 63.90  ? 38   LYS C CD    1 
ATOM   3845  C  CE    . LYS C  2  38   ? 85.439  -41.781 74.180  1.00 76.65  ? 38   LYS C CE    1 
ATOM   3846  N  NZ    . LYS C  2  38   ? 86.449  -41.595 75.272  1.00 67.60  ? 38   LYS C NZ    1 
ATOM   3847  N  N     . ARG C  2  39   ? 82.447  -38.584 69.182  1.00 63.34  ? 39   ARG C N     1 
ATOM   3848  C  CA    . ARG C  2  39   ? 81.252  -37.751 69.078  1.00 55.09  ? 39   ARG C CA    1 
ATOM   3849  C  C     . ARG C  2  39   ? 80.114  -38.442 68.339  1.00 60.05  ? 39   ARG C C     1 
ATOM   3850  O  O     . ARG C  2  39   ? 80.337  -39.124 67.334  1.00 60.70  ? 39   ARG C O     1 
ATOM   3851  C  CB    . ARG C  2  39   ? 81.570  -36.416 68.398  1.00 49.59  ? 39   ARG C CB    1 
ATOM   3852  C  CG    . ARG C  2  39   ? 82.417  -35.485 69.238  1.00 47.23  ? 39   ARG C CG    1 
ATOM   3853  C  CD    . ARG C  2  39   ? 82.335  -34.066 68.729  1.00 47.42  ? 39   ARG C CD    1 
ATOM   3854  N  NE    . ARG C  2  39   ? 83.105  -33.147 69.561  1.00 46.99  ? 39   ARG C NE    1 
ATOM   3855  C  CZ    . ARG C  2  39   ? 84.235  -32.568 69.174  1.00 45.69  ? 39   ARG C CZ    1 
ATOM   3856  N  NH1   . ARG C  2  39   ? 84.723  -32.811 67.964  1.00 48.82  ? 39   ARG C NH1   1 
ATOM   3857  N  NH2   . ARG C  2  39   ? 84.872  -31.742 69.991  1.00 44.03  ? 39   ARG C NH2   1 
ATOM   3858  N  N     . GLU C  2  40   ? 78.898  -38.274 68.856  1.00 60.96  ? 40   GLU C N     1 
ATOM   3859  C  CA    . GLU C  2  40   ? 77.685  -38.692 68.155  1.00 60.09  ? 40   GLU C CA    1 
ATOM   3860  C  C     . GLU C  2  40   ? 77.324  -37.683 67.069  1.00 58.40  ? 40   GLU C C     1 
ATOM   3861  O  O     . GLU C  2  40   ? 77.762  -36.528 67.127  1.00 53.49  ? 40   GLU C O     1 
ATOM   3862  C  CB    . GLU C  2  40   ? 76.528  -38.863 69.128  1.00 57.86  ? 40   GLU C CB    1 
ATOM   3863  C  CG    . GLU C  2  40   ? 76.763  -39.935 70.170  1.00 67.50  ? 40   GLU C CG    1 
ATOM   3864  C  CD    . GLU C  2  40   ? 75.638  -40.011 71.179  1.00 91.40  ? 40   GLU C CD    1 
ATOM   3865  O  OE1   . GLU C  2  40   ? 74.464  -39.837 70.779  1.00 87.56  ? 40   GLU C OE1   1 
ATOM   3866  O  OE2   . GLU C  2  40   ? 75.931  -40.236 72.374  1.00 102.21 ? 40   GLU C OE2   1 
ATOM   3867  N  N     . ASN C  2  41   ? 76.517  -38.105 66.094  1.00 60.48  ? 41   ASN C N     1 
ATOM   3868  C  CA    . ASN C  2  41   ? 76.156  -37.206 65.008  1.00 55.28  ? 41   ASN C CA    1 
ATOM   3869  C  C     . ASN C  2  41   ? 74.906  -36.474 65.484  1.00 56.76  ? 41   ASN C C     1 
ATOM   3870  O  O     . ASN C  2  41   ? 73.776  -36.919 65.275  1.00 57.11  ? 41   ASN C O     1 
ATOM   3871  C  CB    . ASN C  2  41   ? 75.838  -38.069 63.774  1.00 56.21  ? 41   ASN C CB    1 
ATOM   3872  C  CG    . ASN C  2  41   ? 75.498  -37.257 62.526  1.00 64.17  ? 41   ASN C CG    1 
ATOM   3873  O  OD1   . ASN C  2  41   ? 74.765  -36.276 62.583  1.00 71.63  ? 41   ASN C OD1   1 
ATOM   3874  N  ND2   . ASN C  2  41   ? 76.016  -37.693 61.382  1.00 62.62  ? 41   ASN C ND2   1 
ATOM   3875  N  N     . VAL C  2  42   ? 75.145  -35.292 66.048  1.00 54.99  ? 42   VAL C N     1 
ATOM   3876  C  CA    . VAL C  2  42   ? 74.147  -34.468 66.725  1.00 50.71  ? 42   VAL C CA    1 
ATOM   3877  C  C     . VAL C  2  42   ? 74.755  -33.080 66.807  1.00 48.10  ? 42   VAL C C     1 
ATOM   3878  O  O     . VAL C  2  42   ? 75.973  -32.931 66.716  1.00 53.95  ? 42   VAL C O     1 
ATOM   3879  C  CB    . VAL C  2  42   ? 73.827  -34.926 68.189  1.00 50.41  ? 42   VAL C CB    1 
ATOM   3880  C  CG1   . VAL C  2  42   ? 73.199  -36.317 68.242  1.00 47.35  ? 42   VAL C CG1   1 
ATOM   3881  C  CG2   . VAL C  2  42   ? 75.061  -34.856 69.072  1.00 50.04  ? 42   VAL C CG2   1 
ATOM   3882  N  N     . GLY C  2  43   ? 73.920  -32.072 67.008  1.00 45.50  ? 43   GLY C N     1 
ATOM   3883  C  CA    . GLY C  2  43   ? 74.398  -30.713 67.177  1.00 48.65  ? 43   GLY C CA    1 
ATOM   3884  C  C     . GLY C  2  43   ? 75.337  -30.236 66.090  1.00 48.36  ? 43   GLY C C     1 
ATOM   3885  O  O     . GLY C  2  43   ? 75.141  -30.531 64.906  1.00 51.18  ? 43   GLY C O     1 
ATOM   3886  N  N     . ILE C  2  44   ? 76.361  -29.498 66.510  1.00 44.96  ? 44   ILE C N     1 
ATOM   3887  C  CA    . ILE C  2  44   ? 77.392  -28.988 65.616  1.00 45.46  ? 44   ILE C CA    1 
ATOM   3888  C  C     . ILE C  2  44   ? 77.931  -30.105 64.723  1.00 47.64  ? 44   ILE C C     1 
ATOM   3889  O  O     . ILE C  2  44   ? 78.050  -29.941 63.502  1.00 44.52  ? 44   ILE C O     1 
ATOM   3890  C  CB    . ILE C  2  44   ? 78.543  -28.340 66.435  1.00 47.44  ? 44   ILE C CB    1 
ATOM   3891  C  CG1   . ILE C  2  44   ? 78.058  -27.047 67.080  1.00 48.07  ? 44   ILE C CG1   1 
ATOM   3892  C  CG2   . ILE C  2  44   ? 79.757  -28.055 65.576  1.00 48.96  ? 44   ILE C CG2   1 
ATOM   3893  C  CD1   . ILE C  2  44   ? 77.159  -26.245 66.184  1.00 48.48  ? 44   ILE C CD1   1 
ATOM   3894  N  N     . GLN C  2  45   ? 78.227  -31.247 65.340  1.00 47.65  ? 45   GLN C N     1 
ATOM   3895  C  CA    . GLN C  2  45   ? 78.728  -32.412 64.620  1.00 48.05  ? 45   GLN C CA    1 
ATOM   3896  C  C     . GLN C  2  45   ? 77.808  -32.769 63.453  1.00 50.65  ? 45   GLN C C     1 
ATOM   3897  O  O     . GLN C  2  45   ? 78.259  -32.921 62.314  1.00 48.16  ? 45   GLN C O     1 
ATOM   3898  C  CB    . GLN C  2  45   ? 78.882  -33.602 65.573  1.00 47.79  ? 45   GLN C CB    1 
ATOM   3899  C  CG    . GLN C  2  45   ? 79.568  -34.814 64.958  1.00 55.31  ? 45   GLN C CG    1 
ATOM   3900  C  CD    . GLN C  2  45   ? 81.009  -34.538 64.552  1.00 53.48  ? 45   GLN C CD    1 
ATOM   3901  O  OE1   . GLN C  2  45   ? 81.687  -33.699 65.141  1.00 56.82  ? 45   GLN C OE1   1 
ATOM   3902  N  NE2   . GLN C  2  45   ? 81.481  -35.251 63.540  1.00 50.03  ? 45   GLN C NE2   1 
ATOM   3903  N  N     . ALA C  2  46   ? 76.513  -32.862 63.742  1.00 52.67  ? 46   ALA C N     1 
ATOM   3904  C  CA    . ALA C  2  46   ? 75.505  -33.182 62.732  1.00 52.78  ? 46   ALA C CA    1 
ATOM   3905  C  C     . ALA C  2  46   ? 75.420  -32.132 61.629  1.00 50.85  ? 46   ALA C C     1 
ATOM   3906  O  O     . ALA C  2  46   ? 75.174  -32.465 60.470  1.00 54.29  ? 46   ALA C O     1 
ATOM   3907  C  CB    . ALA C  2  46   ? 74.152  -33.365 63.382  1.00 49.89  ? 46   ALA C CB    1 
ATOM   3908  N  N     . ALA C  2  47   ? 75.611  -30.868 61.996  1.00 50.20  ? 47   ALA C N     1 
ATOM   3909  C  CA    . ALA C  2  47   ? 75.627  -29.794 61.006  1.00 49.12  ? 47   ALA C CA    1 
ATOM   3910  C  C     . ALA C  2  47   ? 76.780  -29.976 60.021  1.00 49.81  ? 47   ALA C C     1 
ATOM   3911  O  O     . ALA C  2  47   ? 76.587  -29.876 58.806  1.00 51.51  ? 47   ALA C O     1 
ATOM   3912  C  CB    . ALA C  2  47   ? 75.720  -28.446 61.682  1.00 47.23  ? 47   ALA C CB    1 
ATOM   3913  N  N     . PHE C  2  48   ? 77.976  -30.243 60.548  1.00 53.59  ? 48   PHE C N     1 
ATOM   3914  C  CA    . PHE C  2  48   ? 79.143  -30.488 59.695  1.00 51.19  ? 48   PHE C CA    1 
ATOM   3915  C  C     . PHE C  2  48   ? 78.928  -31.694 58.795  1.00 53.88  ? 48   PHE C C     1 
ATOM   3916  O  O     . PHE C  2  48   ? 79.159  -31.629 57.587  1.00 50.71  ? 48   PHE C O     1 
ATOM   3917  C  CB    . PHE C  2  48   ? 80.405  -30.712 60.525  1.00 43.76  ? 48   PHE C CB    1 
ATOM   3918  C  CG    . PHE C  2  48   ? 81.123  -29.450 60.889  1.00 39.69  ? 48   PHE C CG    1 
ATOM   3919  C  CD1   . PHE C  2  48   ? 81.307  -29.103 62.219  1.00 38.62  ? 48   PHE C CD1   1 
ATOM   3920  C  CD2   . PHE C  2  48   ? 81.613  -28.610 59.902  1.00 39.73  ? 48   PHE C CD2   1 
ATOM   3921  C  CE1   . PHE C  2  48   ? 81.969  -27.946 62.558  1.00 40.22  ? 48   PHE C CE1   1 
ATOM   3922  C  CE2   . PHE C  2  48   ? 82.279  -27.448 60.232  1.00 38.53  ? 48   PHE C CE2   1 
ATOM   3923  C  CZ    . PHE C  2  48   ? 82.459  -27.114 61.564  1.00 42.48  ? 48   PHE C CZ    1 
ATOM   3924  N  N     . ARG C  2  49   ? 78.486  -32.794 59.397  1.00 57.36  ? 49   ARG C N     1 
ATOM   3925  C  CA    . ARG C  2  49   ? 78.244  -34.030 58.659  1.00 60.19  ? 49   ARG C CA    1 
ATOM   3926  C  C     . ARG C  2  49   ? 77.200  -33.843 57.560  1.00 62.78  ? 49   ARG C C     1 
ATOM   3927  O  O     . ARG C  2  49   ? 77.249  -34.506 56.524  1.00 74.57  ? 49   ARG C O     1 
ATOM   3928  C  CB    . ARG C  2  49   ? 77.827  -35.146 59.616  1.00 55.69  ? 49   ARG C CB    1 
ATOM   3929  C  CG    . ARG C  2  49   ? 78.915  -35.524 60.609  1.00 61.09  ? 49   ARG C CG    1 
ATOM   3930  C  CD    . ARG C  2  49   ? 80.008  -36.360 59.968  1.00 56.51  ? 49   ARG C CD    1 
ATOM   3931  N  NE    . ARG C  2  49   ? 79.500  -37.682 59.626  1.00 71.15  ? 49   ARG C NE    1 
ATOM   3932  C  CZ    . ARG C  2  49   ? 79.123  -38.043 58.404  1.00 82.29  ? 49   ARG C CZ    1 
ATOM   3933  N  NH1   . ARG C  2  49   ? 79.216  -37.182 57.393  1.00 75.93  ? 49   ARG C NH1   1 
ATOM   3934  N  NH2   . ARG C  2  49   ? 78.660  -39.268 58.189  1.00 86.10  ? 49   ARG C NH2   1 
ATOM   3935  N  N     . GLU C  2  50   ? 76.262  -32.931 57.789  1.00 60.11  ? 50   GLU C N     1 
ATOM   3936  C  CA    . GLU C  2  50   ? 75.238  -32.620 56.797  1.00 62.67  ? 50   GLU C CA    1 
ATOM   3937  C  C     . GLU C  2  50   ? 75.803  -31.779 55.652  1.00 59.99  ? 50   GLU C C     1 
ATOM   3938  O  O     . GLU C  2  50   ? 75.523  -32.038 54.485  1.00 69.40  ? 50   GLU C O     1 
ATOM   3939  C  CB    . GLU C  2  50   ? 74.078  -31.880 57.463  1.00 67.78  ? 50   GLU C CB    1 
ATOM   3940  C  CG    . GLU C  2  50   ? 72.698  -32.360 57.063  1.00 82.52  ? 50   GLU C CG    1 
ATOM   3941  C  CD    . GLU C  2  50   ? 71.626  -31.867 58.020  1.00 100.01 ? 50   GLU C CD    1 
ATOM   3942  O  OE1   . GLU C  2  50   ? 71.993  -31.334 59.092  1.00 83.13  ? 50   GLU C OE1   1 
ATOM   3943  O  OE2   . GLU C  2  50   ? 70.423  -32.012 57.703  1.00 106.90 ? 50   GLU C OE2   1 
ATOM   3944  N  N     . THR C  2  51   ? 76.598  -30.770 55.992  1.00 56.71  ? 51   THR C N     1 
ATOM   3945  C  CA    . THR C  2  51   ? 77.125  -29.845 54.993  1.00 59.33  ? 51   THR C CA    1 
ATOM   3946  C  C     . THR C  2  51   ? 78.198  -30.481 54.099  1.00 64.10  ? 51   THR C C     1 
ATOM   3947  O  O     . THR C  2  51   ? 78.320  -30.134 52.925  1.00 63.39  ? 51   THR C O     1 
ATOM   3948  C  CB    . THR C  2  51   ? 77.688  -28.574 55.667  1.00 57.65  ? 51   THR C CB    1 
ATOM   3949  O  OG1   . THR C  2  51   ? 76.721  -28.060 56.590  1.00 56.35  ? 51   THR C OG1   1 
ATOM   3950  C  CG2   . THR C  2  51   ? 78.017  -27.503 54.631  1.00 52.11  ? 51   THR C CG2   1 
ATOM   3951  N  N     . PHE C  2  52   ? 78.953  -31.427 54.657  1.00 66.55  ? 52   PHE C N     1 
ATOM   3952  C  CA    . PHE C  2  52   ? 80.085  -32.049 53.966  1.00 61.86  ? 52   PHE C CA    1 
ATOM   3953  C  C     . PHE C  2  52   ? 79.810  -33.528 53.673  1.00 69.03  ? 52   PHE C C     1 
ATOM   3954  O  O     . PHE C  2  52   ? 79.045  -34.173 54.393  1.00 69.54  ? 52   PHE C O     1 
ATOM   3955  C  CB    . PHE C  2  52   ? 81.349  -31.948 54.823  1.00 59.61  ? 52   PHE C CB    1 
ATOM   3956  C  CG    . PHE C  2  52   ? 81.868  -30.546 55.005  1.00 59.09  ? 52   PHE C CG    1 
ATOM   3957  C  CD1   . PHE C  2  52   ? 82.753  -29.996 54.091  1.00 54.56  ? 52   PHE C CD1   1 
ATOM   3958  C  CD2   . PHE C  2  52   ? 81.498  -29.792 56.113  1.00 53.65  ? 52   PHE C CD2   1 
ATOM   3959  C  CE1   . PHE C  2  52   ? 83.247  -28.715 54.266  1.00 54.02  ? 52   PHE C CE1   1 
ATOM   3960  C  CE2   . PHE C  2  52   ? 81.987  -28.510 56.294  1.00 48.19  ? 52   PHE C CE2   1 
ATOM   3961  C  CZ    . PHE C  2  52   ? 82.865  -27.969 55.369  1.00 51.60  ? 52   PHE C CZ    1 
ATOM   3962  N  N     . PRO C  2  53   ? 80.452  -34.087 52.629  1.00 74.68  ? 53   PRO C N     1 
ATOM   3963  C  CA    . PRO C  2  53   ? 81.433  -33.469 51.723  1.00 66.93  ? 53   PRO C CA    1 
ATOM   3964  C  C     . PRO C  2  53   ? 80.827  -32.530 50.685  1.00 63.08  ? 53   PRO C C     1 
ATOM   3965  O  O     . PRO C  2  53   ? 79.728  -32.764 50.194  1.00 69.76  ? 53   PRO C O     1 
ATOM   3966  C  CB    . PRO C  2  53   ? 82.069  -34.674 51.030  1.00 70.52  ? 53   PRO C CB    1 
ATOM   3967  C  CG    . PRO C  2  53   ? 81.013  -35.716 51.059  1.00 76.72  ? 53   PRO C CG    1 
ATOM   3968  C  CD    . PRO C  2  53   ? 80.275  -35.523 52.347  1.00 74.03  ? 53   PRO C CD    1 
ATOM   3969  N  N     . ILE C  2  54   ? 81.567  -31.480 50.349  1.00 65.31  ? 54   ILE C N     1 
ATOM   3970  C  CA    . ILE C  2  54   ? 81.140  -30.529 49.338  1.00 74.23  ? 54   ILE C CA    1 
ATOM   3971  C  C     . ILE C  2  54   ? 81.706  -30.986 47.996  1.00 82.15  ? 54   ILE C C     1 
ATOM   3972  O  O     . ILE C  2  54   ? 82.911  -30.904 47.754  1.00 79.80  ? 54   ILE C O     1 
ATOM   3973  C  CB    . ILE C  2  54   ? 81.660  -29.124 49.677  1.00 70.94  ? 54   ILE C CB    1 
ATOM   3974  C  CG1   . ILE C  2  54   ? 81.190  -28.717 51.077  1.00 60.65  ? 54   ILE C CG1   1 
ATOM   3975  C  CG2   . ILE C  2  54   ? 81.226  -28.117 48.627  1.00 71.15  ? 54   ILE C CG2   1 
ATOM   3976  C  CD1   . ILE C  2  54   ? 81.696  -27.365 51.523  1.00 59.96  ? 54   ILE C CD1   1 
ATOM   3977  N  N     . GLU C  2  55   ? 80.815  -31.456 47.126  1.00 90.53  ? 55   GLU C N     1 
ATOM   3978  C  CA    . GLU C  2  55   ? 81.194  -32.235 45.946  1.00 87.42  ? 55   GLU C CA    1 
ATOM   3979  C  C     . GLU C  2  55   ? 81.655  -31.475 44.696  1.00 94.46  ? 55   GLU C C     1 
ATOM   3980  O  O     . GLU C  2  55   ? 82.599  -31.922 44.046  1.00 103.56 ? 55   GLU C O     1 
ATOM   3981  C  CB    . GLU C  2  55   ? 80.078  -33.218 45.583  1.00 97.20  ? 55   GLU C CB    1 
ATOM   3982  C  CG    . GLU C  2  55   ? 79.759  -34.223 46.683  1.00 99.58  ? 55   GLU C CG    1 
ATOM   3983  C  CD    . GLU C  2  55   ? 80.233  -35.626 46.352  1.00 106.91 ? 55   GLU C CD    1 
ATOM   3984  O  OE1   . GLU C  2  55   ? 79.958  -36.549 47.153  1.00 97.08  ? 55   GLU C OE1   1 
ATOM   3985  O  OE2   . GLU C  2  55   ? 80.876  -35.805 45.292  1.00 102.02 ? 55   GLU C OE2   1 
ATOM   3986  N  N     . GLU C  2  56   ? 80.974  -30.364 44.385  1.00 90.56  ? 56   GLU C N     1 
ATOM   3987  C  CA    . GLU C  2  56   ? 81.124  -29.531 43.161  1.00 108.65 ? 56   GLU C CA    1 
ATOM   3988  C  C     . GLU C  2  56   ? 79.948  -29.695 42.194  1.00 115.01 ? 56   GLU C C     1 
ATOM   3989  O  O     . GLU C  2  56   ? 79.535  -28.738 41.536  1.00 116.07 ? 56   GLU C O     1 
ATOM   3990  C  CB    . GLU C  2  56   ? 82.472  -29.698 42.422  1.00 93.35  ? 56   GLU C CB    1 
ATOM   3991  C  CG    . GLU C  2  56   ? 82.371  -30.023 40.933  1.00 97.44  ? 56   GLU C CG    1 
ATOM   3992  C  CD    . GLU C  2  56   ? 82.025  -31.484 40.640  1.00 117.74 ? 56   GLU C CD    1 
ATOM   3993  O  OE1   . GLU C  2  56   ? 82.105  -31.890 39.459  1.00 131.29 ? 56   GLU C OE1   1 
ATOM   3994  O  OE2   . GLU C  2  56   ? 81.665  -32.228 41.577  1.00 110.44 ? 56   GLU C OE2   1 
ATOM   3995  N  N     . LEU C  2  64   ? 87.506  -31.891 42.139  1.00 77.09  ? 64   LEU C N     1 
ATOM   3996  C  CA    . LEU C  2  64   ? 87.608  -31.295 43.473  1.00 80.23  ? 64   LEU C CA    1 
ATOM   3997  C  C     . LEU C  2  64   ? 86.496  -31.742 44.433  1.00 82.88  ? 64   LEU C C     1 
ATOM   3998  O  O     . LEU C  2  64   ? 85.315  -31.676 44.101  1.00 87.93  ? 64   LEU C O     1 
ATOM   3999  C  CB    . LEU C  2  64   ? 87.630  -29.767 43.375  1.00 69.29  ? 64   LEU C CB    1 
ATOM   4000  C  CG    . LEU C  2  64   ? 88.972  -29.129 43.018  1.00 80.99  ? 64   LEU C CG    1 
ATOM   4001  C  CD1   . LEU C  2  64   ? 88.841  -27.619 42.891  1.00 77.11  ? 64   LEU C CD1   1 
ATOM   4002  C  CD2   . LEU C  2  64   ? 90.022  -29.494 44.059  1.00 73.90  ? 64   LEU C CD2   1 
ATOM   4003  N  N     . VAL C  2  65   ? 86.894  -32.207 45.616  1.00 80.36  ? 65   VAL C N     1 
ATOM   4004  C  CA    . VAL C  2  65   ? 85.971  -32.612 46.678  1.00 74.45  ? 65   VAL C CA    1 
ATOM   4005  C  C     . VAL C  2  65   ? 86.508  -32.172 48.042  1.00 78.06  ? 65   VAL C C     1 
ATOM   4006  O  O     . VAL C  2  65   ? 87.635  -32.504 48.398  1.00 76.74  ? 65   VAL C O     1 
ATOM   4007  C  CB    . VAL C  2  65   ? 85.796  -34.145 46.704  1.00 66.56  ? 65   VAL C CB    1 
ATOM   4008  C  CG1   . VAL C  2  65   ? 85.138  -34.593 47.999  1.00 63.34  ? 65   VAL C CG1   1 
ATOM   4009  C  CG2   . VAL C  2  65   ? 85.004  -34.618 45.499  1.00 80.59  ? 65   VAL C CG2   1 
ATOM   4010  N  N     . LEU C  2  66   ? 85.710  -31.445 48.819  1.00 80.27  ? 66   LEU C N     1 
ATOM   4011  C  CA    . LEU C  2  66   ? 86.158  -31.012 50.148  1.00 70.97  ? 66   LEU C CA    1 
ATOM   4012  C  C     . LEU C  2  66   ? 85.460  -31.787 51.258  1.00 60.09  ? 66   LEU C C     1 
ATOM   4013  O  O     . LEU C  2  66   ? 84.238  -31.755 51.358  1.00 65.65  ? 66   LEU C O     1 
ATOM   4014  C  CB    . LEU C  2  66   ? 85.930  -29.513 50.332  1.00 63.02  ? 66   LEU C CB    1 
ATOM   4015  C  CG    . LEU C  2  66   ? 86.456  -28.917 51.633  1.00 57.09  ? 66   LEU C CG    1 
ATOM   4016  C  CD1   . LEU C  2  66   ? 87.853  -29.429 51.930  1.00 64.09  ? 66   LEU C CD1   1 
ATOM   4017  C  CD2   . LEU C  2  66   ? 86.456  -27.402 51.536  1.00 61.30  ? 66   LEU C CD2   1 
ATOM   4018  N  N     . ASP C  2  67   ? 86.223  -32.487 52.092  1.00 58.81  ? 67   ASP C N     1 
ATOM   4019  C  CA    . ASP C  2  67   ? 85.586  -33.310 53.118  1.00 62.70  ? 67   ASP C CA    1 
ATOM   4020  C  C     . ASP C  2  67   ? 85.947  -32.934 54.559  1.00 61.73  ? 67   ASP C C     1 
ATOM   4021  O  O     . ASP C  2  67   ? 87.042  -32.443 54.841  1.00 65.20  ? 67   ASP C O     1 
ATOM   4022  C  CB    . ASP C  2  67   ? 85.813  -34.804 52.858  1.00 69.83  ? 67   ASP C CB    1 
ATOM   4023  C  CG    . ASP C  2  67   ? 84.697  -35.677 53.436  1.00 87.83  ? 67   ASP C CG    1 
ATOM   4024  O  OD1   . ASP C  2  67   ? 83.658  -35.126 53.868  1.00 81.19  ? 67   ASP C OD1   1 
ATOM   4025  O  OD2   . ASP C  2  67   ? 84.852  -36.917 53.449  1.00 100.45 ? 67   ASP C OD2   1 
ATOM   4026  N  N     . PHE C  2  68   ? 84.997  -33.171 55.458  1.00 58.96  ? 68   PHE C N     1 
ATOM   4027  C  CA    . PHE C  2  68   ? 85.121  -32.809 56.861  1.00 56.08  ? 68   PHE C CA    1 
ATOM   4028  C  C     . PHE C  2  68   ? 85.639  -33.990 57.667  1.00 53.37  ? 68   PHE C C     1 
ATOM   4029  O  O     . PHE C  2  68   ? 85.107  -35.097 57.577  1.00 54.88  ? 68   PHE C O     1 
ATOM   4030  C  CB    . PHE C  2  68   ? 83.756  -32.346 57.396  1.00 54.57  ? 68   PHE C CB    1 
ATOM   4031  C  CG    . PHE C  2  68   ? 83.648  -32.331 58.902  1.00 48.03  ? 68   PHE C CG    1 
ATOM   4032  C  CD1   . PHE C  2  68   ? 84.203  -31.300 59.644  1.00 45.31  ? 68   PHE C CD1   1 
ATOM   4033  C  CD2   . PHE C  2  68   ? 82.962  -33.336 59.570  1.00 46.18  ? 68   PHE C CD2   1 
ATOM   4034  C  CE1   . PHE C  2  68   ? 84.096  -31.284 61.024  1.00 45.69  ? 68   PHE C CE1   1 
ATOM   4035  C  CE2   . PHE C  2  68   ? 82.847  -33.327 60.946  1.00 45.08  ? 68   PHE C CE2   1 
ATOM   4036  C  CZ    . PHE C  2  68   ? 83.412  -32.300 61.677  1.00 47.39  ? 68   PHE C CZ    1 
ATOM   4037  N  N     . LEU C  2  69   ? 86.679  -33.740 58.455  1.00 50.73  ? 69   LEU C N     1 
ATOM   4038  C  CA    . LEU C  2  69   ? 87.256  -34.757 59.325  1.00 52.09  ? 69   LEU C CA    1 
ATOM   4039  C  C     . LEU C  2  69   ? 86.683  -34.688 60.732  1.00 49.48  ? 69   LEU C C     1 
ATOM   4040  O  O     . LEU C  2  69   ? 86.097  -35.653 61.224  1.00 49.08  ? 69   LEU C O     1 
ATOM   4041  C  CB    . LEU C  2  69   ? 88.782  -34.649 59.367  1.00 56.70  ? 69   LEU C CB    1 
ATOM   4042  C  CG    . LEU C  2  69   ? 89.492  -35.244 58.154  1.00 61.37  ? 69   LEU C CG    1 
ATOM   4043  C  CD1   . LEU C  2  69   ? 90.962  -35.428 58.453  1.00 65.58  ? 69   LEU C CD1   1 
ATOM   4044  C  CD2   . LEU C  2  69   ? 88.844  -36.564 57.754  1.00 57.59  ? 69   LEU C CD2   1 
ATOM   4045  N  N     . GLU C  2  70   ? 86.871  -33.537 61.371  1.00 47.68  ? 70   GLU C N     1 
ATOM   4046  C  CA    . GLU C  2  70   ? 86.507  -33.339 62.764  1.00 43.81  ? 70   GLU C CA    1 
ATOM   4047  C  C     . GLU C  2  70   ? 86.729  -31.877 63.126  1.00 48.27  ? 70   GLU C C     1 
ATOM   4048  O  O     . GLU C  2  70   ? 87.481  -31.172 62.449  1.00 47.05  ? 70   GLU C O     1 
ATOM   4049  C  CB    . GLU C  2  70   ? 87.390  -34.210 63.654  1.00 47.80  ? 70   GLU C CB    1 
ATOM   4050  C  CG    . GLU C  2  70   ? 88.874  -34.096 63.330  1.00 52.41  ? 70   GLU C CG    1 
ATOM   4051  C  CD    . GLU C  2  70   ? 89.771  -34.513 64.481  1.00 62.84  ? 70   GLU C CD    1 
ATOM   4052  O  OE1   . GLU C  2  70   ? 89.750  -33.833 65.530  1.00 65.41  ? 70   GLU C OE1   1 
ATOM   4053  O  OE2   . GLU C  2  70   ? 90.503  -35.514 64.333  1.00 65.57  ? 70   GLU C OE2   1 
ATOM   4054  N  N     . TYR C  2  71   ? 86.091  -31.426 64.205  1.00 44.67  ? 71   TYR C N     1 
ATOM   4055  C  CA    . TYR C  2  71   ? 86.243  -30.043 64.651  1.00 43.26  ? 71   TYR C CA    1 
ATOM   4056  C  C     . TYR C  2  71   ? 86.766  -30.031 66.076  1.00 43.54  ? 71   TYR C C     1 
ATOM   4057  O  O     . TYR C  2  71   ? 86.702  -31.046 66.775  1.00 44.18  ? 71   TYR C O     1 
ATOM   4058  C  CB    . TYR C  2  71   ? 84.917  -29.264 64.571  1.00 40.89  ? 71   TYR C CB    1 
ATOM   4059  C  CG    . TYR C  2  71   ? 83.904  -29.653 65.630  1.00 46.08  ? 71   TYR C CG    1 
ATOM   4060  C  CD1   . TYR C  2  71   ? 83.930  -29.078 66.900  1.00 41.67  ? 71   TYR C CD1   1 
ATOM   4061  C  CD2   . TYR C  2  71   ? 82.923  -30.599 65.365  1.00 45.45  ? 71   TYR C CD2   1 
ATOM   4062  C  CE1   . TYR C  2  71   ? 83.018  -29.445 67.868  1.00 41.75  ? 71   TYR C CE1   1 
ATOM   4063  C  CE2   . TYR C  2  71   ? 82.004  -30.963 66.329  1.00 42.24  ? 71   TYR C CE2   1 
ATOM   4064  C  CZ    . TYR C  2  71   ? 82.055  -30.386 67.576  1.00 43.04  ? 71   TYR C CZ    1 
ATOM   4065  O  OH    . TYR C  2  71   ? 81.135  -30.751 68.531  1.00 44.24  ? 71   TYR C OH    1 
ATOM   4066  N  N     . ARG C  2  72   ? 87.285  -28.887 66.506  1.00 39.91  ? 72   ARG C N     1 
ATOM   4067  C  CA    . ARG C  2  72   ? 87.603  -28.709 67.915  1.00 47.66  ? 72   ARG C CA    1 
ATOM   4068  C  C     . ARG C  2  72   ? 87.269  -27.297 68.384  1.00 47.64  ? 72   ARG C C     1 
ATOM   4069  O  O     . ARG C  2  72   ? 87.254  -26.353 67.586  1.00 44.07  ? 72   ARG C O     1 
ATOM   4070  C  CB    . ARG C  2  72   ? 89.070  -29.048 68.213  1.00 49.09  ? 72   ARG C CB    1 
ATOM   4071  C  CG    . ARG C  2  72   ? 90.061  -28.069 67.637  1.00 43.98  ? 72   ARG C CG    1 
ATOM   4072  C  CD    . ARG C  2  72   ? 91.430  -28.170 68.296  1.00 35.27  ? 72   ARG C CD    1 
ATOM   4073  N  NE    . ARG C  2  72   ? 92.362  -27.257 67.641  1.00 38.90  ? 72   ARG C NE    1 
ATOM   4074  C  CZ    . ARG C  2  72   ? 92.735  -26.084 68.137  1.00 39.26  ? 72   ARG C CZ    1 
ATOM   4075  N  NH1   . ARG C  2  72   ? 92.277  -25.693 69.317  1.00 46.96  ? 72   ARG C NH1   1 
ATOM   4076  N  NH2   . ARG C  2  72   ? 93.571  -25.307 67.462  1.00 37.77  ? 72   ARG C NH2   1 
ATOM   4077  N  N     . LEU C  2  73   ? 86.985  -27.171 69.680  1.00 42.82  ? 73   LEU C N     1 
ATOM   4078  C  CA    . LEU C  2  73   ? 86.744  -25.874 70.302  1.00 40.71  ? 73   LEU C CA    1 
ATOM   4079  C  C     . LEU C  2  73   ? 87.877  -25.532 71.263  1.00 43.51  ? 73   LEU C C     1 
ATOM   4080  O  O     . LEU C  2  73   ? 88.223  -26.329 72.136  1.00 52.34  ? 73   LEU C O     1 
ATOM   4081  C  CB    . LEU C  2  73   ? 85.410  -25.873 71.054  1.00 41.24  ? 73   LEU C CB    1 
ATOM   4082  C  CG    . LEU C  2  73   ? 84.119  -25.905 70.235  1.00 42.09  ? 73   LEU C CG    1 
ATOM   4083  C  CD1   . LEU C  2  73   ? 82.929  -26.320 71.101  1.00 35.96  ? 73   LEU C CD1   1 
ATOM   4084  C  CD2   . LEU C  2  73   ? 83.878  -24.553 69.598  1.00 42.29  ? 73   LEU C CD2   1 
ATOM   4085  N  N     . GLY C  2  74   ? 88.453  -24.346 71.104  1.00 40.56  ? 74   GLY C N     1 
ATOM   4086  C  CA    . GLY C  2  74   ? 89.507  -23.900 71.992  1.00 42.30  ? 74   GLY C CA    1 
ATOM   4087  C  C     . GLY C  2  74   ? 88.999  -23.367 73.320  1.00 43.63  ? 74   GLY C C     1 
ATOM   4088  O  O     . GLY C  2  74   ? 87.832  -23.532 73.666  1.00 45.69  ? 74   GLY C O     1 
ATOM   4089  N  N     . GLU C  2  75   ? 89.894  -22.740 74.074  1.00 46.91  ? 75   GLU C N     1 
ATOM   4090  C  CA    . GLU C  2  75   ? 89.532  -22.070 75.313  1.00 44.98  ? 75   GLU C CA    1 
ATOM   4091  C  C     . GLU C  2  75   ? 89.166  -20.616 75.018  1.00 47.66  ? 75   GLU C C     1 
ATOM   4092  O  O     . GLU C  2  75   ? 89.623  -20.054 74.027  1.00 48.98  ? 75   GLU C O     1 
ATOM   4093  C  CB    . GLU C  2  75   ? 90.698  -22.145 76.301  1.00 49.95  ? 75   GLU C CB    1 
ATOM   4094  C  CG    . GLU C  2  75   ? 91.042  -23.560 76.751  1.00 54.10  ? 75   GLU C CG    1 
ATOM   4095  C  CD    . GLU C  2  75   ? 90.125  -24.065 77.852  1.00 70.92  ? 75   GLU C CD    1 
ATOM   4096  O  OE1   . GLU C  2  75   ? 89.775  -25.268 77.830  1.00 73.47  ? 75   GLU C OE1   1 
ATOM   4097  O  OE2   . GLU C  2  75   ? 89.765  -23.261 78.743  1.00 74.75  ? 75   GLU C OE2   1 
ATOM   4098  N  N     . PRO C  2  76   ? 88.338  -19.999 75.876  1.00 51.21  ? 76   PRO C N     1 
ATOM   4099  C  CA    . PRO C  2  76   ? 87.970  -18.594 75.660  1.00 49.53  ? 76   PRO C CA    1 
ATOM   4100  C  C     . PRO C  2  76   ? 89.163  -17.653 75.830  1.00 50.38  ? 76   PRO C C     1 
ATOM   4101  O  O     . PRO C  2  76   ? 89.899  -17.781 76.808  1.00 52.85  ? 76   PRO C O     1 
ATOM   4102  C  CB    . PRO C  2  76   ? 86.947  -18.318 76.768  1.00 46.85  ? 76   PRO C CB    1 
ATOM   4103  C  CG    . PRO C  2  76   ? 86.566  -19.647 77.309  1.00 44.96  ? 76   PRO C CG    1 
ATOM   4104  C  CD    . PRO C  2  76   ? 87.716  -20.552 77.090  1.00 44.77  ? 76   PRO C CD    1 
ATOM   4105  N  N     . PRO C  2  77   ? 89.339  -16.707 74.894  1.00 44.22  ? 77   PRO C N     1 
ATOM   4106  C  CA    . PRO C  2  77   ? 90.397  -15.690 74.919  1.00 43.65  ? 77   PRO C CA    1 
ATOM   4107  C  C     . PRO C  2  77   ? 90.339  -14.818 76.178  1.00 49.26  ? 77   PRO C C     1 
ATOM   4108  O  O     . PRO C  2  77   ? 91.370  -14.344 76.660  1.00 49.19  ? 77   PRO C O     1 
ATOM   4109  C  CB    . PRO C  2  77   ? 90.075  -14.822 73.698  1.00 39.26  ? 77   PRO C CB    1 
ATOM   4110  C  CG    . PRO C  2  77   ? 89.219  -15.656 72.836  1.00 47.54  ? 77   PRO C CG    1 
ATOM   4111  C  CD    . PRO C  2  77   ? 88.440  -16.542 73.741  1.00 45.30  ? 77   PRO C CD    1 
ATOM   4112  N  N     . PHE C  2  78   ? 89.130  -14.589 76.681  1.00 51.97  ? 78   PHE C N     1 
ATOM   4113  C  CA    . PHE C  2  78   ? 88.925  -13.756 77.856  1.00 51.42  ? 78   PHE C CA    1 
ATOM   4114  C  C     . PHE C  2  78   ? 87.878  -14.393 78.744  1.00 57.45  ? 78   PHE C C     1 
ATOM   4115  O  O     . PHE C  2  78   ? 86.927  -14.995 78.243  1.00 55.39  ? 78   PHE C O     1 
ATOM   4116  C  CB    . PHE C  2  78   ? 88.467  -12.361 77.448  1.00 49.52  ? 78   PHE C CB    1 
ATOM   4117  C  CG    . PHE C  2  78   ? 89.365  -11.710 76.455  1.00 51.28  ? 78   PHE C CG    1 
ATOM   4118  C  CD1   . PHE C  2  78   ? 89.161  -11.889 75.100  1.00 48.34  ? 78   PHE C CD1   1 
ATOM   4119  C  CD2   . PHE C  2  78   ? 90.426  -10.931 76.873  1.00 54.72  ? 78   PHE C CD2   1 
ATOM   4120  C  CE1   . PHE C  2  78   ? 89.997  -11.303 74.182  1.00 47.79  ? 78   PHE C CE1   1 
ATOM   4121  C  CE2   . PHE C  2  78   ? 91.262  -10.334 75.959  1.00 51.39  ? 78   PHE C CE2   1 
ATOM   4122  C  CZ    . PHE C  2  78   ? 91.048  -10.519 74.612  1.00 52.64  ? 78   PHE C CZ    1 
ATOM   4123  N  N     . PRO C  2  79   ? 88.049  -14.267 80.069  1.00 62.84  ? 79   PRO C N     1 
ATOM   4124  C  CA    . PRO C  2  79   ? 87.061  -14.814 81.003  1.00 62.54  ? 79   PRO C CA    1 
ATOM   4125  C  C     . PRO C  2  79   ? 85.780  -13.978 80.996  1.00 60.60  ? 79   PRO C C     1 
ATOM   4126  O  O     . PRO C  2  79   ? 85.720  -12.951 80.317  1.00 60.55  ? 79   PRO C O     1 
ATOM   4127  C  CB    . PRO C  2  79   ? 87.774  -14.713 82.353  1.00 66.51  ? 79   PRO C CB    1 
ATOM   4128  C  CG    . PRO C  2  79   ? 88.722  -13.570 82.189  1.00 62.19  ? 79   PRO C CG    1 
ATOM   4129  C  CD    . PRO C  2  79   ? 89.181  -13.626 80.765  1.00 57.80  ? 79   PRO C CD    1 
ATOM   4130  N  N     . GLN C  2  80   ? 84.779  -14.408 81.756  1.00 59.68  ? 80   GLN C N     1 
ATOM   4131  C  CA    . GLN C  2  80   ? 83.454  -13.793 81.715  1.00 60.40  ? 80   GLN C CA    1 
ATOM   4132  C  C     . GLN C  2  80   ? 83.442  -12.344 82.203  1.00 60.36  ? 80   GLN C C     1 
ATOM   4133  O  O     . GLN C  2  80   ? 82.922  -11.453 81.527  1.00 57.87  ? 80   GLN C O     1 
ATOM   4134  C  CB    . GLN C  2  80   ? 82.469  -14.626 82.531  1.00 52.62  ? 80   GLN C CB    1 
ATOM   4135  C  CG    . GLN C  2  80   ? 82.409  -16.077 82.107  1.00 51.10  ? 80   GLN C CG    1 
ATOM   4136  C  CD    . GLN C  2  80   ? 81.576  -16.918 83.049  1.00 53.94  ? 80   GLN C CD    1 
ATOM   4137  O  OE1   . GLN C  2  80   ? 80.864  -16.388 83.912  1.00 59.35  ? 80   GLN C OE1   1 
ATOM   4138  N  NE2   . GLN C  2  80   ? 81.662  -18.237 82.898  1.00 47.07  ? 80   GLN C NE2   1 
ATOM   4139  N  N     . ASP C  2  81   ? 84.005  -12.126 83.385  1.00 64.60  ? 81   ASP C N     1 
ATOM   4140  C  CA    . ASP C  2  81   ? 84.087  -10.799 83.979  1.00 65.38  ? 81   ASP C CA    1 
ATOM   4141  C  C     . ASP C  2  81   ? 84.730  -9.817  83.001  1.00 61.82  ? 81   ASP C C     1 
ATOM   4142  O  O     . ASP C  2  81   ? 84.242  -8.700  82.796  1.00 62.40  ? 81   ASP C O     1 
ATOM   4143  C  CB    . ASP C  2  81   ? 84.892  -10.875 85.277  1.00 74.16  ? 81   ASP C CB    1 
ATOM   4144  C  CG    . ASP C  2  81   ? 85.702  -12.165 85.382  1.00 88.82  ? 81   ASP C CG    1 
ATOM   4145  O  OD1   . ASP C  2  81   ? 85.110  -13.256 85.213  1.00 81.22  ? 81   ASP C OD1   1 
ATOM   4146  O  OD2   . ASP C  2  81   ? 86.931  -12.091 85.615  1.00 89.82  ? 81   ASP C OD2   1 
ATOM   4147  N  N     . GLU C  2  82   ? 85.816  -10.255 82.380  1.00 64.28  ? 82   GLU C N     1 
ATOM   4148  C  CA    . GLU C  2  82   ? 86.507  -9.432  81.402  1.00 65.14  ? 82   GLU C CA    1 
ATOM   4149  C  C     . GLU C  2  82   ? 85.606  -9.101  80.212  1.00 61.01  ? 82   GLU C C     1 
ATOM   4150  O  O     . GLU C  2  82   ? 85.577  -7.963  79.752  1.00 59.87  ? 82   GLU C O     1 
ATOM   4151  C  CB    . GLU C  2  82   ? 87.791  -10.119 80.935  1.00 67.81  ? 82   GLU C CB    1 
ATOM   4152  C  CG    . GLU C  2  82   ? 88.526  -9.361  79.846  1.00 71.75  ? 82   GLU C CG    1 
ATOM   4153  C  CD    . GLU C  2  82   ? 90.022  -9.427  80.017  1.00 75.98  ? 82   GLU C CD    1 
ATOM   4154  O  OE1   . GLU C  2  82   ? 90.470  -10.071 80.990  1.00 77.60  ? 82   GLU C OE1   1 
ATOM   4155  O  OE2   . GLU C  2  82   ? 90.745  -8.835  79.185  1.00 80.71  ? 82   GLU C OE2   1 
ATOM   4156  N  N     . CYS C  2  83   ? 84.870  -10.096 79.725  1.00 62.12  ? 83   CYS C N     1 
ATOM   4157  C  CA    . CYS C  2  83   ? 83.943  -9.893  78.613  1.00 58.91  ? 83   CYS C CA    1 
ATOM   4158  C  C     . CYS C  2  83   ? 82.893  -8.842  78.943  1.00 58.98  ? 83   CYS C C     1 
ATOM   4159  O  O     . CYS C  2  83   ? 82.640  -7.941  78.143  1.00 57.61  ? 83   CYS C O     1 
ATOM   4160  C  CB    . CYS C  2  83   ? 83.246  -11.200 78.237  1.00 56.59  ? 83   CYS C CB    1 
ATOM   4161  S  SG    . CYS C  2  83   ? 84.303  -12.428 77.464  1.00 57.10  ? 83   CYS C SG    1 
ATOM   4162  N  N     . ARG C  2  84   ? 82.288  -8.964  80.123  1.00 63.13  ? 84   ARG C N     1 
ATOM   4163  C  CA    . ARG C  2  84   ? 81.279  -8.009  80.576  1.00 57.55  ? 84   ARG C CA    1 
ATOM   4164  C  C     . ARG C  2  84   ? 81.865  -6.601  80.669  1.00 59.59  ? 84   ARG C C     1 
ATOM   4165  O  O     . ARG C  2  84   ? 81.236  -5.616  80.255  1.00 59.96  ? 84   ARG C O     1 
ATOM   4166  C  CB    . ARG C  2  84   ? 80.691  -8.442  81.921  1.00 49.45  ? 84   ARG C CB    1 
ATOM   4167  C  CG    . ARG C  2  84   ? 79.864  -9.715  81.849  1.00 50.30  ? 84   ARG C CG    1 
ATOM   4168  C  CD    . ARG C  2  84   ? 79.252  -10.073 83.199  1.00 49.02  ? 84   ARG C CD    1 
ATOM   4169  N  NE    . ARG C  2  84   ? 78.457  -11.300 83.134  1.00 44.93  ? 84   ARG C NE    1 
ATOM   4170  C  CZ    . ARG C  2  84   ? 78.812  -12.453 83.695  1.00 49.26  ? 84   ARG C CZ    1 
ATOM   4171  N  NH1   . ARG C  2  84   ? 79.949  -12.541 84.377  1.00 49.05  ? 84   ARG C NH1   1 
ATOM   4172  N  NH2   . ARG C  2  84   ? 78.028  -13.520 83.582  1.00 48.11  ? 84   ARG C NH2   1 
ATOM   4173  N  N     . GLU C  2  85   ? 83.080  -6.519  81.197  1.00 58.15  ? 85   GLU C N     1 
ATOM   4174  C  CA    . GLU C  2  85   ? 83.794  -5.252  81.277  1.00 64.97  ? 85   GLU C CA    1 
ATOM   4175  C  C     . GLU C  2  85   ? 84.028  -4.603  79.906  1.00 73.90  ? 85   GLU C C     1 
ATOM   4176  O  O     . GLU C  2  85   ? 83.729  -3.424  79.711  1.00 82.53  ? 85   GLU C O     1 
ATOM   4177  C  CB    . GLU C  2  85   ? 85.128  -5.459  81.998  1.00 69.17  ? 85   GLU C CB    1 
ATOM   4178  C  CG    . GLU C  2  85   ? 86.164  -4.383  81.725  1.00 81.43  ? 85   GLU C CG    1 
ATOM   4179  C  CD    . GLU C  2  85   ? 85.988  -3.157  82.599  1.00 100.10 ? 85   GLU C CD    1 
ATOM   4180  O  OE1   . GLU C  2  85   ? 84.958  -3.060  83.305  1.00 99.51  ? 85   GLU C OE1   1 
ATOM   4181  O  OE2   . GLU C  2  85   ? 86.893  -2.292  82.581  1.00 94.45  ? 85   GLU C OE2   1 
ATOM   4182  N  N     . LYS C  2  86   ? 84.553  -5.381  78.963  1.00 71.71  ? 86   LYS C N     1 
ATOM   4183  C  CA    . LYS C  2  86   ? 85.040  -4.858  77.681  1.00 69.19  ? 86   LYS C CA    1 
ATOM   4184  C  C     . LYS C  2  86   ? 84.074  -4.914  76.494  1.00 63.31  ? 86   LYS C C     1 
ATOM   4185  O  O     . LYS C  2  86   ? 84.487  -4.660  75.360  1.00 65.07  ? 86   LYS C O     1 
ATOM   4186  C  CB    . LYS C  2  86   ? 86.374  -5.513  77.294  1.00 66.47  ? 86   LYS C CB    1 
ATOM   4187  C  CG    . LYS C  2  86   ? 87.532  -5.157  78.213  1.00 71.18  ? 86   LYS C CG    1 
ATOM   4188  C  CD    . LYS C  2  86   ? 88.844  -5.713  77.692  1.00 80.07  ? 86   LYS C CD    1 
ATOM   4189  C  CE    . LYS C  2  86   ? 89.999  -5.368  78.618  1.00 88.77  ? 86   LYS C CE    1 
ATOM   4190  N  NZ    . LYS C  2  86   ? 91.308  -5.755  78.023  1.00 96.12  ? 86   LYS C NZ    1 
ATOM   4191  N  N     . ASP C  2  87   ? 82.821  -5.288  76.738  1.00 57.67  ? 87   ASP C N     1 
ATOM   4192  C  CA    . ASP C  2  87   ? 81.828  -5.435  75.663  1.00 65.51  ? 87   ASP C CA    1 
ATOM   4193  C  C     . ASP C  2  87   ? 82.223  -6.533  74.662  1.00 60.68  ? 87   ASP C C     1 
ATOM   4194  O  O     . ASP C  2  87   ? 82.113  -6.370  73.439  1.00 53.52  ? 87   ASP C O     1 
ATOM   4195  C  CB    . ASP C  2  87   ? 81.569  -4.101  74.942  1.00 71.05  ? 87   ASP C CB    1 
ATOM   4196  C  CG    . ASP C  2  87   ? 80.728  -3.139  75.763  1.00 83.02  ? 87   ASP C CG    1 
ATOM   4197  O  OD1   . ASP C  2  87   ? 80.576  -3.355  76.988  1.00 87.22  ? 87   ASP C OD1   1 
ATOM   4198  O  OD2   . ASP C  2  87   ? 80.222  -2.156  75.177  1.00 85.01  ? 87   ASP C OD2   1 
ATOM   4199  N  N     . LEU C  2  88   ? 82.665  -7.661  75.207  1.00 57.51  ? 88   LEU C N     1 
ATOM   4200  C  CA    . LEU C  2  88   ? 83.104  -8.795  74.414  1.00 51.53  ? 88   LEU C CA    1 
ATOM   4201  C  C     . LEU C  2  88   ? 82.097  -9.917  74.533  1.00 51.98  ? 88   LEU C C     1 
ATOM   4202  O  O     . LEU C  2  88   ? 81.398  -10.023 75.533  1.00 58.24  ? 88   LEU C O     1 
ATOM   4203  C  CB    . LEU C  2  88   ? 84.454  -9.304  74.913  1.00 48.56  ? 88   LEU C CB    1 
ATOM   4204  C  CG    . LEU C  2  88   ? 85.608  -8.303  74.914  1.00 53.30  ? 88   LEU C CG    1 
ATOM   4205  C  CD1   . LEU C  2  88   ? 86.926  -9.018  75.165  1.00 47.46  ? 88   LEU C CD1   1 
ATOM   4206  C  CD2   . LEU C  2  88   ? 85.651  -7.511  73.615  1.00 44.88  ? 88   LEU C CD2   1 
ATOM   4207  N  N     . THR C  2  89   ? 82.013  -10.747 73.502  1.00 47.84  ? 89   THR C N     1 
ATOM   4208  C  CA    . THR C  2  89   ? 81.236  -11.969 73.585  1.00 44.38  ? 89   THR C CA    1 
ATOM   4209  C  C     . THR C  2  89   ? 82.079  -13.079 74.206  1.00 45.37  ? 89   THR C C     1 
ATOM   4210  O  O     . THR C  2  89   ? 83.229  -13.281 73.814  1.00 43.11  ? 89   THR C O     1 
ATOM   4211  C  CB    . THR C  2  89   ? 80.738  -12.403 72.210  1.00 43.50  ? 89   THR C CB    1 
ATOM   4212  O  OG1   . THR C  2  89   ? 79.773  -11.454 71.742  1.00 47.31  ? 89   THR C OG1   1 
ATOM   4213  C  CG2   . THR C  2  89   ? 80.100  -13.789 72.274  1.00 41.86  ? 89   THR C CG2   1 
ATOM   4214  N  N     . TYR C  2  90   ? 81.510  -13.777 75.188  1.00 44.30  ? 90   TYR C N     1 
ATOM   4215  C  CA    . TYR C  2  90   ? 82.194  -14.896 75.823  1.00 44.27  ? 90   TYR C CA    1 
ATOM   4216  C  C     . TYR C  2  90   ? 82.051  -16.109 74.907  1.00 43.75  ? 90   TYR C C     1 
ATOM   4217  O  O     . TYR C  2  90   ? 80.945  -16.598 74.659  1.00 39.24  ? 90   TYR C O     1 
ATOM   4218  C  CB    . TYR C  2  90   ? 81.594  -15.159 77.208  1.00 44.17  ? 90   TYR C CB    1 
ATOM   4219  C  CG    . TYR C  2  90   ? 82.221  -16.306 77.970  1.00 43.47  ? 90   TYR C CG    1 
ATOM   4220  C  CD1   . TYR C  2  90   ? 83.554  -16.271 78.343  1.00 49.13  ? 90   TYR C CD1   1 
ATOM   4221  C  CD2   . TYR C  2  90   ? 81.467  -17.413 78.338  1.00 44.79  ? 90   TYR C CD2   1 
ATOM   4222  C  CE1   . TYR C  2  90   ? 84.131  -17.315 79.047  1.00 48.76  ? 90   TYR C CE1   1 
ATOM   4223  C  CE2   . TYR C  2  90   ? 82.032  -18.460 79.043  1.00 47.94  ? 90   TYR C CE2   1 
ATOM   4224  C  CZ    . TYR C  2  90   ? 83.366  -18.405 79.394  1.00 50.55  ? 90   TYR C CZ    1 
ATOM   4225  O  OH    . TYR C  2  90   ? 83.936  -19.443 80.095  1.00 59.45  ? 90   TYR C OH    1 
ATOM   4226  N  N     . GLN C  2  91   ? 83.185  -16.593 74.411  1.00 48.34  ? 91   GLN C N     1 
ATOM   4227  C  CA    . GLN C  2  91   ? 83.176  -17.506 73.277  1.00 43.88  ? 91   GLN C CA    1 
ATOM   4228  C  C     . GLN C  2  91   ? 84.449  -18.332 73.156  1.00 43.77  ? 91   GLN C C     1 
ATOM   4229  O  O     . GLN C  2  91   ? 85.476  -17.996 73.745  1.00 48.21  ? 91   GLN C O     1 
ATOM   4230  C  CB    . GLN C  2  91   ? 82.956  -16.713 71.993  1.00 41.19  ? 91   GLN C CB    1 
ATOM   4231  C  CG    . GLN C  2  91   ? 83.927  -15.563 71.829  1.00 42.72  ? 91   GLN C CG    1 
ATOM   4232  C  CD    . GLN C  2  91   ? 83.627  -14.710 70.614  1.00 46.74  ? 91   GLN C CD    1 
ATOM   4233  O  OE1   . GLN C  2  91   ? 82.499  -14.691 70.109  1.00 49.89  ? 91   GLN C OE1   1 
ATOM   4234  N  NE2   . GLN C  2  91   ? 84.648  -14.015 70.119  1.00 45.08  ? 91   GLN C NE2   1 
ATOM   4235  N  N     . ALA C  2  92   ? 84.369  -19.411 72.380  1.00 43.78  ? 92   ALA C N     1 
ATOM   4236  C  CA    . ALA C  2  92   ? 85.518  -20.272 72.105  1.00 46.45  ? 92   ALA C CA    1 
ATOM   4237  C  C     . ALA C  2  92   ? 85.839  -20.313 70.615  1.00 44.39  ? 92   ALA C C     1 
ATOM   4238  O  O     . ALA C  2  92   ? 84.938  -20.279 69.781  1.00 42.47  ? 92   ALA C O     1 
ATOM   4239  C  CB    . ALA C  2  92   ? 85.254  -21.679 72.611  1.00 45.32  ? 92   ALA C CB    1 
ATOM   4240  N  N     . PRO C  2  93   ? 87.133  -20.392 70.275  1.00 44.05  ? 93   PRO C N     1 
ATOM   4241  C  CA    . PRO C  2  93   ? 87.521  -20.556 68.872  1.00 44.69  ? 93   PRO C CA    1 
ATOM   4242  C  C     . PRO C  2  93   ? 87.116  -21.923 68.327  1.00 41.21  ? 93   PRO C C     1 
ATOM   4243  O  O     . PRO C  2  93   ? 87.348  -22.945 68.966  1.00 41.44  ? 93   PRO C O     1 
ATOM   4244  C  CB    . PRO C  2  93   ? 89.043  -20.423 68.918  1.00 45.35  ? 93   PRO C CB    1 
ATOM   4245  C  CG    . PRO C  2  93   ? 89.411  -20.806 70.308  1.00 44.08  ? 93   PRO C CG    1 
ATOM   4246  C  CD    . PRO C  2  93   ? 88.301  -20.303 71.164  1.00 43.91  ? 93   PRO C CD    1 
ATOM   4247  N  N     . LEU C  2  94   ? 86.507  -21.924 67.151  1.00 40.86  ? 94   LEU C N     1 
ATOM   4248  C  CA    . LEU C  2  94   ? 86.127  -23.151 66.468  1.00 44.95  ? 94   LEU C CA    1 
ATOM   4249  C  C     . LEU C  2  94   ? 87.068  -23.411 65.297  1.00 45.04  ? 94   LEU C C     1 
ATOM   4250  O  O     . LEU C  2  94   ? 87.295  -22.534 64.463  1.00 44.09  ? 94   LEU C O     1 
ATOM   4251  C  CB    . LEU C  2  94   ? 84.693  -23.047 65.951  1.00 39.90  ? 94   LEU C CB    1 
ATOM   4252  C  CG    . LEU C  2  94   ? 84.204  -24.224 65.107  1.00 42.51  ? 94   LEU C CG    1 
ATOM   4253  C  CD1   . LEU C  2  94   ? 83.948  -25.448 65.971  1.00 44.18  ? 94   LEU C CD1   1 
ATOM   4254  C  CD2   . LEU C  2  94   ? 82.958  -23.845 64.342  1.00 51.90  ? 94   LEU C CD2   1 
ATOM   4255  N  N     . TYR C  2  95   ? 87.622  -24.615 65.240  1.00 42.99  ? 95   TYR C N     1 
ATOM   4256  C  CA    . TYR C  2  95   ? 88.449  -25.005 64.108  1.00 46.73  ? 95   TYR C CA    1 
ATOM   4257  C  C     . TYR C  2  95   ? 87.860  -26.260 63.489  1.00 44.36  ? 95   TYR C C     1 
ATOM   4258  O  O     . TYR C  2  95   ? 87.175  -27.028 64.161  1.00 45.60  ? 95   TYR C O     1 
ATOM   4259  C  CB    . TYR C  2  95   ? 89.890  -25.278 64.547  1.00 48.14  ? 95   TYR C CB    1 
ATOM   4260  C  CG    . TYR C  2  95   ? 90.558  -24.147 65.299  1.00 47.89  ? 95   TYR C CG    1 
ATOM   4261  C  CD1   . TYR C  2  95   ? 90.357  -23.978 66.661  1.00 43.34  ? 95   TYR C CD1   1 
ATOM   4262  C  CD2   . TYR C  2  95   ? 91.401  -23.256 64.650  1.00 45.31  ? 95   TYR C CD2   1 
ATOM   4263  C  CE1   . TYR C  2  95   ? 90.970  -22.948 67.352  1.00 44.46  ? 95   TYR C CE1   1 
ATOM   4264  C  CE2   . TYR C  2  95   ? 92.022  -22.221 65.334  1.00 39.38  ? 95   TYR C CE2   1 
ATOM   4265  C  CZ    . TYR C  2  95   ? 91.807  -22.074 66.685  1.00 47.32  ? 95   TYR C CZ    1 
ATOM   4266  O  OH    . TYR C  2  95   ? 92.422  -21.046 67.375  1.00 56.73  ? 95   TYR C OH    1 
ATOM   4267  N  N     . ALA C  2  96   ? 88.124  -26.466 62.208  1.00 45.61  ? 96   ALA C N     1 
ATOM   4268  C  CA    . ALA C  2  96   ? 87.719  -27.699 61.551  1.00 49.18  ? 96   ALA C CA    1 
ATOM   4269  C  C     . ALA C  2  96   ? 88.854  -28.250 60.692  1.00 54.77  ? 96   ALA C C     1 
ATOM   4270  O  O     . ALA C  2  96   ? 89.441  -27.526 59.877  1.00 49.41  ? 96   ALA C O     1 
ATOM   4271  C  CB    . ALA C  2  96   ? 86.474  -27.469 60.714  1.00 47.18  ? 96   ALA C CB    1 
ATOM   4272  N  N     . ARG C  2  97   ? 89.175  -29.526 60.896  1.00 57.67  ? 97   ARG C N     1 
ATOM   4273  C  CA    . ARG C  2  97   ? 90.136  -30.212 60.040  1.00 57.86  ? 97   ARG C CA    1 
ATOM   4274  C  C     . ARG C  2  97   ? 89.414  -30.669 58.785  1.00 53.76  ? 97   ARG C C     1 
ATOM   4275  O  O     . ARG C  2  97   ? 88.483  -31.483 58.839  1.00 48.69  ? 97   ARG C O     1 
ATOM   4276  C  CB    . ARG C  2  97   ? 90.763  -31.414 60.755  1.00 64.55  ? 97   ARG C CB    1 
ATOM   4277  C  CG    . ARG C  2  97   ? 91.416  -31.078 62.097  1.00 75.85  ? 97   ARG C CG    1 
ATOM   4278  C  CD    . ARG C  2  97   ? 92.888  -31.497 62.143  1.00 91.14  ? 97   ARG C CD    1 
ATOM   4279  N  NE    . ARG C  2  97   ? 93.075  -32.885 62.564  1.00 96.54  ? 97   ARG C NE    1 
ATOM   4280  C  CZ    . ARG C  2  97   ? 93.172  -33.920 61.732  1.00 91.95  ? 97   ARG C CZ    1 
ATOM   4281  N  NH1   . ARG C  2  97   ? 93.098  -33.734 60.420  1.00 82.05  ? 97   ARG C NH1   1 
ATOM   4282  N  NH2   . ARG C  2  97   ? 93.344  -35.145 62.214  1.00 90.14  ? 97   ARG C NH2   1 
ATOM   4283  N  N     . LEU C  2  98   ? 89.861  -30.140 57.654  1.00 54.85  ? 98   LEU C N     1 
ATOM   4284  C  CA    . LEU C  2  98   ? 89.247  -30.430 56.372  1.00 57.36  ? 98   LEU C CA    1 
ATOM   4285  C  C     . LEU C  2  98   ? 90.296  -31.005 55.437  1.00 64.12  ? 98   LEU C C     1 
ATOM   4286  O  O     . LEU C  2  98   ? 91.443  -30.556 55.434  1.00 68.42  ? 98   LEU C O     1 
ATOM   4287  C  CB    . LEU C  2  98   ? 88.677  -29.149 55.764  1.00 55.70  ? 98   LEU C CB    1 
ATOM   4288  C  CG    . LEU C  2  98   ? 87.644  -28.352 56.562  1.00 53.33  ? 98   LEU C CG    1 
ATOM   4289  C  CD1   . LEU C  2  98   ? 87.236  -27.118 55.768  1.00 47.73  ? 98   LEU C CD1   1 
ATOM   4290  C  CD2   . LEU C  2  98   ? 86.425  -29.207 56.914  1.00 46.88  ? 98   LEU C CD2   1 
ATOM   4291  N  N     . GLN C  2  99   ? 89.920  -31.999 54.642  1.00 68.30  ? 99   GLN C N     1 
ATOM   4292  C  CA    . GLN C  2  99   ? 90.832  -32.465 53.604  1.00 71.34  ? 99   GLN C CA    1 
ATOM   4293  C  C     . GLN C  2  99   ? 90.270  -32.251 52.205  1.00 65.06  ? 99   GLN C C     1 
ATOM   4294  O  O     . GLN C  2  99   ? 89.164  -32.692 51.877  1.00 64.52  ? 99   GLN C O     1 
ATOM   4295  C  CB    . GLN C  2  99   ? 91.280  -33.917 53.824  1.00 76.55  ? 99   GLN C CB    1 
ATOM   4296  C  CG    . GLN C  2  99   ? 90.198  -34.970 53.691  1.00 78.09  ? 99   GLN C CG    1 
ATOM   4297  C  CD    . GLN C  2  99   ? 90.748  -36.376 53.830  1.00 86.42  ? 99   GLN C CD    1 
ATOM   4298  O  OE1   . GLN C  2  99   ? 90.557  -37.217 52.952  1.00 98.79  ? 99   GLN C OE1   1 
ATOM   4299  N  NE2   . GLN C  2  99   ? 91.438  -36.639 54.937  1.00 77.85  ? 99   GLN C NE2   1 
ATOM   4300  N  N     . LEU C  2  100  ? 91.039  -31.526 51.401  1.00 73.14  ? 100  LEU C N     1 
ATOM   4301  C  CA    . LEU C  2  100  ? 90.743  -31.357 49.989  1.00 79.51  ? 100  LEU C CA    1 
ATOM   4302  C  C     . LEU C  2  100  ? 91.279  -32.555 49.223  1.00 78.86  ? 100  LEU C C     1 
ATOM   4303  O  O     . LEU C  2  100  ? 92.442  -32.923 49.360  1.00 80.90  ? 100  LEU C O     1 
ATOM   4304  C  CB    . LEU C  2  100  ? 91.382  -30.079 49.454  1.00 76.42  ? 100  LEU C CB    1 
ATOM   4305  C  CG    . LEU C  2  100  ? 91.078  -29.781 47.991  1.00 65.44  ? 100  LEU C CG    1 
ATOM   4306  C  CD1   . LEU C  2  100  ? 89.570  -29.757 47.764  1.00 69.09  ? 100  LEU C CD1   1 
ATOM   4307  C  CD2   . LEU C  2  100  ? 91.707  -28.460 47.600  1.00 71.70  ? 100  LEU C CD2   1 
ATOM   4308  N  N     . ILE C  2  101  ? 90.416  -33.167 48.426  1.00 81.62  ? 101  ILE C N     1 
ATOM   4309  C  CA    . ILE C  2  101  ? 90.780  -34.337 47.650  1.00 84.77  ? 101  ILE C CA    1 
ATOM   4310  C  C     . ILE C  2  101  ? 90.494  -34.058 46.188  1.00 90.61  ? 101  ILE C C     1 
ATOM   4311  O  O     . ILE C  2  101  ? 89.461  -33.490 45.849  1.00 85.28  ? 101  ILE C O     1 
ATOM   4312  C  CB    . ILE C  2  101  ? 89.955  -35.567 48.076  1.00 84.80  ? 101  ILE C CB    1 
ATOM   4313  C  CG1   . ILE C  2  101  ? 89.946  -35.711 49.601  1.00 93.03  ? 101  ILE C CG1   1 
ATOM   4314  C  CG2   . ILE C  2  101  ? 90.488  -36.825 47.413  1.00 88.88  ? 101  ILE C CG2   1 
ATOM   4315  C  CD1   . ILE C  2  101  ? 89.026  -36.810 50.112  1.00 94.55  ? 101  ILE C CD1   1 
ATOM   4316  N  N     . HIS C  2  102  ? 91.420  -34.440 45.319  1.00 106.04 ? 102  HIS C N     1 
ATOM   4317  C  CA    . HIS C  2  102  ? 91.143  -34.447 43.895  1.00 106.90 ? 102  HIS C CA    1 
ATOM   4318  C  C     . HIS C  2  102  ? 90.863  -35.899 43.532  1.00 112.42 ? 102  HIS C C     1 
ATOM   4319  O  O     . HIS C  2  102  ? 91.759  -36.738 43.585  1.00 112.74 ? 102  HIS C O     1 
ATOM   4320  C  CB    . HIS C  2  102  ? 92.338  -33.907 43.111  1.00 104.71 ? 102  HIS C CB    1 
ATOM   4321  C  CG    . HIS C  2  102  ? 91.973  -33.297 41.793  1.00 117.48 ? 102  HIS C CG    1 
ATOM   4322  N  ND1   . HIS C  2  102  ? 91.325  -34.000 40.800  1.00 120.34 ? 102  HIS C ND1   1 
ATOM   4323  C  CD2   . HIS C  2  102  ? 92.171  -32.050 41.304  1.00 115.23 ? 102  HIS C CD2   1 
ATOM   4324  C  CE1   . HIS C  2  102  ? 91.138  -33.211 39.756  1.00 120.65 ? 102  HIS C CE1   1 
ATOM   4325  N  NE2   . HIS C  2  102  ? 91.642  -32.023 40.036  1.00 115.71 ? 102  HIS C NE2   1 
ATOM   4326  N  N     . LYS C  2  103  ? 89.613  -36.204 43.197  1.00 116.83 ? 103  LYS C N     1 
ATOM   4327  C  CA    . LYS C  2  103  ? 89.222  -37.582 42.909  1.00 115.89 ? 103  LYS C CA    1 
ATOM   4328  C  C     . LYS C  2  103  ? 89.913  -38.112 41.652  1.00 122.57 ? 103  LYS C C     1 
ATOM   4329  O  O     . LYS C  2  103  ? 90.156  -39.313 41.523  1.00 122.52 ? 103  LYS C O     1 
ATOM   4330  C  CB    . LYS C  2  103  ? 87.696  -37.718 42.800  1.00 103.67 ? 103  LYS C CB    1 
ATOM   4331  C  CG    . LYS C  2  103  ? 86.928  -36.400 42.753  1.00 96.01  ? 103  LYS C CG    1 
ATOM   4332  C  CD    . LYS C  2  103  ? 86.974  -35.754 41.373  1.00 108.01 ? 103  LYS C CD    1 
ATOM   4333  C  CE    . LYS C  2  103  ? 85.982  -34.607 41.272  1.00 101.29 ? 103  LYS C CE    1 
ATOM   4334  N  NZ    . LYS C  2  103  ? 84.594  -35.051 41.595  1.00 100.92 ? 103  LYS C NZ    1 
ATOM   4335  N  N     . ASP C  2  104  ? 90.216  -37.206 40.727  1.00 117.64 ? 104  ASP C N     1 
ATOM   4336  C  CA    . ASP C  2  104  ? 90.969  -37.551 39.528  1.00 121.56 ? 104  ASP C CA    1 
ATOM   4337  C  C     . ASP C  2  104  ? 92.425  -37.901 39.853  1.00 121.08 ? 104  ASP C C     1 
ATOM   4338  O  O     . ASP C  2  104  ? 92.889  -39.005 39.564  1.00 118.95 ? 104  ASP C O     1 
ATOM   4339  C  CB    . ASP C  2  104  ? 90.911  -36.390 38.532  1.00 126.38 ? 104  ASP C CB    1 
ATOM   4340  C  CG    . ASP C  2  104  ? 91.418  -36.769 37.154  1.00 127.56 ? 104  ASP C CG    1 
ATOM   4341  O  OD1   . ASP C  2  104  ? 92.028  -35.903 36.492  1.00 123.13 ? 104  ASP C OD1   1 
ATOM   4342  O  OD2   . ASP C  2  104  ? 91.198  -37.924 36.729  1.00 127.33 ? 104  ASP C OD2   1 
ATOM   4343  N  N     . THR C  2  105  ? 93.127  -36.960 40.482  1.00 122.20 ? 105  THR C N     1 
ATOM   4344  C  CA    . THR C  2  105  ? 94.553  -37.108 40.774  1.00 119.77 ? 105  THR C CA    1 
ATOM   4345  C  C     . THR C  2  105  ? 94.815  -38.085 41.926  1.00 122.81 ? 105  THR C C     1 
ATOM   4346  O  O     . THR C  2  105  ? 95.778  -38.851 41.894  1.00 129.99 ? 105  THR C O     1 
ATOM   4347  C  CB    . THR C  2  105  ? 95.210  -35.735 41.107  1.00 111.48 ? 105  THR C CB    1 
ATOM   4348  O  OG1   . THR C  2  105  ? 94.948  -34.796 40.054  1.00 97.12  ? 105  THR C OG1   1 
ATOM   4349  C  CG2   . THR C  2  105  ? 96.715  -35.878 41.287  1.00 101.10 ? 105  THR C CG2   1 
ATOM   4350  N  N     . GLY C  2  106  ? 93.945  -38.061 42.932  1.00 128.33 ? 106  GLY C N     1 
ATOM   4351  C  CA    . GLY C  2  106  ? 94.158  -38.812 44.159  1.00 126.90 ? 106  GLY C CA    1 
ATOM   4352  C  C     . GLY C  2  106  ? 94.772  -37.900 45.206  1.00 123.74 ? 106  GLY C C     1 
ATOM   4353  O  O     . GLY C  2  106  ? 94.816  -38.225 46.398  1.00 109.15 ? 106  GLY C O     1 
ATOM   4354  N  N     . LEU C  2  107  ? 95.222  -36.738 44.734  1.00 121.61 ? 107  LEU C N     1 
ATOM   4355  C  CA    . LEU C  2  107  ? 95.899  -35.720 45.535  1.00 113.73 ? 107  LEU C CA    1 
ATOM   4356  C  C     . LEU C  2  107  ? 95.127  -35.361 46.805  1.00 104.22 ? 107  LEU C C     1 
ATOM   4357  O  O     . LEU C  2  107  ? 93.906  -35.215 46.783  1.00 99.37  ? 107  LEU C O     1 
ATOM   4358  C  CB    . LEU C  2  107  ? 96.130  -34.472 44.661  1.00 106.77 ? 107  LEU C CB    1 
ATOM   4359  C  CG    . LEU C  2  107  ? 96.512  -33.079 45.192  1.00 109.19 ? 107  LEU C CG    1 
ATOM   4360  C  CD1   . LEU C  2  107  ? 95.308  -32.294 45.756  1.00 97.92  ? 107  LEU C CD1   1 
ATOM   4361  C  CD2   . LEU C  2  107  ? 97.655  -33.152 46.205  1.00 111.44 ? 107  LEU C CD2   1 
ATOM   4362  N  N     . ILE C  2  108  ? 95.852  -35.224 47.911  1.00 100.39 ? 108  ILE C N     1 
ATOM   4363  C  CA    . ILE C  2  108  ? 95.245  -34.842 49.179  1.00 94.60  ? 108  ILE C CA    1 
ATOM   4364  C  C     . ILE C  2  108  ? 95.994  -33.702 49.870  1.00 89.60  ? 108  ILE C C     1 
ATOM   4365  O  O     . ILE C  2  108  ? 97.151  -33.852 50.264  1.00 91.08  ? 108  ILE C O     1 
ATOM   4366  C  CB    . ILE C  2  108  ? 95.158  -36.040 50.150  1.00 93.92  ? 108  ILE C CB    1 
ATOM   4367  C  CG1   . ILE C  2  108  ? 94.332  -37.174 49.532  1.00 97.02  ? 108  ILE C CG1   1 
ATOM   4368  C  CG2   . ILE C  2  108  ? 94.570  -35.604 51.490  1.00 90.71  ? 108  ILE C CG2   1 
ATOM   4369  C  CD1   . ILE C  2  108  ? 94.016  -38.304 50.493  1.00 99.80  ? 108  ILE C CD1   1 
ATOM   4370  N  N     . LYS C  2  109  ? 95.321  -32.565 50.013  1.00 85.52  ? 109  LYS C N     1 
ATOM   4371  C  CA    . LYS C  2  109  ? 95.810  -31.483 50.860  1.00 82.49  ? 109  LYS C CA    1 
ATOM   4372  C  C     . LYS C  2  109  ? 94.871  -31.318 52.061  1.00 78.50  ? 109  LYS C C     1 
ATOM   4373  O  O     . LYS C  2  109  ? 93.661  -31.171 51.903  1.00 78.66  ? 109  LYS C O     1 
ATOM   4374  C  CB    . LYS C  2  109  ? 95.938  -30.178 50.070  1.00 77.67  ? 109  LYS C CB    1 
ATOM   4375  C  CG    . LYS C  2  109  ? 96.248  -28.949 50.925  1.00 80.89  ? 109  LYS C CG    1 
ATOM   4376  C  CD    . LYS C  2  109  ? 97.549  -29.099 51.703  1.00 83.42  ? 109  LYS C CD    1 
ATOM   4377  C  CE    . LYS C  2  109  ? 97.930  -27.807 52.429  1.00 82.84  ? 109  LYS C CE    1 
ATOM   4378  N  NZ    . LYS C  2  109  ? 97.007  -27.462 53.550  1.00 82.48  ? 109  LYS C NZ    1 
ATOM   4379  N  N     . GLU C  2  110  ? 95.439  -31.352 53.261  1.00 75.12  ? 110  GLU C N     1 
ATOM   4380  C  CA    . GLU C  2  110  ? 94.651  -31.344 54.485  1.00 68.77  ? 110  GLU C CA    1 
ATOM   4381  C  C     . GLU C  2  110  ? 95.113  -30.236 55.423  1.00 65.77  ? 110  GLU C C     1 
ATOM   4382  O  O     . GLU C  2  110  ? 96.311  -30.026 55.606  1.00 70.75  ? 110  GLU C O     1 
ATOM   4383  C  CB    . GLU C  2  110  ? 94.754  -32.707 55.167  1.00 70.87  ? 110  GLU C CB    1 
ATOM   4384  C  CG    . GLU C  2  110  ? 94.152  -32.783 56.555  1.00 74.26  ? 110  GLU C CG    1 
ATOM   4385  C  CD    . GLU C  2  110  ? 94.347  -34.152 57.182  1.00 83.68  ? 110  GLU C CD    1 
ATOM   4386  O  OE1   . GLU C  2  110  ? 94.533  -34.226 58.418  1.00 84.19  ? 110  GLU C OE1   1 
ATOM   4387  O  OE2   . GLU C  2  110  ? 94.317  -35.154 56.432  1.00 77.58  ? 110  GLU C OE2   1 
ATOM   4388  N  N     . ASP C  2  111  ? 94.157  -29.523 56.009  1.00 65.08  ? 111  ASP C N     1 
ATOM   4389  C  CA    . ASP C  2  111  ? 94.474  -28.404 56.888  1.00 67.38  ? 111  ASP C CA    1 
ATOM   4390  C  C     . ASP C  2  111  ? 93.365  -28.156 57.920  1.00 59.17  ? 111  ASP C C     1 
ATOM   4391  O  O     . ASP C  2  111  ? 92.220  -28.561 57.730  1.00 61.07  ? 111  ASP C O     1 
ATOM   4392  C  CB    . ASP C  2  111  ? 94.746  -27.142 56.057  1.00 66.50  ? 111  ASP C CB    1 
ATOM   4393  C  CG    . ASP C  2  111  ? 95.306  -25.996 56.891  1.00 82.77  ? 111  ASP C CG    1 
ATOM   4394  O  OD1   . ASP C  2  111  ? 95.074  -24.823 56.521  1.00 81.29  ? 111  ASP C OD1   1 
ATOM   4395  O  OD2   . ASP C  2  111  ? 95.972  -26.267 57.919  1.00 85.51  ? 111  ASP C OD2   1 
ATOM   4396  N  N     . GLU C  2  112  ? 93.717  -27.500 59.021  1.00 56.49  ? 112  GLU C N     1 
ATOM   4397  C  CA    . GLU C  2  112  ? 92.739  -27.131 60.036  1.00 56.61  ? 112  GLU C CA    1 
ATOM   4398  C  C     . GLU C  2  112  ? 92.416  -25.656 59.866  1.00 57.47  ? 112  GLU C C     1 
ATOM   4399  O  O     . GLU C  2  112  ? 93.248  -24.790 60.153  1.00 58.41  ? 112  GLU C O     1 
ATOM   4400  C  CB    . GLU C  2  112  ? 93.299  -27.384 61.439  1.00 51.19  ? 112  GLU C CB    1 
ATOM   4401  C  CG    . GLU C  2  112  ? 92.323  -27.113 62.569  1.00 54.50  ? 112  GLU C CG    1 
ATOM   4402  C  CD    . GLU C  2  112  ? 93.008  -26.983 63.927  1.00 62.19  ? 112  GLU C CD    1 
ATOM   4403  O  OE1   . GLU C  2  112  ? 93.965  -26.179 64.045  1.00 56.03  ? 112  GLU C OE1   1 
ATOM   4404  O  OE2   . GLU C  2  112  ? 92.585  -27.684 64.877  1.00 53.80  ? 112  GLU C OE2   1 
ATOM   4405  N  N     . VAL C  2  113  ? 91.207  -25.366 59.397  1.00 53.99  ? 113  VAL C N     1 
ATOM   4406  C  CA    . VAL C  2  113  ? 90.834  -23.983 59.141  1.00 51.28  ? 113  VAL C CA    1 
ATOM   4407  C  C     . VAL C  2  113  ? 90.043  -23.393 60.300  1.00 52.23  ? 113  VAL C C     1 
ATOM   4408  O  O     . VAL C  2  113  ? 89.246  -24.074 60.950  1.00 50.87  ? 113  VAL C O     1 
ATOM   4409  C  CB    . VAL C  2  113  ? 90.076  -23.807 57.800  1.00 53.77  ? 113  VAL C CB    1 
ATOM   4410  C  CG1   . VAL C  2  113  ? 90.935  -24.277 56.646  1.00 55.93  ? 113  VAL C CG1   1 
ATOM   4411  C  CG2   . VAL C  2  113  ? 88.766  -24.562 57.818  1.00 60.38  ? 113  VAL C CG2   1 
ATOM   4412  N  N     . PHE C  2  114  ? 90.298  -22.120 60.562  1.00 52.62  ? 114  PHE C N     1 
ATOM   4413  C  CA    . PHE C  2  114  ? 89.650  -21.405 61.645  1.00 48.95  ? 114  PHE C CA    1 
ATOM   4414  C  C     . PHE C  2  114  ? 88.327  -20.820 61.163  1.00 51.80  ? 114  PHE C C     1 
ATOM   4415  O  O     . PHE C  2  114  ? 88.293  -20.027 60.225  1.00 50.68  ? 114  PHE C O     1 
ATOM   4416  C  CB    . PHE C  2  114  ? 90.579  -20.307 62.158  1.00 48.37  ? 114  PHE C CB    1 
ATOM   4417  C  CG    . PHE C  2  114  ? 89.971  -19.448 63.210  1.00 48.95  ? 114  PHE C CG    1 
ATOM   4418  C  CD1   . PHE C  2  114  ? 89.553  -19.996 64.408  1.00 46.97  ? 114  PHE C CD1   1 
ATOM   4419  C  CD2   . PHE C  2  114  ? 89.823  -18.087 63.006  1.00 53.85  ? 114  PHE C CD2   1 
ATOM   4420  C  CE1   . PHE C  2  114  ? 88.986  -19.204 65.385  1.00 49.59  ? 114  PHE C CE1   1 
ATOM   4421  C  CE2   . PHE C  2  114  ? 89.258  -17.286 63.977  1.00 55.23  ? 114  PHE C CE2   1 
ATOM   4422  C  CZ    . PHE C  2  114  ? 88.841  -17.844 65.171  1.00 52.29  ? 114  PHE C CZ    1 
ATOM   4423  N  N     . LEU C  2  115  ? 87.243  -21.243 61.807  1.00 55.05  ? 115  LEU C N     1 
ATOM   4424  C  CA    . LEU C  2  115  ? 85.883  -20.857 61.432  1.00 53.92  ? 115  LEU C CA    1 
ATOM   4425  C  C     . LEU C  2  115  ? 85.304  -19.698 62.238  1.00 51.58  ? 115  LEU C C     1 
ATOM   4426  O  O     . LEU C  2  115  ? 84.123  -19.389 62.112  1.00 59.00  ? 115  LEU C O     1 
ATOM   4427  C  CB    . LEU C  2  115  ? 84.941  -22.061 61.515  1.00 51.04  ? 115  LEU C CB    1 
ATOM   4428  C  CG    . LEU C  2  115  ? 85.323  -23.220 60.597  1.00 48.75  ? 115  LEU C CG    1 
ATOM   4429  C  CD1   . LEU C  2  115  ? 84.237  -24.277 60.587  1.00 43.42  ? 115  LEU C CD1   1 
ATOM   4430  C  CD2   . LEU C  2  115  ? 85.598  -22.703 59.197  1.00 50.15  ? 115  LEU C CD2   1 
ATOM   4431  N  N     . GLY C  2  116  ? 86.111  -19.085 63.094  1.00 47.06  ? 116  GLY C N     1 
ATOM   4432  C  CA    . GLY C  2  116  ? 85.613  -18.015 63.941  1.00 52.80  ? 116  GLY C CA    1 
ATOM   4433  C  C     . GLY C  2  116  ? 85.300  -18.509 65.340  1.00 48.80  ? 116  GLY C C     1 
ATOM   4434  O  O     . GLY C  2  116  ? 85.725  -19.590 65.720  1.00 47.06  ? 116  GLY C O     1 
ATOM   4435  N  N     . HIS C  2  117  ? 84.554  -17.723 66.108  1.00 46.38  ? 117  HIS C N     1 
ATOM   4436  C  CA    . HIS C  2  117  ? 84.237  -18.089 67.488  1.00 46.36  ? 117  HIS C CA    1 
ATOM   4437  C  C     . HIS C  2  117  ? 82.763  -18.453 67.674  1.00 42.92  ? 117  HIS C C     1 
ATOM   4438  O  O     . HIS C  2  117  ? 81.906  -18.007 66.916  1.00 47.46  ? 117  HIS C O     1 
ATOM   4439  C  CB    . HIS C  2  117  ? 84.601  -16.953 68.437  1.00 44.67  ? 117  HIS C CB    1 
ATOM   4440  C  CG    . HIS C  2  117  ? 86.070  -16.684 68.532  1.00 47.95  ? 117  HIS C CG    1 
ATOM   4441  N  ND1   . HIS C  2  117  ? 86.828  -17.071 69.617  1.00 48.28  ? 117  HIS C ND1   1 
ATOM   4442  C  CD2   . HIS C  2  117  ? 86.917  -16.051 67.686  1.00 50.99  ? 117  HIS C CD2   1 
ATOM   4443  C  CE1   . HIS C  2  117  ? 88.081  -16.695 69.432  1.00 49.69  ? 117  HIS C CE1   1 
ATOM   4444  N  NE2   . HIS C  2  117  ? 88.162  -16.074 68.269  1.00 54.66  ? 117  HIS C NE2   1 
ATOM   4445  N  N     . ILE C  2  118  ? 82.477  -19.284 68.673  1.00 44.03  ? 118  ILE C N     1 
ATOM   4446  C  CA    . ILE C  2  118  ? 81.097  -19.600 69.033  1.00 46.94  ? 118  ILE C CA    1 
ATOM   4447  C  C     . ILE C  2  118  ? 80.863  -19.242 70.493  1.00 40.86  ? 118  ILE C C     1 
ATOM   4448  O  O     . ILE C  2  118  ? 81.688  -19.548 71.345  1.00 42.83  ? 118  ILE C O     1 
ATOM   4449  C  CB    . ILE C  2  118  ? 80.812  -21.097 68.841  1.00 42.25  ? 118  ILE C CB    1 
ATOM   4450  C  CG1   . ILE C  2  118  ? 80.487  -21.389 67.383  1.00 45.73  ? 118  ILE C CG1   1 
ATOM   4451  C  CG2   . ILE C  2  118  ? 79.654  -21.547 69.706  1.00 41.86  ? 118  ILE C CG2   1 
ATOM   4452  C  CD1   . ILE C  2  118  ? 80.084  -22.820 67.153  1.00 56.71  ? 118  ILE C CD1   1 
ATOM   4453  N  N     . PRO C  2  119  ? 79.717  -18.619 70.794  1.00 39.15  ? 119  PRO C N     1 
ATOM   4454  C  CA    . PRO C  2  119  ? 79.470  -18.168 72.166  1.00 44.54  ? 119  PRO C CA    1 
ATOM   4455  C  C     . PRO C  2  119  ? 79.320  -19.328 73.147  1.00 39.93  ? 119  PRO C C     1 
ATOM   4456  O  O     . PRO C  2  119  ? 78.706  -20.349 72.821  1.00 36.52  ? 119  PRO C O     1 
ATOM   4457  C  CB    . PRO C  2  119  ? 78.161  -17.385 72.040  1.00 42.23  ? 119  PRO C CB    1 
ATOM   4458  C  CG    . PRO C  2  119  ? 78.158  -16.916 70.631  1.00 41.44  ? 119  PRO C CG    1 
ATOM   4459  C  CD    . PRO C  2  119  ? 78.742  -18.052 69.851  1.00 41.09  ? 119  PRO C CD    1 
ATOM   4460  N  N     . LEU C  2  120  ? 79.895  -19.166 74.335  1.00 37.83  ? 120  LEU C N     1 
ATOM   4461  C  CA    . LEU C  2  120  ? 79.813  -20.194 75.367  1.00 42.70  ? 120  LEU C CA    1 
ATOM   4462  C  C     . LEU C  2  120  ? 78.733  -19.866 76.380  1.00 40.19  ? 120  LEU C C     1 
ATOM   4463  O  O     . LEU C  2  120  ? 78.526  -18.709 76.740  1.00 40.60  ? 120  LEU C O     1 
ATOM   4464  C  CB    . LEU C  2  120  ? 81.156  -20.369 76.085  1.00 40.54  ? 120  LEU C CB    1 
ATOM   4465  C  CG    . LEU C  2  120  ? 82.343  -20.779 75.213  1.00 41.85  ? 120  LEU C CG    1 
ATOM   4466  C  CD1   . LEU C  2  120  ? 83.599  -20.826 76.034  1.00 40.13  ? 120  LEU C CD1   1 
ATOM   4467  C  CD2   . LEU C  2  120  ? 82.102  -22.120 74.534  1.00 39.40  ? 120  LEU C CD2   1 
ATOM   4468  N  N     . MET C  2  121  ? 78.040  -20.895 76.837  1.00 41.62  ? 121  MET C N     1 
ATOM   4469  C  CA    . MET C  2  121  ? 77.078  -20.726 77.908  1.00 44.06  ? 121  MET C CA    1 
ATOM   4470  C  C     . MET C  2  121  ? 77.848  -20.701 79.233  1.00 43.54  ? 121  MET C C     1 
ATOM   4471  O  O     . MET C  2  121  ? 78.784  -21.481 79.430  1.00 40.11  ? 121  MET C O     1 
ATOM   4472  C  CB    . MET C  2  121  ? 76.042  -21.855 77.857  1.00 36.19  ? 121  MET C CB    1 
ATOM   4473  C  CG    . MET C  2  121  ? 75.001  -21.826 78.948  1.00 37.25  ? 121  MET C CG    1 
ATOM   4474  S  SD    . MET C  2  121  ? 73.804  -23.168 78.791  1.00 48.11  ? 121  MET C SD    1 
ATOM   4475  C  CE    . MET C  2  121  ? 72.777  -22.562 77.458  1.00 38.39  ? 121  MET C CE    1 
ATOM   4476  N  N     . THR C  2  122  ? 77.480  -19.782 80.122  1.00 43.53  ? 122  THR C N     1 
ATOM   4477  C  CA    . THR C  2  122  ? 78.084  -19.716 81.451  1.00 45.90  ? 122  THR C CA    1 
ATOM   4478  C  C     . THR C  2  122  ? 77.561  -20.850 82.333  1.00 49.01  ? 122  THR C C     1 
ATOM   4479  O  O     . THR C  2  122  ? 76.772  -21.686 81.881  1.00 49.90  ? 122  THR C O     1 
ATOM   4480  C  CB    . THR C  2  122  ? 77.792  -18.376 82.137  1.00 45.49  ? 122  THR C CB    1 
ATOM   4481  O  OG1   . THR C  2  122  ? 76.375  -18.202 82.249  1.00 46.66  ? 122  THR C OG1   1 
ATOM   4482  C  CG2   . THR C  2  122  ? 78.385  -17.220 81.342  1.00 40.40  ? 122  THR C CG2   1 
ATOM   4483  N  N     . GLU C  2  123  ? 77.999  -20.883 83.589  1.00 49.52  ? 123  GLU C N     1 
ATOM   4484  C  CA    . GLU C  2  123  ? 77.615  -21.968 84.484  1.00 57.61  ? 123  GLU C CA    1 
ATOM   4485  C  C     . GLU C  2  123  ? 76.124  -21.957 84.770  1.00 59.68  ? 123  GLU C C     1 
ATOM   4486  O  O     . GLU C  2  123  ? 75.522  -23.006 85.005  1.00 61.57  ? 123  GLU C O     1 
ATOM   4487  C  CB    . GLU C  2  123  ? 78.380  -21.890 85.803  1.00 72.09  ? 123  GLU C CB    1 
ATOM   4488  C  CG    . GLU C  2  123  ? 79.852  -22.238 85.717  1.00 80.52  ? 123  GLU C CG    1 
ATOM   4489  C  CD    . GLU C  2  123  ? 80.528  -22.174 87.074  1.00 100.60 ? 123  GLU C CD    1 
ATOM   4490  O  OE1   . GLU C  2  123  ? 79.839  -22.408 88.096  1.00 81.48  ? 123  GLU C OE1   1 
ATOM   4491  O  OE2   . GLU C  2  123  ? 81.743  -21.881 87.119  1.00 119.00 ? 123  GLU C OE2   1 
ATOM   4492  N  N     . ASP C  2  124  ? 75.532  -20.767 84.745  1.00 57.09  ? 124  ASP C N     1 
ATOM   4493  C  CA    . ASP C  2  124  ? 74.131  -20.602 85.116  1.00 54.40  ? 124  ASP C CA    1 
ATOM   4494  C  C     . ASP C  2  124  ? 73.161  -20.676 83.935  1.00 49.42  ? 124  ASP C C     1 
ATOM   4495  O  O     . ASP C  2  124  ? 71.966  -20.474 84.103  1.00 53.88  ? 124  ASP C O     1 
ATOM   4496  C  CB    . ASP C  2  124  ? 73.933  -19.294 85.878  1.00 56.36  ? 124  ASP C CB    1 
ATOM   4497  C  CG    . ASP C  2  124  ? 74.298  -18.082 85.052  1.00 59.71  ? 124  ASP C CG    1 
ATOM   4498  O  OD1   . ASP C  2  124  ? 75.511  -17.796 84.917  1.00 65.14  ? 124  ASP C OD1   1 
ATOM   4499  O  OD2   . ASP C  2  124  ? 73.373  -17.416 84.539  1.00 56.42  ? 124  ASP C OD2   1 
ATOM   4500  N  N     . GLY C  2  125  ? 73.667  -20.959 82.742  1.00 50.72  ? 125  GLY C N     1 
ATOM   4501  C  CA    . GLY C  2  125  ? 72.793  -21.173 81.603  1.00 44.12  ? 125  GLY C CA    1 
ATOM   4502  C  C     . GLY C  2  125  ? 72.527  -19.944 80.753  1.00 42.09  ? 125  GLY C C     1 
ATOM   4503  O  O     . GLY C  2  125  ? 71.599  -19.926 79.946  1.00 39.88  ? 125  GLY C O     1 
ATOM   4504  N  N     . SER C  2  126  ? 73.343  -18.912 80.924  1.00 42.27  ? 126  SER C N     1 
ATOM   4505  C  CA    . SER C  2  126  ? 73.166  -17.693 80.152  1.00 41.20  ? 126  SER C CA    1 
ATOM   4506  C  C     . SER C  2  126  ? 74.364  -17.425 79.258  1.00 42.08  ? 126  SER C C     1 
ATOM   4507  O  O     . SER C  2  126  ? 75.341  -18.171 79.258  1.00 43.19  ? 126  SER C O     1 
ATOM   4508  C  CB    . SER C  2  126  ? 72.922  -16.500 81.079  1.00 46.18  ? 126  SER C CB    1 
ATOM   4509  O  OG    . SER C  2  126  ? 73.967  -16.363 82.022  1.00 43.68  ? 126  SER C OG    1 
ATOM   4510  N  N     . PHE C  2  127  ? 74.279  -16.344 78.495  1.00 44.10  ? 127  PHE C N     1 
ATOM   4511  C  CA    . PHE C  2  127  ? 75.343  -15.961 77.585  1.00 42.32  ? 127  PHE C CA    1 
ATOM   4512  C  C     . PHE C  2  127  ? 75.793  -14.541 77.865  1.00 44.50  ? 127  PHE C C     1 
ATOM   4513  O  O     . PHE C  2  127  ? 75.082  -13.768 78.493  1.00 49.50  ? 127  PHE C O     1 
ATOM   4514  C  CB    . PHE C  2  127  ? 74.870  -16.073 76.141  1.00 35.21  ? 127  PHE C CB    1 
ATOM   4515  C  CG    . PHE C  2  127  ? 74.628  -17.487 75.688  1.00 40.92  ? 127  PHE C CG    1 
ATOM   4516  C  CD1   . PHE C  2  127  ? 73.386  -18.084 75.862  1.00 39.87  ? 127  PHE C CD1   1 
ATOM   4517  C  CD2   . PHE C  2  127  ? 75.640  -18.218 75.080  1.00 36.64  ? 127  PHE C CD2   1 
ATOM   4518  C  CE1   . PHE C  2  127  ? 73.159  -19.389 75.437  1.00 37.39  ? 127  PHE C CE1   1 
ATOM   4519  C  CE2   . PHE C  2  127  ? 75.420  -19.518 74.659  1.00 36.33  ? 127  PHE C CE2   1 
ATOM   4520  C  CZ    . PHE C  2  127  ? 74.177  -20.105 74.838  1.00 35.39  ? 127  PHE C CZ    1 
ATOM   4521  N  N     . ILE C  2  128  ? 76.994  -14.213 77.418  1.00 41.22  ? 128  ILE C N     1 
ATOM   4522  C  CA    . ILE C  2  128  ? 77.470  -12.846 77.439  1.00 38.05  ? 128  ILE C CA    1 
ATOM   4523  C  C     . ILE C  2  128  ? 77.733  -12.473 75.986  1.00 44.87  ? 128  ILE C C     1 
ATOM   4524  O  O     . ILE C  2  128  ? 78.671  -12.974 75.368  1.00 47.16  ? 128  ILE C O     1 
ATOM   4525  C  CB    . ILE C  2  128  ? 78.758  -12.746 78.252  1.00 41.80  ? 128  ILE C CB    1 
ATOM   4526  C  CG1   . ILE C  2  128  ? 78.512  -13.261 79.675  1.00 43.66  ? 128  ILE C CG1   1 
ATOM   4527  C  CG2   . ILE C  2  128  ? 79.276  -11.322 78.257  1.00 49.09  ? 128  ILE C CG2   1 
ATOM   4528  C  CD1   . ILE C  2  128  ? 79.769  -13.497 80.477  1.00 40.77  ? 128  ILE C CD1   1 
ATOM   4529  N  N     . ILE C  2  129  ? 76.890  -11.605 75.441  1.00 44.79  ? 129  ILE C N     1 
ATOM   4530  C  CA    . ILE C  2  129  ? 76.935  -11.256 74.026  1.00 44.72  ? 129  ILE C CA    1 
ATOM   4531  C  C     . ILE C  2  129  ? 77.151  -9.756  73.898  1.00 51.73  ? 129  ILE C C     1 
ATOM   4532  O  O     . ILE C  2  129  ? 76.262  -8.968  74.216  1.00 58.49  ? 129  ILE C O     1 
ATOM   4533  C  CB    . ILE C  2  129  ? 75.611  -11.636 73.328  1.00 45.66  ? 129  ILE C CB    1 
ATOM   4534  C  CG1   . ILE C  2  129  ? 75.268  -13.109 73.576  1.00 47.07  ? 129  ILE C CG1   1 
ATOM   4535  C  CG2   . ILE C  2  129  ? 75.677  -11.346 71.851  1.00 43.38  ? 129  ILE C CG2   1 
ATOM   4536  C  CD1   . ILE C  2  129  ? 76.284  -14.078 73.026  1.00 42.68  ? 129  ILE C CD1   1 
ATOM   4537  N  N     . ASN C  2  130  ? 78.330  -9.367  73.426  1.00 56.07  ? 130  ASN C N     1 
ATOM   4538  C  CA    . ASN C  2  130  ? 78.728  -7.960  73.384  1.00 59.94  ? 130  ASN C CA    1 
ATOM   4539  C  C     . ASN C  2  130  ? 78.644  -7.239  74.729  1.00 58.06  ? 130  ASN C C     1 
ATOM   4540  O  O     . ASN C  2  130  ? 78.253  -6.072  74.793  1.00 57.18  ? 130  ASN C O     1 
ATOM   4541  C  CB    . ASN C  2  130  ? 77.953  -7.203  72.305  1.00 56.47  ? 130  ASN C CB    1 
ATOM   4542  C  CG    . ASN C  2  130  ? 78.397  -7.589  70.912  1.00 67.63  ? 130  ASN C CG    1 
ATOM   4543  O  OD1   . ASN C  2  130  ? 77.591  -8.007  70.081  1.00 77.01  ? 130  ASN C OD1   1 
ATOM   4544  N  ND2   . ASN C  2  130  ? 79.697  -7.472  70.655  1.00 64.61  ? 130  ASN C ND2   1 
ATOM   4545  N  N     . GLY C  2  131  ? 79.019  -7.947  75.794  1.00 52.49  ? 131  GLY C N     1 
ATOM   4546  C  CA    . GLY C  2  131  ? 79.093  -7.368  77.121  1.00 56.83  ? 131  GLY C CA    1 
ATOM   4547  C  C     . GLY C  2  131  ? 77.826  -7.490  77.948  1.00 59.75  ? 131  GLY C C     1 
ATOM   4548  O  O     . GLY C  2  131  ? 77.858  -7.330  79.171  1.00 64.65  ? 131  GLY C O     1 
ATOM   4549  N  N     . ALA C  2  132  ? 76.708  -7.774  77.290  1.00 52.93  ? 132  ALA C N     1 
ATOM   4550  C  CA    . ALA C  2  132  ? 75.426  -7.847  77.979  1.00 52.76  ? 132  ALA C CA    1 
ATOM   4551  C  C     . ALA C  2  132  ? 74.982  -9.290  78.159  1.00 48.73  ? 132  ALA C C     1 
ATOM   4552  O  O     . ALA C  2  132  ? 75.164  -10.109 77.269  1.00 52.01  ? 132  ALA C O     1 
ATOM   4553  C  CB    . ALA C  2  132  ? 74.379  -7.067  77.208  1.00 56.14  ? 132  ALA C CB    1 
ATOM   4554  N  N     . ASP C  2  133  ? 74.397  -9.601  79.309  1.00 46.08  ? 133  ASP C N     1 
ATOM   4555  C  CA    . ASP C  2  133  ? 73.914  -10.957 79.567  1.00 44.32  ? 133  ASP C CA    1 
ATOM   4556  C  C     . ASP C  2  133  ? 72.593  -11.267 78.874  1.00 47.46  ? 133  ASP C C     1 
ATOM   4557  O  O     . ASP C  2  133  ? 71.637  -10.498 78.960  1.00 50.20  ? 133  ASP C O     1 
ATOM   4558  C  CB    . ASP C  2  133  ? 73.794  -11.220 81.067  1.00 48.06  ? 133  ASP C CB    1 
ATOM   4559  C  CG    . ASP C  2  133  ? 75.060  -11.811 81.654  1.00 60.44  ? 133  ASP C CG    1 
ATOM   4560  O  OD1   . ASP C  2  133  ? 75.113  -13.052 81.814  1.00 60.57  ? 133  ASP C OD1   1 
ATOM   4561  O  OD2   . ASP C  2  133  ? 76.003  -11.038 81.944  1.00 60.75  ? 133  ASP C OD2   1 
ATOM   4562  N  N     . ARG C  2  134  ? 72.546  -12.410 78.197  1.00 45.50  ? 134  ARG C N     1 
ATOM   4563  C  CA    . ARG C  2  134  ? 71.358  -12.816 77.458  1.00 41.65  ? 134  ARG C CA    1 
ATOM   4564  C  C     . ARG C  2  134  ? 70.918  -14.248 77.758  1.00 41.65  ? 134  ARG C C     1 
ATOM   4565  O  O     . ARG C  2  134  ? 71.711  -15.077 78.190  1.00 41.03  ? 134  ARG C O     1 
ATOM   4566  C  CB    . ARG C  2  134  ? 71.580  -12.635 75.957  1.00 41.72  ? 134  ARG C CB    1 
ATOM   4567  C  CG    . ARG C  2  134  ? 71.802  -11.196 75.554  1.00 45.59  ? 134  ARG C CG    1 
ATOM   4568  C  CD    . ARG C  2  134  ? 71.718  -10.993 74.050  1.00 48.35  ? 134  ARG C CD    1 
ATOM   4569  N  NE    . ARG C  2  134  ? 71.168  -9.677  73.750  1.00 49.10  ? 134  ARG C NE    1 
ATOM   4570  C  CZ    . ARG C  2  134  ? 69.930  -9.472  73.321  1.00 48.29  ? 134  ARG C CZ    1 
ATOM   4571  N  NH1   . ARG C  2  134  ? 69.130  -10.504 73.112  1.00 45.63  ? 134  ARG C NH1   1 
ATOM   4572  N  NH2   . ARG C  2  134  ? 69.496  -8.239  73.088  1.00 60.27  ? 134  ARG C NH2   1 
ATOM   4573  N  N     . VAL C  2  135  ? 69.636  -14.519 77.535  1.00 41.36  ? 135  VAL C N     1 
ATOM   4574  C  CA    . VAL C  2  135  ? 69.070  -15.851 77.697  1.00 35.56  ? 135  VAL C CA    1 
ATOM   4575  C  C     . VAL C  2  135  ? 68.475  -16.243 76.356  1.00 37.07  ? 135  VAL C C     1 
ATOM   4576  O  O     . VAL C  2  135  ? 67.890  -15.409 75.672  1.00 43.60  ? 135  VAL C O     1 
ATOM   4577  C  CB    . VAL C  2  135  ? 67.952  -15.864 78.777  1.00 35.00  ? 135  VAL C CB    1 
ATOM   4578  C  CG1   . VAL C  2  135  ? 67.210  -17.183 78.785  1.00 35.55  ? 135  VAL C CG1   1 
ATOM   4579  C  CG2   . VAL C  2  135  ? 68.525  -15.585 80.153  1.00 38.66  ? 135  VAL C CG2   1 
ATOM   4580  N  N     . ILE C  2  136  ? 68.647  -17.493 75.952  1.00 32.82  ? 136  ILE C N     1 
ATOM   4581  C  CA    . ILE C  2  136  ? 67.922  -17.983 74.792  1.00 34.89  ? 136  ILE C CA    1 
ATOM   4582  C  C     . ILE C  2  136  ? 66.718  -18.761 75.297  1.00 37.67  ? 136  ILE C C     1 
ATOM   4583  O  O     . ILE C  2  136  ? 66.860  -19.812 75.922  1.00 41.24  ? 136  ILE C O     1 
ATOM   4584  C  CB    . ILE C  2  136  ? 68.772  -18.898 73.893  1.00 35.06  ? 136  ILE C CB    1 
ATOM   4585  C  CG1   . ILE C  2  136  ? 70.118  -18.246 73.553  1.00 35.62  ? 136  ILE C CG1   1 
ATOM   4586  C  CG2   . ILE C  2  136  ? 68.001  -19.265 72.636  1.00 33.15  ? 136  ILE C CG2   1 
ATOM   4587  C  CD1   . ILE C  2  136  ? 70.011  -16.936 72.831  1.00 32.87  ? 136  ILE C CD1   1 
ATOM   4588  N  N     . VAL C  2  137  ? 65.532  -18.234 75.034  1.00 33.12  ? 137  VAL C N     1 
ATOM   4589  C  CA    . VAL C  2  137  ? 64.311  -18.862 75.499  1.00 33.88  ? 137  VAL C CA    1 
ATOM   4590  C  C     . VAL C  2  137  ? 63.929  -20.043 74.612  1.00 33.49  ? 137  VAL C C     1 
ATOM   4591  O  O     . VAL C  2  137  ? 63.899  -19.924 73.390  1.00 37.24  ? 137  VAL C O     1 
ATOM   4592  C  CB    . VAL C  2  137  ? 63.152  -17.843 75.545  1.00 34.99  ? 137  VAL C CB    1 
ATOM   4593  C  CG1   . VAL C  2  137  ? 61.840  -18.543 75.805  1.00 39.27  ? 137  VAL C CG1   1 
ATOM   4594  C  CG2   . VAL C  2  137  ? 63.410  -16.811 76.613  1.00 31.45  ? 137  VAL C CG2   1 
ATOM   4595  N  N     . SER C  2  138  ? 63.632  -21.177 75.239  1.00 37.02  ? 138  SER C N     1 
ATOM   4596  C  CA    . SER C  2  138  ? 63.166  -22.368 74.533  1.00 37.34  ? 138  SER C CA    1 
ATOM   4597  C  C     . SER C  2  138  ? 61.895  -22.054 73.762  1.00 37.03  ? 138  SER C C     1 
ATOM   4598  O  O     . SER C  2  138  ? 61.110  -21.210 74.175  1.00 42.05  ? 138  SER C O     1 
ATOM   4599  C  CB    . SER C  2  138  ? 62.893  -23.497 75.525  1.00 39.44  ? 138  SER C CB    1 
ATOM   4600  O  OG    . SER C  2  138  ? 63.860  -23.521 76.564  1.00 42.97  ? 138  SER C OG    1 
ATOM   4601  N  N     . GLN C  2  139  ? 61.691  -22.728 72.637  1.00 41.61  ? 139  GLN C N     1 
ATOM   4602  C  CA    . GLN C  2  139  ? 60.524  -22.448 71.808  1.00 42.73  ? 139  GLN C CA    1 
ATOM   4603  C  C     . GLN C  2  139  ? 59.627  -23.660 71.603  1.00 44.62  ? 139  GLN C C     1 
ATOM   4604  O  O     . GLN C  2  139  ? 60.057  -24.660 71.060  1.00 46.72  ? 139  GLN C O     1 
ATOM   4605  C  CB    . GLN C  2  139  ? 60.953  -21.914 70.445  1.00 40.03  ? 139  GLN C CB    1 
ATOM   4606  C  CG    . GLN C  2  139  ? 59.808  -21.853 69.455  1.00 45.77  ? 139  GLN C CG    1 
ATOM   4607  C  CD    . GLN C  2  139  ? 60.234  -21.380 68.084  1.00 53.46  ? 139  GLN C CD    1 
ATOM   4608  O  OE1   . GLN C  2  139  ? 61.152  -21.931 67.478  1.00 54.64  ? 139  GLN C OE1   1 
ATOM   4609  N  NE2   . GLN C  2  139  ? 59.565  -20.347 67.586  1.00 60.87  ? 139  GLN C NE2   1 
ATOM   4610  N  N     . ILE C  2  140  ? 58.370  -23.566 72.015  1.00 45.17  ? 140  ILE C N     1 
ATOM   4611  C  CA    . ILE C  2  140  ? 57.422  -24.646 71.758  1.00 44.12  ? 140  ILE C CA    1 
ATOM   4612  C  C     . ILE C  2  140  ? 56.907  -24.547 70.325  1.00 45.12  ? 140  ILE C C     1 
ATOM   4613  O  O     . ILE C  2  140  ? 56.809  -23.451 69.772  1.00 48.00  ? 140  ILE C O     1 
ATOM   4614  C  CB    . ILE C  2  140  ? 56.247  -24.628 72.773  1.00 46.48  ? 140  ILE C CB    1 
ATOM   4615  C  CG1   . ILE C  2  140  ? 55.438  -25.926 72.707  1.00 43.06  ? 140  ILE C CG1   1 
ATOM   4616  C  CG2   . ILE C  2  140  ? 55.363  -23.412 72.562  1.00 44.48  ? 140  ILE C CG2   1 
ATOM   4617  C  CD1   . ILE C  2  140  ? 54.654  -26.203 73.968  1.00 35.43  ? 140  ILE C CD1   1 
ATOM   4618  N  N     . HIS C  2  141  ? 56.622  -25.691 69.713  1.00 44.05  ? 141  HIS C N     1 
ATOM   4619  C  CA    . HIS C  2  141  ? 56.028  -25.709 68.380  1.00 44.77  ? 141  HIS C CA    1 
ATOM   4620  C  C     . HIS C  2  141  ? 55.432  -27.071 68.087  1.00 47.61  ? 141  HIS C C     1 
ATOM   4621  O  O     . HIS C  2  141  ? 55.546  -27.989 68.895  1.00 46.53  ? 141  HIS C O     1 
ATOM   4622  C  CB    . HIS C  2  141  ? 57.057  -25.354 67.309  1.00 44.76  ? 141  HIS C CB    1 
ATOM   4623  C  CG    . HIS C  2  141  ? 58.066  -26.431 67.049  1.00 49.07  ? 141  HIS C CG    1 
ATOM   4624  N  ND1   . HIS C  2  141  ? 58.485  -26.764 65.779  1.00 51.03  ? 141  HIS C ND1   1 
ATOM   4625  C  CD2   . HIS C  2  141  ? 58.753  -27.237 67.893  1.00 49.62  ? 141  HIS C CD2   1 
ATOM   4626  C  CE1   . HIS C  2  141  ? 59.379  -27.734 65.850  1.00 48.17  ? 141  HIS C CE1   1 
ATOM   4627  N  NE2   . HIS C  2  141  ? 59.560  -28.039 67.122  1.00 48.15  ? 141  HIS C NE2   1 
ATOM   4628  N  N     . ARG C  2  142  ? 54.798  -27.202 66.929  1.00 49.40  ? 142  ARG C N     1 
ATOM   4629  C  CA    . ARG C  2  142  ? 54.232  -28.480 66.530  1.00 49.72  ? 142  ARG C CA    1 
ATOM   4630  C  C     . ARG C  2  142  ? 55.358  -29.434 66.189  1.00 50.78  ? 142  ARG C C     1 
ATOM   4631  O  O     . ARG C  2  142  ? 56.243  -29.098 65.399  1.00 53.83  ? 142  ARG C O     1 
ATOM   4632  C  CB    . ARG C  2  142  ? 53.336  -28.319 65.309  1.00 54.21  ? 142  ARG C CB    1 
ATOM   4633  C  CG    . ARG C  2  142  ? 52.157  -27.399 65.507  1.00 64.68  ? 142  ARG C CG    1 
ATOM   4634  C  CD    . ARG C  2  142  ? 51.206  -27.526 64.336  1.00 74.19  ? 142  ARG C CD    1 
ATOM   4635  N  NE    . ARG C  2  142  ? 50.708  -28.891 64.201  1.00 74.78  ? 142  ARG C NE    1 
ATOM   4636  C  CZ    . ARG C  2  142  ? 49.999  -29.326 63.167  1.00 68.27  ? 142  ARG C CZ    1 
ATOM   4637  N  NH1   . ARG C  2  142  ? 49.709  -28.502 62.168  1.00 64.78  ? 142  ARG C NH1   1 
ATOM   4638  N  NH2   . ARG C  2  142  ? 49.585  -30.586 63.130  1.00 65.36  ? 142  ARG C NH2   1 
ATOM   4639  N  N     . SER C  2  143  ? 55.331  -30.619 66.786  1.00 49.51  ? 143  SER C N     1 
ATOM   4640  C  CA    . SER C  2  143  ? 56.318  -31.635 66.464  1.00 48.32  ? 143  SER C CA    1 
ATOM   4641  C  C     . SER C  2  143  ? 56.132  -32.068 65.035  1.00 53.76  ? 143  SER C C     1 
ATOM   4642  O  O     . SER C  2  143  ? 55.002  -32.216 64.576  1.00 56.58  ? 143  SER C O     1 
ATOM   4643  C  CB    . SER C  2  143  ? 56.165  -32.860 67.356  1.00 54.98  ? 143  SER C CB    1 
ATOM   4644  O  OG    . SER C  2  143  ? 56.798  -33.979 66.756  1.00 55.90  ? 143  SER C OG    1 
ATOM   4645  N  N     . PRO C  2  144  ? 57.243  -32.254 64.316  1.00 54.62  ? 144  PRO C N     1 
ATOM   4646  C  CA    . PRO C  2  144  ? 57.170  -32.895 63.003  1.00 52.08  ? 144  PRO C CA    1 
ATOM   4647  C  C     . PRO C  2  144  ? 56.609  -34.312 63.129  1.00 55.44  ? 144  PRO C C     1 
ATOM   4648  O  O     . PRO C  2  144  ? 56.592  -34.885 64.222  1.00 54.46  ? 144  PRO C O     1 
ATOM   4649  C  CB    . PRO C  2  144  ? 58.629  -32.918 62.554  1.00 51.86  ? 144  PRO C CB    1 
ATOM   4650  C  CG    . PRO C  2  144  ? 59.216  -31.710 63.206  1.00 53.14  ? 144  PRO C CG    1 
ATOM   4651  C  CD    . PRO C  2  144  ? 58.556  -31.631 64.557  1.00 49.61  ? 144  PRO C CD    1 
ATOM   4652  N  N     . GLY C  2  145  ? 56.123  -34.856 62.022  1.00 53.88  ? 145  GLY C N     1 
ATOM   4653  C  CA    . GLY C  2  145  ? 55.501  -36.161 62.022  1.00 56.04  ? 145  GLY C CA    1 
ATOM   4654  C  C     . GLY C  2  145  ? 54.404  -36.208 60.984  1.00 54.69  ? 145  GLY C C     1 
ATOM   4655  O  O     . GLY C  2  145  ? 54.357  -35.370 60.078  1.00 52.38  ? 145  GLY C O     1 
ATOM   4656  N  N     . VAL C  2  146  ? 53.522  -37.194 61.118  1.00 56.17  ? 146  VAL C N     1 
ATOM   4657  C  CA    . VAL C  2  146  ? 52.380  -37.336 60.225  1.00 59.92  ? 146  VAL C CA    1 
ATOM   4658  C  C     . VAL C  2  146  ? 51.094  -37.284 61.033  1.00 62.64  ? 146  VAL C C     1 
ATOM   4659  O  O     . VAL C  2  146  ? 50.862  -38.124 61.905  1.00 69.20  ? 146  VAL C O     1 
ATOM   4660  C  CB    . VAL C  2  146  ? 52.433  -38.657 59.430  1.00 62.33  ? 146  VAL C CB    1 
ATOM   4661  C  CG1   . VAL C  2  146  ? 51.108  -38.908 58.741  1.00 61.59  ? 146  VAL C CG1   1 
ATOM   4662  C  CG2   . VAL C  2  146  ? 53.572  -38.629 58.418  1.00 55.01  ? 146  VAL C CG2   1 
ATOM   4663  N  N     . TYR C  2  147  ? 50.261  -36.290 60.742  1.00 60.99  ? 147  TYR C N     1 
ATOM   4664  C  CA    . TYR C  2  147  ? 49.043  -36.072 61.509  1.00 66.19  ? 147  TYR C CA    1 
ATOM   4665  C  C     . TYR C  2  147  ? 47.819  -36.247 60.634  1.00 63.98  ? 147  TYR C C     1 
ATOM   4666  O  O     . TYR C  2  147  ? 47.891  -36.078 59.426  1.00 62.60  ? 147  TYR C O     1 
ATOM   4667  C  CB    . TYR C  2  147  ? 49.039  -34.669 62.116  1.00 64.32  ? 147  TYR C CB    1 
ATOM   4668  C  CG    . TYR C  2  147  ? 50.202  -34.403 63.036  1.00 62.11  ? 147  TYR C CG    1 
ATOM   4669  C  CD1   . TYR C  2  147  ? 51.379  -33.838 62.553  1.00 59.23  ? 147  TYR C CD1   1 
ATOM   4670  C  CD2   . TYR C  2  147  ? 50.129  -34.723 64.386  1.00 58.50  ? 147  TYR C CD2   1 
ATOM   4671  C  CE1   . TYR C  2  147  ? 52.450  -33.597 63.390  1.00 60.27  ? 147  TYR C CE1   1 
ATOM   4672  C  CE2   . TYR C  2  147  ? 51.193  -34.485 65.234  1.00 61.40  ? 147  TYR C CE2   1 
ATOM   4673  C  CZ    . TYR C  2  147  ? 52.353  -33.920 64.733  1.00 65.08  ? 147  TYR C CZ    1 
ATOM   4674  O  OH    . TYR C  2  147  ? 53.417  -33.680 65.577  1.00 62.23  ? 147  TYR C OH    1 
ATOM   4675  N  N     . PHE C  2  148  ? 46.698  -36.595 61.253  1.00 65.36  ? 148  PHE C N     1 
ATOM   4676  C  CA    . PHE C  2  148  ? 45.430  -36.671 60.540  1.00 65.45  ? 148  PHE C CA    1 
ATOM   4677  C  C     . PHE C  2  148  ? 44.395  -35.834 61.277  1.00 73.29  ? 148  PHE C C     1 
ATOM   4678  O  O     . PHE C  2  148  ? 44.044  -36.114 62.426  1.00 73.26  ? 148  PHE C O     1 
ATOM   4679  C  CB    . PHE C  2  148  ? 44.970  -38.122 60.395  1.00 64.06  ? 148  PHE C CB    1 
ATOM   4680  C  CG    . PHE C  2  148  ? 45.974  -39.001 59.710  1.00 69.38  ? 148  PHE C CG    1 
ATOM   4681  C  CD1   . PHE C  2  148  ? 46.982  -39.619 60.435  1.00 69.17  ? 148  PHE C CD1   1 
ATOM   4682  C  CD2   . PHE C  2  148  ? 45.925  -39.192 58.338  1.00 70.70  ? 148  PHE C CD2   1 
ATOM   4683  C  CE1   . PHE C  2  148  ? 47.917  -40.413 59.810  1.00 67.88  ? 148  PHE C CE1   1 
ATOM   4684  C  CE2   . PHE C  2  148  ? 46.855  -39.990 57.706  1.00 69.65  ? 148  PHE C CE2   1 
ATOM   4685  C  CZ    . PHE C  2  148  ? 47.852  -40.602 58.443  1.00 73.23  ? 148  PHE C CZ    1 
ATOM   4686  N  N     . THR C  2  149  ? 43.924  -34.788 60.611  1.00 73.30  ? 149  THR C N     1 
ATOM   4687  C  CA    . THR C  2  149  ? 42.973  -33.875 61.216  1.00 71.02  ? 149  THR C CA    1 
ATOM   4688  C  C     . THR C  2  149  ? 41.657  -33.947 60.434  1.00 79.16  ? 149  THR C C     1 
ATOM   4689  O  O     . THR C  2  149  ? 41.660  -34.294 59.261  1.00 78.35  ? 149  THR C O     1 
ATOM   4690  C  CB    . THR C  2  149  ? 43.551  -32.440 61.237  1.00 69.61  ? 149  THR C CB    1 
ATOM   4691  O  OG1   . THR C  2  149  ? 42.830  -31.635 62.178  1.00 90.89  ? 149  THR C OG1   1 
ATOM   4692  C  CG2   . THR C  2  149  ? 43.501  -31.802 59.850  1.00 66.38  ? 149  THR C CG2   1 
ATOM   4693  N  N     . PRO C  2  150  ? 40.519  -33.672 61.091  1.00 81.34  ? 150  PRO C N     1 
ATOM   4694  C  CA    . PRO C  2  150  ? 39.247  -33.644 60.356  1.00 73.65  ? 150  PRO C CA    1 
ATOM   4695  C  C     . PRO C  2  150  ? 39.170  -32.479 59.369  1.00 81.02  ? 150  PRO C C     1 
ATOM   4696  O  O     . PRO C  2  150  ? 39.568  -31.369 59.720  1.00 83.65  ? 150  PRO C O     1 
ATOM   4697  C  CB    . PRO C  2  150  ? 38.214  -33.448 61.463  1.00 66.70  ? 150  PRO C CB    1 
ATOM   4698  C  CG    . PRO C  2  150  ? 38.866  -33.979 62.689  1.00 79.43  ? 150  PRO C CG    1 
ATOM   4699  C  CD    . PRO C  2  150  ? 40.313  -33.624 62.548  1.00 82.43  ? 150  PRO C CD    1 
ATOM   4700  N  N     . ASP C  2  151  ? 38.672  -32.735 58.158  1.00 85.92  ? 151  ASP C N     1 
ATOM   4701  C  CA    . ASP C  2  151  ? 38.453  -31.684 57.160  1.00 88.18  ? 151  ASP C CA    1 
ATOM   4702  C  C     . ASP C  2  151  ? 37.222  -30.865 57.537  1.00 93.53  ? 151  ASP C C     1 
ATOM   4703  O  O     . ASP C  2  151  ? 36.105  -31.385 57.540  1.00 94.43  ? 151  ASP C O     1 
ATOM   4704  C  CB    . ASP C  2  151  ? 38.279  -32.299 55.765  1.00 86.53  ? 151  ASP C CB    1 
ATOM   4705  C  CG    . ASP C  2  151  ? 38.034  -31.255 54.674  1.00 91.90  ? 151  ASP C CG    1 
ATOM   4706  O  OD1   . ASP C  2  151  ? 38.264  -30.050 54.907  1.00 89.51  ? 151  ASP C OD1   1 
ATOM   4707  O  OD2   . ASP C  2  151  ? 37.623  -31.652 53.562  1.00 95.19  ? 151  ASP C OD2   1 
ATOM   4708  N  N     . PRO C  2  152  ? 37.426  -29.574 57.855  1.00 96.99  ? 152  PRO C N     1 
ATOM   4709  C  CA    . PRO C  2  152  ? 36.364  -28.694 58.359  1.00 100.73 ? 152  PRO C CA    1 
ATOM   4710  C  C     . PRO C  2  152  ? 35.174  -28.560 57.409  1.00 105.96 ? 152  PRO C C     1 
ATOM   4711  O  O     . PRO C  2  152  ? 34.038  -28.467 57.878  1.00 106.21 ? 152  PRO C O     1 
ATOM   4712  C  CB    . PRO C  2  152  ? 37.074  -27.342 58.522  1.00 102.57 ? 152  PRO C CB    1 
ATOM   4713  C  CG    . PRO C  2  152  ? 38.293  -27.435 57.651  1.00 100.05 ? 152  PRO C CG    1 
ATOM   4714  C  CD    . PRO C  2  152  ? 38.711  -28.865 57.728  1.00 94.08  ? 152  PRO C CD    1 
ATOM   4715  N  N     . ALA C  2  153  ? 35.432  -28.549 56.102  1.00 100.94 ? 153  ALA C N     1 
ATOM   4716  C  CA    . ALA C  2  153  ? 34.366  -28.416 55.111  1.00 95.85  ? 153  ALA C CA    1 
ATOM   4717  C  C     . ALA C  2  153  ? 33.494  -29.667 55.014  1.00 93.03  ? 153  ALA C C     1 
ATOM   4718  O  O     . ALA C  2  153  ? 32.278  -29.602 55.181  1.00 106.65 ? 153  ALA C O     1 
ATOM   4719  C  CB    . ALA C  2  153  ? 34.950  -28.074 53.745  1.00 93.13  ? 153  ALA C CB    1 
ATOM   4720  N  N     . ARG C  2  154  ? 34.126  -30.807 54.764  1.00 94.96  ? 154  ARG C N     1 
ATOM   4721  C  CA    . ARG C  2  154  ? 33.408  -32.058 54.562  1.00 96.54  ? 154  ARG C CA    1 
ATOM   4722  C  C     . ARG C  2  154  ? 33.570  -32.963 55.778  1.00 94.62  ? 154  ARG C C     1 
ATOM   4723  O  O     . ARG C  2  154  ? 34.651  -33.497 56.016  1.00 98.58  ? 154  ARG C O     1 
ATOM   4724  C  CB    . ARG C  2  154  ? 33.934  -32.751 53.305  1.00 103.01 ? 154  ARG C CB    1 
ATOM   4725  C  CG    . ARG C  2  154  ? 33.919  -31.859 52.072  1.00 103.79 ? 154  ARG C CG    1 
ATOM   4726  C  CD    . ARG C  2  154  ? 35.187  -32.002 51.236  1.00 97.29  ? 154  ARG C CD    1 
ATOM   4727  N  NE    . ARG C  2  154  ? 35.513  -33.395 50.936  1.00 110.67 ? 154  ARG C NE    1 
ATOM   4728  C  CZ    . ARG C  2  154  ? 34.881  -34.140 50.032  1.00 110.67 ? 154  ARG C CZ    1 
ATOM   4729  N  NH1   . ARG C  2  154  ? 33.870  -33.633 49.339  1.00 114.28 ? 154  ARG C NH1   1 
ATOM   4730  N  NH2   . ARG C  2  154  ? 35.253  -35.397 49.826  1.00 104.59 ? 154  ARG C NH2   1 
ATOM   4731  N  N     . PRO C  2  155  ? 32.491  -33.134 56.552  1.00 96.33  ? 155  PRO C N     1 
ATOM   4732  C  CA    . PRO C  2  155  ? 32.509  -33.829 57.847  1.00 106.95 ? 155  PRO C CA    1 
ATOM   4733  C  C     . PRO C  2  155  ? 33.031  -35.266 57.804  1.00 108.15 ? 155  PRO C C     1 
ATOM   4734  O  O     . PRO C  2  155  ? 33.864  -35.633 58.634  1.00 112.94 ? 155  PRO C O     1 
ATOM   4735  C  CB    . PRO C  2  155  ? 31.038  -33.815 58.264  1.00 94.67  ? 155  PRO C CB    1 
ATOM   4736  C  CG    . PRO C  2  155  ? 30.488  -32.605 57.605  1.00 98.97  ? 155  PRO C CG    1 
ATOM   4737  C  CD    . PRO C  2  155  ? 31.175  -32.536 56.273  1.00 101.06 ? 155  PRO C CD    1 
ATOM   4738  N  N     . GLY C  2  156  ? 32.567  -36.061 56.847  1.00 98.52  ? 156  GLY C N     1 
ATOM   4739  C  CA    . GLY C  2  156  ? 32.970  -37.455 56.774  1.00 105.66 ? 156  GLY C CA    1 
ATOM   4740  C  C     . GLY C  2  156  ? 34.360  -37.672 56.199  1.00 104.02 ? 156  GLY C C     1 
ATOM   4741  O  O     . GLY C  2  156  ? 34.754  -38.807 55.922  1.00 99.19  ? 156  GLY C O     1 
ATOM   4742  N  N     . ARG C  2  157  ? 35.109  -36.587 56.029  1.00 99.14  ? 157  ARG C N     1 
ATOM   4743  C  CA    . ARG C  2  157  ? 36.421  -36.652 55.393  1.00 96.07  ? 157  ARG C CA    1 
ATOM   4744  C  C     . ARG C  2  157  ? 37.539  -36.094 56.271  1.00 93.36  ? 157  ARG C C     1 
ATOM   4745  O  O     . ARG C  2  157  ? 37.284  -35.409 57.265  1.00 90.96  ? 157  ARG C O     1 
ATOM   4746  C  CB    . ARG C  2  157  ? 36.392  -35.947 54.033  1.00 98.59  ? 157  ARG C CB    1 
ATOM   4747  C  CG    . ARG C  2  157  ? 35.484  -36.637 53.033  1.00 100.38 ? 157  ARG C CG    1 
ATOM   4748  C  CD    . ARG C  2  157  ? 35.788  -38.127 52.998  1.00 104.77 ? 157  ARG C CD    1 
ATOM   4749  N  NE    . ARG C  2  157  ? 34.766  -38.899 52.300  1.00 100.88 ? 157  ARG C NE    1 
ATOM   4750  C  CZ    . ARG C  2  157  ? 34.785  -39.146 50.995  1.00 112.35 ? 157  ARG C CZ    1 
ATOM   4751  N  NH1   . ARG C  2  157  ? 35.773  -38.674 50.244  1.00 108.41 ? 157  ARG C NH1   1 
ATOM   4752  N  NH2   . ARG C  2  157  ? 33.817  -39.862 50.439  1.00 117.30 ? 157  ARG C NH2   1 
ATOM   4753  N  N     . TYR C  2  158  ? 38.778  -36.411 55.901  1.00 87.61  ? 158  TYR C N     1 
ATOM   4754  C  CA    . TYR C  2  158  ? 39.940  -36.019 56.690  1.00 77.54  ? 158  TYR C CA    1 
ATOM   4755  C  C     . TYR C  2  158  ? 41.094  -35.501 55.834  1.00 80.18  ? 158  TYR C C     1 
ATOM   4756  O  O     . TYR C  2  158  ? 41.194  -35.809 54.644  1.00 88.17  ? 158  TYR C O     1 
ATOM   4757  C  CB    . TYR C  2  158  ? 40.425  -37.199 57.533  1.00 78.86  ? 158  TYR C CB    1 
ATOM   4758  C  CG    . TYR C  2  158  ? 39.384  -37.760 58.475  1.00 82.58  ? 158  TYR C CG    1 
ATOM   4759  C  CD1   . TYR C  2  158  ? 39.100  -37.130 59.679  1.00 83.50  ? 158  TYR C CD1   1 
ATOM   4760  C  CD2   . TYR C  2  158  ? 38.692  -38.923 58.164  1.00 82.53  ? 158  TYR C CD2   1 
ATOM   4761  C  CE1   . TYR C  2  158  ? 38.154  -37.638 60.541  1.00 86.74  ? 158  TYR C CE1   1 
ATOM   4762  C  CE2   . TYR C  2  158  ? 37.743  -39.440 59.022  1.00 79.05  ? 158  TYR C CE2   1 
ATOM   4763  C  CZ    . TYR C  2  158  ? 37.479  -38.793 60.210  1.00 83.23  ? 158  TYR C CZ    1 
ATOM   4764  O  OH    . TYR C  2  158  ? 36.536  -39.300 61.074  1.00 90.63  ? 158  TYR C OH    1 
ATOM   4765  N  N     . ILE C  2  159  ? 41.961  -34.711 56.462  1.00 76.98  ? 159  ILE C N     1 
ATOM   4766  C  CA    . ILE C  2  159  ? 43.193  -34.226 55.850  1.00 72.64  ? 159  ILE C CA    1 
ATOM   4767  C  C     . ILE C  2  159  ? 44.406  -34.869 56.519  1.00 70.98  ? 159  ILE C C     1 
ATOM   4768  O  O     . ILE C  2  159  ? 44.535  -34.854 57.749  1.00 70.25  ? 159  ILE C O     1 
ATOM   4769  C  CB    . ILE C  2  159  ? 43.344  -32.703 56.007  1.00 67.49  ? 159  ILE C CB    1 
ATOM   4770  C  CG1   . ILE C  2  159  ? 42.056  -31.981 55.610  1.00 76.46  ? 159  ILE C CG1   1 
ATOM   4771  C  CG2   . ILE C  2  159  ? 44.529  -32.205 55.196  1.00 64.04  ? 159  ILE C CG2   1 
ATOM   4772  C  CD1   . ILE C  2  159  ? 41.779  -32.001 54.126  1.00 90.97  ? 159  ILE C CD1   1 
ATOM   4773  N  N     . ALA C  2  160  ? 45.296  -35.427 55.706  1.00 69.55  ? 160  ALA C N     1 
ATOM   4774  C  CA    . ALA C  2  160  ? 46.554  -35.957 56.213  1.00 65.28  ? 160  ALA C CA    1 
ATOM   4775  C  C     . ALA C  2  160  ? 47.658  -34.926 56.001  1.00 67.39  ? 160  ALA C C     1 
ATOM   4776  O  O     . ALA C  2  160  ? 47.896  -34.487 54.882  1.00 67.73  ? 160  ALA C O     1 
ATOM   4777  C  CB    . ALA C  2  160  ? 46.898  -37.256 55.520  1.00 65.73  ? 160  ALA C CB    1 
ATOM   4778  N  N     . SER C  2  161  ? 48.325  -34.532 57.080  1.00 66.37  ? 161  SER C N     1 
ATOM   4779  C  CA    . SER C  2  161  ? 49.379  -33.528 57.003  1.00 64.43  ? 161  SER C CA    1 
ATOM   4780  C  C     . SER C  2  161  ? 50.743  -34.121 57.360  1.00 62.47  ? 161  SER C C     1 
ATOM   4781  O  O     . SER C  2  161  ? 50.926  -34.678 58.441  1.00 59.56  ? 161  SER C O     1 
ATOM   4782  C  CB    . SER C  2  161  ? 49.057  -32.349 57.924  1.00 62.10  ? 161  SER C CB    1 
ATOM   4783  O  OG    . SER C  2  161  ? 47.659  -32.100 57.962  1.00 67.82  ? 161  SER C OG    1 
ATOM   4784  N  N     . ILE C  2  162  ? 51.693  -34.004 56.436  1.00 64.54  ? 162  ILE C N     1 
ATOM   4785  C  CA    . ILE C  2  162  ? 53.066  -34.430 56.676  1.00 61.61  ? 162  ILE C CA    1 
ATOM   4786  C  C     . ILE C  2  162  ? 53.929  -33.214 56.985  1.00 59.45  ? 162  ILE C C     1 
ATOM   4787  O  O     . ILE C  2  162  ? 54.180  -32.385 56.114  1.00 59.90  ? 162  ILE C O     1 
ATOM   4788  C  CB    . ILE C  2  162  ? 53.652  -35.170 55.456  1.00 60.88  ? 162  ILE C CB    1 
ATOM   4789  C  CG1   . ILE C  2  162  ? 52.893  -36.477 55.212  1.00 61.66  ? 162  ILE C CG1   1 
ATOM   4790  C  CG2   . ILE C  2  162  ? 55.140  -35.435 55.653  1.00 54.68  ? 162  ILE C CG2   1 
ATOM   4791  C  CD1   . ILE C  2  162  ? 53.378  -37.255 54.005  1.00 61.34  ? 162  ILE C CD1   1 
ATOM   4792  N  N     . ILE C  2  163  ? 54.375  -33.113 58.233  1.00 57.42  ? 163  ILE C N     1 
ATOM   4793  C  CA    . ILE C  2  163  ? 55.115  -31.946 58.698  1.00 59.02  ? 163  ILE C CA    1 
ATOM   4794  C  C     . ILE C  2  163  ? 56.569  -32.275 59.056  1.00 58.61  ? 163  ILE C C     1 
ATOM   4795  O  O     . ILE C  2  163  ? 56.818  -33.135 59.889  1.00 56.38  ? 163  ILE C O     1 
ATOM   4796  C  CB    . ILE C  2  163  ? 54.411  -31.313 59.911  1.00 62.79  ? 163  ILE C CB    1 
ATOM   4797  C  CG1   . ILE C  2  163  ? 52.963  -30.975 59.557  1.00 63.50  ? 163  ILE C CG1   1 
ATOM   4798  C  CG2   . ILE C  2  163  ? 55.155  -30.076 60.383  1.00 63.83  ? 163  ILE C CG2   1 
ATOM   4799  C  CD1   . ILE C  2  163  ? 52.113  -30.649 60.758  1.00 65.52  ? 163  ILE C CD1   1 
ATOM   4800  N  N     . PRO C  2  164  ? 57.537  -31.617 58.398  1.00 56.67  ? 164  PRO C N     1 
ATOM   4801  C  CA    . PRO C  2  164  ? 58.952  -31.758 58.749  1.00 53.75  ? 164  PRO C CA    1 
ATOM   4802  C  C     . PRO C  2  164  ? 59.385  -30.674 59.741  1.00 57.14  ? 164  PRO C C     1 
ATOM   4803  O  O     . PRO C  2  164  ? 58.548  -29.875 60.167  1.00 62.22  ? 164  PRO C O     1 
ATOM   4804  C  CB    . PRO C  2  164  ? 59.638  -31.533 57.411  1.00 58.46  ? 164  PRO C CB    1 
ATOM   4805  C  CG    . PRO C  2  164  ? 58.790  -30.490 56.777  1.00 57.96  ? 164  PRO C CG    1 
ATOM   4806  C  CD    . PRO C  2  164  ? 57.366  -30.759 57.213  1.00 62.02  ? 164  PRO C CD    1 
ATOM   4807  N  N     . LEU C  2  165  ? 60.667  -30.645 60.103  1.00 55.93  ? 165  LEU C N     1 
ATOM   4808  C  CA    . LEU C  2  165  ? 61.199  -29.564 60.929  1.00 56.51  ? 165  LEU C CA    1 
ATOM   4809  C  C     . LEU C  2  165  ? 61.101  -28.227 60.191  1.00 64.11  ? 165  LEU C C     1 
ATOM   4810  O  O     . LEU C  2  165  ? 61.129  -28.191 58.956  1.00 58.37  ? 165  LEU C O     1 
ATOM   4811  C  CB    . LEU C  2  165  ? 62.655  -29.832 61.304  1.00 55.83  ? 165  LEU C CB    1 
ATOM   4812  C  CG    . LEU C  2  165  ? 63.000  -31.057 62.141  1.00 56.81  ? 165  LEU C CG    1 
ATOM   4813  C  CD1   . LEU C  2  165  ? 64.468  -31.398 61.963  1.00 59.11  ? 165  LEU C CD1   1 
ATOM   4814  C  CD2   . LEU C  2  165  ? 62.696  -30.804 63.595  1.00 49.99  ? 165  LEU C CD2   1 
ATOM   4815  N  N     . PRO C  2  166  ? 60.972  -27.121 60.948  1.00 69.08  ? 166  PRO C N     1 
ATOM   4816  C  CA    . PRO C  2  166  ? 60.922  -25.768 60.382  1.00 71.37  ? 166  PRO C CA    1 
ATOM   4817  C  C     . PRO C  2  166  ? 62.103  -25.499 59.460  1.00 72.64  ? 166  PRO C C     1 
ATOM   4818  O  O     . PRO C  2  166  ? 63.226  -25.864 59.819  1.00 73.50  ? 166  PRO C O     1 
ATOM   4819  C  CB    . PRO C  2  166  ? 61.025  -24.877 61.620  1.00 61.60  ? 166  PRO C CB    1 
ATOM   4820  C  CG    . PRO C  2  166  ? 60.416  -25.681 62.699  1.00 57.48  ? 166  PRO C CG    1 
ATOM   4821  C  CD    . PRO C  2  166  ? 60.771  -27.111 62.408  1.00 58.36  ? 166  PRO C CD    1 
ATOM   4822  N  N     . LYS C  2  167  ? 61.844  -24.897 58.297  1.00 73.46  ? 167  LYS C N     1 
ATOM   4823  C  CA    . LYS C  2  167  ? 62.885  -24.544 57.324  1.00 78.48  ? 167  LYS C CA    1 
ATOM   4824  C  C     . LYS C  2  167  ? 63.519  -25.774 56.656  1.00 75.36  ? 167  LYS C C     1 
ATOM   4825  O  O     . LYS C  2  167  ? 64.377  -25.658 55.781  1.00 80.66  ? 167  LYS C O     1 
ATOM   4826  C  CB    . LYS C  2  167  ? 63.944  -23.630 57.959  1.00 84.45  ? 167  LYS C CB    1 
ATOM   4827  C  CG    . LYS C  2  167  ? 63.439  -22.230 58.314  1.00 80.17  ? 167  LYS C CG    1 
ATOM   4828  C  CD    . LYS C  2  167  ? 63.343  -21.366 57.065  1.00 96.73  ? 167  LYS C CD    1 
ATOM   4829  C  CE    . LYS C  2  167  ? 63.033  -19.914 57.386  1.00 98.79  ? 167  LYS C CE    1 
ATOM   4830  N  NZ    . LYS C  2  167  ? 63.110  -19.068 56.154  1.00 89.60  ? 167  LYS C NZ    1 
ATOM   4831  N  N     . ARG C  2  168  ? 63.044  -26.945 57.056  1.00 75.41  ? 168  ARG C N     1 
ATOM   4832  C  CA    . ARG C  2  168  ? 63.521  -28.226 56.532  1.00 74.81  ? 168  ARG C CA    1 
ATOM   4833  C  C     . ARG C  2  168  ? 62.577  -28.948 55.579  1.00 71.19  ? 168  ARG C C     1 
ATOM   4834  O  O     . ARG C  2  168  ? 62.697  -30.135 55.390  1.00 65.58  ? 168  ARG C O     1 
ATOM   4835  C  CB    . ARG C  2  168  ? 63.917  -29.163 57.661  1.00 69.03  ? 168  ARG C CB    1 
ATOM   4836  C  CG    . ARG C  2  168  ? 64.893  -28.549 58.637  1.00 72.20  ? 168  ARG C CG    1 
ATOM   4837  C  CD    . ARG C  2  168  ? 66.300  -29.018 58.364  1.00 77.18  ? 168  ARG C CD    1 
ATOM   4838  N  NE    . ARG C  2  168  ? 66.747  -28.633 57.039  1.00 87.52  ? 168  ARG C NE    1 
ATOM   4839  C  CZ    . ARG C  2  168  ? 67.851  -29.087 56.473  1.00 85.64  ? 168  ARG C CZ    1 
ATOM   4840  N  NH1   . ARG C  2  168  ? 68.615  -29.945 57.119  1.00 86.51  ? 168  ARG C NH1   1 
ATOM   4841  N  NH2   . ARG C  2  168  ? 68.186  -28.687 55.264  1.00 83.59  ? 168  ARG C NH2   1 
ATOM   4842  N  N     . GLY C  2  169  ? 61.603  -28.244 55.029  1.00 73.05  ? 169  GLY C N     1 
ATOM   4843  C  CA    . GLY C  2  169  ? 60.771  -28.796 53.983  1.00 65.08  ? 169  GLY C CA    1 
ATOM   4844  C  C     . GLY C  2  169  ? 59.409  -28.156 53.901  1.00 78.21  ? 169  GLY C C     1 
ATOM   4845  O  O     . GLY C  2  169  ? 59.010  -27.435 54.793  1.00 92.37  ? 169  GLY C O     1 
ATOM   4846  N  N     . PRO C  2  170  ? 58.695  -28.436 52.824  1.00 73.81  ? 170  PRO C N     1 
ATOM   4847  C  CA    . PRO C  2  170  ? 57.367  -27.894 52.579  1.00 80.95  ? 170  PRO C CA    1 
ATOM   4848  C  C     . PRO C  2  170  ? 56.383  -28.712 53.340  1.00 77.05  ? 170  PRO C C     1 
ATOM   4849  O  O     . PRO C  2  170  ? 56.756  -29.838 53.587  1.00 65.14  ? 170  PRO C O     1 
ATOM   4850  C  CB    . PRO C  2  170  ? 57.183  -28.211 51.120  1.00 67.89  ? 170  PRO C CB    1 
ATOM   4851  C  CG    . PRO C  2  170  ? 57.807  -29.546 51.004  1.00 63.71  ? 170  PRO C CG    1 
ATOM   4852  C  CD    . PRO C  2  170  ? 58.972  -29.566 51.938  1.00 60.83  ? 170  PRO C CD    1 
ATOM   4853  N  N     . TRP C  2  171  ? 55.174  -28.269 53.682  1.00 79.40  ? 171  TRP C N     1 
ATOM   4854  C  CA    . TRP C  2  171  ? 54.370  -29.344 54.248  1.00 70.08  ? 171  TRP C CA    1 
ATOM   4855  C  C     . TRP C  2  171  ? 53.597  -29.980 53.103  1.00 72.18  ? 171  TRP C C     1 
ATOM   4856  O  O     . TRP C  2  171  ? 53.005  -29.281 52.276  1.00 71.82  ? 171  TRP C O     1 
ATOM   4857  C  CB    . TRP C  2  171  ? 53.395  -28.828 55.312  1.00 73.07  ? 171  TRP C CB    1 
ATOM   4858  C  CG    . TRP C  2  171  ? 54.044  -28.281 56.556  1.00 84.69  ? 171  TRP C CG    1 
ATOM   4859  C  CD1   . TRP C  2  171  ? 55.376  -28.270 56.853  1.00 88.57  ? 171  TRP C CD1   1 
ATOM   4860  C  CD2   . TRP C  2  171  ? 53.381  -27.668 57.668  1.00 84.98  ? 171  TRP C CD2   1 
ATOM   4861  N  NE1   . TRP C  2  171  ? 55.584  -27.682 58.079  1.00 92.96  ? 171  TRP C NE1   1 
ATOM   4862  C  CE2   . TRP C  2  171  ? 54.374  -27.305 58.600  1.00 88.30  ? 171  TRP C CE2   1 
ATOM   4863  C  CE3   . TRP C  2  171  ? 52.045  -27.388 57.966  1.00 86.58  ? 171  TRP C CE3   1 
ATOM   4864  C  CZ2   . TRP C  2  171  ? 54.073  -26.681 59.809  1.00 86.96  ? 171  TRP C CZ2   1 
ATOM   4865  C  CZ3   . TRP C  2  171  ? 51.747  -26.767 59.166  1.00 92.02  ? 171  TRP C CZ3   1 
ATOM   4866  C  CH2   . TRP C  2  171  ? 52.757  -26.421 60.073  1.00 87.30  ? 171  TRP C CH2   1 
ATOM   4867  N  N     . ILE C  2  172  ? 53.360  -31.270 53.203  1.00 71.87  ? 172  ILE C N     1 
ATOM   4868  C  CA    . ILE C  2  172  ? 52.496  -31.933 52.253  1.00 70.76  ? 172  ILE C CA    1 
ATOM   4869  C  C     . ILE C  2  172  ? 51.157  -32.302 52.856  1.00 68.73  ? 172  ILE C C     1 
ATOM   4870  O  O     . ILE C  2  172  ? 51.092  -32.789 53.959  1.00 63.46  ? 172  ILE C O     1 
ATOM   4871  C  CB    . ILE C  2  172  ? 53.142  -33.203 51.733  1.00 68.34  ? 172  ILE C CB    1 
ATOM   4872  C  CG1   . ILE C  2  172  ? 54.191  -32.860 50.696  1.00 64.04  ? 172  ILE C CG1   1 
ATOM   4873  C  CG2   . ILE C  2  172  ? 52.088  -34.105 51.141  1.00 71.89  ? 172  ILE C CG2   1 
ATOM   4874  C  CD1   . ILE C  2  172  ? 55.544  -33.428 51.016  1.00 66.18  ? 172  ILE C CD1   1 
ATOM   4875  N  N     . ASP C  2  173  ? 50.086  -32.035 52.123  1.00 74.00  ? 173  ASP C N     1 
ATOM   4876  C  CA    . ASP C  2  173  ? 48.753  -32.423 52.538  1.00 69.89  ? 173  ASP C CA    1 
ATOM   4877  C  C     . ASP C  2  173  ? 48.132  -33.379 51.547  1.00 73.07  ? 173  ASP C C     1 
ATOM   4878  O  O     . ASP C  2  173  ? 48.059  -33.105 50.371  1.00 75.68  ? 173  ASP C O     1 
ATOM   4879  C  CB    . ASP C  2  173  ? 47.858  -31.205 52.643  1.00 72.92  ? 173  ASP C CB    1 
ATOM   4880  C  CG    . ASP C  2  173  ? 47.955  -30.535 53.969  1.00 76.68  ? 173  ASP C CG    1 
ATOM   4881  O  OD1   . ASP C  2  173  ? 48.856  -30.883 54.737  1.00 78.49  ? 173  ASP C OD1   1 
ATOM   4882  O  OD2   . ASP C  2  173  ? 47.132  -29.653 54.247  1.00 81.43  ? 173  ASP C OD2   1 
ATOM   4883  N  N     . LEU C  2  174  ? 47.667  -34.496 52.068  1.00 69.79  ? 174  LEU C N     1 
ATOM   4884  C  CA    . LEU C  2  174  ? 46.941  -35.537 51.355  1.00 73.06  ? 174  LEU C CA    1 
ATOM   4885  C  C     . LEU C  2  174  ? 45.444  -35.417 51.641  1.00 77.75  ? 174  LEU C C     1 
ATOM   4886  O  O     . LEU C  2  174  ? 45.017  -35.446 52.799  1.00 79.25  ? 174  LEU C O     1 
ATOM   4887  C  CB    . LEU C  2  174  ? 47.448  -36.913 51.780  1.00 66.30  ? 174  LEU C CB    1 
ATOM   4888  C  CG    . LEU C  2  174  ? 48.590  -37.542 50.982  1.00 65.88  ? 174  LEU C CG    1 
ATOM   4889  C  CD1   . LEU C  2  174  ? 49.678  -36.534 50.629  1.00 67.78  ? 174  LEU C CD1   1 
ATOM   4890  C  CD2   . LEU C  2  174  ? 49.170  -38.696 51.774  1.00 74.02  ? 174  LEU C CD2   1 
ATOM   4891  N  N     . GLU C  2  175  ? 44.651  -35.282 50.581  1.00 86.12  ? 175  GLU C N     1 
ATOM   4892  C  CA    . GLU C  2  175  ? 43.219  -35.029 50.712  1.00 89.59  ? 175  GLU C CA    1 
ATOM   4893  C  C     . GLU C  2  175  ? 42.439  -35.920 49.752  1.00 90.17  ? 175  GLU C C     1 
ATOM   4894  O  O     . GLU C  2  175  ? 42.941  -36.276 48.695  1.00 89.56  ? 175  GLU C O     1 
ATOM   4895  C  CB    . GLU C  2  175  ? 42.939  -33.552 50.411  1.00 91.10  ? 175  GLU C CB    1 
ATOM   4896  C  CG    . GLU C  2  175  ? 41.511  -33.091 50.653  1.00 100.40 ? 175  GLU C CG    1 
ATOM   4897  C  CD    . GLU C  2  175  ? 41.375  -31.578 50.593  1.00 106.85 ? 175  GLU C CD    1 
ATOM   4898  O  OE1   . GLU C  2  175  ? 42.420  -30.892 50.539  1.00 101.37 ? 175  GLU C OE1   1 
ATOM   4899  O  OE2   . GLU C  2  175  ? 40.226  -31.079 50.601  1.00 107.39 ? 175  GLU C OE2   1 
ATOM   4900  N  N     . VAL C  2  176  ? 41.220  -36.301 50.118  1.00 96.36  ? 176  VAL C N     1 
ATOM   4901  C  CA    . VAL C  2  176  ? 40.350  -36.978 49.160  1.00 95.23  ? 176  VAL C CA    1 
ATOM   4902  C  C     . VAL C  2  176  ? 39.310  -35.987 48.646  1.00 99.10  ? 176  VAL C C     1 
ATOM   4903  O  O     . VAL C  2  176  ? 38.393  -35.595 49.371  1.00 100.42 ? 176  VAL C O     1 
ATOM   4904  C  CB    . VAL C  2  176  ? 39.663  -38.219 49.761  1.00 90.76  ? 176  VAL C CB    1 
ATOM   4905  C  CG1   . VAL C  2  176  ? 38.729  -38.845 48.744  1.00 95.53  ? 176  VAL C CG1   1 
ATOM   4906  C  CG2   . VAL C  2  176  ? 40.700  -39.231 50.209  1.00 86.14  ? 176  VAL C CG2   1 
ATOM   4907  N  N     . GLU C  2  177  ? 39.467  -35.593 47.387  1.00 99.12  ? 177  GLU C N     1 
ATOM   4908  C  CA    . GLU C  2  177  ? 38.649  -34.548 46.781  1.00 103.13 ? 177  GLU C CA    1 
ATOM   4909  C  C     . GLU C  2  177  ? 37.208  -35.030 46.594  1.00 104.56 ? 177  GLU C C     1 
ATOM   4910  O  O     . GLU C  2  177  ? 36.962  -36.236 46.565  1.00 105.78 ? 177  GLU C O     1 
ATOM   4911  C  CB    . GLU C  2  177  ? 39.273  -34.123 45.445  1.00 105.19 ? 177  GLU C CB    1 
ATOM   4912  C  CG    . GLU C  2  177  ? 39.574  -32.628 45.325  1.00 110.28 ? 177  GLU C CG    1 
ATOM   4913  C  CD    . GLU C  2  177  ? 40.342  -32.077 46.515  1.00 106.63 ? 177  GLU C CD    1 
ATOM   4914  O  OE1   . GLU C  2  177  ? 39.816  -31.170 47.199  1.00 97.28  ? 177  GLU C OE1   1 
ATOM   4915  O  OE2   . GLU C  2  177  ? 41.474  -32.546 46.761  1.00 106.65 ? 177  GLU C OE2   1 
ATOM   4916  N  N     . PRO C  2  178  ? 36.246  -34.090 46.493  1.00 103.24 ? 178  PRO C N     1 
ATOM   4917  C  CA    . PRO C  2  178  ? 34.841  -34.453 46.262  1.00 105.52 ? 178  PRO C CA    1 
ATOM   4918  C  C     . PRO C  2  178  ? 34.625  -35.321 45.020  1.00 103.49 ? 178  PRO C C     1 
ATOM   4919  O  O     . PRO C  2  178  ? 33.730  -36.166 45.024  1.00 97.20  ? 178  PRO C O     1 
ATOM   4920  C  CB    . PRO C  2  178  ? 34.145  -33.093 46.093  1.00 103.84 ? 178  PRO C CB    1 
ATOM   4921  C  CG    . PRO C  2  178  ? 35.252  -32.089 45.920  1.00 96.54  ? 178  PRO C CG    1 
ATOM   4922  C  CD    . PRO C  2  178  ? 36.394  -32.641 46.700  1.00 97.49  ? 178  PRO C CD    1 
ATOM   4923  N  N     . ASN C  2  179  ? 35.435  -35.120 43.983  1.00 100.61 ? 179  ASN C N     1 
ATOM   4924  C  CA    . ASN C  2  179  ? 35.338  -35.930 42.772  1.00 100.36 ? 179  ASN C CA    1 
ATOM   4925  C  C     . ASN C  2  179  ? 35.784  -37.379 42.982  1.00 106.81 ? 179  ASN C C     1 
ATOM   4926  O  O     . ASN C  2  179  ? 35.532  -38.244 42.143  1.00 116.05 ? 179  ASN C O     1 
ATOM   4927  C  CB    . ASN C  2  179  ? 36.107  -35.284 41.610  1.00 101.59 ? 179  ASN C CB    1 
ATOM   4928  C  CG    . ASN C  2  179  ? 37.590  -35.108 41.903  1.00 107.53 ? 179  ASN C CG    1 
ATOM   4929  O  OD1   . ASN C  2  179  ? 38.158  -35.800 42.746  1.00 108.40 ? 179  ASN C OD1   1 
ATOM   4930  N  ND2   . ASN C  2  179  ? 38.225  -34.178 41.197  1.00 102.97 ? 179  ASN C ND2   1 
ATOM   4931  N  N     . GLY C  2  180  ? 36.458  -37.631 44.100  1.00 104.20 ? 180  GLY C N     1 
ATOM   4932  C  CA    . GLY C  2  180  ? 36.877  -38.975 44.451  1.00 105.13 ? 180  GLY C CA    1 
ATOM   4933  C  C     . GLY C  2  180  ? 38.361  -39.247 44.286  1.00 108.12 ? 180  GLY C C     1 
ATOM   4934  O  O     . GLY C  2  180  ? 38.861  -40.260 44.776  1.00 107.38 ? 180  GLY C O     1 
ATOM   4935  N  N     . VAL C  2  181  ? 39.071  -38.354 43.598  1.00 106.88 ? 181  VAL C N     1 
ATOM   4936  C  CA    . VAL C  2  181  ? 40.508  -38.539 43.383  1.00 106.21 ? 181  VAL C CA    1 
ATOM   4937  C  C     . VAL C  2  181  ? 41.340  -37.947 44.530  1.00 102.00 ? 181  VAL C C     1 
ATOM   4938  O  O     . VAL C  2  181  ? 41.008  -36.894 45.084  1.00 97.63  ? 181  VAL C O     1 
ATOM   4939  C  CB    . VAL C  2  181  ? 40.978  -38.009 41.991  1.00 99.09  ? 181  VAL C CB    1 
ATOM   4940  C  CG1   . VAL C  2  181  ? 41.123  -36.494 41.991  1.00 94.00  ? 181  VAL C CG1   1 
ATOM   4941  C  CG2   . VAL C  2  181  ? 42.287  -38.671 41.578  1.00 95.82  ? 181  VAL C CG2   1 
ATOM   4942  N  N     . VAL C  2  182  ? 42.411  -38.647 44.892  1.00 99.28  ? 182  VAL C N     1 
ATOM   4943  C  CA    . VAL C  2  182  ? 43.250  -38.244 46.014  1.00 92.95  ? 182  VAL C CA    1 
ATOM   4944  C  C     . VAL C  2  182  ? 44.331  -37.245 45.590  1.00 92.13  ? 182  VAL C C     1 
ATOM   4945  O  O     . VAL C  2  182  ? 45.207  -37.553 44.775  1.00 87.48  ? 182  VAL C O     1 
ATOM   4946  C  CB    . VAL C  2  182  ? 43.875  -39.474 46.713  1.00 93.77  ? 182  VAL C CB    1 
ATOM   4947  C  CG1   . VAL C  2  182  ? 44.361  -40.485 45.682  1.00 103.92 ? 182  VAL C CG1   1 
ATOM   4948  C  CG2   . VAL C  2  182  ? 44.997  -39.054 47.651  1.00 86.99  ? 182  VAL C CG2   1 
ATOM   4949  N  N     . SER C  2  183  ? 44.253  -36.048 46.163  1.00 90.63  ? 183  SER C N     1 
ATOM   4950  C  CA    . SER C  2  183  ? 45.126  -34.940 45.804  1.00 87.02  ? 183  SER C CA    1 
ATOM   4951  C  C     . SER C  2  183  ? 46.230  -34.698 46.829  1.00 86.07  ? 183  SER C C     1 
ATOM   4952  O  O     . SER C  2  183  ? 46.038  -34.881 48.033  1.00 85.07  ? 183  SER C O     1 
ATOM   4953  C  CB    . SER C  2  183  ? 44.310  -33.657 45.624  1.00 86.08  ? 183  SER C CB    1 
ATOM   4954  O  OG    . SER C  2  183  ? 43.871  -33.146 46.871  1.00 84.79  ? 183  SER C OG    1 
ATOM   4955  N  N     . MET C  2  184  ? 47.386  -34.282 46.324  1.00 86.24  ? 184  MET C N     1 
ATOM   4956  C  CA    . MET C  2  184  ? 48.525  -33.894 47.142  1.00 81.42  ? 184  MET C CA    1 
ATOM   4957  C  C     . MET C  2  184  ? 48.815  -32.409 46.939  1.00 81.64  ? 184  MET C C     1 
ATOM   4958  O  O     . MET C  2  184  ? 48.876  -31.928 45.802  1.00 78.34  ? 184  MET C O     1 
ATOM   4959  C  CB    . MET C  2  184  ? 49.744  -34.738 46.771  1.00 78.10  ? 184  MET C CB    1 
ATOM   4960  C  CG    . MET C  2  184  ? 51.062  -34.266 47.362  1.00 76.31  ? 184  MET C CG    1 
ATOM   4961  S  SD    . MET C  2  184  ? 52.250  -35.618 47.395  1.00 80.95  ? 184  MET C SD    1 
ATOM   4962  C  CE    . MET C  2  184  ? 53.808  -34.766 47.187  1.00 70.97  ? 184  MET C CE    1 
ATOM   4963  N  N     . LYS C  2  185  ? 48.978  -31.693 48.051  1.00 83.26  ? 185  LYS C N     1 
ATOM   4964  C  CA    . LYS C  2  185  ? 49.225  -30.253 48.044  1.00 76.91  ? 185  LYS C CA    1 
ATOM   4965  C  C     . LYS C  2  185  ? 50.624  -29.954 48.572  1.00 73.90  ? 185  LYS C C     1 
ATOM   4966  O  O     . LYS C  2  185  ? 50.956  -30.293 49.719  1.00 76.13  ? 185  LYS C O     1 
ATOM   4967  C  CB    . LYS C  2  185  ? 48.179  -29.532 48.895  1.00 74.89  ? 185  LYS C CB    1 
ATOM   4968  C  CG    . LYS C  2  185  ? 48.174  -28.015 48.754  1.00 76.00  ? 185  LYS C CG    1 
ATOM   4969  C  CD    . LYS C  2  185  ? 47.230  -27.388 49.774  1.00 75.92  ? 185  LYS C CD    1 
ATOM   4970  C  CE    . LYS C  2  185  ? 45.886  -28.111 49.793  1.00 84.38  ? 185  LYS C CE    1 
ATOM   4971  N  NZ    . LYS C  2  185  ? 45.038  -27.735 50.959  1.00 90.95  ? 185  LYS C NZ    1 
ATOM   4972  N  N     . VAL C  2  186  ? 51.435  -29.345 47.706  1.00 72.23  ? 186  VAL C N     1 
ATOM   4973  C  CA    . VAL C  2  186  ? 52.823  -28.985 47.986  1.00 75.25  ? 186  VAL C CA    1 
ATOM   4974  C  C     . VAL C  2  186  ? 53.138  -27.607 47.411  1.00 83.41  ? 186  VAL C C     1 
ATOM   4975  O  O     . VAL C  2  186  ? 52.969  -27.386 46.213  1.00 88.70  ? 186  VAL C O     1 
ATOM   4976  C  CB    . VAL C  2  186  ? 53.799  -29.971 47.320  1.00 75.08  ? 186  VAL C CB    1 
ATOM   4977  C  CG1   . VAL C  2  186  ? 55.234  -29.559 47.587  1.00 77.33  ? 186  VAL C CG1   1 
ATOM   4978  C  CG2   . VAL C  2  186  ? 53.554  -31.372 47.811  1.00 80.41  ? 186  VAL C CG2   1 
ATOM   4979  N  N     . ASN C  2  187  ? 53.617  -26.693 48.252  1.00 85.88  ? 187  ASN C N     1 
ATOM   4980  C  CA    . ASN C  2  187  ? 53.948  -25.335 47.816  1.00 85.95  ? 187  ASN C CA    1 
ATOM   4981  C  C     . ASN C  2  187  ? 52.781  -24.644 47.118  1.00 87.98  ? 187  ASN C C     1 
ATOM   4982  O  O     . ASN C  2  187  ? 52.950  -24.027 46.065  1.00 87.95  ? 187  ASN C O     1 
ATOM   4983  C  CB    . ASN C  2  187  ? 55.184  -25.331 46.911  1.00 81.58  ? 187  ASN C CB    1 
ATOM   4984  C  CG    . ASN C  2  187  ? 56.448  -25.742 47.644  1.00 87.08  ? 187  ASN C CG    1 
ATOM   4985  O  OD1   . ASN C  2  187  ? 57.201  -26.599 47.175  1.00 85.29  ? 187  ASN C OD1   1 
ATOM   4986  N  ND2   . ASN C  2  187  ? 56.690  -25.130 48.801  1.00 89.14  ? 187  ASN C ND2   1 
ATOM   4987  N  N     . LYS C  2  188  ? 51.599  -24.780 47.713  1.00 89.98  ? 188  LYS C N     1 
ATOM   4988  C  CA    . LYS C  2  188  ? 50.358  -24.172 47.220  1.00 97.31  ? 188  LYS C CA    1 
ATOM   4989  C  C     . LYS C  2  188  ? 49.793  -24.785 45.930  1.00 93.99  ? 188  LYS C C     1 
ATOM   4990  O  O     . LYS C  2  188  ? 48.697  -24.423 45.504  1.00 96.87  ? 188  LYS C O     1 
ATOM   4991  C  CB    . LYS C  2  188  ? 50.484  -22.644 47.102  1.00 104.98 ? 188  LYS C CB    1 
ATOM   4992  C  CG    . LYS C  2  188  ? 50.928  -21.956 48.390  1.00 113.76 ? 188  LYS C CG    1 
ATOM   4993  C  CD    . LYS C  2  188  ? 50.817  -20.441 48.283  1.00 115.50 ? 188  LYS C CD    1 
ATOM   4994  C  CE    . LYS C  2  188  ? 51.552  -19.746 49.421  1.00 114.73 ? 188  LYS C CE    1 
ATOM   4995  N  NZ    . LYS C  2  188  ? 53.028  -19.928 49.320  1.00 126.08 ? 188  LYS C NZ    1 
ATOM   4996  N  N     . ARG C  2  189  ? 50.526  -25.714 45.318  1.00 92.80  ? 189  ARG C N     1 
ATOM   4997  C  CA    . ARG C  2  189  ? 50.024  -26.435 44.146  1.00 87.24  ? 189  ARG C CA    1 
ATOM   4998  C  C     . ARG C  2  189  ? 49.465  -27.807 44.523  1.00 82.09  ? 189  ARG C C     1 
ATOM   4999  O  O     . ARG C  2  189  ? 50.013  -28.494 45.383  1.00 81.86  ? 189  ARG C O     1 
ATOM   5000  C  CB    . ARG C  2  189  ? 51.116  -26.601 43.087  1.00 86.03  ? 189  ARG C CB    1 
ATOM   5001  C  CG    . ARG C  2  189  ? 51.553  -25.316 42.407  1.00 91.92  ? 189  ARG C CG    1 
ATOM   5002  C  CD    . ARG C  2  189  ? 52.578  -25.613 41.320  1.00 95.57  ? 189  ARG C CD    1 
ATOM   5003  N  NE    . ARG C  2  189  ? 53.331  -24.428 40.915  1.00 104.05 ? 189  ARG C NE    1 
ATOM   5004  C  CZ    . ARG C  2  189  ? 53.089  -23.721 39.814  1.00 109.82 ? 189  ARG C CZ    1 
ATOM   5005  N  NH1   . ARG C  2  189  ? 52.107  -24.075 38.995  1.00 107.34 ? 189  ARG C NH1   1 
ATOM   5006  N  NH2   . ARG C  2  189  ? 53.834  -22.658 39.532  1.00 107.07 ? 189  ARG C NH2   1 
ATOM   5007  N  N     . LYS C  2  190  ? 48.370  -28.198 43.877  1.00 88.53  ? 190  LYS C N     1 
ATOM   5008  C  CA    . LYS C  2  190  ? 47.783  -29.519 44.090  1.00 87.19  ? 190  LYS C CA    1 
ATOM   5009  C  C     . LYS C  2  190  ? 47.918  -30.352 42.823  1.00 80.89  ? 190  LYS C C     1 
ATOM   5010  O  O     . LYS C  2  190  ? 47.908  -29.814 41.716  1.00 81.79  ? 190  LYS C O     1 
ATOM   5011  C  CB    . LYS C  2  190  ? 46.303  -29.414 44.481  1.00 74.81  ? 190  LYS C CB    1 
ATOM   5012  C  CG    . LYS C  2  190  ? 46.017  -28.434 45.601  1.00 74.69  ? 190  LYS C CG    1 
ATOM   5013  C  CD    . LYS C  2  190  ? 44.532  -28.365 45.931  1.00 78.66  ? 190  LYS C CD    1 
ATOM   5014  C  CE    . LYS C  2  190  ? 44.030  -29.658 46.562  1.00 89.80  ? 190  LYS C CE    1 
ATOM   5015  N  NZ    . LYS C  2  190  ? 42.711  -29.476 47.240  1.00 90.50  ? 190  LYS C NZ    1 
ATOM   5016  N  N     . PHE C  2  191  ? 48.056  -31.663 42.983  1.00 79.76  ? 191  PHE C N     1 
ATOM   5017  C  CA    . PHE C  2  191  ? 48.023  -32.560 41.834  1.00 81.98  ? 191  PHE C CA    1 
ATOM   5018  C  C     . PHE C  2  191  ? 47.499  -33.924 42.278  1.00 90.94  ? 191  PHE C C     1 
ATOM   5019  O  O     . PHE C  2  191  ? 47.293  -34.139 43.466  1.00 91.21  ? 191  PHE C O     1 
ATOM   5020  C  CB    . PHE C  2  191  ? 49.420  -32.672 41.220  1.00 81.10  ? 191  PHE C CB    1 
ATOM   5021  C  CG    . PHE C  2  191  ? 50.462  -33.192 42.166  1.00 87.38  ? 191  PHE C CG    1 
ATOM   5022  C  CD1   . PHE C  2  191  ? 50.760  -34.542 42.213  1.00 89.25  ? 191  PHE C CD1   1 
ATOM   5023  C  CD2   . PHE C  2  191  ? 51.156  -32.330 42.999  1.00 86.67  ? 191  PHE C CD2   1 
ATOM   5024  C  CE1   . PHE C  2  191  ? 51.719  -35.029 43.079  1.00 87.64  ? 191  PHE C CE1   1 
ATOM   5025  C  CE2   . PHE C  2  191  ? 52.119  -32.809 43.867  1.00 87.84  ? 191  PHE C CE2   1 
ATOM   5026  C  CZ    . PHE C  2  191  ? 52.401  -34.162 43.905  1.00 87.82  ? 191  PHE C CZ    1 
ATOM   5027  N  N     . PRO C  2  192  ? 47.270  -34.853 41.335  1.00 92.93  ? 192  PRO C N     1 
ATOM   5028  C  CA    . PRO C  2  192  ? 46.879  -36.180 41.826  1.00 93.45  ? 192  PRO C CA    1 
ATOM   5029  C  C     . PRO C  2  192  ? 48.045  -36.922 42.475  1.00 90.37  ? 192  PRO C C     1 
ATOM   5030  O  O     . PRO C  2  192  ? 49.125  -36.994 41.893  1.00 90.87  ? 192  PRO C O     1 
ATOM   5031  C  CB    . PRO C  2  192  ? 46.420  -36.903 40.556  1.00 90.76  ? 192  PRO C CB    1 
ATOM   5032  C  CG    . PRO C  2  192  ? 47.083  -36.161 39.435  1.00 96.09  ? 192  PRO C CG    1 
ATOM   5033  C  CD    . PRO C  2  192  ? 47.111  -34.735 39.876  1.00 87.25  ? 192  PRO C CD    1 
ATOM   5034  N  N     . LEU C  2  193  ? 47.810  -37.498 43.649  1.00 86.39  ? 193  LEU C N     1 
ATOM   5035  C  CA    . LEU C  2  193  ? 48.847  -38.217 44.381  1.00 83.94  ? 193  LEU C CA    1 
ATOM   5036  C  C     . LEU C  2  193  ? 49.314  -39.438 43.591  1.00 86.01  ? 193  LEU C C     1 
ATOM   5037  O  O     . LEU C  2  193  ? 50.444  -39.913 43.750  1.00 83.56  ? 193  LEU C O     1 
ATOM   5038  C  CB    . LEU C  2  193  ? 48.312  -38.639 45.752  1.00 81.23  ? 193  LEU C CB    1 
ATOM   5039  C  CG    . LEU C  2  193  ? 49.205  -39.496 46.646  1.00 68.58  ? 193  LEU C CG    1 
ATOM   5040  C  CD1   . LEU C  2  193  ? 50.472  -38.752 47.001  1.00 74.86  ? 193  LEU C CD1   1 
ATOM   5041  C  CD2   . LEU C  2  193  ? 48.459  -39.908 47.897  1.00 70.78  ? 193  LEU C CD2   1 
ATOM   5042  N  N     . VAL C  2  194  ? 48.429  -39.928 42.730  1.00 90.53  ? 194  VAL C N     1 
ATOM   5043  C  CA    . VAL C  2  194  ? 48.688  -41.106 41.914  1.00 89.15  ? 194  VAL C CA    1 
ATOM   5044  C  C     . VAL C  2  194  ? 49.930  -40.938 41.044  1.00 87.06  ? 194  VAL C C     1 
ATOM   5045  O  O     . VAL C  2  194  ? 50.708  -41.873 40.879  1.00 87.54  ? 194  VAL C O     1 
ATOM   5046  C  CB    . VAL C  2  194  ? 47.490  -41.406 41.001  1.00 93.17  ? 194  VAL C CB    1 
ATOM   5047  C  CG1   . VAL C  2  194  ? 47.469  -42.880 40.623  1.00 89.26  ? 194  VAL C CG1   1 
ATOM   5048  C  CG2   . VAL C  2  194  ? 46.189  -40.993 41.689  1.00 99.10  ? 194  VAL C CG2   1 
ATOM   5049  N  N     . LEU C  2  195  ? 50.107  -39.741 40.493  1.00 86.05  ? 195  LEU C N     1 
ATOM   5050  C  CA    . LEU C  2  195  ? 51.247  -39.438 39.633  1.00 84.21  ? 195  LEU C CA    1 
ATOM   5051  C  C     . LEU C  2  195  ? 52.568  -39.605 40.384  1.00 87.10  ? 195  LEU C C     1 
ATOM   5052  O  O     . LEU C  2  195  ? 53.511  -40.245 39.898  1.00 85.10  ? 195  LEU C O     1 
ATOM   5053  C  CB    . LEU C  2  195  ? 51.118  -38.012 39.099  1.00 79.47  ? 195  LEU C CB    1 
ATOM   5054  C  CG    . LEU C  2  195  ? 52.266  -37.450 38.263  1.00 88.18  ? 195  LEU C CG    1 
ATOM   5055  C  CD1   . LEU C  2  195  ? 52.541  -38.333 37.068  1.00 88.26  ? 195  LEU C CD1   1 
ATOM   5056  C  CD2   . LEU C  2  195  ? 51.942  -36.038 37.814  1.00 90.54  ? 195  LEU C CD2   1 
ATOM   5057  N  N     . LEU C  2  196  ? 52.618  -39.028 41.580  1.00 88.43  ? 196  LEU C N     1 
ATOM   5058  C  CA    . LEU C  2  196  ? 53.789  -39.127 42.443  1.00 84.93  ? 196  LEU C CA    1 
ATOM   5059  C  C     . LEU C  2  196  ? 54.026  -40.576 42.857  1.00 84.15  ? 196  LEU C C     1 
ATOM   5060  O  O     . LEU C  2  196  ? 55.169  -41.022 42.922  1.00 86.84  ? 196  LEU C O     1 
ATOM   5061  C  CB    . LEU C  2  196  ? 53.623  -38.222 43.670  1.00 88.59  ? 196  LEU C CB    1 
ATOM   5062  C  CG    . LEU C  2  196  ? 54.795  -38.012 44.638  1.00 80.78  ? 196  LEU C CG    1 
ATOM   5063  C  CD1   . LEU C  2  196  ? 54.718  -38.977 45.810  1.00 70.63  ? 196  LEU C CD1   1 
ATOM   5064  C  CD2   . LEU C  2  196  ? 56.140  -38.122 43.921  1.00 72.04  ? 196  LEU C CD2   1 
ATOM   5065  N  N     . LEU C  2  197  ? 52.950  -41.308 43.133  1.00 83.44  ? 197  LEU C N     1 
ATOM   5066  C  CA    . LEU C  2  197  ? 53.068  -42.736 43.421  1.00 83.30  ? 197  LEU C CA    1 
ATOM   5067  C  C     . LEU C  2  197  ? 53.701  -43.483 42.242  1.00 88.82  ? 197  LEU C C     1 
ATOM   5068  O  O     . LEU C  2  197  ? 54.528  -44.378 42.428  1.00 87.41  ? 197  LEU C O     1 
ATOM   5069  C  CB    . LEU C  2  197  ? 51.702  -43.333 43.756  1.00 78.81  ? 197  LEU C CB    1 
ATOM   5070  C  CG    . LEU C  2  197  ? 51.107  -42.921 45.102  1.00 83.00  ? 197  LEU C CG    1 
ATOM   5071  C  CD1   . LEU C  2  197  ? 49.710  -43.493 45.272  1.00 84.98  ? 197  LEU C CD1   1 
ATOM   5072  C  CD2   . LEU C  2  197  ? 52.011  -43.376 46.234  1.00 83.04  ? 197  LEU C CD2   1 
ATOM   5073  N  N     . ARG C  2  198  ? 53.315  -43.099 41.029  1.00 87.89  ? 198  ARG C N     1 
ATOM   5074  C  CA    . ARG C  2  198  ? 53.857  -43.711 39.825  1.00 86.67  ? 198  ARG C CA    1 
ATOM   5075  C  C     . ARG C  2  198  ? 55.343  -43.403 39.684  1.00 89.74  ? 198  ARG C C     1 
ATOM   5076  O  O     . ARG C  2  198  ? 56.118  -44.263 39.270  1.00 96.08  ? 198  ARG C O     1 
ATOM   5077  C  CB    . ARG C  2  198  ? 53.089  -43.245 38.589  1.00 92.51  ? 198  ARG C CB    1 
ATOM   5078  C  CG    . ARG C  2  198  ? 53.476  -43.960 37.300  1.00 105.08 ? 198  ARG C CG    1 
ATOM   5079  C  CD    . ARG C  2  198  ? 53.301  -45.471 37.417  1.00 112.83 ? 198  ARG C CD    1 
ATOM   5080  N  NE    . ARG C  2  198  ? 53.686  -46.165 36.188  1.00 115.45 ? 198  ARG C NE    1 
ATOM   5081  C  CZ    . ARG C  2  198  ? 54.048  -47.443 36.130  1.00 113.91 ? 198  ARG C CZ    1 
ATOM   5082  N  NH1   . ARG C  2  198  ? 54.383  -47.988 34.968  1.00 114.41 ? 198  ARG C NH1   1 
ATOM   5083  N  NH2   . ARG C  2  198  ? 54.084  -48.176 37.235  1.00 114.00 ? 198  ARG C NH2   1 
ATOM   5084  N  N     . VAL C  2  199  ? 55.741  -42.180 40.030  1.00 88.94  ? 199  VAL C N     1 
ATOM   5085  C  CA    . VAL C  2  199  ? 57.163  -41.829 40.041  1.00 84.85  ? 199  VAL C CA    1 
ATOM   5086  C  C     . VAL C  2  199  ? 57.921  -42.702 41.044  1.00 84.09  ? 199  VAL C C     1 
ATOM   5087  O  O     . VAL C  2  199  ? 59.082  -43.052 40.834  1.00 88.25  ? 199  VAL C O     1 
ATOM   5088  C  CB    . VAL C  2  199  ? 57.384  -40.338 40.377  1.00 80.44  ? 199  VAL C CB    1 
ATOM   5089  C  CG1   . VAL C  2  199  ? 58.868  -39.995 40.365  1.00 74.83  ? 199  VAL C CG1   1 
ATOM   5090  C  CG2   . VAL C  2  199  ? 56.628  -39.454 39.401  1.00 80.07  ? 199  VAL C CG2   1 
ATOM   5091  N  N     . LEU C  2  200  ? 57.243  -43.070 42.126  1.00 88.69  ? 200  LEU C N     1 
ATOM   5092  C  CA    . LEU C  2  200  ? 57.831  -43.915 43.160  1.00 89.54  ? 200  LEU C CA    1 
ATOM   5093  C  C     . LEU C  2  200  ? 57.916  -45.366 42.702  1.00 90.06  ? 200  LEU C C     1 
ATOM   5094  O  O     . LEU C  2  200  ? 58.542  -46.200 43.359  1.00 91.00  ? 200  LEU C O     1 
ATOM   5095  C  CB    . LEU C  2  200  ? 57.022  -43.818 44.458  1.00 87.30  ? 200  LEU C CB    1 
ATOM   5096  C  CG    . LEU C  2  200  ? 57.011  -42.462 45.169  1.00 79.04  ? 200  LEU C CG    1 
ATOM   5097  C  CD1   . LEU C  2  200  ? 55.913  -42.413 46.208  1.00 79.54  ? 200  LEU C CD1   1 
ATOM   5098  C  CD2   . LEU C  2  200  ? 58.356  -42.176 45.808  1.00 83.99  ? 200  LEU C CD2   1 
ATOM   5099  N  N     . GLY C  2  201  ? 57.273  -45.663 41.577  1.00 90.73  ? 201  GLY C N     1 
ATOM   5100  C  CA    . GLY C  2  201  ? 57.356  -46.983 40.979  1.00 94.28  ? 201  GLY C CA    1 
ATOM   5101  C  C     . GLY C  2  201  ? 56.211  -47.910 41.335  1.00 93.68  ? 201  GLY C C     1 
ATOM   5102  O  O     . GLY C  2  201  ? 56.310  -49.123 41.163  1.00 96.71  ? 201  GLY C O     1 
ATOM   5103  N  N     . TYR C  2  202  ? 55.121  -47.346 41.839  1.00 93.03  ? 202  TYR C N     1 
ATOM   5104  C  CA    . TYR C  2  202  ? 53.957  -48.153 42.174  1.00 95.89  ? 202  TYR C CA    1 
ATOM   5105  C  C     . TYR C  2  202  ? 53.174  -48.520 40.922  1.00 102.54 ? 202  TYR C C     1 
ATOM   5106  O  O     . TYR C  2  202  ? 53.063  -47.722 39.991  1.00 99.35  ? 202  TYR C O     1 
ATOM   5107  C  CB    . TYR C  2  202  ? 53.053  -47.425 43.172  1.00 94.13  ? 202  TYR C CB    1 
ATOM   5108  C  CG    . TYR C  2  202  ? 53.561  -47.461 44.595  1.00 91.40  ? 202  TYR C CG    1 
ATOM   5109  C  CD1   . TYR C  2  202  ? 53.622  -48.655 45.299  1.00 96.97  ? 202  TYR C CD1   1 
ATOM   5110  C  CD2   . TYR C  2  202  ? 53.970  -46.302 45.239  1.00 90.34  ? 202  TYR C CD2   1 
ATOM   5111  C  CE1   . TYR C  2  202  ? 54.083  -48.696 46.598  1.00 94.86  ? 202  TYR C CE1   1 
ATOM   5112  C  CE2   . TYR C  2  202  ? 54.432  -46.334 46.540  1.00 89.93  ? 202  TYR C CE2   1 
ATOM   5113  C  CZ    . TYR C  2  202  ? 54.485  -47.534 47.214  1.00 91.47  ? 202  TYR C CZ    1 
ATOM   5114  O  OH    . TYR C  2  202  ? 54.942  -47.576 48.511  1.00 92.60  ? 202  TYR C OH    1 
ATOM   5115  N  N     . ASP C  2  203  ? 52.635  -49.734 40.903  1.00 109.99 ? 203  ASP C N     1 
ATOM   5116  C  CA    . ASP C  2  203  ? 51.800  -50.174 39.794  1.00 115.61 ? 203  ASP C CA    1 
ATOM   5117  C  C     . ASP C  2  203  ? 50.399  -50.493 40.297  1.00 119.61 ? 203  ASP C C     1 
ATOM   5118  O  O     . ASP C  2  203  ? 50.199  -50.731 41.487  1.00 117.67 ? 203  ASP C O     1 
ATOM   5119  C  CB    . ASP C  2  203  ? 52.407  -51.390 39.092  1.00 121.81 ? 203  ASP C CB    1 
ATOM   5120  C  CG    . ASP C  2  203  ? 51.899  -51.555 37.666  1.00 133.00 ? 203  ASP C CG    1 
ATOM   5121  O  OD1   . ASP C  2  203  ? 52.735  -51.695 36.747  1.00 134.59 ? 203  ASP C OD1   1 
ATOM   5122  O  OD2   . ASP C  2  203  ? 50.664  -51.541 37.462  1.00 129.79 ? 203  ASP C OD2   1 
ATOM   5123  N  N     . GLN C  2  204  ? 49.439  -50.487 39.377  1.00 125.95 ? 204  GLN C N     1 
ATOM   5124  C  CA    . GLN C  2  204  ? 48.029  -50.692 39.695  1.00 122.64 ? 204  GLN C CA    1 
ATOM   5125  C  C     . GLN C  2  204  ? 47.773  -51.952 40.523  1.00 121.95 ? 204  GLN C C     1 
ATOM   5126  O  O     . GLN C  2  204  ? 46.896  -51.968 41.388  1.00 114.20 ? 204  GLN C O     1 
ATOM   5127  C  CB    . GLN C  2  204  ? 47.217  -50.733 38.401  1.00 123.18 ? 204  GLN C CB    1 
ATOM   5128  C  CG    . GLN C  2  204  ? 45.719  -50.742 38.597  1.00 128.79 ? 204  GLN C CG    1 
ATOM   5129  C  CD    . GLN C  2  204  ? 44.975  -50.461 37.309  1.00 131.19 ? 204  GLN C CD    1 
ATOM   5130  O  OE1   . GLN C  2  204  ? 45.587  -50.209 36.270  1.00 125.55 ? 204  GLN C OE1   1 
ATOM   5131  N  NE2   . GLN C  2  204  ? 43.649  -50.500 37.370  1.00 136.32 ? 204  GLN C NE2   1 
ATOM   5132  N  N     . GLU C  2  205  ? 48.554  -52.996 40.257  1.00 128.74 ? 205  GLU C N     1 
ATOM   5133  C  CA    . GLU C  2  205  ? 48.451  -54.260 40.979  1.00 125.87 ? 205  GLU C CA    1 
ATOM   5134  C  C     . GLU C  2  205  ? 48.766  -54.064 42.458  1.00 119.93 ? 205  GLU C C     1 
ATOM   5135  O  O     . GLU C  2  205  ? 47.990  -54.469 43.331  1.00 123.35 ? 205  GLU C O     1 
ATOM   5136  C  CB    . GLU C  2  205  ? 49.423  -55.282 40.381  1.00 134.88 ? 205  GLU C CB    1 
ATOM   5137  C  CG    . GLU C  2  205  ? 48.952  -56.730 40.436  1.00 142.30 ? 205  GLU C CG    1 
ATOM   5138  C  CD    . GLU C  2  205  ? 48.354  -57.200 39.118  1.00 151.66 ? 205  GLU C CD    1 
ATOM   5139  O  OE1   . GLU C  2  205  ? 47.942  -56.341 38.309  1.00 146.27 ? 205  GLU C OE1   1 
ATOM   5140  O  OE2   . GLU C  2  205  ? 48.303  -58.428 38.887  1.00 146.70 ? 205  GLU C OE2   1 
ATOM   5141  N  N     . THR C  2  206  ? 49.907  -53.431 42.725  1.00 118.08 ? 206  THR C N     1 
ATOM   5142  C  CA    . THR C  2  206  ? 50.384  -53.200 44.087  1.00 110.91 ? 206  THR C CA    1 
ATOM   5143  C  C     . THR C  2  206  ? 49.403  -52.345 44.891  1.00 114.57 ? 206  THR C C     1 
ATOM   5144  O  O     . THR C  2  206  ? 49.079  -52.668 46.035  1.00 114.69 ? 206  THR C O     1 
ATOM   5145  C  CB    . THR C  2  206  ? 51.776  -52.530 44.090  1.00 100.65 ? 206  THR C CB    1 
ATOM   5146  O  OG1   . THR C  2  206  ? 52.572  -53.066 43.026  1.00 107.97 ? 206  THR C OG1   1 
ATOM   5147  C  CG2   . THR C  2  206  ? 52.486  -52.767 45.412  1.00 101.18 ? 206  THR C CG2   1 
ATOM   5148  N  N     . LEU C  2  207  ? 48.926  -51.260 44.286  1.00 113.32 ? 207  LEU C N     1 
ATOM   5149  C  CA    . LEU C  2  207  ? 47.969  -50.375 44.948  1.00 111.34 ? 207  LEU C CA    1 
ATOM   5150  C  C     . LEU C  2  207  ? 46.628  -51.066 45.188  1.00 110.80 ? 207  LEU C C     1 
ATOM   5151  O  O     . LEU C  2  207  ? 45.998  -50.869 46.227  1.00 112.25 ? 207  LEU C O     1 
ATOM   5152  C  CB    . LEU C  2  207  ? 47.766  -49.088 44.145  1.00 104.05 ? 207  LEU C CB    1 
ATOM   5153  C  CG    . LEU C  2  207  ? 49.008  -48.226 43.901  1.00 102.36 ? 207  LEU C CG    1 
ATOM   5154  C  CD1   . LEU C  2  207  ? 48.617  -46.892 43.289  1.00 102.90 ? 207  LEU C CD1   1 
ATOM   5155  C  CD2   . LEU C  2  207  ? 49.804  -48.016 45.182  1.00 98.03  ? 207  LEU C CD2   1 
ATOM   5156  N  N     . ALA C  2  208  ? 46.197  -51.878 44.227  1.00 118.82 ? 208  ALA C N     1 
ATOM   5157  C  CA    . ALA C  2  208  ? 44.953  -52.628 44.368  1.00 118.23 ? 208  ALA C CA    1 
ATOM   5158  C  C     . ALA C  2  208  ? 45.016  -53.625 45.524  1.00 118.26 ? 208  ALA C C     1 
ATOM   5159  O  O     . ALA C  2  208  ? 44.115  -53.665 46.365  1.00 116.62 ? 208  ALA C O     1 
ATOM   5160  C  CB    . ALA C  2  208  ? 44.601  -53.340 43.069  1.00 121.65 ? 208  ALA C CB    1 
ATOM   5161  N  N     . ARG C  2  209  ? 46.076  -54.430 45.570  1.00 115.03 ? 209  ARG C N     1 
ATOM   5162  C  CA    . ARG C  2  209  ? 46.207  -55.406 46.648  1.00 117.04 ? 209  ARG C CA    1 
ATOM   5163  C  C     . ARG C  2  209  ? 46.414  -54.727 47.999  1.00 123.35 ? 209  ARG C C     1 
ATOM   5164  O  O     . ARG C  2  209  ? 45.905  -55.194 49.019  1.00 131.28 ? 209  ARG C O     1 
ATOM   5165  C  CB    . ARG C  2  209  ? 47.329  -56.416 46.371  1.00 117.37 ? 209  ARG C CB    1 
ATOM   5166  C  CG    . ARG C  2  209  ? 48.689  -55.805 46.093  1.00 115.32 ? 209  ARG C CG    1 
ATOM   5167  C  CD    . ARG C  2  209  ? 49.784  -56.860 46.086  1.00 115.76 ? 209  ARG C CD    1 
ATOM   5168  N  NE    . ARG C  2  209  ? 50.167  -57.252 47.440  1.00 123.76 ? 209  ARG C NE    1 
ATOM   5169  C  CZ    . ARG C  2  209  ? 51.148  -56.680 48.132  1.00 123.04 ? 209  ARG C CZ    1 
ATOM   5170  N  NH1   . ARG C  2  209  ? 51.849  -55.689 47.594  1.00 116.30 ? 209  ARG C NH1   1 
ATOM   5171  N  NH2   . ARG C  2  209  ? 51.430  -57.097 49.359  1.00 107.23 ? 209  ARG C NH2   1 
ATOM   5172  N  N     . GLU C  2  210  ? 47.153  -53.621 48.001  1.00 121.21 ? 210  GLU C N     1 
ATOM   5173  C  CA    . GLU C  2  210  ? 47.476  -52.928 49.243  1.00 115.50 ? 210  GLU C CA    1 
ATOM   5174  C  C     . GLU C  2  210  ? 46.284  -52.200 49.866  1.00 113.05 ? 210  GLU C C     1 
ATOM   5175  O  O     . GLU C  2  210  ? 45.957  -52.411 51.035  1.00 111.43 ? 210  GLU C O     1 
ATOM   5176  C  CB    . GLU C  2  210  ? 48.621  -51.942 49.017  1.00 109.15 ? 210  GLU C CB    1 
ATOM   5177  C  CG    . GLU C  2  210  ? 49.496  -51.745 50.233  1.00 117.59 ? 210  GLU C CG    1 
ATOM   5178  C  CD    . GLU C  2  210  ? 50.193  -53.024 50.642  1.00 125.55 ? 210  GLU C CD    1 
ATOM   5179  O  OE1   . GLU C  2  210  ? 50.643  -53.765 49.740  1.00 120.00 ? 210  GLU C OE1   1 
ATOM   5180  O  OE2   . GLU C  2  210  ? 50.282  -53.292 51.860  1.00 124.51 ? 210  GLU C OE2   1 
ATOM   5181  N  N     . LEU C  2  211  ? 45.643  -51.339 49.082  1.00 109.82 ? 211  LEU C N     1 
ATOM   5182  C  CA    . LEU C  2  211  ? 44.590  -50.469 49.602  1.00 106.15 ? 211  LEU C CA    1 
ATOM   5183  C  C     . LEU C  2  211  ? 43.167  -50.976 49.365  1.00 112.22 ? 211  LEU C C     1 
ATOM   5184  O  O     . LEU C  2  211  ? 42.204  -50.332 49.779  1.00 108.04 ? 211  LEU C O     1 
ATOM   5185  C  CB    . LEU C  2  211  ? 44.745  -49.046 49.056  1.00 98.29  ? 211  LEU C CB    1 
ATOM   5186  C  CG    . LEU C  2  211  ? 46.019  -48.301 49.464  1.00 95.27  ? 211  LEU C CG    1 
ATOM   5187  C  CD1   . LEU C  2  211  ? 47.176  -48.619 48.533  1.00 104.88 ? 211  LEU C CD1   1 
ATOM   5188  C  CD2   . LEU C  2  211  ? 45.778  -46.811 49.506  1.00 92.57  ? 211  LEU C CD2   1 
ATOM   5189  N  N     . GLY C  2  212  ? 43.041  -52.127 48.711  1.00 119.15 ? 212  GLY C N     1 
ATOM   5190  C  CA    . GLY C  2  212  ? 41.744  -52.661 48.328  1.00 118.82 ? 212  GLY C CA    1 
ATOM   5191  C  C     . GLY C  2  212  ? 40.739  -52.858 49.451  1.00 111.60 ? 212  GLY C C     1 
ATOM   5192  O  O     . GLY C  2  212  ? 39.532  -52.726 49.239  1.00 108.23 ? 212  GLY C O     1 
ATOM   5193  N  N     . ALA C  2  213  ? 41.236  -53.165 50.646  1.00 110.64 ? 213  ALA C N     1 
ATOM   5194  C  CA    . ALA C  2  213  ? 40.386  -53.457 51.802  1.00 112.68 ? 213  ALA C CA    1 
ATOM   5195  C  C     . ALA C  2  213  ? 39.376  -52.350 52.128  1.00 110.90 ? 213  ALA C C     1 
ATOM   5196  O  O     . ALA C  2  213  ? 38.308  -52.614 52.680  1.00 111.37 ? 213  ALA C O     1 
ATOM   5197  C  CB    . ALA C  2  213  ? 41.246  -53.770 53.024  1.00 106.51 ? 213  ALA C CB    1 
ATOM   5198  N  N     . TYR C  2  214  ? 39.722  -51.114 51.781  1.00 114.27 ? 214  TYR C N     1 
ATOM   5199  C  CA    . TYR C  2  214  ? 38.849  -49.969 52.006  1.00 111.51 ? 214  TYR C CA    1 
ATOM   5200  C  C     . TYR C  2  214  ? 38.208  -49.645 50.664  1.00 119.31 ? 214  TYR C C     1 
ATOM   5201  O  O     . TYR C  2  214  ? 38.860  -49.128 49.758  1.00 122.35 ? 214  TYR C O     1 
ATOM   5202  C  CB    . TYR C  2  214  ? 39.674  -48.801 52.547  1.00 102.91 ? 214  TYR C CB    1 
ATOM   5203  C  CG    . TYR C  2  214  ? 40.837  -49.278 53.400  1.00 103.83 ? 214  TYR C CG    1 
ATOM   5204  C  CD1   . TYR C  2  214  ? 40.660  -49.604 54.741  1.00 95.45  ? 214  TYR C CD1   1 
ATOM   5205  C  CD2   . TYR C  2  214  ? 42.108  -49.436 52.852  1.00 104.73 ? 214  TYR C CD2   1 
ATOM   5206  C  CE1   . TYR C  2  214  ? 41.717  -50.059 55.516  1.00 91.21  ? 214  TYR C CE1   1 
ATOM   5207  C  CE2   . TYR C  2  214  ? 43.172  -49.892 53.618  1.00 100.68 ? 214  TYR C CE2   1 
ATOM   5208  C  CZ    . TYR C  2  214  ? 42.973  -50.200 54.948  1.00 98.59  ? 214  TYR C CZ    1 
ATOM   5209  O  OH    . TYR C  2  214  ? 44.034  -50.650 55.707  1.00 92.31  ? 214  TYR C OH    1 
ATOM   5210  N  N     . GLY C  2  215  ? 36.917  -49.940 50.556  1.00 117.03 ? 215  GLY C N     1 
ATOM   5211  C  CA    . GLY C  2  215  ? 36.301  -50.224 49.271  1.00 122.70 ? 215  GLY C CA    1 
ATOM   5212  C  C     . GLY C  2  215  ? 36.250  -49.177 48.177  1.00 122.18 ? 215  GLY C C     1 
ATOM   5213  O  O     . GLY C  2  215  ? 36.746  -49.408 47.074  1.00 119.66 ? 215  GLY C O     1 
ATOM   5214  N  N     . GLU C  2  216  ? 35.655  -48.027 48.464  1.00 121.80 ? 216  GLU C N     1 
ATOM   5215  C  CA    . GLU C  2  216  ? 35.295  -47.100 47.395  1.00 130.59 ? 216  GLU C CA    1 
ATOM   5216  C  C     . GLU C  2  216  ? 36.389  -46.110 46.997  1.00 126.88 ? 216  GLU C C     1 
ATOM   5217  O  O     . GLU C  2  216  ? 36.300  -45.464 45.953  1.00 126.68 ? 216  GLU C O     1 
ATOM   5218  C  CB    . GLU C  2  216  ? 34.002  -46.356 47.759  1.00 136.78 ? 216  GLU C CB    1 
ATOM   5219  C  CG    . GLU C  2  216  ? 32.824  -47.284 48.010  1.00 139.25 ? 216  GLU C CG    1 
ATOM   5220  C  CD    . GLU C  2  216  ? 32.615  -48.281 46.882  1.00 141.67 ? 216  GLU C CD    1 
ATOM   5221  O  OE1   . GLU C  2  216  ? 32.036  -47.894 45.845  1.00 140.12 ? 216  GLU C OE1   1 
ATOM   5222  O  OE2   . GLU C  2  216  ? 33.034  -49.450 47.029  1.00 137.15 ? 216  GLU C OE2   1 
ATOM   5223  N  N     . LEU C  2  217  ? 37.422  -46.006 47.822  1.00 121.56 ? 217  LEU C N     1 
ATOM   5224  C  CA    . LEU C  2  217  ? 38.449  -44.987 47.641  1.00 112.74 ? 217  LEU C CA    1 
ATOM   5225  C  C     . LEU C  2  217  ? 39.492  -45.359 46.582  1.00 111.00 ? 217  LEU C C     1 
ATOM   5226  O  O     . LEU C  2  217  ? 39.926  -44.514 45.783  1.00 114.83 ? 217  LEU C O     1 
ATOM   5227  C  CB    . LEU C  2  217  ? 39.117  -44.712 48.987  1.00 112.18 ? 217  LEU C CB    1 
ATOM   5228  C  CG    . LEU C  2  217  ? 38.089  -44.625 50.122  1.00 109.39 ? 217  LEU C CG    1 
ATOM   5229  C  CD1   . LEU C  2  217  ? 38.721  -44.871 51.484  1.00 98.78  ? 217  LEU C CD1   1 
ATOM   5230  C  CD2   . LEU C  2  217  ? 37.345  -43.293 50.091  1.00 103.13 ? 217  LEU C CD2   1 
ATOM   5231  N  N     . VAL C  2  218  ? 39.879  -46.631 46.573  1.00 107.19 ? 218  VAL C N     1 
ATOM   5232  C  CA    . VAL C  2  218  ? 40.938  -47.107 45.690  1.00 110.69 ? 218  VAL C CA    1 
ATOM   5233  C  C     . VAL C  2  218  ? 40.632  -46.880 44.210  1.00 116.90 ? 218  VAL C C     1 
ATOM   5234  O  O     . VAL C  2  218  ? 41.537  -46.627 43.420  1.00 111.05 ? 218  VAL C O     1 
ATOM   5235  C  CB    . VAL C  2  218  ? 41.230  -48.593 45.917  1.00 112.10 ? 218  VAL C CB    1 
ATOM   5236  C  CG1   . VAL C  2  218  ? 42.686  -48.898 45.588  1.00 106.92 ? 218  VAL C CG1   1 
ATOM   5237  C  CG2   . VAL C  2  218  ? 40.922  -48.964 47.347  1.00 111.44 ? 218  VAL C CG2   1 
ATOM   5238  N  N     . GLN C  2  219  ? 39.360  -46.977 43.835  1.00 126.91 ? 219  GLN C N     1 
ATOM   5239  C  CA    . GLN C  2  219  ? 38.961  -46.685 42.460  1.00 127.67 ? 219  GLN C CA    1 
ATOM   5240  C  C     . GLN C  2  219  ? 39.146  -45.202 42.161  1.00 120.58 ? 219  GLN C C     1 
ATOM   5241  O  O     . GLN C  2  219  ? 39.433  -44.818 41.026  1.00 121.14 ? 219  GLN C O     1 
ATOM   5242  C  CB    . GLN C  2  219  ? 37.514  -47.113 42.193  1.00 130.17 ? 219  GLN C CB    1 
ATOM   5243  C  CG    . GLN C  2  219  ? 37.375  -48.519 41.619  1.00 131.78 ? 219  GLN C CG    1 
ATOM   5244  C  CD    . GLN C  2  219  ? 37.793  -49.600 42.600  1.00 142.14 ? 219  GLN C CD    1 
ATOM   5245  O  OE1   . GLN C  2  219  ? 37.123  -49.831 43.608  1.00 141.71 ? 219  GLN C OE1   1 
ATOM   5246  N  NE2   . GLN C  2  219  ? 38.905  -50.268 42.308  1.00 133.23 ? 219  GLN C NE2   1 
ATOM   5247  N  N     . GLY C  2  220  ? 38.983  -44.374 43.190  1.00 117.60 ? 220  GLY C N     1 
ATOM   5248  C  CA    . GLY C  2  220  ? 39.247  -42.952 43.078  1.00 114.66 ? 220  GLY C CA    1 
ATOM   5249  C  C     . GLY C  2  220  ? 40.736  -42.706 42.936  1.00 113.95 ? 220  GLY C C     1 
ATOM   5250  O  O     . GLY C  2  220  ? 41.170  -41.676 42.419  1.00 109.44 ? 220  GLY C O     1 
ATOM   5251  N  N     . LEU C  2  221  ? 41.529  -43.663 43.404  1.00 116.04 ? 221  LEU C N     1 
ATOM   5252  C  CA    . LEU C  2  221  ? 42.976  -43.594 43.222  1.00 111.26 ? 221  LEU C CA    1 
ATOM   5253  C  C     . LEU C  2  221  ? 43.376  -43.995 41.796  1.00 110.31 ? 221  LEU C C     1 
ATOM   5254  O  O     . LEU C  2  221  ? 44.430  -43.601 41.307  1.00 108.26 ? 221  LEU C O     1 
ATOM   5255  C  CB    . LEU C  2  221  ? 43.677  -44.498 44.243  1.00 112.75 ? 221  LEU C CB    1 
ATOM   5256  C  CG    . LEU C  2  221  ? 44.987  -44.079 44.917  1.00 99.21  ? 221  LEU C CG    1 
ATOM   5257  C  CD1   . LEU C  2  221  ? 45.345  -45.090 45.994  1.00 97.39  ? 221  LEU C CD1   1 
ATOM   5258  C  CD2   . LEU C  2  221  ? 46.127  -43.948 43.926  1.00 94.81  ? 221  LEU C CD2   1 
ATOM   5259  N  N     . MET C  2  222  ? 42.527  -44.773 41.127  1.00 120.27 ? 222  MET C N     1 
ATOM   5260  C  CA    . MET C  2  222  ? 42.875  -45.337 39.820  1.00 118.85 ? 222  MET C CA    1 
ATOM   5261  C  C     . MET C  2  222  ? 42.787  -44.337 38.665  1.00 121.30 ? 222  MET C C     1 
ATOM   5262  O  O     . MET C  2  222  ? 41.721  -43.785 38.382  1.00 115.44 ? 222  MET C O     1 
ATOM   5263  C  CB    . MET C  2  222  ? 41.991  -46.549 39.507  1.00 116.04 ? 222  MET C CB    1 
ATOM   5264  C  CG    . MET C  2  222  ? 42.168  -47.720 40.457  1.00 116.57 ? 222  MET C CG    1 
ATOM   5265  S  SD    . MET C  2  222  ? 43.861  -48.337 40.486  1.00 122.17 ? 222  MET C SD    1 
ATOM   5266  C  CE    . MET C  2  222  ? 43.723  -49.676 41.670  1.00 116.94 ? 222  MET C CE    1 
ATOM   5267  N  N     . ASP C  2  223  ? 43.914  -44.130 37.991  1.00 122.09 ? 223  ASP C N     1 
ATOM   5268  C  CA    . ASP C  2  223  ? 43.956  -43.318 36.780  1.00 124.68 ? 223  ASP C CA    1 
ATOM   5269  C  C     . ASP C  2  223  ? 44.750  -44.047 35.702  1.00 128.83 ? 223  ASP C C     1 
ATOM   5270  O  O     . ASP C  2  223  ? 45.951  -44.271 35.849  1.00 119.32 ? 223  ASP C O     1 
ATOM   5271  C  CB    . ASP C  2  223  ? 44.576  -41.948 37.062  1.00 122.09 ? 223  ASP C CB    1 
ATOM   5272  C  CG    . ASP C  2  223  ? 44.575  -41.047 35.842  1.00 123.83 ? 223  ASP C CG    1 
ATOM   5273  O  OD1   . ASP C  2  223  ? 45.542  -41.107 35.056  1.00 122.84 ? 223  ASP C OD1   1 
ATOM   5274  O  OD2   . ASP C  2  223  ? 43.607  -40.278 35.667  1.00 126.34 ? 223  ASP C OD2   1 
ATOM   5275  N  N     . GLU C  2  224  ? 44.071  -44.396 34.614  1.00 139.26 ? 224  GLU C N     1 
ATOM   5276  C  CA    . GLU C  2  224  ? 44.640  -45.241 33.564  1.00 136.20 ? 224  GLU C CA    1 
ATOM   5277  C  C     . GLU C  2  224  ? 45.866  -44.645 32.869  1.00 132.72 ? 224  GLU C C     1 
ATOM   5278  O  O     . GLU C  2  224  ? 46.878  -45.328 32.690  1.00 129.61 ? 224  GLU C O     1 
ATOM   5279  C  CB    . GLU C  2  224  ? 43.567  -45.609 32.530  1.00 144.39 ? 224  GLU C CB    1 
ATOM   5280  C  CG    . GLU C  2  224  ? 42.712  -44.439 32.043  1.00 149.59 ? 224  GLU C CG    1 
ATOM   5281  C  CD    . GLU C  2  224  ? 41.553  -44.122 32.976  1.00 155.60 ? 224  GLU C CD    1 
ATOM   5282  O  OE1   . GLU C  2  224  ? 40.430  -44.607 32.719  1.00 158.73 ? 224  GLU C OE1   1 
ATOM   5283  O  OE2   . GLU C  2  224  ? 41.766  -43.386 33.964  1.00 143.25 ? 224  GLU C OE2   1 
ATOM   5284  N  N     . SER C  2  225  ? 45.767  -43.377 32.479  1.00 129.80 ? 225  SER C N     1 
ATOM   5285  C  CA    . SER C  2  225  ? 46.838  -42.704 31.750  1.00 123.45 ? 225  SER C CA    1 
ATOM   5286  C  C     . SER C  2  225  ? 48.154  -42.707 32.520  1.00 120.63 ? 225  SER C C     1 
ATOM   5287  O  O     . SER C  2  225  ? 49.221  -42.891 31.938  1.00 119.89 ? 225  SER C O     1 
ATOM   5288  C  CB    . SER C  2  225  ? 46.433  -41.268 31.419  1.00 120.57 ? 225  SER C CB    1 
ATOM   5289  O  OG    . SER C  2  225  ? 46.082  -40.557 32.592  1.00 126.93 ? 225  SER C OG    1 
ATOM   5290  N  N     . VAL C  2  226  ? 48.066  -42.509 33.831  1.00 123.24 ? 226  VAL C N     1 
ATOM   5291  C  CA    . VAL C  2  226  ? 49.248  -42.468 34.684  1.00 119.63 ? 226  VAL C CA    1 
ATOM   5292  C  C     . VAL C  2  226  ? 49.917  -43.839 34.799  1.00 120.72 ? 226  VAL C C     1 
ATOM   5293  O  O     . VAL C  2  226  ? 51.142  -43.945 34.728  1.00 118.76 ? 226  VAL C O     1 
ATOM   5294  C  CB    . VAL C  2  226  ? 48.909  -41.917 36.086  1.00 117.91 ? 226  VAL C CB    1 
ATOM   5295  C  CG1   . VAL C  2  226  ? 50.090  -42.075 37.029  1.00 104.82 ? 226  VAL C CG1   1 
ATOM   5296  C  CG2   . VAL C  2  226  ? 48.497  -40.458 35.993  1.00 114.80 ? 226  VAL C CG2   1 
ATOM   5297  N  N     . PHE C  2  227  ? 49.115  -44.886 34.967  1.00 123.74 ? 227  PHE C N     1 
ATOM   5298  C  CA    . PHE C  2  227  ? 49.651  -46.242 35.045  1.00 123.99 ? 227  PHE C CA    1 
ATOM   5299  C  C     . PHE C  2  227  ? 50.224  -46.687 33.703  1.00 126.58 ? 227  PHE C C     1 
ATOM   5300  O  O     . PHE C  2  227  ? 51.137  -47.512 33.651  1.00 124.46 ? 227  PHE C O     1 
ATOM   5301  C  CB    . PHE C  2  227  ? 48.582  -47.234 35.509  1.00 127.85 ? 227  PHE C CB    1 
ATOM   5302  C  CG    . PHE C  2  227  ? 48.220  -47.101 36.959  1.00 127.60 ? 227  PHE C CG    1 
ATOM   5303  C  CD1   . PHE C  2  227  ? 49.147  -47.391 37.946  1.00 126.12 ? 227  PHE C CD1   1 
ATOM   5304  C  CD2   . PHE C  2  227  ? 46.950  -46.699 37.335  1.00 123.97 ? 227  PHE C CD2   1 
ATOM   5305  C  CE1   . PHE C  2  227  ? 48.816  -47.271 39.282  1.00 123.83 ? 227  PHE C CE1   1 
ATOM   5306  C  CE2   . PHE C  2  227  ? 46.612  -46.577 38.669  1.00 125.90 ? 227  PHE C CE2   1 
ATOM   5307  C  CZ    . PHE C  2  227  ? 47.546  -46.865 39.645  1.00 124.89 ? 227  PHE C CZ    1 
ATOM   5308  N  N     . ALA C  2  228  ? 49.679  -46.134 32.623  1.00 127.49 ? 228  ALA C N     1 
ATOM   5309  C  CA    . ALA C  2  228  ? 50.140  -46.456 31.277  1.00 121.61 ? 228  ALA C CA    1 
ATOM   5310  C  C     . ALA C  2  228  ? 51.587  -46.020 31.053  1.00 123.55 ? 228  ALA C C     1 
ATOM   5311  O  O     . ALA C  2  228  ? 52.379  -46.751 30.456  1.00 125.43 ? 228  ALA C O     1 
ATOM   5312  C  CB    . ALA C  2  228  ? 49.226  -45.821 30.240  1.00 117.32 ? 228  ALA C CB    1 
ATOM   5313  N  N     . MET C  2  229  ? 51.926  -44.829 31.537  1.00 123.71 ? 229  MET C N     1 
ATOM   5314  C  CA    . MET C  2  229  ? 53.265  -44.277 31.353  1.00 120.95 ? 229  MET C CA    1 
ATOM   5315  C  C     . MET C  2  229  ? 54.236  -44.726 32.443  1.00 115.93 ? 229  MET C C     1 
ATOM   5316  O  O     . MET C  2  229  ? 53.887  -44.777 33.620  1.00 116.56 ? 229  MET C O     1 
ATOM   5317  C  CB    . MET C  2  229  ? 53.213  -42.748 31.283  1.00 120.00 ? 229  MET C CB    1 
ATOM   5318  C  CG    . MET C  2  229  ? 52.726  -42.064 32.552  1.00 114.87 ? 229  MET C CG    1 
ATOM   5319  S  SD    . MET C  2  229  ? 52.323  -40.328 32.275  1.00 105.31 ? 229  MET C SD    1 
ATOM   5320  C  CE    . MET C  2  229  ? 51.931  -39.789 33.929  1.00 110.83 ? 229  MET C CE    1 
ATOM   5321  N  N     . ARG C  2  230  ? 55.458  -45.054 32.038  1.00 120.65 ? 230  ARG C N     1 
ATOM   5322  C  CA    . ARG C  2  230  ? 56.486  -45.488 32.977  1.00 120.95 ? 230  ARG C CA    1 
ATOM   5323  C  C     . ARG C  2  230  ? 56.892  -44.341 33.908  1.00 116.50 ? 230  ARG C C     1 
ATOM   5324  O  O     . ARG C  2  230  ? 56.613  -43.179 33.607  1.00 116.80 ? 230  ARG C O     1 
ATOM   5325  C  CB    . ARG C  2  230  ? 57.694  -46.058 32.219  1.00 118.81 ? 230  ARG C CB    1 
ATOM   5326  C  CG    . ARG C  2  230  ? 58.060  -45.328 30.946  1.00 114.44 ? 230  ARG C CG    1 
ATOM   5327  C  CD    . ARG C  2  230  ? 59.390  -45.835 30.411  1.00 120.48 ? 230  ARG C CD    1 
ATOM   5328  N  NE    . ARG C  2  230  ? 59.397  -45.913 28.954  1.00 127.72 ? 230  ARG C NE    1 
ATOM   5329  C  CZ    . ARG C  2  230  ? 59.652  -44.886 28.150  1.00 125.40 ? 230  ARG C CZ    1 
ATOM   5330  N  NH1   . ARG C  2  230  ? 59.635  -45.053 26.835  1.00 126.18 ? 230  ARG C NH1   1 
ATOM   5331  N  NH2   . ARG C  2  230  ? 59.922  -43.692 28.660  1.00 121.77 ? 230  ARG C NH2   1 
ATOM   5332  N  N     . PRO C  2  231  ? 57.539  -44.663 35.047  1.00 108.62 ? 231  PRO C N     1 
ATOM   5333  C  CA    . PRO C  2  231  ? 57.924  -43.657 36.045  1.00 107.43 ? 231  PRO C CA    1 
ATOM   5334  C  C     . PRO C  2  231  ? 58.696  -42.453 35.504  1.00 109.50 ? 231  PRO C C     1 
ATOM   5335  O  O     . PRO C  2  231  ? 58.650  -41.391 36.118  1.00 110.18 ? 231  PRO C O     1 
ATOM   5336  C  CB    . PRO C  2  231  ? 58.816  -44.452 36.998  1.00 103.06 ? 231  PRO C CB    1 
ATOM   5337  C  CG    . PRO C  2  231  ? 58.241  -45.810 36.967  1.00 102.00 ? 231  PRO C CG    1 
ATOM   5338  C  CD    . PRO C  2  231  ? 57.760  -46.030 35.557  1.00 104.94 ? 231  PRO C CD    1 
ATOM   5339  N  N     . GLU C  2  232  ? 59.386  -42.607 34.381  1.00 110.54 ? 232  GLU C N     1 
ATOM   5340  C  CA    . GLU C  2  232  ? 60.181  -41.516 33.830  1.00 108.91 ? 232  GLU C CA    1 
ATOM   5341  C  C     . GLU C  2  232  ? 59.264  -40.454 33.237  1.00 105.80 ? 232  GLU C C     1 
ATOM   5342  O  O     . GLU C  2  232  ? 59.420  -39.254 33.501  1.00 104.32 ? 232  GLU C O     1 
ATOM   5343  C  CB    . GLU C  2  232  ? 61.154  -42.037 32.766  1.00 117.68 ? 232  GLU C CB    1 
ATOM   5344  C  CG    . GLU C  2  232  ? 61.285  -43.560 32.705  1.00 125.01 ? 232  GLU C CG    1 
ATOM   5345  C  CD    . GLU C  2  232  ? 61.803  -44.178 33.999  1.00 130.42 ? 232  GLU C CD    1 
ATOM   5346  O  OE1   . GLU C  2  232  ? 61.487  -45.359 34.260  1.00 123.92 ? 232  GLU C OE1   1 
ATOM   5347  O  OE2   . GLU C  2  232  ? 62.514  -43.483 34.757  1.00 135.78 ? 232  GLU C OE2   1 
ATOM   5348  N  N     . GLU C  2  233  ? 58.300  -40.911 32.444  1.00 104.11 ? 233  GLU C N     1 
ATOM   5349  C  CA    . GLU C  2  233  ? 57.309  -40.031 31.841  1.00 105.20 ? 233  GLU C CA    1 
ATOM   5350  C  C     . GLU C  2  233  ? 56.490  -39.356 32.930  1.00 105.04 ? 233  GLU C C     1 
ATOM   5351  O  O     . GLU C  2  233  ? 56.094  -38.198 32.798  1.00 101.70 ? 233  GLU C O     1 
ATOM   5352  C  CB    . GLU C  2  233  ? 56.387  -40.825 30.915  1.00 114.47 ? 233  GLU C CB    1 
ATOM   5353  C  CG    . GLU C  2  233  ? 57.116  -41.828 30.037  1.00 120.13 ? 233  GLU C CG    1 
ATOM   5354  C  CD    . GLU C  2  233  ? 56.287  -42.295 28.855  1.00 121.25 ? 233  GLU C CD    1 
ATOM   5355  O  OE1   . GLU C  2  233  ? 55.063  -42.045 28.838  1.00 114.37 ? 233  GLU C OE1   1 
ATOM   5356  O  OE2   . GLU C  2  233  ? 56.867  -42.907 27.935  1.00 128.63 ? 233  GLU C OE2   1 
ATOM   5357  N  N     . ALA C  2  234  ? 56.247  -40.093 34.009  1.00 110.01 ? 234  ALA C N     1 
ATOM   5358  C  CA    . ALA C  2  234  ? 55.489  -39.581 35.142  1.00 98.43  ? 234  ALA C CA    1 
ATOM   5359  C  C     . ALA C  2  234  ? 56.292  -38.532 35.900  1.00 94.03  ? 234  ALA C C     1 
ATOM   5360  O  O     . ALA C  2  234  ? 55.728  -37.592 36.452  1.00 93.31  ? 234  ALA C O     1 
ATOM   5361  C  CB    . ALA C  2  234  ? 55.093  -40.720 36.064  1.00 95.63  ? 234  ALA C CB    1 
ATOM   5362  N  N     . LEU C  2  235  ? 57.611  -38.701 35.921  1.00 95.82  ? 235  LEU C N     1 
ATOM   5363  C  CA    . LEU C  2  235  ? 58.507  -37.756 36.583  1.00 95.98  ? 235  LEU C CA    1 
ATOM   5364  C  C     . LEU C  2  235  ? 58.594  -36.450 35.804  1.00 97.57  ? 235  LEU C C     1 
ATOM   5365  O  O     . LEU C  2  235  ? 58.552  -35.361 36.387  1.00 98.44  ? 235  LEU C O     1 
ATOM   5366  C  CB    . LEU C  2  235  ? 59.903  -38.362 36.748  1.00 96.51  ? 235  LEU C CB    1 
ATOM   5367  C  CG    . LEU C  2  235  ? 61.020  -37.449 37.261  1.00 91.43  ? 235  LEU C CG    1 
ATOM   5368  C  CD1   . LEU C  2  235  ? 60.643  -36.828 38.588  1.00 92.72  ? 235  LEU C CD1   1 
ATOM   5369  C  CD2   . LEU C  2  235  ? 62.312  -38.229 37.398  1.00 91.50  ? 235  LEU C CD2   1 
ATOM   5370  N  N     . ILE C  2  236  ? 58.721  -36.562 34.484  1.00 98.21  ? 236  ILE C N     1 
ATOM   5371  C  CA    . ILE C  2  236  ? 58.733  -35.377 33.632  1.00 93.61  ? 236  ILE C CA    1 
ATOM   5372  C  C     . ILE C  2  236  ? 57.383  -34.657 33.699  1.00 93.67  ? 236  ILE C C     1 
ATOM   5373  O  O     . ILE C  2  236  ? 57.328  -33.430 33.801  1.00 94.11  ? 236  ILE C O     1 
ATOM   5374  C  CB    . ILE C  2  236  ? 59.114  -35.727 32.178  1.00 84.92  ? 236  ILE C CB    1 
ATOM   5375  C  CG1   . ILE C  2  236  ? 60.586  -36.136 32.109  1.00 89.38  ? 236  ILE C CG1   1 
ATOM   5376  C  CG2   . ILE C  2  236  ? 58.858  -34.552 31.252  1.00 84.58  ? 236  ILE C CG2   1 
ATOM   5377  C  CD1   . ILE C  2  236  ? 61.052  -36.516 30.722  1.00 108.42 ? 236  ILE C CD1   1 
ATOM   5378  N  N     . ARG C  2  237  ? 56.301  -35.431 33.673  1.00 92.91  ? 237  ARG C N     1 
ATOM   5379  C  CA    . ARG C  2  237  ? 54.947  -34.890 33.784  1.00 94.06  ? 237  ARG C CA    1 
ATOM   5380  C  C     . ARG C  2  237  ? 54.740  -34.147 35.108  1.00 98.89  ? 237  ARG C C     1 
ATOM   5381  O  O     . ARG C  2  237  ? 54.221  -33.020 35.134  1.00 101.74 ? 237  ARG C O     1 
ATOM   5382  C  CB    . ARG C  2  237  ? 53.925  -36.022 33.630  1.00 98.25  ? 237  ARG C CB    1 
ATOM   5383  C  CG    . ARG C  2  237  ? 52.542  -35.734 34.188  1.00 101.83 ? 237  ARG C CG    1 
ATOM   5384  C  CD    . ARG C  2  237  ? 51.702  -34.879 33.257  1.00 101.36 ? 237  ARG C CD    1 
ATOM   5385  N  NE    . ARG C  2  237  ? 50.367  -34.666 33.811  1.00 109.36 ? 237  ARG C NE    1 
ATOM   5386  C  CZ    . ARG C  2  237  ? 49.430  -33.912 33.246  1.00 115.19 ? 237  ARG C CZ    1 
ATOM   5387  N  NH1   . ARG C  2  237  ? 48.246  -33.778 33.828  1.00 108.48 ? 237  ARG C NH1   1 
ATOM   5388  N  NH2   . ARG C  2  237  ? 49.675  -33.290 32.101  1.00 128.98 ? 237  ARG C NH2   1 
ATOM   5389  N  N     . LEU C  2  238  ? 55.158  -34.778 36.203  1.00 95.96  ? 238  LEU C N     1 
ATOM   5390  C  CA    . LEU C  2  238  ? 55.070  -34.168 37.525  1.00 90.28  ? 238  LEU C CA    1 
ATOM   5391  C  C     . LEU C  2  238  ? 55.876  -32.877 37.580  1.00 90.74  ? 238  LEU C C     1 
ATOM   5392  O  O     . LEU C  2  238  ? 55.410  -31.874 38.118  1.00 91.61  ? 238  LEU C O     1 
ATOM   5393  C  CB    . LEU C  2  238  ? 55.549  -35.137 38.612  1.00 91.18  ? 238  LEU C CB    1 
ATOM   5394  C  CG    . LEU C  2  238  ? 55.449  -34.631 40.058  1.00 94.36  ? 238  LEU C CG    1 
ATOM   5395  C  CD1   . LEU C  2  238  ? 54.014  -34.248 40.417  1.00 82.78  ? 238  LEU C CD1   1 
ATOM   5396  C  CD2   . LEU C  2  238  ? 55.993  -35.659 41.042  1.00 81.38  ? 238  LEU C CD2   1 
ATOM   5397  N  N     . PHE C  2  239  ? 57.080  -32.904 37.014  1.00 90.58  ? 239  PHE C N     1 
ATOM   5398  C  CA    . PHE C  2  239  ? 57.918  -31.711 36.969  1.00 85.19  ? 239  PHE C CA    1 
ATOM   5399  C  C     . PHE C  2  239  ? 57.261  -30.580 36.180  1.00 89.13  ? 239  PHE C C     1 
ATOM   5400  O  O     . PHE C  2  239  ? 57.374  -29.415 36.554  1.00 91.04  ? 239  PHE C O     1 
ATOM   5401  C  CB    . PHE C  2  239  ? 59.298  -32.027 36.393  1.00 80.02  ? 239  PHE C CB    1 
ATOM   5402  C  CG    . PHE C  2  239  ? 60.210  -30.836 36.326  1.00 82.44  ? 239  PHE C CG    1 
ATOM   5403  C  CD1   . PHE C  2  239  ? 60.273  -30.055 35.183  1.00 93.04  ? 239  PHE C CD1   1 
ATOM   5404  C  CD2   . PHE C  2  239  ? 61.001  -30.493 37.406  1.00 85.33  ? 239  PHE C CD2   1 
ATOM   5405  C  CE1   . PHE C  2  239  ? 61.109  -28.957 35.121  1.00 94.20  ? 239  PHE C CE1   1 
ATOM   5406  C  CE2   . PHE C  2  239  ? 61.841  -29.396 37.348  1.00 90.19  ? 239  PHE C CE2   1 
ATOM   5407  C  CZ    . PHE C  2  239  ? 61.895  -28.629 36.204  1.00 89.78  ? 239  PHE C CZ    1 
ATOM   5408  N  N     . THR C  2  240  ? 56.583  -30.922 35.087  1.00 92.82  ? 240  THR C N     1 
ATOM   5409  C  CA    . THR C  2  240  ? 55.866  -29.920 34.302  1.00 95.48  ? 240  THR C CA    1 
ATOM   5410  C  C     . THR C  2  240  ? 54.670  -29.373 35.075  1.00 96.71  ? 240  THR C C     1 
ATOM   5411  O  O     . THR C  2  240  ? 54.248  -28.236 34.860  1.00 93.99  ? 240  THR C O     1 
ATOM   5412  C  CB    . THR C  2  240  ? 55.371  -30.478 32.955  1.00 96.45  ? 240  THR C CB    1 
ATOM   5413  O  OG1   . THR C  2  240  ? 54.488  -31.582 33.185  1.00 102.51 ? 240  THR C OG1   1 
ATOM   5414  C  CG2   . THR C  2  240  ? 56.541  -30.932 32.103  1.00 97.86  ? 240  THR C CG2   1 
ATOM   5415  N  N     . LEU C  2  241  ? 54.119  -30.189 35.968  1.00 97.16  ? 241  LEU C N     1 
ATOM   5416  C  CA    . LEU C  2  241  ? 53.043  -29.724 36.837  1.00 95.22  ? 241  LEU C CA    1 
ATOM   5417  C  C     . LEU C  2  241  ? 53.551  -28.764 37.914  1.00 96.88  ? 241  LEU C C     1 
ATOM   5418  O  O     . LEU C  2  241  ? 52.921  -27.742 38.188  1.00 99.20  ? 241  LEU C O     1 
ATOM   5419  C  CB    . LEU C  2  241  ? 52.314  -30.905 37.482  1.00 96.17  ? 241  LEU C CB    1 
ATOM   5420  C  CG    . LEU C  2  241  ? 51.331  -31.660 36.587  1.00 99.21  ? 241  LEU C CG    1 
ATOM   5421  C  CD1   . LEU C  2  241  ? 50.591  -32.721 37.380  1.00 94.66  ? 241  LEU C CD1   1 
ATOM   5422  C  CD2   . LEU C  2  241  ? 50.348  -30.694 35.946  1.00 108.19 ? 241  LEU C CD2   1 
ATOM   5423  N  N     . LEU C  2  242  ? 54.688  -29.097 38.519  1.00 96.02  ? 242  LEU C N     1 
ATOM   5424  C  CA    . LEU C  2  242  ? 55.248  -28.301 39.614  1.00 97.15  ? 242  LEU C CA    1 
ATOM   5425  C  C     . LEU C  2  242  ? 56.017  -27.062 39.155  1.00 94.35  ? 242  LEU C C     1 
ATOM   5426  O  O     . LEU C  2  242  ? 55.983  -26.023 39.813  1.00 98.49  ? 242  LEU C O     1 
ATOM   5427  C  CB    . LEU C  2  242  ? 56.141  -29.163 40.512  1.00 96.01  ? 242  LEU C CB    1 
ATOM   5428  C  CG    . LEU C  2  242  ? 55.519  -30.421 41.124  1.00 93.73  ? 242  LEU C CG    1 
ATOM   5429  C  CD1   . LEU C  2  242  ? 56.519  -31.097 42.049  1.00 83.02  ? 242  LEU C CD1   1 
ATOM   5430  C  CD2   . LEU C  2  242  ? 54.222  -30.102 41.861  1.00 82.65  ? 242  LEU C CD2   1 
ATOM   5431  N  N     . ARG C  2  243  ? 56.692  -27.155 38.024  1.00 95.52  ? 243  ARG C N     1 
ATOM   5432  C  CA    . ARG C  2  243  ? 57.453  -26.022 37.534  1.00 98.54  ? 243  ARG C CA    1 
ATOM   5433  C  C     . ARG C  2  243  ? 57.136  -25.675 36.097  1.00 99.55  ? 243  ARG C C     1 
ATOM   5434  O  O     . ARG C  2  243  ? 57.929  -25.917 35.208  1.00 100.79 ? 243  ARG C O     1 
ATOM   5435  C  CB    . ARG C  2  243  ? 58.937  -26.305 37.667  1.00 98.08  ? 243  ARG C CB    1 
ATOM   5436  C  CG    . ARG C  2  243  ? 59.486  -26.029 39.048  1.00 100.02 ? 243  ARG C CG    1 
ATOM   5437  C  CD    . ARG C  2  243  ? 60.998  -26.095 39.043  1.00 103.02 ? 243  ARG C CD    1 
ATOM   5438  N  NE    . ARG C  2  243  ? 61.613  -24.841 38.629  1.00 101.51 ? 243  ARG C NE    1 
ATOM   5439  C  CZ    . ARG C  2  243  ? 61.620  -23.746 39.366  1.00 95.67  ? 243  ARG C CZ    1 
ATOM   5440  N  NH1   . ARG C  2  243  ? 61.036  -23.751 40.550  1.00 91.01  ? 243  ARG C NH1   1 
ATOM   5441  N  NH2   . ARG C  2  243  ? 62.208  -22.656 38.921  1.00 90.01  ? 243  ARG C NH2   1 
ATOM   5442  N  N     . PRO C  2  244  ? 55.976  -25.090 35.875  1.00 99.01  ? 244  PRO C N     1 
ATOM   5443  C  CA    . PRO C  2  244  ? 55.556  -24.708 34.522  1.00 102.88 ? 244  PRO C CA    1 
ATOM   5444  C  C     . PRO C  2  244  ? 56.513  -23.706 33.880  1.00 101.10 ? 244  PRO C C     1 
ATOM   5445  O  O     . PRO C  2  244  ? 57.054  -22.840 34.564  1.00 96.44  ? 244  PRO C O     1 
ATOM   5446  C  CB    . PRO C  2  244  ? 54.193  -24.051 34.754  1.00 97.87  ? 244  PRO C CB    1 
ATOM   5447  C  CG    . PRO C  2  244  ? 53.709  -24.617 36.042  1.00 98.27  ? 244  PRO C CG    1 
ATOM   5448  C  CD    . PRO C  2  244  ? 54.941  -24.788 36.878  1.00 96.60  ? 244  PRO C CD    1 
ATOM   5449  N  N     . GLY C  2  245  ? 56.719  -23.836 32.574  1.00 101.23 ? 245  GLY C N     1 
ATOM   5450  C  CA    . GLY C  2  245  ? 57.557  -22.910 31.834  1.00 110.18 ? 245  GLY C CA    1 
ATOM   5451  C  C     . GLY C  2  245  ? 59.034  -23.254 31.875  1.00 108.23 ? 245  GLY C C     1 
ATOM   5452  O  O     . GLY C  2  245  ? 59.811  -22.772 31.054  1.00 102.35 ? 245  GLY C O     1 
ATOM   5453  N  N     . ASP C  2  246  ? 59.421  -24.087 32.835  1.00 105.32 ? 246  ASP C N     1 
ATOM   5454  C  CA    . ASP C  2  246  ? 60.787  -24.584 32.921  1.00 103.15 ? 246  ASP C CA    1 
ATOM   5455  C  C     . ASP C  2  246  ? 60.884  -25.803 32.014  1.00 106.40 ? 246  ASP C C     1 
ATOM   5456  O  O     . ASP C  2  246  ? 60.152  -26.775 32.207  1.00 103.72 ? 246  ASP C O     1 
ATOM   5457  C  CB    . ASP C  2  246  ? 61.115  -24.965 34.370  1.00 100.32 ? 246  ASP C CB    1 
ATOM   5458  C  CG    . ASP C  2  246  ? 62.593  -25.264 34.590  1.00 110.19 ? 246  ASP C CG    1 
ATOM   5459  O  OD1   . ASP C  2  246  ? 63.309  -25.567 33.611  1.00 116.34 ? 246  ASP C OD1   1 
ATOM   5460  O  OD2   . ASP C  2  246  ? 63.040  -25.207 35.759  1.00 102.25 ? 246  ASP C OD2   1 
ATOM   5461  N  N     . PRO C  2  247  ? 61.775  -25.751 31.006  1.00 105.49 ? 247  PRO C N     1 
ATOM   5462  C  CA    . PRO C  2  247  ? 61.924  -26.879 30.079  1.00 107.38 ? 247  PRO C CA    1 
ATOM   5463  C  C     . PRO C  2  247  ? 62.246  -28.168 30.831  1.00 108.05 ? 247  PRO C C     1 
ATOM   5464  O  O     . PRO C  2  247  ? 63.171  -28.191 31.646  1.00 104.92 ? 247  PRO C O     1 
ATOM   5465  C  CB    . PRO C  2  247  ? 63.092  -26.451 29.176  1.00 98.08  ? 247  PRO C CB    1 
ATOM   5466  C  CG    . PRO C  2  247  ? 63.765  -25.326 29.900  1.00 94.21  ? 247  PRO C CG    1 
ATOM   5467  C  CD    . PRO C  2  247  ? 62.679  -24.641 30.668  1.00 94.05  ? 247  PRO C CD    1 
ATOM   5468  N  N     . PRO C  2  248  ? 61.477  -29.231 30.557  1.00 104.74 ? 248  PRO C N     1 
ATOM   5469  C  CA    . PRO C  2  248  ? 61.479  -30.474 31.336  1.00 106.23 ? 248  PRO C CA    1 
ATOM   5470  C  C     . PRO C  2  248  ? 62.624  -31.424 30.996  1.00 102.81 ? 248  PRO C C     1 
ATOM   5471  O  O     . PRO C  2  248  ? 62.366  -32.579 30.655  1.00 103.80 ? 248  PRO C O     1 
ATOM   5472  C  CB    . PRO C  2  248  ? 60.138  -31.127 30.961  1.00 106.71 ? 248  PRO C CB    1 
ATOM   5473  C  CG    . PRO C  2  248  ? 59.384  -30.093 30.156  1.00 104.94 ? 248  PRO C CG    1 
ATOM   5474  C  CD    . PRO C  2  248  ? 60.428  -29.241 29.528  1.00 103.99 ? 248  PRO C CD    1 
ATOM   5475  N  N     . LYS C  2  249  ? 63.861  -30.950 31.084  1.00 100.33 ? 249  LYS C N     1 
ATOM   5476  C  CA    . LYS C  2  249  ? 65.013  -31.827 30.937  1.00 100.62 ? 249  LYS C CA    1 
ATOM   5477  C  C     . LYS C  2  249  ? 64.925  -32.863 32.052  1.00 105.04 ? 249  LYS C C     1 
ATOM   5478  O  O     . LYS C  2  249  ? 64.616  -32.522 33.191  1.00 108.31 ? 249  LYS C O     1 
ATOM   5479  C  CB    . LYS C  2  249  ? 66.314  -31.025 31.027  1.00 105.22 ? 249  LYS C CB    1 
ATOM   5480  C  CG    . LYS C  2  249  ? 67.517  -31.687 30.367  1.00 114.54 ? 249  LYS C CG    1 
ATOM   5481  C  CD    . LYS C  2  249  ? 68.673  -30.703 30.217  1.00 113.67 ? 249  LYS C CD    1 
ATOM   5482  C  CE    . LYS C  2  249  ? 69.919  -31.374 29.645  1.00 106.55 ? 249  LYS C CE    1 
ATOM   5483  N  NZ    . LYS C  2  249  ? 69.705  -31.912 28.271  1.00 102.86 ? 249  LYS C NZ    1 
ATOM   5484  N  N     . ARG C  2  250  ? 65.174  -34.126 31.718  1.00 113.14 ? 250  ARG C N     1 
ATOM   5485  C  CA    . ARG C  2  250  ? 64.960  -35.235 32.650  1.00 107.95 ? 250  ARG C CA    1 
ATOM   5486  C  C     . ARG C  2  250  ? 65.826  -35.140 33.911  1.00 104.25 ? 250  ARG C C     1 
ATOM   5487  O  O     . ARG C  2  250  ? 65.352  -35.403 35.023  1.00 108.93 ? 250  ARG C O     1 
ATOM   5488  C  CB    . ARG C  2  250  ? 65.185  -36.571 31.936  1.00 119.40 ? 250  ARG C CB    1 
ATOM   5489  C  CG    . ARG C  2  250  ? 64.795  -37.796 32.741  1.00 109.74 ? 250  ARG C CG    1 
ATOM   5490  C  CD    . ARG C  2  250  ? 66.022  -38.597 33.130  1.00 106.30 ? 250  ARG C CD    1 
ATOM   5491  N  NE    . ARG C  2  250  ? 65.678  -39.758 33.943  1.00 114.61 ? 250  ARG C NE    1 
ATOM   5492  C  CZ    . ARG C  2  250  ? 66.563  -40.477 34.626  1.00 119.01 ? 250  ARG C CZ    1 
ATOM   5493  N  NH1   . ARG C  2  250  ? 67.849  -40.150 34.594  1.00 119.63 ? 250  ARG C NH1   1 
ATOM   5494  N  NH2   . ARG C  2  250  ? 66.162  -41.519 35.345  1.00 106.17 ? 250  ARG C NH2   1 
ATOM   5495  N  N     . ASP C  2  251  ? 67.086  -34.753 33.737  1.00 105.35 ? 251  ASP C N     1 
ATOM   5496  C  CA    . ASP C  2  251  ? 67.995  -34.567 34.868  1.00 110.17 ? 251  ASP C CA    1 
ATOM   5497  C  C     . ASP C  2  251  ? 67.550  -33.430 35.803  1.00 105.74 ? 251  ASP C C     1 
ATOM   5498  O  O     . ASP C  2  251  ? 67.690  -33.537 37.028  1.00 99.81  ? 251  ASP C O     1 
ATOM   5499  C  CB    . ASP C  2  251  ? 69.437  -34.362 34.382  1.00 108.24 ? 251  ASP C CB    1 
ATOM   5500  C  CG    . ASP C  2  251  ? 69.518  -33.516 33.120  1.00 119.25 ? 251  ASP C CG    1 
ATOM   5501  O  OD1   . ASP C  2  251  ? 69.129  -34.016 32.040  1.00 118.04 ? 251  ASP C OD1   1 
ATOM   5502  O  OD2   . ASP C  2  251  ? 69.981  -32.357 33.203  1.00 112.50 ? 251  ASP C OD2   1 
ATOM   5503  N  N     . LYS C  2  252  ? 67.009  -32.356 35.226  1.00 103.57 ? 252  LYS C N     1 
ATOM   5504  C  CA    . LYS C  2  252  ? 66.433  -31.262 36.009  1.00 95.72  ? 252  LYS C CA    1 
ATOM   5505  C  C     . LYS C  2  252  ? 65.264  -31.753 36.863  1.00 93.17  ? 252  LYS C C     1 
ATOM   5506  O  O     . LYS C  2  252  ? 65.126  -31.365 38.023  1.00 89.15  ? 252  LYS C O     1 
ATOM   5507  C  CB    . LYS C  2  252  ? 65.967  -30.115 35.104  1.00 92.96  ? 252  LYS C CB    1 
ATOM   5508  C  CG    . LYS C  2  252  ? 66.983  -28.995 34.921  1.00 100.74 ? 252  LYS C CG    1 
ATOM   5509  C  CD    . LYS C  2  252  ? 66.292  -27.657 34.669  1.00 110.89 ? 252  LYS C CD    1 
ATOM   5510  C  CE    . LYS C  2  252  ? 67.277  -26.494 34.760  1.00 115.44 ? 252  LYS C CE    1 
ATOM   5511  N  NZ    . LYS C  2  252  ? 66.592  -25.169 34.856  1.00 108.80 ? 252  LYS C NZ    1 
ATOM   5512  N  N     . ALA C  2  253  ? 64.430  -32.609 36.278  1.00 93.85  ? 253  ALA C N     1 
ATOM   5513  C  CA    . ALA C  2  253  ? 63.283  -33.185 36.975  1.00 91.47  ? 253  ALA C CA    1 
ATOM   5514  C  C     . ALA C  2  253  ? 63.719  -34.071 38.138  1.00 91.22  ? 253  ALA C C     1 
ATOM   5515  O  O     . ALA C  2  253  ? 63.205  -33.940 39.257  1.00 91.63  ? 253  ALA C O     1 
ATOM   5516  C  CB    . ALA C  2  253  ? 62.420  -33.973 36.007  1.00 91.70  ? 253  ALA C CB    1 
ATOM   5517  N  N     . VAL C  2  254  ? 64.658  -34.974 37.863  1.00 93.59  ? 254  VAL C N     1 
ATOM   5518  C  CA    . VAL C  2  254  ? 65.240  -35.822 38.901  1.00 92.44  ? 254  VAL C CA    1 
ATOM   5519  C  C     . VAL C  2  254  ? 65.781  -34.979 40.051  1.00 89.92  ? 254  VAL C C     1 
ATOM   5520  O  O     . VAL C  2  254  ? 65.459  -35.219 41.218  1.00 83.17  ? 254  VAL C O     1 
ATOM   5521  C  CB    . VAL C  2  254  ? 66.391  -36.687 38.348  1.00 92.65  ? 254  VAL C CB    1 
ATOM   5522  C  CG1   . VAL C  2  254  ? 67.087  -37.440 39.473  1.00 85.49  ? 254  VAL C CG1   1 
ATOM   5523  C  CG2   . VAL C  2  254  ? 65.874  -37.650 37.300  1.00 101.78 ? 254  VAL C CG2   1 
ATOM   5524  N  N     . ALA C  2  255  ? 66.596  -33.985 39.707  1.00 93.33  ? 255  ALA C N     1 
ATOM   5525  C  CA    . ALA C  2  255  ? 67.192  -33.094 40.696  1.00 89.85  ? 255  ALA C CA    1 
ATOM   5526  C  C     . ALA C  2  255  ? 66.137  -32.395 41.552  1.00 87.30  ? 255  ALA C C     1 
ATOM   5527  O  O     . ALA C  2  255  ? 66.228  -32.398 42.780  1.00 80.07  ? 255  ALA C O     1 
ATOM   5528  C  CB    . ALA C  2  255  ? 68.087  -32.069 40.015  1.00 85.24  ? 255  ALA C CB    1 
ATOM   5529  N  N     . TYR C  2  256  ? 65.137  -31.805 40.898  1.00 89.74  ? 256  TYR C N     1 
ATOM   5530  C  CA    . TYR C  2  256  ? 64.099  -31.056 41.603  1.00 84.54  ? 256  TYR C CA    1 
ATOM   5531  C  C     . TYR C  2  256  ? 63.275  -31.931 42.541  1.00 85.94  ? 256  TYR C C     1 
ATOM   5532  O  O     . TYR C  2  256  ? 63.118  -31.598 43.716  1.00 85.51  ? 256  TYR C O     1 
ATOM   5533  C  CB    . TYR C  2  256  ? 63.173  -30.321 40.630  1.00 82.14  ? 256  TYR C CB    1 
ATOM   5534  C  CG    . TYR C  2  256  ? 62.119  -29.494 41.334  1.00 92.54  ? 256  TYR C CG    1 
ATOM   5535  C  CD1   . TYR C  2  256  ? 62.451  -28.291 41.946  1.00 99.81  ? 256  TYR C CD1   1 
ATOM   5536  C  CD2   . TYR C  2  256  ? 60.797  -29.921 41.401  1.00 90.63  ? 256  TYR C CD2   1 
ATOM   5537  C  CE1   . TYR C  2  256  ? 61.497  -27.532 42.600  1.00 99.31  ? 256  TYR C CE1   1 
ATOM   5538  C  CE2   . TYR C  2  256  ? 59.835  -29.168 42.054  1.00 91.38  ? 256  TYR C CE2   1 
ATOM   5539  C  CZ    . TYR C  2  256  ? 60.192  -27.974 42.651  1.00 96.87  ? 256  TYR C CZ    1 
ATOM   5540  O  OH    . TYR C  2  256  ? 59.246  -27.216 43.302  1.00 99.59  ? 256  TYR C OH    1 
ATOM   5541  N  N     . VAL C  2  257  ? 62.749  -33.040 42.024  1.00 83.79  ? 257  VAL C N     1 
ATOM   5542  C  CA    . VAL C  2  257  ? 61.930  -33.936 42.845  1.00 82.12  ? 257  VAL C CA    1 
ATOM   5543  C  C     . VAL C  2  257  ? 62.730  -34.525 44.006  1.00 82.05  ? 257  VAL C C     1 
ATOM   5544  O  O     . VAL C  2  257  ? 62.232  -34.618 45.134  1.00 81.58  ? 257  VAL C O     1 
ATOM   5545  C  CB    . VAL C  2  257  ? 61.265  -35.051 42.005  1.00 78.51  ? 257  VAL C CB    1 
ATOM   5546  C  CG1   . VAL C  2  257  ? 60.866  -36.229 42.878  1.00 78.02  ? 257  VAL C CG1   1 
ATOM   5547  C  CG2   . VAL C  2  257  ? 60.052  -34.500 41.277  1.00 71.63  ? 257  VAL C CG2   1 
ATOM   5548  N  N     . TYR C  2  258  ? 63.976  -34.900 43.728  1.00 86.98  ? 258  TYR C N     1 
ATOM   5549  C  CA    . TYR C  2  258  ? 64.889  -35.359 44.771  1.00 85.33  ? 258  TYR C CA    1 
ATOM   5550  C  C     . TYR C  2  258  ? 65.049  -34.296 45.857  1.00 86.47  ? 258  TYR C C     1 
ATOM   5551  O  O     . TYR C  2  258  ? 64.936  -34.591 47.048  1.00 85.67  ? 258  TYR C O     1 
ATOM   5552  C  CB    . TYR C  2  258  ? 66.250  -35.710 44.166  1.00 79.69  ? 258  TYR C CB    1 
ATOM   5553  C  CG    . TYR C  2  258  ? 67.300  -36.133 45.167  1.00 78.87  ? 258  TYR C CG    1 
ATOM   5554  C  CD1   . TYR C  2  258  ? 68.347  -35.284 45.504  1.00 75.57  ? 258  TYR C CD1   1 
ATOM   5555  C  CD2   . TYR C  2  258  ? 67.249  -37.386 45.771  1.00 81.78  ? 258  TYR C CD2   1 
ATOM   5556  C  CE1   . TYR C  2  258  ? 69.317  -35.668 46.417  1.00 74.96  ? 258  TYR C CE1   1 
ATOM   5557  C  CE2   . TYR C  2  258  ? 68.213  -37.780 46.685  1.00 77.59  ? 258  TYR C CE2   1 
ATOM   5558  C  CZ    . TYR C  2  258  ? 69.245  -36.917 47.003  1.00 74.79  ? 258  TYR C CZ    1 
ATOM   5559  O  OH    . TYR C  2  258  ? 70.209  -37.302 47.906  1.00 68.81  ? 258  TYR C OH    1 
ATOM   5560  N  N     . GLY C  2  259  ? 65.296  -33.059 45.434  1.00 85.16  ? 259  GLY C N     1 
ATOM   5561  C  CA    . GLY C  2  259  ? 65.484  -31.952 46.354  1.00 91.31  ? 259  GLY C CA    1 
ATOM   5562  C  C     . GLY C  2  259  ? 64.249  -31.650 47.181  1.00 93.16  ? 259  GLY C C     1 
ATOM   5563  O  O     . GLY C  2  259  ? 64.344  -31.198 48.322  1.00 90.45  ? 259  GLY C O     1 
ATOM   5564  N  N     . LEU C  2  260  ? 63.081  -31.899 46.600  1.00 91.38  ? 260  LEU C N     1 
ATOM   5565  C  CA    . LEU C  2  260  ? 61.824  -31.635 47.284  1.00 85.91  ? 260  LEU C CA    1 
ATOM   5566  C  C     . LEU C  2  260  ? 61.462  -32.737 48.274  1.00 81.69  ? 260  LEU C C     1 
ATOM   5567  O  O     . LEU C  2  260  ? 60.842  -32.475 49.302  1.00 82.48  ? 260  LEU C O     1 
ATOM   5568  C  CB    . LEU C  2  260  ? 60.695  -31.470 46.266  1.00 89.55  ? 260  LEU C CB    1 
ATOM   5569  C  CG    . LEU C  2  260  ? 59.421  -30.787 46.764  1.00 90.56  ? 260  LEU C CG    1 
ATOM   5570  C  CD1   . LEU C  2  260  ? 59.672  -29.301 46.999  1.00 93.99  ? 260  LEU C CD1   1 
ATOM   5571  C  CD2   . LEU C  2  260  ? 58.279  -30.997 45.784  1.00 89.14  ? 260  LEU C CD2   1 
ATOM   5572  N  N     . ILE C  2  261  ? 61.854  -33.968 47.964  1.00 82.12  ? 261  ILE C N     1 
ATOM   5573  C  CA    . ILE C  2  261  ? 61.356  -35.138 48.695  1.00 85.26  ? 261  ILE C CA    1 
ATOM   5574  C  C     . ILE C  2  261  ? 62.447  -36.006 49.348  1.00 87.08  ? 261  ILE C C     1 
ATOM   5575  O  O     . ILE C  2  261  ? 62.407  -36.242 50.554  1.00 84.58  ? 261  ILE C O     1 
ATOM   5576  C  CB    . ILE C  2  261  ? 60.325  -35.967 47.856  1.00 83.46  ? 261  ILE C CB    1 
ATOM   5577  C  CG1   . ILE C  2  261  ? 58.905  -35.697 48.347  1.00 76.21  ? 261  ILE C CG1   1 
ATOM   5578  C  CG2   . ILE C  2  261  ? 60.555  -37.453 47.967  1.00 83.81  ? 261  ILE C CG2   1 
ATOM   5579  C  CD1   . ILE C  2  261  ? 58.461  -34.270 48.199  1.00 81.56  ? 261  ILE C CD1   1 
ATOM   5580  N  N     . ALA C  2  262  ? 63.380  -36.521 48.549  1.00 88.42  ? 262  ALA C N     1 
ATOM   5581  C  CA    . ALA C  2  262  ? 64.353  -37.497 49.037  1.00 84.74  ? 262  ALA C CA    1 
ATOM   5582  C  C     . ALA C  2  262  ? 65.675  -36.917 49.538  1.00 81.77  ? 262  ALA C C     1 
ATOM   5583  O  O     . ALA C  2  262  ? 66.473  -37.634 50.138  1.00 79.28  ? 262  ALA C O     1 
ATOM   5584  C  CB    . ALA C  2  262  ? 64.615  -38.549 47.965  1.00 92.03  ? 262  ALA C CB    1 
ATOM   5585  N  N     . ASP C  2  263  ? 65.904  -35.628 49.299  1.00 84.89  ? 263  ASP C N     1 
ATOM   5586  C  CA    . ASP C  2  263  ? 67.180  -34.996 49.649  1.00 86.41  ? 263  ASP C CA    1 
ATOM   5587  C  C     . ASP C  2  263  ? 67.267  -34.728 51.150  1.00 84.68  ? 263  ASP C C     1 
ATOM   5588  O  O     . ASP C  2  263  ? 66.521  -33.909 51.682  1.00 85.74  ? 263  ASP C O     1 
ATOM   5589  C  CB    . ASP C  2  263  ? 67.351  -33.683 48.871  1.00 87.63  ? 263  ASP C CB    1 
ATOM   5590  C  CG    . ASP C  2  263  ? 68.780  -33.155 48.897  1.00 86.69  ? 263  ASP C CG    1 
ATOM   5591  O  OD1   . ASP C  2  263  ? 69.599  -33.651 49.698  1.00 84.49  ? 263  ASP C OD1   1 
ATOM   5592  O  OD2   . ASP C  2  263  ? 69.080  -32.228 48.111  1.00 83.89  ? 263  ASP C OD2   1 
ATOM   5593  N  N     . PRO C  2  264  ? 68.197  -35.411 51.837  1.00 87.24  ? 264  PRO C N     1 
ATOM   5594  C  CA    . PRO C  2  264  ? 68.382  -35.249 53.284  1.00 88.95  ? 264  PRO C CA    1 
ATOM   5595  C  C     . PRO C  2  264  ? 68.947  -33.879 53.640  1.00 88.30  ? 264  PRO C C     1 
ATOM   5596  O  O     . PRO C  2  264  ? 68.877  -33.460 54.798  1.00 90.76  ? 264  PRO C O     1 
ATOM   5597  C  CB    . PRO C  2  264  ? 69.389  -36.344 53.633  1.00 77.29  ? 264  PRO C CB    1 
ATOM   5598  C  CG    . PRO C  2  264  ? 70.137  -36.574 52.378  1.00 91.54  ? 264  PRO C CG    1 
ATOM   5599  C  CD    . PRO C  2  264  ? 69.144  -36.385 51.270  1.00 88.16  ? 264  PRO C CD    1 
ATOM   5600  N  N     . ARG C  2  265  ? 69.508  -33.191 52.653  1.00 83.80  ? 265  ARG C N     1 
ATOM   5601  C  CA    . ARG C  2  265  ? 70.003  -31.839 52.863  1.00 83.98  ? 265  ARG C CA    1 
ATOM   5602  C  C     . ARG C  2  265  ? 68.873  -30.809 52.831  1.00 82.75  ? 265  ARG C C     1 
ATOM   5603  O  O     . ARG C  2  265  ? 68.834  -29.898 53.650  1.00 89.37  ? 265  ARG C O     1 
ATOM   5604  C  CB    . ARG C  2  265  ? 71.083  -31.492 51.836  1.00 95.13  ? 265  ARG C CB    1 
ATOM   5605  C  CG    . ARG C  2  265  ? 72.487  -31.999 52.206  1.00 92.77  ? 265  ARG C CG    1 
ATOM   5606  C  CD    . ARG C  2  265  ? 73.167  -32.717 51.041  1.00 99.41  ? 265  ARG C CD    1 
ATOM   5607  N  NE    . ARG C  2  265  ? 74.374  -32.027 50.588  1.00 102.78 ? 265  ARG C NE    1 
ATOM   5608  C  CZ    . ARG C  2  265  ? 75.613  -32.364 50.937  1.00 94.17  ? 265  ARG C CZ    1 
ATOM   5609  N  NH1   . ARG C  2  265  ? 75.828  -33.393 51.748  1.00 86.44  ? 265  ARG C NH1   1 
ATOM   5610  N  NH2   . ARG C  2  265  ? 76.641  -31.671 50.470  1.00 87.70  ? 265  ARG C NH2   1 
ATOM   5611  N  N     . ARG C  2  266  ? 67.945  -30.952 51.889  1.00 83.03  ? 266  ARG C N     1 
ATOM   5612  C  CA    . ARG C  2  266  ? 66.818  -30.019 51.784  1.00 86.01  ? 266  ARG C CA    1 
ATOM   5613  C  C     . ARG C  2  266  ? 65.545  -30.455 52.522  1.00 78.78  ? 266  ARG C C     1 
ATOM   5614  O  O     . ARG C  2  266  ? 64.655  -29.644 52.756  1.00 72.08  ? 266  ARG C O     1 
ATOM   5615  C  CB    . ARG C  2  266  ? 66.495  -29.722 50.322  1.00 92.99  ? 266  ARG C CB    1 
ATOM   5616  C  CG    . ARG C  2  266  ? 67.687  -29.287 49.481  1.00 103.54 ? 266  ARG C CG    1 
ATOM   5617  C  CD    . ARG C  2  266  ? 67.222  -28.658 48.184  1.00 109.49 ? 266  ARG C CD    1 
ATOM   5618  N  NE    . ARG C  2  266  ? 66.370  -27.501 48.448  1.00 114.94 ? 266  ARG C NE    1 
ATOM   5619  C  CZ    . ARG C  2  266  ? 65.329  -27.149 47.701  1.00 112.09 ? 266  ARG C CZ    1 
ATOM   5620  N  NH1   . ARG C  2  266  ? 64.619  -26.080 48.030  1.00 105.76 ? 266  ARG C NH1   1 
ATOM   5621  N  NH2   . ARG C  2  266  ? 64.999  -27.866 46.630  1.00 110.21 ? 266  ARG C NH2   1 
ATOM   5622  N  N     . TYR C  2  267  ? 65.464  -31.726 52.902  1.00 74.59  ? 267  TYR C N     1 
ATOM   5623  C  CA    . TYR C  2  267  ? 64.291  -32.216 53.619  1.00 72.07  ? 267  TYR C CA    1 
ATOM   5624  C  C     . TYR C  2  267  ? 64.687  -32.981 54.869  1.00 74.86  ? 267  TYR C C     1 
ATOM   5625  O  O     . TYR C  2  267  ? 65.299  -34.043 54.798  1.00 75.42  ? 267  TYR C O     1 
ATOM   5626  C  CB    . TYR C  2  267  ? 63.395  -33.086 52.725  1.00 67.30  ? 267  TYR C CB    1 
ATOM   5627  C  CG    . TYR C  2  267  ? 62.026  -33.363 53.323  1.00 67.55  ? 267  TYR C CG    1 
ATOM   5628  C  CD1   . TYR C  2  267  ? 60.928  -32.580 52.989  1.00 69.15  ? 267  TYR C CD1   1 
ATOM   5629  C  CD2   . TYR C  2  267  ? 61.836  -34.394 54.231  1.00 65.81  ? 267  TYR C CD2   1 
ATOM   5630  C  CE1   . TYR C  2  267  ? 59.679  -32.821 53.537  1.00 63.61  ? 267  TYR C CE1   1 
ATOM   5631  C  CE2   . TYR C  2  267  ? 60.591  -34.641 54.787  1.00 64.62  ? 267  TYR C CE2   1 
ATOM   5632  C  CZ    . TYR C  2  267  ? 59.519  -33.853 54.437  1.00 63.80  ? 267  TYR C CZ    1 
ATOM   5633  O  OH    . TYR C  2  267  ? 58.284  -34.103 54.989  1.00 63.82  ? 267  TYR C OH    1 
ATOM   5634  N  N     . ASP C  2  268  ? 64.326  -32.436 56.020  1.00 70.53  ? 268  ASP C N     1 
ATOM   5635  C  CA    . ASP C  2  268  ? 64.628  -33.099 57.271  1.00 70.60  ? 268  ASP C CA    1 
ATOM   5636  C  C     . ASP C  2  268  ? 63.361  -33.221 58.100  1.00 69.86  ? 268  ASP C C     1 
ATOM   5637  O  O     . ASP C  2  268  ? 62.825  -32.228 58.590  1.00 68.45  ? 268  ASP C O     1 
ATOM   5638  C  CB    . ASP C  2  268  ? 65.676  -32.294 58.043  1.00 78.87  ? 268  ASP C CB    1 
ATOM   5639  C  CG    . ASP C  2  268  ? 66.557  -33.156 58.929  1.00 77.66  ? 268  ASP C CG    1 
ATOM   5640  O  OD1   . ASP C  2  268  ? 66.213  -34.332 59.160  1.00 68.82  ? 268  ASP C OD1   1 
ATOM   5641  O  OD2   . ASP C  2  268  ? 67.599  -32.647 59.400  1.00 78.44  ? 268  ASP C OD2   1 
ATOM   5642  N  N     . LEU C  2  269  ? 62.885  -34.451 58.257  1.00 72.08  ? 269  LEU C N     1 
ATOM   5643  C  CA    . LEU C  2  269  ? 61.889  -34.756 59.265  1.00 61.15  ? 269  LEU C CA    1 
ATOM   5644  C  C     . LEU C  2  269  ? 62.705  -34.684 60.532  1.00 65.05  ? 269  LEU C C     1 
ATOM   5645  O  O     . LEU C  2  269  ? 63.926  -34.783 60.484  1.00 78.90  ? 269  LEU C O     1 
ATOM   5646  C  CB    . LEU C  2  269  ? 61.365  -36.177 59.074  1.00 57.97  ? 269  LEU C CB    1 
ATOM   5647  C  CG    . LEU C  2  269  ? 59.864  -36.429 59.135  1.00 59.00  ? 269  LEU C CG    1 
ATOM   5648  C  CD1   . LEU C  2  269  ? 59.138  -35.458 58.229  1.00 64.69  ? 269  LEU C CD1   1 
ATOM   5649  C  CD2   . LEU C  2  269  ? 59.568  -37.855 58.722  1.00 51.07  ? 269  LEU C CD2   1 
ATOM   5650  N  N     . GLY C  2  270  ? 62.079  -34.504 61.676  1.00 57.91  ? 270  GLY C N     1 
ATOM   5651  C  CA    . GLY C  2  270  ? 62.880  -34.529 62.879  1.00 67.47  ? 270  GLY C CA    1 
ATOM   5652  C  C     . GLY C  2  270  ? 63.385  -35.934 63.141  1.00 64.95  ? 270  GLY C C     1 
ATOM   5653  O  O     . GLY C  2  270  ? 63.002  -36.876 62.453  1.00 64.90  ? 270  GLY C O     1 
ATOM   5654  N  N     . GLU C  2  271  ? 64.257  -36.085 64.127  1.00 64.07  ? 271  GLU C N     1 
ATOM   5655  C  CA    . GLU C  2  271  ? 64.461  -37.402 64.691  1.00 67.88  ? 271  GLU C CA    1 
ATOM   5656  C  C     . GLU C  2  271  ? 63.149  -37.707 65.406  1.00 69.90  ? 271  GLU C C     1 
ATOM   5657  O  O     . GLU C  2  271  ? 62.662  -38.845 65.405  1.00 69.73  ? 271  GLU C O     1 
ATOM   5658  C  CB    . GLU C  2  271  ? 65.635  -37.406 65.667  1.00 73.21  ? 271  GLU C CB    1 
ATOM   5659  C  CG    . GLU C  2  271  ? 66.099  -38.799 66.082  1.00 80.75  ? 271  GLU C CG    1 
ATOM   5660  C  CD    . GLU C  2  271  ? 66.751  -39.574 64.943  1.00 88.28  ? 271  GLU C CD    1 
ATOM   5661  O  OE1   . GLU C  2  271  ? 67.424  -38.951 64.092  1.00 87.27  ? 271  GLU C OE1   1 
ATOM   5662  O  OE2   . GLU C  2  271  ? 66.589  -40.812 64.898  1.00 91.11  ? 271  GLU C OE2   1 
ATOM   5663  N  N     . ALA C  2  272  ? 62.570  -36.661 65.993  1.00 65.53  ? 272  ALA C N     1 
ATOM   5664  C  CA    . ALA C  2  272  ? 61.252  -36.746 66.610  1.00 65.87  ? 272  ALA C CA    1 
ATOM   5665  C  C     . ALA C  2  272  ? 60.171  -36.901 65.548  1.00 61.65  ? 272  ALA C C     1 
ATOM   5666  O  O     . ALA C  2  272  ? 59.176  -37.586 65.763  1.00 61.56  ? 272  ALA C O     1 
ATOM   5667  C  CB    . ALA C  2  272  ? 60.983  -35.522 67.472  1.00 64.17  ? 272  ALA C CB    1 
ATOM   5668  N  N     . GLY C  2  273  ? 60.372  -36.258 64.403  1.00 61.23  ? 273  GLY C N     1 
ATOM   5669  C  CA    . GLY C  2  273  ? 59.476  -36.417 63.273  1.00 62.36  ? 273  GLY C CA    1 
ATOM   5670  C  C     . GLY C  2  273  ? 59.444  -37.864 62.816  1.00 67.21  ? 273  GLY C C     1 
ATOM   5671  O  O     . GLY C  2  273  ? 58.373  -38.459 62.660  1.00 65.23  ? 273  GLY C O     1 
ATOM   5672  N  N     . ARG C  2  274  ? 60.634  -38.427 62.616  1.00 69.49  ? 274  ARG C N     1 
ATOM   5673  C  CA    . ARG C  2  274  ? 60.798  -39.831 62.258  1.00 64.72  ? 274  ARG C CA    1 
ATOM   5674  C  C     . ARG C  2  274  ? 60.143  -40.763 63.272  1.00 67.11  ? 274  ARG C C     1 
ATOM   5675  O  O     . ARG C  2  274  ? 59.400  -41.668 62.899  1.00 68.56  ? 274  ARG C O     1 
ATOM   5676  C  CB    . ARG C  2  274  ? 62.282  -40.170 62.141  1.00 67.85  ? 274  ARG C CB    1 
ATOM   5677  C  CG    . ARG C  2  274  ? 62.574  -41.647 61.943  1.00 74.48  ? 274  ARG C CG    1 
ATOM   5678  C  CD    . ARG C  2  274  ? 63.956  -41.987 62.454  1.00 76.01  ? 274  ARG C CD    1 
ATOM   5679  N  NE    . ARG C  2  274  ? 64.723  -42.759 61.487  1.00 93.09  ? 274  ARG C NE    1 
ATOM   5680  C  CZ    . ARG C  2  274  ? 66.047  -42.866 61.508  1.00 107.18 ? 274  ARG C CZ    1 
ATOM   5681  N  NH1   . ARG C  2  274  ? 66.749  -42.245 62.447  1.00 107.75 ? 274  ARG C NH1   1 
ATOM   5682  N  NH2   . ARG C  2  274  ? 66.669  -43.588 60.586  1.00 112.01 ? 274  ARG C NH2   1 
ATOM   5683  N  N     . TYR C  2  275  ? 60.422  -40.544 64.553  1.00 72.00  ? 275  TYR C N     1 
ATOM   5684  C  CA    . TYR C  2  275  ? 59.834  -41.378 65.597  1.00 79.25  ? 275  TYR C CA    1 
ATOM   5685  C  C     . TYR C  2  275  ? 58.300  -41.303 65.614  1.00 80.18  ? 275  TYR C C     1 
ATOM   5686  O  O     . TYR C  2  275  ? 57.622  -42.323 65.751  1.00 77.99  ? 275  TYR C O     1 
ATOM   5687  C  CB    . TYR C  2  275  ? 60.404  -41.021 66.975  1.00 85.38  ? 275  TYR C CB    1 
ATOM   5688  C  CG    . TYR C  2  275  ? 59.756  -41.794 68.103  1.00 98.10  ? 275  TYR C CG    1 
ATOM   5689  C  CD1   . TYR C  2  275  ? 60.108  -43.113 68.357  1.00 108.56 ? 275  TYR C CD1   1 
ATOM   5690  C  CD2   . TYR C  2  275  ? 58.783  -41.208 68.908  1.00 98.36  ? 275  TYR C CD2   1 
ATOM   5691  C  CE1   . TYR C  2  275  ? 59.511  -43.828 69.382  1.00 119.14 ? 275  TYR C CE1   1 
ATOM   5692  C  CE2   . TYR C  2  275  ? 58.182  -41.915 69.937  1.00 103.71 ? 275  TYR C CE2   1 
ATOM   5693  C  CZ    . TYR C  2  275  ? 58.550  -43.225 70.168  1.00 111.04 ? 275  TYR C CZ    1 
ATOM   5694  O  OH    . TYR C  2  275  ? 57.959  -43.936 71.187  1.00 109.52 ? 275  TYR C OH    1 
ATOM   5695  N  N     . LYS C  2  276  ? 57.761  -40.096 65.474  1.00 77.61  ? 276  LYS C N     1 
ATOM   5696  C  CA    . LYS C  2  276  ? 56.314  -39.899 65.466  1.00 73.46  ? 276  LYS C CA    1 
ATOM   5697  C  C     . LYS C  2  276  ? 55.662  -40.561 64.256  1.00 74.91  ? 276  LYS C C     1 
ATOM   5698  O  O     . LYS C  2  276  ? 54.574  -41.124 64.361  1.00 73.85  ? 276  LYS C O     1 
ATOM   5699  C  CB    . LYS C  2  276  ? 55.966  -38.406 65.505  1.00 77.27  ? 276  LYS C CB    1 
ATOM   5700  C  CG    . LYS C  2  276  ? 56.191  -37.739 66.859  1.00 78.62  ? 276  LYS C CG    1 
ATOM   5701  C  CD    . LYS C  2  276  ? 55.126  -38.132 67.868  1.00 71.31  ? 276  LYS C CD    1 
ATOM   5702  C  CE    . LYS C  2  276  ? 53.750  -37.683 67.409  1.00 68.42  ? 276  LYS C CE    1 
ATOM   5703  N  NZ    . LYS C  2  276  ? 53.752  -36.244 67.042  1.00 65.95  ? 276  LYS C NZ    1 
ATOM   5704  N  N     . ALA C  2  277  ? 56.329  -40.488 63.107  1.00 79.23  ? 277  ALA C N     1 
ATOM   5705  C  CA    . ALA C  2  277  ? 55.838  -41.146 61.899  1.00 71.38  ? 277  ALA C CA    1 
ATOM   5706  C  C     . ALA C  2  277  ? 55.828  -42.662 62.068  1.00 75.73  ? 277  ALA C C     1 
ATOM   5707  O  O     . ALA C  2  277  ? 54.813  -43.314 61.822  1.00 74.62  ? 277  ALA C O     1 
ATOM   5708  C  CB    . ALA C  2  277  ? 56.681  -40.754 60.703  1.00 62.80  ? 277  ALA C CB    1 
ATOM   5709  N  N     . GLU C  2  278  ? 56.963  -43.214 62.491  1.00 79.46  ? 278  GLU C N     1 
ATOM   5710  C  CA    . GLU C  2  278  ? 57.087  -44.649 62.732  1.00 79.78  ? 278  GLU C CA    1 
ATOM   5711  C  C     . GLU C  2  278  ? 56.035  -45.137 63.722  1.00 82.69  ? 278  GLU C C     1 
ATOM   5712  O  O     . GLU C  2  278  ? 55.469  -46.218 63.560  1.00 84.23  ? 278  GLU C O     1 
ATOM   5713  C  CB    . GLU C  2  278  ? 58.487  -44.990 63.257  1.00 81.22  ? 278  GLU C CB    1 
ATOM   5714  C  CG    . GLU C  2  278  ? 59.597  -44.882 62.223  1.00 86.23  ? 278  GLU C CG    1 
ATOM   5715  C  CD    . GLU C  2  278  ? 60.973  -45.160 62.808  1.00 96.65  ? 278  GLU C CD    1 
ATOM   5716  O  OE1   . GLU C  2  278  ? 61.082  -45.299 64.047  1.00 96.59  ? 278  GLU C OE1   1 
ATOM   5717  O  OE2   . GLU C  2  278  ? 61.946  -45.238 62.024  1.00 97.41  ? 278  GLU C OE2   1 
ATOM   5718  N  N     . GLU C  2  279  ? 55.771  -44.331 64.744  1.00 83.52  ? 279  GLU C N     1 
ATOM   5719  C  CA    . GLU C  2  279  ? 54.845  -44.722 65.797  1.00 84.85  ? 279  GLU C CA    1 
ATOM   5720  C  C     . GLU C  2  279  ? 53.391  -44.639 65.339  1.00 84.39  ? 279  GLU C C     1 
ATOM   5721  O  O     . GLU C  2  279  ? 52.576  -45.497 65.674  1.00 84.36  ? 279  GLU C O     1 
ATOM   5722  C  CB    . GLU C  2  279  ? 55.064  -43.862 67.043  1.00 90.65  ? 279  GLU C CB    1 
ATOM   5723  C  CG    . GLU C  2  279  ? 54.321  -44.362 68.265  1.00 112.33 ? 279  GLU C CG    1 
ATOM   5724  C  CD    . GLU C  2  279  ? 54.660  -45.804 68.592  1.00 123.09 ? 279  GLU C CD    1 
ATOM   5725  O  OE1   . GLU C  2  279  ? 53.728  -46.578 68.907  1.00 119.62 ? 279  GLU C OE1   1 
ATOM   5726  O  OE2   . GLU C  2  279  ? 55.858  -46.161 68.534  1.00 117.03 ? 279  GLU C OE2   1 
ATOM   5727  N  N     . LYS C  2  280  ? 53.073  -43.606 64.566  1.00 83.84  ? 280  LYS C N     1 
ATOM   5728  C  CA    . LYS C  2  280  ? 51.708  -43.387 64.096  1.00 79.80  ? 280  LYS C CA    1 
ATOM   5729  C  C     . LYS C  2  280  ? 51.304  -44.374 63.007  1.00 80.95  ? 280  LYS C C     1 
ATOM   5730  O  O     . LYS C  2  280  ? 50.230  -44.969 63.064  1.00 76.45  ? 280  LYS C O     1 
ATOM   5731  C  CB    . LYS C  2  280  ? 51.554  -41.959 63.571  1.00 84.17  ? 280  LYS C CB    1 
ATOM   5732  C  CG    . LYS C  2  280  ? 50.155  -41.613 63.084  1.00 80.22  ? 280  LYS C CG    1 
ATOM   5733  C  CD    . LYS C  2  280  ? 49.151  -41.638 64.219  1.00 72.74  ? 280  LYS C CD    1 
ATOM   5734  C  CE    . LYS C  2  280  ? 47.818  -41.047 63.789  1.00 74.79  ? 280  LYS C CE    1 
ATOM   5735  N  NZ    . LYS C  2  280  ? 46.822  -41.018 64.901  1.00 80.96  ? 280  LYS C NZ    1 
ATOM   5736  N  N     . LEU C  2  281  ? 52.173  -44.540 62.015  1.00 87.18  ? 281  LEU C N     1 
ATOM   5737  C  CA    . LEU C  2  281  ? 51.863  -45.355 60.843  1.00 87.38  ? 281  LEU C CA    1 
ATOM   5738  C  C     . LEU C  2  281  ? 52.268  -46.819 61.008  1.00 89.64  ? 281  LEU C C     1 
ATOM   5739  O  O     . LEU C  2  281  ? 51.937  -47.657 60.167  1.00 89.37  ? 281  LEU C O     1 
ATOM   5740  C  CB    . LEU C  2  281  ? 52.555  -44.773 59.613  1.00 80.76  ? 281  LEU C CB    1 
ATOM   5741  C  CG    . LEU C  2  281  ? 52.450  -43.259 59.445  1.00 76.20  ? 281  LEU C CG    1 
ATOM   5742  C  CD1   . LEU C  2  281  ? 53.489  -42.775 58.447  1.00 72.53  ? 281  LEU C CD1   1 
ATOM   5743  C  CD2   . LEU C  2  281  ? 51.050  -42.858 59.014  1.00 66.46  ? 281  LEU C CD2   1 
ATOM   5744  N  N     . GLY C  2  282  ? 52.985  -47.117 62.088  1.00 90.58  ? 282  GLY C N     1 
ATOM   5745  C  CA    . GLY C  2  282  ? 53.466  -48.463 62.349  1.00 91.99  ? 282  GLY C CA    1 
ATOM   5746  C  C     . GLY C  2  282  ? 54.451  -48.958 61.305  1.00 91.30  ? 282  GLY C C     1 
ATOM   5747  O  O     . GLY C  2  282  ? 54.295  -50.050 60.758  1.00 89.27  ? 282  GLY C O     1 
ATOM   5748  N  N     . ILE C  2  283  ? 55.465  -48.149 61.014  1.00 85.59  ? 283  ILE C N     1 
ATOM   5749  C  CA    . ILE C  2  283  ? 56.481  -48.522 60.036  1.00 89.16  ? 283  ILE C CA    1 
ATOM   5750  C  C     . ILE C  2  283  ? 57.878  -48.181 60.548  1.00 92.15  ? 283  ILE C C     1 
ATOM   5751  O  O     . ILE C  2  283  ? 58.033  -47.693 61.669  1.00 92.03  ? 283  ILE C O     1 
ATOM   5752  C  CB    . ILE C  2  283  ? 56.257  -47.818 58.676  1.00 89.41  ? 283  ILE C CB    1 
ATOM   5753  C  CG1   . ILE C  2  283  ? 56.602  -46.329 58.773  1.00 81.41  ? 283  ILE C CG1   1 
ATOM   5754  C  CG2   . ILE C  2  283  ? 54.826  -48.024 58.179  1.00 82.06  ? 283  ILE C CG2   1 
ATOM   5755  C  CD1   . ILE C  2  283  ? 56.441  -45.587 57.474  1.00 72.72  ? 283  ILE C CD1   1 
ATOM   5756  N  N     . ARG C  2  284  ? 58.892  -48.449 59.729  1.00 85.42  ? 284  ARG C N     1 
ATOM   5757  C  CA    . ARG C  2  284  ? 60.258  -48.073 60.068  1.00 89.70  ? 284  ARG C CA    1 
ATOM   5758  C  C     . ARG C  2  284  ? 60.898  -47.254 58.960  1.00 89.82  ? 284  ARG C C     1 
ATOM   5759  O  O     . ARG C  2  284  ? 60.899  -47.656 57.797  1.00 87.26  ? 284  ARG C O     1 
ATOM   5760  C  CB    . ARG C  2  284  ? 61.112  -49.303 60.374  1.00 99.01  ? 284  ARG C CB    1 
ATOM   5761  C  CG    . ARG C  2  284  ? 61.267  -49.592 61.857  1.00 108.46 ? 284  ARG C CG    1 
ATOM   5762  C  CD    . ARG C  2  284  ? 62.668  -50.102 62.173  1.00 127.55 ? 284  ARG C CD    1 
ATOM   5763  N  NE    . ARG C  2  284  ? 63.701  -49.116 61.855  1.00 127.85 ? 284  ARG C NE    1 
ATOM   5764  C  CZ    . ARG C  2  284  ? 64.226  -48.264 62.734  1.00 130.28 ? 284  ARG C CZ    1 
ATOM   5765  N  NH1   . ARG C  2  284  ? 65.161  -47.404 62.348  1.00 122.90 ? 284  ARG C NH1   1 
ATOM   5766  N  NH2   . ARG C  2  284  ? 63.820  -48.271 63.999  1.00 121.02 ? 284  ARG C NH2   1 
ATOM   5767  N  N     . LEU C  2  285  ? 61.443  -46.103 59.333  1.00 92.06  ? 285  LEU C N     1 
ATOM   5768  C  CA    . LEU C  2  285  ? 62.092  -45.219 58.378  1.00 95.83  ? 285  LEU C CA    1 
ATOM   5769  C  C     . LEU C  2  285  ? 63.588  -45.503 58.293  1.00 99.78  ? 285  LEU C C     1 
ATOM   5770  O  O     . LEU C  2  285  ? 64.271  -45.616 59.313  1.00 99.01  ? 285  LEU C O     1 
ATOM   5771  C  CB    . LEU C  2  285  ? 61.854  -43.756 58.759  1.00 95.23  ? 285  LEU C CB    1 
ATOM   5772  C  CG    . LEU C  2  285  ? 60.719  -42.998 58.066  1.00 87.89  ? 285  LEU C CG    1 
ATOM   5773  C  CD1   . LEU C  2  285  ? 61.077  -42.697 56.615  1.00 88.94  ? 285  LEU C CD1   1 
ATOM   5774  C  CD2   . LEU C  2  285  ? 59.418  -43.775 58.153  1.00 77.70  ? 285  LEU C CD2   1 
ATOM   5775  N  N     . SER C  2  286  ? 64.089  -45.617 57.067  1.00 98.68  ? 286  SER C N     1 
ATOM   5776  C  CA    . SER C  2  286  ? 65.513  -45.792 56.837  1.00 96.71  ? 286  SER C CA    1 
ATOM   5777  C  C     . SER C  2  286  ? 66.227  -44.466 57.065  1.00 97.11  ? 286  SER C C     1 
ATOM   5778  O  O     . SER C  2  286  ? 67.443  -44.422 57.243  1.00 100.31 ? 286  SER C O     1 
ATOM   5779  C  CB    . SER C  2  286  ? 65.762  -46.282 55.411  1.00 99.05  ? 286  SER C CB    1 
ATOM   5780  O  OG    . SER C  2  286  ? 65.389  -45.297 54.464  1.00 101.16 ? 286  SER C OG    1 
ATOM   5781  N  N     . GLY C  2  287  ? 65.457  -43.384 57.062  1.00 97.34  ? 287  GLY C N     1 
ATOM   5782  C  CA    . GLY C  2  287  ? 66.010  -42.058 57.243  1.00 90.27  ? 287  GLY C CA    1 
ATOM   5783  C  C     . GLY C  2  287  ? 64.959  -41.012 57.543  1.00 89.12  ? 287  GLY C C     1 
ATOM   5784  O  O     . GLY C  2  287  ? 63.814  -41.324 57.856  1.00 91.05  ? 287  GLY C O     1 
ATOM   5785  N  N     . ARG C  2  288  ? 65.365  -39.755 57.448  1.00 83.27  ? 288  ARG C N     1 
ATOM   5786  C  CA    . ARG C  2  288  ? 64.504  -38.624 57.771  1.00 76.49  ? 288  ARG C CA    1 
ATOM   5787  C  C     . ARG C  2  288  ? 63.766  -37.995 56.583  1.00 78.01  ? 288  ARG C C     1 
ATOM   5788  O  O     . ARG C  2  288  ? 63.220  -36.901 56.692  1.00 73.67  ? 288  ARG C O     1 
ATOM   5789  C  CB    . ARG C  2  288  ? 65.249  -37.606 58.626  1.00 75.93  ? 288  ARG C CB    1 
ATOM   5790  C  CG    . ARG C  2  288  ? 65.631  -38.193 59.980  1.00 71.30  ? 288  ARG C CG    1 
ATOM   5791  C  CD    . ARG C  2  288  ? 65.982  -37.117 60.977  1.00 72.37  ? 288  ARG C CD    1 
ATOM   5792  N  NE    . ARG C  2  288  ? 67.145  -36.350 60.554  1.00 71.93  ? 288  ARG C NE    1 
ATOM   5793  C  CZ    . ARG C  2  288  ? 68.387  -36.641 60.912  1.00 71.95  ? 288  ARG C CZ    1 
ATOM   5794  N  NH1   . ARG C  2  288  ? 68.614  -37.680 61.702  1.00 74.23  ? 288  ARG C NH1   1 
ATOM   5795  N  NH2   . ARG C  2  288  ? 69.398  -35.896 60.484  1.00 85.51  ? 288  ARG C NH2   1 
ATOM   5796  N  N     . THR C  2  289  ? 63.795  -38.673 55.440  1.00 84.41  ? 289  THR C N     1 
ATOM   5797  C  CA    . THR C  2  289  ? 63.169  -38.166 54.222  1.00 80.50  ? 289  THR C CA    1 
ATOM   5798  C  C     . THR C  2  289  ? 61.936  -38.983 53.837  1.00 77.22  ? 289  THR C C     1 
ATOM   5799  O  O     . THR C  2  289  ? 61.781  -40.127 54.264  1.00 77.07  ? 289  THR C O     1 
ATOM   5800  C  CB    . THR C  2  289  ? 64.156  -38.168 53.045  1.00 83.09  ? 289  THR C CB    1 
ATOM   5801  O  OG1   . THR C  2  289  ? 64.932  -39.372 53.078  1.00 86.13  ? 289  THR C OG1   1 
ATOM   5802  C  CG2   . THR C  2  289  ? 65.091  -36.974 53.135  1.00 85.00  ? 289  THR C CG2   1 
ATOM   5803  N  N     . LEU C  2  290  ? 61.043  -38.366 53.064  1.00 78.03  ? 290  LEU C N     1 
ATOM   5804  C  CA    . LEU C  2  290  ? 59.793  -39.000 52.649  1.00 79.60  ? 290  LEU C CA    1 
ATOM   5805  C  C     . LEU C  2  290  ? 59.998  -40.108 51.621  1.00 86.92  ? 290  LEU C C     1 
ATOM   5806  O  O     . LEU C  2  290  ? 59.169  -41.008 51.501  1.00 84.66  ? 290  LEU C O     1 
ATOM   5807  C  CB    . LEU C  2  290  ? 58.820  -37.961 52.091  1.00 75.16  ? 290  LEU C CB    1 
ATOM   5808  C  CG    . LEU C  2  290  ? 58.453  -36.809 53.021  1.00 68.86  ? 290  LEU C CG    1 
ATOM   5809  C  CD1   . LEU C  2  290  ? 57.384  -35.946 52.385  1.00 65.68  ? 290  LEU C CD1   1 
ATOM   5810  C  CD2   . LEU C  2  290  ? 58.000  -37.322 54.378  1.00 66.60  ? 290  LEU C CD2   1 
ATOM   5811  N  N     . ALA C  2  291  ? 61.089  -40.026 50.866  1.00 92.73  ? 291  ALA C N     1 
ATOM   5812  C  CA    . ALA C  2  291  ? 61.461  -41.096 49.948  1.00 90.57  ? 291  ALA C CA    1 
ATOM   5813  C  C     . ALA C  2  291  ? 62.976  -41.166 49.777  1.00 94.80  ? 291  ALA C C     1 
ATOM   5814  O  O     . ALA C  2  291  ? 63.714  -40.398 50.394  1.00 89.29  ? 291  ALA C O     1 
ATOM   5815  C  CB    . ALA C  2  291  ? 60.774  -40.918 48.609  1.00 88.68  ? 291  ALA C CB    1 
ATOM   5816  N  N     . ARG C  2  292  ? 63.431  -42.094 48.940  1.00 106.95 ? 292  ARG C N     1 
ATOM   5817  C  CA    . ARG C  2  292  ? 64.856  -42.280 48.685  1.00 105.81 ? 292  ARG C CA    1 
ATOM   5818  C  C     . ARG C  2  292  ? 65.176  -42.244 47.197  1.00 104.09 ? 292  ARG C C     1 
ATOM   5819  O  O     . ARG C  2  292  ? 64.315  -42.517 46.358  1.00 105.48 ? 292  ARG C O     1 
ATOM   5820  C  CB    . ARG C  2  292  ? 65.326  -43.628 49.228  1.00 101.29 ? 292  ARG C CB    1 
ATOM   5821  C  CG    . ARG C  2  292  ? 65.378  -43.750 50.730  1.00 97.89  ? 292  ARG C CG    1 
ATOM   5822  C  CD    . ARG C  2  292  ? 65.698  -45.186 51.095  1.00 108.83 ? 292  ARG C CD    1 
ATOM   5823  N  NE    . ARG C  2  292  ? 64.773  -46.106 50.437  1.00 118.61 ? 292  ARG C NE    1 
ATOM   5824  C  CZ    . ARG C  2  292  ? 64.849  -47.432 50.512  1.00 121.92 ? 292  ARG C CZ    1 
ATOM   5825  N  NH1   . ARG C  2  292  ? 65.816  -48.005 51.217  1.00 120.75 ? 292  ARG C NH1   1 
ATOM   5826  N  NH2   . ARG C  2  292  ? 63.957  -48.184 49.880  1.00 114.88 ? 292  ARG C NH2   1 
ATOM   5827  N  N     . PHE C  2  293  ? 66.424  -41.915 46.878  1.00 106.86 ? 293  PHE C N     1 
ATOM   5828  C  CA    . PHE C  2  293  ? 66.938  -42.115 45.532  1.00 112.87 ? 293  PHE C CA    1 
ATOM   5829  C  C     . PHE C  2  293  ? 67.981  -43.224 45.594  1.00 116.47 ? 293  PHE C C     1 
ATOM   5830  O  O     . PHE C  2  293  ? 69.087  -43.026 46.093  1.00 117.09 ? 293  PHE C O     1 
ATOM   5831  C  CB    . PHE C  2  293  ? 67.553  -40.826 44.989  1.00 107.44 ? 293  PHE C CB    1 
ATOM   5832  C  CG    . PHE C  2  293  ? 67.839  -40.866 43.516  1.00 111.44 ? 293  PHE C CG    1 
ATOM   5833  C  CD1   . PHE C  2  293  ? 66.840  -40.590 42.596  1.00 108.54 ? 293  PHE C CD1   1 
ATOM   5834  C  CD2   . PHE C  2  293  ? 69.104  -41.179 43.050  1.00 115.30 ? 293  PHE C CD2   1 
ATOM   5835  C  CE1   . PHE C  2  293  ? 67.098  -40.627 41.241  1.00 110.18 ? 293  PHE C CE1   1 
ATOM   5836  C  CE2   . PHE C  2  293  ? 69.368  -41.218 41.697  1.00 115.42 ? 293  PHE C CE2   1 
ATOM   5837  C  CZ    . PHE C  2  293  ? 68.364  -40.941 40.791  1.00 116.77 ? 293  PHE C CZ    1 
ATOM   5838  N  N     . GLU C  2  294  ? 67.622  -44.391 45.072  1.00 122.68 ? 294  GLU C N     1 
ATOM   5839  C  CA    . GLU C  2  294  ? 68.453  -45.581 45.204  1.00 129.09 ? 294  GLU C CA    1 
ATOM   5840  C  C     . GLU C  2  294  ? 68.481  -46.385 43.907  1.00 139.14 ? 294  GLU C C     1 
ATOM   5841  O  O     . GLU C  2  294  ? 67.431  -46.682 43.331  1.00 140.46 ? 294  GLU C O     1 
ATOM   5842  C  CB    . GLU C  2  294  ? 67.943  -46.448 46.358  1.00 126.47 ? 294  GLU C CB    1 
ATOM   5843  C  CG    . GLU C  2  294  ? 68.640  -47.788 46.506  1.00 133.42 ? 294  GLU C CG    1 
ATOM   5844  C  CD    . GLU C  2  294  ? 68.132  -48.578 47.698  1.00 133.13 ? 294  GLU C CD    1 
ATOM   5845  O  OE1   . GLU C  2  294  ? 67.317  -49.502 47.499  1.00 130.57 ? 294  GLU C OE1   1 
ATOM   5846  O  OE2   . GLU C  2  294  ? 68.548  -48.275 48.836  1.00 126.42 ? 294  GLU C OE2   1 
ATOM   5847  N  N     . ASP C  2  295  ? 69.688  -46.722 43.455  1.00 139.66 ? 295  ASP C N     1 
ATOM   5848  C  CA    . ASP C  2  295  ? 69.894  -47.474 42.218  1.00 130.94 ? 295  ASP C CA    1 
ATOM   5849  C  C     . ASP C  2  295  ? 69.264  -46.788 41.011  1.00 124.92 ? 295  ASP C C     1 
ATOM   5850  O  O     . ASP C  2  295  ? 68.745  -47.450 40.115  1.00 128.22 ? 295  ASP C O     1 
ATOM   5851  C  CB    . ASP C  2  295  ? 69.372  -48.911 42.347  1.00 135.93 ? 295  ASP C CB    1 
ATOM   5852  C  CG    . ASP C  2  295  ? 70.018  -49.667 43.493  1.00 141.46 ? 295  ASP C CG    1 
ATOM   5853  O  OD1   . ASP C  2  295  ? 69.343  -50.535 44.087  1.00 141.38 ? 295  ASP C OD1   1 
ATOM   5854  O  OD2   . ASP C  2  295  ? 71.198  -49.391 43.802  1.00 138.47 ? 295  ASP C OD2   1 
ATOM   5855  N  N     . GLY C  2  296  ? 69.303  -45.459 41.001  1.00 118.50 ? 296  GLY C N     1 
ATOM   5856  C  CA    . GLY C  2  296  ? 68.849  -44.692 39.856  1.00 120.98 ? 296  GLY C CA    1 
ATOM   5857  C  C     . GLY C  2  296  ? 67.385  -44.287 39.857  1.00 121.19 ? 296  GLY C C     1 
ATOM   5858  O  O     . GLY C  2  296  ? 66.989  -43.391 39.111  1.00 114.59 ? 296  GLY C O     1 
ATOM   5859  N  N     . GLU C  2  297  ? 66.575  -44.941 40.683  1.00 124.62 ? 297  GLU C N     1 
ATOM   5860  C  CA    . GLU C  2  297  ? 65.144  -44.641 40.729  1.00 126.40 ? 297  GLU C CA    1 
ATOM   5861  C  C     . GLU C  2  297  ? 64.698  -44.108 42.092  1.00 121.81 ? 297  GLU C C     1 
ATOM   5862  O  O     . GLU C  2  297  ? 65.496  -44.008 43.025  1.00 117.26 ? 297  GLU C O     1 
ATOM   5863  C  CB    . GLU C  2  297  ? 64.324  -45.881 40.358  1.00 128.67 ? 297  GLU C CB    1 
ATOM   5864  C  CG    . GLU C  2  297  ? 64.536  -47.069 41.288  1.00 133.20 ? 297  GLU C CG    1 
ATOM   5865  C  CD    . GLU C  2  297  ? 63.659  -48.258 40.935  1.00 133.91 ? 297  GLU C CD    1 
ATOM   5866  O  OE1   . GLU C  2  297  ? 63.584  -49.203 41.750  1.00 139.71 ? 297  GLU C OE1   1 
ATOM   5867  O  OE2   . GLU C  2  297  ? 63.046  -48.251 39.846  1.00 124.62 ? 297  GLU C OE2   1 
ATOM   5868  N  N     . PHE C  2  298  ? 63.416  -43.771 42.198  1.00 117.46 ? 298  PHE C N     1 
ATOM   5869  C  CA    . PHE C  2  298  ? 62.844  -43.305 43.458  1.00 108.58 ? 298  PHE C CA    1 
ATOM   5870  C  C     . PHE C  2  298  ? 62.157  -44.447 44.195  1.00 102.82 ? 298  PHE C C     1 
ATOM   5871  O  O     . PHE C  2  298  ? 61.423  -45.231 43.595  1.00 104.62 ? 298  PHE C O     1 
ATOM   5872  C  CB    . PHE C  2  298  ? 61.841  -42.175 43.216  1.00 103.92 ? 298  PHE C CB    1 
ATOM   5873  C  CG    . PHE C  2  298  ? 62.477  -40.843 42.936  1.00 101.26 ? 298  PHE C CG    1 
ATOM   5874  C  CD1   . PHE C  2  298  ? 62.608  -40.380 41.638  1.00 101.73 ? 298  PHE C CD1   1 
ATOM   5875  C  CD2   . PHE C  2  298  ? 62.940  -40.050 43.973  1.00 93.98  ? 298  PHE C CD2   1 
ATOM   5876  C  CE1   . PHE C  2  298  ? 63.191  -39.152 41.379  1.00 97.11  ? 298  PHE C CE1   1 
ATOM   5877  C  CE2   . PHE C  2  298  ? 63.523  -38.824 43.721  1.00 89.20  ? 298  PHE C CE2   1 
ATOM   5878  C  CZ    . PHE C  2  298  ? 63.650  -38.375 42.423  1.00 92.21  ? 298  PHE C CZ    1 
ATOM   5879  N  N     . LYS C  2  299  ? 62.397  -44.537 45.498  1.00 103.93 ? 299  LYS C N     1 
ATOM   5880  C  CA    . LYS C  2  299  ? 61.757  -45.558 46.321  1.00 103.21 ? 299  LYS C CA    1 
ATOM   5881  C  C     . LYS C  2  299  ? 60.974  -44.926 47.468  1.00 101.01 ? 299  LYS C C     1 
ATOM   5882  O  O     . LYS C  2  299  ? 61.528  -44.168 48.262  1.00 102.17 ? 299  LYS C O     1 
ATOM   5883  C  CB    . LYS C  2  299  ? 62.795  -46.545 46.859  1.00 105.97 ? 299  LYS C CB    1 
ATOM   5884  C  CG    . LYS C  2  299  ? 63.353  -47.486 45.802  1.00 120.97 ? 299  LYS C CG    1 
ATOM   5885  C  CD    . LYS C  2  299  ? 64.510  -48.315 46.343  1.00 125.49 ? 299  LYS C CD    1 
ATOM   5886  C  CE    . LYS C  2  299  ? 64.963  -49.363 45.332  1.00 131.30 ? 299  LYS C CE    1 
ATOM   5887  N  NZ    . LYS C  2  299  ? 63.928  -50.414 45.103  1.00 124.16 ? 299  LYS C NZ    1 
ATOM   5888  N  N     . ASP C  2  300  ? 59.685  -45.244 47.546  1.00 94.04  ? 300  ASP C N     1 
ATOM   5889  C  CA    . ASP C  2  300  ? 58.807  -44.658 48.555  1.00 94.07  ? 300  ASP C CA    1 
ATOM   5890  C  C     . ASP C  2  300  ? 59.162  -45.098 49.975  1.00 95.82  ? 300  ASP C C     1 
ATOM   5891  O  O     . ASP C  2  300  ? 59.652  -46.205 50.195  1.00 93.75  ? 300  ASP C O     1 
ATOM   5892  C  CB    . ASP C  2  300  ? 57.343  -44.995 48.257  1.00 92.92  ? 300  ASP C CB    1 
ATOM   5893  C  CG    . ASP C  2  300  ? 56.377  -44.285 49.192  1.00 87.53  ? 300  ASP C CG    1 
ATOM   5894  O  OD1   . ASP C  2  300  ? 56.591  -43.089 49.481  1.00 88.18  ? 300  ASP C OD1   1 
ATOM   5895  O  OD2   . ASP C  2  300  ? 55.406  -44.925 49.646  1.00 87.00  ? 300  ASP C OD2   1 
ATOM   5896  N  N     . GLU C  2  301  ? 58.910  -44.208 50.930  1.00 95.82  ? 301  GLU C N     1 
ATOM   5897  C  CA    . GLU C  2  301  ? 59.140  -44.465 52.348  1.00 95.15  ? 301  GLU C CA    1 
ATOM   5898  C  C     . GLU C  2  301  ? 57.879  -44.146 53.147  1.00 92.39  ? 301  GLU C C     1 
ATOM   5899  O  O     . GLU C  2  301  ? 57.318  -44.999 53.831  1.00 84.18  ? 301  GLU C O     1 
ATOM   5900  C  CB    . GLU C  2  301  ? 60.311  -43.626 52.863  1.00 96.38  ? 301  GLU C CB    1 
ATOM   5901  C  CG    . GLU C  2  301  ? 61.687  -44.143 52.467  1.00 102.15 ? 301  GLU C CG    1 
ATOM   5902  C  CD    . GLU C  2  301  ? 62.243  -45.149 53.461  1.00 105.59 ? 301  GLU C CD    1 
ATOM   5903  O  OE1   . GLU C  2  301  ? 61.670  -45.278 54.562  1.00 102.66 ? 301  GLU C OE1   1 
ATOM   5904  O  OE2   . GLU C  2  301  ? 63.253  -45.809 53.143  1.00 106.11 ? 301  GLU C OE2   1 
ATOM   5905  N  N     . VAL C  2  302  ? 57.466  -42.888 53.058  1.00 91.64  ? 302  VAL C N     1 
ATOM   5906  C  CA    . VAL C  2  302  ? 56.381  -42.320 53.853  1.00 81.49  ? 302  VAL C CA    1 
ATOM   5907  C  C     . VAL C  2  302  ? 54.985  -42.418 53.213  1.00 83.75  ? 302  VAL C C     1 
ATOM   5908  O  O     . VAL C  2  302  ? 54.044  -42.892 53.849  1.00 81.56  ? 302  VAL C O     1 
ATOM   5909  C  CB    . VAL C  2  302  ? 56.709  -40.881 54.302  1.00 77.44  ? 302  VAL C CB    1 
ATOM   5910  C  CG1   . VAL C  2  302  ? 55.562  -40.291 55.080  1.00 70.46  ? 302  VAL C CG1   1 
ATOM   5911  C  CG2   . VAL C  2  302  ? 57.964  -40.885 55.157  1.00 78.70  ? 302  VAL C CG2   1 
ATOM   5912  N  N     . PHE C  2  303  ? 54.848  -41.902 51.991  1.00 82.49  ? 303  PHE C N     1 
ATOM   5913  C  CA    . PHE C  2  303  ? 53.546  -41.712 51.328  1.00 79.65  ? 303  PHE C CA    1 
ATOM   5914  C  C     . PHE C  2  303  ? 52.525  -42.859 51.379  1.00 82.67  ? 303  PHE C C     1 
ATOM   5915  O  O     . PHE C  2  303  ? 51.349  -42.624 51.665  1.00 84.87  ? 303  PHE C O     1 
ATOM   5916  C  CB    . PHE C  2  303  ? 53.753  -41.311 49.868  1.00 69.20  ? 303  PHE C CB    1 
ATOM   5917  C  CG    . PHE C  2  303  ? 54.389  -39.972 49.697  1.00 67.22  ? 303  PHE C CG    1 
ATOM   5918  C  CD1   . PHE C  2  303  ? 55.758  -39.858 49.536  1.00 67.29  ? 303  PHE C CD1   1 
ATOM   5919  C  CD2   . PHE C  2  303  ? 53.620  -38.823 49.698  1.00 65.42  ? 303  PHE C CD2   1 
ATOM   5920  C  CE1   . PHE C  2  303  ? 56.348  -38.622 49.379  1.00 67.57  ? 303  PHE C CE1   1 
ATOM   5921  C  CE2   . PHE C  2  303  ? 54.204  -37.583 49.541  1.00 66.33  ? 303  PHE C CE2   1 
ATOM   5922  C  CZ    . PHE C  2  303  ? 55.571  -37.483 49.379  1.00 68.81  ? 303  PHE C CZ    1 
ATOM   5923  N  N     . LEU C  2  304  ? 52.946  -44.086 51.089  1.00 82.48  ? 304  LEU C N     1 
ATOM   5924  C  CA    . LEU C  2  304  ? 51.988  -45.196 51.083  1.00 86.62  ? 304  LEU C CA    1 
ATOM   5925  C  C     . LEU C  2  304  ? 51.395  -45.540 52.463  1.00 81.25  ? 304  LEU C C     1 
ATOM   5926  O  O     . LEU C  2  304  ? 50.191  -45.751 52.567  1.00 77.43  ? 304  LEU C O     1 
ATOM   5927  C  CB    . LEU C  2  304  ? 52.539  -46.442 50.371  1.00 95.03  ? 304  LEU C CB    1 
ATOM   5928  C  CG    . LEU C  2  304  ? 51.515  -47.570 50.185  1.00 93.44  ? 304  LEU C CG    1 
ATOM   5929  C  CD1   . LEU C  2  304  ? 50.354  -47.111 49.315  1.00 82.40  ? 304  LEU C CD1   1 
ATOM   5930  C  CD2   . LEU C  2  304  ? 52.161  -48.819 49.606  1.00 93.59  ? 304  LEU C CD2   1 
ATOM   5931  N  N     . PRO C  2  305  ? 52.230  -45.613 53.519  1.00 81.86  ? 305  PRO C N     1 
ATOM   5932  C  CA    . PRO C  2  305  ? 51.651  -45.784 54.860  1.00 84.51  ? 305  PRO C CA    1 
ATOM   5933  C  C     . PRO C  2  305  ? 50.712  -44.656 55.309  1.00 80.20  ? 305  PRO C C     1 
ATOM   5934  O  O     . PRO C  2  305  ? 49.726  -44.937 55.998  1.00 75.89  ? 305  PRO C O     1 
ATOM   5935  C  CB    . PRO C  2  305  ? 52.886  -45.831 55.760  1.00 79.45  ? 305  PRO C CB    1 
ATOM   5936  C  CG    . PRO C  2  305  ? 53.924  -46.433 54.907  1.00 75.27  ? 305  PRO C CG    1 
ATOM   5937  C  CD    . PRO C  2  305  ? 53.678  -45.895 53.524  1.00 83.66  ? 305  PRO C CD    1 
ATOM   5938  N  N     . THR C  2  306  ? 51.011  -43.411 54.941  1.00 80.48  ? 306  THR C N     1 
ATOM   5939  C  CA    . THR C  2  306  ? 50.151  -42.292 55.324  1.00 81.00  ? 306  THR C CA    1 
ATOM   5940  C  C     . THR C  2  306  ? 48.837  -42.321 54.554  1.00 80.62  ? 306  THR C C     1 
ATOM   5941  O  O     . THR C  2  306  ? 47.778  -42.034 55.111  1.00 83.69  ? 306  THR C O     1 
ATOM   5942  C  CB    . THR C  2  306  ? 50.826  -40.922 55.113  1.00 73.27  ? 306  THR C CB    1 
ATOM   5943  O  OG1   . THR C  2  306  ? 50.988  -40.676 53.715  1.00 83.82  ? 306  THR C OG1   1 
ATOM   5944  C  CG2   . THR C  2  306  ? 52.173  -40.887 55.777  1.00 68.85  ? 306  THR C CG2   1 
ATOM   5945  N  N     . LEU C  2  307  ? 48.911  -42.666 53.272  1.00 80.51  ? 307  LEU C N     1 
ATOM   5946  C  CA    . LEU C  2  307  ? 47.716  -42.803 52.444  1.00 83.65  ? 307  LEU C CA    1 
ATOM   5947  C  C     . LEU C  2  307  ? 46.842  -43.942 52.961  1.00 80.47  ? 307  LEU C C     1 
ATOM   5948  O  O     . LEU C  2  307  ? 45.617  -43.821 53.050  1.00 80.87  ? 307  LEU C O     1 
ATOM   5949  C  CB    . LEU C  2  307  ? 48.108  -43.056 50.985  1.00 88.10  ? 307  LEU C CB    1 
ATOM   5950  C  CG    . LEU C  2  307  ? 46.989  -43.350 49.983  1.00 89.00  ? 307  LEU C CG    1 
ATOM   5951  C  CD1   . LEU C  2  307  ? 46.012  -42.189 49.891  1.00 90.68  ? 307  LEU C CD1   1 
ATOM   5952  C  CD2   . LEU C  2  307  ? 47.576  -43.668 48.618  1.00 84.42  ? 307  LEU C CD2   1 
ATOM   5953  N  N     . ARG C  2  308  ? 47.495  -45.044 53.312  1.00 82.63  ? 308  ARG C N     1 
ATOM   5954  C  CA    . ARG C  2  308  ? 46.835  -46.219 53.864  1.00 82.53  ? 308  ARG C CA    1 
ATOM   5955  C  C     . ARG C  2  308  ? 46.120  -45.864 55.164  1.00 77.51  ? 308  ARG C C     1 
ATOM   5956  O  O     . ARG C  2  308  ? 44.972  -46.256 55.368  1.00 80.34  ? 308  ARG C O     1 
ATOM   5957  C  CB    . ARG C  2  308  ? 47.866  -47.333 54.092  1.00 81.13  ? 308  ARG C CB    1 
ATOM   5958  C  CG    . ARG C  2  308  ? 47.298  -48.736 54.266  1.00 86.98  ? 308  ARG C CG    1 
ATOM   5959  C  CD    . ARG C  2  308  ? 46.964  -49.022 55.718  1.00 88.95  ? 308  ARG C CD    1 
ATOM   5960  N  NE    . ARG C  2  308  ? 48.018  -48.541 56.607  1.00 103.78 ? 308  ARG C NE    1 
ATOM   5961  C  CZ    . ARG C  2  308  ? 47.844  -48.285 57.900  1.00 102.39 ? 308  ARG C CZ    1 
ATOM   5962  N  NH1   . ARG C  2  308  ? 46.651  -48.466 58.453  1.00 91.61  ? 308  ARG C NH1   1 
ATOM   5963  N  NH2   . ARG C  2  308  ? 48.861  -47.844 58.636  1.00 95.31  ? 308  ARG C NH2   1 
ATOM   5964  N  N     . TYR C  2  309  ? 46.797  -45.115 56.033  1.00 79.84  ? 309  TYR C N     1 
ATOM   5965  C  CA    . TYR C  2  309  ? 46.209  -44.695 57.304  1.00 79.04  ? 309  TYR C CA    1 
ATOM   5966  C  C     . TYR C  2  309  ? 45.034  -43.748 57.078  1.00 78.46  ? 309  TYR C C     1 
ATOM   5967  O  O     . TYR C  2  309  ? 44.020  -43.840 57.765  1.00 77.51  ? 309  TYR C O     1 
ATOM   5968  C  CB    . TYR C  2  309  ? 47.258  -44.027 58.200  1.00 80.49  ? 309  TYR C CB    1 
ATOM   5969  C  CG    . TYR C  2  309  ? 46.862  -43.906 59.664  1.00 75.73  ? 309  TYR C CG    1 
ATOM   5970  C  CD1   . TYR C  2  309  ? 47.459  -44.701 60.630  1.00 78.27  ? 309  TYR C CD1   1 
ATOM   5971  C  CD2   . TYR C  2  309  ? 45.898  -42.993 60.077  1.00 76.34  ? 309  TYR C CD2   1 
ATOM   5972  C  CE1   . TYR C  2  309  ? 47.108  -44.592 61.962  1.00 84.79  ? 309  TYR C CE1   1 
ATOM   5973  C  CE2   . TYR C  2  309  ? 45.538  -42.879 61.406  1.00 78.72  ? 309  TYR C CE2   1 
ATOM   5974  C  CZ    . TYR C  2  309  ? 46.146  -43.681 62.345  1.00 81.92  ? 309  TYR C CZ    1 
ATOM   5975  O  OH    . TYR C  2  309  ? 45.792  -43.575 63.671  1.00 78.09  ? 309  TYR C OH    1 
ATOM   5976  N  N     . LEU C  2  310  ? 45.181  -42.836 56.122  1.00 76.31  ? 310  LEU C N     1 
ATOM   5977  C  CA    . LEU C  2  310  ? 44.112  -41.904 55.772  1.00 77.52  ? 310  LEU C CA    1 
ATOM   5978  C  C     . LEU C  2  310  ? 42.851  -42.639 55.319  1.00 84.26  ? 310  LEU C C     1 
ATOM   5979  O  O     . LEU C  2  310  ? 41.749  -42.356 55.807  1.00 84.17  ? 310  LEU C O     1 
ATOM   5980  C  CB    . LEU C  2  310  ? 44.578  -40.936 54.682  1.00 77.05  ? 310  LEU C CB    1 
ATOM   5981  C  CG    . LEU C  2  310  ? 43.510  -40.074 53.999  1.00 72.47  ? 310  LEU C CG    1 
ATOM   5982  C  CD1   . LEU C  2  310  ? 42.720  -39.257 55.012  1.00 73.56  ? 310  LEU C CD1   1 
ATOM   5983  C  CD2   . LEU C  2  310  ? 44.147  -39.168 52.958  1.00 72.65  ? 310  LEU C CD2   1 
ATOM   5984  N  N     . PHE C  2  311  ? 43.014  -43.579 54.389  1.00 83.50  ? 311  PHE C N     1 
ATOM   5985  C  CA    . PHE C  2  311  ? 41.885  -44.375 53.910  1.00 85.34  ? 311  PHE C CA    1 
ATOM   5986  C  C     . PHE C  2  311  ? 41.265  -45.202 55.032  1.00 90.09  ? 311  PHE C C     1 
ATOM   5987  O  O     . PHE C  2  311  ? 40.042  -45.255 55.169  1.00 93.58  ? 311  PHE C O     1 
ATOM   5988  C  CB    . PHE C  2  311  ? 42.296  -45.294 52.753  1.00 92.32  ? 311  PHE C CB    1 
ATOM   5989  C  CG    . PHE C  2  311  ? 42.346  -44.610 51.413  1.00 95.62  ? 311  PHE C CG    1 
ATOM   5990  C  CD1   . PHE C  2  311  ? 41.886  -43.312 51.258  1.00 99.37  ? 311  PHE C CD1   1 
ATOM   5991  C  CD2   . PHE C  2  311  ? 42.846  -45.272 50.305  1.00 94.46  ? 311  PHE C CD2   1 
ATOM   5992  C  CE1   . PHE C  2  311  ? 41.935  -42.686 50.024  1.00 99.13  ? 311  PHE C CE1   1 
ATOM   5993  C  CE2   . PHE C  2  311  ? 42.899  -44.651 49.073  1.00 99.11  ? 311  PHE C CE2   1 
ATOM   5994  C  CZ    . PHE C  2  311  ? 42.443  -43.356 48.932  1.00 99.76  ? 311  PHE C CZ    1 
ATOM   5995  N  N     . ALA C  2  312  ? 42.113  -45.845 55.830  1.00 89.81  ? 312  ALA C N     1 
ATOM   5996  C  CA    . ALA C  2  312  ? 41.647  -46.660 56.947  1.00 86.61  ? 312  ALA C CA    1 
ATOM   5997  C  C     . ALA C  2  312  ? 40.857  -45.825 57.951  1.00 86.89  ? 312  ALA C C     1 
ATOM   5998  O  O     . ALA C  2  312  ? 39.919  -46.311 58.575  1.00 85.76  ? 312  ALA C O     1 
ATOM   5999  C  CB    . ALA C  2  312  ? 42.818  -47.341 57.628  1.00 87.69  ? 312  ALA C CB    1 
ATOM   6000  N  N     . LEU C  2  313  ? 41.240  -44.562 58.096  1.00 88.15  ? 313  LEU C N     1 
ATOM   6001  C  CA    . LEU C  2  313  ? 40.549  -43.652 58.997  1.00 90.03  ? 313  LEU C CA    1 
ATOM   6002  C  C     . LEU C  2  313  ? 39.198  -43.232 58.421  1.00 88.51  ? 313  LEU C C     1 
ATOM   6003  O  O     . LEU C  2  313  ? 38.184  -43.262 59.121  1.00 88.27  ? 313  LEU C O     1 
ATOM   6004  C  CB    . LEU C  2  313  ? 41.414  -42.423 59.289  1.00 88.89  ? 313  LEU C CB    1 
ATOM   6005  C  CG    . LEU C  2  313  ? 40.839  -41.386 60.256  1.00 84.23  ? 313  LEU C CG    1 
ATOM   6006  C  CD1   . LEU C  2  313  ? 40.538  -42.011 61.614  1.00 83.95  ? 313  LEU C CD1   1 
ATOM   6007  C  CD2   . LEU C  2  313  ? 41.793  -40.213 60.396  1.00 82.30  ? 313  LEU C CD2   1 
ATOM   6008  N  N     . THR C  2  314  ? 39.191  -42.844 57.146  1.00 87.94  ? 314  THR C N     1 
ATOM   6009  C  CA    . THR C  2  314  ? 37.958  -42.442 56.470  1.00 91.93  ? 314  THR C CA    1 
ATOM   6010  C  C     . THR C  2  314  ? 36.933  -43.576 56.478  1.00 92.72  ? 314  THR C C     1 
ATOM   6011  O  O     . THR C  2  314  ? 35.734  -43.352 56.669  1.00 85.31  ? 314  THR C O     1 
ATOM   6012  C  CB    . THR C  2  314  ? 38.222  -42.000 55.012  1.00 84.62  ? 314  THR C CB    1 
ATOM   6013  O  OG1   . THR C  2  314  ? 39.131  -40.893 55.000  1.00 84.60  ? 314  THR C OG1   1 
ATOM   6014  C  CG2   . THR C  2  314  ? 36.932  -41.577 54.339  1.00 88.40  ? 314  THR C CG2   1 
ATOM   6015  N  N     . ALA C  2  315  ? 37.422  -44.797 56.287  1.00 93.49  ? 315  ALA C N     1 
ATOM   6016  C  CA    . ALA C  2  315  ? 36.569  -45.981 56.281  1.00 97.43  ? 315  ALA C CA    1 
ATOM   6017  C  C     . ALA C  2  315  ? 36.062  -46.356 57.678  1.00 97.00  ? 315  ALA C C     1 
ATOM   6018  O  O     . ALA C  2  315  ? 35.161  -47.181 57.816  1.00 99.31  ? 315  ALA C O     1 
ATOM   6019  C  CB    . ALA C  2  315  ? 37.303  -47.158 55.644  1.00 93.92  ? 315  ALA C CB    1 
ATOM   6020  N  N     . GLY C  2  316  ? 36.644  -45.754 58.710  1.00 93.22  ? 316  GLY C N     1 
ATOM   6021  C  CA    . GLY C  2  316  ? 36.213  -46.000 60.074  1.00 91.28  ? 316  GLY C CA    1 
ATOM   6022  C  C     . GLY C  2  316  ? 36.773  -47.281 60.663  1.00 92.97  ? 316  GLY C C     1 
ATOM   6023  O  O     . GLY C  2  316  ? 36.154  -47.900 61.528  1.00 99.14  ? 316  GLY C O     1 
ATOM   6024  N  N     . VAL C  2  317  ? 37.951  -47.675 60.192  1.00 93.90  ? 317  VAL C N     1 
ATOM   6025  C  CA    . VAL C  2  317  ? 38.626  -48.869 60.690  1.00 95.31  ? 317  VAL C CA    1 
ATOM   6026  C  C     . VAL C  2  317  ? 39.109  -48.680 62.128  1.00 96.89  ? 317  VAL C C     1 
ATOM   6027  O  O     . VAL C  2  317  ? 39.742  -47.673 62.447  1.00 95.68  ? 317  VAL C O     1 
ATOM   6028  C  CB    . VAL C  2  317  ? 39.818  -49.251 59.786  1.00 92.05  ? 317  VAL C CB    1 
ATOM   6029  C  CG1   . VAL C  2  317  ? 40.616  -50.393 60.390  1.00 96.91  ? 317  VAL C CG1   1 
ATOM   6030  C  CG2   . VAL C  2  317  ? 39.328  -49.618 58.395  1.00 91.99  ? 317  VAL C CG2   1 
ATOM   6031  N  N     . PRO C  2  318  ? 38.795  -49.648 63.004  1.00 99.40  ? 318  PRO C N     1 
ATOM   6032  C  CA    . PRO C  2  318  ? 39.210  -49.634 64.410  1.00 101.68 ? 318  PRO C CA    1 
ATOM   6033  C  C     . PRO C  2  318  ? 40.723  -49.536 64.574  1.00 100.25 ? 318  PRO C C     1 
ATOM   6034  O  O     . PRO C  2  318  ? 41.464  -50.185 63.835  1.00 94.75  ? 318  PRO C O     1 
ATOM   6035  C  CB    . PRO C  2  318  ? 38.719  -50.988 64.925  1.00 97.44  ? 318  PRO C CB    1 
ATOM   6036  C  CG    . PRO C  2  318  ? 37.566  -51.316 64.061  1.00 99.71  ? 318  PRO C CG    1 
ATOM   6037  C  CD    . PRO C  2  318  ? 37.913  -50.790 62.705  1.00 99.23  ? 318  PRO C CD    1 
ATOM   6038  N  N     . GLY C  2  319  ? 41.165  -48.730 65.536  1.00 104.49 ? 319  GLY C N     1 
ATOM   6039  C  CA    . GLY C  2  319  ? 42.582  -48.568 65.815  1.00 106.53 ? 319  GLY C CA    1 
ATOM   6040  C  C     . GLY C  2  319  ? 43.190  -47.354 65.138  1.00 102.89 ? 319  GLY C C     1 
ATOM   6041  O  O     . GLY C  2  319  ? 44.401  -47.131 65.207  1.00 99.90  ? 319  GLY C O     1 
ATOM   6042  N  N     . HIS C  2  320  ? 42.347  -46.566 64.479  1.00 98.13  ? 320  HIS C N     1 
ATOM   6043  C  CA    . HIS C  2  320  ? 42.802  -45.374 63.776  1.00 90.52  ? 320  HIS C CA    1 
ATOM   6044  C  C     . HIS C  2  320  ? 42.136  -44.125 64.335  1.00 88.61  ? 320  HIS C C     1 
ATOM   6045  O  O     . HIS C  2  320  ? 40.913  -44.056 64.429  1.00 92.26  ? 320  HIS C O     1 
ATOM   6046  C  CB    . HIS C  2  320  ? 42.520  -45.501 62.280  1.00 92.52  ? 320  HIS C CB    1 
ATOM   6047  C  CG    . HIS C  2  320  ? 43.261  -46.623 61.621  1.00 91.89  ? 320  HIS C CG    1 
ATOM   6048  N  ND1   . HIS C  2  320  ? 43.083  -47.943 61.974  1.00 96.20  ? 320  HIS C ND1   1 
ATOM   6049  C  CD2   . HIS C  2  320  ? 44.189  -46.621 60.635  1.00 89.45  ? 320  HIS C CD2   1 
ATOM   6050  C  CE1   . HIS C  2  320  ? 43.865  -48.706 61.231  1.00 92.78  ? 320  HIS C CE1   1 
ATOM   6051  N  NE2   . HIS C  2  320  ? 44.545  -47.928 60.410  1.00 85.94  ? 320  HIS C NE2   1 
ATOM   6052  N  N     . GLU C  2  321  ? 42.948  -43.139 64.705  1.00 96.12  ? 321  GLU C N     1 
ATOM   6053  C  CA    . GLU C  2  321  ? 42.447  -41.944 65.377  1.00 96.22  ? 321  GLU C CA    1 
ATOM   6054  C  C     . GLU C  2  321  ? 42.896  -40.648 64.711  1.00 86.59  ? 321  GLU C C     1 
ATOM   6055  O  O     . GLU C  2  321  ? 43.885  -40.615 63.979  1.00 81.82  ? 321  GLU C O     1 
ATOM   6056  C  CB    . GLU C  2  321  ? 42.900  -41.925 66.842  1.00 94.52  ? 321  GLU C CB    1 
ATOM   6057  C  CG    . GLU C  2  321  ? 42.350  -43.050 67.698  1.00 100.05 ? 321  GLU C CG    1 
ATOM   6058  C  CD    . GLU C  2  321  ? 42.745  -42.911 69.156  1.00 111.74 ? 321  GLU C CD    1 
ATOM   6059  O  OE1   . GLU C  2  321  ? 43.752  -42.227 69.439  1.00 101.15 ? 321  GLU C OE1   1 
ATOM   6060  O  OE2   . GLU C  2  321  ? 42.045  -43.481 70.020  1.00 120.90 ? 321  GLU C OE2   1 
ATOM   6061  N  N     . VAL C  2  322  ? 42.148  -39.583 64.970  1.00 82.07  ? 322  VAL C N     1 
ATOM   6062  C  CA    . VAL C  2  322  ? 42.595  -38.236 64.653  1.00 77.27  ? 322  VAL C CA    1 
ATOM   6063  C  C     . VAL C  2  322  ? 43.557  -37.755 65.732  1.00 75.16  ? 322  VAL C C     1 
ATOM   6064  O  O     . VAL C  2  322  ? 43.529  -38.246 66.865  1.00 71.62  ? 322  VAL C O     1 
ATOM   6065  C  CB    . VAL C  2  322  ? 41.419  -37.256 64.537  1.00 75.83  ? 322  VAL C CB    1 
ATOM   6066  C  CG1   . VAL C  2  322  ? 40.887  -37.247 63.120  1.00 75.55  ? 322  VAL C CG1   1 
ATOM   6067  C  CG2   . VAL C  2  322  ? 40.321  -37.636 65.517  1.00 78.00  ? 322  VAL C CG2   1 
ATOM   6068  N  N     . ASP C  2  323  ? 44.413  -36.802 65.376  1.00 67.28  ? 323  ASP C N     1 
ATOM   6069  C  CA    . ASP C  2  323  ? 45.413  -36.301 66.309  1.00 66.57  ? 323  ASP C CA    1 
ATOM   6070  C  C     . ASP C  2  323  ? 45.037  -34.961 66.932  1.00 59.09  ? 323  ASP C C     1 
ATOM   6071  O  O     . ASP C  2  323  ? 44.607  -34.041 66.238  1.00 53.94  ? 323  ASP C O     1 
ATOM   6072  C  CB    . ASP C  2  323  ? 46.773  -36.198 65.623  1.00 68.19  ? 323  ASP C CB    1 
ATOM   6073  C  CG    . ASP C  2  323  ? 47.298  -37.545 65.175  1.00 74.55  ? 323  ASP C CG    1 
ATOM   6074  O  OD1   . ASP C  2  323  ? 47.671  -38.351 66.054  1.00 74.06  ? 323  ASP C OD1   1 
ATOM   6075  O  OD2   . ASP C  2  323  ? 47.340  -37.795 63.951  1.00 73.53  ? 323  ASP C OD2   1 
ATOM   6076  N  N     . ASP C  2  324  ? 45.211  -34.863 68.247  1.00 55.32  ? 324  ASP C N     1 
ATOM   6077  C  CA    . ASP C  2  324  ? 45.017  -33.608 68.956  1.00 56.46  ? 324  ASP C CA    1 
ATOM   6078  C  C     . ASP C  2  324  ? 46.330  -32.847 68.817  1.00 61.95  ? 324  ASP C C     1 
ATOM   6079  O  O     . ASP C  2  324  ? 47.358  -33.280 69.332  1.00 60.88  ? 324  ASP C O     1 
ATOM   6080  C  CB    . ASP C  2  324  ? 44.738  -33.909 70.430  1.00 53.63  ? 324  ASP C CB    1 
ATOM   6081  C  CG    . ASP C  2  324  ? 44.365  -32.677 71.234  1.00 54.60  ? 324  ASP C CG    1 
ATOM   6082  O  OD1   . ASP C  2  324  ? 44.609  -31.541 70.774  1.00 61.58  ? 324  ASP C OD1   1 
ATOM   6083  O  OD2   . ASP C  2  324  ? 43.831  -32.853 72.347  1.00 59.83  ? 324  ASP C OD2   1 
ATOM   6084  N  N     . ILE C  2  325  ? 46.307  -31.706 68.138  1.00 58.59  ? 325  ILE C N     1 
ATOM   6085  C  CA    . ILE C  2  325  ? 47.566  -31.060 67.791  1.00 57.71  ? 325  ILE C CA    1 
ATOM   6086  C  C     . ILE C  2  325  ? 48.123  -30.213 68.923  1.00 57.02  ? 325  ILE C C     1 
ATOM   6087  O  O     . ILE C  2  325  ? 49.273  -29.772 68.870  1.00 60.38  ? 325  ILE C O     1 
ATOM   6088  C  CB    . ILE C  2  325  ? 47.474  -30.219 66.498  1.00 58.77  ? 325  ILE C CB    1 
ATOM   6089  C  CG1   . ILE C  2  325  ? 46.742  -28.906 66.753  1.00 60.23  ? 325  ILE C CG1   1 
ATOM   6090  C  CG2   . ILE C  2  325  ? 46.817  -31.013 65.389  1.00 48.81  ? 325  ILE C CG2   1 
ATOM   6091  C  CD1   . ILE C  2  325  ? 46.883  -27.926 65.620  1.00 55.51  ? 325  ILE C CD1   1 
ATOM   6092  N  N     . ASP C  2  326  ? 47.303  -29.972 69.938  1.00 54.82  ? 326  ASP C N     1 
ATOM   6093  C  CA    . ASP C  2  326  ? 47.770  -29.270 71.126  1.00 56.62  ? 326  ASP C CA    1 
ATOM   6094  C  C     . ASP C  2  326  ? 48.129  -30.225 72.260  1.00 52.66  ? 326  ASP C C     1 
ATOM   6095  O  O     . ASP C  2  326  ? 48.576  -29.799 73.326  1.00 51.05  ? 326  ASP C O     1 
ATOM   6096  C  CB    . ASP C  2  326  ? 46.744  -28.239 71.577  1.00 62.41  ? 326  ASP C CB    1 
ATOM   6097  C  CG    . ASP C  2  326  ? 46.540  -27.153 70.553  1.00 71.74  ? 326  ASP C CG    1 
ATOM   6098  O  OD1   . ASP C  2  326  ? 47.493  -26.373 70.323  1.00 69.18  ? 326  ASP C OD1   1 
ATOM   6099  O  OD2   . ASP C  2  326  ? 45.432  -27.085 69.976  1.00 80.45  ? 326  ASP C OD2   1 
ATOM   6100  N  N     . HIS C  2  327  ? 47.921  -31.515 72.024  1.00 49.97  ? 327  HIS C N     1 
ATOM   6101  C  CA    . HIS C  2  327  ? 48.375  -32.552 72.938  1.00 51.21  ? 327  HIS C CA    1 
ATOM   6102  C  C     . HIS C  2  327  ? 49.893  -32.419 73.053  1.00 51.81  ? 327  HIS C C     1 
ATOM   6103  O  O     . HIS C  2  327  ? 50.579  -32.203 72.054  1.00 45.34  ? 327  HIS C O     1 
ATOM   6104  C  CB    . HIS C  2  327  ? 47.992  -33.927 72.382  1.00 49.59  ? 327  HIS C CB    1 
ATOM   6105  C  CG    . HIS C  2  327  ? 48.112  -35.049 73.367  1.00 49.01  ? 327  HIS C CG    1 
ATOM   6106  N  ND1   . HIS C  2  327  ? 49.316  -35.641 73.680  1.00 53.50  ? 327  HIS C ND1   1 
ATOM   6107  C  CD2   . HIS C  2  327  ? 47.172  -35.709 74.084  1.00 47.85  ? 327  HIS C CD2   1 
ATOM   6108  C  CE1   . HIS C  2  327  ? 49.115  -36.605 74.562  1.00 54.48  ? 327  HIS C CE1   1 
ATOM   6109  N  NE2   . HIS C  2  327  ? 47.823  -36.666 74.824  1.00 52.93  ? 327  HIS C NE2   1 
ATOM   6110  N  N     . LEU C  2  328  ? 50.428  -32.568 74.259  1.00 51.46  ? 328  LEU C N     1 
ATOM   6111  C  CA    . LEU C  2  328  ? 51.845  -32.301 74.469  1.00 49.62  ? 328  LEU C CA    1 
ATOM   6112  C  C     . LEU C  2  328  ? 52.713  -33.457 73.989  1.00 53.37  ? 328  LEU C C     1 
ATOM   6113  O  O     . LEU C  2  328  ? 53.937  -33.429 74.126  1.00 51.09  ? 328  LEU C O     1 
ATOM   6114  C  CB    . LEU C  2  328  ? 52.145  -31.956 75.925  1.00 43.62  ? 328  LEU C CB    1 
ATOM   6115  C  CG    . LEU C  2  328  ? 51.911  -30.486 76.268  1.00 45.14  ? 328  LEU C CG    1 
ATOM   6116  C  CD1   . LEU C  2  328  ? 52.424  -30.170 77.661  1.00 44.59  ? 328  LEU C CD1   1 
ATOM   6117  C  CD2   . LEU C  2  328  ? 52.565  -29.584 75.237  1.00 40.28  ? 328  LEU C CD2   1 
ATOM   6118  N  N     . GLY C  2  329  ? 52.067  -34.482 73.445  1.00 53.02  ? 329  GLY C N     1 
ATOM   6119  C  CA    . GLY C  2  329  ? 52.767  -35.511 72.704  1.00 52.96  ? 329  GLY C CA    1 
ATOM   6120  C  C     . GLY C  2  329  ? 53.072  -35.026 71.296  1.00 56.91  ? 329  GLY C C     1 
ATOM   6121  O  O     . GLY C  2  329  ? 54.056  -35.437 70.688  1.00 60.76  ? 329  GLY C O     1 
ATOM   6122  N  N     . ASN C  2  330  ? 52.207  -34.164 70.769  1.00 55.05  ? 330  ASN C N     1 
ATOM   6123  C  CA    . ASN C  2  330  ? 52.378  -33.607 69.427  1.00 52.28  ? 330  ASN C CA    1 
ATOM   6124  C  C     . ASN C  2  330  ? 52.984  -32.203 69.390  1.00 49.19  ? 330  ASN C C     1 
ATOM   6125  O  O     . ASN C  2  330  ? 53.108  -31.598 68.327  1.00 47.46  ? 330  ASN C O     1 
ATOM   6126  C  CB    . ASN C  2  330  ? 51.051  -33.642 68.672  1.00 52.61  ? 330  ASN C CB    1 
ATOM   6127  C  CG    . ASN C  2  330  ? 50.412  -35.015 68.692  1.00 54.46  ? 330  ASN C CG    1 
ATOM   6128  O  OD1   . ASN C  2  330  ? 51.094  -36.031 68.564  1.00 60.90  ? 330  ASN C OD1   1 
ATOM   6129  N  ND2   . ASN C  2  330  ? 49.098  -35.055 68.865  1.00 54.90  ? 330  ASN C ND2   1 
ATOM   6130  N  N     . ARG C  2  331  ? 53.328  -31.678 70.560  1.00 51.75  ? 331  ARG C N     1 
ATOM   6131  C  CA    . ARG C  2  331  ? 53.932  -30.356 70.665  1.00 48.71  ? 331  ARG C CA    1 
ATOM   6132  C  C     . ARG C  2  331  ? 55.260  -30.496 71.401  1.00 45.74  ? 331  ARG C C     1 
ATOM   6133  O  O     . ARG C  2  331  ? 55.317  -31.098 72.469  1.00 45.56  ? 331  ARG C O     1 
ATOM   6134  C  CB    . ARG C  2  331  ? 52.984  -29.391 71.395  1.00 51.90  ? 331  ARG C CB    1 
ATOM   6135  C  CG    . ARG C  2  331  ? 52.691  -28.103 70.628  1.00 51.52  ? 331  ARG C CG    1 
ATOM   6136  C  CD    . ARG C  2  331  ? 51.329  -27.497 70.962  1.00 50.75  ? 331  ARG C CD    1 
ATOM   6137  N  NE    . ARG C  2  331  ? 51.356  -26.554 72.085  1.00 51.88  ? 331  ARG C NE    1 
ATOM   6138  C  CZ    . ARG C  2  331  ? 51.695  -25.268 71.988  1.00 53.04  ? 331  ARG C CZ    1 
ATOM   6139  N  NH1   . ARG C  2  331  ? 51.674  -24.491 73.064  1.00 45.59  ? 331  ARG C NH1   1 
ATOM   6140  N  NH2   . ARG C  2  331  ? 52.064  -24.755 70.820  1.00 55.77  ? 331  ARG C NH2   1 
ATOM   6141  N  N     . ARG C  2  332  ? 56.331  -29.962 70.824  1.00 46.28  ? 332  ARG C N     1 
ATOM   6142  C  CA    . ARG C  2  332  ? 57.666  -30.163 71.384  1.00 45.21  ? 332  ARG C CA    1 
ATOM   6143  C  C     . ARG C  2  332  ? 58.444  -28.871 71.576  1.00 45.70  ? 332  ARG C C     1 
ATOM   6144  O  O     . ARG C  2  332  ? 58.140  -27.844 70.964  1.00 47.44  ? 332  ARG C O     1 
ATOM   6145  C  CB    . ARG C  2  332  ? 58.477  -31.114 70.506  1.00 46.80  ? 332  ARG C CB    1 
ATOM   6146  C  CG    . ARG C  2  332  ? 58.846  -30.536 69.154  1.00 45.51  ? 332  ARG C CG    1 
ATOM   6147  C  CD    . ARG C  2  332  ? 59.644  -31.528 68.325  1.00 47.57  ? 332  ARG C CD    1 
ATOM   6148  N  NE    . ARG C  2  332  ? 60.982  -31.749 68.860  1.00 42.04  ? 332  ARG C NE    1 
ATOM   6149  C  CZ    . ARG C  2  332  ? 62.055  -31.056 68.493  1.00 43.85  ? 332  ARG C CZ    1 
ATOM   6150  N  NH1   . ARG C  2  332  ? 61.953  -30.093 67.587  1.00 44.81  ? 332  ARG C NH1   1 
ATOM   6151  N  NH2   . ARG C  2  332  ? 63.234  -31.323 69.035  1.00 45.41  ? 332  ARG C NH2   1 
ATOM   6152  N  N     . ILE C  2  333  ? 59.465  -28.948 72.425  1.00 46.99  ? 333  ILE C N     1 
ATOM   6153  C  CA    . ILE C  2  333  ? 60.319  -27.808 72.747  1.00 48.39  ? 333  ILE C CA    1 
ATOM   6154  C  C     . ILE C  2  333  ? 61.641  -27.829 71.973  1.00 47.34  ? 333  ILE C C     1 
ATOM   6155  O  O     . ILE C  2  333  ? 62.325  -28.849 71.919  1.00 48.26  ? 333  ILE C O     1 
ATOM   6156  C  CB    . ILE C  2  333  ? 60.652  -27.780 74.250  1.00 42.19  ? 333  ILE C CB    1 
ATOM   6157  C  CG1   . ILE C  2  333  ? 59.376  -27.902 75.088  1.00 41.80  ? 333  ILE C CG1   1 
ATOM   6158  C  CG2   . ILE C  2  333  ? 61.424  -26.529 74.601  1.00 42.85  ? 333  ILE C CG2   1 
ATOM   6159  C  CD1   . ILE C  2  333  ? 58.386  -26.795 74.863  1.00 41.11  ? 333  ILE C CD1   1 
ATOM   6160  N  N     . ARG C  2  334  ? 61.990  -26.697 71.374  1.00 44.59  ? 334  ARG C N     1 
ATOM   6161  C  CA    . ARG C  2  334  ? 63.292  -26.505 70.758  1.00 46.48  ? 334  ARG C CA    1 
ATOM   6162  C  C     . ARG C  2  334  ? 64.146  -25.647 71.683  1.00 45.78  ? 334  ARG C C     1 
ATOM   6163  O  O     . ARG C  2  334  ? 63.924  -24.441 71.810  1.00 44.90  ? 334  ARG C O     1 
ATOM   6164  C  CB    . ARG C  2  334  ? 63.133  -25.811 69.410  1.00 42.89  ? 334  ARG C CB    1 
ATOM   6165  C  CG    . ARG C  2  334  ? 62.213  -26.542 68.465  1.00 46.36  ? 334  ARG C CG    1 
ATOM   6166  C  CD    . ARG C  2  334  ? 61.902  -25.701 67.256  1.00 47.07  ? 334  ARG C CD    1 
ATOM   6167  N  NE    . ARG C  2  334  ? 63.044  -25.578 66.362  1.00 49.39  ? 334  ARG C NE    1 
ATOM   6168  C  CZ    . ARG C  2  334  ? 63.192  -24.590 65.487  1.00 58.85  ? 334  ARG C CZ    1 
ATOM   6169  N  NH1   . ARG C  2  334  ? 62.275  -23.629 65.405  1.00 60.95  ? 334  ARG C NH1   1 
ATOM   6170  N  NH2   . ARG C  2  334  ? 64.259  -24.555 64.703  1.00 62.99  ? 334  ARG C NH2   1 
ATOM   6171  N  N     . THR C  2  335  ? 65.131  -26.277 72.315  1.00 48.15  ? 335  THR C N     1 
ATOM   6172  C  CA    . THR C  2  335  ? 65.959  -25.612 73.317  1.00 47.14  ? 335  THR C CA    1 
ATOM   6173  C  C     . THR C  2  335  ? 67.150  -24.900 72.676  1.00 45.48  ? 335  THR C C     1 
ATOM   6174  O  O     . THR C  2  335  ? 67.314  -24.942 71.457  1.00 44.55  ? 335  THR C O     1 
ATOM   6175  C  CB    . THR C  2  335  ? 66.434  -26.603 74.403  1.00 48.52  ? 335  THR C CB    1 
ATOM   6176  O  OG1   . THR C  2  335  ? 66.849  -27.830 73.790  1.00 50.34  ? 335  THR C OG1   1 
ATOM   6177  C  CG2   . THR C  2  335  ? 65.308  -26.910 75.362  1.00 47.59  ? 335  THR C CG2   1 
ATOM   6178  N  N     . VAL C  2  336  ? 67.968  -24.257 73.510  1.00 43.81  ? 336  VAL C N     1 
ATOM   6179  C  CA    . VAL C  2  336  ? 69.086  -23.422 73.066  1.00 38.56  ? 336  VAL C CA    1 
ATOM   6180  C  C     . VAL C  2  336  ? 69.933  -24.102 72.014  1.00 47.29  ? 336  VAL C C     1 
ATOM   6181  O  O     . VAL C  2  336  ? 70.238  -23.526 70.962  1.00 47.88  ? 336  VAL C O     1 
ATOM   6182  C  CB    . VAL C  2  336  ? 70.056  -23.149 74.219  1.00 38.59  ? 336  VAL C CB    1 
ATOM   6183  C  CG1   . VAL C  2  336  ? 70.776  -21.834 73.991  1.00 42.26  ? 336  VAL C CG1   1 
ATOM   6184  C  CG2   . VAL C  2  336  ? 69.329  -23.152 75.538  1.00 49.56  ? 336  VAL C CG2   1 
ATOM   6185  N  N     . GLY C  2  337  ? 70.322  -25.334 72.325  1.00 46.03  ? 337  GLY C N     1 
ATOM   6186  C  CA    . GLY C  2  337  ? 71.162  -26.121 71.453  1.00 38.93  ? 337  GLY C CA    1 
ATOM   6187  C  C     . GLY C  2  337  ? 70.567  -26.274 70.074  1.00 42.04  ? 337  GLY C C     1 
ATOM   6188  O  O     . GLY C  2  337  ? 71.250  -26.059 69.086  1.00 50.08  ? 337  GLY C O     1 
ATOM   6189  N  N     . GLU C  2  338  ? 69.289  -26.627 70.006  1.00 44.12  ? 338  GLU C N     1 
ATOM   6190  C  CA    . GLU C  2  338  ? 68.629  -26.852 68.726  1.00 41.05  ? 338  GLU C CA    1 
ATOM   6191  C  C     . GLU C  2  338  ? 68.544  -25.583 67.878  1.00 46.47  ? 338  GLU C C     1 
ATOM   6192  O  O     . GLU C  2  338  ? 68.811  -25.619 66.678  1.00 56.49  ? 338  GLU C O     1 
ATOM   6193  C  CB    . GLU C  2  338  ? 67.241  -27.459 68.944  1.00 45.32  ? 338  GLU C CB    1 
ATOM   6194  C  CG    . GLU C  2  338  ? 66.465  -27.722 67.671  1.00 46.50  ? 338  GLU C CG    1 
ATOM   6195  C  CD    . GLU C  2  338  ? 65.248  -28.596 67.901  1.00 49.66  ? 338  GLU C CD    1 
ATOM   6196  O  OE1   . GLU C  2  338  ? 65.162  -29.223 68.980  1.00 50.70  ? 338  GLU C OE1   1 
ATOM   6197  O  OE2   . GLU C  2  338  ? 64.381  -28.654 67.002  1.00 55.51  ? 338  GLU C OE2   1 
ATOM   6198  N  N     . LEU C  2  339  ? 68.190  -24.466 68.508  1.00 44.98  ? 339  LEU C N     1 
ATOM   6199  C  CA    . LEU C  2  339  ? 68.052  -23.185 67.822  1.00 43.90  ? 339  LEU C CA    1 
ATOM   6200  C  C     . LEU C  2  339  ? 69.393  -22.715 67.270  1.00 46.44  ? 339  LEU C C     1 
ATOM   6201  O  O     . LEU C  2  339  ? 69.541  -22.417 66.061  1.00 52.79  ? 339  LEU C O     1 
ATOM   6202  C  CB    . LEU C  2  339  ? 67.494  -22.137 68.790  1.00 46.28  ? 339  LEU C CB    1 
ATOM   6203  C  CG    . LEU C  2  339  ? 66.171  -22.501 69.471  1.00 45.71  ? 339  LEU C CG    1 
ATOM   6204  C  CD1   . LEU C  2  339  ? 65.828  -21.520 70.592  1.00 40.48  ? 339  LEU C CD1   1 
ATOM   6205  C  CD2   . LEU C  2  339  ? 65.049  -22.581 68.445  1.00 37.85  ? 339  LEU C CD2   1 
ATOM   6206  N  N     . MET C  2  340  ? 70.372  -22.655 68.166  1.00 46.78  ? 340  MET C N     1 
ATOM   6207  C  CA    . MET C  2  340  ? 71.723  -22.273 67.787  1.00 49.44  ? 340  MET C CA    1 
ATOM   6208  C  C     . MET C  2  340  ? 72.252  -23.171 66.662  1.00 49.28  ? 340  MET C C     1 
ATOM   6209  O  O     . MET C  2  340  ? 72.814  -22.686 65.682  1.00 49.78  ? 340  MET C O     1 
ATOM   6210  C  CB    . MET C  2  340  ? 72.650  -22.314 69.003  1.00 46.26  ? 340  MET C CB    1 
ATOM   6211  C  CG    . MET C  2  340  ? 74.088  -21.936 68.701  1.00 51.16  ? 340  MET C CG    1 
ATOM   6212  S  SD    . MET C  2  340  ? 75.085  -23.312 68.094  1.00 50.76  ? 340  MET C SD    1 
ATOM   6213  C  CE    . MET C  2  340  ? 76.517  -22.427 67.496  1.00 58.84  ? 340  MET C CE    1 
ATOM   6214  N  N     . THR C  2  341  ? 72.061  -24.477 66.812  1.00 45.89  ? 341  THR C N     1 
ATOM   6215  C  CA    . THR C  2  341  ? 72.507  -25.445 65.819  1.00 48.68  ? 341  THR C CA    1 
ATOM   6216  C  C     . THR C  2  341  ? 71.837  -25.214 64.469  1.00 55.04  ? 341  THR C C     1 
ATOM   6217  O  O     . THR C  2  341  ? 72.467  -25.386 63.424  1.00 56.30  ? 341  THR C O     1 
ATOM   6218  C  CB    . THR C  2  341  ? 72.256  -26.893 66.289  1.00 49.45  ? 341  THR C CB    1 
ATOM   6219  O  OG1   . THR C  2  341  ? 73.070  -27.167 67.435  1.00 42.45  ? 341  THR C OG1   1 
ATOM   6220  C  CG2   . THR C  2  341  ? 72.588  -27.895 65.190  1.00 52.64  ? 341  THR C CG2   1 
ATOM   6221  N  N     . ASP C  2  342  ? 70.566  -24.824 64.490  1.00 50.02  ? 342  ASP C N     1 
ATOM   6222  C  CA    . ASP C  2  342  ? 69.876  -24.468 63.257  1.00 53.26  ? 342  ASP C CA    1 
ATOM   6223  C  C     . ASP C  2  342  ? 70.578  -23.310 62.551  1.00 50.72  ? 342  ASP C C     1 
ATOM   6224  O  O     . ASP C  2  342  ? 70.865  -23.376 61.345  1.00 53.85  ? 342  ASP C O     1 
ATOM   6225  C  CB    . ASP C  2  342  ? 68.420  -24.103 63.532  1.00 60.46  ? 342  ASP C CB    1 
ATOM   6226  C  CG    . ASP C  2  342  ? 67.451  -25.079 62.907  1.00 82.57  ? 342  ASP C CG    1 
ATOM   6227  O  OD1   . ASP C  2  342  ? 67.641  -26.299 63.100  1.00 97.81  ? 342  ASP C OD1   1 
ATOM   6228  O  OD2   . ASP C  2  342  ? 66.510  -24.629 62.216  1.00 82.22  ? 342  ASP C OD2   1 
ATOM   6229  N  N     . GLN C  2  343  ? 70.864  -22.246 63.295  1.00 48.14  ? 343  GLN C N     1 
ATOM   6230  C  CA    . GLN C  2  343  ? 71.537  -21.114 62.655  1.00 52.21  ? 343  GLN C CA    1 
ATOM   6231  C  C     . GLN C  2  343  ? 72.941  -21.470 62.158  1.00 54.26  ? 343  GLN C C     1 
ATOM   6232  O  O     . GLN C  2  343  ? 73.394  -20.990 61.102  1.00 53.31  ? 343  GLN C O     1 
ATOM   6233  C  CB    . GLN C  2  343  ? 71.545  -19.882 63.562  1.00 46.67  ? 343  GLN C CB    1 
ATOM   6234  C  CG    . GLN C  2  343  ? 70.173  -19.249 63.669  1.00 50.86  ? 343  GLN C CG    1 
ATOM   6235  C  CD    . GLN C  2  343  ? 69.451  -19.210 62.328  1.00 53.37  ? 343  GLN C CD    1 
ATOM   6236  O  OE1   . GLN C  2  343  ? 69.801  -18.427 61.439  1.00 53.70  ? 343  GLN C OE1   1 
ATOM   6237  N  NE2   . GLN C  2  343  ? 68.445  -20.068 62.172  1.00 44.00  ? 343  GLN C NE2   1 
ATOM   6238  N  N     . PHE C  2  344  ? 73.606  -22.333 62.919  1.00 51.53  ? 344  PHE C N     1 
ATOM   6239  C  CA    . PHE C  2  344  ? 74.916  -22.858 62.562  1.00 52.05  ? 344  PHE C CA    1 
ATOM   6240  C  C     . PHE C  2  344  ? 74.831  -23.589 61.220  1.00 53.18  ? 344  PHE C C     1 
ATOM   6241  O  O     . PHE C  2  344  ? 75.667  -23.391 60.337  1.00 54.25  ? 344  PHE C O     1 
ATOM   6242  C  CB    . PHE C  2  344  ? 75.418  -23.800 63.666  1.00 53.90  ? 344  PHE C CB    1 
ATOM   6243  C  CG    . PHE C  2  344  ? 76.862  -24.201 63.523  1.00 54.61  ? 344  PHE C CG    1 
ATOM   6244  C  CD1   . PHE C  2  344  ? 77.216  -25.346 62.825  1.00 54.19  ? 344  PHE C CD1   1 
ATOM   6245  C  CD2   . PHE C  2  344  ? 77.865  -23.438 64.093  1.00 51.00  ? 344  PHE C CD2   1 
ATOM   6246  C  CE1   . PHE C  2  344  ? 78.541  -25.715 62.691  1.00 48.68  ? 344  PHE C CE1   1 
ATOM   6247  C  CE2   . PHE C  2  344  ? 79.191  -23.802 63.960  1.00 51.19  ? 344  PHE C CE2   1 
ATOM   6248  C  CZ    . PHE C  2  344  ? 79.528  -24.942 63.258  1.00 49.98  ? 344  PHE C CZ    1 
ATOM   6249  N  N     . ARG C  2  345  ? 73.801  -24.417 61.073  1.00 52.17  ? 345  ARG C N     1 
ATOM   6250  C  CA    . ARG C  2  345  ? 73.576  -25.178 59.851  1.00 48.47  ? 345  ARG C CA    1 
ATOM   6251  C  C     . ARG C  2  345  ? 73.349  -24.257 58.660  1.00 52.60  ? 345  ARG C C     1 
ATOM   6252  O  O     . ARG C  2  345  ? 73.861  -24.506 57.565  1.00 59.27  ? 345  ARG C O     1 
ATOM   6253  C  CB    . ARG C  2  345  ? 72.391  -26.121 60.031  1.00 50.36  ? 345  ARG C CB    1 
ATOM   6254  C  CG    . ARG C  2  345  ? 71.950  -26.825 58.769  1.00 60.25  ? 345  ARG C CG    1 
ATOM   6255  C  CD    . ARG C  2  345  ? 70.936  -27.916 59.074  1.00 81.96  ? 345  ARG C CD    1 
ATOM   6256  N  NE    . ARG C  2  345  ? 71.483  -28.945 59.958  1.00 95.70  ? 345  ARG C NE    1 
ATOM   6257  C  CZ    . ARG C  2  345  ? 71.181  -29.070 61.250  1.00 91.75  ? 345  ARG C CZ    1 
ATOM   6258  N  NH1   . ARG C  2  345  ? 70.325  -28.230 61.819  1.00 86.79  ? 345  ARG C NH1   1 
ATOM   6259  N  NH2   . ARG C  2  345  ? 71.732  -30.039 61.975  1.00 71.02  ? 345  ARG C NH2   1 
ATOM   6260  N  N     . VAL C  2  346  ? 72.591  -23.188 58.878  1.00 51.07  ? 346  VAL C N     1 
ATOM   6261  C  CA    . VAL C  2  346  ? 72.378  -22.189 57.828  1.00 52.10  ? 346  VAL C CA    1 
ATOM   6262  C  C     . VAL C  2  346  ? 73.684  -21.513 57.363  1.00 51.77  ? 346  VAL C C     1 
ATOM   6263  O  O     . VAL C  2  346  ? 74.004  -21.493 56.156  1.00 52.32  ? 346  VAL C O     1 
ATOM   6264  C  CB    . VAL C  2  346  ? 71.346  -21.140 58.278  1.00 44.02  ? 346  VAL C CB    1 
ATOM   6265  C  CG1   . VAL C  2  346  ? 71.406  -19.907 57.408  1.00 46.25  ? 346  VAL C CG1   1 
ATOM   6266  C  CG2   . VAL C  2  346  ? 69.969  -21.747 58.256  1.00 41.13  ? 346  VAL C CG2   1 
ATOM   6267  N  N     . GLY C  2  347  ? 74.440  -20.975 58.318  1.00 52.22  ? 347  GLY C N     1 
ATOM   6268  C  CA    . GLY C  2  347  ? 75.719  -20.360 58.000  1.00 53.03  ? 347  GLY C CA    1 
ATOM   6269  C  C     . GLY C  2  347  ? 76.660  -21.326 57.302  1.00 56.46  ? 347  GLY C C     1 
ATOM   6270  O  O     . GLY C  2  347  ? 77.442  -20.940 56.425  1.00 57.08  ? 347  GLY C O     1 
ATOM   6271  N  N     . LEU C  2  348  ? 76.568  -22.596 57.683  1.00 54.19  ? 348  LEU C N     1 
ATOM   6272  C  CA    . LEU C  2  348  ? 77.404  -23.642 57.104  1.00 55.32  ? 348  LEU C CA    1 
ATOM   6273  C  C     . LEU C  2  348  ? 77.033  -23.916 55.649  1.00 55.82  ? 348  LEU C C     1 
ATOM   6274  O  O     . LEU C  2  348  ? 77.907  -24.086 54.801  1.00 53.85  ? 348  LEU C O     1 
ATOM   6275  C  CB    . LEU C  2  348  ? 77.298  -24.927 57.929  1.00 54.78  ? 348  LEU C CB    1 
ATOM   6276  C  CG    . LEU C  2  348  ? 78.603  -25.658 58.247  1.00 48.89  ? 348  LEU C CG    1 
ATOM   6277  C  CD1   . LEU C  2  348  ? 79.630  -24.683 58.796  1.00 47.44  ? 348  LEU C CD1   1 
ATOM   6278  C  CD2   . LEU C  2  348  ? 78.361  -26.801 59.233  1.00 45.87  ? 348  LEU C CD2   1 
ATOM   6279  N  N     . ALA C  2  349  ? 75.736  -23.971 55.365  1.00 57.72  ? 349  ALA C N     1 
ATOM   6280  C  CA    . ALA C  2  349  ? 75.278  -24.141 53.990  1.00 57.87  ? 349  ALA C CA    1 
ATOM   6281  C  C     . ALA C  2  349  ? 75.745  -22.981 53.110  1.00 58.26  ? 349  ALA C C     1 
ATOM   6282  O  O     . ALA C  2  349  ? 76.158  -23.186 51.961  1.00 65.11  ? 349  ALA C O     1 
ATOM   6283  C  CB    . ALA C  2  349  ? 73.765  -24.277 53.938  1.00 56.80  ? 349  ALA C CB    1 
ATOM   6284  N  N     . ARG C  2  350  ? 75.690  -21.765 53.647  1.00 53.58  ? 350  ARG C N     1 
ATOM   6285  C  CA    . ARG C  2  350  ? 76.196  -20.612 52.895  1.00 60.68  ? 350  ARG C CA    1 
ATOM   6286  C  C     . ARG C  2  350  ? 77.707  -20.690 52.622  1.00 68.32  ? 350  ARG C C     1 
ATOM   6287  O  O     . ARG C  2  350  ? 78.168  -20.456 51.486  1.00 72.76  ? 350  ARG C O     1 
ATOM   6288  C  CB    . ARG C  2  350  ? 75.836  -19.316 53.609  1.00 53.96  ? 350  ARG C CB    1 
ATOM   6289  C  CG    . ARG C  2  350  ? 74.344  -19.126 53.721  1.00 58.13  ? 350  ARG C CG    1 
ATOM   6290  C  CD    . ARG C  2  350  ? 73.998  -18.014 54.671  1.00 66.61  ? 350  ARG C CD    1 
ATOM   6291  N  NE    . ARG C  2  350  ? 72.556  -17.820 54.754  1.00 69.66  ? 350  ARG C NE    1 
ATOM   6292  C  CZ    . ARG C  2  350  ? 71.964  -17.067 55.673  1.00 73.94  ? 350  ARG C CZ    1 
ATOM   6293  N  NH1   . ARG C  2  350  ? 72.698  -16.447 56.592  1.00 68.32  ? 350  ARG C NH1   1 
ATOM   6294  N  NH2   . ARG C  2  350  ? 70.642  -16.945 55.681  1.00 74.24  ? 350  ARG C NH2   1 
ATOM   6295  N  N     . LEU C  2  351  ? 78.467  -21.025 53.663  1.00 65.81  ? 351  LEU C N     1 
ATOM   6296  C  CA    . LEU C  2  351  ? 79.903  -21.262 53.528  1.00 60.05  ? 351  LEU C CA    1 
ATOM   6297  C  C     . LEU C  2  351  ? 80.187  -22.306 52.450  1.00 63.11  ? 351  LEU C C     1 
ATOM   6298  O  O     . LEU C  2  351  ? 81.142  -22.174 51.681  1.00 69.70  ? 351  LEU C O     1 
ATOM   6299  C  CB    . LEU C  2  351  ? 80.489  -21.710 54.867  1.00 65.63  ? 351  LEU C CB    1 
ATOM   6300  C  CG    . LEU C  2  351  ? 81.968  -22.087 54.951  1.00 64.12  ? 351  LEU C CG    1 
ATOM   6301  C  CD1   . LEU C  2  351  ? 82.545  -21.609 56.278  1.00 58.78  ? 351  LEU C CD1   1 
ATOM   6302  C  CD2   . LEU C  2  351  ? 82.159  -23.593 54.803  1.00 53.38  ? 351  LEU C CD2   1 
ATOM   6303  N  N     . ALA C  2  352  ? 79.346  -23.337 52.398  1.00 60.41  ? 352  ALA C N     1 
ATOM   6304  C  CA    . ALA C  2  352  ? 79.460  -24.383 51.386  1.00 61.53  ? 352  ALA C CA    1 
ATOM   6305  C  C     . ALA C  2  352  ? 79.199  -23.856 49.976  1.00 72.83  ? 352  ALA C C     1 
ATOM   6306  O  O     . ALA C  2  352  ? 79.890  -24.245 49.031  1.00 77.55  ? 352  ALA C O     1 
ATOM   6307  C  CB    . ALA C  2  352  ? 78.528  -25.538 51.700  1.00 55.50  ? 352  ALA C CB    1 
ATOM   6308  N  N     . ARG C  2  353  ? 78.198  -22.987 49.831  1.00 75.18  ? 353  ARG C N     1 
ATOM   6309  C  CA    . ARG C  2  353  ? 77.953  -22.317 48.552  1.00 71.46  ? 353  ARG C CA    1 
ATOM   6310  C  C     . ARG C  2  353  ? 79.215  -21.583 48.089  1.00 71.82  ? 353  ARG C C     1 
ATOM   6311  O  O     . ARG C  2  353  ? 79.634  -21.705 46.927  1.00 76.22  ? 353  ARG C O     1 
ATOM   6312  C  CB    . ARG C  2  353  ? 76.779  -21.338 48.659  1.00 74.57  ? 353  ARG C CB    1 
ATOM   6313  C  CG    . ARG C  2  353  ? 76.408  -20.672 47.341  1.00 93.79  ? 353  ARG C CG    1 
ATOM   6314  C  CD    . ARG C  2  353  ? 76.404  -19.146 47.433  1.00 102.54 ? 353  ARG C CD    1 
ATOM   6315  N  NE    . ARG C  2  353  ? 76.397  -18.528 46.104  1.00 121.56 ? 353  ARG C NE    1 
ATOM   6316  C  CZ    . ARG C  2  353  ? 76.263  -17.224 45.876  1.00 115.06 ? 353  ARG C CZ    1 
ATOM   6317  N  NH1   . ARG C  2  353  ? 76.115  -16.381 46.892  1.00 107.96 ? 353  ARG C NH1   1 
ATOM   6318  N  NH2   . ARG C  2  353  ? 76.270  -16.762 44.629  1.00 87.65  ? 353  ARG C NH2   1 
ATOM   6319  N  N     . GLY C  2  354  ? 79.828  -20.837 49.009  1.00 68.35  ? 354  GLY C N     1 
ATOM   6320  C  CA    . GLY C  2  354  ? 81.083  -20.155 48.720  1.00 69.79  ? 354  GLY C CA    1 
ATOM   6321  C  C     . GLY C  2  354  ? 82.218  -21.087 48.310  1.00 72.44  ? 354  GLY C C     1 
ATOM   6322  O  O     . GLY C  2  354  ? 83.001  -20.784 47.401  1.00 67.01  ? 354  GLY C O     1 
ATOM   6323  N  N     . VAL C  2  355  ? 82.313  -22.225 48.990  1.00 75.89  ? 355  VAL C N     1 
ATOM   6324  C  CA    . VAL C  2  355  ? 83.306  -23.238 48.649  1.00 70.22  ? 355  VAL C CA    1 
ATOM   6325  C  C     . VAL C  2  355  ? 83.108  -23.739 47.226  1.00 72.84  ? 355  VAL C C     1 
ATOM   6326  O  O     . VAL C  2  355  ? 84.048  -23.747 46.438  1.00 82.84  ? 355  VAL C O     1 
ATOM   6327  C  CB    . VAL C  2  355  ? 83.263  -24.431 49.628  1.00 66.82  ? 355  VAL C CB    1 
ATOM   6328  C  CG1   . VAL C  2  355  ? 83.954  -25.647 49.034  1.00 68.39  ? 355  VAL C CG1   1 
ATOM   6329  C  CG2   . VAL C  2  355  ? 83.900  -24.045 50.944  1.00 68.88  ? 355  VAL C CG2   1 
ATOM   6330  N  N     . ARG C  2  356  ? 81.885  -24.147 46.899  1.00 74.07  ? 356  ARG C N     1 
ATOM   6331  C  CA    . ARG C  2  356  ? 81.575  -24.624 45.554  1.00 73.41  ? 356  ARG C CA    1 
ATOM   6332  C  C     . ARG C  2  356  ? 81.888  -23.583 44.485  1.00 77.56  ? 356  ARG C C     1 
ATOM   6333  O  O     . ARG C  2  356  ? 82.385  -23.924 43.409  1.00 78.73  ? 356  ARG C O     1 
ATOM   6334  C  CB    . ARG C  2  356  ? 80.117  -25.083 45.443  1.00 67.26  ? 356  ARG C CB    1 
ATOM   6335  C  CG    . ARG C  2  356  ? 79.934  -26.550 45.757  1.00 76.69  ? 356  ARG C CG    1 
ATOM   6336  C  CD    . ARG C  2  356  ? 78.503  -27.016 45.588  1.00 88.32  ? 356  ARG C CD    1 
ATOM   6337  N  NE    . ARG C  2  356  ? 78.352  -28.392 46.054  1.00 96.45  ? 356  ARG C NE    1 
ATOM   6338  C  CZ    . ARG C  2  356  ? 77.900  -28.731 47.259  1.00 94.07  ? 356  ARG C CZ    1 
ATOM   6339  N  NH1   . ARG C  2  356  ? 77.533  -27.790 48.123  1.00 82.69  ? 356  ARG C NH1   1 
ATOM   6340  N  NH2   . ARG C  2  356  ? 77.804  -30.014 47.597  1.00 86.62  ? 356  ARG C NH2   1 
ATOM   6341  N  N     . GLU C  2  357  ? 81.610  -22.317 44.777  1.00 76.36  ? 357  GLU C N     1 
ATOM   6342  C  CA    . GLU C  2  357  ? 81.930  -21.279 43.806  1.00 82.34  ? 357  GLU C CA    1 
ATOM   6343  C  C     . GLU C  2  357  ? 83.439  -21.084 43.650  1.00 88.77  ? 357  GLU C C     1 
ATOM   6344  O  O     . GLU C  2  357  ? 83.916  -20.758 42.562  1.00 97.43  ? 357  GLU C O     1 
ATOM   6345  C  CB    . GLU C  2  357  ? 81.249  -19.952 44.137  1.00 94.27  ? 357  GLU C CB    1 
ATOM   6346  C  CG    . GLU C  2  357  ? 81.301  -18.969 42.975  1.00 116.57 ? 357  GLU C CG    1 
ATOM   6347  C  CD    . GLU C  2  357  ? 80.827  -17.580 43.345  1.00 131.12 ? 357  GLU C CD    1 
ATOM   6348  O  OE1   . GLU C  2  357  ? 80.131  -17.435 44.376  1.00 125.16 ? 357  GLU C OE1   1 
ATOM   6349  O  OE2   . GLU C  2  357  ? 81.158  -16.632 42.598  1.00 131.12 ? 357  GLU C OE2   1 
ATOM   6350  N  N     . ARG C  2  358  ? 84.193  -21.281 44.729  1.00 88.99  ? 358  ARG C N     1 
ATOM   6351  C  CA    . ARG C  2  358  ? 85.650  -21.158 44.647  1.00 84.13  ? 358  ARG C CA    1 
ATOM   6352  C  C     . ARG C  2  358  ? 86.301  -22.364 43.965  1.00 88.29  ? 358  ARG C C     1 
ATOM   6353  O  O     . ARG C  2  358  ? 87.463  -22.304 43.564  1.00 90.77  ? 358  ARG C O     1 
ATOM   6354  C  CB    . ARG C  2  358  ? 86.265  -20.954 46.032  1.00 77.64  ? 358  ARG C CB    1 
ATOM   6355  C  CG    . ARG C  2  358  ? 87.117  -19.700 46.163  1.00 77.23  ? 358  ARG C CG    1 
ATOM   6356  C  CD    . ARG C  2  358  ? 86.340  -18.586 46.840  1.00 81.81  ? 358  ARG C CD    1 
ATOM   6357  N  NE    . ARG C  2  358  ? 85.651  -19.085 48.027  1.00 90.16  ? 358  ARG C NE    1 
ATOM   6358  C  CZ    . ARG C  2  358  ? 84.898  -18.341 48.829  1.00 89.55  ? 358  ARG C CZ    1 
ATOM   6359  N  NH1   . ARG C  2  358  ? 84.733  -17.050 48.577  1.00 92.15  ? 358  ARG C NH1   1 
ATOM   6360  N  NH2   . ARG C  2  358  ? 84.310  -18.890 49.886  1.00 81.72  ? 358  ARG C NH2   1 
ATOM   6361  N  N     . MET C  2  359  ? 85.543  -23.449 43.825  1.00 87.75  ? 359  MET C N     1 
ATOM   6362  C  CA    . MET C  2  359  ? 86.052  -24.682 43.227  1.00 87.85  ? 359  MET C CA    1 
ATOM   6363  C  C     . MET C  2  359  ? 85.968  -24.649 41.706  1.00 100.95 ? 359  MET C C     1 
ATOM   6364  O  O     . MET C  2  359  ? 86.266  -25.638 41.033  1.00 111.68 ? 359  MET C O     1 
ATOM   6365  C  CB    . MET C  2  359  ? 85.310  -25.905 43.773  1.00 78.86  ? 359  MET C CB    1 
ATOM   6366  C  CG    . MET C  2  359  ? 85.655  -26.240 45.212  1.00 72.06  ? 359  MET C CG    1 
ATOM   6367  S  SD    . MET C  2  359  ? 85.148  -27.896 45.706  1.00 82.99  ? 359  MET C SD    1 
ATOM   6368  C  CE    . MET C  2  359  ? 83.415  -27.864 45.284  1.00 89.75  ? 359  MET C CE    1 
ATOM   6369  N  N     . LEU C  2  360  ? 85.537  -23.510 41.174  1.00 100.86 ? 360  LEU C N     1 
ATOM   6370  C  CA    . LEU C  2  360  ? 85.464  -23.296 39.731  1.00 101.48 ? 360  LEU C CA    1 
ATOM   6371  C  C     . LEU C  2  360  ? 86.518  -22.284 39.290  1.00 104.42 ? 360  LEU C C     1 
ATOM   6372  O  O     . LEU C  2  360  ? 87.402  -22.602 38.496  1.00 115.07 ? 360  LEU C O     1 
ATOM   6373  C  CB    . LEU C  2  360  ? 84.064  -22.848 39.310  1.00 98.85  ? 360  LEU C CB    1 
ATOM   6374  C  CG    . LEU C  2  360  ? 83.031  -23.941 38.999  1.00 101.05 ? 360  LEU C CG    1 
ATOM   6375  C  CD1   . LEU C  2  360  ? 82.869  -24.948 40.140  1.00 95.10  ? 360  LEU C CD1   1 
ATOM   6376  C  CD2   . LEU C  2  360  ? 81.686  -23.313 38.641  1.00 91.36  ? 360  LEU C CD2   1 
ATOM   6377  N  N     . MET C  2  361  ? 86.427  -21.068 39.819  1.00 103.38 ? 361  MET C N     1 
ATOM   6378  C  CA    . MET C  2  361  ? 87.354  -20.000 39.456  1.00 111.67 ? 361  MET C CA    1 
ATOM   6379  C  C     . MET C  2  361  ? 88.757  -20.273 39.998  1.00 121.84 ? 361  MET C C     1 
ATOM   6380  O  O     . MET C  2  361  ? 89.007  -21.313 40.609  1.00 123.02 ? 361  MET C O     1 
ATOM   6381  C  CB    . MET C  2  361  ? 86.852  -18.656 39.992  1.00 108.41 ? 361  MET C CB    1 
ATOM   6382  C  CG    . MET C  2  361  ? 85.348  -18.584 40.193  1.00 110.31 ? 361  MET C CG    1 
ATOM   6383  S  SD    . MET C  2  361  ? 84.424  -18.878 38.675  1.00 118.88 ? 361  MET C SD    1 
ATOM   6384  C  CE    . MET C  2  361  ? 85.004  -17.518 37.661  1.00 89.20  ? 361  MET C CE    1 
ATOM   6385  N  N     . GLY C  2  362  ? 89.672  -19.337 39.761  1.00 128.72 ? 362  GLY C N     1 
ATOM   6386  C  CA    . GLY C  2  362  ? 91.050  -19.484 40.198  1.00 137.70 ? 362  GLY C CA    1 
ATOM   6387  C  C     . GLY C  2  362  ? 91.741  -20.655 39.525  1.00 153.40 ? 362  GLY C C     1 
ATOM   6388  O  O     . GLY C  2  362  ? 91.250  -21.181 38.525  1.00 156.63 ? 362  GLY C O     1 
ATOM   6389  N  N     . SER C  2  363  ? 92.883  -21.067 40.067  1.00 156.95 ? 363  SER C N     1 
ATOM   6390  C  CA    . SER C  2  363  ? 93.590  -22.227 39.537  1.00 154.56 ? 363  SER C CA    1 
ATOM   6391  C  C     . SER C  2  363  ? 92.929  -23.520 40.015  1.00 152.07 ? 363  SER C C     1 
ATOM   6392  O  O     . SER C  2  363  ? 92.724  -23.716 41.214  1.00 143.22 ? 363  SER C O     1 
ATOM   6393  C  CB    . SER C  2  363  ? 95.076  -22.190 39.917  1.00 140.15 ? 363  SER C CB    1 
ATOM   6394  O  OG    . SER C  2  363  ? 95.256  -21.995 41.310  1.00 130.42 ? 363  SER C OG    1 
ATOM   6395  N  N     . GLU C  2  364  ? 92.586  -24.393 39.069  1.00 161.31 ? 364  GLU C N     1 
ATOM   6396  C  CA    . GLU C  2  364  ? 91.939  -25.668 39.382  1.00 161.37 ? 364  GLU C CA    1 
ATOM   6397  C  C     . GLU C  2  364  ? 92.915  -26.658 40.012  1.00 152.25 ? 364  GLU C C     1 
ATOM   6398  O  O     . GLU C  2  364  ? 92.520  -27.736 40.462  1.00 138.95 ? 364  GLU C O     1 
ATOM   6399  C  CB    . GLU C  2  364  ? 91.316  -26.285 38.123  1.00 160.83 ? 364  GLU C CB    1 
ATOM   6400  C  CG    . GLU C  2  364  ? 89.990  -25.664 37.700  1.00 152.68 ? 364  GLU C CG    1 
ATOM   6401  C  CD    . GLU C  2  364  ? 88.882  -25.907 38.710  1.00 143.26 ? 364  GLU C CD    1 
ATOM   6402  O  OE1   . GLU C  2  364  ? 88.640  -25.013 39.549  1.00 136.51 ? 364  GLU C OE1   1 
ATOM   6403  O  OE2   . GLU C  2  364  ? 88.254  -26.989 38.665  1.00 132.44 ? 364  GLU C OE2   1 
ATOM   6404  N  N     . ASP C  2  365  ? 94.190  -26.283 40.037  1.00 152.95 ? 365  ASP C N     1 
ATOM   6405  C  CA    . ASP C  2  365  ? 95.234  -27.152 40.563  1.00 150.12 ? 365  ASP C CA    1 
ATOM   6406  C  C     . ASP C  2  365  ? 95.652  -26.783 41.984  1.00 141.65 ? 365  ASP C C     1 
ATOM   6407  O  O     . ASP C  2  365  ? 95.512  -27.595 42.900  1.00 137.68 ? 365  ASP C O     1 
ATOM   6408  C  CB    . ASP C  2  365  ? 96.448  -27.186 39.638  1.00 147.80 ? 365  ASP C CB    1 
ATOM   6409  C  CG    . ASP C  2  365  ? 97.370  -28.344 39.946  1.00 143.73 ? 365  ASP C CG    1 
ATOM   6410  O  OD1   . ASP C  2  365  ? 96.887  -29.346 40.520  1.00 135.02 ? 365  ASP C OD1   1 
ATOM   6411  O  OD2   . ASP C  2  365  ? 98.570  -28.254 39.618  1.00 140.02 ? 365  ASP C OD2   1 
ATOM   6412  N  N     . SER C  2  366  ? 96.168  -25.570 42.177  1.00 136.96 ? 366  SER C N     1 
ATOM   6413  C  CA    . SER C  2  366  ? 96.659  -25.205 43.498  1.00 129.82 ? 366  SER C CA    1 
ATOM   6414  C  C     . SER C  2  366  ? 95.561  -24.548 44.321  1.00 126.13 ? 366  SER C C     1 
ATOM   6415  O  O     . SER C  2  366  ? 95.226  -23.378 44.129  1.00 131.37 ? 366  SER C O     1 
ATOM   6416  C  CB    . SER C  2  366  ? 97.838  -24.240 43.370  1.00 127.01 ? 366  SER C CB    1 
ATOM   6417  O  OG    . SER C  2  366  ? 98.101  -23.592 44.602  1.00 132.14 ? 366  SER C OG    1 
ATOM   6418  N  N     . LEU C  2  367  ? 95.037  -25.321 45.268  1.00 113.81 ? 367  LEU C N     1 
ATOM   6419  C  CA    . LEU C  2  367  ? 94.031  -24.866 46.212  1.00 101.80 ? 367  LEU C CA    1 
ATOM   6420  C  C     . LEU C  2  367  ? 94.240  -25.605 47.522  1.00 101.36 ? 367  LEU C C     1 
ATOM   6421  O  O     . LEU C  2  367  ? 94.426  -26.822 47.532  1.00 94.35  ? 367  LEU C O     1 
ATOM   6422  C  CB    . LEU C  2  367  ? 92.622  -25.154 45.688  1.00 91.72  ? 367  LEU C CB    1 
ATOM   6423  C  CG    . LEU C  2  367  ? 92.101  -24.334 44.506  1.00 99.01  ? 367  LEU C CG    1 
ATOM   6424  C  CD1   . LEU C  2  367  ? 90.740  -24.845 44.067  1.00 85.58  ? 367  LEU C CD1   1 
ATOM   6425  C  CD2   . LEU C  2  367  ? 92.036  -22.851 44.851  1.00 96.82  ? 367  LEU C CD2   1 
ATOM   6426  N  N     . THR C  2  368  ? 94.204  -24.878 48.629  1.00 97.82  ? 368  THR C N     1 
ATOM   6427  C  CA    . THR C  2  368  ? 94.229  -25.518 49.931  1.00 92.58  ? 368  THR C CA    1 
ATOM   6428  C  C     . THR C  2  368  ? 92.803  -25.494 50.481  1.00 85.02  ? 368  THR C C     1 
ATOM   6429  O  O     . THR C  2  368  ? 91.913  -24.921 49.850  1.00 80.33  ? 368  THR C O     1 
ATOM   6430  C  CB    . THR C  2  368  ? 95.221  -24.801 50.876  1.00 95.02  ? 368  THR C CB    1 
ATOM   6431  O  OG1   . THR C  2  368  ? 94.920  -23.402 50.924  1.00 93.82  ? 368  THR C OG1   1 
ATOM   6432  C  CG2   . THR C  2  368  ? 96.649  -24.979 50.379  1.00 89.20  ? 368  THR C CG2   1 
ATOM   6433  N  N     . PRO C  2  369  ? 92.568  -26.128 51.643  1.00 83.41  ? 369  PRO C N     1 
ATOM   6434  C  CA    . PRO C  2  369  ? 91.255  -25.903 52.250  1.00 75.79  ? 369  PRO C CA    1 
ATOM   6435  C  C     . PRO C  2  369  ? 91.133  -24.474 52.760  1.00 71.17  ? 369  PRO C C     1 
ATOM   6436  O  O     . PRO C  2  369  ? 90.034  -23.934 52.787  1.00 71.72  ? 369  PRO C O     1 
ATOM   6437  C  CB    . PRO C  2  369  ? 91.237  -26.893 53.414  1.00 73.42  ? 369  PRO C CB    1 
ATOM   6438  C  CG    . PRO C  2  369  ? 92.146  -27.984 52.981  1.00 74.63  ? 369  PRO C CG    1 
ATOM   6439  C  CD    . PRO C  2  369  ? 93.250  -27.289 52.240  1.00 80.16  ? 369  PRO C CD    1 
ATOM   6440  N  N     . ALA C  2  370  ? 92.255  -23.868 53.138  1.00 72.58  ? 370  ALA C N     1 
ATOM   6441  C  CA    . ALA C  2  370  ? 92.257  -22.497 53.640  1.00 70.66  ? 370  ALA C CA    1 
ATOM   6442  C  C     . ALA C  2  370  ? 91.846  -21.479 52.575  1.00 75.57  ? 370  ALA C C     1 
ATOM   6443  O  O     . ALA C  2  370  ? 91.262  -20.443 52.890  1.00 74.64  ? 370  ALA C O     1 
ATOM   6444  C  CB    . ALA C  2  370  ? 93.623  -22.149 54.205  1.00 75.12  ? 370  ALA C CB    1 
ATOM   6445  N  N     . LYS C  2  371  ? 92.167  -21.777 51.319  1.00 81.94  ? 371  LYS C N     1 
ATOM   6446  C  CA    . LYS C  2  371  ? 91.838  -20.899 50.200  1.00 79.75  ? 371  LYS C CA    1 
ATOM   6447  C  C     . LYS C  2  371  ? 90.380  -21.059 49.790  1.00 73.72  ? 371  LYS C C     1 
ATOM   6448  O  O     . LYS C  2  371  ? 89.760  -20.127 49.280  1.00 71.65  ? 371  LYS C O     1 
ATOM   6449  C  CB    . LYS C  2  371  ? 92.738  -21.205 48.998  1.00 87.58  ? 371  LYS C CB    1 
ATOM   6450  C  CG    . LYS C  2  371  ? 94.204  -20.827 49.159  1.00 85.97  ? 371  LYS C CG    1 
ATOM   6451  C  CD    . LYS C  2  371  ? 95.024  -21.344 47.979  1.00 102.06 ? 371  LYS C CD    1 
ATOM   6452  C  CE    . LYS C  2  371  ? 96.488  -20.937 48.078  1.00 108.85 ? 371  LYS C CE    1 
ATOM   6453  N  NZ    . LYS C  2  371  ? 96.672  -19.464 47.949  1.00 110.88 ? 371  LYS C NZ    1 
ATOM   6454  N  N     . LEU C  2  372  ? 89.849  -22.258 50.009  1.00 74.49  ? 372  LEU C N     1 
ATOM   6455  C  CA    . LEU C  2  372  ? 88.496  -22.616 49.595  1.00 70.61  ? 372  LEU C CA    1 
ATOM   6456  C  C     . LEU C  2  372  ? 87.409  -22.088 50.540  1.00 73.62  ? 372  LEU C C     1 
ATOM   6457  O  O     . LEU C  2  372  ? 86.274  -21.838 50.122  1.00 69.98  ? 372  LEU C O     1 
ATOM   6458  C  CB    . LEU C  2  372  ? 88.389  -24.139 49.487  1.00 68.63  ? 372  LEU C CB    1 
ATOM   6459  C  CG    . LEU C  2  372  ? 87.980  -24.721 48.138  1.00 72.96  ? 372  LEU C CG    1 
ATOM   6460  C  CD1   . LEU C  2  372  ? 88.661  -23.962 47.024  1.00 80.19  ? 372  LEU C CD1   1 
ATOM   6461  C  CD2   . LEU C  2  372  ? 88.331  -26.201 48.069  1.00 69.87  ? 372  LEU C CD2   1 
ATOM   6462  N  N     . VAL C  2  373  ? 87.763  -21.917 51.811  1.00 72.78  ? 373  VAL C N     1 
ATOM   6463  C  CA    . VAL C  2  373  ? 86.784  -21.601 52.849  1.00 64.05  ? 373  VAL C CA    1 
ATOM   6464  C  C     . VAL C  2  373  ? 86.795  -20.140 53.298  1.00 65.15  ? 373  VAL C C     1 
ATOM   6465  O  O     . VAL C  2  373  ? 87.830  -19.597 53.682  1.00 66.37  ? 373  VAL C O     1 
ATOM   6466  C  CB    . VAL C  2  373  ? 86.951  -22.525 54.080  1.00 57.25  ? 373  VAL C CB    1 
ATOM   6467  C  CG1   . VAL C  2  373  ? 86.275  -21.932 55.298  1.00 59.05  ? 373  VAL C CG1   1 
ATOM   6468  C  CG2   . VAL C  2  373  ? 86.395  -23.910 53.783  1.00 56.19  ? 373  VAL C CG2   1 
ATOM   6469  N  N     . ASN C  2  374  ? 85.625  -19.514 53.222  1.00 67.86  ? 374  ASN C N     1 
ATOM   6470  C  CA    . ASN C  2  374  ? 85.388  -18.212 53.823  1.00 64.12  ? 374  ASN C CA    1 
ATOM   6471  C  C     . ASN C  2  374  ? 84.376  -18.395 54.950  1.00 64.73  ? 374  ASN C C     1 
ATOM   6472  O  O     . ASN C  2  374  ? 83.252  -18.838 54.718  1.00 65.50  ? 374  ASN C O     1 
ATOM   6473  C  CB    . ASN C  2  374  ? 84.868  -17.218 52.783  1.00 62.26  ? 374  ASN C CB    1 
ATOM   6474  C  CG    . ASN C  2  374  ? 84.707  -15.822 53.344  1.00 63.73  ? 374  ASN C CG    1 
ATOM   6475  O  OD1   . ASN C  2  374  ? 85.129  -15.542 54.460  1.00 69.28  ? 374  ASN C OD1   1 
ATOM   6476  N  ND2   . ASN C  2  374  ? 84.098  -14.937 52.570  1.00 63.69  ? 374  ASN C ND2   1 
ATOM   6477  N  N     . SER C  2  375  ? 84.781  -18.069 56.171  1.00 60.80  ? 375  SER C N     1 
ATOM   6478  C  CA    . SER C  2  375  ? 83.958  -18.354 57.340  1.00 63.35  ? 375  SER C CA    1 
ATOM   6479  C  C     . SER C  2  375  ? 82.984  -17.225 57.682  1.00 65.64  ? 375  SER C C     1 
ATOM   6480  O  O     . SER C  2  375  ? 82.139  -17.380 58.567  1.00 67.05  ? 375  SER C O     1 
ATOM   6481  C  CB    . SER C  2  375  ? 84.838  -18.677 58.553  1.00 59.65  ? 375  SER C CB    1 
ATOM   6482  O  OG    . SER C  2  375  ? 85.530  -17.526 59.010  1.00 63.12  ? 375  SER C OG    1 
ATOM   6483  N  N     . ARG C  2  376  ? 83.103  -16.100 56.980  1.00 64.63  ? 376  ARG C N     1 
ATOM   6484  C  CA    . ARG C  2  376  ? 82.238  -14.942 57.226  1.00 63.85  ? 376  ARG C CA    1 
ATOM   6485  C  C     . ARG C  2  376  ? 80.730  -15.248 57.310  1.00 59.89  ? 376  ARG C C     1 
ATOM   6486  O  O     . ARG C  2  376  ? 80.083  -14.779 58.241  1.00 55.05  ? 376  ARG C O     1 
ATOM   6487  C  CB    . ARG C  2  376  ? 82.513  -13.799 56.232  1.00 62.86  ? 376  ARG C CB    1 
ATOM   6488  C  CG    . ARG C  2  376  ? 83.921  -13.229 56.285  1.00 66.52  ? 376  ARG C CG    1 
ATOM   6489  C  CD    . ARG C  2  376  ? 84.373  -12.954 57.708  1.00 65.94  ? 376  ARG C CD    1 
ATOM   6490  N  NE    . ARG C  2  376  ? 85.660  -12.264 57.750  1.00 66.63  ? 376  ARG C NE    1 
ATOM   6491  C  CZ    . ARG C  2  376  ? 86.374  -12.075 58.854  1.00 71.01  ? 376  ARG C CZ    1 
ATOM   6492  N  NH1   . ARG C  2  376  ? 85.938  -12.535 60.017  1.00 75.64  ? 376  ARG C NH1   1 
ATOM   6493  N  NH2   . ARG C  2  376  ? 87.532  -11.431 58.797  1.00 71.55  ? 376  ARG C NH2   1 
ATOM   6494  N  N     . PRO C  2  377  ? 80.170  -16.025 56.352  1.00 58.17  ? 377  PRO C N     1 
ATOM   6495  C  CA    . PRO C  2  377  ? 78.752  -16.405 56.436  1.00 57.89  ? 377  PRO C CA    1 
ATOM   6496  C  C     . PRO C  2  377  ? 78.362  -17.140 57.722  1.00 60.10  ? 377  PRO C C     1 
ATOM   6497  O  O     . PRO C  2  377  ? 77.271  -16.918 58.257  1.00 57.34  ? 377  PRO C O     1 
ATOM   6498  C  CB    . PRO C  2  377  ? 78.581  -17.348 55.244  1.00 56.72  ? 377  PRO C CB    1 
ATOM   6499  C  CG    . PRO C  2  377  ? 79.561  -16.874 54.273  1.00 55.82  ? 377  PRO C CG    1 
ATOM   6500  C  CD    . PRO C  2  377  ? 80.753  -16.461 55.071  1.00 54.97  ? 377  PRO C CD    1 
ATOM   6501  N  N     . LEU C  2  378  ? 79.240  -18.015 58.198  1.00 63.22  ? 378  LEU C N     1 
ATOM   6502  C  CA    . LEU C  2  378  ? 78.983  -18.773 59.414  1.00 54.56  ? 378  LEU C CA    1 
ATOM   6503  C  C     . LEU C  2  378  ? 78.989  -17.850 60.627  1.00 49.90  ? 378  LEU C C     1 
ATOM   6504  O  O     . LEU C  2  378  ? 78.057  -17.859 61.448  1.00 52.11  ? 378  LEU C O     1 
ATOM   6505  C  CB    . LEU C  2  378  ? 80.040  -19.862 59.574  1.00 52.51  ? 378  LEU C CB    1 
ATOM   6506  C  CG    . LEU C  2  378  ? 79.897  -20.791 60.778  1.00 58.58  ? 378  LEU C CG    1 
ATOM   6507  C  CD1   . LEU C  2  378  ? 78.543  -21.492 60.778  1.00 56.43  ? 378  LEU C CD1   1 
ATOM   6508  C  CD2   . LEU C  2  378  ? 81.031  -21.800 60.786  1.00 59.76  ? 378  LEU C CD2   1 
ATOM   6509  N  N     . GLU C  2  379  ? 80.049  -17.053 60.728  1.00 52.79  ? 379  GLU C N     1 
ATOM   6510  C  CA    . GLU C  2  379  ? 80.196  -16.085 61.806  1.00 57.75  ? 379  GLU C CA    1 
ATOM   6511  C  C     . GLU C  2  379  ? 78.990  -15.162 61.840  1.00 59.06  ? 379  GLU C C     1 
ATOM   6512  O  O     . GLU C  2  379  ? 78.470  -14.837 62.906  1.00 59.00  ? 379  GLU C O     1 
ATOM   6513  C  CB    . GLU C  2  379  ? 81.461  -15.249 61.614  1.00 58.53  ? 379  GLU C CB    1 
ATOM   6514  C  CG    . GLU C  2  379  ? 82.754  -16.044 61.563  1.00 61.18  ? 379  GLU C CG    1 
ATOM   6515  C  CD    . GLU C  2  379  ? 83.969  -15.162 61.298  1.00 77.86  ? 379  GLU C CD    1 
ATOM   6516  O  OE1   . GLU C  2  379  ? 84.489  -15.179 60.157  1.00 70.77  ? 379  GLU C OE1   1 
ATOM   6517  O  OE2   . GLU C  2  379  ? 84.405  -14.452 62.232  1.00 82.56  ? 379  GLU C OE2   1 
ATOM   6518  N  N     . ALA C  2  380  ? 78.544  -14.755 60.658  1.00 57.96  ? 380  ALA C N     1 
ATOM   6519  C  CA    . ALA C  2  380  ? 77.417  -13.847 60.537  1.00 52.28  ? 380  ALA C CA    1 
ATOM   6520  C  C     . ALA C  2  380  ? 76.109  -14.501 60.971  1.00 54.62  ? 380  ALA C C     1 
ATOM   6521  O  O     . ALA C  2  380  ? 75.323  -13.880 61.675  1.00 55.03  ? 380  ALA C O     1 
ATOM   6522  C  CB    . ALA C  2  380  ? 77.305  -13.319 59.129  1.00 43.76  ? 380  ALA C CB    1 
ATOM   6523  N  N     . ALA C  2  381  ? 75.873  -15.745 60.558  1.00 51.33  ? 381  ALA C N     1 
ATOM   6524  C  CA    . ALA C  2  381  ? 74.662  -16.457 60.977  1.00 48.70  ? 381  ALA C CA    1 
ATOM   6525  C  C     . ALA C  2  381  ? 74.585  -16.618 62.498  1.00 50.72  ? 381  ALA C C     1 
ATOM   6526  O  O     . ALA C  2  381  ? 73.522  -16.432 63.103  1.00 53.19  ? 381  ALA C O     1 
ATOM   6527  C  CB    . ALA C  2  381  ? 74.566  -17.811 60.297  1.00 44.53  ? 381  ALA C CB    1 
ATOM   6528  N  N     . ILE C  2  382  ? 75.711  -16.955 63.117  1.00 51.16  ? 382  ILE C N     1 
ATOM   6529  C  CA    . ILE C  2  382  ? 75.726  -17.115 64.566  1.00 49.59  ? 382  ILE C CA    1 
ATOM   6530  C  C     . ILE C  2  382  ? 75.593  -15.775 65.298  1.00 50.70  ? 382  ILE C C     1 
ATOM   6531  O  O     . ILE C  2  382  ? 74.821  -15.645 66.258  1.00 46.98  ? 382  ILE C O     1 
ATOM   6532  C  CB    . ILE C  2  382  ? 76.979  -17.861 65.037  1.00 49.07  ? 382  ILE C CB    1 
ATOM   6533  C  CG1   . ILE C  2  382  ? 76.989  -19.273 64.464  1.00 52.16  ? 382  ILE C CG1   1 
ATOM   6534  C  CG2   . ILE C  2  382  ? 77.017  -17.940 66.547  1.00 47.17  ? 382  ILE C CG2   1 
ATOM   6535  C  CD1   . ILE C  2  382  ? 78.332  -19.950 64.578  1.00 59.99  ? 382  ILE C CD1   1 
ATOM   6536  N  N     . ARG C  2  383  ? 76.335  -14.776 64.836  1.00 53.95  ? 383  ARG C N     1 
ATOM   6537  C  CA    . ARG C  2  383  ? 76.278  -13.448 65.438  1.00 59.77  ? 383  ARG C CA    1 
ATOM   6538  C  C     . ARG C  2  383  ? 74.870  -12.869 65.319  1.00 59.29  ? 383  ARG C C     1 
ATOM   6539  O  O     . ARG C  2  383  ? 74.394  -12.167 66.212  1.00 54.61  ? 383  ARG C O     1 
ATOM   6540  C  CB    . ARG C  2  383  ? 77.300  -12.517 64.783  1.00 53.01  ? 383  ARG C CB    1 
ATOM   6541  C  CG    . ARG C  2  383  ? 77.403  -11.147 65.429  1.00 56.75  ? 383  ARG C CG    1 
ATOM   6542  C  CD    . ARG C  2  383  ? 78.571  -10.355 64.869  1.00 70.45  ? 383  ARG C CD    1 
ATOM   6543  N  NE    . ARG C  2  383  ? 78.580  -10.372 63.408  1.00 93.46  ? 383  ARG C NE    1 
ATOM   6544  C  CZ    . ARG C  2  383  ? 79.489  -11.006 62.670  1.00 86.75  ? 383  ARG C CZ    1 
ATOM   6545  N  NH1   . ARG C  2  383  ? 80.480  -11.670 63.258  1.00 70.87  ? 383  ARG C NH1   1 
ATOM   6546  N  NH2   . ARG C  2  383  ? 79.409  -10.971 61.344  1.00 75.65  ? 383  ARG C NH2   1 
ATOM   6547  N  N     . GLU C  2  384  ? 74.212  -13.192 64.209  1.00 60.45  ? 384  GLU C N     1 
ATOM   6548  C  CA    . GLU C  2  384  ? 72.842  -12.774 63.944  1.00 61.22  ? 384  GLU C CA    1 
ATOM   6549  C  C     . GLU C  2  384  ? 71.866  -13.446 64.909  1.00 54.13  ? 384  GLU C C     1 
ATOM   6550  O  O     . GLU C  2  384  ? 70.995  -12.790 65.474  1.00 59.10  ? 384  GLU C O     1 
ATOM   6551  C  CB    . GLU C  2  384  ? 72.460  -13.104 62.498  1.00 60.53  ? 384  GLU C CB    1 
ATOM   6552  C  CG    . GLU C  2  384  ? 71.109  -12.570 62.052  1.00 74.89  ? 384  GLU C CG    1 
ATOM   6553  C  CD    . GLU C  2  384  ? 71.149  -11.093 61.705  1.00 90.49  ? 384  GLU C CD    1 
ATOM   6554  O  OE1   . GLU C  2  384  ? 72.241  -10.486 61.805  1.00 87.32  ? 384  GLU C OE1   1 
ATOM   6555  O  OE2   . GLU C  2  384  ? 70.089  -10.543 61.327  1.00 90.26  ? 384  GLU C OE2   1 
ATOM   6556  N  N     . PHE C  2  385  ? 72.008  -14.755 65.088  1.00 50.73  ? 385  PHE C N     1 
ATOM   6557  C  CA    . PHE C  2  385  ? 71.167  -15.470 66.042  1.00 44.27  ? 385  PHE C CA    1 
ATOM   6558  C  C     . PHE C  2  385  ? 71.310  -14.928 67.459  1.00 45.61  ? 385  PHE C C     1 
ATOM   6559  O  O     . PHE C  2  385  ? 70.324  -14.624 68.116  1.00 46.15  ? 385  PHE C O     1 
ATOM   6560  C  CB    . PHE C  2  385  ? 71.500  -16.955 66.037  1.00 43.93  ? 385  PHE C CB    1 
ATOM   6561  C  CG    . PHE C  2  385  ? 70.784  -17.741 67.094  1.00 42.82  ? 385  PHE C CG    1 
ATOM   6562  C  CD1   . PHE C  2  385  ? 69.469  -18.123 66.921  1.00 44.23  ? 385  PHE C CD1   1 
ATOM   6563  C  CD2   . PHE C  2  385  ? 71.436  -18.114 68.256  1.00 46.54  ? 385  PHE C CD2   1 
ATOM   6564  C  CE1   . PHE C  2  385  ? 68.816  -18.856 67.889  1.00 47.22  ? 385  PHE C CE1   1 
ATOM   6565  C  CE2   . PHE C  2  385  ? 70.788  -18.844 69.228  1.00 40.04  ? 385  PHE C CE2   1 
ATOM   6566  C  CZ    . PHE C  2  385  ? 69.477  -19.215 69.044  1.00 38.81  ? 385  PHE C CZ    1 
ATOM   6567  N  N     . PHE C  2  386  ? 72.537  -14.812 67.940  1.00 49.67  ? 386  PHE C N     1 
ATOM   6568  C  CA    . PHE C  2  386  ? 72.724  -14.383 69.319  1.00 43.62  ? 386  PHE C CA    1 
ATOM   6569  C  C     . PHE C  2  386  ? 72.386  -12.910 69.557  1.00 50.17  ? 386  PHE C C     1 
ATOM   6570  O  O     . PHE C  2  386  ? 71.812  -12.569 70.591  1.00 54.12  ? 386  PHE C O     1 
ATOM   6571  C  CB    . PHE C  2  386  ? 74.128  -14.731 69.834  1.00 41.89  ? 386  PHE C CB    1 
ATOM   6572  C  CG    . PHE C  2  386  ? 74.261  -16.152 70.304  1.00 41.32  ? 386  PHE C CG    1 
ATOM   6573  C  CD1   . PHE C  2  386  ? 74.715  -17.144 69.451  1.00 39.58  ? 386  PHE C CD1   1 
ATOM   6574  C  CD2   . PHE C  2  386  ? 73.915  -16.501 71.599  1.00 44.25  ? 386  PHE C CD2   1 
ATOM   6575  C  CE1   . PHE C  2  386  ? 74.830  -18.457 69.883  1.00 40.49  ? 386  PHE C CE1   1 
ATOM   6576  C  CE2   . PHE C  2  386  ? 74.026  -17.809 72.036  1.00 37.34  ? 386  PHE C CE2   1 
ATOM   6577  C  CZ    . PHE C  2  386  ? 74.484  -18.788 71.176  1.00 38.31  ? 386  PHE C CZ    1 
ATOM   6578  N  N     . SER C  2  387  ? 72.764  -12.034 68.629  1.00 57.75  ? 387  SER C N     1 
ATOM   6579  C  CA    . SER C  2  387  ? 72.478  -10.609 68.799  1.00 58.17  ? 387  SER C CA    1 
ATOM   6580  C  C     . SER C  2  387  ? 71.042  -10.200 68.456  1.00 61.86  ? 387  SER C C     1 
ATOM   6581  O  O     . SER C  2  387  ? 70.361  -9.557  69.252  1.00 70.49  ? 387  SER C O     1 
ATOM   6582  C  CB    . SER C  2  387  ? 73.472  -9.757  68.003  1.00 63.42  ? 387  SER C CB    1 
ATOM   6583  O  OG    . SER C  2  387  ? 74.813  -10.016 68.399  1.00 53.20  ? 387  SER C OG    1 
ATOM   6584  N  N     . ARG C  2  388  ? 70.589  -10.559 67.264  1.00 58.56  ? 388  ARG C N     1 
ATOM   6585  C  CA    . ARG C  2  388  ? 69.310  -10.045 66.777  1.00 61.82  ? 388  ARG C CA    1 
ATOM   6586  C  C     . ARG C  2  388  ? 68.061  -10.936 66.831  1.00 62.64  ? 388  ARG C C     1 
ATOM   6587  O  O     . ARG C  2  388  ? 66.980  -10.479 66.459  1.00 73.23  ? 388  ARG C O     1 
ATOM   6588  C  CB    . ARG C  2  388  ? 69.483  -9.404  65.395  1.00 75.05  ? 388  ARG C CB    1 
ATOM   6589  C  CG    . ARG C  2  388  ? 70.092  -8.009  65.473  1.00 79.26  ? 388  ARG C CG    1 
ATOM   6590  C  CD    . ARG C  2  388  ? 70.642  -7.537  64.134  1.00 86.97  ? 388  ARG C CD    1 
ATOM   6591  N  NE    . ARG C  2  388  ? 71.807  -8.310  63.702  1.00 93.04  ? 388  ARG C NE    1 
ATOM   6592  C  CZ    . ARG C  2  388  ? 73.046  -8.126  64.157  1.00 93.85  ? 388  ARG C CZ    1 
ATOM   6593  N  NH1   . ARG C  2  388  ? 73.291  -7.197  65.073  1.00 94.11  ? 388  ARG C NH1   1 
ATOM   6594  N  NH2   . ARG C  2  388  ? 74.043  -8.876  63.700  1.00 83.99  ? 388  ARG C NH2   1 
ATOM   6595  N  N     . SER C  2  389  ? 68.179  -12.182 67.282  1.00 54.61  ? 389  SER C N     1 
ATOM   6596  C  CA    . SER C  2  389  ? 66.996  -13.049 67.330  1.00 51.49  ? 389  SER C CA    1 
ATOM   6597  C  C     . SER C  2  389  ? 65.981  -12.601 68.384  1.00 51.66  ? 389  SER C C     1 
ATOM   6598  O  O     . SER C  2  389  ? 66.319  -11.899 69.337  1.00 58.00  ? 389  SER C O     1 
ATOM   6599  C  CB    . SER C  2  389  ? 67.371  -14.516 67.549  1.00 50.54  ? 389  SER C CB    1 
ATOM   6600  O  OG    . SER C  2  389  ? 66.212  -15.316 67.752  1.00 54.05  ? 389  SER C OG    1 
ATOM   6601  N  N     . GLN C  2  390  ? 64.731  -13.005 68.200  1.00 48.99  ? 390  GLN C N     1 
ATOM   6602  C  CA    . GLN C  2  390  ? 63.691  -12.673 69.157  1.00 58.54  ? 390  GLN C CA    1 
ATOM   6603  C  C     . GLN C  2  390  ? 63.798  -13.580 70.377  1.00 59.81  ? 390  GLN C C     1 
ATOM   6604  O  O     . GLN C  2  390  ? 63.455  -13.186 71.494  1.00 57.94  ? 390  GLN C O     1 
ATOM   6605  C  CB    . GLN C  2  390  ? 62.304  -12.808 68.524  1.00 63.03  ? 390  GLN C CB    1 
ATOM   6606  C  CG    . GLN C  2  390  ? 61.162  -12.522 69.491  1.00 78.44  ? 390  GLN C CG    1 
ATOM   6607  C  CD    . GLN C  2  390  ? 59.807  -12.590 68.829  1.00 88.22  ? 390  GLN C CD    1 
ATOM   6608  O  OE1   . GLN C  2  390  ? 59.708  -12.804 67.618  1.00 94.60  ? 390  GLN C OE1   1 
ATOM   6609  N  NE2   . GLN C  2  390  ? 58.749  -12.406 69.618  1.00 79.50  ? 390  GLN C NE2   1 
ATOM   6610  N  N     . LEU C  2  391  ? 64.276  -14.799 70.154  1.00 53.33  ? 391  LEU C N     1 
ATOM   6611  C  CA    . LEU C  2  391  ? 64.404  -15.768 71.230  1.00 45.05  ? 391  LEU C CA    1 
ATOM   6612  C  C     . LEU C  2  391  ? 65.643  -15.476 72.067  1.00 45.83  ? 391  LEU C C     1 
ATOM   6613  O  O     . LEU C  2  391  ? 65.807  -16.029 73.162  1.00 42.89  ? 391  LEU C O     1 
ATOM   6614  C  CB    . LEU C  2  391  ? 64.431  -17.195 70.675  1.00 43.18  ? 391  LEU C CB    1 
ATOM   6615  C  CG    . LEU C  2  391  ? 63.069  -17.703 70.194  1.00 48.95  ? 391  LEU C CG    1 
ATOM   6616  C  CD1   . LEU C  2  391  ? 63.155  -19.102 69.601  1.00 40.64  ? 391  LEU C CD1   1 
ATOM   6617  C  CD2   . LEU C  2  391  ? 62.074  -17.670 71.338  1.00 47.99  ? 391  LEU C CD2   1 
ATOM   6618  N  N     . SER C  2  392  ? 66.508  -14.599 71.557  1.00 40.54  ? 392  SER C N     1 
ATOM   6619  C  CA    . SER C  2  392  ? 67.659  -14.152 72.325  1.00 41.09  ? 392  SER C CA    1 
ATOM   6620  C  C     . SER C  2  392  ? 67.283  -12.874 73.033  1.00 41.69  ? 392  SER C C     1 
ATOM   6621  O  O     . SER C  2  392  ? 67.145  -11.827 72.401  1.00 45.79  ? 392  SER C O     1 
ATOM   6622  C  CB    . SER C  2  392  ? 68.858  -13.895 71.415  1.00 45.65  ? 392  SER C CB    1 
ATOM   6623  O  OG    . SER C  2  392  ? 69.992  -13.489 72.171  1.00 42.77  ? 392  SER C OG    1 
ATOM   6624  N  N     . GLN C  2  393  ? 67.151  -12.951 74.351  1.00 40.90  ? 393  GLN C N     1 
ATOM   6625  C  CA    . GLN C  2  393  ? 66.635  -11.830 75.123  1.00 41.78  ? 393  GLN C CA    1 
ATOM   6626  C  C     . GLN C  2  393  ? 67.631  -11.301 76.136  1.00 44.36  ? 393  GLN C C     1 
ATOM   6627  O  O     . GLN C  2  393  ? 68.437  -12.054 76.678  1.00 43.10  ? 393  GLN C O     1 
ATOM   6628  C  CB    . GLN C  2  393  ? 65.345  -12.231 75.830  1.00 41.78  ? 393  GLN C CB    1 
ATOM   6629  C  CG    . GLN C  2  393  ? 64.252  -12.688 74.885  1.00 42.15  ? 393  GLN C CG    1 
ATOM   6630  C  CD    . GLN C  2  393  ? 63.086  -13.336 75.605  1.00 45.92  ? 393  GLN C CD    1 
ATOM   6631  O  OE1   . GLN C  2  393  ? 62.924  -13.198 76.826  1.00 47.05  ? 393  GLN C OE1   1 
ATOM   6632  N  NE2   . GLN C  2  393  ? 62.267  -14.058 74.851  1.00 43.68  ? 393  GLN C NE2   1 
ATOM   6633  N  N     . PHE C  2  394  ? 67.569  -9.993  76.370  1.00 44.67  ? 394  PHE C N     1 
ATOM   6634  C  CA    . PHE C  2  394  ? 68.324  -9.343  77.430  1.00 43.47  ? 394  PHE C CA    1 
ATOM   6635  C  C     . PHE C  2  394  ? 67.942  -10.074 78.717  1.00 43.41  ? 394  PHE C C     1 
ATOM   6636  O  O     . PHE C  2  394  ? 66.761  -10.187 79.041  1.00 45.09  ? 394  PHE C O     1 
ATOM   6637  C  CB    . PHE C  2  394  ? 67.890  -7.877  77.486  1.00 39.97  ? 394  PHE C CB    1 
ATOM   6638  C  CG    . PHE C  2  394  ? 68.901  -6.953  78.079  1.00 46.71  ? 394  PHE C CG    1 
ATOM   6639  C  CD1   . PHE C  2  394  ? 70.164  -6.840  77.526  1.00 53.06  ? 394  PHE C CD1   1 
ATOM   6640  C  CD2   . PHE C  2  394  ? 68.573  -6.158  79.174  1.00 50.01  ? 394  PHE C CD2   1 
ATOM   6641  C  CE1   . PHE C  2  394  ? 71.098  -5.973  78.075  1.00 61.78  ? 394  PHE C CE1   1 
ATOM   6642  C  CE2   . PHE C  2  394  ? 69.495  -5.285  79.725  1.00 48.86  ? 394  PHE C CE2   1 
ATOM   6643  C  CZ    . PHE C  2  394  ? 70.764  -5.194  79.178  1.00 54.82  ? 394  PHE C CZ    1 
ATOM   6644  N  N     . LYS C  2  395  ? 68.905  -10.585 79.452  1.00 43.06  ? 395  LYS C N     1 
ATOM   6645  C  CA    . LYS C  2  395  ? 68.580  -11.389 80.607  1.00 45.77  ? 395  LYS C CA    1 
ATOM   6646  C  C     . LYS C  2  395  ? 67.854  -10.597 81.656  1.00 47.79  ? 395  LYS C C     1 
ATOM   6647  O  O     . LYS C  2  395  ? 68.189  -9.464  81.910  1.00 47.20  ? 395  LYS C O     1 
ATOM   6648  C  CB    . LYS C  2  395  ? 69.853  -11.934 81.211  1.00 46.00  ? 395  LYS C CB    1 
ATOM   6649  C  CG    . LYS C  2  395  ? 69.687  -13.196 82.010  1.00 43.01  ? 395  LYS C CG    1 
ATOM   6650  C  CD    . LYS C  2  395  ? 70.515  -13.115 83.260  1.00 46.09  ? 395  LYS C CD    1 
ATOM   6651  C  CE    . LYS C  2  395  ? 71.684  -14.054 83.198  1.00 48.36  ? 395  LYS C CE    1 
ATOM   6652  N  NZ    . LYS C  2  395  ? 72.210  -14.294 84.559  1.00 52.79  ? 395  LYS C NZ    1 
ATOM   6653  N  N     . ASP C  2  396  ? 66.876  -11.216 82.298  1.00 46.91  ? 396  ASP C N     1 
ATOM   6654  C  CA    . ASP C  2  396  ? 66.206  -10.584 83.404  1.00 46.36  ? 396  ASP C CA    1 
ATOM   6655  C  C     . ASP C  2  396  ? 66.914  -11.017 84.646  1.00 44.86  ? 396  ASP C C     1 
ATOM   6656  O  O     . ASP C  2  396  ? 66.795  -12.134 85.065  1.00 42.22  ? 396  ASP C O     1 
ATOM   6657  C  CB    . ASP C  2  396  ? 64.763  -11.040 83.465  1.00 47.08  ? 396  ASP C CB    1 
ATOM   6658  C  CG    . ASP C  2  396  ? 63.971  -10.333 84.537  1.00 54.98  ? 396  ASP C CG    1 
ATOM   6659  O  OD1   . ASP C  2  396  ? 64.540  -9.550  85.295  1.00 47.36  ? 396  ASP C OD1   1 
ATOM   6660  O  OD2   . ASP C  2  396  ? 62.763  -10.564 84.627  1.00 54.50  ? 396  ASP C OD2   1 
ATOM   6661  N  N     . GLU C  2  397  ? 67.656  -10.111 85.245  1.00 44.00  ? 397  GLU C N     1 
ATOM   6662  C  CA    . GLU C  2  397  ? 68.375  -10.434 86.439  1.00 44.26  ? 397  GLU C CA    1 
ATOM   6663  C  C     . GLU C  2  397  ? 68.113  -9.443  87.540  1.00 49.29  ? 397  GLU C C     1 
ATOM   6664  O  O     . GLU C  2  397  ? 69.009  -9.034  88.229  1.00 54.71  ? 397  GLU C O     1 
ATOM   6665  C  CB    . GLU C  2  397  ? 69.864  -10.639 86.190  1.00 48.76  ? 397  GLU C CB    1 
ATOM   6666  C  CG    . GLU C  2  397  ? 70.547  -9.701  85.223  1.00 53.49  ? 397  GLU C CG    1 
ATOM   6667  C  CD    . GLU C  2  397  ? 72.048  -9.805  85.330  1.00 61.28  ? 397  GLU C CD    1 
ATOM   6668  O  OE1   . GLU C  2  397  ? 72.514  -10.747 85.968  1.00 72.44  ? 397  GLU C OE1   1 
ATOM   6669  O  OE2   . GLU C  2  397  ? 72.771  -8.957  84.804  1.00 59.24  ? 397  GLU C OE2   1 
ATOM   6670  N  N     . THR C  2  398  ? 66.862  -9.065  87.706  1.00 45.26  ? 398  THR C N     1 
ATOM   6671  C  CA    . THR C  2  398  ? 66.505  -8.136  88.733  1.00 44.13  ? 398  THR C CA    1 
ATOM   6672  C  C     . THR C  2  398  ? 66.884  -8.748  90.052  1.00 46.16  ? 398  THR C C     1 
ATOM   6673  O  O     . THR C  2  398  ? 67.434  -8.095  90.906  1.00 42.88  ? 398  THR C O     1 
ATOM   6674  C  CB    . THR C  2  398  ? 64.998  -7.922  88.716  1.00 45.28  ? 398  THR C CB    1 
ATOM   6675  O  OG1   . THR C  2  398  ? 64.585  -7.648  87.387  1.00 40.41  ? 398  THR C OG1   1 
ATOM   6676  C  CG2   . THR C  2  398  ? 64.622  -6.775  89.555  1.00 44.81  ? 398  THR C CG2   1 
ATOM   6677  N  N     . ASN C  2  399  ? 66.600  -10.026 90.197  1.00 44.05  ? 399  ASN C N     1 
ATOM   6678  C  CA    . ASN C  2  399  ? 66.954  -10.783 91.375  1.00 43.12  ? 399  ASN C CA    1 
ATOM   6679  C  C     . ASN C  2  399  ? 67.242  -12.182 90.907  1.00 49.41  ? 399  ASN C C     1 
ATOM   6680  O  O     . ASN C  2  399  ? 66.946  -12.493 89.779  1.00 45.13  ? 399  ASN C O     1 
ATOM   6681  C  CB    . ASN C  2  399  ? 65.866  -10.727 92.434  1.00 36.20  ? 399  ASN C CB    1 
ATOM   6682  C  CG    . ASN C  2  399  ? 64.592  -11.397 92.016  1.00 40.26  ? 399  ASN C CG    1 
ATOM   6683  O  OD1   . ASN C  2  399  ? 64.562  -12.569 91.726  1.00 39.09  ? 399  ASN C OD1   1 
ATOM   6684  N  ND2   . ASN C  2  399  ? 63.529  -10.658 92.027  1.00 37.62  ? 399  ASN C ND2   1 
ATOM   6685  N  N     . PRO C  2  400  ? 67.879  -13.016 91.711  1.00 51.01  ? 400  PRO C N     1 
ATOM   6686  C  CA    . PRO C  2  400  ? 68.275  -14.329 91.176  1.00 44.17  ? 400  PRO C CA    1 
ATOM   6687  C  C     . PRO C  2  400  ? 67.118  -15.144 90.590  1.00 42.57  ? 400  PRO C C     1 
ATOM   6688  O  O     . PRO C  2  400  ? 67.279  -15.820 89.554  1.00 43.23  ? 400  PRO C O     1 
ATOM   6689  C  CB    . PRO C  2  400  ? 68.841  -15.039 92.406  1.00 49.97  ? 400  PRO C CB    1 
ATOM   6690  C  CG    . PRO C  2  400  ? 69.371  -13.939 93.254  1.00 50.94  ? 400  PRO C CG    1 
ATOM   6691  C  CD    . PRO C  2  400  ? 68.424  -12.793 93.065  1.00 46.54  ? 400  PRO C CD    1 
ATOM   6692  N  N     . LEU C  2  401  ? 65.962  -15.077 91.246  1.00 39.96  ? 401  LEU C N     1 
ATOM   6693  C  CA    . LEU C  2  401  ? 64.783  -15.795 90.781  1.00 39.67  ? 401  LEU C CA    1 
ATOM   6694  C  C     . LEU C  2  401  ? 64.352  -15.320 89.394  1.00 41.85  ? 401  LEU C C     1 
ATOM   6695  O  O     . LEU C  2  401  ? 63.851  -16.110 88.592  1.00 42.58  ? 401  LEU C O     1 
ATOM   6696  C  CB    . LEU C  2  401  ? 63.627  -15.665 91.775  1.00 38.17  ? 401  LEU C CB    1 
ATOM   6697  C  CG    . LEU C  2  401  ? 62.318  -16.325 91.329  1.00 41.19  ? 401  LEU C CG    1 
ATOM   6698  C  CD1   . LEU C  2  401  ? 62.494  -17.825 91.089  1.00 43.60  ? 401  LEU C CD1   1 
ATOM   6699  C  CD2   . LEU C  2  401  ? 61.209  -16.058 92.323  1.00 41.32  ? 401  LEU C CD2   1 
ATOM   6700  N  N     . SER C  2  402  ? 64.563  -14.034 89.114  1.00 42.96  ? 402  SER C N     1 
ATOM   6701  C  CA    . SER C  2  402  ? 64.267  -13.467 87.799  1.00 41.03  ? 402  SER C CA    1 
ATOM   6702  C  C     . SER C  2  402  ? 64.943  -14.263 86.687  1.00 39.55  ? 402  SER C C     1 
ATOM   6703  O  O     . SER C  2  402  ? 64.286  -14.716 85.749  1.00 39.32  ? 402  SER C O     1 
ATOM   6704  C  CB    . SER C  2  402  ? 64.732  -12.014 87.716  1.00 42.56  ? 402  SER C CB    1 
ATOM   6705  O  OG    . SER C  2  402  ? 64.464  -11.310 88.906  1.00 42.62  ? 402  SER C OG    1 
ATOM   6706  N  N     . SER C  2  403  ? 66.257  -14.435 86.800  1.00 39.96  ? 403  SER C N     1 
ATOM   6707  C  CA    . SER C  2  403  ? 67.013  -15.143 85.770  1.00 45.50  ? 403  SER C CA    1 
ATOM   6708  C  C     . SER C  2  403  ? 66.717  -16.633 85.772  1.00 43.00  ? 403  SER C C     1 
ATOM   6709  O  O     . SER C  2  403  ? 66.586  -17.246 84.697  1.00 45.23  ? 403  SER C O     1 
ATOM   6710  C  CB    . SER C  2  403  ? 68.518  -14.876 85.877  1.00 41.73  ? 403  SER C CB    1 
ATOM   6711  O  OG    . SER C  2  403  ? 68.863  -14.364 87.144  1.00 45.73  ? 403  SER C OG    1 
ATOM   6712  N  N     . LEU C  2  404  ? 66.596  -17.214 86.964  1.00 41.31  ? 404  LEU C N     1 
ATOM   6713  C  CA    . LEU C  2  404  ? 66.228  -18.626 87.030  1.00 43.40  ? 404  LEU C CA    1 
ATOM   6714  C  C     . LEU C  2  404  ? 64.938  -18.892 86.254  1.00 43.13  ? 404  LEU C C     1 
ATOM   6715  O  O     . LEU C  2  404  ? 64.850  -19.852 85.489  1.00 41.57  ? 404  LEU C O     1 
ATOM   6716  C  CB    . LEU C  2  404  ? 66.088  -19.115 88.468  1.00 41.01  ? 404  LEU C CB    1 
ATOM   6717  C  CG    . LEU C  2  404  ? 65.598  -20.562 88.548  1.00 44.04  ? 404  LEU C CG    1 
ATOM   6718  C  CD1   . LEU C  2  404  ? 66.610  -21.507 87.914  1.00 44.47  ? 404  LEU C CD1   1 
ATOM   6719  C  CD2   . LEU C  2  404  ? 65.304  -20.966 89.979  1.00 48.55  ? 404  LEU C CD2   1 
ATOM   6720  N  N     . ARG C  2  405  ? 63.950  -18.022 86.434  1.00 41.51  ? 405  ARG C N     1 
ATOM   6721  C  CA    . ARG C  2  405  ? 62.684  -18.164 85.726  1.00 40.91  ? 405  ARG C CA    1 
ATOM   6722  C  C     . ARG C  2  405  ? 62.827  -17.893 84.235  1.00 42.58  ? 405  ARG C C     1 
ATOM   6723  O  O     . ARG C  2  405  ? 62.223  -18.580 83.410  1.00 42.32  ? 405  ARG C O     1 
ATOM   6724  C  CB    . ARG C  2  405  ? 61.631  -17.217 86.286  1.00 35.62  ? 405  ARG C CB    1 
ATOM   6725  C  CG    . ARG C  2  405  ? 60.298  -17.412 85.612  1.00 46.46  ? 405  ARG C CG    1 
ATOM   6726  C  CD    . ARG C  2  405  ? 59.398  -16.220 85.772  1.00 54.12  ? 405  ARG C CD    1 
ATOM   6727  N  NE    . ARG C  2  405  ? 59.676  -15.164 84.809  1.00 49.30  ? 405  ARG C NE    1 
ATOM   6728  C  CZ    . ARG C  2  405  ? 58.787  -14.240 84.469  1.00 50.57  ? 405  ARG C CZ    1 
ATOM   6729  N  NH1   . ARG C  2  405  ? 57.574  -14.269 85.001  1.00 43.80  ? 405  ARG C NH1   1 
ATOM   6730  N  NH2   . ARG C  2  405  ? 59.102  -13.295 83.599  1.00 64.52  ? 405  ARG C NH2   1 
ATOM   6731  N  N     . HIS C  2  406  ? 63.608  -16.869 83.905  1.00 38.49  ? 406  HIS C N     1 
ATOM   6732  C  CA    . HIS C  2  406  ? 63.806  -16.469 82.527  1.00 34.74  ? 406  HIS C CA    1 
ATOM   6733  C  C     . HIS C  2  406  ? 64.300  -17.649 81.712  1.00 38.33  ? 406  HIS C C     1 
ATOM   6734  O  O     . HIS C  2  406  ? 63.810  -17.911 80.611  1.00 36.48  ? 406  HIS C O     1 
ATOM   6735  C  CB    . HIS C  2  406  ? 64.812  -15.330 82.449  1.00 32.26  ? 406  HIS C CB    1 
ATOM   6736  C  CG    . HIS C  2  406  ? 64.789  -14.605 81.144  1.00 33.76  ? 406  HIS C CG    1 
ATOM   6737  N  ND1   . HIS C  2  406  ? 65.537  -13.471 80.909  1.00 37.64  ? 406  HIS C ND1   1 
ATOM   6738  C  CD2   . HIS C  2  406  ? 64.105  -14.847 80.002  1.00 32.46  ? 406  HIS C CD2   1 
ATOM   6739  C  CE1   . HIS C  2  406  ? 65.318  -13.051 79.677  1.00 39.07  ? 406  HIS C CE1   1 
ATOM   6740  N  NE2   . HIS C  2  406  ? 64.448  -13.865 79.106  1.00 34.84  ? 406  HIS C NE2   1 
ATOM   6741  N  N     . LYS C  2  407  ? 65.260  -18.375 82.271  1.00 38.58  ? 407  LYS C N     1 
ATOM   6742  C  CA    . LYS C  2  407  ? 65.829  -19.518 81.568  1.00 38.99  ? 407  LYS C CA    1 
ATOM   6743  C  C     . LYS C  2  407  ? 64.831  -20.657 81.360  1.00 37.95  ? 407  LYS C C     1 
ATOM   6744  O  O     . LYS C  2  407  ? 64.986  -21.460 80.439  1.00 43.15  ? 407  LYS C O     1 
ATOM   6745  C  CB    . LYS C  2  407  ? 67.082  -20.018 82.290  1.00 43.75  ? 407  LYS C CB    1 
ATOM   6746  C  CG    . LYS C  2  407  ? 68.225  -19.016 82.286  1.00 44.90  ? 407  LYS C CG    1 
ATOM   6747  C  CD    . LYS C  2  407  ? 69.045  -19.098 83.558  1.00 45.61  ? 407  LYS C CD    1 
ATOM   6748  C  CE    . LYS C  2  407  ? 70.064  -17.971 83.624  1.00 47.07  ? 407  LYS C CE    1 
ATOM   6749  N  NZ    . LYS C  2  407  ? 70.620  -17.827 85.008  1.00 60.20  ? 407  LYS C NZ    1 
ATOM   6750  N  N     . ARG C  2  408  ? 63.811  -20.728 82.212  1.00 38.38  ? 408  ARG C N     1 
ATOM   6751  C  CA    . ARG C  2  408  ? 62.804  -21.792 82.126  1.00 36.69  ? 408  ARG C CA    1 
ATOM   6752  C  C     . ARG C  2  408  ? 61.560  -21.392 81.334  1.00 37.34  ? 408  ARG C C     1 
ATOM   6753  O  O     . ARG C  2  408  ? 60.574  -22.125 81.312  1.00 39.52  ? 408  ARG C O     1 
ATOM   6754  C  CB    . ARG C  2  408  ? 62.417  -22.306 83.512  1.00 38.10  ? 408  ARG C CB    1 
ATOM   6755  C  CG    . ARG C  2  408  ? 63.603  -22.502 84.424  1.00 37.91  ? 408  ARG C CG    1 
ATOM   6756  C  CD    . ARG C  2  408  ? 63.207  -23.080 85.764  1.00 39.81  ? 408  ARG C CD    1 
ATOM   6757  N  NE    . ARG C  2  408  ? 63.179  -24.535 85.726  1.00 43.56  ? 408  ARG C NE    1 
ATOM   6758  C  CZ    . ARG C  2  408  ? 62.082  -25.261 85.898  1.00 49.17  ? 408  ARG C CZ    1 
ATOM   6759  N  NH1   . ARG C  2  408  ? 60.923  -24.664 86.135  1.00 49.48  ? 408  ARG C NH1   1 
ATOM   6760  N  NH2   . ARG C  2  408  ? 62.145  -26.584 85.845  1.00 50.16  ? 408  ARG C NH2   1 
ATOM   6761  N  N     . ARG C  2  409  ? 61.574  -20.236 80.714  1.00 40.30  ? 409  ARG C N     1 
ATOM   6762  C  CA    . ARG C  2  409  ? 60.422  -19.841 79.950  1.00 41.61  ? 409  ARG C CA    1 
ATOM   6763  C  C     . ARG C  2  409  ? 60.306  -20.518 78.621  1.00 40.97  ? 409  ARG C C     1 
ATOM   6764  O  O     . ARG C  2  409  ? 61.281  -20.877 78.019  1.00 39.33  ? 409  ARG C O     1 
ATOM   6765  C  CB    . ARG C  2  409  ? 60.306  -18.335 79.853  1.00 43.68  ? 409  ARG C CB    1 
ATOM   6766  C  CG    . ARG C  2  409  ? 59.485  -17.802 81.008  1.00 65.58  ? 409  ARG C CG    1 
ATOM   6767  C  CD    . ARG C  2  409  ? 58.688  -16.592 80.615  1.00 74.56  ? 409  ARG C CD    1 
ATOM   6768  N  NE    . ARG C  2  409  ? 59.591  -15.497 80.315  1.00 80.24  ? 409  ARG C NE    1 
ATOM   6769  C  CZ    . ARG C  2  409  ? 59.218  -14.232 80.232  1.00 81.65  ? 409  ARG C CZ    1 
ATOM   6770  N  NH1   . ARG C  2  409  ? 60.115  -13.308 79.961  1.00 75.62  ? 409  ARG C NH1   1 
ATOM   6771  N  NH2   . ARG C  2  409  ? 57.953  -13.897 80.424  1.00 72.91  ? 409  ARG C NH2   1 
ATOM   6772  N  N     . ILE C  2  410  ? 59.071  -20.686 78.192  1.00 42.36  ? 410  ILE C N     1 
ATOM   6773  C  CA    . ILE C  2  410  ? 58.714  -21.367 76.953  1.00 38.54  ? 410  ILE C CA    1 
ATOM   6774  C  C     . ILE C  2  410  ? 57.894  -20.432 76.070  1.00 40.69  ? 410  ILE C C     1 
ATOM   6775  O  O     . ILE C  2  410  ? 56.836  -19.974 76.478  1.00 41.98  ? 410  ILE C O     1 
ATOM   6776  C  CB    . ILE C  2  410  ? 57.876  -22.618 77.243  1.00 40.74  ? 410  ILE C CB    1 
ATOM   6777  C  CG1   . ILE C  2  410  ? 58.669  -23.598 78.108  1.00 42.55  ? 410  ILE C CG1   1 
ATOM   6778  C  CG2   . ILE C  2  410  ? 57.425  -23.279 75.947  1.00 40.32  ? 410  ILE C CG2   1 
ATOM   6779  C  CD1   . ILE C  2  410  ? 57.889  -24.838 78.499  1.00 45.24  ? 410  ILE C CD1   1 
ATOM   6780  N  N     . SER C  2  411  ? 58.372  -20.145 74.862  1.00 40.05  ? 411  SER C N     1 
ATOM   6781  C  CA    . SER C  2  411  ? 57.654  -19.230 73.972  1.00 39.24  ? 411  SER C CA    1 
ATOM   6782  C  C     . SER C  2  411  ? 57.109  -19.918 72.725  1.00 43.74  ? 411  SER C C     1 
ATOM   6783  O  O     . SER C  2  411  ? 57.788  -20.743 72.123  1.00 46.99  ? 411  SER C O     1 
ATOM   6784  C  CB    . SER C  2  411  ? 58.541  -18.052 73.571  1.00 38.12  ? 411  SER C CB    1 
ATOM   6785  O  OG    . SER C  2  411  ? 57.872  -17.206 72.653  1.00 44.26  ? 411  SER C OG    1 
ATOM   6786  N  N     . ALA C  2  412  ? 55.877  -19.581 72.350  1.00 46.41  ? 412  ALA C N     1 
ATOM   6787  C  CA    . ALA C  2  412  ? 55.292  -20.084 71.110  1.00 46.69  ? 412  ALA C CA    1 
ATOM   6788  C  C     . ALA C  2  412  ? 55.516  -19.074 69.997  1.00 56.15  ? 412  ALA C C     1 
ATOM   6789  O  O     . ALA C  2  412  ? 55.159  -19.311 68.845  1.00 59.78  ? 412  ALA C O     1 
ATOM   6790  C  CB    . ALA C  2  412  ? 53.814  -20.359 71.283  1.00 43.52  ? 412  ALA C CB    1 
ATOM   6791  N  N     . LEU C  2  413  ? 56.118  -17.945 70.362  1.00 56.06  ? 413  LEU C N     1 
ATOM   6792  C  CA    . LEU C  2  413  ? 56.448  -16.881 69.421  1.00 56.87  ? 413  LEU C CA    1 
ATOM   6793  C  C     . LEU C  2  413  ? 57.836  -17.101 68.823  1.00 58.93  ? 413  LEU C C     1 
ATOM   6794  O  O     . LEU C  2  413  ? 58.427  -18.168 68.975  1.00 54.05  ? 413  LEU C O     1 
ATOM   6795  C  CB    . LEU C  2  413  ? 56.399  -15.526 70.126  1.00 57.63  ? 413  LEU C CB    1 
ATOM   6796  C  CG    . LEU C  2  413  ? 55.100  -15.178 70.847  1.00 56.57  ? 413  LEU C CG    1 
ATOM   6797  C  CD1   . LEU C  2  413  ? 55.237  -13.841 71.550  1.00 56.73  ? 413  LEU C CD1   1 
ATOM   6798  C  CD2   . LEU C  2  413  ? 53.929  -15.167 69.868  1.00 57.78  ? 413  LEU C CD2   1 
ATOM   6799  N  N     . GLY C  2  414  ? 58.351  -16.087 68.137  1.00 62.24  ? 414  GLY C N     1 
ATOM   6800  C  CA    . GLY C  2  414  ? 59.663  -16.178 67.521  1.00 67.31  ? 414  GLY C CA    1 
ATOM   6801  C  C     . GLY C  2  414  ? 59.633  -16.770 66.120  1.00 74.09  ? 414  GLY C C     1 
ATOM   6802  O  O     . GLY C  2  414  ? 58.583  -17.205 65.636  1.00 73.09  ? 414  GLY C O     1 
ATOM   6803  N  N     . PRO C  2  415  ? 60.796  -16.789 65.455  1.00 72.99  ? 415  PRO C N     1 
ATOM   6804  C  CA    . PRO C  2  415  ? 60.926  -17.324 64.094  1.00 70.14  ? 415  PRO C CA    1 
ATOM   6805  C  C     . PRO C  2  415  ? 60.579  -18.807 64.028  1.00 69.49  ? 415  PRO C C     1 
ATOM   6806  O  O     . PRO C  2  415  ? 61.017  -19.577 64.880  1.00 74.06  ? 415  PRO C O     1 
ATOM   6807  C  CB    . PRO C  2  415  ? 62.411  -17.116 63.778  1.00 67.43  ? 415  PRO C CB    1 
ATOM   6808  C  CG    . PRO C  2  415  ? 62.850  -16.016 64.692  1.00 73.82  ? 415  PRO C CG    1 
ATOM   6809  C  CD    . PRO C  2  415  ? 62.062  -16.223 65.950  1.00 72.70  ? 415  PRO C CD    1 
ATOM   6810  N  N     . GLY C  2  416  ? 59.803  -19.199 63.023  1.00 71.53  ? 416  GLY C N     1 
ATOM   6811  C  CA    . GLY C  2  416  ? 59.403  -20.585 62.867  1.00 71.16  ? 416  GLY C CA    1 
ATOM   6812  C  C     . GLY C  2  416  ? 58.247  -20.942 63.780  1.00 80.39  ? 416  GLY C C     1 
ATOM   6813  O  O     . GLY C  2  416  ? 58.026  -22.113 64.094  1.00 82.72  ? 416  GLY C O     1 
ATOM   6814  N  N     . GLY C  2  417  ? 57.500  -19.925 64.196  1.00 74.82  ? 417  GLY C N     1 
ATOM   6815  C  CA    . GLY C  2  417  ? 56.422  -20.108 65.146  1.00 71.77  ? 417  GLY C CA    1 
ATOM   6816  C  C     . GLY C  2  417  ? 55.345  -19.058 64.976  1.00 84.16  ? 417  GLY C C     1 
ATOM   6817  O  O     . GLY C  2  417  ? 55.412  -18.231 64.067  1.00 90.11  ? 417  GLY C O     1 
ATOM   6818  N  N     . LEU C  2  418  ? 54.353  -19.101 65.860  1.00 78.26  ? 418  LEU C N     1 
ATOM   6819  C  CA    . LEU C  2  418  ? 53.175  -18.239 65.795  1.00 78.82  ? 418  LEU C CA    1 
ATOM   6820  C  C     . LEU C  2  418  ? 53.464  -16.744 65.762  1.00 84.97  ? 418  LEU C C     1 
ATOM   6821  O  O     . LEU C  2  418  ? 54.391  -16.265 66.416  1.00 77.75  ? 418  LEU C O     1 
ATOM   6822  C  CB    . LEU C  2  418  ? 52.272  -18.519 66.997  1.00 70.68  ? 418  LEU C CB    1 
ATOM   6823  C  CG    . LEU C  2  418  ? 51.164  -19.563 66.877  1.00 72.04  ? 418  LEU C CG    1 
ATOM   6824  C  CD1   . LEU C  2  418  ? 51.317  -20.381 65.623  1.00 76.95  ? 418  LEU C CD1   1 
ATOM   6825  C  CD2   . LEU C  2  418  ? 51.178  -20.451 68.100  1.00 67.29  ? 418  LEU C CD2   1 
ATOM   6826  N  N     . THR C  2  419  ? 52.664  -16.014 64.987  1.00 97.80  ? 419  THR C N     1 
ATOM   6827  C  CA    . THR C  2  419  ? 52.551  -14.573 65.159  1.00 95.89  ? 419  THR C CA    1 
ATOM   6828  C  C     . THR C  2  419  ? 51.389  -14.404 66.131  1.00 94.35  ? 419  THR C C     1 
ATOM   6829  O  O     . THR C  2  419  ? 50.749  -15.387 66.497  1.00 96.15  ? 419  THR C O     1 
ATOM   6830  C  CB    . THR C  2  419  ? 52.245  -13.853 63.832  1.00 102.53 ? 419  THR C CB    1 
ATOM   6831  O  OG1   . THR C  2  419  ? 52.910  -14.519 62.750  1.00 93.59  ? 419  THR C OG1   1 
ATOM   6832  C  CG2   . THR C  2  419  ? 52.711  -12.403 63.890  1.00 106.57 ? 419  THR C CG2   1 
ATOM   6833  N  N     . ARG C  2  420  ? 51.095  -13.179 66.546  1.00 95.64  ? 420  ARG C N     1 
ATOM   6834  C  CA    . ARG C  2  420  ? 50.091  -12.987 67.586  1.00 88.93  ? 420  ARG C CA    1 
ATOM   6835  C  C     . ARG C  2  420  ? 48.656  -13.124 67.056  1.00 102.71 ? 420  ARG C C     1 
ATOM   6836  O  O     . ARG C  2  420  ? 47.759  -13.567 67.774  1.00 100.92 ? 420  ARG C O     1 
ATOM   6837  C  CB    . ARG C  2  420  ? 50.301  -11.653 68.299  1.00 80.26  ? 420  ARG C CB    1 
ATOM   6838  C  CG    . ARG C  2  420  ? 49.587  -11.568 69.631  1.00 87.09  ? 420  ARG C CG    1 
ATOM   6839  C  CD    . ARG C  2  420  ? 50.212  -10.512 70.529  1.00 86.97  ? 420  ARG C CD    1 
ATOM   6840  N  NE    . ARG C  2  420  ? 51.572  -10.863 70.934  1.00 73.49  ? 420  ARG C NE    1 
ATOM   6841  C  CZ    . ARG C  2  420  ? 52.629  -10.078 70.758  1.00 78.35  ? 420  ARG C CZ    1 
ATOM   6842  N  NH1   . ARG C  2  420  ? 52.489  -8.891  70.183  1.00 90.74  ? 420  ARG C NH1   1 
ATOM   6843  N  NH2   . ARG C  2  420  ? 53.826  -10.480 71.159  1.00 75.68  ? 420  ARG C NH2   1 
ATOM   6844  N  N     . GLU C  2  421  ? 48.444  -12.756 65.797  1.00 106.06 ? 421  GLU C N     1 
ATOM   6845  C  CA    . GLU C  2  421  ? 47.144  -12.961 65.163  1.00 104.74 ? 421  GLU C CA    1 
ATOM   6846  C  C     . GLU C  2  421  ? 46.933  -14.442 64.875  1.00 105.97 ? 421  GLU C C     1 
ATOM   6847  O  O     . GLU C  2  421  ? 45.800  -14.937 64.883  1.00 110.27 ? 421  GLU C O     1 
ATOM   6848  C  CB    . GLU C  2  421  ? 47.020  -12.141 63.879  1.00 102.32 ? 421  GLU C CB    1 
ATOM   6849  C  CG    . GLU C  2  421  ? 48.116  -12.393 62.855  1.00 106.41 ? 421  GLU C CG    1 
ATOM   6850  C  CD    . GLU C  2  421  ? 49.344  -11.527 63.082  1.00 119.54 ? 421  GLU C CD    1 
ATOM   6851  O  OE1   . GLU C  2  421  ? 50.013  -11.164 62.085  1.00 123.55 ? 421  GLU C OE1   1 
ATOM   6852  O  OE2   . GLU C  2  421  ? 49.641  -11.207 64.256  1.00 116.75 ? 421  GLU C OE2   1 
ATOM   6853  N  N     . ARG C  2  422  ? 48.040  -15.135 64.620  1.00 105.74 ? 422  ARG C N     1 
ATOM   6854  C  CA    . ARG C  2  422  ? 48.031  -16.576 64.393  1.00 105.74 ? 422  ARG C CA    1 
ATOM   6855  C  C     . ARG C  2  422  ? 47.586  -17.378 65.621  1.00 102.15 ? 422  ARG C C     1 
ATOM   6856  O  O     . ARG C  2  422  ? 47.266  -18.567 65.533  1.00 98.29  ? 422  ARG C O     1 
ATOM   6857  C  CB    . ARG C  2  422  ? 49.396  -17.025 63.870  1.00 102.26 ? 422  ARG C CB    1 
ATOM   6858  C  CG    . ARG C  2  422  ? 49.465  -16.847 62.376  1.00 113.89 ? 422  ARG C CG    1 
ATOM   6859  C  CD    . ARG C  2  422  ? 50.780  -16.889 61.675  1.00 114.94 ? 422  ARG C CD    1 
ATOM   6860  N  NE    . ARG C  2  422  ? 51.767  -17.920 61.878  1.00 117.17 ? 422  ARG C NE    1 
ATOM   6861  C  CZ    . ARG C  2  422  ? 51.883  -19.152 61.412  1.00 122.86 ? 422  ARG C CZ    1 
ATOM   6862  N  NH1   . ARG C  2  422  ? 53.030  -19.718 61.669  1.00 122.76 ? 422  ARG C NH1   1 
ATOM   6863  N  NH2   . ARG C  2  422  ? 50.942  -19.840 60.795  1.00 122.77 ? 422  ARG C NH2   1 
ATOM   6864  N  N     . ALA C  2  423  ? 47.509  -16.700 66.758  1.00 94.16  ? 423  ALA C N     1 
ATOM   6865  C  CA    . ALA C  2  423  ? 47.177  -17.364 68.001  1.00 86.78  ? 423  ALA C CA    1 
ATOM   6866  C  C     . ALA C  2  423  ? 45.733  -17.104 68.419  1.00 86.43  ? 423  ALA C C     1 
ATOM   6867  O  O     . ALA C  2  423  ? 45.369  -15.987 68.796  1.00 84.90  ? 423  ALA C O     1 
ATOM   6868  C  CB    . ALA C  2  423  ? 48.141  -16.931 69.084  1.00 77.42  ? 423  ALA C CB    1 
ATOM   6869  N  N     . GLY C  2  424  ? 44.917  -18.151 68.345  1.00 75.83  ? 424  GLY C N     1 
ATOM   6870  C  CA    . GLY C  2  424  ? 43.544  -18.085 68.803  1.00 82.81  ? 424  GLY C CA    1 
ATOM   6871  C  C     . GLY C  2  424  ? 43.434  -18.636 70.210  1.00 81.50  ? 424  GLY C C     1 
ATOM   6872  O  O     . GLY C  2  424  ? 44.386  -18.562 70.987  1.00 76.01  ? 424  GLY C O     1 
ATOM   6873  N  N     . PHE C  2  425  ? 42.277  -19.198 70.538  1.00 78.84  ? 425  PHE C N     1 
ATOM   6874  C  CA    . PHE C  2  425  ? 42.058  -19.775 71.860  1.00 77.14  ? 425  PHE C CA    1 
ATOM   6875  C  C     . PHE C  2  425  ? 42.776  -21.113 72.026  1.00 75.32  ? 425  PHE C C     1 
ATOM   6876  O  O     . PHE C  2  425  ? 43.311  -21.406 73.096  1.00 72.66  ? 425  PHE C O     1 
ATOM   6877  C  CB    . PHE C  2  425  ? 40.559  -19.941 72.139  1.00 79.08  ? 425  PHE C CB    1 
ATOM   6878  C  CG    . PHE C  2  425  ? 39.851  -18.652 72.443  1.00 80.50  ? 425  PHE C CG    1 
ATOM   6879  C  CD1   . PHE C  2  425  ? 39.408  -18.377 73.727  1.00 84.92  ? 425  PHE C CD1   1 
ATOM   6880  C  CD2   . PHE C  2  425  ? 39.635  -17.711 71.448  1.00 78.44  ? 425  PHE C CD2   1 
ATOM   6881  C  CE1   . PHE C  2  425  ? 38.756  -17.192 74.013  1.00 84.90  ? 425  PHE C CE1   1 
ATOM   6882  C  CE2   . PHE C  2  425  ? 38.989  -16.524 71.724  1.00 77.56  ? 425  PHE C CE2   1 
ATOM   6883  C  CZ    . PHE C  2  425  ? 38.546  -16.262 73.008  1.00 86.62  ? 425  PHE C CZ    1 
ATOM   6884  N  N     . ASP C  2  426  ? 42.782  -21.914 70.963  1.00 76.79  ? 426  ASP C N     1 
ATOM   6885  C  CA    . ASP C  2  426  ? 43.315  -23.276 71.005  1.00 71.52  ? 426  ASP C CA    1 
ATOM   6886  C  C     . ASP C  2  426  ? 44.734  -23.354 71.547  1.00 65.14  ? 426  ASP C C     1 
ATOM   6887  O  O     . ASP C  2  426  ? 45.062  -24.243 72.330  1.00 63.68  ? 426  ASP C O     1 
ATOM   6888  C  CB    . ASP C  2  426  ? 43.272  -23.908 69.614  1.00 84.28  ? 426  ASP C CB    1 
ATOM   6889  C  CG    . ASP C  2  426  ? 41.867  -24.270 69.182  1.00 90.76  ? 426  ASP C CG    1 
ATOM   6890  O  OD1   . ASP C  2  426  ? 41.042  -24.581 70.067  1.00 85.63  ? 426  ASP C OD1   1 
ATOM   6891  O  OD2   . ASP C  2  426  ? 41.592  -24.249 67.960  1.00 83.04  ? 426  ASP C OD2   1 
ATOM   6892  N  N     . VAL C  2  427  ? 45.573  -22.419 71.121  1.00 66.55  ? 427  VAL C N     1 
ATOM   6893  C  CA    . VAL C  2  427  ? 46.980  -22.427 71.504  1.00 66.13  ? 427  VAL C CA    1 
ATOM   6894  C  C     . VAL C  2  427  ? 47.231  -21.860 72.897  1.00 58.12  ? 427  VAL C C     1 
ATOM   6895  O  O     . VAL C  2  427  ? 48.110  -22.329 73.620  1.00 55.49  ? 427  VAL C O     1 
ATOM   6896  C  CB    . VAL C  2  427  ? 47.836  -21.655 70.494  1.00 62.86  ? 427  VAL C CB    1 
ATOM   6897  C  CG1   . VAL C  2  427  ? 48.957  -22.539 69.996  1.00 58.52  ? 427  VAL C CG1   1 
ATOM   6898  C  CG2   . VAL C  2  427  ? 46.975  -21.169 69.338  1.00 73.25  ? 427  VAL C CG2   1 
ATOM   6899  N  N     . ARG C  2  428  ? 46.458  -20.847 73.268  1.00 58.06  ? 428  ARG C N     1 
ATOM   6900  C  CA    . ARG C  2  428  ? 46.647  -20.174 74.547  1.00 50.81  ? 428  ARG C CA    1 
ATOM   6901  C  C     . ARG C  2  428  ? 46.050  -20.979 75.693  1.00 45.79  ? 428  ARG C C     1 
ATOM   6902  O  O     . ARG C  2  428  ? 46.342  -20.724 76.855  1.00 40.36  ? 428  ARG C O     1 
ATOM   6903  C  CB    . ARG C  2  428  ? 46.038  -18.777 74.498  1.00 48.18  ? 428  ARG C CB    1 
ATOM   6904  C  CG    . ARG C  2  428  ? 46.490  -17.970 73.294  1.00 52.54  ? 428  ARG C CG    1 
ATOM   6905  C  CD    . ARG C  2  428  ? 45.688  -16.700 73.151  1.00 53.19  ? 428  ARG C CD    1 
ATOM   6906  N  NE    . ARG C  2  428  ? 46.509  -15.510 73.330  1.00 50.40  ? 428  ARG C NE    1 
ATOM   6907  C  CZ    . ARG C  2  428  ? 46.822  -14.673 72.349  1.00 52.11  ? 428  ARG C CZ    1 
ATOM   6908  N  NH1   . ARG C  2  428  ? 46.378  -14.896 71.122  1.00 61.56  ? 428  ARG C NH1   1 
ATOM   6909  N  NH2   . ARG C  2  428  ? 47.570  -13.611 72.597  1.00 50.80  ? 428  ARG C NH2   1 
ATOM   6910  N  N     . ASP C  2  429  ? 45.238  -21.972 75.345  1.00 51.88  ? 429  ASP C N     1 
ATOM   6911  C  CA    . ASP C  2  429  ? 44.540  -22.798 76.323  1.00 52.53  ? 429  ASP C CA    1 
ATOM   6912  C  C     . ASP C  2  429  ? 45.494  -23.597 77.195  1.00 49.36  ? 429  ASP C C     1 
ATOM   6913  O  O     . ASP C  2  429  ? 46.639  -23.841 76.828  1.00 53.33  ? 429  ASP C O     1 
ATOM   6914  C  CB    . ASP C  2  429  ? 43.593  -23.768 75.614  1.00 57.23  ? 429  ASP C CB    1 
ATOM   6915  C  CG    . ASP C  2  429  ? 42.150  -23.325 75.673  1.00 71.44  ? 429  ASP C CG    1 
ATOM   6916  O  OD1   . ASP C  2  429  ? 41.753  -22.735 76.702  1.00 72.67  ? 429  ASP C OD1   1 
ATOM   6917  O  OD2   . ASP C  2  429  ? 41.412  -23.574 74.692  1.00 72.89  ? 429  ASP C OD2   1 
ATOM   6918  N  N     . VAL C  2  430  ? 45.008  -23.997 78.361  1.00 50.16  ? 430  VAL C N     1 
ATOM   6919  C  CA    . VAL C  2  430  ? 45.728  -24.942 79.189  1.00 45.93  ? 430  VAL C CA    1 
ATOM   6920  C  C     . VAL C  2  430  ? 45.221  -26.312 78.785  1.00 49.03  ? 430  VAL C C     1 
ATOM   6921  O  O     . VAL C  2  430  ? 44.063  -26.651 79.025  1.00 57.12  ? 430  VAL C O     1 
ATOM   6922  C  CB    . VAL C  2  430  ? 45.444  -24.705 80.690  1.00 47.81  ? 430  VAL C CB    1 
ATOM   6923  C  CG1   . VAL C  2  430  ? 45.839  -25.917 81.518  1.00 42.96  ? 430  VAL C CG1   1 
ATOM   6924  C  CG2   . VAL C  2  430  ? 46.174  -23.467 81.173  1.00 48.02  ? 430  VAL C CG2   1 
ATOM   6925  N  N     . HIS C  2  431  ? 46.082  -27.091 78.144  1.00 46.21  ? 431  HIS C N     1 
ATOM   6926  C  CA    . HIS C  2  431  ? 45.724  -28.438 77.732  1.00 47.95  ? 431  HIS C CA    1 
ATOM   6927  C  C     . HIS C  2  431  ? 45.822  -29.359 78.939  1.00 53.65  ? 431  HIS C C     1 
ATOM   6928  O  O     . HIS C  2  431  ? 46.619  -29.108 79.846  1.00 52.72  ? 431  HIS C O     1 
ATOM   6929  C  CB    . HIS C  2  431  ? 46.661  -28.919 76.625  1.00 50.93  ? 431  HIS C CB    1 
ATOM   6930  C  CG    . HIS C  2  431  ? 46.104  -30.046 75.813  1.00 50.35  ? 431  HIS C CG    1 
ATOM   6931  N  ND1   . HIS C  2  431  ? 46.097  -31.351 76.257  1.00 49.10  ? 431  HIS C ND1   1 
ATOM   6932  C  CD2   . HIS C  2  431  ? 45.524  -30.062 74.590  1.00 47.21  ? 431  HIS C CD2   1 
ATOM   6933  C  CE1   . HIS C  2  431  ? 45.539  -32.121 75.340  1.00 45.78  ? 431  HIS C CE1   1 
ATOM   6934  N  NE2   . HIS C  2  431  ? 45.181  -31.363 74.321  1.00 43.42  ? 431  HIS C NE2   1 
ATOM   6935  N  N     . ARG C  2  432  ? 45.015  -30.418 78.963  1.00 54.27  ? 432  ARG C N     1 
ATOM   6936  C  CA    . ARG C  2  432  ? 45.061  -31.367 80.073  1.00 51.13  ? 432  ARG C CA    1 
ATOM   6937  C  C     . ARG C  2  432  ? 46.463  -31.945 80.224  1.00 51.96  ? 432  ARG C C     1 
ATOM   6938  O  O     . ARG C  2  432  ? 46.898  -32.247 81.333  1.00 53.83  ? 432  ARG C O     1 
ATOM   6939  C  CB    . ARG C  2  432  ? 44.046  -32.495 79.881  1.00 48.99  ? 432  ARG C CB    1 
ATOM   6940  C  CG    . ARG C  2  432  ? 44.259  -33.307 78.623  1.00 50.32  ? 432  ARG C CG    1 
ATOM   6941  C  CD    . ARG C  2  432  ? 43.324  -34.495 78.566  1.00 52.61  ? 432  ARG C CD    1 
ATOM   6942  N  NE    . ARG C  2  432  ? 43.554  -35.330 77.389  1.00 49.53  ? 432  ARG C NE    1 
ATOM   6943  C  CZ    . ARG C  2  432  ? 44.454  -36.305 77.336  1.00 51.33  ? 432  ARG C CZ    1 
ATOM   6944  N  NH1   . ARG C  2  432  ? 45.218  -36.565 78.392  1.00 56.86  ? 432  ARG C NH1   1 
ATOM   6945  N  NH2   . ARG C  2  432  ? 44.594  -37.019 76.230  1.00 52.91  ? 432  ARG C NH2   1 
ATOM   6946  N  N     . THR C  2  433  ? 47.170  -32.071 79.103  1.00 47.93  ? 433  THR C N     1 
ATOM   6947  C  CA    . THR C  2  433  ? 48.511  -32.640 79.095  1.00 43.59  ? 433  THR C CA    1 
ATOM   6948  C  C     . THR C  2  433  ? 49.565  -31.685 79.646  1.00 42.99  ? 433  THR C C     1 
ATOM   6949  O  O     . THR C  2  433  ? 50.716  -32.070 79.810  1.00 45.71  ? 433  THR C O     1 
ATOM   6950  C  CB    . THR C  2  433  ? 48.924  -33.126 77.686  1.00 49.04  ? 433  THR C CB    1 
ATOM   6951  O  OG1   . THR C  2  433  ? 48.912  -32.026 76.769  1.00 52.16  ? 433  THR C OG1   1 
ATOM   6952  C  CG2   . THR C  2  433  ? 47.977  -34.207 77.186  1.00 46.62  ? 433  THR C CG2   1 
ATOM   6953  N  N     . HIS C  2  434  ? 49.177  -30.444 79.934  1.00 44.67  ? 434  HIS C N     1 
ATOM   6954  C  CA    . HIS C  2  434  ? 50.088  -29.490 80.567  1.00 44.26  ? 434  HIS C CA    1 
ATOM   6955  C  C     . HIS C  2  434  ? 50.416  -29.920 81.992  1.00 46.12  ? 434  HIS C C     1 
ATOM   6956  O  O     . HIS C  2  434  ? 51.354  -29.408 82.602  1.00 45.92  ? 434  HIS C O     1 
ATOM   6957  C  CB    . HIS C  2  434  ? 49.490  -28.084 80.601  1.00 43.21  ? 434  HIS C CB    1 
ATOM   6958  C  CG    . HIS C  2  434  ? 49.522  -27.375 79.287  1.00 43.14  ? 434  HIS C CG    1 
ATOM   6959  N  ND1   . HIS C  2  434  ? 49.679  -28.033 78.089  1.00 45.55  ? 434  HIS C ND1   1 
ATOM   6960  C  CD2   . HIS C  2  434  ? 49.416  -26.060 78.986  1.00 41.77  ? 434  HIS C CD2   1 
ATOM   6961  C  CE1   . HIS C  2  434  ? 49.668  -27.154 77.103  1.00 42.84  ? 434  HIS C CE1   1 
ATOM   6962  N  NE2   . HIS C  2  434  ? 49.510  -25.950 77.621  1.00 41.85  ? 434  HIS C NE2   1 
ATOM   6963  N  N     . TYR C  2  435  ? 49.628  -30.856 82.512  1.00 48.51  ? 435  TYR C N     1 
ATOM   6964  C  CA    . TYR C  2  435  ? 49.789  -31.360 83.869  1.00 47.09  ? 435  TYR C CA    1 
ATOM   6965  C  C     . TYR C  2  435  ? 51.204  -31.894 84.080  1.00 48.52  ? 435  TYR C C     1 
ATOM   6966  O  O     . TYR C  2  435  ? 51.652  -32.799 83.378  1.00 51.61  ? 435  TYR C O     1 
ATOM   6967  C  CB    . TYR C  2  435  ? 48.778  -32.484 84.100  1.00 46.93  ? 435  TYR C CB    1 
ATOM   6968  C  CG    . TYR C  2  435  ? 48.601  -32.898 85.542  1.00 51.66  ? 435  TYR C CG    1 
ATOM   6969  C  CD1   . TYR C  2  435  ? 47.486  -32.494 86.264  1.00 46.63  ? 435  TYR C CD1   1 
ATOM   6970  C  CD2   . TYR C  2  435  ? 49.540  -33.707 86.180  1.00 49.94  ? 435  TYR C CD2   1 
ATOM   6971  C  CE1   . TYR C  2  435  ? 47.312  -32.876 87.574  1.00 47.29  ? 435  TYR C CE1   1 
ATOM   6972  C  CE2   . TYR C  2  435  ? 49.374  -34.093 87.490  1.00 45.74  ? 435  TYR C CE2   1 
ATOM   6973  C  CZ    . TYR C  2  435  ? 48.258  -33.673 88.184  1.00 50.02  ? 435  TYR C CZ    1 
ATOM   6974  O  OH    . TYR C  2  435  ? 48.081  -34.048 89.494  1.00 52.71  ? 435  TYR C OH    1 
ATOM   6975  N  N     . GLY C  2  436  ? 51.899  -31.344 85.068  1.00 45.90  ? 436  GLY C N     1 
ATOM   6976  C  CA    . GLY C  2  436  ? 53.243  -31.788 85.383  1.00 49.01  ? 436  GLY C CA    1 
ATOM   6977  C  C     . GLY C  2  436  ? 54.317  -31.323 84.421  1.00 46.52  ? 436  GLY C C     1 
ATOM   6978  O  O     . GLY C  2  436  ? 55.500  -31.581 84.636  1.00 47.92  ? 436  GLY C O     1 
ATOM   6979  N  N     . ARG C  2  437  ? 53.906  -30.625 83.369  1.00 46.17  ? 437  ARG C N     1 
ATOM   6980  C  CA    . ARG C  2  437  ? 54.814  -30.229 82.298  1.00 47.22  ? 437  ARG C CA    1 
ATOM   6981  C  C     . ARG C  2  437  ? 54.935  -28.713 82.152  1.00 47.44  ? 437  ARG C C     1 
ATOM   6982  O  O     . ARG C  2  437  ? 56.020  -28.150 82.275  1.00 47.65  ? 437  ARG C O     1 
ATOM   6983  C  CB    . ARG C  2  437  ? 54.382  -30.872 80.983  1.00 46.39  ? 437  ARG C CB    1 
ATOM   6984  C  CG    . ARG C  2  437  ? 54.548  -32.370 80.989  1.00 45.39  ? 437  ARG C CG    1 
ATOM   6985  C  CD    . ARG C  2  437  ? 53.956  -33.022 79.764  1.00 46.68  ? 437  ARG C CD    1 
ATOM   6986  N  NE    . ARG C  2  437  ? 53.997  -34.475 79.886  1.00 47.07  ? 437  ARG C NE    1 
ATOM   6987  C  CZ    . ARG C  2  437  ? 53.095  -35.190 80.547  1.00 46.65  ? 437  ARG C CZ    1 
ATOM   6988  N  NH1   . ARG C  2  437  ? 52.077  -34.592 81.143  1.00 53.47  ? 437  ARG C NH1   1 
ATOM   6989  N  NH2   . ARG C  2  437  ? 53.209  -36.504 80.617  1.00 51.21  ? 437  ARG C NH2   1 
ATOM   6990  N  N     . ILE C  2  438  ? 53.821  -28.062 81.849  1.00 49.17  ? 438  ILE C N     1 
ATOM   6991  C  CA    . ILE C  2  438  ? 53.787  -26.612 81.749  1.00 45.22  ? 438  ILE C CA    1 
ATOM   6992  C  C     . ILE C  2  438  ? 52.863  -26.059 82.822  1.00 41.86  ? 438  ILE C C     1 
ATOM   6993  O  O     . ILE C  2  438  ? 51.746  -26.539 82.980  1.00 44.09  ? 438  ILE C O     1 
ATOM   6994  C  CB    . ILE C  2  438  ? 53.282  -26.171 80.374  1.00 40.85  ? 438  ILE C CB    1 
ATOM   6995  C  CG1   . ILE C  2  438  ? 54.183  -26.740 79.282  1.00 44.20  ? 438  ILE C CG1   1 
ATOM   6996  C  CG2   . ILE C  2  438  ? 53.236  -24.670 80.296  1.00 43.26  ? 438  ILE C CG2   1 
ATOM   6997  C  CD1   . ILE C  2  438  ? 53.736  -26.395 77.877  1.00 49.00  ? 438  ILE C CD1   1 
ATOM   6998  N  N     . CYS C  2  439  ? 53.328  -25.056 83.560  1.00 40.19  ? 439  CYS C N     1 
ATOM   6999  C  CA    . CYS C  2  439  ? 52.526  -24.466 84.627  1.00 42.93  ? 439  CYS C CA    1 
ATOM   7000  C  C     . CYS C  2  439  ? 51.254  -23.778 84.117  1.00 46.06  ? 439  CYS C C     1 
ATOM   7001  O  O     . CYS C  2  439  ? 51.319  -22.920 83.246  1.00 48.88  ? 439  CYS C O     1 
ATOM   7002  C  CB    . CYS C  2  439  ? 53.355  -23.470 85.426  1.00 41.37  ? 439  CYS C CB    1 
ATOM   7003  S  SG    . CYS C  2  439  ? 52.446  -22.741 86.805  1.00 46.11  ? 439  CYS C SG    1 
ATOM   7004  N  N     . PRO C  2  440  ? 50.091  -24.166 84.666  1.00 46.14  ? 440  PRO C N     1 
ATOM   7005  C  CA    . PRO C  2  440  ? 48.773  -23.606 84.328  1.00 44.06  ? 440  PRO C CA    1 
ATOM   7006  C  C     . PRO C  2  440  ? 48.591  -22.184 84.853  1.00 45.28  ? 440  PRO C C     1 
ATOM   7007  O  O     . PRO C  2  440  ? 47.684  -21.469 84.428  1.00 49.00  ? 440  PRO C O     1 
ATOM   7008  C  CB    . PRO C  2  440  ? 47.802  -24.558 85.028  1.00 41.09  ? 440  PRO C CB    1 
ATOM   7009  C  CG    . PRO C  2  440  ? 48.571  -25.077 86.194  1.00 45.04  ? 440  PRO C CG    1 
ATOM   7010  C  CD    . PRO C  2  440  ? 50.001  -25.179 85.733  1.00 45.68  ? 440  PRO C CD    1 
ATOM   7011  N  N     . VAL C  2  441  ? 49.453  -21.795 85.782  1.00 44.91  ? 441  VAL C N     1 
ATOM   7012  C  CA    . VAL C  2  441  ? 49.367  -20.506 86.464  1.00 43.47  ? 441  VAL C CA    1 
ATOM   7013  C  C     . VAL C  2  441  ? 50.227  -19.416 85.818  1.00 44.53  ? 441  VAL C C     1 
ATOM   7014  O  O     . VAL C  2  441  ? 49.717  -18.359 85.455  1.00 43.35  ? 441  VAL C O     1 
ATOM   7015  C  CB    . VAL C  2  441  ? 49.647  -20.617 87.979  1.00 39.24  ? 441  VAL C CB    1 
ATOM   7016  C  CG1   . VAL C  2  441  ? 49.767  -19.245 88.596  1.00 38.25  ? 441  VAL C CG1   1 
ATOM   7017  C  CG2   . VAL C  2  441  ? 48.542  -21.400 88.655  1.00 39.21  ? 441  VAL C CG2   1 
ATOM   7018  N  N     . GLU C  2  442  ? 51.530  -19.651 85.690  1.00 45.29  ? 442  GLU C N     1 
ATOM   7019  C  CA    . GLU C  2  442  ? 52.425  -18.543 85.401  1.00 44.56  ? 442  GLU C CA    1 
ATOM   7020  C  C     . GLU C  2  442  ? 52.519  -18.308 83.901  1.00 48.35  ? 442  GLU C C     1 
ATOM   7021  O  O     . GLU C  2  442  ? 53.195  -19.024 83.163  1.00 48.59  ? 442  GLU C O     1 
ATOM   7022  C  CB    . GLU C  2  442  ? 53.814  -18.865 85.949  1.00 42.93  ? 442  GLU C CB    1 
ATOM   7023  C  CG    . GLU C  2  442  ? 54.800  -17.717 85.888  1.00 50.07  ? 442  GLU C CG    1 
ATOM   7024  C  CD    . GLU C  2  442  ? 56.243  -18.190 85.791  1.00 53.79  ? 442  GLU C CD    1 
ATOM   7025  O  OE1   . GLU C  2  442  ? 56.673  -19.042 86.599  1.00 53.07  ? 442  GLU C OE1   1 
ATOM   7026  O  OE2   . GLU C  2  442  ? 56.947  -17.713 84.883  1.00 68.24  ? 442  GLU C OE2   1 
ATOM   7027  N  N     . THR C  2  443  ? 51.834  -17.255 83.477  1.00 49.88  ? 443  THR C N     1 
ATOM   7028  C  CA    . THR C  2  443  ? 51.799  -16.813 82.094  1.00 47.88  ? 443  THR C CA    1 
ATOM   7029  C  C     . THR C  2  443  ? 51.570  -15.308 82.150  1.00 46.51  ? 443  THR C C     1 
ATOM   7030  O  O     . THR C  2  443  ? 51.052  -14.808 83.146  1.00 47.09  ? 443  THR C O     1 
ATOM   7031  C  CB    . THR C  2  443  ? 50.683  -17.532 81.299  1.00 47.13  ? 443  THR C CB    1 
ATOM   7032  O  OG1   . THR C  2  443  ? 50.780  -17.196 79.911  1.00 43.76  ? 443  THR C OG1   1 
ATOM   7033  C  CG2   . THR C  2  443  ? 49.305  -17.152 81.815  1.00 47.09  ? 443  THR C CG2   1 
ATOM   7034  N  N     . PRO C  2  444  ? 51.967  -14.572 81.104  1.00 45.88  ? 444  PRO C N     1 
ATOM   7035  C  CA    . PRO C  2  444  ? 51.731  -13.131 81.173  1.00 43.26  ? 444  PRO C CA    1 
ATOM   7036  C  C     . PRO C  2  444  ? 50.254  -12.782 81.092  1.00 52.08  ? 444  PRO C C     1 
ATOM   7037  O  O     . PRO C  2  444  ? 49.472  -13.436 80.403  1.00 53.42  ? 444  PRO C O     1 
ATOM   7038  C  CB    . PRO C  2  444  ? 52.447  -12.596 79.936  1.00 41.16  ? 444  PRO C CB    1 
ATOM   7039  C  CG    . PRO C  2  444  ? 53.428  -13.635 79.579  1.00 47.02  ? 444  PRO C CG    1 
ATOM   7040  C  CD    . PRO C  2  444  ? 52.794  -14.931 79.944  1.00 45.89  ? 444  PRO C CD    1 
ATOM   7041  N  N     . GLU C  2  445  ? 49.887  -11.744 81.826  1.00 57.68  ? 445  GLU C N     1 
ATOM   7042  C  CA    . GLU C  2  445  ? 48.572  -11.146 81.742  1.00 57.63  ? 445  GLU C CA    1 
ATOM   7043  C  C     . GLU C  2  445  ? 48.598  -10.282 80.479  1.00 60.67  ? 445  GLU C C     1 
ATOM   7044  O  O     . GLU C  2  445  ? 49.615  -9.643  80.187  1.00 63.87  ? 445  GLU C O     1 
ATOM   7045  C  CB    . GLU C  2  445  ? 48.379  -10.292 82.990  1.00 56.22  ? 445  GLU C CB    1 
ATOM   7046  C  CG    . GLU C  2  445  ? 46.995  -9.751  83.242  1.00 76.21  ? 445  GLU C CG    1 
ATOM   7047  C  CD    . GLU C  2  445  ? 46.938  -8.972  84.551  1.00 85.92  ? 445  GLU C CD    1 
ATOM   7048  O  OE1   . GLU C  2  445  ? 45.857  -8.439  84.887  1.00 86.12  ? 445  GLU C OE1   1 
ATOM   7049  O  OE2   . GLU C  2  445  ? 47.983  -8.894  85.241  1.00 71.21  ? 445  GLU C OE2   1 
ATOM   7050  N  N     . GLY C  2  446  ? 47.506  -10.253 79.722  1.00 51.76  ? 446  GLY C N     1 
ATOM   7051  C  CA    . GLY C  2  446  ? 47.493  -9.457  78.504  1.00 45.06  ? 446  GLY C CA    1 
ATOM   7052  C  C     . GLY C  2  446  ? 47.725  -10.222 77.213  1.00 50.62  ? 446  GLY C C     1 
ATOM   7053  O  O     . GLY C  2  446  ? 47.481  -11.424 77.139  1.00 51.28  ? 446  GLY C O     1 
ATOM   7054  N  N     . ALA C  2  447  ? 48.167  -9.506  76.182  1.00 52.56  ? 447  ALA C N     1 
ATOM   7055  C  CA    . ALA C  2  447  ? 48.262  -10.044 74.825  1.00 48.18  ? 447  ALA C CA    1 
ATOM   7056  C  C     . ALA C  2  447  ? 49.050  -11.349 74.670  1.00 50.51  ? 447  ALA C C     1 
ATOM   7057  O  O     . ALA C  2  447  ? 48.750  -12.160 73.796  1.00 51.89  ? 447  ALA C O     1 
ATOM   7058  C  CB    . ALA C  2  447  ? 48.809  -8.992  73.887  1.00 49.87  ? 447  ALA C CB    1 
ATOM   7059  N  N     . ASN C  2  448  ? 50.052  -11.555 75.514  1.00 52.92  ? 448  ASN C N     1 
ATOM   7060  C  CA    . ASN C  2  448  ? 50.886  -12.749 75.403  1.00 54.00  ? 448  ASN C CA    1 
ATOM   7061  C  C     . ASN C  2  448  ? 50.348  -13.944 76.186  1.00 53.43  ? 448  ASN C C     1 
ATOM   7062  O  O     . ASN C  2  448  ? 51.004  -14.982 76.250  1.00 52.69  ? 448  ASN C O     1 
ATOM   7063  C  CB    . ASN C  2  448  ? 52.321  -12.459 75.855  1.00 57.06  ? 448  ASN C CB    1 
ATOM   7064  C  CG    . ASN C  2  448  ? 53.107  -11.656 74.839  1.00 56.48  ? 448  ASN C CG    1 
ATOM   7065  O  OD1   . ASN C  2  448  ? 52.975  -11.850 73.632  1.00 56.47  ? 448  ASN C OD1   1 
ATOM   7066  N  ND2   . ASN C  2  448  ? 53.937  -10.746 75.330  1.00 64.92  ? 448  ASN C ND2   1 
ATOM   7067  N  N     . ILE C  2  449  ? 49.173  -13.799 76.791  1.00 48.80  ? 449  ILE C N     1 
ATOM   7068  C  CA    . ILE C  2  449  ? 48.624  -14.862 77.623  1.00 44.53  ? 449  ILE C CA    1 
ATOM   7069  C  C     . ILE C  2  449  ? 48.501  -16.186 76.866  1.00 46.54  ? 449  ILE C C     1 
ATOM   7070  O  O     . ILE C  2  449  ? 47.955  -16.248 75.762  1.00 49.20  ? 449  ILE C O     1 
ATOM   7071  C  CB    . ILE C  2  449  ? 47.272  -14.462 78.277  1.00 49.71  ? 449  ILE C CB    1 
ATOM   7072  C  CG1   . ILE C  2  449  ? 46.892  -15.462 79.373  1.00 44.60  ? 449  ILE C CG1   1 
ATOM   7073  C  CG2   . ILE C  2  449  ? 46.162  -14.318 77.233  1.00 45.71  ? 449  ILE C CG2   1 
ATOM   7074  C  CD1   . ILE C  2  449  ? 45.653  -15.095 80.110  1.00 39.63  ? 449  ILE C CD1   1 
ATOM   7075  N  N     . GLY C  2  450  ? 49.060  -17.237 77.458  1.00 47.73  ? 450  GLY C N     1 
ATOM   7076  C  CA    . GLY C  2  450  ? 49.044  -18.559 76.859  1.00 51.03  ? 450  GLY C CA    1 
ATOM   7077  C  C     . GLY C  2  450  ? 50.141  -18.790 75.829  1.00 53.35  ? 450  GLY C C     1 
ATOM   7078  O  O     . GLY C  2  450  ? 50.422  -19.933 75.470  1.00 56.06  ? 450  GLY C O     1 
ATOM   7079  N  N     . LEU C  2  451  ? 50.732  -17.709 75.325  1.00 50.17  ? 451  LEU C N     1 
ATOM   7080  C  CA    . LEU C  2  451  ? 51.856  -17.803 74.391  1.00 52.45  ? 451  LEU C CA    1 
ATOM   7081  C  C     . LEU C  2  451  ? 53.204  -17.994 75.095  1.00 51.54  ? 451  LEU C C     1 
ATOM   7082  O  O     . LEU C  2  451  ? 54.042  -18.783 74.657  1.00 49.15  ? 451  LEU C O     1 
ATOM   7083  C  CB    . LEU C  2  451  ? 51.899  -16.583 73.474  1.00 51.29  ? 451  LEU C CB    1 
ATOM   7084  C  CG    . LEU C  2  451  ? 50.581  -16.315 72.752  1.00 50.39  ? 451  LEU C CG    1 
ATOM   7085  C  CD1   . LEU C  2  451  ? 50.746  -15.181 71.763  1.00 55.10  ? 451  LEU C CD1   1 
ATOM   7086  C  CD2   . LEU C  2  451  ? 50.087  -17.576 72.064  1.00 48.54  ? 451  LEU C CD2   1 
ATOM   7087  N  N     . ILE C  2  452  ? 53.408  -17.258 76.183  1.00 45.80  ? 452  ILE C N     1 
ATOM   7088  C  CA    . ILE C  2  452  ? 54.602  -17.412 77.004  1.00 45.41  ? 452  ILE C CA    1 
ATOM   7089  C  C     . ILE C  2  452  ? 54.239  -18.191 78.260  1.00 44.11  ? 452  ILE C C     1 
ATOM   7090  O  O     . ILE C  2  452  ? 53.356  -17.797 79.010  1.00 47.66  ? 452  ILE C O     1 
ATOM   7091  C  CB    . ILE C  2  452  ? 55.177  -16.058 77.435  1.00 43.18  ? 452  ILE C CB    1 
ATOM   7092  C  CG1   . ILE C  2  452  ? 55.142  -15.052 76.288  1.00 48.36  ? 452  ILE C CG1   1 
ATOM   7093  C  CG2   . ILE C  2  452  ? 56.568  -16.228 77.904  1.00 40.32  ? 452  ILE C CG2   1 
ATOM   7094  C  CD1   . ILE C  2  452  ? 56.025  -15.414 75.140  1.00 43.93  ? 452  ILE C CD1   1 
ATOM   7095  N  N     . THR C  2  453  ? 54.914  -19.304 78.486  1.00 41.34  ? 453  THR C N     1 
ATOM   7096  C  CA    . THR C  2  453  ? 54.585  -20.165 79.609  1.00 44.54  ? 453  THR C CA    1 
ATOM   7097  C  C     . THR C  2  453  ? 55.847  -20.585 80.351  1.00 47.58  ? 453  THR C C     1 
ATOM   7098  O  O     . THR C  2  453  ? 56.942  -20.137 80.026  1.00 46.02  ? 453  THR C O     1 
ATOM   7099  C  CB    . THR C  2  453  ? 53.758  -21.394 79.164  1.00 52.86  ? 453  THR C CB    1 
ATOM   7100  O  OG1   . THR C  2  453  ? 54.252  -21.890 77.914  1.00 54.25  ? 453  THR C OG1   1 
ATOM   7101  C  CG2   . THR C  2  453  ? 52.283  -21.022 79.002  1.00 51.77  ? 453  THR C CG2   1 
ATOM   7102  N  N     . SER C  2  454  ? 55.700  -21.423 81.367  1.00 48.40  ? 454  SER C N     1 
ATOM   7103  C  CA    . SER C  2  454  ? 56.851  -21.780 82.179  1.00 43.11  ? 454  SER C CA    1 
ATOM   7104  C  C     . SER C  2  454  ? 56.910  -23.274 82.441  1.00 42.91  ? 454  SER C C     1 
ATOM   7105  O  O     . SER C  2  454  ? 55.884  -23.919 82.657  1.00 46.17  ? 454  SER C O     1 
ATOM   7106  C  CB    . SER C  2  454  ? 56.845  -20.998 83.491  1.00 46.63  ? 454  SER C CB    1 
ATOM   7107  O  OG    . SER C  2  454  ? 58.171  -20.714 83.897  1.00 49.90  ? 454  SER C OG    1 
ATOM   7108  N  N     . LEU C  2  455  ? 58.122  -23.817 82.403  1.00 42.09  ? 455  LEU C N     1 
ATOM   7109  C  CA    . LEU C  2  455  ? 58.344  -25.231 82.655  1.00 41.59  ? 455  LEU C CA    1 
ATOM   7110  C  C     . LEU C  2  455  ? 57.940  -25.569 84.082  1.00 42.34  ? 455  LEU C C     1 
ATOM   7111  O  O     . LEU C  2  455  ? 58.249  -24.824 85.016  1.00 41.06  ? 455  LEU C O     1 
ATOM   7112  C  CB    . LEU C  2  455  ? 59.818  -25.566 82.443  1.00 39.76  ? 455  LEU C CB    1 
ATOM   7113  C  CG    . LEU C  2  455  ? 60.179  -27.045 82.345  1.00 44.40  ? 455  LEU C CG    1 
ATOM   7114  C  CD1   . LEU C  2  455  ? 59.490  -27.681 81.145  1.00 39.43  ? 455  LEU C CD1   1 
ATOM   7115  C  CD2   . LEU C  2  455  ? 61.684  -27.219 82.257  1.00 37.10  ? 455  LEU C CD2   1 
ATOM   7116  N  N     . ALA C  2  456  ? 57.241  -26.685 84.253  1.00 41.88  ? 456  ALA C N     1 
ATOM   7117  C  CA    . ALA C  2  456  ? 56.844  -27.120 85.588  1.00 43.20  ? 456  ALA C CA    1 
ATOM   7118  C  C     . ALA C  2  456  ? 58.085  -27.525 86.378  1.00 50.99  ? 456  ALA C C     1 
ATOM   7119  O  O     . ALA C  2  456  ? 59.136  -27.804 85.792  1.00 52.85  ? 456  ALA C O     1 
ATOM   7120  C  CB    . ALA C  2  456  ? 55.848  -28.265 85.510  1.00 42.85  ? 456  ALA C CB    1 
ATOM   7121  N  N     . ALA C  2  457  ? 57.962  -27.551 87.702  1.00 44.69  ? 457  ALA C N     1 
ATOM   7122  C  CA    . ALA C  2  457  ? 59.117  -27.721 88.583  1.00 49.72  ? 457  ALA C CA    1 
ATOM   7123  C  C     . ALA C  2  457  ? 59.859  -29.052 88.423  1.00 49.22  ? 457  ALA C C     1 
ATOM   7124  O  O     . ALA C  2  457  ? 61.085  -29.082 88.418  1.00 45.50  ? 457  ALA C O     1 
ATOM   7125  C  CB    . ALA C  2  457  ? 58.709  -27.502 90.038  1.00 47.53  ? 457  ALA C CB    1 
ATOM   7126  N  N     . TYR C  2  458  ? 59.119  -30.148 88.298  1.00 53.57  ? 458  TYR C N     1 
ATOM   7127  C  CA    . TYR C  2  458  ? 59.735  -31.468 88.182  1.00 54.27  ? 458  TYR C CA    1 
ATOM   7128  C  C     . TYR C  2  458  ? 59.912  -31.911 86.738  1.00 51.11  ? 458  TYR C C     1 
ATOM   7129  O  O     . TYR C  2  458  ? 60.346  -33.031 86.480  1.00 51.88  ? 458  TYR C O     1 
ATOM   7130  C  CB    . TYR C  2  458  ? 58.914  -32.519 88.927  1.00 53.76  ? 458  TYR C CB    1 
ATOM   7131  C  CG    . TYR C  2  458  ? 59.250  -32.666 90.392  1.00 55.19  ? 458  TYR C CG    1 
ATOM   7132  C  CD1   . TYR C  2  458  ? 58.423  -32.130 91.371  1.00 53.90  ? 458  TYR C CD1   1 
ATOM   7133  C  CD2   . TYR C  2  458  ? 60.387  -33.352 90.797  1.00 57.92  ? 458  TYR C CD2   1 
ATOM   7134  C  CE1   . TYR C  2  458  ? 58.718  -32.274 92.713  1.00 51.98  ? 458  TYR C CE1   1 
ATOM   7135  C  CE2   . TYR C  2  458  ? 60.695  -33.497 92.139  1.00 53.14  ? 458  TYR C CE2   1 
ATOM   7136  C  CZ    . TYR C  2  458  ? 59.855  -32.957 93.089  1.00 52.56  ? 458  TYR C CZ    1 
ATOM   7137  O  OH    . TYR C  2  458  ? 60.150  -33.093 94.422  1.00 55.25  ? 458  TYR C OH    1 
ATOM   7138  N  N     . ALA C  2  459  ? 59.564  -31.040 85.801  1.00 49.89  ? 459  ALA C N     1 
ATOM   7139  C  CA    . ALA C  2  459  ? 59.600  -31.391 84.386  1.00 51.16  ? 459  ALA C CA    1 
ATOM   7140  C  C     . ALA C  2  459  ? 61.006  -31.358 83.785  1.00 52.15  ? 459  ALA C C     1 
ATOM   7141  O  O     . ALA C  2  459  ? 61.852  -30.551 84.179  1.00 51.26  ? 459  ALA C O     1 
ATOM   7142  C  CB    . ALA C  2  459  ? 58.671  -30.481 83.599  1.00 43.79  ? 459  ALA C CB    1 
ATOM   7143  N  N     . ARG C  2  460  ? 61.250  -32.249 82.830  1.00 51.58  ? 460  ARG C N     1 
ATOM   7144  C  CA    . ARG C  2  460  ? 62.437  -32.151 81.990  1.00 53.97  ? 460  ARG C CA    1 
ATOM   7145  C  C     . ARG C  2  460  ? 62.115  -32.460 80.536  1.00 45.63  ? 460  ARG C C     1 
ATOM   7146  O  O     . ARG C  2  460  ? 61.240  -33.270 80.237  1.00 43.85  ? 460  ARG C O     1 
ATOM   7147  C  CB    . ARG C  2  460  ? 63.584  -33.032 82.491  1.00 62.85  ? 460  ARG C CB    1 
ATOM   7148  C  CG    . ARG C  2  460  ? 63.158  -34.279 83.231  1.00 68.45  ? 460  ARG C CG    1 
ATOM   7149  C  CD    . ARG C  2  460  ? 64.238  -35.363 83.179  1.00 80.58  ? 460  ARG C CD    1 
ATOM   7150  N  NE    . ARG C  2  460  ? 65.557  -34.873 83.574  1.00 89.41  ? 460  ARG C NE    1 
ATOM   7151  C  CZ    . ARG C  2  460  ? 66.022  -34.877 84.822  1.00 85.45  ? 460  ARG C CZ    1 
ATOM   7152  N  NH1   . ARG C  2  460  ? 65.274  -35.344 85.813  1.00 75.73  ? 460  ARG C NH1   1 
ATOM   7153  N  NH2   . ARG C  2  460  ? 67.238  -34.412 85.080  1.00 84.56  ? 460  ARG C NH2   1 
ATOM   7154  N  N     . VAL C  2  461  ? 62.823  -31.781 79.642  1.00 45.17  ? 461  VAL C N     1 
ATOM   7155  C  CA    . VAL C  2  461  ? 62.671  -31.978 78.210  1.00 47.33  ? 461  VAL C CA    1 
ATOM   7156  C  C     . VAL C  2  461  ? 63.583  -33.114 77.754  1.00 46.00  ? 461  VAL C C     1 
ATOM   7157  O  O     . VAL C  2  461  ? 64.797  -33.048 77.948  1.00 50.98  ? 461  VAL C O     1 
ATOM   7158  C  CB    . VAL C  2  461  ? 63.055  -30.695 77.447  1.00 43.54  ? 461  VAL C CB    1 
ATOM   7159  C  CG1   . VAL C  2  461  ? 62.825  -30.869 75.953  1.00 44.20  ? 461  VAL C CG1   1 
ATOM   7160  C  CG2   . VAL C  2  461  ? 62.278  -29.502 77.986  1.00 43.53  ? 461  VAL C CG2   1 
ATOM   7161  N  N     . ASP C  2  462  ? 63.011  -34.155 77.155  1.00 43.60  ? 462  ASP C N     1 
ATOM   7162  C  CA    . ASP C  2  462  ? 63.820  -35.270 76.669  1.00 49.38  ? 462  ASP C CA    1 
ATOM   7163  C  C     . ASP C  2  462  ? 64.625  -34.950 75.393  1.00 57.81  ? 462  ASP C C     1 
ATOM   7164  O  O     . ASP C  2  462  ? 64.572  -33.833 74.870  1.00 53.58  ? 462  ASP C O     1 
ATOM   7165  C  CB    . ASP C  2  462  ? 62.982  -36.549 76.508  1.00 52.84  ? 462  ASP C CB    1 
ATOM   7166  C  CG    . ASP C  2  462  ? 61.933  -36.451 75.402  1.00 59.93  ? 462  ASP C CG    1 
ATOM   7167  O  OD1   . ASP C  2  462  ? 62.080  -35.619 74.482  1.00 59.49  ? 462  ASP C OD1   1 
ATOM   7168  O  OD2   . ASP C  2  462  ? 60.958  -37.237 75.443  1.00 59.48  ? 462  ASP C OD2   1 
ATOM   7169  N  N     . GLU C  2  463  ? 65.361  -35.942 74.899  1.00 62.79  ? 463  GLU C N     1 
ATOM   7170  C  CA    . GLU C  2  463  ? 66.264  -35.745 73.768  1.00 69.02  ? 463  GLU C CA    1 
ATOM   7171  C  C     . GLU C  2  463  ? 65.504  -35.434 72.485  1.00 64.13  ? 463  GLU C C     1 
ATOM   7172  O  O     . GLU C  2  463  ? 66.022  -34.760 71.590  1.00 60.49  ? 463  GLU C O     1 
ATOM   7173  C  CB    . GLU C  2  463  ? 67.157  -36.974 73.582  1.00 80.07  ? 463  GLU C CB    1 
ATOM   7174  C  CG    . GLU C  2  463  ? 67.984  -37.315 74.819  1.00 102.94 ? 463  GLU C CG    1 
ATOM   7175  C  CD    . GLU C  2  463  ? 68.643  -38.680 74.732  1.00 125.95 ? 463  GLU C CD    1 
ATOM   7176  O  OE1   . GLU C  2  463  ? 68.733  -39.360 75.780  1.00 115.18 ? 463  GLU C OE1   1 
ATOM   7177  O  OE2   . GLU C  2  463  ? 69.071  -39.070 73.622  1.00 124.64 ? 463  GLU C OE2   1 
ATOM   7178  N  N     . LEU C  2  464  ? 64.271  -35.925 72.412  1.00 58.97  ? 464  LEU C N     1 
ATOM   7179  C  CA    . LEU C  2  464  ? 63.400  -35.680 71.271  1.00 55.14  ? 464  LEU C CA    1 
ATOM   7180  C  C     . LEU C  2  464  ? 62.714  -34.317 71.353  1.00 51.30  ? 464  LEU C C     1 
ATOM   7181  O  O     . LEU C  2  464  ? 62.203  -33.806 70.357  1.00 52.15  ? 464  LEU C O     1 
ATOM   7182  C  CB    . LEU C  2  464  ? 62.359  -36.794 71.159  1.00 58.83  ? 464  LEU C CB    1 
ATOM   7183  C  CG    . LEU C  2  464  ? 62.529  -37.784 70.004  1.00 58.17  ? 464  LEU C CG    1 
ATOM   7184  C  CD1   . LEU C  2  464  ? 63.984  -37.886 69.554  1.00 58.58  ? 464  LEU C CD1   1 
ATOM   7185  C  CD2   . LEU C  2  464  ? 61.967  -39.146 70.380  1.00 54.66  ? 464  LEU C CD2   1 
ATOM   7186  N  N     . GLY C  2  465  ? 62.701  -33.733 72.546  1.00 56.51  ? 465  GLY C N     1 
ATOM   7187  C  CA    . GLY C  2  465  ? 62.126  -32.413 72.737  1.00 58.51  ? 465  GLY C CA    1 
ATOM   7188  C  C     . GLY C  2  465  ? 60.745  -32.374 73.366  1.00 48.74  ? 465  GLY C C     1 
ATOM   7189  O  O     . GLY C  2  465  ? 60.110  -31.324 73.404  1.00 51.27  ? 465  GLY C O     1 
ATOM   7190  N  N     . PHE C  2  466  ? 60.272  -33.518 73.846  1.00 49.74  ? 466  PHE C N     1 
ATOM   7191  C  CA    . PHE C  2  466  ? 58.982  -33.585 74.521  1.00 48.78  ? 466  PHE C CA    1 
ATOM   7192  C  C     . PHE C  2  466  ? 59.159  -33.443 76.026  1.00 51.95  ? 466  PHE C C     1 
ATOM   7193  O  O     . PHE C  2  466  ? 60.096  -33.989 76.608  1.00 53.21  ? 466  PHE C O     1 
ATOM   7194  C  CB    . PHE C  2  466  ? 58.264  -34.894 74.195  1.00 47.01  ? 466  PHE C CB    1 
ATOM   7195  C  CG    . PHE C  2  466  ? 58.025  -35.101 72.733  1.00 52.61  ? 466  PHE C CG    1 
ATOM   7196  C  CD1   . PHE C  2  466  ? 58.680  -36.105 72.045  1.00 58.46  ? 466  PHE C CD1   1 
ATOM   7197  C  CD2   . PHE C  2  466  ? 57.157  -34.279 72.039  1.00 53.96  ? 466  PHE C CD2   1 
ATOM   7198  C  CE1   . PHE C  2  466  ? 58.463  -36.294 70.696  1.00 60.00  ? 466  PHE C CE1   1 
ATOM   7199  C  CE2   . PHE C  2  466  ? 56.941  -34.459 70.689  1.00 53.19  ? 466  PHE C CE2   1 
ATOM   7200  C  CZ    . PHE C  2  466  ? 57.591  -35.470 70.017  1.00 57.95  ? 466  PHE C CZ    1 
ATOM   7201  N  N     . ILE C  2  467  ? 58.258  -32.703 76.658  1.00 50.82  ? 467  ILE C N     1 
ATOM   7202  C  CA    . ILE C  2  467  ? 58.350  -32.477 78.091  1.00 50.15  ? 467  ILE C CA    1 
ATOM   7203  C  C     . ILE C  2  467  ? 57.843  -33.704 78.841  1.00 52.75  ? 467  ILE C C     1 
ATOM   7204  O  O     . ILE C  2  467  ? 56.745  -34.198 78.574  1.00 51.86  ? 467  ILE C O     1 
ATOM   7205  C  CB    . ILE C  2  467  ? 57.561  -31.227 78.516  1.00 46.35  ? 467  ILE C CB    1 
ATOM   7206  C  CG1   . ILE C  2  467  ? 57.895  -30.057 77.592  1.00 45.25  ? 467  ILE C CG1   1 
ATOM   7207  C  CG2   . ILE C  2  467  ? 57.869  -30.869 79.959  1.00 49.07  ? 467  ILE C CG2   1 
ATOM   7208  C  CD1   . ILE C  2  467  ? 57.079  -28.819 77.854  1.00 46.21  ? 467  ILE C CD1   1 
ATOM   7209  N  N     . ARG C  2  468  ? 58.658  -34.204 79.765  1.00 52.64  ? 468  ARG C N     1 
ATOM   7210  C  CA    . ARG C  2  468  ? 58.291  -35.368 80.557  1.00 47.24  ? 468  ARG C CA    1 
ATOM   7211  C  C     . ARG C  2  468  ? 58.106  -34.982 82.014  1.00 48.50  ? 468  ARG C C     1 
ATOM   7212  O  O     . ARG C  2  468  ? 58.726  -34.036 82.498  1.00 49.98  ? 468  ARG C O     1 
ATOM   7213  C  CB    . ARG C  2  468  ? 59.340  -36.472 80.432  1.00 46.11  ? 468  ARG C CB    1 
ATOM   7214  C  CG    . ARG C  2  468  ? 59.609  -36.910 79.004  1.00 56.30  ? 468  ARG C CG    1 
ATOM   7215  C  CD    . ARG C  2  468  ? 60.790  -37.870 78.926  1.00 58.96  ? 468  ARG C CD    1 
ATOM   7216  N  NE    . ARG C  2  468  ? 60.365  -39.261 78.858  1.00 56.12  ? 468  ARG C NE    1 
ATOM   7217  C  CZ    . ARG C  2  468  ? 60.359  -39.986 77.744  1.00 64.97  ? 468  ARG C CZ    1 
ATOM   7218  N  NH1   . ARG C  2  468  ? 60.765  -39.453 76.598  1.00 58.01  ? 468  ARG C NH1   1 
ATOM   7219  N  NH2   . ARG C  2  468  ? 59.947  -41.245 77.775  1.00 81.58  ? 468  ARG C NH2   1 
ATOM   7220  N  N     . THR C  2  469  ? 57.239  -35.718 82.701  1.00 49.66  ? 469  THR C N     1 
ATOM   7221  C  CA    . THR C  2  469  ? 56.966  -35.489 84.113  1.00 52.84  ? 469  THR C CA    1 
ATOM   7222  C  C     . THR C  2  469  ? 57.058  -36.826 84.851  1.00 54.01  ? 469  THR C C     1 
ATOM   7223  O  O     . THR C  2  469  ? 56.665  -37.859 84.309  1.00 52.46  ? 469  THR C O     1 
ATOM   7224  C  CB    . THR C  2  469  ? 55.575  -34.823 84.314  1.00 52.86  ? 469  THR C CB    1 
ATOM   7225  O  OG1   . THR C  2  469  ? 55.340  -34.572 85.701  1.00 50.54  ? 469  THR C OG1   1 
ATOM   7226  C  CG2   . THR C  2  469  ? 54.462  -35.700 83.773  1.00 58.10  ? 469  THR C CG2   1 
ATOM   7227  N  N     . PRO C  2  470  ? 57.612  -36.817 86.075  1.00 51.94  ? 470  PRO C N     1 
ATOM   7228  C  CA    . PRO C  2  470  ? 57.841  -38.050 86.835  1.00 52.00  ? 470  PRO C CA    1 
ATOM   7229  C  C     . PRO C  2  470  ? 56.588  -38.630 87.490  1.00 57.54  ? 470  PRO C C     1 
ATOM   7230  O  O     . PRO C  2  470  ? 55.732  -37.884 87.951  1.00 60.84  ? 470  PRO C O     1 
ATOM   7231  C  CB    . PRO C  2  470  ? 58.825  -37.601 87.915  1.00 54.41  ? 470  PRO C CB    1 
ATOM   7232  C  CG    . PRO C  2  470  ? 58.477  -36.181 88.145  1.00 54.80  ? 470  PRO C CG    1 
ATOM   7233  C  CD    . PRO C  2  470  ? 58.106  -35.633 86.798  1.00 56.31  ? 470  PRO C CD    1 
ATOM   7234  N  N     . TYR C  2  471  ? 56.501  -39.955 87.541  1.00 59.49  ? 471  TYR C N     1 
ATOM   7235  C  CA    . TYR C  2  471  ? 55.464  -40.641 88.306  1.00 58.70  ? 471  TYR C CA    1 
ATOM   7236  C  C     . TYR C  2  471  ? 56.058  -41.848 89.021  1.00 66.07  ? 471  TYR C C     1 
ATOM   7237  O  O     . TYR C  2  471  ? 56.994  -42.463 88.531  1.00 62.87  ? 471  TYR C O     1 
ATOM   7238  C  CB    . TYR C  2  471  ? 54.330  -41.115 87.402  1.00 58.68  ? 471  TYR C CB    1 
ATOM   7239  C  CG    . TYR C  2  471  ? 53.534  -40.013 86.744  1.00 64.71  ? 471  TYR C CG    1 
ATOM   7240  C  CD1   . TYR C  2  471  ? 53.670  -39.750 85.389  1.00 65.00  ? 471  TYR C CD1   1 
ATOM   7241  C  CD2   . TYR C  2  471  ? 52.639  -39.241 87.475  1.00 65.01  ? 471  TYR C CD2   1 
ATOM   7242  C  CE1   . TYR C  2  471  ? 52.941  -38.749 84.779  1.00 67.87  ? 471  TYR C CE1   1 
ATOM   7243  C  CE2   . TYR C  2  471  ? 51.904  -38.233 86.872  1.00 60.66  ? 471  TYR C CE2   1 
ATOM   7244  C  CZ    . TYR C  2  471  ? 52.060  -37.994 85.524  1.00 62.12  ? 471  TYR C CZ    1 
ATOM   7245  O  OH    . TYR C  2  471  ? 51.339  -36.999 84.912  1.00 59.93  ? 471  TYR C OH    1 
ATOM   7246  N  N     . ARG C  2  472  ? 55.506  -42.187 90.179  1.00 67.40  ? 472  ARG C N     1 
ATOM   7247  C  CA    . ARG C  2  472  ? 55.927  -43.365 90.923  1.00 64.17  ? 472  ARG C CA    1 
ATOM   7248  C  C     . ARG C  2  472  ? 55.164  -44.600 90.477  1.00 68.49  ? 472  ARG C C     1 
ATOM   7249  O  O     . ARG C  2  472  ? 53.951  -44.554 90.314  1.00 67.15  ? 472  ARG C O     1 
ATOM   7250  C  CB    . ARG C  2  472  ? 55.688  -43.155 92.410  1.00 65.18  ? 472  ARG C CB    1 
ATOM   7251  C  CG    . ARG C  2  472  ? 56.614  -42.161 93.047  1.00 68.70  ? 472  ARG C CG    1 
ATOM   7252  C  CD    . ARG C  2  472  ? 56.877  -42.569 94.472  1.00 79.40  ? 472  ARG C CD    1 
ATOM   7253  N  NE    . ARG C  2  472  ? 55.927  -41.986 95.408  1.00 78.64  ? 472  ARG C NE    1 
ATOM   7254  C  CZ    . ARG C  2  472  ? 55.845  -42.334 96.687  1.00 84.51  ? 472  ARG C CZ    1 
ATOM   7255  N  NH1   . ARG C  2  472  ? 56.641  -43.278 97.170  1.00 78.62  ? 472  ARG C NH1   1 
ATOM   7256  N  NH2   . ARG C  2  472  ? 54.958  -41.749 97.478  1.00 90.64  ? 472  ARG C NH2   1 
ATOM   7257  N  N     . ARG C  2  473  ? 55.874  -45.707 90.286  1.00 74.70  ? 473  ARG C N     1 
ATOM   7258  C  CA    . ARG C  2  473  ? 55.224  -46.962 89.936  1.00 73.66  ? 473  ARG C CA    1 
ATOM   7259  C  C     . ARG C  2  473  ? 54.425  -47.476 91.126  1.00 73.43  ? 473  ARG C C     1 
ATOM   7260  O  O     . ARG C  2  473  ? 54.859  -47.360 92.273  1.00 70.26  ? 473  ARG C O     1 
ATOM   7261  C  CB    . ARG C  2  473  ? 56.258  -48.007 89.506  1.00 73.79  ? 473  ARG C CB    1 
ATOM   7262  C  CG    . ARG C  2  473  ? 55.667  -49.359 89.122  1.00 76.81  ? 473  ARG C CG    1 
ATOM   7263  C  CD    . ARG C  2  473  ? 55.670  -49.568 87.617  1.00 78.62  ? 473  ARG C CD    1 
ATOM   7264  N  NE    . ARG C  2  473  ? 57.019  -49.458 87.068  1.00 85.01  ? 473  ARG C NE    1 
ATOM   7265  C  CZ    . ARG C  2  473  ? 57.306  -49.446 85.770  1.00 89.54  ? 473  ARG C CZ    1 
ATOM   7266  N  NH1   . ARG C  2  473  ? 56.334  -49.539 84.870  1.00 83.45  ? 473  ARG C NH1   1 
ATOM   7267  N  NH2   . ARG C  2  473  ? 58.567  -49.338 85.370  1.00 93.16  ? 473  ARG C NH2   1 
ATOM   7268  N  N     . VAL C  2  474  ? 53.247  -48.026 90.850  1.00 74.80  ? 474  VAL C N     1 
ATOM   7269  C  CA    . VAL C  2  474  ? 52.438  -48.659 91.882  1.00 76.48  ? 474  VAL C CA    1 
ATOM   7270  C  C     . VAL C  2  474  ? 52.116  -50.089 91.469  1.00 79.55  ? 474  VAL C C     1 
ATOM   7271  O  O     . VAL C  2  474  ? 51.419  -50.317 90.482  1.00 76.64  ? 474  VAL C O     1 
ATOM   7272  C  CB    . VAL C  2  474  ? 51.126  -47.890 92.141  1.00 69.89  ? 474  VAL C CB    1 
ATOM   7273  C  CG1   . VAL C  2  474  ? 50.243  -48.661 93.098  1.00 74.66  ? 474  VAL C CG1   1 
ATOM   7274  C  CG2   . VAL C  2  474  ? 51.419  -46.510 92.697  1.00 71.45  ? 474  VAL C CG2   1 
ATOM   7275  N  N     . VAL C  2  475  ? 52.637  -51.051 92.223  1.00 88.64  ? 475  VAL C N     1 
ATOM   7276  C  CA    . VAL C  2  475  ? 52.385  -52.459 91.941  1.00 90.00  ? 475  VAL C CA    1 
ATOM   7277  C  C     . VAL C  2  475  ? 51.544  -53.065 93.057  1.00 87.33  ? 475  VAL C C     1 
ATOM   7278  O  O     . VAL C  2  475  ? 51.875  -52.930 94.239  1.00 82.20  ? 475  VAL C O     1 
ATOM   7279  C  CB    . VAL C  2  475  ? 53.692  -53.255 91.791  1.00 91.90  ? 475  VAL C CB    1 
ATOM   7280  C  CG1   . VAL C  2  475  ? 53.386  -54.684 91.375  1.00 95.47  ? 475  VAL C CG1   1 
ATOM   7281  C  CG2   . VAL C  2  475  ? 54.609  -52.586 90.775  1.00 80.16  ? 475  VAL C CG2   1 
ATOM   7282  N  N     . GLY C  2  476  ? 50.460  -53.736 92.679  1.00 87.81  ? 476  GLY C N     1 
ATOM   7283  C  CA    . GLY C  2  476  ? 49.488  -54.186 93.655  1.00 83.35  ? 476  GLY C CA    1 
ATOM   7284  C  C     . GLY C  2  476  ? 48.864  -52.951 94.265  1.00 86.07  ? 476  GLY C C     1 
ATOM   7285  O  O     . GLY C  2  476  ? 48.309  -52.113 93.553  1.00 94.47  ? 476  GLY C O     1 
ATOM   7286  N  N     . GLY C  2  477  ? 48.948  -52.838 95.583  1.00 85.27  ? 477  GLY C N     1 
ATOM   7287  C  CA    . GLY C  2  477  ? 48.553  -51.618 96.259  1.00 86.17  ? 477  GLY C CA    1 
ATOM   7288  C  C     . GLY C  2  477  ? 49.766  -50.880 96.788  1.00 91.27  ? 477  GLY C C     1 
ATOM   7289  O  O     . GLY C  2  477  ? 49.636  -49.903 97.526  1.00 97.16  ? 477  GLY C O     1 
ATOM   7290  N  N     . VAL C  2  478  ? 50.951  -51.350 96.410  1.00 88.34  ? 478  VAL C N     1 
ATOM   7291  C  CA    . VAL C  2  478  ? 52.195  -50.820 96.959  1.00 87.58  ? 478  VAL C CA    1 
ATOM   7292  C  C     . VAL C  2  478  ? 52.848  -49.785 96.046  1.00 85.48  ? 478  VAL C C     1 
ATOM   7293  O  O     . VAL C  2  478  ? 53.045  -50.025 94.855  1.00 80.95  ? 478  VAL C O     1 
ATOM   7294  C  CB    . VAL C  2  478  ? 53.204  -51.950 97.260  1.00 85.24  ? 478  VAL C CB    1 
ATOM   7295  C  CG1   . VAL C  2  478  ? 54.514  -51.374 97.770  1.00 88.91  ? 478  VAL C CG1   1 
ATOM   7296  C  CG2   . VAL C  2  478  ? 52.621  -52.920 98.272  1.00 93.73  ? 478  VAL C CG2   1 
ATOM   7297  N  N     . VAL C  2  479  ? 53.181  -48.634 96.620  1.00 81.65  ? 479  VAL C N     1 
ATOM   7298  C  CA    . VAL C  2  479  ? 53.844  -47.571 95.884  1.00 76.34  ? 479  VAL C CA    1 
ATOM   7299  C  C     . VAL C  2  479  ? 55.355  -47.714 96.004  1.00 79.93  ? 479  VAL C C     1 
ATOM   7300  O  O     . VAL C  2  479  ? 55.913  -47.600 97.093  1.00 80.67  ? 479  VAL C O     1 
ATOM   7301  C  CB    . VAL C  2  479  ? 53.437  -46.195 96.422  1.00 74.80  ? 479  VAL C CB    1 
ATOM   7302  C  CG1   . VAL C  2  479  ? 54.053  -45.097 95.578  1.00 78.08  ? 479  VAL C CG1   1 
ATOM   7303  C  CG2   . VAL C  2  479  ? 51.929  -46.068 96.447  1.00 75.53  ? 479  VAL C CG2   1 
ATOM   7304  N  N     . THR C  2  480  ? 56.018  -47.963 94.881  1.00 81.31  ? 480  THR C N     1 
ATOM   7305  C  CA    . THR C  2  480  ? 57.464  -48.113 94.886  1.00 80.94  ? 480  THR C CA    1 
ATOM   7306  C  C     . THR C  2  480  ? 58.100  -46.743 95.042  1.00 84.99  ? 480  THR C C     1 
ATOM   7307  O  O     . THR C  2  480  ? 57.405  -45.728 95.066  1.00 83.66  ? 480  THR C O     1 
ATOM   7308  C  CB    . THR C  2  480  ? 57.966  -48.733 93.570  1.00 81.44  ? 480  THR C CB    1 
ATOM   7309  O  OG1   . THR C  2  480  ? 56.926  -49.521 92.979  1.00 81.11  ? 480  THR C OG1   1 
ATOM   7310  C  CG2   . THR C  2  480  ? 59.194  -49.608 93.815  1.00 87.78  ? 480  THR C CG2   1 
ATOM   7311  N  N     . ASP C  2  481  ? 59.421  -46.714 95.160  1.00 87.55  ? 481  ASP C N     1 
ATOM   7312  C  CA    . ASP C  2  481  ? 60.152  -45.459 95.118  1.00 83.31  ? 481  ASP C CA    1 
ATOM   7313  C  C     . ASP C  2  481  ? 60.732  -45.227 93.730  1.00 86.90  ? 481  ASP C C     1 
ATOM   7314  O  O     . ASP C  2  481  ? 61.420  -44.233 93.499  1.00 89.90  ? 481  ASP C O     1 
ATOM   7315  C  CB    . ASP C  2  481  ? 61.246  -45.418 96.185  1.00 92.28  ? 481  ASP C CB    1 
ATOM   7316  C  CG    . ASP C  2  481  ? 60.688  -45.205 97.581  1.00 100.36 ? 481  ASP C CG    1 
ATOM   7317  O  OD1   . ASP C  2  481  ? 59.487  -44.882 97.698  1.00 99.63  ? 481  ASP C OD1   1 
ATOM   7318  O  OD2   . ASP C  2  481  ? 61.448  -45.348 98.562  1.00 105.98 ? 481  ASP C OD2   1 
ATOM   7319  N  N     . GLU C  2  482  ? 60.458  -46.149 92.808  1.00 85.54  ? 482  GLU C N     1 
ATOM   7320  C  CA    . GLU C  2  482  ? 60.974  -46.021 91.447  1.00 84.47  ? 482  GLU C CA    1 
ATOM   7321  C  C     . GLU C  2  482  ? 60.140  -45.054 90.603  1.00 81.11  ? 482  GLU C C     1 
ATOM   7322  O  O     . GLU C  2  482  ? 58.918  -45.187 90.495  1.00 75.43  ? 482  GLU C O     1 
ATOM   7323  C  CB    . GLU C  2  482  ? 61.135  -47.387 90.760  1.00 80.80  ? 482  GLU C CB    1 
ATOM   7324  C  CG    . GLU C  2  482  ? 59.855  -48.059 90.292  1.00 82.28  ? 482  GLU C CG    1 
ATOM   7325  C  CD    . GLU C  2  482  ? 59.958  -48.581 88.860  1.00 91.43  ? 482  GLU C CD    1 
ATOM   7326  O  OE1   . GLU C  2  482  ? 60.861  -48.139 88.117  1.00 85.12  ? 482  GLU C OE1   1 
ATOM   7327  O  OE2   . GLU C  2  482  ? 59.133  -49.434 88.474  1.00 93.76  ? 482  GLU C OE2   1 
ATOM   7328  N  N     . VAL C  2  483  ? 60.816  -44.065 90.026  1.00 79.93  ? 483  VAL C N     1 
ATOM   7329  C  CA    . VAL C  2  483  ? 60.143  -43.031 89.253  1.00 74.57  ? 483  VAL C CA    1 
ATOM   7330  C  C     . VAL C  2  483  ? 60.393  -43.174 87.755  1.00 63.89  ? 483  VAL C C     1 
ATOM   7331  O  O     . VAL C  2  483  ? 61.506  -43.450 87.312  1.00 62.31  ? 483  VAL C O     1 
ATOM   7332  C  CB    . VAL C  2  483  ? 60.518  -41.607 89.734  1.00 70.85  ? 483  VAL C CB    1 
ATOM   7333  C  CG1   . VAL C  2  483  ? 60.172  -41.445 91.200  1.00 65.74  ? 483  VAL C CG1   1 
ATOM   7334  C  CG2   . VAL C  2  483  ? 61.998  -41.322 89.500  1.00 83.50  ? 483  VAL C CG2   1 
ATOM   7335  N  N     . VAL C  2  484  ? 59.328  -42.998 86.988  1.00 62.28  ? 484  VAL C N     1 
ATOM   7336  C  CA    . VAL C  2  484  ? 59.378  -43.056 85.542  1.00 62.82  ? 484  VAL C CA    1 
ATOM   7337  C  C     . VAL C  2  484  ? 58.981  -41.699 84.988  1.00 60.05  ? 484  VAL C C     1 
ATOM   7338  O  O     . VAL C  2  484  ? 57.899  -41.199 85.294  1.00 60.43  ? 484  VAL C O     1 
ATOM   7339  C  CB    . VAL C  2  484  ? 58.389  -44.101 85.007  1.00 55.93  ? 484  VAL C CB    1 
ATOM   7340  C  CG1   . VAL C  2  484  ? 58.388  -44.109 83.485  1.00 58.41  ? 484  VAL C CG1   1 
ATOM   7341  C  CG2   . VAL C  2  484  ? 58.723  -45.471 85.563  1.00 60.85  ? 484  VAL C CG2   1 
ATOM   7342  N  N     . TYR C  2  485  ? 59.858  -41.092 84.194  1.00 56.12  ? 485  TYR C N     1 
ATOM   7343  C  CA    . TYR C  2  485  ? 59.508  -39.862 83.504  1.00 50.20  ? 485  TYR C CA    1 
ATOM   7344  C  C     . TYR C  2  485  ? 58.735  -40.199 82.236  1.00 55.41  ? 485  TYR C C     1 
ATOM   7345  O  O     . TYR C  2  485  ? 59.230  -40.923 81.373  1.00 59.64  ? 485  TYR C O     1 
ATOM   7346  C  CB    . TYR C  2  485  ? 60.756  -39.050 83.182  1.00 48.62  ? 485  TYR C CB    1 
ATOM   7347  C  CG    . TYR C  2  485  ? 61.200  -38.150 84.303  1.00 50.29  ? 485  TYR C CG    1 
ATOM   7348  C  CD1   . TYR C  2  485  ? 62.030  -38.618 85.308  1.00 56.21  ? 485  TYR C CD1   1 
ATOM   7349  C  CD2   . TYR C  2  485  ? 60.788  -36.827 84.357  1.00 56.93  ? 485  TYR C CD2   1 
ATOM   7350  C  CE1   . TYR C  2  485  ? 62.437  -37.791 86.342  1.00 61.70  ? 485  TYR C CE1   1 
ATOM   7351  C  CE2   . TYR C  2  485  ? 61.189  -35.992 85.383  1.00 61.80  ? 485  TYR C CE2   1 
ATOM   7352  C  CZ    . TYR C  2  485  ? 62.013  -36.477 86.373  1.00 62.82  ? 485  TYR C CZ    1 
ATOM   7353  O  OH    . TYR C  2  485  ? 62.410  -35.644 87.393  1.00 56.48  ? 485  TYR C OH    1 
ATOM   7354  N  N     . MET C  2  486  ? 57.515  -39.682 82.127  1.00 53.48  ? 486  MET C N     1 
ATOM   7355  C  CA    . MET C  2  486  ? 56.659  -40.014 80.993  1.00 56.58  ? 486  MET C CA    1 
ATOM   7356  C  C     . MET C  2  486  ? 56.339  -38.814 80.118  1.00 57.81  ? 486  MET C C     1 
ATOM   7357  O  O     . MET C  2  486  ? 56.178  -37.703 80.613  1.00 58.97  ? 486  MET C O     1 
ATOM   7358  C  CB    . MET C  2  486  ? 55.347  -40.633 81.474  1.00 62.26  ? 486  MET C CB    1 
ATOM   7359  C  CG    . MET C  2  486  ? 55.490  -41.986 82.132  1.00 68.71  ? 486  MET C CG    1 
ATOM   7360  S  SD    . MET C  2  486  ? 53.888  -42.680 82.559  1.00 62.74  ? 486  MET C SD    1 
ATOM   7361  C  CE    . MET C  2  486  ? 54.165  -43.059 84.275  1.00 64.48  ? 486  MET C CE    1 
ATOM   7362  N  N     . THR C  2  487  ? 56.238  -39.045 78.813  1.00 60.98  ? 487  THR C N     1 
ATOM   7363  C  CA    . THR C  2  487  ? 55.701  -38.031 77.924  1.00 55.58  ? 487  THR C CA    1 
ATOM   7364  C  C     . THR C  2  487  ? 54.197  -38.079 78.078  1.00 53.53  ? 487  THR C C     1 
ATOM   7365  O  O     . THR C  2  487  ? 53.672  -38.990 78.708  1.00 56.49  ? 487  THR C O     1 
ATOM   7366  C  CB    . THR C  2  487  ? 56.040  -38.339 76.463  1.00 52.47  ? 487  THR C CB    1 
ATOM   7367  O  OG1   . THR C  2  487  ? 55.401  -39.558 76.077  1.00 53.87  ? 487  THR C OG1   1 
ATOM   7368  C  CG2   . THR C  2  487  ? 57.533  -38.484 76.289  1.00 52.44  ? 487  THR C CG2   1 
ATOM   7369  N  N     . ALA C  2  488  ? 53.500  -37.135 77.458  1.00 55.52  ? 488  ALA C N     1 
ATOM   7370  C  CA    . ALA C  2  488  ? 52.049  -37.057 77.589  1.00 57.30  ? 488  ALA C CA    1 
ATOM   7371  C  C     . ALA C  2  488  ? 51.393  -38.268 76.941  1.00 60.60  ? 488  ALA C C     1 
ATOM   7372  O  O     . ALA C  2  488  ? 50.426  -38.836 77.473  1.00 61.83  ? 488  ALA C O     1 
ATOM   7373  C  CB    . ALA C  2  488  ? 51.531  -35.772 76.968  1.00 50.87  ? 488  ALA C CB    1 
ATOM   7374  N  N     . THR C  2  489  ? 51.943  -38.664 75.797  1.00 58.49  ? 489  THR C N     1 
ATOM   7375  C  CA    . THR C  2  489  ? 51.416  -39.782 75.028  1.00 58.91  ? 489  THR C CA    1 
ATOM   7376  C  C     . THR C  2  489  ? 51.479  -41.076 75.823  1.00 61.58  ? 489  THR C C     1 
ATOM   7377  O  O     . THR C  2  489  ? 50.510  -41.833 75.865  1.00 64.42  ? 489  THR C O     1 
ATOM   7378  C  CB    . THR C  2  489  ? 52.180  -39.971 73.709  1.00 56.65  ? 489  THR C CB    1 
ATOM   7379  O  OG1   . THR C  2  489  ? 52.229  -38.727 72.999  1.00 63.53  ? 489  THR C OG1   1 
ATOM   7380  C  CG2   . THR C  2  489  ? 51.491  -41.005 72.846  1.00 57.95  ? 489  THR C CG2   1 
ATOM   7381  N  N     . GLU C  2  490  ? 52.618  -41.326 76.460  1.00 62.76  ? 490  GLU C N     1 
ATOM   7382  C  CA    . GLU C  2  490  ? 52.762  -42.517 77.286  1.00 67.31  ? 490  GLU C CA    1 
ATOM   7383  C  C     . GLU C  2  490  ? 51.965  -42.385 78.582  1.00 64.92  ? 490  GLU C C     1 
ATOM   7384  O  O     . GLU C  2  490  ? 51.473  -43.376 79.113  1.00 67.02  ? 490  GLU C O     1 
ATOM   7385  C  CB    . GLU C  2  490  ? 54.231  -42.809 77.589  1.00 67.68  ? 490  GLU C CB    1 
ATOM   7386  C  CG    . GLU C  2  490  ? 54.472  -44.195 78.170  1.00 70.88  ? 490  GLU C CG    1 
ATOM   7387  C  CD    . GLU C  2  490  ? 55.796  -44.296 78.897  1.00 98.79  ? 490  GLU C CD    1 
ATOM   7388  O  OE1   . GLU C  2  490  ? 56.684  -43.447 78.644  1.00 110.69 ? 490  GLU C OE1   1 
ATOM   7389  O  OE2   . GLU C  2  490  ? 55.946  -45.218 79.729  1.00 93.94  ? 490  GLU C OE2   1 
ATOM   7390  N  N     . GLU C  2  491  ? 51.835  -41.161 79.085  1.00 60.96  ? 491  GLU C N     1 
ATOM   7391  C  CA    . GLU C  2  491  ? 51.046  -40.917 80.290  1.00 64.11  ? 491  GLU C CA    1 
ATOM   7392  C  C     . GLU C  2  491  ? 49.586  -41.299 80.080  1.00 64.66  ? 491  GLU C C     1 
ATOM   7393  O  O     . GLU C  2  491  ? 48.934  -41.794 80.997  1.00 65.79  ? 491  GLU C O     1 
ATOM   7394  C  CB    . GLU C  2  491  ? 51.139  -39.453 80.725  1.00 65.83  ? 491  GLU C CB    1 
ATOM   7395  C  CG    . GLU C  2  491  ? 50.220  -39.100 81.886  1.00 64.19  ? 491  GLU C CG    1 
ATOM   7396  C  CD    . GLU C  2  491  ? 50.127  -37.607 82.138  1.00 70.83  ? 491  GLU C CD    1 
ATOM   7397  O  OE1   . GLU C  2  491  ? 48.999  -37.103 82.327  1.00 67.96  ? 491  GLU C OE1   1 
ATOM   7398  O  OE2   . GLU C  2  491  ? 51.182  -36.937 82.156  1.00 75.13  ? 491  GLU C OE2   1 
ATOM   7399  N  N     . ASP C  2  492  ? 49.077  -41.086 78.869  1.00 66.67  ? 492  ASP C N     1 
ATOM   7400  C  CA    . ASP C  2  492  ? 47.674  -41.401 78.576  1.00 63.89  ? 492  ASP C CA    1 
ATOM   7401  C  C     . ASP C  2  492  ? 47.316  -42.884 78.720  1.00 66.44  ? 492  ASP C C     1 
ATOM   7402  O  O     . ASP C  2  492  ? 46.140  -43.243 78.729  1.00 72.22  ? 492  ASP C O     1 
ATOM   7403  C  CB    . ASP C  2  492  ? 47.270  -40.905 77.184  1.00 57.74  ? 492  ASP C CB    1 
ATOM   7404  C  CG    . ASP C  2  492  ? 46.968  -39.419 77.160  1.00 63.13  ? 492  ASP C CG    1 
ATOM   7405  O  OD1   . ASP C  2  492  ? 46.925  -38.842 76.052  1.00 63.34  ? 492  ASP C OD1   1 
ATOM   7406  O  OD2   . ASP C  2  492  ? 46.776  -38.828 78.248  1.00 61.34  ? 492  ASP C OD2   1 
ATOM   7407  N  N     . ARG C  2  493  ? 48.322  -43.741 78.842  1.00 68.51  ? 493  ARG C N     1 
ATOM   7408  C  CA    . ARG C  2  493  ? 48.083  -45.180 78.914  1.00 69.07  ? 493  ARG C CA    1 
ATOM   7409  C  C     . ARG C  2  493  ? 47.604  -45.637 80.289  1.00 67.49  ? 493  ARG C C     1 
ATOM   7410  O  O     . ARG C  2  493  ? 46.811  -46.571 80.394  1.00 72.51  ? 493  ARG C O     1 
ATOM   7411  C  CB    . ARG C  2  493  ? 49.344  -45.960 78.519  1.00 70.34  ? 493  ARG C CB    1 
ATOM   7412  C  CG    . ARG C  2  493  ? 49.968  -45.510 77.205  1.00 85.13  ? 493  ARG C CG    1 
ATOM   7413  C  CD    . ARG C  2  493  ? 51.198  -46.328 76.836  1.00 86.03  ? 493  ARG C CD    1 
ATOM   7414  N  NE    . ARG C  2  493  ? 50.848  -47.631 76.278  1.00 96.34  ? 493  ARG C NE    1 
ATOM   7415  C  CZ    . ARG C  2  493  ? 51.229  -48.794 76.795  1.00 91.48  ? 493  ARG C CZ    1 
ATOM   7416  N  NH1   . ARG C  2  493  ? 51.981  -48.821 77.888  1.00 91.65  ? 493  ARG C NH1   1 
ATOM   7417  N  NH2   . ARG C  2  493  ? 50.861  -49.929 76.217  1.00 84.51  ? 493  ARG C NH2   1 
ATOM   7418  N  N     . TYR C  2  494  ? 48.080  -44.980 81.342  1.00 65.80  ? 494  TYR C N     1 
ATOM   7419  C  CA    . TYR C  2  494  ? 47.885  -45.501 82.692  1.00 67.83  ? 494  TYR C CA    1 
ATOM   7420  C  C     . TYR C  2  494  ? 46.816  -44.786 83.518  1.00 71.49  ? 494  TYR C C     1 
ATOM   7421  O  O     . TYR C  2  494  ? 46.229  -43.791 83.091  1.00 70.44  ? 494  TYR C O     1 
ATOM   7422  C  CB    . TYR C  2  494  ? 49.220  -45.506 83.449  1.00 68.71  ? 494  TYR C CB    1 
ATOM   7423  C  CG    . TYR C  2  494  ? 50.366  -46.028 82.613  1.00 74.03  ? 494  TYR C CG    1 
ATOM   7424  C  CD1   . TYR C  2  494  ? 50.466  -47.378 82.300  1.00 78.46  ? 494  TYR C CD1   1 
ATOM   7425  C  CD2   . TYR C  2  494  ? 51.338  -45.171 82.120  1.00 72.88  ? 494  TYR C CD2   1 
ATOM   7426  C  CE1   . TYR C  2  494  ? 51.504  -47.862 81.523  1.00 77.18  ? 494  TYR C CE1   1 
ATOM   7427  C  CE2   . TYR C  2  494  ? 52.381  -45.646 81.344  1.00 81.58  ? 494  TYR C CE2   1 
ATOM   7428  C  CZ    . TYR C  2  494  ? 52.457  -46.993 81.049  1.00 80.82  ? 494  TYR C CZ    1 
ATOM   7429  O  OH    . TYR C  2  494  ? 53.492  -47.471 80.278  1.00 90.40  ? 494  TYR C OH    1 
ATOM   7430  N  N     . THR C  2  495  ? 46.584  -45.318 84.713  1.00 71.00  ? 495  THR C N     1 
ATOM   7431  C  CA    . THR C  2  495  ? 45.679  -44.728 85.684  1.00 65.22  ? 495  THR C CA    1 
ATOM   7432  C  C     . THR C  2  495  ? 46.538  -44.192 86.813  1.00 65.52  ? 495  THR C C     1 
ATOM   7433  O  O     . THR C  2  495  ? 47.158  -44.963 87.543  1.00 61.17  ? 495  THR C O     1 
ATOM   7434  C  CB    . THR C  2  495  ? 44.715  -45.779 86.243  1.00 63.33  ? 495  THR C CB    1 
ATOM   7435  O  OG1   . THR C  2  495  ? 43.929  -46.318 85.176  1.00 72.87  ? 495  THR C OG1   1 
ATOM   7436  C  CG2   . THR C  2  495  ? 43.795  -45.165 87.276  1.00 62.58  ? 495  THR C CG2   1 
ATOM   7437  N  N     . ILE C  2  496  ? 46.587  -42.872 86.953  1.00 66.01  ? 496  ILE C N     1 
ATOM   7438  C  CA    . ILE C  2  496  ? 47.564  -42.261 87.849  1.00 63.67  ? 496  ILE C CA    1 
ATOM   7439  C  C     . ILE C  2  496  ? 46.947  -41.609 89.082  1.00 67.59  ? 496  ILE C C     1 
ATOM   7440  O  O     . ILE C  2  496  ? 46.199  -40.642 88.974  1.00 72.99  ? 496  ILE C O     1 
ATOM   7441  C  CB    . ILE C  2  496  ? 48.407  -41.222 87.105  1.00 62.95  ? 496  ILE C CB    1 
ATOM   7442  C  CG1   . ILE C  2  496  ? 48.948  -41.822 85.803  1.00 66.80  ? 496  ILE C CG1   1 
ATOM   7443  C  CG2   . ILE C  2  496  ? 49.521  -40.720 88.001  1.00 62.37  ? 496  ILE C CG2   1 
ATOM   7444  C  CD1   . ILE C  2  496  ? 49.799  -40.880 84.993  1.00 63.65  ? 496  ILE C CD1   1 
ATOM   7445  N  N     . ALA C  2  497  ? 47.282  -42.132 90.256  1.00 63.46  ? 497  ALA C N     1 
ATOM   7446  C  CA    . ALA C  2  497  ? 46.699  -41.645 91.502  1.00 65.89  ? 497  ALA C CA    1 
ATOM   7447  C  C     . ALA C  2  497  ? 47.301  -40.316 91.922  1.00 67.72  ? 497  ALA C C     1 
ATOM   7448  O  O     . ALA C  2  497  ? 48.445  -40.017 91.592  1.00 68.40  ? 497  ALA C O     1 
ATOM   7449  C  CB    . ALA C  2  497  ? 46.872  -42.673 92.610  1.00 69.57  ? 497  ALA C CB    1 
ATOM   7450  N  N     . GLN C  2  498  ? 46.522  -39.527 92.657  1.00 67.85  ? 498  GLN C N     1 
ATOM   7451  C  CA    . GLN C  2  498  ? 46.981  -38.240 93.167  1.00 65.69  ? 498  GLN C CA    1 
ATOM   7452  C  C     . GLN C  2  498  ? 48.025  -38.419 94.264  1.00 66.47  ? 498  GLN C C     1 
ATOM   7453  O  O     . GLN C  2  498  ? 48.049  -39.442 94.944  1.00 68.29  ? 498  GLN C O     1 
ATOM   7454  C  CB    . GLN C  2  498  ? 45.799  -37.412 93.676  1.00 64.21  ? 498  GLN C CB    1 
ATOM   7455  C  CG    . GLN C  2  498  ? 44.964  -36.785 92.567  1.00 66.26  ? 498  GLN C CG    1 
ATOM   7456  C  CD    . GLN C  2  498  ? 45.702  -35.676 91.838  1.00 61.70  ? 498  GLN C CD    1 
ATOM   7457  O  OE1   . GLN C  2  498  ? 46.344  -34.832 92.462  1.00 64.48  ? 498  GLN C OE1   1 
ATOM   7458  N  NE2   . GLN C  2  498  ? 45.621  -35.679 90.512  1.00 51.79  ? 498  GLN C NE2   1 
ATOM   7459  N  N     . ALA C  2  499  ? 48.885  -37.419 94.432  1.00 64.44  ? 499  ALA C N     1 
ATOM   7460  C  CA    . ALA C  2  499  ? 50.010  -37.520 95.359  1.00 66.59  ? 499  ALA C CA    1 
ATOM   7461  C  C     . ALA C  2  499  ? 49.601  -37.507 96.834  1.00 79.70  ? 499  ALA C C     1 
ATOM   7462  O  O     . ALA C  2  499  ? 50.355  -37.961 97.695  1.00 77.06  ? 499  ALA C O     1 
ATOM   7463  C  CB    . ALA C  2  499  ? 51.019  -36.421 95.084  1.00 59.43  ? 499  ALA C CB    1 
ATOM   7464  N  N     . ASN C  2  500  ? 48.414  -36.983 97.124  1.00 80.77  ? 500  ASN C N     1 
ATOM   7465  C  CA    . ASN C  2  500  ? 47.958  -36.888 98.505  1.00 72.78  ? 500  ASN C CA    1 
ATOM   7466  C  C     . ASN C  2  500  ? 47.146  -38.090 98.988  1.00 79.69  ? 500  ASN C C     1 
ATOM   7467  O  O     . ASN C  2  500  ? 46.635  -38.079 100.105 1.00 90.89  ? 500  ASN C O     1 
ATOM   7468  C  CB    . ASN C  2  500  ? 47.198  -35.578 98.757  1.00 76.57  ? 500  ASN C CB    1 
ATOM   7469  C  CG    . ASN C  2  500  ? 45.822  -35.547 98.097  1.00 86.53  ? 500  ASN C CG    1 
ATOM   7470  O  OD1   . ASN C  2  500  ? 45.415  -36.486 97.410  1.00 86.54  ? 500  ASN C OD1   1 
ATOM   7471  N  ND2   . ASN C  2  500  ? 45.093  -34.457 98.318  1.00 81.95  ? 500  ASN C ND2   1 
ATOM   7472  N  N     . THR C  2  501  ? 47.013  -39.111 98.143  1.00 78.57  ? 501  THR C N     1 
ATOM   7473  C  CA    . THR C  2  501  ? 46.273  -40.316 98.518  1.00 79.16  ? 501  THR C CA    1 
ATOM   7474  C  C     . THR C  2  501  ? 46.915  -40.983 99.730  1.00 85.21  ? 501  THR C C     1 
ATOM   7475  O  O     . THR C  2  501  ? 48.125  -41.214 99.742  1.00 84.90  ? 501  THR C O     1 
ATOM   7476  C  CB    . THR C  2  501  ? 46.174  -41.325 97.357  1.00 78.83  ? 501  THR C CB    1 
ATOM   7477  O  OG1   . THR C  2  501  ? 47.473  -41.537 96.794  1.00 82.58  ? 501  THR C OG1   1 
ATOM   7478  C  CG2   . THR C  2  501  ? 45.230  -40.808 96.275  1.00 78.67  ? 501  THR C CG2   1 
ATOM   7479  N  N     . PRO C  2  502  ? 46.099  -41.285 100.756 1.00 87.15  ? 502  PRO C N     1 
ATOM   7480  C  CA    . PRO C  2  502  ? 46.538  -41.778 102.068 1.00 86.65  ? 502  PRO C CA    1 
ATOM   7481  C  C     . PRO C  2  502  ? 47.400  -43.032 101.986 1.00 92.73  ? 502  PRO C C     1 
ATOM   7482  O  O     . PRO C  2  502  ? 47.105  -43.939 101.208 1.00 92.67  ? 502  PRO C O     1 
ATOM   7483  C  CB    . PRO C  2  502  ? 45.221  -42.099 102.777 1.00 87.40  ? 502  PRO C CB    1 
ATOM   7484  C  CG    . PRO C  2  502  ? 44.220  -41.222 102.121 1.00 89.84  ? 502  PRO C CG    1 
ATOM   7485  C  CD    . PRO C  2  502  ? 44.632  -41.156 100.686 1.00 83.42  ? 502  PRO C CD    1 
ATOM   7486  N  N     . LEU C  2  503  ? 48.456  -43.077 102.790 1.00 96.44  ? 503  LEU C N     1 
ATOM   7487  C  CA    . LEU C  2  503  ? 49.348  -44.227 102.813 1.00 99.09  ? 503  LEU C CA    1 
ATOM   7488  C  C     . LEU C  2  503  ? 49.682  -44.642 104.242 1.00 109.17 ? 503  LEU C C     1 
ATOM   7489  O  O     . LEU C  2  503  ? 49.903  -43.796 105.110 1.00 111.32 ? 503  LEU C O     1 
ATOM   7490  C  CB    . LEU C  2  503  ? 50.652  -43.911 102.071 1.00 98.78  ? 503  LEU C CB    1 
ATOM   7491  C  CG    . LEU C  2  503  ? 50.625  -43.477 100.604 1.00 95.75  ? 503  LEU C CG    1 
ATOM   7492  C  CD1   . LEU C  2  503  ? 52.032  -43.149 100.129 1.00 84.29  ? 503  LEU C CD1   1 
ATOM   7493  C  CD2   . LEU C  2  503  ? 50.003  -44.544 99.723  1.00 91.63  ? 503  LEU C CD2   1 
ATOM   7494  N  N     . GLU C  2  504  ? 49.702  -45.949 104.482 1.00 111.46 ? 504  GLU C N     1 
ATOM   7495  C  CA    . GLU C  2  504  ? 50.370  -46.494 105.657 1.00 113.65 ? 504  GLU C CA    1 
ATOM   7496  C  C     . GLU C  2  504  ? 51.562  -47.306 105.165 1.00 111.18 ? 504  GLU C C     1 
ATOM   7497  O  O     . GLU C  2  504  ? 51.403  -48.368 104.563 1.00 109.28 ? 504  GLU C O     1 
ATOM   7498  C  CB    . GLU C  2  504  ? 49.420  -47.344 106.508 1.00 119.17 ? 504  GLU C CB    1 
ATOM   7499  C  CG    . GLU C  2  504  ? 48.531  -48.298 105.725 1.00 124.98 ? 504  GLU C CG    1 
ATOM   7500  C  CD    . GLU C  2  504  ? 47.689  -49.180 106.630 1.00 133.56 ? 504  GLU C CD    1 
ATOM   7501  O  OE1   . GLU C  2  504  ? 48.014  -49.279 107.832 1.00 135.56 ? 504  GLU C OE1   1 
ATOM   7502  O  OE2   . GLU C  2  504  ? 46.702  -49.770 106.140 1.00 135.47 ? 504  GLU C OE2   1 
ATOM   7503  N  N     . GLY C  2  505  ? 52.761  -46.789 105.410 1.00 108.57 ? 505  GLY C N     1 
ATOM   7504  C  CA    . GLY C  2  505  ? 53.954  -47.340 104.797 1.00 105.58 ? 505  GLY C CA    1 
ATOM   7505  C  C     . GLY C  2  505  ? 53.938  -47.069 103.304 1.00 103.04 ? 505  GLY C C     1 
ATOM   7506  O  O     . GLY C  2  505  ? 53.616  -45.966 102.869 1.00 105.46 ? 505  GLY C O     1 
ATOM   7507  N  N     . ASN C  2  506  ? 54.279  -48.080 102.514 1.00 100.79 ? 506  ASN C N     1 
ATOM   7508  C  CA    . ASN C  2  506  ? 54.244  -47.956 101.063 1.00 95.63  ? 506  ASN C CA    1 
ATOM   7509  C  C     . ASN C  2  506  ? 52.920  -48.422 100.469 1.00 94.92  ? 506  ASN C C     1 
ATOM   7510  O  O     . ASN C  2  506  ? 52.761  -48.477 99.253  1.00 91.27  ? 506  ASN C O     1 
ATOM   7511  C  CB    . ASN C  2  506  ? 55.412  -48.711 100.430 1.00 97.48  ? 506  ASN C CB    1 
ATOM   7512  C  CG    . ASN C  2  506  ? 56.718  -47.943 100.525 1.00 110.48 ? 506  ASN C CG    1 
ATOM   7513  O  OD1   . ASN C  2  506  ? 56.824  -46.966 101.269 1.00 110.56 ? 506  ASN C OD1   1 
ATOM   7514  N  ND2   . ASN C  2  506  ? 57.720  -48.379 99.766  1.00 104.08 ? 506  ASN C ND2   1 
ATOM   7515  N  N     . ARG C  2  507  ? 51.976  -48.766 101.338 1.00 103.89 ? 507  ARG C N     1 
ATOM   7516  C  CA    . ARG C  2  507  ? 50.689  -49.302 100.907 1.00 102.02 ? 507  ARG C CA    1 
ATOM   7517  C  C     . ARG C  2  507  ? 49.603  -48.233 100.869 1.00 98.53  ? 507  ARG C C     1 
ATOM   7518  O  O     . ARG C  2  507  ? 49.541  -47.369 101.746 1.00 101.61 ? 507  ARG C O     1 
ATOM   7519  C  CB    . ARG C  2  507  ? 50.265  -50.456 101.824 1.00 109.43 ? 507  ARG C CB    1 
ATOM   7520  C  CG    . ARG C  2  507  ? 48.862  -50.986 101.566 1.00 116.22 ? 507  ARG C CG    1 
ATOM   7521  C  CD    . ARG C  2  507  ? 48.648  -52.356 102.195 1.00 117.19 ? 507  ARG C CD    1 
ATOM   7522  N  NE    . ARG C  2  507  ? 49.601  -53.339 101.684 1.00 129.92 ? 507  ARG C NE    1 
ATOM   7523  C  CZ    . ARG C  2  507  ? 49.508  -53.927 100.494 1.00 130.33 ? 507  ARG C CZ    1 
ATOM   7524  N  NH1   . ARG C  2  507  ? 48.505  -53.632 99.677  1.00 123.49 ? 507  ARG C NH1   1 
ATOM   7525  N  NH2   . ARG C  2  507  ? 50.424  -54.810 100.116 1.00 126.29 ? 507  ARG C NH2   1 
ATOM   7526  N  N     . ILE C  2  508  ? 48.748  -48.297 99.852  1.00 87.41  ? 508  ILE C N     1 
ATOM   7527  C  CA    . ILE C  2  508  ? 47.630  -47.368 99.736  1.00 93.21  ? 508  ILE C CA    1 
ATOM   7528  C  C     . ILE C  2  508  ? 46.586  -47.667 100.807 1.00 98.52  ? 508  ILE C C     1 
ATOM   7529  O  O     . ILE C  2  508  ? 46.044  -48.771 100.869 1.00 96.45  ? 508  ILE C O     1 
ATOM   7530  C  CB    . ILE C  2  508  ? 46.982  -47.441 98.338  1.00 90.09  ? 508  ILE C CB    1 
ATOM   7531  C  CG1   . ILE C  2  508  ? 47.966  -46.958 97.273  1.00 89.42  ? 508  ILE C CG1   1 
ATOM   7532  C  CG2   . ILE C  2  508  ? 45.707  -46.615 98.287  1.00 87.42  ? 508  ILE C CG2   1 
ATOM   7533  C  CD1   . ILE C  2  508  ? 47.415  -47.003 95.863  1.00 88.98  ? 508  ILE C CD1   1 
ATOM   7534  N  N     . ALA C  2  509  ? 46.295  -46.667 101.634 1.00 103.69 ? 509  ALA C N     1 
ATOM   7535  C  CA    . ALA C  2  509  ? 45.459  -46.857 102.818 1.00 100.78 ? 509  ALA C CA    1 
ATOM   7536  C  C     . ALA C  2  509  ? 43.993  -46.498 102.605 1.00 98.28  ? 509  ALA C C     1 
ATOM   7537  O  O     . ALA C  2  509  ? 43.196  -46.572 103.537 1.00 105.10 ? 509  ALA C O     1 
ATOM   7538  C  CB    . ALA C  2  509  ? 46.027  -46.074 103.995 1.00 98.76  ? 509  ALA C CB    1 
ATOM   7539  N  N     . ALA C  2  510  ? 43.637  -46.102 101.388 1.00 97.09  ? 510  ALA C N     1 
ATOM   7540  C  CA    . ALA C  2  510  ? 42.264  -45.696 101.102 1.00 96.56  ? 510  ALA C CA    1 
ATOM   7541  C  C     . ALA C  2  510  ? 41.520  -46.758 100.302 1.00 99.07  ? 510  ALA C C     1 
ATOM   7542  O  O     . ALA C  2  510  ? 42.112  -47.455 99.479  1.00 99.46  ? 510  ALA C O     1 
ATOM   7543  C  CB    . ALA C  2  510  ? 42.242  -44.365 100.370 1.00 99.21  ? 510  ALA C CB    1 
ATOM   7544  N  N     . GLU C  2  511  ? 40.221  -46.882 100.552 1.00 103.63 ? 511  GLU C N     1 
ATOM   7545  C  CA    . GLU C  2  511  ? 39.398  -47.841 99.825  1.00 109.40 ? 511  GLU C CA    1 
ATOM   7546  C  C     . GLU C  2  511  ? 39.087  -47.302 98.433  1.00 105.71 ? 511  GLU C C     1 
ATOM   7547  O  O     . GLU C  2  511  ? 38.916  -48.061 97.478  1.00 101.00 ? 511  GLU C O     1 
ATOM   7548  C  CB    . GLU C  2  511  ? 38.107  -48.129 100.591 1.00 117.39 ? 511  GLU C CB    1 
ATOM   7549  C  CG    . GLU C  2  511  ? 37.280  -49.262 100.003 1.00 131.08 ? 511  GLU C CG    1 
ATOM   7550  C  CD    . GLU C  2  511  ? 35.878  -48.826 99.618  1.00 136.69 ? 511  GLU C CD    1 
ATOM   7551  O  OE1   . GLU C  2  511  ? 35.205  -48.171 100.443 1.00 126.81 ? 511  GLU C OE1   1 
ATOM   7552  O  OE2   . GLU C  2  511  ? 35.452  -49.134 98.485  1.00 143.70 ? 511  GLU C OE2   1 
ATOM   7553  N  N     . ARG C  2  512  ? 39.020  -45.979 98.331  1.00 102.61 ? 512  ARG C N     1 
ATOM   7554  C  CA    . ARG C  2  512  ? 38.804  -45.312 97.055  1.00 95.68  ? 512  ARG C CA    1 
ATOM   7555  C  C     . ARG C  2  512  ? 39.831  -44.196 96.848  1.00 92.24  ? 512  ARG C C     1 
ATOM   7556  O  O     . ARG C  2  512  ? 40.032  -43.353 97.724  1.00 90.02  ? 512  ARG C O     1 
ATOM   7557  C  CB    . ARG C  2  512  ? 37.380  -44.757 96.977  1.00 99.94  ? 512  ARG C CB    1 
ATOM   7558  C  CG    . ARG C  2  512  ? 36.755  -44.441 98.330  1.00 108.54 ? 512  ARG C CG    1 
ATOM   7559  C  CD    . ARG C  2  512  ? 35.625  -43.433 98.189  1.00 108.23 ? 512  ARG C CD    1 
ATOM   7560  N  NE    . ARG C  2  512  ? 34.771  -43.720 97.039  1.00 110.18 ? 512  ARG C NE    1 
ATOM   7561  C  CZ    . ARG C  2  512  ? 33.991  -42.821 96.444  1.00 107.42 ? 512  ARG C CZ    1 
ATOM   7562  N  NH1   . ARG C  2  512  ? 33.960  -41.571 96.889  1.00 104.43 ? 512  ARG C NH1   1 
ATOM   7563  N  NH2   . ARG C  2  512  ? 33.248  -43.167 95.400  1.00 94.72  ? 512  ARG C NH2   1 
ATOM   7564  N  N     . VAL C  2  513  ? 40.480  -44.198 95.686  1.00 85.13  ? 513  VAL C N     1 
ATOM   7565  C  CA    . VAL C  2  513  ? 41.525  -43.221 95.392  1.00 80.14  ? 513  VAL C CA    1 
ATOM   7566  C  C     . VAL C  2  513  ? 41.130  -42.292 94.252  1.00 73.77  ? 513  VAL C C     1 
ATOM   7567  O  O     . VAL C  2  513  ? 40.306  -42.642 93.401  1.00 71.57  ? 513  VAL C O     1 
ATOM   7568  C  CB    . VAL C  2  513  ? 42.875  -43.898 95.050  1.00 74.87  ? 513  VAL C CB    1 
ATOM   7569  C  CG1   . VAL C  2  513  ? 43.104  -45.114 95.931  1.00 82.71  ? 513  VAL C CG1   1 
ATOM   7570  C  CG2   . VAL C  2  513  ? 42.935  -44.278 93.584  1.00 77.19  ? 513  VAL C CG2   1 
ATOM   7571  N  N     . VAL C  2  514  ? 41.716  -41.098 94.255  1.00 71.97  ? 514  VAL C N     1 
ATOM   7572  C  CA    . VAL C  2  514  ? 41.480  -40.120 93.204  1.00 66.98  ? 514  VAL C CA    1 
ATOM   7573  C  C     . VAL C  2  514  ? 42.566  -40.246 92.152  1.00 67.07  ? 514  VAL C C     1 
ATOM   7574  O  O     . VAL C  2  514  ? 43.745  -40.076 92.450  1.00 72.33  ? 514  VAL C O     1 
ATOM   7575  C  CB    . VAL C  2  514  ? 41.520  -38.694 93.752  1.00 66.49  ? 514  VAL C CB    1 
ATOM   7576  C  CG1   . VAL C  2  514  ? 41.071  -37.716 92.684  1.00 64.77  ? 514  VAL C CG1   1 
ATOM   7577  C  CG2   . VAL C  2  514  ? 40.651  -38.577 94.985  1.00 62.42  ? 514  VAL C CG2   1 
ATOM   7578  N  N     . ALA C  2  515  ? 42.176  -40.547 90.921  1.00 67.30  ? 515  ALA C N     1 
ATOM   7579  C  CA    . ALA C  2  515  ? 43.163  -40.758 89.873  1.00 65.32  ? 515  ALA C CA    1 
ATOM   7580  C  C     . ALA C  2  515  ? 42.783  -40.086 88.561  1.00 62.97  ? 515  ALA C C     1 
ATOM   7581  O  O     . ALA C  2  515  ? 41.695  -39.528 88.421  1.00 62.02  ? 515  ALA C O     1 
ATOM   7582  C  CB    . ALA C  2  515  ? 43.385  -42.251 89.657  1.00 67.09  ? 515  ALA C CB    1 
ATOM   7583  N  N     . ARG C  2  516  ? 43.688  -40.163 87.595  1.00 61.92  ? 516  ARG C N     1 
ATOM   7584  C  CA    . ARG C  2  516  ? 43.433  -39.631 86.268  1.00 59.64  ? 516  ARG C CA    1 
ATOM   7585  C  C     . ARG C  2  516  ? 43.631  -40.716 85.220  1.00 62.53  ? 516  ARG C C     1 
ATOM   7586  O  O     . ARG C  2  516  ? 44.574  -41.511 85.303  1.00 66.41  ? 516  ARG C O     1 
ATOM   7587  C  CB    . ARG C  2  516  ? 44.358  -38.453 85.966  1.00 58.68  ? 516  ARG C CB    1 
ATOM   7588  C  CG    . ARG C  2  516  ? 44.119  -37.228 86.817  1.00 51.67  ? 516  ARG C CG    1 
ATOM   7589  C  CD    . ARG C  2  516  ? 45.144  -36.162 86.505  1.00 49.20  ? 516  ARG C CD    1 
ATOM   7590  N  NE    . ARG C  2  516  ? 46.506  -36.622 86.763  1.00 58.23  ? 516  ARG C NE    1 
ATOM   7591  C  CZ    . ARG C  2  516  ? 47.515  -36.504 85.904  1.00 58.68  ? 516  ARG C CZ    1 
ATOM   7592  N  NH1   . ARG C  2  516  ? 47.323  -35.938 84.717  1.00 53.65  ? 516  ARG C NH1   1 
ATOM   7593  N  NH2   . ARG C  2  516  ? 48.719  -36.952 86.233  1.00 57.93  ? 516  ARG C NH2   1 
ATOM   7594  N  N     . ARG C  2  517  ? 42.716  -40.753 84.256  1.00 61.91  ? 517  ARG C N     1 
ATOM   7595  C  CA    . ARG C  2  517  ? 42.873  -41.543 83.045  1.00 59.58  ? 517  ARG C CA    1 
ATOM   7596  C  C     . ARG C  2  517  ? 42.667  -40.600 81.880  1.00 66.58  ? 517  ARG C C     1 
ATOM   7597  O  O     . ARG C  2  517  ? 41.560  -40.092 81.677  1.00 65.62  ? 517  ARG C O     1 
ATOM   7598  C  CB    . ARG C  2  517  ? 41.844  -42.665 82.976  1.00 64.64  ? 517  ARG C CB    1 
ATOM   7599  C  CG    . ARG C  2  517  ? 42.110  -43.822 83.914  1.00 76.41  ? 517  ARG C CG    1 
ATOM   7600  C  CD    . ARG C  2  517  ? 40.912  -44.760 83.971  1.00 85.11  ? 517  ARG C CD    1 
ATOM   7601  N  NE    . ARG C  2  517  ? 41.125  -45.877 84.888  1.00 86.10  ? 517  ARG C NE    1 
ATOM   7602  C  CZ    . ARG C  2  517  ? 40.145  -46.575 85.453  1.00 86.32  ? 517  ARG C CZ    1 
ATOM   7603  N  NH1   . ARG C  2  517  ? 38.878  -46.264 85.201  1.00 74.54  ? 517  ARG C NH1   1 
ATOM   7604  N  NH2   . ARG C  2  517  ? 40.430  -47.577 86.278  1.00 84.44  ? 517  ARG C NH2   1 
ATOM   7605  N  N     . LYS C  2  518  ? 43.735  -40.379 81.117  1.00 68.59  ? 518  LYS C N     1 
ATOM   7606  C  CA    . LYS C  2  518  ? 43.743  -39.388 80.047  1.00 61.84  ? 518  LYS C CA    1 
ATOM   7607  C  C     . LYS C  2  518  ? 43.253  -38.027 80.545  1.00 64.49  ? 518  LYS C C     1 
ATOM   7608  O  O     . LYS C  2  518  ? 42.459  -37.362 79.883  1.00 67.42  ? 518  LYS C O     1 
ATOM   7609  C  CB    . LYS C  2  518  ? 42.919  -39.861 78.848  1.00 54.56  ? 518  LYS C CB    1 
ATOM   7610  C  CG    . LYS C  2  518  ? 43.496  -41.074 78.140  1.00 61.76  ? 518  LYS C CG    1 
ATOM   7611  C  CD    . LYS C  2  518  ? 42.895  -41.242 76.750  1.00 71.85  ? 518  LYS C CD    1 
ATOM   7612  C  CE    . LYS C  2  518  ? 43.470  -42.452 76.030  1.00 74.75  ? 518  LYS C CE    1 
ATOM   7613  N  NZ    . LYS C  2  518  ? 43.140  -43.728 76.728  1.00 86.09  ? 518  LYS C NZ    1 
ATOM   7614  N  N     . GLY C  2  519  ? 43.713  -37.637 81.730  1.00 58.39  ? 519  GLY C N     1 
ATOM   7615  C  CA    . GLY C  2  519  ? 43.407  -36.332 82.279  1.00 60.07  ? 519  GLY C CA    1 
ATOM   7616  C  C     . GLY C  2  519  ? 42.059  -36.265 82.966  1.00 64.29  ? 519  GLY C C     1 
ATOM   7617  O  O     . GLY C  2  519  ? 41.809  -35.368 83.773  1.00 61.96  ? 519  GLY C O     1 
ATOM   7618  N  N     . GLU C  2  520  ? 41.194  -37.223 82.657  1.00 65.47  ? 520  GLU C N     1 
ATOM   7619  C  CA    . GLU C  2  520  ? 39.857  -37.266 83.236  1.00 69.30  ? 520  GLU C CA    1 
ATOM   7620  C  C     . GLU C  2  520  ? 39.915  -37.741 84.688  1.00 68.61  ? 520  GLU C C     1 
ATOM   7621  O  O     . GLU C  2  520  ? 40.447  -38.813 84.971  1.00 62.33  ? 520  GLU C O     1 
ATOM   7622  C  CB    . GLU C  2  520  ? 38.963  -38.197 82.419  1.00 67.82  ? 520  GLU C CB    1 
ATOM   7623  C  CG    . GLU C  2  520  ? 37.480  -37.993 82.653  1.00 80.28  ? 520  GLU C CG    1 
ATOM   7624  C  CD    . GLU C  2  520  ? 36.970  -36.703 82.040  1.00 95.10  ? 520  GLU C CD    1 
ATOM   7625  O  OE1   . GLU C  2  520  ? 36.007  -36.127 82.590  1.00 99.41  ? 520  GLU C OE1   1 
ATOM   7626  O  OE2   . GLU C  2  520  ? 37.528  -36.269 81.006  1.00 87.83  ? 520  GLU C OE2   1 
ATOM   7627  N  N     . PRO C  2  521  ? 39.380  -36.936 85.620  1.00 68.71  ? 521  PRO C N     1 
ATOM   7628  C  CA    . PRO C  2  521  ? 39.378  -37.331 87.033  1.00 64.74  ? 521  PRO C CA    1 
ATOM   7629  C  C     . PRO C  2  521  ? 38.394  -38.472 87.307  1.00 64.79  ? 521  PRO C C     1 
ATOM   7630  O  O     . PRO C  2  521  ? 37.277  -38.475 86.782  1.00 61.17  ? 521  PRO C O     1 
ATOM   7631  C  CB    . PRO C  2  521  ? 38.963  -36.047 87.755  1.00 56.16  ? 521  PRO C CB    1 
ATOM   7632  C  CG    . PRO C  2  521  ? 38.200  -35.275 86.748  1.00 64.59  ? 521  PRO C CG    1 
ATOM   7633  C  CD    . PRO C  2  521  ? 38.784  -35.606 85.410  1.00 68.23  ? 521  PRO C CD    1 
ATOM   7634  N  N     . VAL C  2  522  ? 38.816  -39.437 88.117  1.00 61.80  ? 522  VAL C N     1 
ATOM   7635  C  CA    . VAL C  2  522  ? 38.039  -40.651 88.326  1.00 65.46  ? 522  VAL C CA    1 
ATOM   7636  C  C     . VAL C  2  522  ? 38.312  -41.268 89.704  1.00 73.14  ? 522  VAL C C     1 
ATOM   7637  O  O     . VAL C  2  522  ? 39.422  -41.163 90.230  1.00 73.39  ? 522  VAL C O     1 
ATOM   7638  C  CB    . VAL C  2  522  ? 38.334  -41.679 87.206  1.00 65.60  ? 522  VAL C CB    1 
ATOM   7639  C  CG1   . VAL C  2  522  ? 39.766  -42.178 87.300  1.00 66.26  ? 522  VAL C CG1   1 
ATOM   7640  C  CG2   . VAL C  2  522  ? 37.352  -42.838 87.250  1.00 79.64  ? 522  VAL C CG2   1 
ATOM   7641  N  N     . ILE C  2  523  ? 37.292  -41.894 90.292  1.00 75.90  ? 523  ILE C N     1 
ATOM   7642  C  CA    . ILE C  2  523  ? 37.445  -42.613 91.557  1.00 75.34  ? 523  ILE C CA    1 
ATOM   7643  C  C     . ILE C  2  523  ? 37.739  -44.082 91.272  1.00 72.31  ? 523  ILE C C     1 
ATOM   7644  O  O     . ILE C  2  523  ? 37.072  -44.708 90.450  1.00 75.78  ? 523  ILE C O     1 
ATOM   7645  C  CB    . ILE C  2  523  ? 36.192  -42.484 92.445  1.00 77.63  ? 523  ILE C CB    1 
ATOM   7646  C  CG1   . ILE C  2  523  ? 35.914  -41.015 92.757  1.00 71.74  ? 523  ILE C CG1   1 
ATOM   7647  C  CG2   . ILE C  2  523  ? 36.365  -43.267 93.732  1.00 78.68  ? 523  ILE C CG2   1 
ATOM   7648  C  CD1   . ILE C  2  523  ? 37.096  -40.296 93.354  1.00 70.62  ? 523  ILE C CD1   1 
ATOM   7649  N  N     . VAL C  2  524  ? 38.733  -44.636 91.956  1.00 72.29  ? 524  VAL C N     1 
ATOM   7650  C  CA    . VAL C  2  524  ? 39.310  -45.901 91.519  1.00 75.52  ? 524  VAL C CA    1 
ATOM   7651  C  C     . VAL C  2  524  ? 39.771  -46.791 92.683  1.00 82.03  ? 524  VAL C C     1 
ATOM   7652  O  O     . VAL C  2  524  ? 40.126  -46.293 93.745  1.00 85.75  ? 524  VAL C O     1 
ATOM   7653  C  CB    . VAL C  2  524  ? 40.460  -45.607 90.510  1.00 74.85  ? 524  VAL C CB    1 
ATOM   7654  C  CG1   . VAL C  2  524  ? 41.716  -46.406 90.812  1.00 79.26  ? 524  VAL C CG1   1 
ATOM   7655  C  CG2   . VAL C  2  524  ? 39.983  -45.816 89.078  1.00 71.68  ? 524  VAL C CG2   1 
ATOM   7656  N  N     . SER C  2  525  ? 39.735  -48.109 92.489  1.00 85.74  ? 525  SER C N     1 
ATOM   7657  C  CA    . SER C  2  525  ? 40.241  -49.048 93.493  1.00 88.81  ? 525  SER C CA    1 
ATOM   7658  C  C     . SER C  2  525  ? 41.763  -49.171 93.437  1.00 84.68  ? 525  SER C C     1 
ATOM   7659  O  O     . SER C  2  525  ? 42.347  -49.123 92.359  1.00 93.11  ? 525  SER C O     1 
ATOM   7660  C  CB    . SER C  2  525  ? 39.602  -50.429 93.313  1.00 96.99  ? 525  SER C CB    1 
ATOM   7661  O  OG    . SER C  2  525  ? 38.403  -50.542 94.062  1.00 110.48 ? 525  SER C OG    1 
ATOM   7662  N  N     . PRO C  2  526  ? 42.407  -49.351 94.600  1.00 81.20  ? 526  PRO C N     1 
ATOM   7663  C  CA    . PRO C  2  526  ? 43.869  -49.459 94.724  1.00 87.88  ? 526  PRO C CA    1 
ATOM   7664  C  C     . PRO C  2  526  ? 44.508  -50.508 93.809  1.00 87.16  ? 526  PRO C C     1 
ATOM   7665  O  O     . PRO C  2  526  ? 45.703  -50.422 93.524  1.00 81.10  ? 526  PRO C O     1 
ATOM   7666  C  CB    . PRO C  2  526  ? 44.059  -49.852 96.190  1.00 82.96  ? 526  PRO C CB    1 
ATOM   7667  C  CG    . PRO C  2  526  ? 42.894  -49.244 96.876  1.00 81.16  ? 526  PRO C CG    1 
ATOM   7668  C  CD    . PRO C  2  526  ? 41.747  -49.368 95.917  1.00 82.79  ? 526  PRO C CD    1 
ATOM   7669  N  N     . GLU C  2  527  ? 43.725  -51.487 93.368  1.00 93.49  ? 527  GLU C N     1 
ATOM   7670  C  CA    . GLU C  2  527  ? 44.211  -52.491 92.428  1.00 90.66  ? 527  GLU C CA    1 
ATOM   7671  C  C     . GLU C  2  527  ? 44.384  -51.891 91.037  1.00 88.66  ? 527  GLU C C     1 
ATOM   7672  O  O     . GLU C  2  527  ? 45.214  -52.352 90.254  1.00 90.94  ? 527  GLU C O     1 
ATOM   7673  C  CB    . GLU C  2  527  ? 43.257  -53.691 92.366  1.00 89.17  ? 527  GLU C CB    1 
ATOM   7674  C  CG    . GLU C  2  527  ? 43.274  -54.587 93.606  1.00 100.44 ? 527  GLU C CG    1 
ATOM   7675  C  CD    . GLU C  2  527  ? 42.540  -53.983 94.798  1.00 104.99 ? 527  GLU C CD    1 
ATOM   7676  O  OE1   . GLU C  2  527  ? 41.609  -53.176 94.583  1.00 105.65 ? 527  GLU C OE1   1 
ATOM   7677  O  OE2   . GLU C  2  527  ? 42.894  -54.315 95.951  1.00 95.38  ? 527  GLU C OE2   1 
ATOM   7678  N  N     . GLU C  2  528  ? 43.602  -50.857 90.740  1.00 84.73  ? 528  GLU C N     1 
ATOM   7679  C  CA    . GLU C  2  528  ? 43.608  -50.234 89.419  1.00 85.71  ? 528  GLU C CA    1 
ATOM   7680  C  C     . GLU C  2  528  ? 44.657  -49.135 89.271  1.00 80.39  ? 528  GLU C C     1 
ATOM   7681  O  O     . GLU C  2  528  ? 44.749  -48.510 88.214  1.00 76.67  ? 528  GLU C O     1 
ATOM   7682  C  CB    . GLU C  2  528  ? 42.236  -49.641 89.100  1.00 86.46  ? 528  GLU C CB    1 
ATOM   7683  C  CG    . GLU C  2  528  ? 41.066  -50.563 89.362  1.00 89.39  ? 528  GLU C CG    1 
ATOM   7684  C  CD    . GLU C  2  528  ? 39.742  -49.911 89.019  1.00 93.25  ? 528  GLU C CD    1 
ATOM   7685  O  OE1   . GLU C  2  528  ? 39.032  -49.482 89.956  1.00 91.11  ? 528  GLU C OE1   1 
ATOM   7686  O  OE2   . GLU C  2  528  ? 39.416  -49.824 87.814  1.00 84.06  ? 528  GLU C OE2   1 
ATOM   7687  N  N     . VAL C  2  529  ? 45.443  -48.901 90.318  1.00 74.52  ? 529  VAL C N     1 
ATOM   7688  C  CA    . VAL C  2  529  ? 46.383  -47.790 90.311  1.00 68.22  ? 529  VAL C CA    1 
ATOM   7689  C  C     . VAL C  2  529  ? 47.726  -48.245 89.770  1.00 69.14  ? 529  VAL C C     1 
ATOM   7690  O  O     . VAL C  2  529  ? 48.432  -49.023 90.405  1.00 74.32  ? 529  VAL C O     1 
ATOM   7691  C  CB    . VAL C  2  529  ? 46.587  -47.215 91.726  1.00 74.09  ? 529  VAL C CB    1 
ATOM   7692  C  CG1   . VAL C  2  529  ? 47.664  -46.151 91.716  1.00 74.51  ? 529  VAL C CG1   1 
ATOM   7693  C  CG2   . VAL C  2  529  ? 45.290  -46.650 92.264  1.00 74.25  ? 529  VAL C CG2   1 
ATOM   7694  N  N     . GLU C  2  530  ? 48.052  -47.768 88.574  1.00 65.78  ? 530  GLU C N     1 
ATOM   7695  C  CA    . GLU C  2  530  ? 49.310  -48.083 87.912  1.00 65.70  ? 530  GLU C CA    1 
ATOM   7696  C  C     . GLU C  2  530  ? 50.471  -47.178 88.343  1.00 67.04  ? 530  GLU C C     1 
ATOM   7697  O  O     . GLU C  2  530  ? 51.598  -47.640 88.512  1.00 71.94  ? 530  GLU C O     1 
ATOM   7698  C  CB    . GLU C  2  530  ? 49.105  -48.093 86.395  1.00 67.38  ? 530  GLU C CB    1 
ATOM   7699  C  CG    . GLU C  2  530  ? 47.902  -48.942 85.990  1.00 67.40  ? 530  GLU C CG    1 
ATOM   7700  C  CD    . GLU C  2  530  ? 47.644  -48.969 84.497  1.00 79.71  ? 530  GLU C CD    1 
ATOM   7701  O  OE1   . GLU C  2  530  ? 46.563  -48.503 84.068  1.00 74.76  ? 530  GLU C OE1   1 
ATOM   7702  O  OE2   . GLU C  2  530  ? 48.512  -49.475 83.755  1.00 94.36  ? 530  GLU C OE2   1 
ATOM   7703  N  N     . PHE C  2  531  ? 50.189  -45.888 88.505  1.00 66.42  ? 531  PHE C N     1 
ATOM   7704  C  CA    . PHE C  2  531  ? 51.199  -44.924 88.936  1.00 66.00  ? 531  PHE C CA    1 
ATOM   7705  C  C     . PHE C  2  531  ? 50.631  -43.922 89.937  1.00 66.01  ? 531  PHE C C     1 
ATOM   7706  O  O     . PHE C  2  531  ? 49.443  -43.951 90.248  1.00 69.50  ? 531  PHE C O     1 
ATOM   7707  C  CB    . PHE C  2  531  ? 51.766  -44.158 87.738  1.00 69.46  ? 531  PHE C CB    1 
ATOM   7708  C  CG    . PHE C  2  531  ? 52.671  -44.973 86.858  1.00 69.26  ? 531  PHE C CG    1 
ATOM   7709  C  CD1   . PHE C  2  531  ? 52.170  -45.628 85.743  1.00 66.46  ? 531  PHE C CD1   1 
ATOM   7710  C  CD2   . PHE C  2  531  ? 54.025  -45.071 87.136  1.00 63.50  ? 531  PHE C CD2   1 
ATOM   7711  C  CE1   . PHE C  2  531  ? 52.999  -46.371 84.926  1.00 64.61  ? 531  PHE C CE1   1 
ATOM   7712  C  CE2   . PHE C  2  531  ? 54.859  -45.812 86.322  1.00 64.80  ? 531  PHE C CE2   1 
ATOM   7713  C  CZ    . PHE C  2  531  ? 54.346  -46.462 85.215  1.00 65.36  ? 531  PHE C CZ    1 
ATOM   7714  N  N     . MET C  2  532  ? 51.484  -43.028 90.427  1.00 64.50  ? 532  MET C N     1 
ATOM   7715  C  CA    . MET C  2  532  ? 51.062  -41.989 91.365  1.00 63.66  ? 532  MET C CA    1 
ATOM   7716  C  C     . MET C  2  532  ? 51.931  -40.735 91.229  1.00 65.25  ? 532  MET C C     1 
ATOM   7717  O  O     . MET C  2  532  ? 53.124  -40.832 90.967  1.00 63.14  ? 532  MET C O     1 
ATOM   7718  C  CB    . MET C  2  532  ? 51.101  -42.524 92.798  1.00 61.47  ? 532  MET C CB    1 
ATOM   7719  C  CG    . MET C  2  532  ? 50.761  -41.504 93.869  1.00 69.75  ? 532  MET C CG    1 
ATOM   7720  S  SD    . MET C  2  532  ? 50.657  -42.226 95.524  1.00 66.33  ? 532  MET C SD    1 
ATOM   7721  C  CE    . MET C  2  532  ? 51.346  -40.905 96.519  1.00 79.41  ? 532  MET C CE    1 
ATOM   7722  N  N     . ASP C  2  533  ? 51.330  -39.561 91.397  1.00 64.70  ? 533  ASP C N     1 
ATOM   7723  C  CA    . ASP C  2  533  ? 52.070  -38.305 91.316  1.00 61.66  ? 533  ASP C CA    1 
ATOM   7724  C  C     . ASP C  2  533  ? 53.213  -38.270 92.329  1.00 61.94  ? 533  ASP C C     1 
ATOM   7725  O  O     . ASP C  2  533  ? 53.086  -38.783 93.442  1.00 62.87  ? 533  ASP C O     1 
ATOM   7726  C  CB    . ASP C  2  533  ? 51.141  -37.113 91.557  1.00 59.36  ? 533  ASP C CB    1 
ATOM   7727  C  CG    . ASP C  2  533  ? 50.162  -36.886 90.423  1.00 63.24  ? 533  ASP C CG    1 
ATOM   7728  O  OD1   . ASP C  2  533  ? 49.814  -37.852 89.708  1.00 63.83  ? 533  ASP C OD1   1 
ATOM   7729  O  OD2   . ASP C  2  533  ? 49.730  -35.727 90.254  1.00 66.25  ? 533  ASP C OD2   1 
ATOM   7730  N  N     . VAL C  2  534  ? 54.329  -37.665 91.935  1.00 58.61  ? 534  VAL C N     1 
ATOM   7731  C  CA    . VAL C  2  534  ? 55.475  -37.517 92.823  1.00 56.05  ? 534  VAL C CA    1 
ATOM   7732  C  C     . VAL C  2  534  ? 55.193  -36.491 93.923  1.00 57.54  ? 534  VAL C C     1 
ATOM   7733  O  O     . VAL C  2  534  ? 55.595  -36.677 95.073  1.00 65.74  ? 534  VAL C O     1 
ATOM   7734  C  CB    . VAL C  2  534  ? 56.740  -37.124 92.032  1.00 56.01  ? 534  VAL C CB    1 
ATOM   7735  C  CG1   . VAL C  2  534  ? 57.857  -36.683 92.964  1.00 56.27  ? 534  VAL C CG1   1 
ATOM   7736  C  CG2   . VAL C  2  534  ? 57.191  -38.284 91.157  1.00 59.38  ? 534  VAL C CG2   1 
ATOM   7737  N  N     . SER C  2  535  ? 54.456  -35.439 93.572  1.00 54.82  ? 535  SER C N     1 
ATOM   7738  C  CA    . SER C  2  535  ? 54.241  -34.298 94.459  1.00 54.15  ? 535  SER C CA    1 
ATOM   7739  C  C     . SER C  2  535  ? 53.280  -33.300 93.821  1.00 54.16  ? 535  SER C C     1 
ATOM   7740  O  O     . SER C  2  535  ? 53.109  -33.294 92.607  1.00 56.51  ? 535  SER C O     1 
ATOM   7741  C  CB    . SER C  2  535  ? 55.573  -33.602 94.745  1.00 55.61  ? 535  SER C CB    1 
ATOM   7742  O  OG    . SER C  2  535  ? 55.385  -32.365 95.408  1.00 56.63  ? 535  SER C OG    1 
ATOM   7743  N  N     . PRO C  2  536  ? 52.621  -32.468 94.641  1.00 56.78  ? 536  PRO C N     1 
ATOM   7744  C  CA    . PRO C  2  536  ? 51.833  -31.373 94.067  1.00 53.25  ? 536  PRO C CA    1 
ATOM   7745  C  C     . PRO C  2  536  ? 52.735  -30.353 93.373  1.00 50.72  ? 536  PRO C C     1 
ATOM   7746  O  O     . PRO C  2  536  ? 52.321  -29.746 92.375  1.00 46.36  ? 536  PRO C O     1 
ATOM   7747  C  CB    . PRO C  2  536  ? 51.166  -30.742 95.292  1.00 51.66  ? 536  PRO C CB    1 
ATOM   7748  C  CG    . PRO C  2  536  ? 51.157  -31.813 96.320  1.00 55.29  ? 536  PRO C CG    1 
ATOM   7749  C  CD    . PRO C  2  536  ? 52.406  -32.603 96.092  1.00 55.94  ? 536  PRO C CD    1 
ATOM   7750  N  N     . LYS C  2  537  ? 53.961  -30.194 93.879  1.00 47.67  ? 537  LYS C N     1 
ATOM   7751  C  CA    . LYS C  2  537  ? 54.922  -29.249 93.312  1.00 48.06  ? 537  LYS C CA    1 
ATOM   7752  C  C     . LYS C  2  537  ? 55.108  -29.443 91.807  1.00 47.24  ? 537  LYS C C     1 
ATOM   7753  O  O     . LYS C  2  537  ? 55.431  -28.501 91.091  1.00 47.35  ? 537  LYS C O     1 
ATOM   7754  C  CB    . LYS C  2  537  ? 56.285  -29.375 93.995  1.00 46.41  ? 537  LYS C CB    1 
ATOM   7755  C  CG    . LYS C  2  537  ? 56.269  -29.323 95.507  1.00 51.75  ? 537  LYS C CG    1 
ATOM   7756  C  CD    . LYS C  2  537  ? 57.689  -29.376 96.070  1.00 52.16  ? 537  LYS C CD    1 
ATOM   7757  C  CE    . LYS C  2  537  ? 57.710  -29.733 97.557  1.00 76.54  ? 537  LYS C CE    1 
ATOM   7758  N  NZ    . LYS C  2  537  ? 57.064  -28.719 98.452  1.00 78.85  ? 537  LYS C NZ    1 
ATOM   7759  N  N     . GLN C  2  538  ? 54.897  -30.665 91.330  1.00 45.37  ? 538  GLN C N     1 
ATOM   7760  C  CA    . GLN C  2  538  ? 55.159  -30.980 89.932  1.00 53.52  ? 538  GLN C CA    1 
ATOM   7761  C  C     . GLN C  2  538  ? 54.150  -30.349 88.979  1.00 51.28  ? 538  GLN C C     1 
ATOM   7762  O  O     . GLN C  2  538  ? 54.403  -30.258 87.779  1.00 55.16  ? 538  GLN C O     1 
ATOM   7763  C  CB    . GLN C  2  538  ? 55.260  -32.497 89.701  1.00 52.31  ? 538  GLN C CB    1 
ATOM   7764  C  CG    . GLN C  2  538  ? 53.940  -33.237 89.609  1.00 48.12  ? 538  GLN C CG    1 
ATOM   7765  C  CD    . GLN C  2  538  ? 54.138  -34.716 89.343  1.00 49.62  ? 538  GLN C CD    1 
ATOM   7766  O  OE1   . GLN C  2  538  ? 53.866  -35.558 90.193  1.00 52.74  ? 538  GLN C OE1   1 
ATOM   7767  N  NE2   . GLN C  2  538  ? 54.620  -35.037 88.156  1.00 56.46  ? 538  GLN C NE2   1 
ATOM   7768  N  N     . VAL C  2  539  ? 53.019  -29.900 89.512  1.00 47.44  ? 539  VAL C N     1 
ATOM   7769  C  CA    . VAL C  2  539  ? 51.985  -29.306 88.671  1.00 46.41  ? 539  VAL C CA    1 
ATOM   7770  C  C     . VAL C  2  539  ? 52.289  -27.839 88.328  1.00 46.11  ? 539  VAL C C     1 
ATOM   7771  O  O     . VAL C  2  539  ? 51.789  -27.301 87.337  1.00 41.95  ? 539  VAL C O     1 
ATOM   7772  C  CB    . VAL C  2  539  ? 50.596  -29.456 89.331  1.00 46.62  ? 539  VAL C CB    1 
ATOM   7773  C  CG1   . VAL C  2  539  ? 49.505  -28.792 88.505  1.00 42.58  ? 539  VAL C CG1   1 
ATOM   7774  C  CG2   . VAL C  2  539  ? 50.278  -30.925 89.536  1.00 50.40  ? 539  VAL C CG2   1 
ATOM   7775  N  N     . PHE C  2  540  ? 53.149  -27.208 89.120  1.00 42.43  ? 540  PHE C N     1 
ATOM   7776  C  CA    . PHE C  2  540  ? 53.352  -25.771 89.001  1.00 40.60  ? 540  PHE C CA    1 
ATOM   7777  C  C     . PHE C  2  540  ? 54.795  -25.373 88.746  1.00 41.59  ? 540  PHE C C     1 
ATOM   7778  O  O     . PHE C  2  540  ? 55.714  -26.145 88.987  1.00 48.38  ? 540  PHE C O     1 
ATOM   7779  C  CB    . PHE C  2  540  ? 52.827  -25.060 90.251  1.00 45.84  ? 540  PHE C CB    1 
ATOM   7780  C  CG    . PHE C  2  540  ? 51.405  -25.404 90.580  1.00 44.99  ? 540  PHE C CG    1 
ATOM   7781  C  CD1   . PHE C  2  540  ? 51.116  -26.415 91.481  1.00 46.49  ? 540  PHE C CD1   1 
ATOM   7782  C  CD2   . PHE C  2  540  ? 50.357  -24.732 89.973  1.00 44.34  ? 540  PHE C CD2   1 
ATOM   7783  C  CE1   . PHE C  2  540  ? 49.808  -26.743 91.782  1.00 50.77  ? 540  PHE C CE1   1 
ATOM   7784  C  CE2   . PHE C  2  540  ? 49.048  -25.055 90.264  1.00 45.29  ? 540  PHE C CE2   1 
ATOM   7785  C  CZ    . PHE C  2  540  ? 48.772  -26.063 91.171  1.00 50.12  ? 540  PHE C CZ    1 
ATOM   7786  N  N     . SER C  2  541  ? 54.978  -24.147 88.270  1.00 42.31  ? 541  SER C N     1 
ATOM   7787  C  CA    . SER C  2  541  ? 56.296  -23.622 87.959  1.00 44.83  ? 541  SER C CA    1 
ATOM   7788  C  C     . SER C  2  541  ? 57.059  -23.338 89.241  1.00 45.25  ? 541  SER C C     1 
ATOM   7789  O  O     . SER C  2  541  ? 56.540  -23.538 90.335  1.00 45.11  ? 541  SER C O     1 
ATOM   7790  C  CB    . SER C  2  541  ? 56.170  -22.329 87.158  1.00 45.03  ? 541  SER C CB    1 
ATOM   7791  O  OG    . SER C  2  541  ? 55.624  -21.298 87.962  1.00 47.20  ? 541  SER C OG    1 
ATOM   7792  N  N     . VAL C  2  542  ? 58.291  -22.864 89.101  1.00 44.93  ? 542  VAL C N     1 
ATOM   7793  C  CA    . VAL C  2  542  ? 59.111  -22.553 90.260  1.00 43.65  ? 542  VAL C CA    1 
ATOM   7794  C  C     . VAL C  2  542  ? 58.559  -21.331 90.991  1.00 45.79  ? 542  VAL C C     1 
ATOM   7795  O  O     . VAL C  2  542  ? 58.504  -21.312 92.219  1.00 41.59  ? 542  VAL C O     1 
ATOM   7796  C  CB    . VAL C  2  542  ? 60.597  -22.367 89.877  1.00 37.24  ? 542  VAL C CB    1 
ATOM   7797  C  CG1   . VAL C  2  542  ? 61.361  -21.652 90.970  1.00 30.89  ? 542  VAL C CG1   1 
ATOM   7798  C  CG2   . VAL C  2  542  ? 61.233  -23.711 89.580  1.00 41.35  ? 542  VAL C CG2   1 
ATOM   7799  N  N     . ASN C  2  543  ? 58.125  -20.324 90.240  1.00 48.71  ? 543  ASN C N     1 
ATOM   7800  C  CA    . ASN C  2  543  ? 57.545  -19.133 90.856  1.00 46.34  ? 543  ASN C CA    1 
ATOM   7801  C  C     . ASN C  2  543  ? 56.248  -19.437 91.590  1.00 45.50  ? 543  ASN C C     1 
ATOM   7802  O  O     . ASN C  2  543  ? 56.053  -19.001 92.724  1.00 40.51  ? 543  ASN C O     1 
ATOM   7803  C  CB    . ASN C  2  543  ? 57.327  -18.035 89.818  1.00 48.38  ? 543  ASN C CB    1 
ATOM   7804  C  CG    . ASN C  2  543  ? 58.624  -17.524 89.248  1.00 46.47  ? 543  ASN C CG    1 
ATOM   7805  O  OD1   . ASN C  2  543  ? 59.400  -18.288 88.680  1.00 46.88  ? 543  ASN C OD1   1 
ATOM   7806  N  ND2   . ASN C  2  543  ? 58.871  -16.231 89.395  1.00 45.12  ? 543  ASN C ND2   1 
ATOM   7807  N  N     . THR C  2  544  ? 55.369  -20.191 90.938  1.00 43.33  ? 544  THR C N     1 
ATOM   7808  C  CA    . THR C  2  544  ? 54.103  -20.584 91.538  1.00 40.16  ? 544  THR C CA    1 
ATOM   7809  C  C     . THR C  2  544  ? 54.321  -21.422 92.800  1.00 49.51  ? 544  THR C C     1 
ATOM   7810  O  O     . THR C  2  544  ? 53.563  -21.314 93.765  1.00 52.71  ? 544  THR C O     1 
ATOM   7811  C  CB    . THR C  2  544  ? 53.233  -21.354 90.534  1.00 41.11  ? 544  THR C CB    1 
ATOM   7812  O  OG1   . THR C  2  544  ? 53.121  -20.592 89.329  1.00 44.27  ? 544  THR C OG1   1 
ATOM   7813  C  CG2   . THR C  2  544  ? 51.841  -21.604 91.094  1.00 42.18  ? 544  THR C CG2   1 
ATOM   7814  N  N     . ASN C  2  545  ? 55.371  -22.239 92.800  1.00 47.95  ? 545  ASN C N     1 
ATOM   7815  C  CA    . ASN C  2  545  ? 55.675  -23.101 93.941  1.00 44.45  ? 545  ASN C CA    1 
ATOM   7816  C  C     . ASN C  2  545  ? 56.179  -22.360 95.178  1.00 49.17  ? 545  ASN C C     1 
ATOM   7817  O  O     . ASN C  2  545  ? 56.337  -22.957 96.242  1.00 52.09  ? 545  ASN C O     1 
ATOM   7818  C  CB    . ASN C  2  545  ? 56.685  -24.176 93.547  1.00 43.52  ? 545  ASN C CB    1 
ATOM   7819  C  CG    . ASN C  2  545  ? 56.032  -25.502 93.261  1.00 45.68  ? 545  ASN C CG    1 
ATOM   7820  O  OD1   . ASN C  2  545  ? 55.480  -26.136 94.155  1.00 56.85  ? 545  ASN C OD1   1 
ATOM   7821  N  ND2   . ASN C  2  545  ? 56.099  -25.938 92.014  1.00 46.49  ? 545  ASN C ND2   1 
ATOM   7822  N  N     . LEU C  2  546  ? 56.441  -21.065 95.033  1.00 46.15  ? 546  LEU C N     1 
ATOM   7823  C  CA    . LEU C  2  546  ? 56.936  -20.251 96.137  1.00 45.69  ? 546  LEU C CA    1 
ATOM   7824  C  C     . LEU C  2  546  ? 55.812  -19.522 96.877  1.00 44.83  ? 546  LEU C C     1 
ATOM   7825  O  O     . LEU C  2  546  ? 56.072  -18.737 97.792  1.00 43.89  ? 546  LEU C O     1 
ATOM   7826  C  CB    . LEU C  2  546  ? 57.976  -19.244 95.635  1.00 39.63  ? 546  LEU C CB    1 
ATOM   7827  C  CG    . LEU C  2  546  ? 59.339  -19.792 95.233  1.00 38.63  ? 546  LEU C CG    1 
ATOM   7828  C  CD1   . LEU C  2  546  ? 60.179  -18.700 94.599  1.00 41.21  ? 546  LEU C CD1   1 
ATOM   7829  C  CD2   . LEU C  2  546  ? 60.050  -20.380 96.437  1.00 41.70  ? 546  LEU C CD2   1 
ATOM   7830  N  N     . ILE C  2  547  ? 54.571  -19.775 96.468  1.00 44.49  ? 547  ILE C N     1 
ATOM   7831  C  CA    . ILE C  2  547  ? 53.408  -19.125 97.071  1.00 49.49  ? 547  ILE C CA    1 
ATOM   7832  C  C     . ILE C  2  547  ? 52.702  -20.014 98.094  1.00 47.24  ? 547  ILE C C     1 
ATOM   7833  O  O     . ILE C  2  547  ? 51.953  -20.909 97.716  1.00 46.04  ? 547  ILE C O     1 
ATOM   7834  C  CB    . ILE C  2  547  ? 52.358  -18.792 96.001  1.00 45.19  ? 547  ILE C CB    1 
ATOM   7835  C  CG1   . ILE C  2  547  ? 52.964  -17.963 94.875  1.00 38.77  ? 547  ILE C CG1   1 
ATOM   7836  C  CG2   . ILE C  2  547  ? 51.171  -18.071 96.621  1.00 46.14  ? 547  ILE C CG2   1 
ATOM   7837  C  CD1   . ILE C  2  547  ? 51.985  -17.728 93.742  1.00 39.46  ? 547  ILE C CD1   1 
ATOM   7838  N  N     . PRO C  2  548  ? 52.877  -19.726 99.391  1.00 42.49  ? 548  PRO C N     1 
ATOM   7839  C  CA    . PRO C  2  548  ? 52.261  -20.564 100.423 1.00 44.72  ? 548  PRO C CA    1 
ATOM   7840  C  C     . PRO C  2  548  ? 50.747  -20.403 100.437 1.00 44.30  ? 548  PRO C C     1 
ATOM   7841  O  O     . PRO C  2  548  ? 50.248  -19.342 100.084 1.00 43.33  ? 548  PRO C O     1 
ATOM   7842  C  CB    . PRO C  2  548  ? 52.859  -20.013 101.717 1.00 47.41  ? 548  PRO C CB    1 
ATOM   7843  C  CG    . PRO C  2  548  ? 53.171  -18.599 101.403 1.00 50.62  ? 548  PRO C CG    1 
ATOM   7844  C  CD    . PRO C  2  548  ? 53.595  -18.578 99.966  1.00 43.78  ? 548  PRO C CD    1 
ATOM   7845  N  N     . PHE C  2  549  ? 50.035  -21.450 100.840 1.00 48.83  ? 549  PHE C N     1 
ATOM   7846  C  CA    . PHE C  2  549  ? 48.574  -21.442 100.871 1.00 51.04  ? 549  PHE C CA    1 
ATOM   7847  C  C     . PHE C  2  549  ? 47.982  -21.185 99.493  1.00 51.21  ? 549  PHE C C     1 
ATOM   7848  O  O     . PHE C  2  549  ? 46.900  -20.607 99.367  1.00 50.43  ? 549  PHE C O     1 
ATOM   7849  C  CB    . PHE C  2  549  ? 48.048  -20.414 101.874 1.00 49.84  ? 549  PHE C CB    1 
ATOM   7850  C  CG    . PHE C  2  549  ? 48.542  -20.630 103.269 1.00 45.18  ? 549  PHE C CG    1 
ATOM   7851  C  CD1   . PHE C  2  549  ? 48.136  -21.737 103.994 1.00 50.45  ? 549  PHE C CD1   1 
ATOM   7852  C  CD2   . PHE C  2  549  ? 49.404  -19.725 103.861 1.00 43.75  ? 549  PHE C CD2   1 
ATOM   7853  C  CE1   . PHE C  2  549  ? 48.585  -21.943 105.285 1.00 47.84  ? 549  PHE C CE1   1 
ATOM   7854  C  CE2   . PHE C  2  549  ? 49.855  -19.922 105.149 1.00 45.10  ? 549  PHE C CE2   1 
ATOM   7855  C  CZ    . PHE C  2  549  ? 49.445  -21.034 105.863 1.00 44.76  ? 549  PHE C CZ    1 
ATOM   7856  N  N     . LEU C  2  550  ? 48.707  -21.630 98.471  1.00 52.55  ? 550  LEU C N     1 
ATOM   7857  C  CA    . LEU C  2  550  ? 48.306  -21.481 97.076  1.00 45.83  ? 550  LEU C CA    1 
ATOM   7858  C  C     . LEU C  2  550  ? 46.941  -22.104 96.809  1.00 49.12  ? 550  LEU C C     1 
ATOM   7859  O  O     . LEU C  2  550  ? 46.185  -21.620 95.970  1.00 52.51  ? 550  LEU C O     1 
ATOM   7860  C  CB    . LEU C  2  550  ? 49.356  -22.120 96.172  1.00 44.15  ? 550  LEU C CB    1 
ATOM   7861  C  CG    . LEU C  2  550  ? 48.999  -22.291 94.700  1.00 48.05  ? 550  LEU C CG    1 
ATOM   7862  C  CD1   . LEU C  2  550  ? 48.905  -20.938 94.011  1.00 46.78  ? 550  LEU C CD1   1 
ATOM   7863  C  CD2   . LEU C  2  550  ? 50.013  -23.199 94.014  1.00 48.54  ? 550  LEU C CD2   1 
ATOM   7864  N  N     . GLU C  2  551  ? 46.627  -23.177 97.528  1.00 49.08  ? 551  GLU C N     1 
ATOM   7865  C  CA    . GLU C  2  551  ? 45.334  -23.836 97.395  1.00 51.59  ? 551  GLU C CA    1 
ATOM   7866  C  C     . GLU C  2  551  ? 44.185  -22.901 97.796  1.00 54.92  ? 551  GLU C C     1 
ATOM   7867  O  O     . GLU C  2  551  ? 43.031  -23.107 97.403  1.00 50.84  ? 551  GLU C O     1 
ATOM   7868  C  CB    . GLU C  2  551  ? 45.297  -25.125 98.226  1.00 50.53  ? 551  GLU C CB    1 
ATOM   7869  C  CG    . GLU C  2  551  ? 45.493  -24.929 99.728  1.00 51.00  ? 551  GLU C CG    1 
ATOM   7870  C  CD    . GLU C  2  551  ? 46.948  -25.012 100.161 1.00 54.82  ? 551  GLU C CD    1 
ATOM   7871  O  OE1   . GLU C  2  551  ? 47.207  -25.270 101.358 1.00 64.69  ? 551  GLU C OE1   1 
ATOM   7872  O  OE2   . GLU C  2  551  ? 47.835  -24.820 99.308  1.00 54.75  ? 551  GLU C OE2   1 
ATOM   7873  N  N     . HIS C  2  552  ? 44.508  -21.869 98.573  1.00 50.28  ? 552  HIS C N     1 
ATOM   7874  C  CA    . HIS C  2  552  ? 43.504  -20.914 99.031  1.00 50.93  ? 552  HIS C CA    1 
ATOM   7875  C  C     . HIS C  2  552  ? 43.418  -19.669 98.151  1.00 52.50  ? 552  HIS C C     1 
ATOM   7876  O  O     . HIS C  2  552  ? 42.597  -18.790 98.403  1.00 53.69  ? 552  HIS C O     1 
ATOM   7877  C  CB    . HIS C  2  552  ? 43.766  -20.510 100.485 1.00 52.12  ? 552  HIS C CB    1 
ATOM   7878  C  CG    . HIS C  2  552  ? 43.823  -21.668 101.434 1.00 54.58  ? 552  HIS C CG    1 
ATOM   7879  N  ND1   . HIS C  2  552  ? 42.694  -22.303 101.905 1.00 43.59  ? 552  HIS C ND1   1 
ATOM   7880  C  CD2   . HIS C  2  552  ? 44.877  -22.309 101.996 1.00 54.74  ? 552  HIS C CD2   1 
ATOM   7881  C  CE1   . HIS C  2  552  ? 43.048  -23.283 102.717 1.00 46.88  ? 552  HIS C CE1   1 
ATOM   7882  N  NE2   . HIS C  2  552  ? 44.367  -23.306 102.792 1.00 52.97  ? 552  HIS C NE2   1 
ATOM   7883  N  N     . ASP C  2  553  ? 44.262  -19.595 97.124  1.00 50.13  ? 553  ASP C N     1 
ATOM   7884  C  CA    . ASP C  2  553  ? 44.292  -18.432 96.233  1.00 44.40  ? 553  ASP C CA    1 
ATOM   7885  C  C     . ASP C  2  553  ? 43.658  -18.704 94.871  1.00 45.82  ? 553  ASP C C     1 
ATOM   7886  O  O     . ASP C  2  553  ? 44.002  -19.680 94.205  1.00 48.46  ? 553  ASP C O     1 
ATOM   7887  C  CB    . ASP C  2  553  ? 45.728  -17.952 96.020  1.00 40.24  ? 553  ASP C CB    1 
ATOM   7888  C  CG    . ASP C  2  553  ? 46.302  -17.259 97.237  1.00 44.56  ? 553  ASP C CG    1 
ATOM   7889  O  OD1   . ASP C  2  553  ? 47.545  -17.215 97.378  1.00 41.34  ? 553  ASP C OD1   1 
ATOM   7890  O  OD2   . ASP C  2  553  ? 45.508  -16.754 98.057  1.00 50.55  ? 553  ASP C OD2   1 
ATOM   7891  N  N     . ASP C  2  554  ? 42.743  -17.834 94.455  1.00 45.02  ? 554  ASP C N     1 
ATOM   7892  C  CA    . ASP C  2  554  ? 42.186  -17.896 93.106  1.00 46.80  ? 554  ASP C CA    1 
ATOM   7893  C  C     . ASP C  2  554  ? 43.307  -17.771 92.073  1.00 48.34  ? 554  ASP C C     1 
ATOM   7894  O  O     . ASP C  2  554  ? 44.206  -16.943 92.228  1.00 46.68  ? 554  ASP C O     1 
ATOM   7895  C  CB    . ASP C  2  554  ? 41.140  -16.792 92.907  1.00 51.08  ? 554  ASP C CB    1 
ATOM   7896  C  CG    . ASP C  2  554  ? 40.577  -16.757 91.486  1.00 54.45  ? 554  ASP C CG    1 
ATOM   7897  O  OD1   . ASP C  2  554  ? 39.682  -17.575 91.170  1.00 52.82  ? 554  ASP C OD1   1 
ATOM   7898  O  OD2   . ASP C  2  554  ? 41.018  -15.897 90.690  1.00 50.98  ? 554  ASP C OD2   1 
ATOM   7899  N  N     . ALA C  2  555  ? 43.246  -18.593 91.026  1.00 51.87  ? 555  ALA C N     1 
ATOM   7900  C  CA    . ALA C  2  555  ? 44.323  -18.686 90.034  1.00 48.90  ? 555  ALA C CA    1 
ATOM   7901  C  C     . ALA C  2  555  ? 44.723  -17.356 89.386  1.00 47.38  ? 555  ALA C C     1 
ATOM   7902  O  O     . ALA C  2  555  ? 45.908  -17.101 89.172  1.00 48.58  ? 555  ALA C O     1 
ATOM   7903  C  CB    . ALA C  2  555  ? 43.978  -19.718 88.967  1.00 39.61  ? 555  ALA C CB    1 
ATOM   7904  N  N     . ASN C  2  556  ? 43.742  -16.511 89.083  1.00 48.73  ? 556  ASN C N     1 
ATOM   7905  C  CA    . ASN C  2  556  ? 44.015  -15.220 88.449  1.00 48.50  ? 556  ASN C CA    1 
ATOM   7906  C  C     . ASN C  2  556  ? 44.930  -14.321 89.283  1.00 45.20  ? 556  ASN C C     1 
ATOM   7907  O  O     . ASN C  2  556  ? 45.721  -13.549 88.746  1.00 48.27  ? 556  ASN C O     1 
ATOM   7908  C  CB    . ASN C  2  556  ? 42.714  -14.482 88.126  1.00 46.57  ? 556  ASN C CB    1 
ATOM   7909  C  CG    . ASN C  2  556  ? 41.814  -15.262 87.184  1.00 55.60  ? 556  ASN C CG    1 
ATOM   7910  O  OD1   . ASN C  2  556  ? 41.857  -15.074 85.968  1.00 53.98  ? 556  ASN C OD1   1 
ATOM   7911  N  ND2   . ASN C  2  556  ? 40.984  -16.141 87.745  1.00 64.14  ? 556  ASN C ND2   1 
ATOM   7912  N  N     . ARG C  2  557  ? 44.803  -14.406 90.599  1.00 42.04  ? 557  ARG C N     1 
ATOM   7913  C  CA    . ARG C  2  557  ? 45.664  -13.648 91.493  1.00 43.85  ? 557  ARG C CA    1 
ATOM   7914  C  C     . ARG C  2  557  ? 47.021  -14.341 91.722  1.00 45.70  ? 557  ARG C C     1 
ATOM   7915  O  O     . ARG C  2  557  ? 48.073  -13.687 91.787  1.00 42.10  ? 557  ARG C O     1 
ATOM   7916  C  CB    . ARG C  2  557  ? 44.940  -13.395 92.815  1.00 48.13  ? 557  ARG C CB    1 
ATOM   7917  C  CG    . ARG C  2  557  ? 44.987  -11.949 93.267  1.00 50.30  ? 557  ARG C CG    1 
ATOM   7918  C  CD    . ARG C  2  557  ? 44.371  -11.021 92.234  1.00 47.76  ? 557  ARG C CD    1 
ATOM   7919  N  NE    . ARG C  2  557  ? 44.831  -9.647  92.415  1.00 42.64  ? 557  ARG C NE    1 
ATOM   7920  C  CZ    . ARG C  2  557  ? 44.306  -8.598  91.794  1.00 43.15  ? 557  ARG C CZ    1 
ATOM   7921  N  NH1   . ARG C  2  557  ? 43.288  -8.765  90.955  1.00 44.12  ? 557  ARG C NH1   1 
ATOM   7922  N  NH2   . ARG C  2  557  ? 44.791  -7.383  92.016  1.00 40.06  ? 557  ARG C NH2   1 
ATOM   7923  N  N     . ALA C  2  558  ? 46.983  -15.668 91.848  1.00 46.50  ? 558  ALA C N     1 
ATOM   7924  C  CA    . ALA C  2  558  ? 48.190  -16.475 91.992  1.00 39.93  ? 558  ALA C CA    1 
ATOM   7925  C  C     . ALA C  2  558  ? 49.148  -16.206 90.838  1.00 41.00  ? 558  ALA C C     1 
ATOM   7926  O  O     . ALA C  2  558  ? 50.362  -16.131 91.033  1.00 42.73  ? 558  ALA C O     1 
ATOM   7927  C  CB    . ALA C  2  558  ? 47.832  -17.949 92.055  1.00 39.98  ? 558  ALA C CB    1 
ATOM   7928  N  N     . LEU C  2  559  ? 48.580  -16.052 89.641  1.00 41.01  ? 559  LEU C N     1 
ATOM   7929  C  CA    . LEU C  2  559  ? 49.326  -15.659 88.449  1.00 39.80  ? 559  LEU C CA    1 
ATOM   7930  C  C     . LEU C  2  559  ? 50.166  -14.405 88.701  1.00 40.38  ? 559  LEU C C     1 
ATOM   7931  O  O     . LEU C  2  559  ? 51.378  -14.389 88.468  1.00 43.60  ? 559  LEU C O     1 
ATOM   7932  C  CB    . LEU C  2  559  ? 48.348  -15.428 87.293  1.00 36.97  ? 559  LEU C CB    1 
ATOM   7933  C  CG    . LEU C  2  559  ? 48.855  -14.948 85.929  1.00 36.92  ? 559  LEU C CG    1 
ATOM   7934  C  CD1   . LEU C  2  559  ? 47.978  -15.503 84.838  1.00 34.14  ? 559  LEU C CD1   1 
ATOM   7935  C  CD2   . LEU C  2  559  ? 48.867  -13.436 85.837  1.00 41.20  ? 559  LEU C CD2   1 
ATOM   7936  N  N     . MET C  2  560  ? 49.512  -13.358 89.185  1.00 36.70  ? 560  MET C N     1 
ATOM   7937  C  CA    . MET C  2  560  ? 50.191  -12.113 89.504  1.00 37.62  ? 560  MET C CA    1 
ATOM   7938  C  C     . MET C  2  560  ? 51.253  -12.305 90.582  1.00 40.63  ? 560  MET C C     1 
ATOM   7939  O  O     . MET C  2  560  ? 52.311  -11.692 90.510  1.00 37.88  ? 560  MET C O     1 
ATOM   7940  C  CB    . MET C  2  560  ? 49.188  -11.050 89.945  1.00 35.48  ? 560  MET C CB    1 
ATOM   7941  C  CG    . MET C  2  560  ? 48.024  -10.884 88.990  1.00 45.58  ? 560  MET C CG    1 
ATOM   7942  S  SD    . MET C  2  560  ? 46.948  -9.504  89.404  1.00 48.44  ? 560  MET C SD    1 
ATOM   7943  C  CE    . MET C  2  560  ? 45.701  -9.647  88.137  1.00 51.52  ? 560  MET C CE    1 
ATOM   7944  N  N     . GLY C  2  561  ? 50.978  -13.147 91.578  1.00 37.34  ? 561  GLY C N     1 
ATOM   7945  C  CA    . GLY C  2  561  ? 51.971  -13.426 92.606  1.00 38.47  ? 561  GLY C CA    1 
ATOM   7946  C  C     . GLY C  2  561  ? 53.253  -13.998 92.018  1.00 40.99  ? 561  GLY C C     1 
ATOM   7947  O  O     . GLY C  2  561  ? 54.375  -13.493 92.267  1.00 41.19  ? 561  GLY C O     1 
ATOM   7948  N  N     . SER C  2  562  ? 53.064  -15.056 91.228  1.00 39.22  ? 562  SER C N     1 
ATOM   7949  C  CA    . SER C  2  562  ? 54.130  -15.687 90.469  1.00 39.36  ? 562  SER C CA    1 
ATOM   7950  C  C     . SER C  2  562  ? 54.936  -14.648 89.720  1.00 41.41  ? 562  SER C C     1 
ATOM   7951  O  O     . SER C  2  562  ? 56.122  -14.460 89.992  1.00 41.97  ? 562  SER C O     1 
ATOM   7952  C  CB    . SER C  2  562  ? 53.557  -16.685 89.467  1.00 40.16  ? 562  SER C CB    1 
ATOM   7953  O  OG    . SER C  2  562  ? 53.092  -17.850 90.114  1.00 47.24  ? 562  SER C OG    1 
ATOM   7954  N  N     . ASN C  2  563  ? 54.284  -13.971 88.781  1.00 40.80  ? 563  ASN C N     1 
ATOM   7955  C  CA    . ASN C  2  563  ? 54.977  -13.002 87.942  1.00 42.28  ? 563  ASN C CA    1 
ATOM   7956  C  C     . ASN C  2  563  ? 55.674  -11.899 88.739  1.00 41.68  ? 563  ASN C C     1 
ATOM   7957  O  O     . ASN C  2  563  ? 56.729  -11.416 88.351  1.00 46.81  ? 563  ASN C O     1 
ATOM   7958  C  CB    . ASN C  2  563  ? 54.024  -12.386 86.912  1.00 45.50  ? 563  ASN C CB    1 
ATOM   7959  C  CG    . ASN C  2  563  ? 53.541  -13.391 85.878  1.00 50.24  ? 563  ASN C CG    1 
ATOM   7960  O  OD1   . ASN C  2  563  ? 54.284  -14.282 85.455  1.00 48.96  ? 563  ASN C OD1   1 
ATOM   7961  N  ND2   . ASN C  2  563  ? 52.286  -13.246 85.462  1.00 50.20  ? 563  ASN C ND2   1 
ATOM   7962  N  N     . MET C  2  564  ? 55.090  -11.499 89.855  1.00 40.51  ? 564  MET C N     1 
ATOM   7963  C  CA    . MET C  2  564  ? 55.623  -10.354 90.575  1.00 42.52  ? 564  MET C CA    1 
ATOM   7964  C  C     . MET C  2  564  ? 56.851  -10.673 91.407  1.00 42.33  ? 564  MET C C     1 
ATOM   7965  O  O     . MET C  2  564  ? 57.691  -9.797  91.613  1.00 41.68  ? 564  MET C O     1 
ATOM   7966  C  CB    . MET C  2  564  ? 54.547  -9.664  91.408  1.00 39.87  ? 564  MET C CB    1 
ATOM   7967  C  CG    . MET C  2  564  ? 53.622  -8.838  90.553  1.00 42.13  ? 564  MET C CG    1 
ATOM   7968  S  SD    . MET C  2  564  ? 52.459  -7.879  91.511  1.00 51.87  ? 564  MET C SD    1 
ATOM   7969  C  CE    . MET C  2  564  ? 51.594  -9.172  92.403  1.00 45.48  ? 564  MET C CE    1 
ATOM   7970  N  N     . GLN C  2  565  ? 56.970  -11.912 91.883  1.00 45.27  ? 565  GLN C N     1 
ATOM   7971  C  CA    . GLN C  2  565  ? 58.226  -12.303 92.541  1.00 45.95  ? 565  GLN C CA    1 
ATOM   7972  C  C     . GLN C  2  565  ? 59.443  -12.056 91.632  1.00 41.99  ? 565  GLN C C     1 
ATOM   7973  O  O     . GLN C  2  565  ? 60.543  -11.766 92.096  1.00 45.60  ? 565  GLN C O     1 
ATOM   7974  C  CB    . GLN C  2  565  ? 58.181  -13.761 92.973  1.00 43.46  ? 565  GLN C CB    1 
ATOM   7975  C  CG    . GLN C  2  565  ? 57.049  -14.067 93.906  1.00 38.89  ? 565  GLN C CG    1 
ATOM   7976  C  CD    . GLN C  2  565  ? 57.171  -15.439 94.490  1.00 40.50  ? 565  GLN C CD    1 
ATOM   7977  O  OE1   . GLN C  2  565  ? 58.042  -15.689 95.323  1.00 42.69  ? 565  GLN C OE1   1 
ATOM   7978  N  NE2   . GLN C  2  565  ? 56.311  -16.351 94.050  1.00 44.82  ? 565  GLN C NE2   1 
ATOM   7979  N  N     . THR C  2  566  ? 59.219  -12.167 90.332  1.00 37.81  ? 566  THR C N     1 
ATOM   7980  C  CA    . THR C  2  566  ? 60.215  -11.841 89.325  1.00 41.17  ? 566  THR C CA    1 
ATOM   7981  C  C     . THR C  2  566  ? 60.673  -10.384 89.407  1.00 41.09  ? 566  THR C C     1 
ATOM   7982  O  O     . THR C  2  566  ? 61.817  -10.058 89.077  1.00 43.99  ? 566  THR C O     1 
ATOM   7983  C  CB    . THR C  2  566  ? 59.633  -12.135 87.931  1.00 41.44  ? 566  THR C CB    1 
ATOM   7984  O  OG1   . THR C  2  566  ? 59.748  -13.538 87.664  1.00 42.27  ? 566  THR C OG1   1 
ATOM   7985  C  CG2   . THR C  2  566  ? 60.318  -11.322 86.841  1.00 45.10  ? 566  THR C CG2   1 
ATOM   7986  N  N     . GLN C  2  567  ? 59.782  -9.511  89.864  1.00 41.05  ? 567  GLN C N     1 
ATOM   7987  C  CA    . GLN C  2  567  ? 60.040  -8.076  89.843  1.00 35.45  ? 567  GLN C CA    1 
ATOM   7988  C  C     . GLN C  2  567  ? 60.572  -7.537  91.159  1.00 30.94  ? 567  GLN C C     1 
ATOM   7989  O  O     . GLN C  2  567  ? 60.831  -6.341  91.279  1.00 30.25  ? 567  GLN C O     1 
ATOM   7990  C  CB    . GLN C  2  567  ? 58.785  -7.323  89.413  1.00 32.59  ? 567  GLN C CB    1 
ATOM   7991  C  CG    . GLN C  2  567  ? 58.163  -7.918  88.163  1.00 40.09  ? 567  GLN C CG    1 
ATOM   7992  C  CD    . GLN C  2  567  ? 56.784  -7.376  87.855  1.00 42.94  ? 567  GLN C CD    1 
ATOM   7993  O  OE1   . GLN C  2  567  ? 56.374  -6.341  88.381  1.00 46.19  ? 567  GLN C OE1   1 
ATOM   7994  N  NE2   . GLN C  2  567  ? 56.054  -8.084  86.998  1.00 50.34  ? 567  GLN C NE2   1 
ATOM   7995  N  N     . ALA C  2  568  ? 60.754  -8.421  92.135  1.00 35.11  ? 568  ALA C N     1 
ATOM   7996  C  CA    . ALA C  2  568  ? 61.206  -8.014  93.465  1.00 34.10  ? 568  ALA C CA    1 
ATOM   7997  C  C     . ALA C  2  568  ? 62.648  -7.531  93.447  1.00 37.85  ? 568  ALA C C     1 
ATOM   7998  O  O     . ALA C  2  568  ? 63.525  -8.162  92.852  1.00 42.49  ? 568  ALA C O     1 
ATOM   7999  C  CB    . ALA C  2  568  ? 61.034  -9.143  94.465  1.00 32.44  ? 568  ALA C CB    1 
ATOM   8000  N  N     . VAL C  2  569  ? 62.883  -6.402  94.102  1.00 35.01  ? 569  VAL C N     1 
ATOM   8001  C  CA    . VAL C  2  569  ? 64.206  -5.801  94.150  1.00 34.49  ? 569  VAL C CA    1 
ATOM   8002  C  C     . VAL C  2  569  ? 64.995  -6.310  95.358  1.00 43.30  ? 569  VAL C C     1 
ATOM   8003  O  O     . VAL C  2  569  ? 64.454  -6.399  96.462  1.00 47.18  ? 569  VAL C O     1 
ATOM   8004  C  CB    . VAL C  2  569  ? 64.087  -4.270  94.199  1.00 34.72  ? 569  VAL C CB    1 
ATOM   8005  C  CG1   . VAL C  2  569  ? 65.391  -3.645  94.608  1.00 41.28  ? 569  VAL C CG1   1 
ATOM   8006  C  CG2   . VAL C  2  569  ? 63.651  -3.737  92.851  1.00 38.46  ? 569  VAL C CG2   1 
ATOM   8007  N  N     . PRO C  2  570  ? 66.275  -6.670  95.154  1.00 43.01  ? 570  PRO C N     1 
ATOM   8008  C  CA    . PRO C  2  570  ? 67.126  -7.077  96.279  1.00 44.38  ? 570  PRO C CA    1 
ATOM   8009  C  C     . PRO C  2  570  ? 67.316  -5.945  97.280  1.00 43.84  ? 570  PRO C C     1 
ATOM   8010  O  O     . PRO C  2  570  ? 67.764  -4.859  96.900  1.00 35.35  ? 570  PRO C O     1 
ATOM   8011  C  CB    . PRO C  2  570  ? 68.466  -7.386  95.609  1.00 39.16  ? 570  PRO C CB    1 
ATOM   8012  C  CG    . PRO C  2  570  ? 68.125  -7.689  94.201  1.00 41.08  ? 570  PRO C CG    1 
ATOM   8013  C  CD    . PRO C  2  570  ? 66.976  -6.790  93.867  1.00 46.05  ? 570  PRO C CD    1 
ATOM   8014  N  N     . LEU C  2  571  ? 67.030  -6.227  98.549  1.00 44.81  ? 571  LEU C N     1 
ATOM   8015  C  CA    . LEU C  2  571  ? 67.058  -5.218  99.600  1.00 37.76  ? 571  LEU C CA    1 
ATOM   8016  C  C     . LEU C  2  571  ? 68.311  -5.386  100.448 1.00 38.00  ? 571  LEU C C     1 
ATOM   8017  O  O     . LEU C  2  571  ? 68.819  -6.498  100.586 1.00 41.95  ? 571  LEU C O     1 
ATOM   8018  C  CB    . LEU C  2  571  ? 65.814  -5.348  100.467 1.00 39.86  ? 571  LEU C CB    1 
ATOM   8019  C  CG    . LEU C  2  571  ? 64.489  -5.299  99.708  1.00 39.64  ? 571  LEU C CG    1 
ATOM   8020  C  CD1   . LEU C  2  571  ? 63.322  -5.690  100.616 1.00 38.53  ? 571  LEU C CD1   1 
ATOM   8021  C  CD2   . LEU C  2  571  ? 64.284  -3.917  99.123  1.00 35.22  ? 571  LEU C CD2   1 
ATOM   8022  N  N     . ILE C  2  572  ? 68.829  -4.286  100.989 1.00 38.43  ? 572  ILE C N     1 
ATOM   8023  C  CA    . ILE C  2  572  ? 70.028  -4.361  101.832 1.00 46.19  ? 572  ILE C CA    1 
ATOM   8024  C  C     . ILE C  2  572  ? 69.799  -5.180  103.116 1.00 41.99  ? 572  ILE C C     1 
ATOM   8025  O  O     . ILE C  2  572  ? 70.705  -5.860  103.597 1.00 44.86  ? 572  ILE C O     1 
ATOM   8026  C  CB    . ILE C  2  572  ? 70.623  -2.953  102.157 1.00 41.23  ? 572  ILE C CB    1 
ATOM   8027  C  CG1   . ILE C  2  572  ? 69.783  -2.216  103.203 1.00 43.13  ? 572  ILE C CG1   1 
ATOM   8028  C  CG2   . ILE C  2  572  ? 70.758  -2.123  100.889 1.00 34.28  ? 572  ILE C CG2   1 
ATOM   8029  C  CD1   . ILE C  2  572  ? 70.214  -0.787  103.437 1.00 38.73  ? 572  ILE C CD1   1 
ATOM   8030  N  N     . ARG C  2  573  ? 68.593  -5.084  103.666 1.00 34.68  ? 573  ARG C N     1 
ATOM   8031  C  CA    . ARG C  2  573  ? 68.176  -5.840  104.845 1.00 40.30  ? 573  ARG C CA    1 
ATOM   8032  C  C     . ARG C  2  573  ? 67.330  -7.099  104.575 1.00 46.18  ? 573  ARG C C     1 
ATOM   8033  O  O     . ARG C  2  573  ? 66.670  -7.620  105.488 1.00 47.70  ? 573  ARG C O     1 
ATOM   8034  C  CB    . ARG C  2  573  ? 67.572  -4.929  105.915 1.00 41.43  ? 573  ARG C CB    1 
ATOM   8035  C  CG    . ARG C  2  573  ? 68.514  -3.801  106.303 1.00 45.21  ? 573  ARG C CG    1 
ATOM   8036  C  CD    . ARG C  2  573  ? 68.214  -3.249  107.681 1.00 54.04  ? 573  ARG C CD    1 
ATOM   8037  N  NE    . ARG C  2  573  ? 68.450  -4.240  108.724 1.00 58.93  ? 573  ARG C NE    1 
ATOM   8038  C  CZ    . ARG C  2  573  ? 68.127  -4.063  109.999 1.00 61.73  ? 573  ARG C CZ    1 
ATOM   8039  N  NH1   . ARG C  2  573  ? 67.558  -2.930  110.387 1.00 54.77  ? 573  ARG C NH1   1 
ATOM   8040  N  NH2   . ARG C  2  573  ? 68.368  -5.018  110.885 1.00 81.13  ? 573  ARG C NH2   1 
ATOM   8041  N  N     . ALA C  2  574  ? 67.297  -7.532  103.316 1.00 38.65  ? 574  ALA C N     1 
ATOM   8042  C  CA    . ALA C  2  574  ? 66.371  -8.571  102.849 1.00 43.60  ? 574  ALA C CA    1 
ATOM   8043  C  C     . ALA C  2  574  ? 66.297  -9.825  103.722 1.00 46.83  ? 574  ALA C C     1 
ATOM   8044  O  O     . ALA C  2  574  ? 67.314  -10.307 104.228 1.00 50.25  ? 574  ALA C O     1 
ATOM   8045  C  CB    . ALA C  2  574  ? 66.713  -8.967  101.405 1.00 40.87  ? 574  ALA C CB    1 
ATOM   8046  N  N     . GLN C  2  575  ? 65.077  -10.333 103.901 1.00 39.77  ? 575  GLN C N     1 
ATOM   8047  C  CA    . GLN C  2  575  ? 64.845  -11.522 104.720 1.00 45.59  ? 575  GLN C CA    1 
ATOM   8048  C  C     . GLN C  2  575  ? 63.984  -12.545 104.000 1.00 43.69  ? 575  GLN C C     1 
ATOM   8049  O  O     . GLN C  2  575  ? 63.199  -12.195 103.130 1.00 43.57  ? 575  GLN C O     1 
ATOM   8050  C  CB    . GLN C  2  575  ? 64.176  -11.150 106.047 1.00 47.59  ? 575  GLN C CB    1 
ATOM   8051  C  CG    . GLN C  2  575  ? 63.772  -9.695  106.163 1.00 44.25  ? 575  GLN C CG    1 
ATOM   8052  C  CD    . GLN C  2  575  ? 63.075  -9.381  107.465 1.00 43.73  ? 575  GLN C CD    1 
ATOM   8053  O  OE1   . GLN C  2  575  ? 62.285  -8.442  107.543 1.00 52.10  ? 575  GLN C OE1   1 
ATOM   8054  N  NE2   . GLN C  2  575  ? 63.364  -10.163 108.501 1.00 50.71  ? 575  GLN C NE2   1 
ATOM   8055  N  N     . ALA C  2  576  ? 64.146  -13.813 104.357 1.00 47.13  ? 576  ALA C N     1 
ATOM   8056  C  CA    . ALA C  2  576  ? 63.267  -14.860 103.860 1.00 46.32  ? 576  ALA C CA    1 
ATOM   8057  C  C     . ALA C  2  576  ? 61.937  -14.744 104.600 1.00 49.69  ? 576  ALA C C     1 
ATOM   8058  O  O     . ALA C  2  576  ? 61.906  -14.266 105.733 1.00 50.74  ? 576  ALA C O     1 
ATOM   8059  C  CB    . ALA C  2  576  ? 63.895  -16.224 104.090 1.00 50.02  ? 576  ALA C CB    1 
ATOM   8060  N  N     . PRO C  2  577  ? 60.831  -15.164 103.962 1.00 48.78  ? 577  PRO C N     1 
ATOM   8061  C  CA    . PRO C  2  577  ? 59.494  -15.057 104.567 1.00 49.95  ? 577  PRO C CA    1 
ATOM   8062  C  C     . PRO C  2  577  ? 59.306  -15.930 105.818 1.00 49.18  ? 577  PRO C C     1 
ATOM   8063  O  O     . PRO C  2  577  ? 59.943  -16.979 105.916 1.00 48.96  ? 577  PRO C O     1 
ATOM   8064  C  CB    . PRO C  2  577  ? 58.563  -15.527 103.438 1.00 46.28  ? 577  PRO C CB    1 
ATOM   8065  C  CG    . PRO C  2  577  ? 59.421  -16.331 102.529 1.00 45.08  ? 577  PRO C CG    1 
ATOM   8066  C  CD    . PRO C  2  577  ? 60.774  -15.696 102.589 1.00 47.58  ? 577  PRO C CD    1 
ATOM   8067  N  N     . VAL C  2  578  ? 58.449  -15.511 106.754 1.00 48.74  ? 578  VAL C N     1 
ATOM   8068  C  CA    . VAL C  2  578  ? 58.202  -16.320 107.955 1.00 49.26  ? 578  VAL C CA    1 
ATOM   8069  C  C     . VAL C  2  578  ? 57.395  -17.570 107.622 1.00 48.22  ? 578  VAL C C     1 
ATOM   8070  O  O     . VAL C  2  578  ? 57.494  -18.579 108.319 1.00 51.68  ? 578  VAL C O     1 
ATOM   8071  C  CB    . VAL C  2  578  ? 57.521  -15.544 109.125 1.00 44.00  ? 578  VAL C CB    1 
ATOM   8072  C  CG1   . VAL C  2  578  ? 58.114  -14.158 109.290 1.00 41.74  ? 578  VAL C CG1   1 
ATOM   8073  C  CG2   . VAL C  2  578  ? 56.022  -15.469 108.938 1.00 46.98  ? 578  VAL C CG2   1 
ATOM   8074  N  N     . VAL C  2  579  ? 56.595  -17.502 106.561 1.00 41.46  ? 579  VAL C N     1 
ATOM   8075  C  CA    . VAL C  2  579  ? 55.949  -18.696 106.028 1.00 44.02  ? 579  VAL C CA    1 
ATOM   8076  C  C     . VAL C  2  579  ? 56.542  -19.027 104.665 1.00 51.66  ? 579  VAL C C     1 
ATOM   8077  O  O     . VAL C  2  579  ? 56.321  -18.300 103.693 1.00 49.03  ? 579  VAL C O     1 
ATOM   8078  C  CB    . VAL C  2  579  ? 54.439  -18.507 105.859 1.00 40.72  ? 579  VAL C CB    1 
ATOM   8079  C  CG1   . VAL C  2  579  ? 53.811  -19.784 105.321 1.00 41.90  ? 579  VAL C CG1   1 
ATOM   8080  C  CG2   . VAL C  2  579  ? 53.810  -18.107 107.175 1.00 48.02  ? 579  VAL C CG2   1 
ATOM   8081  N  N     . MET C  2  580  ? 57.315  -20.106 104.593 1.00 51.84  ? 580  MET C N     1 
ATOM   8082  C  CA    . MET C  2  580  ? 57.878  -20.520 103.320 1.00 46.91  ? 580  MET C CA    1 
ATOM   8083  C  C     . MET C  2  580  ? 57.185  -21.768 102.781 1.00 48.97  ? 580  MET C C     1 
ATOM   8084  O  O     . MET C  2  580  ? 56.387  -22.400 103.473 1.00 46.76  ? 580  MET C O     1 
ATOM   8085  C  CB    . MET C  2  580  ? 59.367  -20.785 103.490 1.00 46.17  ? 580  MET C CB    1 
ATOM   8086  C  CG    . MET C  2  580  ? 60.173  -19.566 103.889 1.00 51.17  ? 580  MET C CG    1 
ATOM   8087  S  SD    . MET C  2  580  ? 61.851  -19.981 104.425 1.00 58.28  ? 580  MET C SD    1 
ATOM   8088  C  CE    . MET C  2  580  ? 61.510  -20.873 105.939 1.00 53.47  ? 580  MET C CE    1 
ATOM   8089  N  N     . THR C  2  581  ? 57.507  -22.125 101.544 1.00 50.01  ? 581  THR C N     1 
ATOM   8090  C  CA    . THR C  2  581  ? 56.985  -23.344 100.942 1.00 52.39  ? 581  THR C CA    1 
ATOM   8091  C  C     . THR C  2  581  ? 58.007  -24.479 100.928 1.00 56.13  ? 581  THR C C     1 
ATOM   8092  O  O     . THR C  2  581  ? 57.689  -25.609 100.544 1.00 55.69  ? 581  THR C O     1 
ATOM   8093  C  CB    . THR C  2  581  ? 56.502  -23.081 99.509  1.00 54.59  ? 581  THR C CB    1 
ATOM   8094  O  OG1   . THR C  2  581  ? 57.631  -22.838 98.662  1.00 51.26  ? 581  THR C OG1   1 
ATOM   8095  C  CG2   . THR C  2  581  ? 55.589  -21.870 99.478  1.00 51.42  ? 581  THR C CG2   1 
ATOM   8096  N  N     . GLY C  2  582  ? 59.232  -24.173 101.350 1.00 57.89  ? 582  GLY C N     1 
ATOM   8097  C  CA    . GLY C  2  582  ? 60.312  -25.144 101.336 1.00 58.02  ? 582  GLY C CA    1 
ATOM   8098  C  C     . GLY C  2  582  ? 61.152  -25.194 100.065 1.00 62.35  ? 582  GLY C C     1 
ATOM   8099  O  O     . GLY C  2  582  ? 62.047  -26.031 99.944  1.00 77.62  ? 582  GLY C O     1 
ATOM   8100  N  N     . LEU C  2  583  ? 60.862  -24.324 99.105  1.00 54.43  ? 583  LEU C N     1 
ATOM   8101  C  CA    . LEU C  2  583  ? 61.676  -24.239 97.895  1.00 53.56  ? 583  LEU C CA    1 
ATOM   8102  C  C     . LEU C  2  583  ? 62.716  -23.118 97.927  1.00 51.71  ? 583  LEU C C     1 
ATOM   8103  O  O     . LEU C  2  583  ? 63.536  -23.001 97.022  1.00 47.04  ? 583  LEU C O     1 
ATOM   8104  C  CB    . LEU C  2  583  ? 60.780  -24.032 96.676  1.00 54.76  ? 583  LEU C CB    1 
ATOM   8105  C  CG    . LEU C  2  583  ? 60.873  -25.057 95.552  1.00 47.65  ? 583  LEU C CG    1 
ATOM   8106  C  CD1   . LEU C  2  583  ? 60.139  -26.328 95.946  1.00 55.90  ? 583  LEU C CD1   1 
ATOM   8107  C  CD2   . LEU C  2  583  ? 60.305  -24.473 94.283  1.00 41.85  ? 583  LEU C CD2   1 
ATOM   8108  N  N     . GLU C  2  584  ? 62.697  -22.298 98.968  1.00 54.20  ? 584  GLU C N     1 
ATOM   8109  C  CA    . GLU C  2  584  ? 63.451  -21.049 98.925  1.00 48.40  ? 584  GLU C CA    1 
ATOM   8110  C  C     . GLU C  2  584  ? 64.969  -21.204 99.055  1.00 51.44  ? 584  GLU C C     1 
ATOM   8111  O  O     . GLU C  2  584  ? 65.710  -20.304 98.668  1.00 53.29  ? 584  GLU C O     1 
ATOM   8112  C  CB    . GLU C  2  584  ? 62.899  -20.028 99.930  1.00 45.43  ? 584  GLU C CB    1 
ATOM   8113  C  CG    . GLU C  2  584  ? 61.959  -20.609 100.964 1.00 52.06  ? 584  GLU C CG    1 
ATOM   8114  C  CD    . GLU C  2  584  ? 60.525  -20.761 100.473 1.00 57.65  ? 584  GLU C CD    1 
ATOM   8115  O  OE1   . GLU C  2  584  ? 59.850  -19.736 100.221 1.00 56.79  ? 584  GLU C OE1   1 
ATOM   8116  O  OE2   . GLU C  2  584  ? 60.061  -21.915 100.371 1.00 60.25  ? 584  GLU C OE2   1 
ATOM   8117  N  N     . GLU C  2  585  ? 65.387  -22.298 99.673  1.00 60.46  ? 585  GLU C N     1 
ATOM   8118  C  CA    . GLU C  2  585  ? 66.761  -22.782 99.665  1.00 57.24  ? 585  GLU C CA    1 
ATOM   8119  C  C     . GLU C  2  585  ? 67.273  -23.311 98.331  1.00 53.53  ? 585  GLU C C     1 
ATOM   8120  O  O     . GLU C  2  585  ? 68.361  -22.990 97.919  1.00 55.80  ? 585  GLU C O     1 
ATOM   8121  C  CB    . GLU C  2  585  ? 66.903  -23.888 100.704 1.00 56.38  ? 585  GLU C CB    1 
ATOM   8122  C  CG    . GLU C  2  585  ? 67.634  -23.493 101.967 1.00 65.17  ? 585  GLU C CG    1 
ATOM   8123  C  CD    . GLU C  2  585  ? 67.464  -24.504 103.078 1.00 77.59  ? 585  GLU C CD    1 
ATOM   8124  O  OE1   . GLU C  2  585  ? 66.479  -25.255 103.069 1.00 74.89  ? 585  GLU C OE1   1 
ATOM   8125  O  OE2   . GLU C  2  585  ? 68.316  -24.559 103.976 1.00 80.67  ? 585  GLU C OE2   1 
ATOM   8126  N  N     . ARG C  2  586  ? 66.481  -24.130 97.664  1.00 46.84  ? 586  ARG C N     1 
ATOM   8127  C  CA    . ARG C  2  586  ? 66.890  -24.734 96.409  1.00 51.60  ? 586  ARG C CA    1 
ATOM   8128  C  C     . ARG C  2  586  ? 67.059  -23.702 95.327  1.00 55.63  ? 586  ARG C C     1 
ATOM   8129  O  O     . ARG C  2  586  ? 67.928  -23.797 94.497  1.00 51.01  ? 586  ARG C O     1 
ATOM   8130  C  CB    . ARG C  2  586  ? 65.892  -25.788 95.959  1.00 49.07  ? 586  ARG C CB    1 
ATOM   8131  C  CG    . ARG C  2  586  ? 66.420  -27.212 95.889  1.00 48.61  ? 586  ARG C CG    1 
ATOM   8132  C  CD    . ARG C  2  586  ? 67.818  -27.322 95.328  1.00 49.75  ? 586  ARG C CD    1 
ATOM   8133  N  NE    . ARG C  2  586  ? 67.814  -27.728 93.935  1.00 49.44  ? 586  ARG C NE    1 
ATOM   8134  C  CZ    . ARG C  2  586  ? 67.290  -28.851 93.494  1.00 50.04  ? 586  ARG C CZ    1 
ATOM   8135  N  NH1   . ARG C  2  586  ? 66.736  -29.684 94.332  1.00 50.98  ? 586  ARG C NH1   1 
ATOM   8136  N  NH2   . ARG C  2  586  ? 67.320  -29.140 92.215  1.00 48.97  ? 586  ARG C NH2   1 
ATOM   8137  N  N     . VAL C  2  587  ? 66.173  -22.729 95.314  1.00 59.30  ? 587  VAL C N     1 
ATOM   8138  C  CA    . VAL C  2  587  ? 66.200  -21.705 94.305  1.00 50.37  ? 587  VAL C CA    1 
ATOM   8139  C  C     . VAL C  2  587  ? 67.473  -20.914 94.398  1.00 49.70  ? 587  VAL C C     1 
ATOM   8140  O  O     . VAL C  2  587  ? 68.102  -20.630 93.411  1.00 49.98  ? 587  VAL C O     1 
ATOM   8141  C  CB    . VAL C  2  587  ? 65.019  -20.750 94.491  1.00 48.86  ? 587  VAL C CB    1 
ATOM   8142  C  CG1   . VAL C  2  587  ? 65.217  -19.496 93.678  1.00 46.14  ? 587  VAL C CG1   1 
ATOM   8143  C  CG2   . VAL C  2  587  ? 63.735  -21.429 94.093  1.00 37.13  ? 587  VAL C CG2   1 
ATOM   8144  N  N     . VAL C  2  588  ? 67.865  -20.565 95.599  1.00 48.73  ? 588  VAL C N     1 
ATOM   8145  C  CA    . VAL C  2  588  ? 69.070  -19.805 95.766  1.00 52.79  ? 588  VAL C CA    1 
ATOM   8146  C  C     . VAL C  2  588  ? 70.256  -20.612 95.319  1.00 55.87  ? 588  VAL C C     1 
ATOM   8147  O  O     . VAL C  2  588  ? 71.177  -20.100 94.726  1.00 55.39  ? 588  VAL C O     1 
ATOM   8148  C  CB    . VAL C  2  588  ? 69.261  -19.398 97.217  1.00 47.76  ? 588  VAL C CB    1 
ATOM   8149  C  CG1   . VAL C  2  588  ? 70.604  -18.748 97.400  1.00 49.92  ? 588  VAL C CG1   1 
ATOM   8150  C  CG2   . VAL C  2  588  ? 68.179  -18.439 97.620  1.00 46.70  ? 588  VAL C CG2   1 
ATOM   8151  N  N     . ARG C  2  589  ? 70.249  -21.884 95.653  1.00 54.74  ? 589  ARG C N     1 
ATOM   8152  C  CA    . ARG C  2  589  ? 71.352  -22.744 95.312  1.00 53.58  ? 589  ARG C CA    1 
ATOM   8153  C  C     . ARG C  2  589  ? 71.530  -22.938 93.822  1.00 53.81  ? 589  ARG C C     1 
ATOM   8154  O  O     . ARG C  2  589  ? 72.627  -22.877 93.322  1.00 51.06  ? 589  ARG C O     1 
ATOM   8155  C  CB    . ARG C  2  589  ? 71.180  -24.078 96.027  1.00 54.71  ? 589  ARG C CB    1 
ATOM   8156  C  CG    . ARG C  2  589  ? 71.724  -25.274 95.299  1.00 55.41  ? 589  ARG C CG    1 
ATOM   8157  C  CD    . ARG C  2  589  ? 72.755  -26.018 96.117  1.00 58.79  ? 589  ARG C CD    1 
ATOM   8158  N  NE    . ARG C  2  589  ? 72.499  -25.985 97.546  1.00 70.21  ? 589  ARG C NE    1 
ATOM   8159  C  CZ    . ARG C  2  589  ? 73.427  -26.218 98.461  1.00 72.30  ? 589  ARG C CZ    1 
ATOM   8160  N  NH1   . ARG C  2  589  ? 74.659  -26.492 98.095  1.00 75.55  ? 589  ARG C NH1   1 
ATOM   8161  N  NH2   . ARG C  2  589  ? 73.131  -26.174 99.738  1.00 71.02  ? 589  ARG C NH2   1 
ATOM   8162  N  N     . ASP C  2  590  ? 70.442  -23.173 93.118  1.00 50.90  ? 590  ASP C N     1 
ATOM   8163  C  CA    . ASP C  2  590  ? 70.467  -23.343 91.679  1.00 48.16  ? 590  ASP C CA    1 
ATOM   8164  C  C     . ASP C  2  590  ? 70.752  -22.078 90.902  1.00 54.94  ? 590  ASP C C     1 
ATOM   8165  O  O     . ASP C  2  590  ? 71.211  -22.123 89.784  1.00 58.46  ? 590  ASP C O     1 
ATOM   8166  C  CB    . ASP C  2  590  ? 69.199  -24.007 91.199  1.00 46.78  ? 590  ASP C CB    1 
ATOM   8167  C  CG    . ASP C  2  590  ? 69.145  -25.440 91.575  1.00 51.50  ? 590  ASP C CG    1 
ATOM   8168  O  OD1   . ASP C  2  590  ? 69.721  -25.798 92.595  1.00 47.41  ? 590  ASP C OD1   1 
ATOM   8169  O  OD2   . ASP C  2  590  ? 68.539  -26.223 90.849  1.00 54.49  ? 590  ASP C OD2   1 
ATOM   8170  N  N     . SER C  2  591  ? 70.406  -20.950 91.489  1.00 58.61  ? 591  SER C N     1 
ATOM   8171  C  CA    . SER C  2  591  ? 70.624  -19.650 90.899  1.00 53.97  ? 591  SER C CA    1 
ATOM   8172  C  C     . SER C  2  591  ? 72.083  -19.363 90.709  1.00 57.57  ? 591  SER C C     1 
ATOM   8173  O  O     . SER C  2  591  ? 72.456  -18.707 89.770  1.00 74.60  ? 591  SER C O     1 
ATOM   8174  C  CB    . SER C  2  591  ? 70.088  -18.582 91.805  1.00 64.69  ? 591  SER C CB    1 
ATOM   8175  O  OG    . SER C  2  591  ? 71.180  -18.026 92.499  1.00 74.75  ? 591  SER C OG    1 
ATOM   8176  N  N     . LEU C  2  592  ? 72.913  -19.779 91.640  1.00 59.25  ? 592  LEU C N     1 
ATOM   8177  C  CA    . LEU C  2  592  ? 74.348  -19.634 91.472  1.00 66.42  ? 592  LEU C CA    1 
ATOM   8178  C  C     . LEU C  2  592  ? 74.845  -18.294 91.963  1.00 66.64  ? 592  LEU C C     1 
ATOM   8179  O  O     . LEU C  2  592  ? 76.027  -18.026 91.976  1.00 66.00  ? 592  LEU C O     1 
ATOM   8180  C  CB    . LEU C  2  592  ? 74.705  -19.785 90.010  1.00 59.69  ? 592  LEU C CB    1 
ATOM   8181  C  CG    . LEU C  2  592  ? 75.007  -21.182 89.518  1.00 57.92  ? 592  LEU C CG    1 
ATOM   8182  C  CD1   . LEU C  2  592  ? 76.429  -21.221 89.022  1.00 74.17  ? 592  LEU C CD1   1 
ATOM   8183  C  CD2   . LEU C  2  592  ? 74.844  -22.144 90.657  1.00 58.06  ? 592  LEU C CD2   1 
ATOM   8184  N  N     . ALA C  2  593  ? 73.913  -17.459 92.365  1.00 61.87  ? 593  ALA C N     1 
ATOM   8185  C  CA    . ALA C  2  593  ? 74.167  -16.254 93.161  1.00 69.78  ? 593  ALA C CA    1 
ATOM   8186  C  C     . ALA C  2  593  ? 74.882  -16.454 94.517  1.00 75.77  ? 593  ALA C C     1 
ATOM   8187  O  O     . ALA C  2  593  ? 75.820  -15.713 94.838  1.00 65.29  ? 593  ALA C O     1 
ATOM   8188  C  CB    . ALA C  2  593  ? 72.860  -15.491 93.365  1.00 74.33  ? 593  ALA C CB    1 
ATOM   8189  N  N     . ALA C  2  594  ? 74.423  -17.416 95.319  1.00 74.25  ? 594  ALA C N     1 
ATOM   8190  C  CA    . ALA C  2  594  ? 75.081  -17.738 96.593  1.00 63.09  ? 594  ALA C CA    1 
ATOM   8191  C  C     . ALA C  2  594  ? 76.316  -18.624 96.418  1.00 62.74  ? 594  ALA C C     1 
ATOM   8192  O  O     . ALA C  2  594  ? 76.433  -19.361 95.443  1.00 70.02  ? 594  ALA C O     1 
ATOM   8193  C  CB    . ALA C  2  594  ? 74.104  -18.377 97.565  1.00 59.79  ? 594  ALA C CB    1 
ATOM   8194  N  N     . LEU C  2  595  ? 77.228  -18.555 97.380  1.00 63.51  ? 595  LEU C N     1 
ATOM   8195  C  CA    . LEU C  2  595  ? 78.496  -19.271 97.303  1.00 57.20  ? 595  LEU C CA    1 
ATOM   8196  C  C     . LEU C  2  595  ? 78.556  -20.398 98.330  1.00 60.87  ? 595  LEU C C     1 
ATOM   8197  O  O     . LEU C  2  595  ? 78.240  -20.192 99.498  1.00 67.59  ? 595  LEU C O     1 
ATOM   8198  C  CB    . LEU C  2  595  ? 79.630  -18.287 97.555  1.00 56.25  ? 595  LEU C CB    1 
ATOM   8199  C  CG    . LEU C  2  595  ? 81.044  -18.694 97.170  1.00 63.96  ? 595  LEU C CG    1 
ATOM   8200  C  CD1   . LEU C  2  595  ? 81.170  -18.804 95.658  1.00 74.57  ? 595  LEU C CD1   1 
ATOM   8201  C  CD2   . LEU C  2  595  ? 82.020  -17.680 97.725  1.00 64.66  ? 595  LEU C CD2   1 
ATOM   8202  N  N     . TYR C  2  596  ? 78.968  -21.588 97.905  1.00 64.66  ? 596  TYR C N     1 
ATOM   8203  C  CA    . TYR C  2  596  ? 79.032  -22.737 98.810  1.00 64.73  ? 596  TYR C CA    1 
ATOM   8204  C  C     . TYR C  2  596  ? 80.415  -23.396 98.838  1.00 70.73  ? 596  TYR C C     1 
ATOM   8205  O  O     . TYR C  2  596  ? 81.232  -23.188 97.939  1.00 75.82  ? 596  TYR C O     1 
ATOM   8206  C  CB    . TYR C  2  596  ? 77.966  -23.772 98.440  1.00 66.33  ? 596  TYR C CB    1 
ATOM   8207  C  CG    . TYR C  2  596  ? 76.557  -23.223 98.403  1.00 70.04  ? 596  TYR C CG    1 
ATOM   8208  C  CD1   . TYR C  2  596  ? 76.035  -22.671 97.238  1.00 68.48  ? 596  TYR C CD1   1 
ATOM   8209  C  CD2   . TYR C  2  596  ? 75.743  -23.259 99.533  1.00 72.49  ? 596  TYR C CD2   1 
ATOM   8210  C  CE1   . TYR C  2  596  ? 74.740  -22.167 97.198  1.00 67.15  ? 596  TYR C CE1   1 
ATOM   8211  C  CE2   . TYR C  2  596  ? 74.448  -22.759 99.504  1.00 67.74  ? 596  TYR C CE2   1 
ATOM   8212  C  CZ    . TYR C  2  596  ? 73.953  -22.213 98.334  1.00 69.67  ? 596  TYR C CZ    1 
ATOM   8213  O  OH    . TYR C  2  596  ? 72.669  -21.714 98.302  1.00 63.89  ? 596  TYR C OH    1 
ATOM   8214  N  N     . ALA C  2  597  ? 80.666  -24.197 99.872  1.00 73.01  ? 597  ALA C N     1 
ATOM   8215  C  CA    . ALA C  2  597  ? 81.946  -24.885 100.038 1.00 74.46  ? 597  ALA C CA    1 
ATOM   8216  C  C     . ALA C  2  597  ? 82.015  -26.182 99.229  1.00 81.83  ? 597  ALA C C     1 
ATOM   8217  O  O     . ALA C  2  597  ? 81.095  -27.000 99.281  1.00 79.53  ? 597  ALA C O     1 
ATOM   8218  C  CB    . ALA C  2  597  ? 82.205  -25.164 101.508 1.00 68.34  ? 597  ALA C CB    1 
ATOM   8219  N  N     . GLU C  2  598  ? 83.109  -26.365 98.489  1.00 81.75  ? 598  GLU C N     1 
ATOM   8220  C  CA    . GLU C  2  598  ? 83.285  -27.539 97.631  1.00 83.40  ? 598  GLU C CA    1 
ATOM   8221  C  C     . GLU C  2  598  ? 83.333  -28.854 98.399  1.00 89.49  ? 598  GLU C C     1 
ATOM   8222  O  O     . GLU C  2  598  ? 82.544  -29.759 98.135  1.00 90.15  ? 598  GLU C O     1 
ATOM   8223  C  CB    . GLU C  2  598  ? 84.547  -27.409 96.777  1.00 89.04  ? 598  GLU C CB    1 
ATOM   8224  C  CG    . GLU C  2  598  ? 84.476  -26.322 95.723  1.00 100.91 ? 598  GLU C CG    1 
ATOM   8225  C  CD    . GLU C  2  598  ? 85.702  -26.299 94.835  1.00 106.40 ? 598  GLU C CD    1 
ATOM   8226  O  OE1   . GLU C  2  598  ? 86.260  -27.387 94.571  1.00 108.11 ? 598  GLU C OE1   1 
ATOM   8227  O  OE2   . GLU C  2  598  ? 86.107  -25.195 94.410  1.00 102.32 ? 598  GLU C OE2   1 
ATOM   8228  N  N     . GLU C  2  599  ? 84.272  -28.958 99.334  1.00 91.70  ? 599  GLU C N     1 
ATOM   8229  C  CA    . GLU C  2  599  ? 84.402  -30.149 100.167 1.00 93.69  ? 599  GLU C CA    1 
ATOM   8230  C  C     . GLU C  2  599  ? 84.394  -29.727 101.629 1.00 88.31  ? 599  GLU C C     1 
ATOM   8231  O  O     . GLU C  2  599  ? 84.240  -28.547 101.932 1.00 83.71  ? 599  GLU C O     1 
ATOM   8232  C  CB    . GLU C  2  599  ? 85.698  -30.894 99.838  1.00 97.61  ? 599  GLU C CB    1 
ATOM   8233  C  CG    . GLU C  2  599  ? 85.550  -32.408 99.786  1.00 105.74 ? 599  GLU C CG    1 
ATOM   8234  C  CD    . GLU C  2  599  ? 84.878  -32.887 98.507  1.00 106.91 ? 599  GLU C CD    1 
ATOM   8235  O  OE1   . GLU C  2  599  ? 85.079  -32.247 97.450  1.00 95.95  ? 599  GLU C OE1   1 
ATOM   8236  O  OE2   . GLU C  2  599  ? 84.148  -33.903 98.561  1.00 106.43 ? 599  GLU C OE2   1 
ATOM   8237  N  N     . ASP C  2  600  ? 84.552  -30.684 102.538 1.00 88.50  ? 600  ASP C N     1 
ATOM   8238  C  CA    . ASP C  2  600  ? 84.686  -30.350 103.952 1.00 87.73  ? 600  ASP C CA    1 
ATOM   8239  C  C     . ASP C  2  600  ? 85.976  -29.570 104.143 1.00 90.35  ? 600  ASP C C     1 
ATOM   8240  O  O     . ASP C  2  600  ? 86.924  -29.738 103.378 1.00 98.19  ? 600  ASP C O     1 
ATOM   8241  C  CB    . ASP C  2  600  ? 84.702  -31.613 104.810 1.00 91.10  ? 600  ASP C CB    1 
ATOM   8242  C  CG    . ASP C  2  600  ? 83.421  -32.414 104.693 1.00 96.72  ? 600  ASP C CG    1 
ATOM   8243  O  OD1   . ASP C  2  600  ? 82.594  -32.353 105.627 1.00 97.39  ? 600  ASP C OD1   1 
ATOM   8244  O  OD2   . ASP C  2  600  ? 83.238  -33.101 103.665 1.00 103.92 ? 600  ASP C OD2   1 
ATOM   8245  N  N     . GLY C  2  601  ? 86.018  -28.705 105.149 1.00 83.96  ? 601  GLY C N     1 
ATOM   8246  C  CA    . GLY C  2  601  ? 87.208  -27.905 105.367 1.00 87.42  ? 601  GLY C CA    1 
ATOM   8247  C  C     . GLY C  2  601  ? 87.103  -26.875 106.472 1.00 86.77  ? 601  GLY C C     1 
ATOM   8248  O  O     . GLY C  2  601  ? 86.146  -26.863 107.248 1.00 91.58  ? 601  GLY C O     1 
ATOM   8249  N  N     . GLU C  2  602  ? 88.106  -26.009 106.544 1.00 80.92  ? 602  GLU C N     1 
ATOM   8250  C  CA    . GLU C  2  602  ? 88.138  -24.951 107.540 1.00 84.05  ? 602  GLU C CA    1 
ATOM   8251  C  C     . GLU C  2  602  ? 88.382  -23.611 106.861 1.00 81.96  ? 602  GLU C C     1 
ATOM   8252  O  O     . GLU C  2  602  ? 89.163  -23.515 105.914 1.00 78.53  ? 602  GLU C O     1 
ATOM   8253  C  CB    . GLU C  2  602  ? 89.225  -25.222 108.581 1.00 92.56  ? 602  GLU C CB    1 
ATOM   8254  C  CG    . GLU C  2  602  ? 89.257  -24.213 109.718 1.00 94.81  ? 602  GLU C CG    1 
ATOM   8255  C  CD    . GLU C  2  602  ? 90.375  -24.477 110.708 1.00 103.75 ? 602  GLU C CD    1 
ATOM   8256  O  OE1   . GLU C  2  602  ? 90.101  -25.080 111.769 1.00 108.91 ? 602  GLU C OE1   1 
ATOM   8257  O  OE2   . GLU C  2  602  ? 91.524  -24.077 110.426 1.00 106.24 ? 602  GLU C OE2   1 
ATOM   8258  N  N     . VAL C  2  603  ? 87.712  -22.576 107.351 1.00 82.04  ? 603  VAL C N     1 
ATOM   8259  C  CA    . VAL C  2  603  ? 87.824  -21.264 106.743 1.00 80.89  ? 603  VAL C CA    1 
ATOM   8260  C  C     . VAL C  2  603  ? 89.111  -20.590 107.196 1.00 76.12  ? 603  VAL C C     1 
ATOM   8261  O  O     . VAL C  2  603  ? 89.309  -20.335 108.383 1.00 72.92  ? 603  VAL C O     1 
ATOM   8262  C  CB    . VAL C  2  603  ? 86.618  -20.382 107.104 1.00 74.87  ? 603  VAL C CB    1 
ATOM   8263  C  CG1   . VAL C  2  603  ? 86.800  -18.991 106.536 1.00 70.19  ? 603  VAL C CG1   1 
ATOM   8264  C  CG2   . VAL C  2  603  ? 85.330  -21.014 106.587 1.00 67.54  ? 603  VAL C CG2   1 
ATOM   8265  N  N     . ALA C  2  604  ? 89.986  -20.311 106.236 1.00 68.51  ? 604  ALA C N     1 
ATOM   8266  C  CA    . ALA C  2  604  ? 91.255  -19.659 106.520 1.00 67.81  ? 604  ALA C CA    1 
ATOM   8267  C  C     . ALA C  2  604  ? 91.113  -18.150 106.643 1.00 69.38  ? 604  ALA C C     1 
ATOM   8268  O  O     . ALA C  2  604  ? 91.667  -17.534 107.552 1.00 73.67  ? 604  ALA C O     1 
ATOM   8269  C  CB    . ALA C  2  604  ? 92.274  -20.003 105.444 1.00 73.51  ? 604  ALA C CB    1 
ATOM   8270  N  N     . LYS C  2  605  ? 90.363  -17.554 105.725 1.00 72.22  ? 605  LYS C N     1 
ATOM   8271  C  CA    . LYS C  2  605  ? 90.258  -16.103 105.679 1.00 70.31  ? 605  LYS C CA    1 
ATOM   8272  C  C     . LYS C  2  605  ? 88.845  -15.628 105.362 1.00 66.94  ? 605  LYS C C     1 
ATOM   8273  O  O     . LYS C  2  605  ? 88.136  -16.255 104.581 1.00 67.41  ? 605  LYS C O     1 
ATOM   8274  C  CB    . LYS C  2  605  ? 91.243  -15.535 104.657 1.00 73.04  ? 605  LYS C CB    1 
ATOM   8275  C  CG    . LYS C  2  605  ? 92.698  -15.667 105.054 1.00 74.26  ? 605  LYS C CG    1 
ATOM   8276  C  CD    . LYS C  2  605  ? 93.605  -15.010 104.031 1.00 80.91  ? 605  LYS C CD    1 
ATOM   8277  C  CE    . LYS C  2  605  ? 95.064  -15.094 104.454 1.00 86.60  ? 605  LYS C CE    1 
ATOM   8278  N  NZ    . LYS C  2  605  ? 95.960  -14.406 103.485 1.00 88.89  ? 605  LYS C NZ    1 
ATOM   8279  N  N     . VAL C  2  606  ? 88.437  -14.527 105.987 1.00 68.07  ? 606  VAL C N     1 
ATOM   8280  C  CA    . VAL C  2  606  ? 87.152  -13.901 105.690 1.00 65.17  ? 606  VAL C CA    1 
ATOM   8281  C  C     . VAL C  2  606  ? 87.288  -12.388 105.556 1.00 66.18  ? 606  VAL C C     1 
ATOM   8282  O  O     . VAL C  2  606  ? 87.715  -11.696 106.479 1.00 66.81  ? 606  VAL C O     1 
ATOM   8283  C  CB    . VAL C  2  606  ? 86.070  -14.236 106.736 1.00 67.78  ? 606  VAL C CB    1 
ATOM   8284  C  CG1   . VAL C  2  606  ? 84.850  -13.353 106.540 1.00 62.48  ? 606  VAL C CG1   1 
ATOM   8285  C  CG2   . VAL C  2  606  ? 85.672  -15.688 106.630 1.00 67.89  ? 606  VAL C CG2   1 
ATOM   8286  N  N     . ASP C  2  607  ? 86.905  -11.891 104.389 1.00 70.04  ? 607  ASP C N     1 
ATOM   8287  C  CA    . ASP C  2  607  ? 87.039  -10.488 104.045 1.00 68.88  ? 607  ASP C CA    1 
ATOM   8288  C  C     . ASP C  2  607  ? 85.734  -10.017 103.415 1.00 69.05  ? 607  ASP C C     1 
ATOM   8289  O  O     . ASP C  2  607  ? 84.859  -10.825 103.092 1.00 67.17  ? 607  ASP C O     1 
ATOM   8290  C  CB    . ASP C  2  607  ? 88.178  -10.316 103.038 1.00 72.95  ? 607  ASP C CB    1 
ATOM   8291  C  CG    . ASP C  2  607  ? 88.918  -9.012  103.214 1.00 78.53  ? 607  ASP C CG    1 
ATOM   8292  O  OD1   . ASP C  2  607  ? 88.809  -8.436  104.315 1.00 77.90  ? 607  ASP C OD1   1 
ATOM   8293  O  OD2   . ASP C  2  607  ? 89.607  -8.571  102.264 1.00 75.08  ? 607  ASP C OD2   1 
ATOM   8294  N  N     . GLY C  2  608  ? 85.593  -8.709  103.250 1.00 66.37  ? 608  GLY C N     1 
ATOM   8295  C  CA    . GLY C  2  608  ? 84.484  -8.183  102.482 1.00 61.71  ? 608  GLY C CA    1 
ATOM   8296  C  C     . GLY C  2  608  ? 84.633  -8.612  101.035 1.00 64.71  ? 608  GLY C C     1 
ATOM   8297  O  O     . GLY C  2  608  ? 83.647  -8.890  100.350 1.00 66.25  ? 608  GLY C O     1 
ATOM   8298  N  N     . ASN C  2  609  ? 85.876  -8.640  100.562 1.00 65.48  ? 609  ASN C N     1 
ATOM   8299  C  CA    . ASN C  2  609  ? 86.153  -8.977  99.172  1.00 55.09  ? 609  ASN C CA    1 
ATOM   8300  C  C     . ASN C  2  609  ? 86.377  -10.450 98.838  1.00 60.08  ? 609  ASN C C     1 
ATOM   8301  O  O     . ASN C  2  609  ? 86.251  -10.840 97.678  1.00 62.76  ? 609  ASN C O     1 
ATOM   8302  C  CB    . ASN C  2  609  ? 87.351  -8.168  98.695  1.00 49.25  ? 609  ASN C CB    1 
ATOM   8303  C  CG    . ASN C  2  609  ? 87.247  -6.725  99.076  1.00 51.17  ? 609  ASN C CG    1 
ATOM   8304  O  OD1   . ASN C  2  609  ? 86.158  -6.163  99.081  1.00 56.90  ? 609  ASN C OD1   1 
ATOM   8305  N  ND2   . ASN C  2  609  ? 88.370  -6.114  99.425  1.00 60.97  ? 609  ASN C ND2   1 
ATOM   8306  N  N     . ARG C  2  610  ? 86.705  -11.272 99.831  1.00 59.64  ? 610  ARG C N     1 
ATOM   8307  C  CA    . ARG C  2  610  ? 87.055  -12.661 99.535  1.00 60.43  ? 610  ARG C CA    1 
ATOM   8308  C  C     . ARG C  2  610  ? 86.958  -13.596 100.725 1.00 60.66  ? 610  ARG C C     1 
ATOM   8309  O  O     . ARG C  2  610  ? 86.979  -13.165 101.869 1.00 60.87  ? 610  ARG C O     1 
ATOM   8310  C  CB    . ARG C  2  610  ? 88.460  -12.750 98.932  1.00 63.49  ? 610  ARG C CB    1 
ATOM   8311  C  CG    . ARG C  2  610  ? 89.544  -12.078 99.767  1.00 70.31  ? 610  ARG C CG    1 
ATOM   8312  C  CD    . ARG C  2  610  ? 90.434  -13.086 100.495 1.00 70.40  ? 610  ARG C CD    1 
ATOM   8313  N  NE    . ARG C  2  610  ? 91.428  -12.418 101.332 1.00 75.11  ? 610  ARG C NE    1 
ATOM   8314  C  CZ    . ARG C  2  610  ? 91.317  -12.262 102.648 1.00 76.62  ? 610  ARG C CZ    1 
ATOM   8315  N  NH1   . ARG C  2  610  ? 90.260  -12.743 103.283 1.00 76.94  ? 610  ARG C NH1   1 
ATOM   8316  N  NH2   . ARG C  2  610  ? 92.264  -11.632 103.331 1.00 77.14  ? 610  ARG C NH2   1 
ATOM   8317  N  N     . ILE C  2  611  ? 86.873  -14.888 100.430 1.00 61.96  ? 611  ILE C N     1 
ATOM   8318  C  CA    . ILE C  2  611  ? 86.861  -15.923 101.450 1.00 63.45  ? 611  ILE C CA    1 
ATOM   8319  C  C     . ILE C  2  611  ? 87.857  -17.007 101.072 1.00 69.68  ? 611  ILE C C     1 
ATOM   8320  O  O     . ILE C  2  611  ? 87.757  -17.587 99.995  1.00 73.05  ? 611  ILE C O     1 
ATOM   8321  C  CB    . ILE C  2  611  ? 85.473  -16.580 101.567 1.00 64.68  ? 611  ILE C CB    1 
ATOM   8322  C  CG1   . ILE C  2  611  ? 84.426  -15.564 102.026 1.00 60.69  ? 611  ILE C CG1   1 
ATOM   8323  C  CG2   . ILE C  2  611  ? 85.522  -17.764 102.524 1.00 66.41  ? 611  ILE C CG2   1 
ATOM   8324  C  CD1   . ILE C  2  611  ? 83.009  -16.102 101.995 1.00 58.70  ? 611  ILE C CD1   1 
ATOM   8325  N  N     . VAL C  2  612  ? 88.816  -17.286 101.950 1.00 71.87  ? 612  VAL C N     1 
ATOM   8326  C  CA    . VAL C  2  612  ? 89.783  -18.351 101.692 1.00 71.01  ? 612  VAL C CA    1 
ATOM   8327  C  C     . VAL C  2  612  ? 89.498  -19.585 102.544 1.00 75.39  ? 612  VAL C C     1 
ATOM   8328  O  O     . VAL C  2  612  ? 89.399  -19.499 103.770 1.00 77.41  ? 612  VAL C O     1 
ATOM   8329  C  CB    . VAL C  2  612  ? 91.225  -17.888 101.931 1.00 65.44  ? 612  VAL C CB    1 
ATOM   8330  C  CG1   . VAL C  2  612  ? 92.186  -19.000 101.582 1.00 68.87  ? 612  VAL C CG1   1 
ATOM   8331  C  CG2   . VAL C  2  612  ? 91.525  -16.649 101.110 1.00 70.32  ? 612  VAL C CG2   1 
ATOM   8332  N  N     . VAL C  2  613  ? 89.368  -20.730 101.882 1.00 76.22  ? 613  VAL C N     1 
ATOM   8333  C  CA    . VAL C  2  613  ? 89.027  -21.982 102.547 1.00 78.76  ? 613  VAL C CA    1 
ATOM   8334  C  C     . VAL C  2  613  ? 90.114  -23.039 102.366 1.00 88.26  ? 613  VAL C C     1 
ATOM   8335  O  O     . VAL C  2  613  ? 90.593  -23.277 101.252 1.00 88.01  ? 613  VAL C O     1 
ATOM   8336  C  CB    . VAL C  2  613  ? 87.698  -22.548 102.011 1.00 76.72  ? 613  VAL C CB    1 
ATOM   8337  C  CG1   . VAL C  2  613  ? 87.392  -23.896 102.642 1.00 78.12  ? 613  VAL C CG1   1 
ATOM   8338  C  CG2   . VAL C  2  613  ? 86.568  -21.567 102.261 1.00 76.44  ? 613  VAL C CG2   1 
ATOM   8339  N  N     . ARG C  2  614  ? 90.504  -23.660 103.476 1.00 88.62  ? 614  ARG C N     1 
ATOM   8340  C  CA    . ARG C  2  614  ? 91.428  -24.784 103.457 1.00 90.09  ? 614  ARG C CA    1 
ATOM   8341  C  C     . ARG C  2  614  ? 90.636  -26.079 103.551 1.00 90.07  ? 614  ARG C C     1 
ATOM   8342  O  O     . ARG C  2  614  ? 90.008  -26.355 104.571 1.00 93.25  ? 614  ARG C O     1 
ATOM   8343  C  CB    . ARG C  2  614  ? 92.409  -24.681 104.626 1.00 99.29  ? 614  ARG C CB    1 
ATOM   8344  C  CG    . ARG C  2  614  ? 93.237  -25.935 104.865 1.00 105.10 ? 614  ARG C CG    1 
ATOM   8345  C  CD    . ARG C  2  614  ? 94.438  -25.655 105.764 1.00 103.75 ? 614  ARG C CD    1 
ATOM   8346  N  NE    . ARG C  2  614  ? 95.344  -24.668 105.178 1.00 108.24 ? 614  ARG C NE    1 
ATOM   8347  C  CZ    . ARG C  2  614  ? 96.180  -24.923 104.176 1.00 108.16 ? 614  ARG C CZ    1 
ATOM   8348  N  NH1   . ARG C  2  614  ? 96.967  -23.965 103.707 1.00 105.37 ? 614  ARG C NH1   1 
ATOM   8349  N  NH2   . ARG C  2  614  ? 96.228  -26.133 103.635 1.00 105.17 ? 614  ARG C NH2   1 
ATOM   8350  N  N     . TYR C  2  615  ? 90.660  -26.872 102.486 1.00 89.99  ? 615  TYR C N     1 
ATOM   8351  C  CA    . TYR C  2  615  ? 89.855  -28.089 102.441 1.00 101.50 ? 615  TYR C CA    1 
ATOM   8352  C  C     . TYR C  2  615  ? 90.557  -29.302 103.054 1.00 110.57 ? 615  TYR C C     1 
ATOM   8353  O  O     . TYR C  2  615  ? 91.662  -29.188 103.587 1.00 108.05 ? 615  TYR C O     1 
ATOM   8354  C  CB    . TYR C  2  615  ? 89.408  -28.389 101.007 1.00 102.75 ? 615  TYR C CB    1 
ATOM   8355  C  CG    . TYR C  2  615  ? 88.356  -27.430 100.487 1.00 101.86 ? 615  TYR C CG    1 
ATOM   8356  C  CD1   . TYR C  2  615  ? 88.639  -26.548 99.450  1.00 99.37  ? 615  TYR C CD1   1 
ATOM   8357  C  CD2   . TYR C  2  615  ? 87.082  -27.401 101.041 1.00 94.56  ? 615  TYR C CD2   1 
ATOM   8358  C  CE1   . TYR C  2  615  ? 87.677  -25.669 98.975  1.00 91.54  ? 615  TYR C CE1   1 
ATOM   8359  C  CE2   . TYR C  2  615  ? 86.118  -26.527 100.573 1.00 88.66  ? 615  TYR C CE2   1 
ATOM   8360  C  CZ    . TYR C  2  615  ? 86.420  -25.664 99.542  1.00 88.78  ? 615  TYR C CZ    1 
ATOM   8361  O  OH    . TYR C  2  615  ? 85.459  -24.796 99.079  1.00 82.01  ? 615  TYR C OH    1 
ATOM   8362  N  N     . GLU C  2  616  ? 89.896  -30.456 102.986 1.00 116.75 ? 616  GLU C N     1 
ATOM   8363  C  CA    . GLU C  2  616  ? 90.458  -31.711 103.480 1.00 118.54 ? 616  GLU C CA    1 
ATOM   8364  C  C     . GLU C  2  616  ? 91.701  -32.067 102.684 1.00 120.37 ? 616  GLU C C     1 
ATOM   8365  O  O     . GLU C  2  616  ? 92.680  -32.584 103.224 1.00 120.05 ? 616  GLU C O     1 
ATOM   8366  C  CB    . GLU C  2  616  ? 89.441  -32.848 103.348 1.00 121.43 ? 616  GLU C CB    1 
ATOM   8367  C  CG    . GLU C  2  616  ? 88.163  -32.673 104.153 1.00 119.55 ? 616  GLU C CG    1 
ATOM   8368  C  CD    . GLU C  2  616  ? 88.313  -33.083 105.609 1.00 127.60 ? 616  GLU C CD    1 
ATOM   8369  O  OE1   . GLU C  2  616  ? 89.417  -32.915 106.172 1.00 135.45 ? 616  GLU C OE1   1 
ATOM   8370  O  OE2   . GLU C  2  616  ? 87.322  -33.578 106.191 1.00 125.90 ? 616  GLU C OE2   1 
ATOM   8371  N  N     . ASP C  2  617  ? 91.648  -31.776 101.390 1.00 121.94 ? 617  ASP C N     1 
ATOM   8372  C  CA    . ASP C  2  617  ? 92.742  -32.061 100.474 1.00 116.18 ? 617  ASP C CA    1 
ATOM   8373  C  C     . ASP C  2  617  ? 94.011  -31.321 100.886 1.00 113.31 ? 617  ASP C C     1 
ATOM   8374  O  O     . ASP C  2  617  ? 95.115  -31.699 100.502 1.00 116.64 ? 617  ASP C O     1 
ATOM   8375  C  CB    . ASP C  2  617  ? 92.342  -31.661 99.054  1.00 113.06 ? 617  ASP C CB    1 
ATOM   8376  C  CG    . ASP C  2  617  ? 90.838  -31.718 98.834  1.00 122.15 ? 617  ASP C CG    1 
ATOM   8377  O  OD1   . ASP C  2  617  ? 90.132  -32.338 99.660  1.00 122.87 ? 617  ASP C OD1   1 
ATOM   8378  O  OD2   . ASP C  2  617  ? 90.361  -31.141 97.834  1.00 119.88 ? 617  ASP C OD2   1 
ATOM   8379  N  N     . GLY C  2  618  ? 93.844  -30.267 101.676 1.00 112.45 ? 618  GLY C N     1 
ATOM   8380  C  CA    . GLY C  2  618  ? 94.959  -29.441 102.091 1.00 108.99 ? 618  GLY C CA    1 
ATOM   8381  C  C     . GLY C  2  618  ? 95.107  -28.250 101.168 1.00 103.71 ? 618  GLY C C     1 
ATOM   8382  O  O     . GLY C  2  618  ? 95.738  -27.253 101.520 1.00 103.24 ? 618  GLY C O     1 
ATOM   8383  N  N     . ARG C  2  619  ? 94.514  -28.355 99.982  1.00 100.75 ? 619  ARG C N     1 
ATOM   8384  C  CA    . ARG C  2  619  ? 94.590  -27.289 98.991  1.00 103.05 ? 619  ARG C CA    1 
ATOM   8385  C  C     . ARG C  2  619  ? 93.858  -26.038 99.463  1.00 97.07  ? 619  ARG C C     1 
ATOM   8386  O  O     . ARG C  2  619  ? 92.780  -26.117 100.052 1.00 97.33  ? 619  ARG C O     1 
ATOM   8387  C  CB    . ARG C  2  619  ? 94.038  -27.762 97.646  1.00 102.74 ? 619  ARG C CB    1 
ATOM   8388  C  CG    . ARG C  2  619  ? 92.621  -28.279 97.710  1.00 100.01 ? 619  ARG C CG    1 
ATOM   8389  C  CD    . ARG C  2  619  ? 92.219  -28.919 96.401  1.00 101.32 ? 619  ARG C CD    1 
ATOM   8390  N  NE    . ARG C  2  619  ? 90.794  -29.226 96.379  1.00 116.07 ? 619  ARG C NE    1 
ATOM   8391  C  CZ    . ARG C  2  619  ? 89.877  -28.467 95.789  1.00 115.44 ? 619  ARG C CZ    1 
ATOM   8392  N  NH1   . ARG C  2  619  ? 88.598  -28.820 95.821  1.00 102.50 ? 619  ARG C NH1   1 
ATOM   8393  N  NH2   . ARG C  2  619  ? 90.244  -27.358 95.159  1.00 108.67 ? 619  ARG C NH2   1 
ATOM   8394  N  N     . LEU C  2  620  ? 94.458  -24.883 99.199  1.00 96.01  ? 620  LEU C N     1 
ATOM   8395  C  CA    . LEU C  2  620  ? 93.919  -23.618 99.670  1.00 89.01  ? 620  LEU C CA    1 
ATOM   8396  C  C     . LEU C  2  620  ? 93.183  -22.918 98.535  1.00 90.63  ? 620  LEU C C     1 
ATOM   8397  O  O     . LEU C  2  620  ? 93.801  -22.439 97.579  1.00 82.68  ? 620  LEU C O     1 
ATOM   8398  C  CB    . LEU C  2  620  ? 95.052  -22.732 100.185 1.00 85.63  ? 620  LEU C CB    1 
ATOM   8399  C  CG    . LEU C  2  620  ? 94.687  -21.676 101.224 1.00 84.69  ? 620  LEU C CG    1 
ATOM   8400  C  CD1   . LEU C  2  620  ? 94.243  -22.345 102.513 1.00 87.50  ? 620  LEU C CD1   1 
ATOM   8401  C  CD2   . LEU C  2  620  ? 95.856  -20.735 101.476 1.00 71.87  ? 620  LEU C CD2   1 
ATOM   8402  N  N     . VAL C  2  621  ? 91.860  -22.855 98.647  1.00 89.23  ? 621  VAL C N     1 
ATOM   8403  C  CA    . VAL C  2  621  ? 91.038  -22.277 97.590  1.00 81.81  ? 621  VAL C CA    1 
ATOM   8404  C  C     . VAL C  2  621  ? 90.550  -20.888 97.976  1.00 76.73  ? 621  VAL C C     1 
ATOM   8405  O  O     . VAL C  2  621  ? 90.050  -20.682 99.081  1.00 76.77  ? 621  VAL C O     1 
ATOM   8406  C  CB    . VAL C  2  621  ? 89.828  -23.167 97.265  1.00 77.96  ? 621  VAL C CB    1 
ATOM   8407  C  CG1   . VAL C  2  621  ? 89.031  -22.573 96.116  1.00 75.16  ? 621  VAL C CG1   1 
ATOM   8408  C  CG2   . VAL C  2  621  ? 90.286  -24.573 96.928  1.00 85.72  ? 621  VAL C CG2   1 
ATOM   8409  N  N     . GLU C  2  622  ? 90.708  -19.934 97.065  1.00 67.24  ? 622  GLU C N     1 
ATOM   8410  C  CA    . GLU C  2  622  ? 90.268  -18.571 97.321  1.00 68.57  ? 622  GLU C CA    1 
ATOM   8411  C  C     . GLU C  2  622  ? 89.059  -18.207 96.466  1.00 72.13  ? 622  GLU C C     1 
ATOM   8412  O  O     . GLU C  2  622  ? 89.101  -18.305 95.242  1.00 75.31  ? 622  GLU C O     1 
ATOM   8413  C  CB    . GLU C  2  622  ? 91.407  -17.579 97.085  1.00 65.71  ? 622  GLU C CB    1 
ATOM   8414  C  CG    . GLU C  2  622  ? 90.969  -16.125 97.111  1.00 71.81  ? 622  GLU C CG    1 
ATOM   8415  C  CD    . GLU C  2  622  ? 92.110  -15.174 97.419  1.00 80.59  ? 622  GLU C CD    1 
ATOM   8416  O  OE1   . GLU C  2  622  ? 93.077  -15.596 98.090  1.00 83.09  ? 622  GLU C OE1   1 
ATOM   8417  O  OE2   . GLU C  2  622  ? 92.038  -14.002 96.992  1.00 74.09  ? 622  GLU C OE2   1 
ATOM   8418  N  N     . TYR C  2  623  ? 87.980  -17.794 97.123  1.00 72.44  ? 623  TYR C N     1 
ATOM   8419  C  CA    . TYR C  2  623  ? 86.766  -17.376 96.436  1.00 61.79  ? 623  TYR C CA    1 
ATOM   8420  C  C     . TYR C  2  623  ? 86.599  -15.870 96.539  1.00 60.92  ? 623  TYR C C     1 
ATOM   8421  O  O     . TYR C  2  623  ? 86.303  -15.346 97.612  1.00 60.12  ? 623  TYR C O     1 
ATOM   8422  C  CB    . TYR C  2  623  ? 85.545  -18.048 97.053  1.00 58.01  ? 623  TYR C CB    1 
ATOM   8423  C  CG    . TYR C  2  623  ? 85.592  -19.557 97.072  1.00 62.70  ? 623  TYR C CG    1 
ATOM   8424  C  CD1   . TYR C  2  623  ? 85.343  -20.293 95.922  1.00 63.09  ? 623  TYR C CD1   1 
ATOM   8425  C  CD2   . TYR C  2  623  ? 85.861  -20.247 98.247  1.00 67.83  ? 623  TYR C CD2   1 
ATOM   8426  C  CE1   . TYR C  2  623  ? 85.374  -21.675 95.936  1.00 66.92  ? 623  TYR C CE1   1 
ATOM   8427  C  CE2   . TYR C  2  623  ? 85.893  -21.629 98.272  1.00 69.72  ? 623  TYR C CE2   1 
ATOM   8428  C  CZ    . TYR C  2  623  ? 85.647  -22.336 97.112  1.00 74.31  ? 623  TYR C CZ    1 
ATOM   8429  O  OH    . TYR C  2  623  ? 85.678  -23.708 97.125  1.00 84.58  ? 623  TYR C OH    1 
ATOM   8430  N  N     . PRO C  2  624  ? 86.798  -15.161 95.422  1.00 60.95  ? 624  PRO C N     1 
ATOM   8431  C  CA    . PRO C  2  624  ? 86.533  -13.722 95.409  1.00 63.01  ? 624  PRO C CA    1 
ATOM   8432  C  C     . PRO C  2  624  ? 85.025  -13.471 95.359  1.00 63.59  ? 624  PRO C C     1 
ATOM   8433  O  O     . PRO C  2  624  ? 84.280  -14.247 94.755  1.00 57.95  ? 624  PRO C O     1 
ATOM   8434  C  CB    . PRO C  2  624  ? 87.199  -13.265 94.114  1.00 51.21  ? 624  PRO C CB    1 
ATOM   8435  C  CG    . PRO C  2  624  ? 87.080  -14.447 93.219  1.00 52.21  ? 624  PRO C CG    1 
ATOM   8436  C  CD    . PRO C  2  624  ? 87.246  -15.651 94.108  1.00 57.79  ? 624  PRO C CD    1 
ATOM   8437  N  N     . LEU C  2  625  ? 84.578  -12.379 95.954  1.00 61.40  ? 625  LEU C N     1 
ATOM   8438  C  CA    . LEU C  2  625  ? 83.165  -12.088 96.034  1.00 55.68  ? 625  LEU C CA    1 
ATOM   8439  C  C     . LEU C  2  625  ? 82.816  -10.903 95.171  1.00 59.67  ? 625  LEU C C     1 
ATOM   8440  O  O     . LEU C  2  625  ? 83.551  -9.940  95.109  1.00 56.08  ? 625  LEU C O     1 
ATOM   8441  C  CB    . LEU C  2  625  ? 82.760  -11.808 97.472  1.00 57.54  ? 625  LEU C CB    1 
ATOM   8442  C  CG    . LEU C  2  625  ? 83.018  -12.886 98.511  1.00 52.59  ? 625  LEU C CG    1 
ATOM   8443  C  CD1   . LEU C  2  625  ? 82.647  -12.380 99.878  1.00 53.97  ? 625  LEU C CD1   1 
ATOM   8444  C  CD2   . LEU C  2  625  ? 82.241  -14.135 98.199  1.00 51.71  ? 625  LEU C CD2   1 
ATOM   8445  N  N     . ARG C  2  626  ? 81.687  -10.997 94.489  1.00 61.13  ? 626  ARG C N     1 
ATOM   8446  C  CA    . ARG C  2  626  ? 81.221  -9.943  93.623  1.00 57.11  ? 626  ARG C CA    1 
ATOM   8447  C  C     . ARG C  2  626  ? 80.599  -8.894  94.495  1.00 59.61  ? 626  ARG C C     1 
ATOM   8448  O  O     . ARG C  2  626  ? 79.659  -9.170  95.200  1.00 58.26  ? 626  ARG C O     1 
ATOM   8449  C  CB    . ARG C  2  626  ? 80.154  -10.523 92.716  1.00 62.77  ? 626  ARG C CB    1 
ATOM   8450  C  CG    . ARG C  2  626  ? 79.618  -9.591  91.656  1.00 71.47  ? 626  ARG C CG    1 
ATOM   8451  C  CD    . ARG C  2  626  ? 78.754  -10.364 90.684  1.00 77.44  ? 626  ARG C CD    1 
ATOM   8452  N  NE    . ARG C  2  626  ? 79.558  -11.323 89.951  1.00 91.53  ? 626  ARG C NE    1 
ATOM   8453  C  CZ    . ARG C  2  626  ? 79.484  -12.638 90.097  1.00 94.08  ? 626  ARG C CZ    1 
ATOM   8454  N  NH1   . ARG C  2  626  ? 78.622  -13.177 90.939  1.00 73.39  ? 626  ARG C NH1   1 
ATOM   8455  N  NH2   . ARG C  2  626  ? 80.278  -13.414 89.388  1.00 92.45  ? 626  ARG C NH2   1 
ATOM   8456  N  N     . ARG C  2  627  ? 81.121  -7.680  94.436  1.00 55.35  ? 627  ARG C N     1 
ATOM   8457  C  CA    . ARG C  2  627  ? 80.671  -6.628  95.316  1.00 57.58  ? 627  ARG C CA    1 
ATOM   8458  C  C     . ARG C  2  627  ? 80.158  -5.436  94.559  1.00 59.73  ? 627  ARG C C     1 
ATOM   8459  O  O     . ARG C  2  627  ? 80.879  -4.837  93.797  1.00 65.80  ? 627  ARG C O     1 
ATOM   8460  C  CB    . ARG C  2  627  ? 81.828  -6.171  96.180  1.00 61.08  ? 627  ARG C CB    1 
ATOM   8461  C  CG    . ARG C  2  627  ? 82.099  -7.054  97.370  1.00 56.55  ? 627  ARG C CG    1 
ATOM   8462  C  CD    . ARG C  2  627  ? 80.799  -7.527  97.950  1.00 60.07  ? 627  ARG C CD    1 
ATOM   8463  N  NE    . ARG C  2  627  ? 80.899  -7.762  99.374  1.00 64.31  ? 627  ARG C NE    1 
ATOM   8464  C  CZ    . ARG C  2  627  ? 80.033  -7.307  100.256 1.00 62.63  ? 627  ARG C CZ    1 
ATOM   8465  N  NH1   . ARG C  2  627  ? 79.006  -6.594  99.857  1.00 67.01  ? 627  ARG C NH1   1 
ATOM   8466  N  NH2   . ARG C  2  627  ? 80.196  -7.572  101.530 1.00 62.27  ? 627  ARG C NH2   1 
ATOM   8467  N  N     . PHE C  2  628  ? 78.919  -5.071  94.826  1.00 58.11  ? 628  PHE C N     1 
ATOM   8468  C  CA    . PHE C  2  628  ? 78.254  -3.913  94.233  1.00 56.37  ? 628  PHE C CA    1 
ATOM   8469  C  C     . PHE C  2  628  ? 78.366  -3.874  92.710  1.00 57.72  ? 628  PHE C C     1 
ATOM   8470  O  O     . PHE C  2  628  ? 78.772  -2.870  92.129  1.00 55.26  ? 628  PHE C O     1 
ATOM   8471  C  CB    . PHE C  2  628  ? 78.767  -2.617  94.862  1.00 55.10  ? 628  PHE C CB    1 
ATOM   8472  C  CG    . PHE C  2  628  ? 78.668  -2.601  96.360  1.00 62.67  ? 628  PHE C CG    1 
ATOM   8473  C  CD1   . PHE C  2  628  ? 77.511  -2.169  96.986  1.00 60.49  ? 628  PHE C CD1   1 
ATOM   8474  C  CD2   . PHE C  2  628  ? 79.728  -3.033  97.145  1.00 62.55  ? 628  PHE C CD2   1 
ATOM   8475  C  CE1   . PHE C  2  628  ? 77.417  -2.157  98.367  1.00 60.53  ? 628  PHE C CE1   1 
ATOM   8476  C  CE2   . PHE C  2  628  ? 79.639  -3.022  98.525  1.00 59.61  ? 628  PHE C CE2   1 
ATOM   8477  C  CZ    . PHE C  2  628  ? 78.481  -2.585  99.137  1.00 55.91  ? 628  PHE C CZ    1 
ATOM   8478  N  N     . TYR C  2  629  ? 77.995  -4.983  92.079  1.00 59.18  ? 629  TYR C N     1 
ATOM   8479  C  CA    . TYR C  2  629  ? 77.982  -5.094  90.627  1.00 58.90  ? 629  TYR C CA    1 
ATOM   8480  C  C     . TYR C  2  629  ? 76.595  -4.748  90.103  1.00 58.68  ? 629  TYR C C     1 
ATOM   8481  O  O     . TYR C  2  629  ? 75.590  -5.049  90.739  1.00 54.80  ? 629  TYR C O     1 
ATOM   8482  C  CB    . TYR C  2  629  ? 78.400  -6.506  90.196  1.00 67.99  ? 629  TYR C CB    1 
ATOM   8483  C  CG    . TYR C  2  629  ? 78.108  -6.853  88.747  1.00 83.36  ? 629  TYR C CG    1 
ATOM   8484  C  CD1   . TYR C  2  629  ? 78.907  -6.370  87.711  1.00 81.72  ? 629  TYR C CD1   1 
ATOM   8485  C  CD2   . TYR C  2  629  ? 77.043  -7.686  88.415  1.00 88.08  ? 629  TYR C CD2   1 
ATOM   8486  C  CE1   . TYR C  2  629  ? 78.639  -6.698  86.382  1.00 84.63  ? 629  TYR C CE1   1 
ATOM   8487  C  CE2   . TYR C  2  629  ? 76.769  -8.019  87.090  1.00 89.23  ? 629  TYR C CE2   1 
ATOM   8488  C  CZ    . TYR C  2  629  ? 77.568  -7.524  86.080  1.00 82.54  ? 629  TYR C CZ    1 
ATOM   8489  O  OH    . TYR C  2  629  ? 77.286  -7.856  84.772  1.00 76.63  ? 629  TYR C OH    1 
ATOM   8490  N  N     . ARG C  2  630  ? 76.550  -4.096  88.947  1.00 65.04  ? 630  ARG C N     1 
ATOM   8491  C  CA    . ARG C  2  630  ? 75.297  -3.628  88.372  1.00 52.41  ? 630  ARG C CA    1 
ATOM   8492  C  C     . ARG C  2  630  ? 74.684  -4.648  87.413  1.00 53.98  ? 630  ARG C C     1 
ATOM   8493  O  O     . ARG C  2  630  ? 75.294  -5.005  86.405  1.00 64.10  ? 630  ARG C O     1 
ATOM   8494  C  CB    . ARG C  2  630  ? 75.529  -2.308  87.643  1.00 43.81  ? 630  ARG C CB    1 
ATOM   8495  C  CG    . ARG C  2  630  ? 74.301  -1.765  86.966  1.00 47.66  ? 630  ARG C CG    1 
ATOM   8496  C  CD    . ARG C  2  630  ? 74.648  -0.679  85.973  1.00 50.97  ? 630  ARG C CD    1 
ATOM   8497  N  NE    . ARG C  2  630  ? 73.435  -0.109  85.397  1.00 56.42  ? 630  ARG C NE    1 
ATOM   8498  C  CZ    . ARG C  2  630  ? 72.801  -0.622  84.350  1.00 59.46  ? 630  ARG C CZ    1 
ATOM   8499  N  NH1   . ARG C  2  630  ? 73.273  -1.712  83.759  1.00 60.53  ? 630  ARG C NH1   1 
ATOM   8500  N  NH2   . ARG C  2  630  ? 71.700  -0.043  83.890  1.00 66.47  ? 630  ARG C NH2   1 
ATOM   8501  N  N     . SER C  2  631  ? 73.477  -5.113  87.725  1.00 49.96  ? 631  SER C N     1 
ATOM   8502  C  CA    . SER C  2  631  ? 72.785  -6.062  86.860  1.00 50.79  ? 631  SER C CA    1 
ATOM   8503  C  C     . SER C  2  631  ? 72.184  -5.346  85.654  1.00 46.32  ? 631  SER C C     1 
ATOM   8504  O  O     . SER C  2  631  ? 72.234  -4.120  85.568  1.00 45.56  ? 631  SER C O     1 
ATOM   8505  C  CB    . SER C  2  631  ? 71.681  -6.785  87.637  1.00 54.34  ? 631  SER C CB    1 
ATOM   8506  O  OG    . SER C  2  631  ? 70.524  -5.973  87.773  1.00 51.90  ? 631  SER C OG    1 
ATOM   8507  N  N     . ASN C  2  632  ? 71.592  -6.117  84.745  1.00 43.91  ? 632  ASN C N     1 
ATOM   8508  C  CA    . ASN C  2  632  ? 70.978  -5.575  83.534  1.00 46.34  ? 632  ASN C CA    1 
ATOM   8509  C  C     . ASN C  2  632  ? 69.933  -4.501  83.838  1.00 49.78  ? 632  ASN C C     1 
ATOM   8510  O  O     . ASN C  2  632  ? 69.795  -3.518  83.105  1.00 49.00  ? 632  ASN C O     1 
ATOM   8511  C  CB    . ASN C  2  632  ? 70.326  -6.696  82.713  1.00 49.26  ? 632  ASN C CB    1 
ATOM   8512  C  CG    . ASN C  2  632  ? 71.320  -7.460  81.845  1.00 49.62  ? 632  ASN C CG    1 
ATOM   8513  O  OD1   . ASN C  2  632  ? 72.430  -6.992  81.581  1.00 52.15  ? 632  ASN C OD1   1 
ATOM   8514  N  ND2   . ASN C  2  632  ? 70.911  -8.638  81.382  1.00 42.19  ? 632  ASN C ND2   1 
ATOM   8515  N  N     . GLN C  2  633  ? 69.194  -4.710  84.921  1.00 47.57  ? 633  GLN C N     1 
ATOM   8516  C  CA    . GLN C  2  633  ? 68.128  -3.800  85.319  1.00 49.38  ? 633  GLN C CA    1 
ATOM   8517  C  C     . GLN C  2  633  ? 68.588  -2.788  86.361  1.00 47.68  ? 633  GLN C C     1 
ATOM   8518  O  O     . GLN C  2  633  ? 67.787  -2.017  86.882  1.00 49.62  ? 633  GLN C O     1 
ATOM   8519  C  CB    . GLN C  2  633  ? 66.902  -4.569  85.810  1.00 46.83  ? 633  GLN C CB    1 
ATOM   8520  C  CG    . GLN C  2  633  ? 67.114  -6.056  85.918  1.00 48.28  ? 633  GLN C CG    1 
ATOM   8521  C  CD    . GLN C  2  633  ? 67.160  -6.754  84.579  1.00 44.23  ? 633  GLN C CD    1 
ATOM   8522  O  OE1   . GLN C  2  633  ? 67.769  -7.812  84.447  1.00 49.59  ? 633  GLN C OE1   1 
ATOM   8523  N  NE2   . GLN C  2  633  ? 66.518  -6.169  83.580  1.00 44.88  ? 633  GLN C NE2   1 
ATOM   8524  N  N     . GLY C  2  634  ? 69.876  -2.809  86.679  1.00 45.42  ? 634  GLY C N     1 
ATOM   8525  C  CA    . GLY C  2  634  ? 70.452  -1.783  87.522  1.00 45.25  ? 634  GLY C CA    1 
ATOM   8526  C  C     . GLY C  2  634  ? 70.313  -2.048  89.005  1.00 46.58  ? 634  GLY C C     1 
ATOM   8527  O  O     . GLY C  2  634  ? 70.645  -1.194  89.821  1.00 48.22  ? 634  GLY C O     1 
ATOM   8528  N  N     . THR C  2  635  ? 69.810  -3.224  89.361  1.00 49.27  ? 635  THR C N     1 
ATOM   8529  C  CA    . THR C  2  635  ? 69.815  -3.636  90.756  1.00 43.38  ? 635  THR C CA    1 
ATOM   8530  C  C     . THR C  2  635  ? 71.218  -4.114  91.092  1.00 46.94  ? 635  THR C C     1 
ATOM   8531  O  O     . THR C  2  635  ? 71.937  -4.591  90.218  1.00 50.97  ? 635  THR C O     1 
ATOM   8532  C  CB    . THR C  2  635  ? 68.790  -4.750  91.044  1.00 43.23  ? 635  THR C CB    1 
ATOM   8533  O  OG1   . THR C  2  635  ? 69.130  -5.930  90.312  1.00 47.26  ? 635  THR C OG1   1 
ATOM   8534  C  CG2   . THR C  2  635  ? 67.399  -4.306  90.649  1.00 46.20  ? 635  THR C CG2   1 
ATOM   8535  N  N     . ALA C  2  636  ? 71.618  -3.977  92.349  1.00 52.46  ? 636  ALA C N     1 
ATOM   8536  C  CA    . ALA C  2  636  ? 72.979  -4.338  92.738  1.00 52.10  ? 636  ALA C CA    1 
ATOM   8537  C  C     . ALA C  2  636  ? 73.111  -5.809  93.107  1.00 52.72  ? 636  ALA C C     1 
ATOM   8538  O  O     . ALA C  2  636  ? 72.443  -6.302  94.015  1.00 53.91  ? 636  ALA C O     1 
ATOM   8539  C  CB    . ALA C  2  636  ? 73.482  -3.451  93.868  1.00 40.44  ? 636  ALA C CB    1 
ATOM   8540  N  N     . LEU C  2  637  ? 73.977  -6.503  92.380  1.00 56.15  ? 637  LEU C N     1 
ATOM   8541  C  CA    . LEU C  2  637  ? 74.336  -7.870  92.705  1.00 58.27  ? 637  LEU C CA    1 
ATOM   8542  C  C     . LEU C  2  637  ? 75.572  -7.821  93.576  1.00 61.21  ? 637  LEU C C     1 
ATOM   8543  O  O     . LEU C  2  637  ? 76.634  -7.393  93.121  1.00 56.19  ? 637  LEU C O     1 
ATOM   8544  C  CB    . LEU C  2  637  ? 74.666  -8.648  91.436  1.00 62.10  ? 637  LEU C CB    1 
ATOM   8545  C  CG    . LEU C  2  637  ? 73.591  -8.632  90.359  1.00 67.97  ? 637  LEU C CG    1 
ATOM   8546  C  CD1   . LEU C  2  637  ? 74.051  -9.446  89.161  1.00 65.88  ? 637  LEU C CD1   1 
ATOM   8547  C  CD2   . LEU C  2  637  ? 72.268  -9.152  90.923  1.00 70.75  ? 637  LEU C CD2   1 
ATOM   8548  N  N     . ASP C  2  638  ? 75.442  -8.245  94.828  1.00 60.24  ? 638  ASP C N     1 
ATOM   8549  C  CA    . ASP C  2  638  ? 76.605  -8.293  95.699  1.00 58.83  ? 638  ASP C CA    1 
ATOM   8550  C  C     . ASP C  2  638  ? 76.552  -9.454  96.695  1.00 61.59  ? 638  ASP C C     1 
ATOM   8551  O  O     . ASP C  2  638  ? 75.490  -9.800  97.215  1.00 64.43  ? 638  ASP C O     1 
ATOM   8552  C  CB    . ASP C  2  638  ? 76.874  -6.911  96.328  1.00 57.01  ? 638  ASP C CB    1 
ATOM   8553  C  CG    . ASP C  2  638  ? 76.696  -6.882  97.824  1.00 67.00  ? 638  ASP C CG    1 
ATOM   8554  O  OD1   . ASP C  2  638  ? 75.614  -7.266  98.316  1.00 85.88  ? 638  ASP C OD1   1 
ATOM   8555  O  OD2   . ASP C  2  638  ? 77.639  -6.440  98.513  1.00 73.14  ? 638  ASP C OD2   1 
ATOM   8556  N  N     . GLN C  2  639  ? 77.705  -10.075 96.920  1.00 61.55  ? 639  GLN C N     1 
ATOM   8557  C  CA    . GLN C  2  639  ? 77.792  -11.241 97.786  1.00 61.33  ? 639  GLN C CA    1 
ATOM   8558  C  C     . GLN C  2  639  ? 78.345  -10.857 99.150  1.00 62.42  ? 639  GLN C C     1 
ATOM   8559  O  O     . GLN C  2  639  ? 79.329  -10.130 99.240  1.00 65.72  ? 639  GLN C O     1 
ATOM   8560  C  CB    . GLN C  2  639  ? 78.685  -12.309 97.147  1.00 57.15  ? 639  GLN C CB    1 
ATOM   8561  C  CG    . GLN C  2  639  ? 78.125  -12.906 95.873  1.00 57.38  ? 639  GLN C CG    1 
ATOM   8562  C  CD    . GLN C  2  639  ? 79.133  -13.774 95.143  1.00 65.48  ? 639  GLN C CD    1 
ATOM   8563  O  OE1   . GLN C  2  639  ? 80.099  -13.272 94.558  1.00 66.01  ? 639  GLN C OE1   1 
ATOM   8564  N  NE2   . GLN C  2  639  ? 78.914  -15.085 95.171  1.00 65.68  ? 639  GLN C NE2   1 
ATOM   8565  N  N     . ARG C  2  640  ? 77.741  -11.369 100.215 1.00 61.38  ? 640  ARG C N     1 
ATOM   8566  C  CA    . ARG C  2  640  ? 78.269  -11.083 101.537 1.00 56.26  ? 640  ARG C CA    1 
ATOM   8567  C  C     . ARG C  2  640  ? 78.680  -12.382 102.212 1.00 56.46  ? 640  ARG C C     1 
ATOM   8568  O  O     . ARG C  2  640  ? 77.942  -13.365 102.176 1.00 57.18  ? 640  ARG C O     1 
ATOM   8569  C  CB    . ARG C  2  640  ? 77.214  -10.358 102.383 1.00 60.93  ? 640  ARG C CB    1 
ATOM   8570  C  CG    . ARG C  2  640  ? 77.076  -8.870  102.078 1.00 66.83  ? 640  ARG C CG    1 
ATOM   8571  C  CD    . ARG C  2  640  ? 75.882  -8.562  101.186 1.00 68.80  ? 640  ARG C CD    1 
ATOM   8572  N  NE    . ARG C  2  640  ? 74.611  -8.726  101.886 1.00 74.71  ? 640  ARG C NE    1 
ATOM   8573  C  CZ    . ARG C  2  640  ? 73.696  -9.634  101.564 1.00 72.51  ? 640  ARG C CZ    1 
ATOM   8574  N  NH1   . ARG C  2  640  ? 73.907  -10.455 100.543 1.00 65.29  ? 640  ARG C NH1   1 
ATOM   8575  N  NH2   . ARG C  2  640  ? 72.566  -9.716  102.256 1.00 71.88  ? 640  ARG C NH2   1 
ATOM   8576  N  N     . PRO C  2  641  ? 79.860  -12.376 102.857 1.00 58.88  ? 641  PRO C N     1 
ATOM   8577  C  CA    . PRO C  2  641  ? 80.382  -13.553 103.562 1.00 55.73  ? 641  PRO C CA    1 
ATOM   8578  C  C     . PRO C  2  641  ? 79.502  -13.934 104.753 1.00 57.33  ? 641  PRO C C     1 
ATOM   8579  O  O     . PRO C  2  641  ? 79.163  -13.080 105.574 1.00 50.85  ? 641  PRO C O     1 
ATOM   8580  C  CB    . PRO C  2  641  ? 81.761  -13.089 104.037 1.00 57.08  ? 641  PRO C CB    1 
ATOM   8581  C  CG    . PRO C  2  641  ? 81.677  -11.596 104.068 1.00 55.32  ? 641  PRO C CG    1 
ATOM   8582  C  CD    . PRO C  2  641  ? 80.784  -11.231 102.934 1.00 56.43  ? 641  PRO C CD    1 
ATOM   8583  N  N     . ARG C  2  642  ? 79.106  -15.200 104.808 1.00 56.75  ? 642  ARG C N     1 
ATOM   8584  C  CA    . ARG C  2  642  ? 78.308  -15.731 105.910 1.00 54.97  ? 642  ARG C CA    1 
ATOM   8585  C  C     . ARG C  2  642  ? 79.084  -16.544 106.956 1.00 56.97  ? 642  ARG C C     1 
ATOM   8586  O  O     . ARG C  2  642  ? 78.490  -17.103 107.878 1.00 62.90  ? 642  ARG C O     1 
ATOM   8587  C  CB    . ARG C  2  642  ? 77.096  -16.499 105.377 1.00 56.74  ? 642  ARG C CB    1 
ATOM   8588  C  CG    . ARG C  2  642  ? 76.024  -15.582 104.806 1.00 54.69  ? 642  ARG C CG    1 
ATOM   8589  C  CD    . ARG C  2  642  ? 75.542  -14.604 105.864 1.00 52.42  ? 642  ARG C CD    1 
ATOM   8590  N  NE    . ARG C  2  642  ? 74.730  -13.517 105.320 1.00 59.06  ? 642  ARG C NE    1 
ATOM   8591  C  CZ    . ARG C  2  642  ? 75.130  -12.250 105.240 1.00 59.06  ? 642  ARG C CZ    1 
ATOM   8592  N  NH1   . ARG C  2  642  ? 76.340  -11.904 105.664 1.00 57.82  ? 642  ARG C NH1   1 
ATOM   8593  N  NH2   . ARG C  2  642  ? 74.321  -11.326 104.735 1.00 55.14  ? 642  ARG C NH2   1 
ATOM   8594  N  N     . VAL C  2  643  ? 80.402  -16.622 106.798 1.00 59.61  ? 643  VAL C N     1 
ATOM   8595  C  CA    . VAL C  2  643  ? 81.244  -17.426 107.684 1.00 60.96  ? 643  VAL C CA    1 
ATOM   8596  C  C     . VAL C  2  643  ? 82.320  -16.590 108.372 1.00 64.33  ? 643  VAL C C     1 
ATOM   8597  O  O     . VAL C  2  643  ? 82.584  -15.454 107.984 1.00 63.49  ? 643  VAL C O     1 
ATOM   8598  C  CB    . VAL C  2  643  ? 81.932  -18.591 106.937 1.00 60.63  ? 643  VAL C CB    1 
ATOM   8599  C  CG1   . VAL C  2  643  ? 80.897  -19.543 106.363 1.00 58.99  ? 643  VAL C CG1   1 
ATOM   8600  C  CG2   . VAL C  2  643  ? 82.857  -18.064 105.848 1.00 56.89  ? 643  VAL C CG2   1 
ATOM   8601  N  N     . VAL C  2  644  ? 82.927  -17.158 109.408 1.00 68.41  ? 644  VAL C N     1 
ATOM   8602  C  CA    . VAL C  2  644  ? 83.962  -16.469 110.167 1.00 70.91  ? 644  VAL C CA    1 
ATOM   8603  C  C     . VAL C  2  644  ? 85.286  -17.255 110.116 1.00 75.55  ? 644  VAL C C     1 
ATOM   8604  O  O     . VAL C  2  644  ? 85.292  -18.453 109.822 1.00 74.44  ? 644  VAL C O     1 
ATOM   8605  C  CB    . VAL C  2  644  ? 83.501  -16.262 111.619 1.00 66.12  ? 644  VAL C CB    1 
ATOM   8606  C  CG1   . VAL C  2  644  ? 83.476  -17.594 112.353 1.00 71.88  ? 644  VAL C CG1   1 
ATOM   8607  C  CG2   . VAL C  2  644  ? 84.381  -15.239 112.337 1.00 80.99  ? 644  VAL C CG2   1 
ATOM   8608  N  N     . VAL C  2  645  ? 86.402  -16.574 110.376 1.00 76.94  ? 645  VAL C N     1 
ATOM   8609  C  CA    . VAL C  2  645  ? 87.723  -17.205 110.344 1.00 77.51  ? 645  VAL C CA    1 
ATOM   8610  C  C     . VAL C  2  645  ? 87.828  -18.371 111.331 1.00 72.11  ? 645  VAL C C     1 
ATOM   8611  O  O     . VAL C  2  645  ? 87.505  -18.229 112.511 1.00 66.29  ? 645  VAL C O     1 
ATOM   8612  C  CB    . VAL C  2  645  ? 88.852  -16.186 110.644 1.00 74.99  ? 645  VAL C CB    1 
ATOM   8613  C  CG1   . VAL C  2  645  ? 90.208  -16.804 110.376 1.00 66.12  ? 645  VAL C CG1   1 
ATOM   8614  C  CG2   . VAL C  2  645  ? 88.680  -14.930 109.810 1.00 74.63  ? 645  VAL C CG2   1 
ATOM   8615  N  N     . GLY C  2  646  ? 88.271  -19.523 110.835 1.00 71.86  ? 646  GLY C N     1 
ATOM   8616  C  CA    . GLY C  2  646  ? 88.475  -20.692 111.673 1.00 69.91  ? 646  GLY C CA    1 
ATOM   8617  C  C     . GLY C  2  646  ? 87.253  -21.580 111.794 1.00 77.56  ? 646  GLY C C     1 
ATOM   8618  O  O     . GLY C  2  646  ? 87.261  -22.568 112.530 1.00 76.84  ? 646  GLY C O     1 
ATOM   8619  N  N     . GLN C  2  647  ? 86.200  -21.234 111.062 1.00 79.04  ? 647  GLN C N     1 
ATOM   8620  C  CA    . GLN C  2  647  ? 84.957  -21.992 111.105 1.00 73.10  ? 647  GLN C CA    1 
ATOM   8621  C  C     . GLN C  2  647  ? 85.057  -23.310 110.342 1.00 74.80  ? 647  GLN C C     1 
ATOM   8622  O  O     . GLN C  2  647  ? 85.586  -23.355 109.234 1.00 75.33  ? 647  GLN C O     1 
ATOM   8623  C  CB    . GLN C  2  647  ? 83.812  -21.145 110.549 1.00 71.24  ? 647  GLN C CB    1 
ATOM   8624  C  CG    . GLN C  2  647  ? 82.539  -21.914 110.282 1.00 68.71  ? 647  GLN C CG    1 
ATOM   8625  C  CD    . GLN C  2  647  ? 81.366  -21.004 110.016 1.00 62.42  ? 647  GLN C CD    1 
ATOM   8626  O  OE1   . GLN C  2  647  ? 81.430  -19.800 110.268 1.00 59.39  ? 647  GLN C OE1   1 
ATOM   8627  N  NE2   . GLN C  2  647  ? 80.283  -21.575 109.506 1.00 66.46  ? 647  GLN C NE2   1 
ATOM   8628  N  N     . ARG C  2  648  ? 84.547  -24.382 110.938 1.00 82.37  ? 648  ARG C N     1 
ATOM   8629  C  CA    . ARG C  2  648  ? 84.518  -25.677 110.266 1.00 91.06  ? 648  ARG C CA    1 
ATOM   8630  C  C     . ARG C  2  648  ? 83.284  -25.790 109.376 1.00 85.97  ? 648  ARG C C     1 
ATOM   8631  O  O     . ARG C  2  648  ? 82.154  -25.707 109.858 1.00 85.72  ? 648  ARG C O     1 
ATOM   8632  C  CB    . ARG C  2  648  ? 84.535  -26.824 111.284 1.00 101.00 ? 648  ARG C CB    1 
ATOM   8633  C  CG    . ARG C  2  648  ? 85.839  -26.960 112.064 1.00 108.36 ? 648  ARG C CG    1 
ATOM   8634  C  CD    . ARG C  2  648  ? 86.376  -28.388 112.018 1.00 112.67 ? 648  ARG C CD    1 
ATOM   8635  N  NE    . ARG C  2  648  ? 87.679  -28.462 111.359 1.00 117.99 ? 648  ARG C NE    1 
ATOM   8636  C  CZ    . ARG C  2  648  ? 87.860  -28.823 110.091 1.00 118.11 ? 648  ARG C CZ    1 
ATOM   8637  N  NH1   . ARG C  2  648  ? 86.820  -29.154 109.336 1.00 112.58 ? 648  ARG C NH1   1 
ATOM   8638  N  NH2   . ARG C  2  648  ? 89.085  -28.858 109.579 1.00 110.28 ? 648  ARG C NH2   1 
ATOM   8639  N  N     . VAL C  2  649  ? 83.506  -25.980 108.078 1.00 83.19  ? 649  VAL C N     1 
ATOM   8640  C  CA    . VAL C  2  649  ? 82.408  -26.122 107.126 1.00 80.69  ? 649  VAL C CA    1 
ATOM   8641  C  C     . VAL C  2  649  ? 82.413  -27.502 106.474 1.00 86.89  ? 649  VAL C C     1 
ATOM   8642  O  O     . VAL C  2  649  ? 83.471  -28.117 106.313 1.00 90.82  ? 649  VAL C O     1 
ATOM   8643  C  CB    . VAL C  2  649  ? 82.452  -25.035 106.021 1.00 76.44  ? 649  VAL C CB    1 
ATOM   8644  C  CG1   . VAL C  2  649  ? 82.405  -23.649 106.637 1.00 79.89  ? 649  VAL C CG1   1 
ATOM   8645  C  CG2   . VAL C  2  649  ? 83.690  -25.186 105.156 1.00 67.71  ? 649  VAL C CG2   1 
ATOM   8646  N  N     . ARG C  2  650  ? 81.229  -27.991 106.109 1.00 83.94  ? 650  ARG C N     1 
ATOM   8647  C  CA    . ARG C  2  650  ? 81.119  -29.254 105.383 1.00 85.88  ? 650  ARG C CA    1 
ATOM   8648  C  C     . ARG C  2  650  ? 80.909  -29.026 103.888 1.00 86.17  ? 650  ARG C C     1 
ATOM   8649  O  O     . ARG C  2  650  ? 80.863  -27.888 103.421 1.00 82.36  ? 650  ARG C O     1 
ATOM   8650  C  CB    . ARG C  2  650  ? 79.982  -30.117 105.933 1.00 91.18  ? 650  ARG C CB    1 
ATOM   8651  C  CG    . ARG C  2  650  ? 80.185  -30.609 107.353 1.00 103.43 ? 650  ARG C CG    1 
ATOM   8652  C  CD    . ARG C  2  650  ? 79.295  -31.812 107.631 1.00 123.03 ? 650  ARG C CD    1 
ATOM   8653  N  NE    . ARG C  2  650  ? 78.992  -31.961 109.052 1.00 148.37 ? 650  ARG C NE    1 
ATOM   8654  C  CZ    . ARG C  2  650  ? 77.911  -31.455 109.641 1.00 146.52 ? 650  ARG C CZ    1 
ATOM   8655  N  NH1   . ARG C  2  650  ? 77.028  -30.764 108.930 1.00 129.37 ? 650  ARG C NH1   1 
ATOM   8656  N  NH2   . ARG C  2  650  ? 77.713  -31.638 110.940 1.00 141.76 ? 650  ARG C NH2   1 
ATOM   8657  N  N     . LYS C  2  651  ? 80.787  -30.118 103.143 1.00 88.02  ? 651  LYS C N     1 
ATOM   8658  C  CA    . LYS C  2  651  ? 80.553  -30.045 101.709 1.00 84.92  ? 651  LYS C CA    1 
ATOM   8659  C  C     . LYS C  2  651  ? 79.141  -29.538 101.453 1.00 89.04  ? 651  LYS C C     1 
ATOM   8660  O  O     . LYS C  2  651  ? 78.171  -30.107 101.954 1.00 92.98  ? 651  LYS C O     1 
ATOM   8661  C  CB    . LYS C  2  651  ? 80.743  -31.426 101.079 1.00 83.62  ? 651  LYS C CB    1 
ATOM   8662  C  CG    . LYS C  2  651  ? 80.415  -31.509 99.601  1.00 75.85  ? 651  LYS C CG    1 
ATOM   8663  C  CD    . LYS C  2  651  ? 80.443  -32.951 99.119  1.00 79.27  ? 651  LYS C CD    1 
ATOM   8664  C  CE    . LYS C  2  651  ? 80.193  -33.054 97.620  1.00 94.89  ? 651  LYS C CE    1 
ATOM   8665  N  NZ    . LYS C  2  651  ? 81.281  -32.428 96.814  1.00 91.70  ? 651  LYS C NZ    1 
ATOM   8666  N  N     . GLY C  2  652  ? 79.029  -28.461 100.682 1.00 84.82  ? 652  GLY C N     1 
ATOM   8667  C  CA    . GLY C  2  652  ? 77.734  -27.885 100.361 1.00 79.75  ? 652  GLY C CA    1 
ATOM   8668  C  C     . GLY C  2  652  ? 77.228  -26.875 101.378 1.00 77.90  ? 652  GLY C C     1 
ATOM   8669  O  O     . GLY C  2  652  ? 76.068  -26.469 101.331 1.00 81.80  ? 652  GLY C O     1 
ATOM   8670  N  N     . ASP C  2  653  ? 78.090  -26.473 102.305 1.00 79.39  ? 653  ASP C N     1 
ATOM   8671  C  CA    . ASP C  2  653  ? 77.722  -25.476 103.307 1.00 76.53  ? 653  ASP C CA    1 
ATOM   8672  C  C     . ASP C  2  653  ? 77.822  -24.067 102.749 1.00 68.33  ? 653  ASP C C     1 
ATOM   8673  O  O     . ASP C  2  653  ? 78.671  -23.782 101.907 1.00 69.60  ? 653  ASP C O     1 
ATOM   8674  C  CB    . ASP C  2  653  ? 78.592  -25.605 104.559 1.00 79.20  ? 653  ASP C CB    1 
ATOM   8675  C  CG    . ASP C  2  653  ? 78.082  -26.660 105.517 1.00 81.77  ? 653  ASP C CG    1 
ATOM   8676  O  OD1   . ASP C  2  653  ? 78.476  -26.620 106.702 1.00 84.48  ? 653  ASP C OD1   1 
ATOM   8677  O  OD2   . ASP C  2  653  ? 77.283  -27.521 105.086 1.00 80.20  ? 653  ASP C OD2   1 
ATOM   8678  N  N     . LEU C  2  654  ? 76.954  -23.183 103.227 1.00 69.03  ? 654  LEU C N     1 
ATOM   8679  C  CA    . LEU C  2  654  ? 76.940  -21.807 102.753 1.00 64.99  ? 654  LEU C CA    1 
ATOM   8680  C  C     . LEU C  2  654  ? 78.188  -21.048 103.201 1.00 64.32  ? 654  LEU C C     1 
ATOM   8681  O  O     . LEU C  2  654  ? 78.576  -21.101 104.369 1.00 64.49  ? 654  LEU C O     1 
ATOM   8682  C  CB    . LEU C  2  654  ? 75.681  -21.083 103.232 1.00 54.19  ? 654  LEU C CB    1 
ATOM   8683  C  CG    . LEU C  2  654  ? 75.504  -19.658 102.710 1.00 52.69  ? 654  LEU C CG    1 
ATOM   8684  C  CD1   . LEU C  2  654  ? 75.016  -19.662 101.272 1.00 61.48  ? 654  LEU C CD1   1 
ATOM   8685  C  CD2   . LEU C  2  654  ? 74.562  -18.880 103.589 1.00 52.27  ? 654  LEU C CD2   1 
ATOM   8686  N  N     . LEU C  2  655  ? 78.808  -20.351 102.254 1.00 58.54  ? 655  LEU C N     1 
ATOM   8687  C  CA    . LEU C  2  655  ? 79.971  -19.507 102.512 1.00 55.15  ? 655  LEU C CA    1 
ATOM   8688  C  C     . LEU C  2  655  ? 79.572  -18.038 102.443 1.00 54.53  ? 655  LEU C C     1 
ATOM   8689  O  O     . LEU C  2  655  ? 79.815  -17.279 103.376 1.00 53.70  ? 655  LEU C O     1 
ATOM   8690  C  CB    . LEU C  2  655  ? 81.121  -19.818 101.551 1.00 62.65  ? 655  LEU C CB    1 
ATOM   8691  C  CG    . LEU C  2  655  ? 81.812  -21.167 101.757 1.00 61.48  ? 655  LEU C CG    1 
ATOM   8692  C  CD1   . LEU C  2  655  ? 82.905  -21.374 100.735 1.00 59.22  ? 655  LEU C CD1   1 
ATOM   8693  C  CD2   . LEU C  2  655  ? 82.375  -21.268 103.167 1.00 69.27  ? 655  LEU C CD2   1 
ATOM   8694  N  N     . ALA C  2  656  ? 79.032  -17.628 101.298 1.00 57.55  ? 656  ALA C N     1 
ATOM   8695  C  CA    . ALA C  2  656  ? 78.524  -16.270 101.132 1.00 56.16  ? 656  ALA C CA    1 
ATOM   8696  C  C     . ALA C  2  656  ? 77.073  -16.242 100.654 1.00 55.59  ? 656  ALA C C     1 
ATOM   8697  O  O     . ALA C  2  656  ? 76.656  -17.091 99.871  1.00 56.07  ? 656  ALA C O     1 
ATOM   8698  C  CB    . ALA C  2  656  ? 79.409  -15.487 100.172 1.00 53.28  ? 656  ALA C CB    1 
ATOM   8699  N  N     . ASP C  2  657  ? 76.310  -15.262 101.132 1.00 55.90  ? 657  ASP C N     1 
ATOM   8700  C  CA    . ASP C  2  657  ? 74.962  -15.013 100.627 1.00 53.52  ? 657  ASP C CA    1 
ATOM   8701  C  C     . ASP C  2  657  ? 75.033  -14.166 99.355  1.00 54.13  ? 657  ASP C C     1 
ATOM   8702  O  O     . ASP C  2  657  ? 75.775  -13.184 99.296  1.00 52.25  ? 657  ASP C O     1 
ATOM   8703  C  CB    . ASP C  2  657  ? 74.110  -14.285 101.680 1.00 51.16  ? 657  ASP C CB    1 
ATOM   8704  C  CG    . ASP C  2  657  ? 73.187  -15.223 102.459 1.00 52.62  ? 657  ASP C CG    1 
ATOM   8705  O  OD1   . ASP C  2  657  ? 72.839  -16.311 101.946 1.00 49.45  ? 657  ASP C OD1   1 
ATOM   8706  O  OD2   . ASP C  2  657  ? 72.795  -14.856 103.590 1.00 52.29  ? 657  ASP C OD2   1 
ATOM   8707  N  N     . GLY C  2  658  ? 74.262  -14.540 98.338  1.00 58.39  ? 658  GLY C N     1 
ATOM   8708  C  CA    . GLY C  2  658  ? 74.148  -13.726 97.140  1.00 58.38  ? 658  GLY C CA    1 
ATOM   8709  C  C     . GLY C  2  658  ? 73.178  -12.581 97.366  1.00 55.47  ? 658  GLY C C     1 
ATOM   8710  O  O     . GLY C  2  658  ? 72.791  -12.308 98.501  1.00 52.50  ? 658  GLY C O     1 
ATOM   8711  N  N     . PRO C  2  659  ? 72.770  -11.897 96.290  1.00 60.47  ? 659  PRO C N     1 
ATOM   8712  C  CA    . PRO C  2  659  ? 71.762  -10.859 96.505  1.00 57.52  ? 659  PRO C CA    1 
ATOM   8713  C  C     . PRO C  2  659  ? 70.409  -11.507 96.769  1.00 50.23  ? 659  PRO C C     1 
ATOM   8714  O  O     . PRO C  2  659  ? 70.176  -12.623 96.300  1.00 50.43  ? 659  PRO C O     1 
ATOM   8715  C  CB    . PRO C  2  659  ? 71.738  -10.096 95.170  1.00 52.18  ? 659  PRO C CB    1 
ATOM   8716  C  CG    . PRO C  2  659  ? 72.690  -10.818 94.249  1.00 56.04  ? 659  PRO C CG    1 
ATOM   8717  C  CD    . PRO C  2  659  ? 73.016  -12.138 94.862  1.00 58.71  ? 659  PRO C CD    1 
ATOM   8718  N  N     . ALA C  2  660  ? 69.545  -10.825 97.515  1.00 41.88  ? 660  ALA C N     1 
ATOM   8719  C  CA    . ALA C  2  660  ? 68.207  -11.325 97.786  1.00 41.00  ? 660  ALA C CA    1 
ATOM   8720  C  C     . ALA C  2  660  ? 68.207  -12.746 98.342  1.00 42.73  ? 660  ALA C C     1 
ATOM   8721  O  O     . ALA C  2  660  ? 67.388  -13.582 97.952  1.00 42.85  ? 660  ALA C O     1 
ATOM   8722  C  CB    . ALA C  2  660  ? 67.341  -11.242 96.540  1.00 42.63  ? 660  ALA C CB    1 
ATOM   8723  N  N     . SER C  2  661  ? 69.147  -13.021 99.236  1.00 42.16  ? 661  SER C N     1 
ATOM   8724  C  CA    . SER C  2  661  ? 69.109  -14.257 100.001 1.00 46.26  ? 661  SER C CA    1 
ATOM   8725  C  C     . SER C  2  661  ? 69.614  -14.035 101.427 1.00 52.74  ? 661  SER C C     1 
ATOM   8726  O  O     . SER C  2  661  ? 70.485  -13.195 101.677 1.00 48.46  ? 661  SER C O     1 
ATOM   8727  C  CB    . SER C  2  661  ? 69.856  -15.403 99.304  1.00 42.82  ? 661  SER C CB    1 
ATOM   8728  O  OG    . SER C  2  661  ? 71.256  -15.278 99.427  1.00 46.57  ? 661  SER C OG    1 
ATOM   8729  N  N     . GLU C  2  662  ? 69.028  -14.783 102.356 1.00 48.02  ? 662  GLU C N     1 
ATOM   8730  C  CA    . GLU C  2  662  ? 69.355  -14.664 103.758 1.00 48.50  ? 662  GLU C CA    1 
ATOM   8731  C  C     . GLU C  2  662  ? 69.712  -16.052 104.253 1.00 54.79  ? 662  GLU C C     1 
ATOM   8732  O  O     . GLU C  2  662  ? 68.858  -16.936 104.291 1.00 56.63  ? 662  GLU C O     1 
ATOM   8733  C  CB    . GLU C  2  662  ? 68.150  -14.116 104.522 1.00 50.99  ? 662  GLU C CB    1 
ATOM   8734  C  CG    . GLU C  2  662  ? 68.355  -13.970 106.024 1.00 57.00  ? 662  GLU C CG    1 
ATOM   8735  C  CD    . GLU C  2  662  ? 67.059  -13.677 106.767 1.00 56.76  ? 662  GLU C CD    1 
ATOM   8736  O  OE1   . GLU C  2  662  ? 66.101  -14.471 106.637 1.00 55.97  ? 662  GLU C OE1   1 
ATOM   8737  O  OE2   . GLU C  2  662  ? 66.996  -12.651 107.479 1.00 55.95  ? 662  GLU C OE2   1 
ATOM   8738  N  N     . ASN C  2  663  ? 70.978  -16.238 104.619 1.00 55.82  ? 663  ASN C N     1 
ATOM   8739  C  CA    . ASN C  2  663  ? 71.479  -17.525 105.094 1.00 50.96  ? 663  ASN C CA    1 
ATOM   8740  C  C     . ASN C  2  663  ? 71.135  -18.687 104.164 1.00 59.25  ? 663  ASN C C     1 
ATOM   8741  O  O     . ASN C  2  663  ? 70.868  -19.801 104.624 1.00 60.39  ? 663  ASN C O     1 
ATOM   8742  C  CB    . ASN C  2  663  ? 70.989  -17.806 106.515 1.00 53.22  ? 663  ASN C CB    1 
ATOM   8743  C  CG    . ASN C  2  663  ? 71.440  -16.743 107.507 1.00 62.78  ? 663  ASN C CG    1 
ATOM   8744  O  OD1   . ASN C  2  663  ? 72.590  -16.302 107.480 1.00 64.89  ? 663  ASN C OD1   1 
ATOM   8745  N  ND2   . ASN C  2  663  ? 70.531  -16.318 108.380 1.00 64.17  ? 663  ASN C ND2   1 
ATOM   8746  N  N     . GLY C  2  664  ? 71.139  -18.414 102.859 1.00 55.01  ? 664  GLY C N     1 
ATOM   8747  C  CA    . GLY C  2  664  ? 70.898  -19.440 101.861 1.00 47.36  ? 664  GLY C CA    1 
ATOM   8748  C  C     . GLY C  2  664  ? 69.448  -19.603 101.446 1.00 49.78  ? 664  GLY C C     1 
ATOM   8749  O  O     . GLY C  2  664  ? 69.142  -20.408 100.566 1.00 52.81  ? 664  GLY C O     1 
ATOM   8750  N  N     . PHE C  2  665  ? 68.556  -18.844 102.077 1.00 48.75  ? 665  PHE C N     1 
ATOM   8751  C  CA    . PHE C  2  665  ? 67.137  -18.865 101.731 1.00 51.35  ? 665  PHE C CA    1 
ATOM   8752  C  C     . PHE C  2  665  ? 66.804  -17.660 100.865 1.00 51.22  ? 665  PHE C C     1 
ATOM   8753  O  O     . PHE C  2  665  ? 67.340  -16.579 101.090 1.00 52.96  ? 665  PHE C O     1 
ATOM   8754  C  CB    . PHE C  2  665  ? 66.274  -18.777 102.988 1.00 54.05  ? 665  PHE C CB    1 
ATOM   8755  C  CG    . PHE C  2  665  ? 66.297  -20.005 103.846 1.00 59.20  ? 665  PHE C CG    1 
ATOM   8756  C  CD1   . PHE C  2  665  ? 65.340  -20.993 103.686 1.00 57.43  ? 665  PHE C CD1   1 
ATOM   8757  C  CD2   . PHE C  2  665  ? 67.248  -20.153 104.838 1.00 58.22  ? 665  PHE C CD2   1 
ATOM   8758  C  CE1   . PHE C  2  665  ? 65.344  -22.112 104.484 1.00 56.64  ? 665  PHE C CE1   1 
ATOM   8759  C  CE2   . PHE C  2  665  ? 67.256  -21.272 105.638 1.00 60.08  ? 665  PHE C CE2   1 
ATOM   8760  C  CZ    . PHE C  2  665  ? 66.302  -22.251 105.461 1.00 58.42  ? 665  PHE C CZ    1 
ATOM   8761  N  N     . LEU C  2  666  ? 65.900  -17.830 99.903  1.00 44.37  ? 666  LEU C N     1 
ATOM   8762  C  CA    . LEU C  2  666  ? 65.528  -16.734 99.017  1.00 42.81  ? 666  LEU C CA    1 
ATOM   8763  C  C     . LEU C  2  666  ? 64.872  -15.598 99.785  1.00 44.37  ? 666  LEU C C     1 
ATOM   8764  O  O     . LEU C  2  666  ? 63.837  -15.798 100.413 1.00 48.59  ? 666  LEU C O     1 
ATOM   8765  C  CB    . LEU C  2  666  ? 64.556  -17.250 97.958  1.00 43.67  ? 666  LEU C CB    1 
ATOM   8766  C  CG    . LEU C  2  666  ? 64.096  -16.254 96.893  1.00 43.66  ? 666  LEU C CG    1 
ATOM   8767  C  CD1   . LEU C  2  666  ? 65.291  -15.680 96.152  1.00 38.81  ? 666  LEU C CD1   1 
ATOM   8768  C  CD2   . LEU C  2  666  ? 63.127  -16.912 95.924  1.00 41.70  ? 666  LEU C CD2   1 
ATOM   8769  N  N     . ALA C  2  667  ? 65.454  -14.402 99.714  1.00 44.83  ? 667  ALA C N     1 
ATOM   8770  C  CA    . ALA C  2  667  ? 64.856  -13.238 100.363 1.00 41.26  ? 667  ALA C CA    1 
ATOM   8771  C  C     . ALA C  2  667  ? 64.447  -12.166 99.358  1.00 44.26  ? 667  ALA C C     1 
ATOM   8772  O  O     . ALA C  2  667  ? 65.254  -11.308 98.994  1.00 45.92  ? 667  ALA C O     1 
ATOM   8773  C  CB    . ALA C  2  667  ? 65.852  -12.651 101.331 1.00 41.97  ? 667  ALA C CB    1 
ATOM   8774  N  N     . LEU C  2  668  ? 63.167  -12.123 99.015  1.00 41.46  ? 668  LEU C N     1 
ATOM   8775  C  CA    . LEU C  2  668  ? 62.715  -11.210 97.974  1.00 38.27  ? 668  LEU C CA    1 
ATOM   8776  C  C     . LEU C  2  668  ? 62.117  -9.933  98.543  1.00 44.87  ? 668  LEU C C     1 
ATOM   8777  O  O     . LEU C  2  668  ? 61.740  -9.027  97.800  1.00 45.09  ? 668  LEU C O     1 
ATOM   8778  C  CB    . LEU C  2  668  ? 61.716  -11.903 97.050  1.00 37.48  ? 668  LEU C CB    1 
ATOM   8779  C  CG    . LEU C  2  668  ? 62.326  -12.989 96.168  1.00 42.17  ? 668  LEU C CG    1 
ATOM   8780  C  CD1   . LEU C  2  668  ? 61.297  -13.570 95.199  1.00 37.62  ? 668  LEU C CD1   1 
ATOM   8781  C  CD2   . LEU C  2  668  ? 63.532  -12.428 95.428  1.00 37.93  ? 668  LEU C CD2   1 
ATOM   8782  N  N     . GLY C  2  669  ? 62.061  -9.850  99.865  1.00 38.73  ? 669  GLY C N     1 
ATOM   8783  C  CA    . GLY C  2  669  ? 61.305  -8.803  100.513 1.00 40.61  ? 669  GLY C CA    1 
ATOM   8784  C  C     . GLY C  2  669  ? 61.553  -8.781  102.001 1.00 47.26  ? 669  GLY C C     1 
ATOM   8785  O  O     . GLY C  2  669  ? 62.599  -9.229  102.479 1.00 44.43  ? 669  GLY C O     1 
ATOM   8786  N  N     . GLN C  2  670  ? 60.611  -8.200  102.730 1.00 43.05  ? 670  GLN C N     1 
ATOM   8787  C  CA    . GLN C  2  670  ? 60.698  -8.178  104.175 1.00 43.49  ? 670  GLN C CA    1 
ATOM   8788  C  C     . GLN C  2  670  ? 59.445  -8.715  104.846 1.00 46.52  ? 670  GLN C C     1 
ATOM   8789  O  O     . GLN C  2  670  ? 58.375  -8.773  104.241 1.00 47.41  ? 670  GLN C O     1 
ATOM   8790  C  CB    . GLN C  2  670  ? 61.005  -6.770  104.658 1.00 42.82  ? 670  GLN C CB    1 
ATOM   8791  C  CG    . GLN C  2  670  ? 62.467  -6.588  104.979 1.00 44.95  ? 670  GLN C CG    1 
ATOM   8792  C  CD    . GLN C  2  670  ? 63.022  -5.338  104.386 1.00 46.37  ? 670  GLN C CD    1 
ATOM   8793  O  OE1   . GLN C  2  670  ? 62.319  -4.608  103.688 1.00 52.02  ? 670  GLN C OE1   1 
ATOM   8794  N  NE2   . GLN C  2  670  ? 64.290  -5.073  104.651 1.00 45.93  ? 670  GLN C NE2   1 
ATOM   8795  N  N     . ASN C  2  671  ? 59.597  -9.131  106.096 1.00 45.90  ? 671  ASN C N     1 
ATOM   8796  C  CA    . ASN C  2  671  ? 58.458  -9.531  106.907 1.00 48.19  ? 671  ASN C CA    1 
ATOM   8797  C  C     . ASN C  2  671  ? 58.012  -8.354  107.757 1.00 51.77  ? 671  ASN C C     1 
ATOM   8798  O  O     . ASN C  2  671  ? 58.761  -7.876  108.611 1.00 48.74  ? 671  ASN C O     1 
ATOM   8799  C  CB    . ASN C  2  671  ? 58.821  -10.713 107.799 1.00 44.21  ? 671  ASN C CB    1 
ATOM   8800  C  CG    . ASN C  2  671  ? 59.235  -11.927 107.008 1.00 45.84  ? 671  ASN C CG    1 
ATOM   8801  O  OD1   . ASN C  2  671  ? 58.423  -12.534 106.308 1.00 47.98  ? 671  ASN C OD1   1 
ATOM   8802  N  ND2   . ASN C  2  671  ? 60.499  -12.304 107.126 1.00 44.75  ? 671  ASN C ND2   1 
ATOM   8803  N  N     . VAL C  2  672  ? 56.800  -7.873  107.514 1.00 47.74  ? 672  VAL C N     1 
ATOM   8804  C  CA    . VAL C  2  672  ? 56.314  -6.714  108.243 1.00 46.12  ? 672  VAL C CA    1 
ATOM   8805  C  C     . VAL C  2  672  ? 55.052  -7.027  109.036 1.00 48.43  ? 672  VAL C C     1 
ATOM   8806  O  O     . VAL C  2  672  ? 54.318  -7.972  108.735 1.00 48.18  ? 672  VAL C O     1 
ATOM   8807  C  CB    . VAL C  2  672  ? 56.076  -5.508  107.314 1.00 41.04  ? 672  VAL C CB    1 
ATOM   8808  C  CG1   . VAL C  2  672  ? 57.403  -4.956  106.820 1.00 39.82  ? 672  VAL C CG1   1 
ATOM   8809  C  CG2   . VAL C  2  672  ? 55.186  -5.904  106.150 1.00 39.80  ? 672  VAL C CG2   1 
ATOM   8810  N  N     . LEU C  2  673  ? 54.818  -6.227  110.065 1.00 46.44  ? 673  LEU C N     1 
ATOM   8811  C  CA    . LEU C  2  673  ? 53.632  -6.372  110.878 1.00 44.13  ? 673  LEU C CA    1 
ATOM   8812  C  C     . LEU C  2  673  ? 52.526  -5.591  110.191 1.00 45.19  ? 673  LEU C C     1 
ATOM   8813  O  O     . LEU C  2  673  ? 52.595  -4.372  110.049 1.00 46.82  ? 673  LEU C O     1 
ATOM   8814  C  CB    . LEU C  2  673  ? 53.891  -5.814  112.275 1.00 46.54  ? 673  LEU C CB    1 
ATOM   8815  C  CG    . LEU C  2  673  ? 53.000  -6.336  113.397 1.00 51.07  ? 673  LEU C CG    1 
ATOM   8816  C  CD1   . LEU C  2  673  ? 53.141  -7.843  113.516 1.00 46.84  ? 673  LEU C CD1   1 
ATOM   8817  C  CD2   . LEU C  2  673  ? 53.360  -5.657  114.705 1.00 58.86  ? 673  LEU C CD2   1 
ATOM   8818  N  N     . VAL C  2  674  ? 51.499  -6.307  109.769 1.00 43.45  ? 674  VAL C N     1 
ATOM   8819  C  CA    . VAL C  2  674  ? 50.446  -5.728  108.971 1.00 43.47  ? 674  VAL C CA    1 
ATOM   8820  C  C     . VAL C  2  674  ? 49.120  -5.773  109.719 1.00 42.51  ? 674  VAL C C     1 
ATOM   8821  O  O     . VAL C  2  674  ? 48.849  -6.715  110.477 1.00 45.68  ? 674  VAL C O     1 
ATOM   8822  C  CB    . VAL C  2  674  ? 50.331  -6.451  107.606 1.00 46.82  ? 674  VAL C CB    1 
ATOM   8823  C  CG1   . VAL C  2  674  ? 49.769  -7.859  107.779 1.00 47.64  ? 674  VAL C CG1   1 
ATOM   8824  C  CG2   . VAL C  2  674  ? 49.472  -5.657  106.658 1.00 46.53  ? 674  VAL C CG2   1 
ATOM   8825  N  N     . ALA C  2  675  ? 48.325  -4.724  109.524 1.00 42.86  ? 675  ALA C N     1 
ATOM   8826  C  CA    . ALA C  2  675  ? 46.948  -4.665  109.995 1.00 39.48  ? 675  ALA C CA    1 
ATOM   8827  C  C     . ALA C  2  675  ? 46.024  -4.575  108.788 1.00 44.22  ? 675  ALA C C     1 
ATOM   8828  O  O     . ALA C  2  675  ? 46.252  -3.772  107.878 1.00 42.19  ? 675  ALA C O     1 
ATOM   8829  C  CB    . ALA C  2  675  ? 46.746  -3.457  110.884 1.00 37.61  ? 675  ALA C CB    1 
ATOM   8830  N  N     . ILE C  2  676  ? 44.975  -5.389  108.780 1.00 43.05  ? 676  ILE C N     1 
ATOM   8831  C  CA    . ILE C  2  676  ? 44.017  -5.342  107.690 1.00 37.33  ? 676  ILE C CA    1 
ATOM   8832  C  C     . ILE C  2  676  ? 42.800  -4.549  108.143 1.00 41.43  ? 676  ILE C C     1 
ATOM   8833  O  O     . ILE C  2  676  ? 42.002  -5.024  108.937 1.00 39.85  ? 676  ILE C O     1 
ATOM   8834  C  CB    . ILE C  2  676  ? 43.609  -6.754  107.243 1.00 36.58  ? 676