data_4G7O
# 
_entry.id   4G7O 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4G7O         
NDB   NA1931       
RCSB  RCSB073841   
WWPDB D_1000073841 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4G7H . unspecified 
PDB 4G7Z . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4G7O 
_pdbx_database_status.recvd_initial_deposition_date   2012-07-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, Y.'     1 
'Ebright, R.H.' 2 
# 
_citation.id                        primary 
_citation.title                     'Structural basis of transcription initiation.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            338 
_citation.page_first                1076 
_citation.page_last                 1080 
_citation.year                      2012 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23086998 
_citation.pdbx_database_id_DOI      10.1126/science.1227786 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhang, Y.'      1 
primary 'Feng, Y.'       2 
primary 'Chatterjee, S.' 3 
primary 'Tuske, S.'      4 
primary 'Ho, M.X.'       5 
primary 'Arnold, E.'     6 
primary 'Ebright, R.H.'  7 
# 
_cell.entry_id           4G7O 
_cell.length_a           185.483 
_cell.length_b           103.883 
_cell.length_c           297.340 
_cell.angle_alpha        90.00 
_cell.angle_beta         98.23 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4G7O 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-directed RNA polymerase subunit alpha'                                                 35056.164  4   
2.7.7.6 ? ? ?                    
2  polymer     nat 'DNA-directed RNA polymerase subunit beta'                                                  125436.539 2   
2.7.7.6 ? ? ?                    
3  polymer     nat 
;DNA-directed RNA polymerase subunit beta'
;
170997.391 2   2.7.7.6 ? ? ?                    
4  polymer     nat 'DNA-directed RNA polymerase subunit omega'                                                 11533.316  2   
2.7.7.6 ? ? ?                    
5  polymer     man 'RNA polymerase sigma factor'                                                               50769.398  2   ? ? 
? ?                    
6  polymer     syn "5'-D(*CP*CP*T*GP*CP*AP*TP*CP*CP*GP*TP*GP*AP*GP*TP*CP*GP*AP*GP*GP*G)-3'"                    6480.172   2   ? ? 
? 'template strand'    
7  polymer     syn "5'-D(*TP*AP*TP*AP*AP*TP*GP*GP*GP*AP*GP*CP*TP*GP*TP*CP*AP*CP*GP*GP*AP*TP*GP*CP*AP*GP*G)-3'" 8421.432   2   ? ? 
? 'nontemplate strand' 
8  polymer     syn "5'-R(*GP*A)-3'"                                                                            629.454    2   ? ? 
? 'RNA strand'         
9  non-polymer syn 'ZINC ION'                                                                                  65.409     4   ? ? 
? ?                    
10 non-polymer syn 'MAGNESIUM ION'                                                                             24.305     5   ? ? 
? ?                    
11 water       nat water                                                                                       18.015     272 ? ? 
? ?                    
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'RNAP subunit alpha, RNA polymerase subunit alpha, Transcriptase subunit alpha'                                    
2 'RNAP subunit beta, RNA polymerase subunit beta, Transcriptase subunit beta'                                       
3 
;RNA polymerase beta-prime subunit, RNAP subunit beta', RNA polymerase subunit beta', Transcriptase subunit beta'
;
4 'RNAP omega subunit, RNA polymerase omega subunit, Transcriptase subunit omega'                                    
5 'RNA polymerase principle sigma factor, sigma A'                                                                   
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
A,B,K,L ? 
2 'polypeptide(L)'        no no 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
C,M     ? 
3 'polypeptide(L)'        no no 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
D,N     ? 
4 'polypeptide(L)'        no no 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
E,O     ? 
5 'polypeptide(L)'        no no 
;MGSSHHHHHHSSGLVPRGSHMKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEG
LDLEEEEEDLPIPKISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSAR
VRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGL
IRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWD
AKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGRE
HTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD
;
;MGSSHHHHHHSSGLVPRGSHMKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEG
LDLEEEEEDLPIPKISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSAR
VRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGL
IRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWD
AKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGRE
HTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD
;
F,P     ? 
6 polydeoxyribonucleotide no no 
;(DC)(DC)(DT)(DG)(DC)(DA)(DT)(DC)(DC)(DG)(DT)(DG)(DA)(DG)(DT)(DC)(DG)(DA)(DG)(DG)
(DG)
;
CCTGCATCCGTGAGTCGAGGG G,Q     ? 
7 polydeoxyribonucleotide no no 
;(DT)(DA)(DT)(DA)(DA)(DT)(DG)(DG)(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DA)(DC)(DG)(DG)
(DA)(DT)(DG)(DC)(DA)(DG)(DG)
;
TATAATGGGAGCTGTCACGGATGCAGG H,R     ? 
8 polyribonucleotide      no no GA GA I,S     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    LEU n 
1 3    ASP n 
1 4    SER n 
1 5    LYS n 
1 6    LEU n 
1 7    LYS n 
1 8    ALA n 
1 9    PRO n 
1 10   VAL n 
1 11   PHE n 
1 12   THR n 
1 13   VAL n 
1 14   ARG n 
1 15   THR n 
1 16   GLN n 
1 17   GLY n 
1 18   ARG n 
1 19   GLU n 
1 20   TYR n 
1 21   GLY n 
1 22   GLU n 
1 23   PHE n 
1 24   VAL n 
1 25   LEU n 
1 26   GLU n 
1 27   PRO n 
1 28   LEU n 
1 29   GLU n 
1 30   ARG n 
1 31   GLY n 
1 32   PHE n 
1 33   GLY n 
1 34   VAL n 
1 35   THR n 
1 36   LEU n 
1 37   GLY n 
1 38   ASN n 
1 39   PRO n 
1 40   LEU n 
1 41   ARG n 
1 42   ARG n 
1 43   ILE n 
1 44   LEU n 
1 45   LEU n 
1 46   SER n 
1 47   SER n 
1 48   ILE n 
1 49   PRO n 
1 50   GLY n 
1 51   THR n 
1 52   ALA n 
1 53   VAL n 
1 54   THR n 
1 55   SER n 
1 56   VAL n 
1 57   TYR n 
1 58   ILE n 
1 59   GLU n 
1 60   ASP n 
1 61   VAL n 
1 62   LEU n 
1 63   HIS n 
1 64   GLU n 
1 65   PHE n 
1 66   SER n 
1 67   THR n 
1 68   ILE n 
1 69   PRO n 
1 70   GLY n 
1 71   VAL n 
1 72   LYS n 
1 73   GLU n 
1 74   ASP n 
1 75   VAL n 
1 76   VAL n 
1 77   GLU n 
1 78   ILE n 
1 79   ILE n 
1 80   LEU n 
1 81   ASN n 
1 82   LEU n 
1 83   LYS n 
1 84   GLU n 
1 85   LEU n 
1 86   VAL n 
1 87   VAL n 
1 88   ARG n 
1 89   PHE n 
1 90   LEU n 
1 91   ASN n 
1 92   PRO n 
1 93   SER n 
1 94   LEU n 
1 95   GLN n 
1 96   THR n 
1 97   VAL n 
1 98   THR n 
1 99   LEU n 
1 100  LEU n 
1 101  LEU n 
1 102  LYS n 
1 103  ALA n 
1 104  GLU n 
1 105  GLY n 
1 106  PRO n 
1 107  LYS n 
1 108  GLU n 
1 109  VAL n 
1 110  LYS n 
1 111  ALA n 
1 112  ARG n 
1 113  ASP n 
1 114  PHE n 
1 115  LEU n 
1 116  PRO n 
1 117  VAL n 
1 118  ALA n 
1 119  ASP n 
1 120  VAL n 
1 121  GLU n 
1 122  ILE n 
1 123  MET n 
1 124  ASN n 
1 125  PRO n 
1 126  ASP n 
1 127  LEU n 
1 128  HIS n 
1 129  ILE n 
1 130  ALA n 
1 131  THR n 
1 132  LEU n 
1 133  GLU n 
1 134  GLU n 
1 135  GLY n 
1 136  GLY n 
1 137  ARG n 
1 138  LEU n 
1 139  ASN n 
1 140  MET n 
1 141  GLU n 
1 142  VAL n 
1 143  ARG n 
1 144  VAL n 
1 145  ASP n 
1 146  ARG n 
1 147  GLY n 
1 148  VAL n 
1 149  GLY n 
1 150  TYR n 
1 151  VAL n 
1 152  PRO n 
1 153  ALA n 
1 154  GLU n 
1 155  LYS n 
1 156  HIS n 
1 157  GLY n 
1 158  ILE n 
1 159  LYS n 
1 160  ASP n 
1 161  ARG n 
1 162  ILE n 
1 163  ASN n 
1 164  ALA n 
1 165  ILE n 
1 166  PRO n 
1 167  VAL n 
1 168  ASP n 
1 169  ALA n 
1 170  VAL n 
1 171  PHE n 
1 172  SER n 
1 173  PRO n 
1 174  VAL n 
1 175  ARG n 
1 176  ARG n 
1 177  VAL n 
1 178  ALA n 
1 179  PHE n 
1 180  GLN n 
1 181  VAL n 
1 182  GLU n 
1 183  ASP n 
1 184  THR n 
1 185  ARG n 
1 186  LEU n 
1 187  GLY n 
1 188  GLN n 
1 189  ARG n 
1 190  THR n 
1 191  ASP n 
1 192  LEU n 
1 193  ASP n 
1 194  LYS n 
1 195  LEU n 
1 196  THR n 
1 197  LEU n 
1 198  ARG n 
1 199  ILE n 
1 200  TRP n 
1 201  THR n 
1 202  ASP n 
1 203  GLY n 
1 204  SER n 
1 205  VAL n 
1 206  THR n 
1 207  PRO n 
1 208  LEU n 
1 209  GLU n 
1 210  ALA n 
1 211  LEU n 
1 212  ASN n 
1 213  GLN n 
1 214  ALA n 
1 215  VAL n 
1 216  GLU n 
1 217  ILE n 
1 218  LEU n 
1 219  ARG n 
1 220  GLU n 
1 221  HIS n 
1 222  LEU n 
1 223  THR n 
1 224  TYR n 
1 225  PHE n 
1 226  SER n 
1 227  ASN n 
1 228  PRO n 
1 229  GLN n 
1 230  ALA n 
1 231  ALA n 
1 232  ALA n 
1 233  VAL n 
1 234  ALA n 
1 235  ALA n 
1 236  PRO n 
1 237  GLU n 
1 238  GLU n 
1 239  ALA n 
1 240  LYS n 
1 241  GLU n 
1 242  PRO n 
1 243  GLU n 
1 244  ALA n 
1 245  PRO n 
1 246  PRO n 
1 247  GLU n 
1 248  GLN n 
1 249  GLU n 
1 250  GLU n 
1 251  GLU n 
1 252  LEU n 
1 253  ASP n 
1 254  LEU n 
1 255  PRO n 
1 256  LEU n 
1 257  GLU n 
1 258  GLU n 
1 259  LEU n 
1 260  GLY n 
1 261  LEU n 
1 262  SER n 
1 263  THR n 
1 264  ARG n 
1 265  VAL n 
1 266  LEU n 
1 267  HIS n 
1 268  SER n 
1 269  LEU n 
1 270  LYS n 
1 271  GLU n 
1 272  GLU n 
1 273  GLY n 
1 274  ILE n 
1 275  GLU n 
1 276  SER n 
1 277  VAL n 
1 278  ARG n 
1 279  ALA n 
1 280  LEU n 
1 281  LEU n 
1 282  ALA n 
1 283  LEU n 
1 284  ASN n 
1 285  LEU n 
1 286  LYS n 
1 287  ASP n 
1 288  LEU n 
1 289  LYS n 
1 290  ASN n 
1 291  ILE n 
1 292  PRO n 
1 293  GLY n 
1 294  ILE n 
1 295  GLY n 
1 296  GLU n 
1 297  ARG n 
1 298  SER n 
1 299  LEU n 
1 300  GLU n 
1 301  GLU n 
1 302  ILE n 
1 303  LYS n 
1 304  GLU n 
1 305  ALA n 
1 306  LEU n 
1 307  GLU n 
1 308  LYS n 
1 309  LYS n 
1 310  GLY n 
1 311  PHE n 
1 312  THR n 
1 313  LEU n 
1 314  LYS n 
1 315  GLU n 
2 1    MET n 
2 2    GLU n 
2 3    ILE n 
2 4    LYS n 
2 5    ARG n 
2 6    PHE n 
2 7    GLY n 
2 8    ARG n 
2 9    ILE n 
2 10   ARG n 
2 11   GLU n 
2 12   VAL n 
2 13   ILE n 
2 14   PRO n 
2 15   LEU n 
2 16   PRO n 
2 17   PRO n 
2 18   LEU n 
2 19   THR n 
2 20   GLU n 
2 21   ILE n 
2 22   GLN n 
2 23   VAL n 
2 24   GLU n 
2 25   SER n 
2 26   TYR n 
2 27   ARG n 
2 28   ARG n 
2 29   ALA n 
2 30   LEU n 
2 31   GLN n 
2 32   ALA n 
2 33   ASP n 
2 34   VAL n 
2 35   PRO n 
2 36   PRO n 
2 37   GLU n 
2 38   LYS n 
2 39   ARG n 
2 40   GLU n 
2 41   ASN n 
2 42   VAL n 
2 43   GLY n 
2 44   ILE n 
2 45   GLN n 
2 46   ALA n 
2 47   ALA n 
2 48   PHE n 
2 49   ARG n 
2 50   GLU n 
2 51   THR n 
2 52   PHE n 
2 53   PRO n 
2 54   ILE n 
2 55   GLU n 
2 56   GLU n 
2 57   GLU n 
2 58   ASP n 
2 59   LYS n 
2 60   GLY n 
2 61   LYS n 
2 62   GLY n 
2 63   GLY n 
2 64   LEU n 
2 65   VAL n 
2 66   LEU n 
2 67   ASP n 
2 68   PHE n 
2 69   LEU n 
2 70   GLU n 
2 71   TYR n 
2 72   ARG n 
2 73   LEU n 
2 74   GLY n 
2 75   GLU n 
2 76   PRO n 
2 77   PRO n 
2 78   PHE n 
2 79   PRO n 
2 80   GLN n 
2 81   ASP n 
2 82   GLU n 
2 83   CYS n 
2 84   ARG n 
2 85   GLU n 
2 86   LYS n 
2 87   ASP n 
2 88   LEU n 
2 89   THR n 
2 90   TYR n 
2 91   GLN n 
2 92   ALA n 
2 93   PRO n 
2 94   LEU n 
2 95   TYR n 
2 96   ALA n 
2 97   ARG n 
2 98   LEU n 
2 99   GLN n 
2 100  LEU n 
2 101  ILE n 
2 102  HIS n 
2 103  LYS n 
2 104  ASP n 
2 105  THR n 
2 106  GLY n 
2 107  LEU n 
2 108  ILE n 
2 109  LYS n 
2 110  GLU n 
2 111  ASP n 
2 112  GLU n 
2 113  VAL n 
2 114  PHE n 
2 115  LEU n 
2 116  GLY n 
2 117  HIS n 
2 118  ILE n 
2 119  PRO n 
2 120  LEU n 
2 121  MET n 
2 122  THR n 
2 123  GLU n 
2 124  ASP n 
2 125  GLY n 
2 126  SER n 
2 127  PHE n 
2 128  ILE n 
2 129  ILE n 
2 130  ASN n 
2 131  GLY n 
2 132  ALA n 
2 133  ASP n 
2 134  ARG n 
2 135  VAL n 
2 136  ILE n 
2 137  VAL n 
2 138  SER n 
2 139  GLN n 
2 140  ILE n 
2 141  HIS n 
2 142  ARG n 
2 143  SER n 
2 144  PRO n 
2 145  GLY n 
2 146  VAL n 
2 147  TYR n 
2 148  PHE n 
2 149  THR n 
2 150  PRO n 
2 151  ASP n 
2 152  PRO n 
2 153  ALA n 
2 154  ARG n 
2 155  PRO n 
2 156  GLY n 
2 157  ARG n 
2 158  TYR n 
2 159  ILE n 
2 160  ALA n 
2 161  SER n 
2 162  ILE n 
2 163  ILE n 
2 164  PRO n 
2 165  LEU n 
2 166  PRO n 
2 167  LYS n 
2 168  ARG n 
2 169  GLY n 
2 170  PRO n 
2 171  TRP n 
2 172  ILE n 
2 173  ASP n 
2 174  LEU n 
2 175  GLU n 
2 176  VAL n 
2 177  GLU n 
2 178  PRO n 
2 179  ASN n 
2 180  GLY n 
2 181  VAL n 
2 182  VAL n 
2 183  SER n 
2 184  MET n 
2 185  LYS n 
2 186  VAL n 
2 187  ASN n 
2 188  LYS n 
2 189  ARG n 
2 190  LYS n 
2 191  PHE n 
2 192  PRO n 
2 193  LEU n 
2 194  VAL n 
2 195  LEU n 
2 196  LEU n 
2 197  LEU n 
2 198  ARG n 
2 199  VAL n 
2 200  LEU n 
2 201  GLY n 
2 202  TYR n 
2 203  ASP n 
2 204  GLN n 
2 205  GLU n 
2 206  THR n 
2 207  LEU n 
2 208  ALA n 
2 209  ARG n 
2 210  GLU n 
2 211  LEU n 
2 212  GLY n 
2 213  ALA n 
2 214  TYR n 
2 215  GLY n 
2 216  GLU n 
2 217  LEU n 
2 218  VAL n 
2 219  GLN n 
2 220  GLY n 
2 221  LEU n 
2 222  MET n 
2 223  ASP n 
2 224  GLU n 
2 225  SER n 
2 226  VAL n 
2 227  PHE n 
2 228  ALA n 
2 229  MET n 
2 230  ARG n 
2 231  PRO n 
2 232  GLU n 
2 233  GLU n 
2 234  ALA n 
2 235  LEU n 
2 236  ILE n 
2 237  ARG n 
2 238  LEU n 
2 239  PHE n 
2 240  THR n 
2 241  LEU n 
2 242  LEU n 
2 243  ARG n 
2 244  PRO n 
2 245  GLY n 
2 246  ASP n 
2 247  PRO n 
2 248  PRO n 
2 249  LYS n 
2 250  ARG n 
2 251  ASP n 
2 252  LYS n 
2 253  ALA n 
2 254  VAL n 
2 255  ALA n 
2 256  TYR n 
2 257  VAL n 
2 258  TYR n 
2 259  GLY n 
2 260  LEU n 
2 261  ILE n 
2 262  ALA n 
2 263  ASP n 
2 264  PRO n 
2 265  ARG n 
2 266  ARG n 
2 267  TYR n 
2 268  ASP n 
2 269  LEU n 
2 270  GLY n 
2 271  GLU n 
2 272  ALA n 
2 273  GLY n 
2 274  ARG n 
2 275  TYR n 
2 276  LYS n 
2 277  ALA n 
2 278  GLU n 
2 279  GLU n 
2 280  LYS n 
2 281  LEU n 
2 282  GLY n 
2 283  ILE n 
2 284  ARG n 
2 285  LEU n 
2 286  SER n 
2 287  GLY n 
2 288  ARG n 
2 289  THR n 
2 290  LEU n 
2 291  ALA n 
2 292  ARG n 
2 293  PHE n 
2 294  GLU n 
2 295  ASP n 
2 296  GLY n 
2 297  GLU n 
2 298  PHE n 
2 299  LYS n 
2 300  ASP n 
2 301  GLU n 
2 302  VAL n 
2 303  PHE n 
2 304  LEU n 
2 305  PRO n 
2 306  THR n 
2 307  LEU n 
2 308  ARG n 
2 309  TYR n 
2 310  LEU n 
2 311  PHE n 
2 312  ALA n 
2 313  LEU n 
2 314  THR n 
2 315  ALA n 
2 316  GLY n 
2 317  VAL n 
2 318  PRO n 
2 319  GLY n 
2 320  HIS n 
2 321  GLU n 
2 322  VAL n 
2 323  ASP n 
2 324  ASP n 
2 325  ILE n 
2 326  ASP n 
2 327  HIS n 
2 328  LEU n 
2 329  GLY n 
2 330  ASN n 
2 331  ARG n 
2 332  ARG n 
2 333  ILE n 
2 334  ARG n 
2 335  THR n 
2 336  VAL n 
2 337  GLY n 
2 338  GLU n 
2 339  LEU n 
2 340  MET n 
2 341  THR n 
2 342  ASP n 
2 343  GLN n 
2 344  PHE n 
2 345  ARG n 
2 346  VAL n 
2 347  GLY n 
2 348  LEU n 
2 349  ALA n 
2 350  ARG n 
2 351  LEU n 
2 352  ALA n 
2 353  ARG n 
2 354  GLY n 
2 355  VAL n 
2 356  ARG n 
2 357  GLU n 
2 358  ARG n 
2 359  MET n 
2 360  LEU n 
2 361  MET n 
2 362  GLY n 
2 363  SER n 
2 364  GLU n 
2 365  ASP n 
2 366  SER n 
2 367  LEU n 
2 368  THR n 
2 369  PRO n 
2 370  ALA n 
2 371  LYS n 
2 372  LEU n 
2 373  VAL n 
2 374  ASN n 
2 375  SER n 
2 376  ARG n 
2 377  PRO n 
2 378  LEU n 
2 379  GLU n 
2 380  ALA n 
2 381  ALA n 
2 382  ILE n 
2 383  ARG n 
2 384  GLU n 
2 385  PHE n 
2 386  PHE n 
2 387  SER n 
2 388  ARG n 
2 389  SER n 
2 390  GLN n 
2 391  LEU n 
2 392  SER n 
2 393  GLN n 
2 394  PHE n 
2 395  LYS n 
2 396  ASP n 
2 397  GLU n 
2 398  THR n 
2 399  ASN n 
2 400  PRO n 
2 401  LEU n 
2 402  SER n 
2 403  SER n 
2 404  LEU n 
2 405  ARG n 
2 406  HIS n 
2 407  LYS n 
2 408  ARG n 
2 409  ARG n 
2 410  ILE n 
2 411  SER n 
2 412  ALA n 
2 413  LEU n 
2 414  GLY n 
2 415  PRO n 
2 416  GLY n 
2 417  GLY n 
2 418  LEU n 
2 419  THR n 
2 420  ARG n 
2 421  GLU n 
2 422  ARG n 
2 423  ALA n 
2 424  GLY n 
2 425  PHE n 
2 426  ASP n 
2 427  VAL n 
2 428  ARG n 
2 429  ASP n 
2 430  VAL n 
2 431  HIS n 
2 432  ARG n 
2 433  THR n 
2 434  HIS n 
2 435  TYR n 
2 436  GLY n 
2 437  ARG n 
2 438  ILE n 
2 439  CYS n 
2 440  PRO n 
2 441  VAL n 
2 442  GLU n 
2 443  THR n 
2 444  PRO n 
2 445  GLU n 
2 446  GLY n 
2 447  ALA n 
2 448  ASN n 
2 449  ILE n 
2 450  GLY n 
2 451  LEU n 
2 452  ILE n 
2 453  THR n 
2 454  SER n 
2 455  LEU n 
2 456  ALA n 
2 457  ALA n 
2 458  TYR n 
2 459  ALA n 
2 460  ARG n 
2 461  VAL n 
2 462  ASP n 
2 463  GLU n 
2 464  LEU n 
2 465  GLY n 
2 466  PHE n 
2 467  ILE n 
2 468  ARG n 
2 469  THR n 
2 470  PRO n 
2 471  TYR n 
2 472  ARG n 
2 473  ARG n 
2 474  VAL n 
2 475  VAL n 
2 476  GLY n 
2 477  GLY n 
2 478  VAL n 
2 479  VAL n 
2 480  THR n 
2 481  ASP n 
2 482  GLU n 
2 483  VAL n 
2 484  VAL n 
2 485  TYR n 
2 486  MET n 
2 487  THR n 
2 488  ALA n 
2 489  THR n 
2 490  GLU n 
2 491  GLU n 
2 492  ASP n 
2 493  ARG n 
2 494  TYR n 
2 495  THR n 
2 496  ILE n 
2 497  ALA n 
2 498  GLN n 
2 499  ALA n 
2 500  ASN n 
2 501  THR n 
2 502  PRO n 
2 503  LEU n 
2 504  GLU n 
2 505  GLY n 
2 506  ASN n 
2 507  ARG n 
2 508  ILE n 
2 509  ALA n 
2 510  ALA n 
2 511  GLU n 
2 512  ARG n 
2 513  VAL n 
2 514  VAL n 
2 515  ALA n 
2 516  ARG n 
2 517  ARG n 
2 518  LYS n 
2 519  GLY n 
2 520  GLU n 
2 521  PRO n 
2 522  VAL n 
2 523  ILE n 
2 524  VAL n 
2 525  SER n 
2 526  PRO n 
2 527  GLU n 
2 528  GLU n 
2 529  VAL n 
2 530  GLU n 
2 531  PHE n 
2 532  MET n 
2 533  ASP n 
2 534  VAL n 
2 535  SER n 
2 536  PRO n 
2 537  LYS n 
2 538  GLN n 
2 539  VAL n 
2 540  PHE n 
2 541  SER n 
2 542  VAL n 
2 543  ASN n 
2 544  THR n 
2 545  ASN n 
2 546  LEU n 
2 547  ILE n 
2 548  PRO n 
2 549  PHE n 
2 550  LEU n 
2 551  GLU n 
2 552  HIS n 
2 553  ASP n 
2 554  ASP n 
2 555  ALA n 
2 556  ASN n 
2 557  ARG n 
2 558  ALA n 
2 559  LEU n 
2 560  MET n 
2 561  GLY n 
2 562  SER n 
2 563  ASN n 
2 564  MET n 
2 565  GLN n 
2 566  THR n 
2 567  GLN n 
2 568  ALA n 
2 569  VAL n 
2 570  PRO n 
2 571  LEU n 
2 572  ILE n 
2 573  ARG n 
2 574  ALA n 
2 575  GLN n 
2 576  ALA n 
2 577  PRO n 
2 578  VAL n 
2 579  VAL n 
2 580  MET n 
2 581  THR n 
2 582  GLY n 
2 583  LEU n 
2 584  GLU n 
2 585  GLU n 
2 586  ARG n 
2 587  VAL n 
2 588  VAL n 
2 589  ARG n 
2 590  ASP n 
2 591  SER n 
2 592  LEU n 
2 593  ALA n 
2 594  ALA n 
2 595  LEU n 
2 596  TYR n 
2 597  ALA n 
2 598  GLU n 
2 599  GLU n 
2 600  ASP n 
2 601  GLY n 
2 602  GLU n 
2 603  VAL n 
2 604  ALA n 
2 605  LYS n 
2 606  VAL n 
2 607  ASP n 
2 608  GLY n 
2 609  ASN n 
2 610  ARG n 
2 611  ILE n 
2 612  VAL n 
2 613  VAL n 
2 614  ARG n 
2 615  TYR n 
2 616  GLU n 
2 617  ASP n 
2 618  GLY n 
2 619  ARG n 
2 620  LEU n 
2 621  VAL n 
2 622  GLU n 
2 623  TYR n 
2 624  PRO n 
2 625  LEU n 
2 626  ARG n 
2 627  ARG n 
2 628  PHE n 
2 629  TYR n 
2 630  ARG n 
2 631  SER n 
2 632  ASN n 
2 633  GLN n 
2 634  GLY n 
2 635  THR n 
2 636  ALA n 
2 637  LEU n 
2 638  ASP n 
2 639  GLN n 
2 640  ARG n 
2 641  PRO n 
2 642  ARG n 
2 643  VAL n 
2 644  VAL n 
2 645  VAL n 
2 646  GLY n 
2 647  GLN n 
2 648  ARG n 
2 649  VAL n 
2 650  ARG n 
2 651  LYS n 
2 652  GLY n 
2 653  ASP n 
2 654  LEU n 
2 655  LEU n 
2 656  ALA n 
2 657  ASP n 
2 658  GLY n 
2 659  PRO n 
2 660  ALA n 
2 661  SER n 
2 662  GLU n 
2 663  ASN n 
2 664  GLY n 
2 665  PHE n 
2 666  LEU n 
2 667  ALA n 
2 668  LEU n 
2 669  GLY n 
2 670  GLN n 
2 671  ASN n 
2 672  VAL n 
2 673  LEU n 
2 674  VAL n 
2 675  ALA n 
2 676  ILE n 
2 677  MET n 
2 678  PRO n 
2 679  PHE n 
2 680  ASP n 
2 681  GLY n 
2 682  TYR n 
2 683  ASN n 
2 684  PHE n 
2 685  GLU n 
2 686  ASP n 
2 687  ALA n 
2 688  ILE n 
2 689  VAL n 
2 690  ILE n 
2 691  SER n 
2 692  GLU n 
2 693  GLU n 
2 694  LEU n 
2 695  LEU n 
2 696  LYS n 
2 697  ARG n 
2 698  ASP n 
2 699  PHE n 
2 700  TYR n 
2 701  THR n 
2 702  SER n 
2 703  ILE n 
2 704  HIS n 
2 705  ILE n 
2 706  GLU n 
2 707  ARG n 
2 708  TYR n 
2 709  GLU n 
2 710  ILE n 
2 711  GLU n 
2 712  ALA n 
2 713  ARG n 
2 714  ASP n 
2 715  THR n 
2 716  LYS n 
2 717  LEU n 
2 718  GLY n 
2 719  PRO n 
2 720  GLU n 
2 721  ARG n 
2 722  ILE n 
2 723  THR n 
2 724  ARG n 
2 725  ASP n 
2 726  ILE n 
2 727  PRO n 
2 728  HIS n 
2 729  LEU n 
2 730  SER n 
2 731  GLU n 
2 732  ALA n 
2 733  ALA n 
2 734  LEU n 
2 735  ARG n 
2 736  ASP n 
2 737  LEU n 
2 738  ASP n 
2 739  GLU n 
2 740  GLU n 
2 741  GLY n 
2 742  VAL n 
2 743  VAL n 
2 744  ARG n 
2 745  ILE n 
2 746  GLY n 
2 747  ALA n 
2 748  GLU n 
2 749  VAL n 
2 750  LYS n 
2 751  PRO n 
2 752  GLY n 
2 753  ASP n 
2 754  ILE n 
2 755  LEU n 
2 756  VAL n 
2 757  GLY n 
2 758  ARG n 
2 759  THR n 
2 760  SER n 
2 761  PHE n 
2 762  LYS n 
2 763  GLY n 
2 764  GLU n 
2 765  SER n 
2 766  GLU n 
2 767  PRO n 
2 768  THR n 
2 769  PRO n 
2 770  GLU n 
2 771  GLU n 
2 772  ARG n 
2 773  LEU n 
2 774  LEU n 
2 775  ARG n 
2 776  SER n 
2 777  ILE n 
2 778  PHE n 
2 779  GLY n 
2 780  GLU n 
2 781  LYS n 
2 782  ALA n 
2 783  ARG n 
2 784  ASP n 
2 785  VAL n 
2 786  LYS n 
2 787  ASP n 
2 788  THR n 
2 789  SER n 
2 790  LEU n 
2 791  ARG n 
2 792  VAL n 
2 793  PRO n 
2 794  PRO n 
2 795  GLY n 
2 796  GLU n 
2 797  GLY n 
2 798  GLY n 
2 799  ILE n 
2 800  VAL n 
2 801  VAL n 
2 802  ARG n 
2 803  THR n 
2 804  VAL n 
2 805  ARG n 
2 806  LEU n 
2 807  ARG n 
2 808  ARG n 
2 809  GLY n 
2 810  ASP n 
2 811  PRO n 
2 812  GLY n 
2 813  VAL n 
2 814  GLU n 
2 815  LEU n 
2 816  LYS n 
2 817  PRO n 
2 818  GLY n 
2 819  VAL n 
2 820  ARG n 
2 821  GLU n 
2 822  VAL n 
2 823  VAL n 
2 824  ARG n 
2 825  VAL n 
2 826  TYR n 
2 827  VAL n 
2 828  ALA n 
2 829  GLN n 
2 830  LYS n 
2 831  ARG n 
2 832  LYS n 
2 833  LEU n 
2 834  GLN n 
2 835  VAL n 
2 836  GLY n 
2 837  ASP n 
2 838  LYS n 
2 839  LEU n 
2 840  ALA n 
2 841  ASN n 
2 842  ARG n 
2 843  HIS n 
2 844  GLY n 
2 845  ASN n 
2 846  LYS n 
2 847  GLY n 
2 848  VAL n 
2 849  VAL n 
2 850  ALA n 
2 851  LYS n 
2 852  ILE n 
2 853  LEU n 
2 854  PRO n 
2 855  VAL n 
2 856  GLU n 
2 857  ASP n 
2 858  MET n 
2 859  PRO n 
2 860  HIS n 
2 861  LEU n 
2 862  PRO n 
2 863  ASP n 
2 864  GLY n 
2 865  THR n 
2 866  PRO n 
2 867  VAL n 
2 868  ASP n 
2 869  VAL n 
2 870  ILE n 
2 871  LEU n 
2 872  ASN n 
2 873  PRO n 
2 874  LEU n 
2 875  GLY n 
2 876  VAL n 
2 877  PRO n 
2 878  SER n 
2 879  ARG n 
2 880  MET n 
2 881  ASN n 
2 882  LEU n 
2 883  GLY n 
2 884  GLN n 
2 885  ILE n 
2 886  LEU n 
2 887  GLU n 
2 888  THR n 
2 889  HIS n 
2 890  LEU n 
2 891  GLY n 
2 892  LEU n 
2 893  ALA n 
2 894  GLY n 
2 895  TYR n 
2 896  PHE n 
2 897  LEU n 
2 898  GLY n 
2 899  GLN n 
2 900  ARG n 
2 901  TYR n 
2 902  ILE n 
2 903  SER n 
2 904  PRO n 
2 905  ILE n 
2 906  PHE n 
2 907  ASP n 
2 908  GLY n 
2 909  ALA n 
2 910  LYS n 
2 911  GLU n 
2 912  PRO n 
2 913  GLU n 
2 914  ILE n 
2 915  LYS n 
2 916  GLU n 
2 917  LEU n 
2 918  LEU n 
2 919  ALA n 
2 920  GLN n 
2 921  ALA n 
2 922  PHE n 
2 923  GLU n 
2 924  VAL n 
2 925  TYR n 
2 926  PHE n 
2 927  GLY n 
2 928  LYS n 
2 929  ARG n 
2 930  LYS n 
2 931  GLY n 
2 932  GLU n 
2 933  GLY n 
2 934  PHE n 
2 935  GLY n 
2 936  VAL n 
2 937  ASP n 
2 938  LYS n 
2 939  ARG n 
2 940  GLU n 
2 941  VAL n 
2 942  GLU n 
2 943  VAL n 
2 944  LEU n 
2 945  ARG n 
2 946  ARG n 
2 947  ALA n 
2 948  GLU n 
2 949  LYS n 
2 950  LEU n 
2 951  GLY n 
2 952  LEU n 
2 953  VAL n 
2 954  THR n 
2 955  PRO n 
2 956  GLY n 
2 957  LYS n 
2 958  THR n 
2 959  PRO n 
2 960  GLU n 
2 961  GLU n 
2 962  GLN n 
2 963  LEU n 
2 964  LYS n 
2 965  GLU n 
2 966  LEU n 
2 967  PHE n 
2 968  LEU n 
2 969  GLN n 
2 970  GLY n 
2 971  LYS n 
2 972  VAL n 
2 973  VAL n 
2 974  LEU n 
2 975  TYR n 
2 976  ASP n 
2 977  GLY n 
2 978  ARG n 
2 979  THR n 
2 980  GLY n 
2 981  GLU n 
2 982  PRO n 
2 983  ILE n 
2 984  GLU n 
2 985  GLY n 
2 986  PRO n 
2 987  ILE n 
2 988  VAL n 
2 989  VAL n 
2 990  GLY n 
2 991  GLN n 
2 992  MET n 
2 993  PHE n 
2 994  ILE n 
2 995  MET n 
2 996  LYS n 
2 997  LEU n 
2 998  TYR n 
2 999  HIS n 
2 1000 MET n 
2 1001 VAL n 
2 1002 GLU n 
2 1003 ASP n 
2 1004 LYS n 
2 1005 MET n 
2 1006 HIS n 
2 1007 ALA n 
2 1008 ARG n 
2 1009 SER n 
2 1010 THR n 
2 1011 GLY n 
2 1012 PRO n 
2 1013 TYR n 
2 1014 SER n 
2 1015 LEU n 
2 1016 ILE n 
2 1017 THR n 
2 1018 GLN n 
2 1019 GLN n 
2 1020 PRO n 
2 1021 LEU n 
2 1022 GLY n 
2 1023 GLY n 
2 1024 LYS n 
2 1025 ALA n 
2 1026 GLN n 
2 1027 PHE n 
2 1028 GLY n 
2 1029 GLY n 
2 1030 GLN n 
2 1031 ARG n 
2 1032 PHE n 
2 1033 GLY n 
2 1034 GLU n 
2 1035 MET n 
2 1036 GLU n 
2 1037 VAL n 
2 1038 TRP n 
2 1039 ALA n 
2 1040 LEU n 
2 1041 GLU n 
2 1042 ALA n 
2 1043 TYR n 
2 1044 GLY n 
2 1045 ALA n 
2 1046 ALA n 
2 1047 HIS n 
2 1048 THR n 
2 1049 LEU n 
2 1050 GLN n 
2 1051 GLU n 
2 1052 MET n 
2 1053 LEU n 
2 1054 THR n 
2 1055 LEU n 
2 1056 LYS n 
2 1057 SER n 
2 1058 ASP n 
2 1059 ASP n 
2 1060 ILE n 
2 1061 GLU n 
2 1062 GLY n 
2 1063 ARG n 
2 1064 ASN n 
2 1065 ALA n 
2 1066 ALA n 
2 1067 TYR n 
2 1068 GLU n 
2 1069 ALA n 
2 1070 ILE n 
2 1071 ILE n 
2 1072 LYS n 
2 1073 GLY n 
2 1074 GLU n 
2 1075 ASP n 
2 1076 VAL n 
2 1077 PRO n 
2 1078 GLU n 
2 1079 PRO n 
2 1080 SER n 
2 1081 VAL n 
2 1082 PRO n 
2 1083 GLU n 
2 1084 SER n 
2 1085 PHE n 
2 1086 ARG n 
2 1087 VAL n 
2 1088 LEU n 
2 1089 VAL n 
2 1090 LYS n 
2 1091 GLU n 
2 1092 LEU n 
2 1093 GLN n 
2 1094 ALA n 
2 1095 LEU n 
2 1096 ALA n 
2 1097 LEU n 
2 1098 ASP n 
2 1099 VAL n 
2 1100 GLN n 
2 1101 THR n 
2 1102 LEU n 
2 1103 ASP n 
2 1104 GLU n 
2 1105 LYS n 
2 1106 ASP n 
2 1107 ASN n 
2 1108 PRO n 
2 1109 VAL n 
2 1110 ASP n 
2 1111 ILE n 
2 1112 PHE n 
2 1113 GLU n 
2 1114 GLY n 
2 1115 LEU n 
2 1116 ALA n 
2 1117 SER n 
2 1118 LYS n 
2 1119 ARG n 
3 1    MET n 
3 2    LYS n 
3 3    LYS n 
3 4    GLU n 
3 5    VAL n 
3 6    ARG n 
3 7    LYS n 
3 8    VAL n 
3 9    ARG n 
3 10   ILE n 
3 11   ALA n 
3 12   LEU n 
3 13   ALA n 
3 14   SER n 
3 15   PRO n 
3 16   GLU n 
3 17   LYS n 
3 18   ILE n 
3 19   ARG n 
3 20   SER n 
3 21   TRP n 
3 22   SER n 
3 23   TYR n 
3 24   GLY n 
3 25   GLU n 
3 26   VAL n 
3 27   GLU n 
3 28   LYS n 
3 29   PRO n 
3 30   GLU n 
3 31   THR n 
3 32   ILE n 
3 33   ASN n 
3 34   TYR n 
3 35   ARG n 
3 36   THR n 
3 37   LEU n 
3 38   LYS n 
3 39   PRO n 
3 40   GLU n 
3 41   ARG n 
3 42   ASP n 
3 43   GLY n 
3 44   LEU n 
3 45   PHE n 
3 46   ASP n 
3 47   GLU n 
3 48   ARG n 
3 49   ILE n 
3 50   PHE n 
3 51   GLY n 
3 52   PRO n 
3 53   ILE n 
3 54   LYS n 
3 55   ASP n 
3 56   TYR n 
3 57   GLU n 
3 58   CYS n 
3 59   ALA n 
3 60   CYS n 
3 61   GLY n 
3 62   LYS n 
3 63   TYR n 
3 64   LYS n 
3 65   ARG n 
3 66   GLN n 
3 67   ARG n 
3 68   PHE n 
3 69   GLU n 
3 70   GLY n 
3 71   LYS n 
3 72   VAL n 
3 73   CYS n 
3 74   GLU n 
3 75   ARG n 
3 76   CYS n 
3 77   GLY n 
3 78   VAL n 
3 79   GLU n 
3 80   VAL n 
3 81   THR n 
3 82   LYS n 
3 83   SER n 
3 84   ILE n 
3 85   VAL n 
3 86   ARG n 
3 87   ARG n 
3 88   TYR n 
3 89   ARG n 
3 90   MET n 
3 91   GLY n 
3 92   HIS n 
3 93   ILE n 
3 94   GLU n 
3 95   LEU n 
3 96   ALA n 
3 97   THR n 
3 98   PRO n 
3 99   ALA n 
3 100  ALA n 
3 101  HIS n 
3 102  ILE n 
3 103  TRP n 
3 104  PHE n 
3 105  VAL n 
3 106  LYS n 
3 107  ASP n 
3 108  VAL n 
3 109  PRO n 
3 110  SER n 
3 111  LYS n 
3 112  ILE n 
3 113  GLY n 
3 114  THR n 
3 115  LEU n 
3 116  LEU n 
3 117  ASP n 
3 118  LEU n 
3 119  SER n 
3 120  ALA n 
3 121  THR n 
3 122  GLU n 
3 123  LEU n 
3 124  GLU n 
3 125  GLN n 
3 126  VAL n 
3 127  LEU n 
3 128  TYR n 
3 129  PHE n 
3 130  SER n 
3 131  LYS n 
3 132  TYR n 
3 133  ILE n 
3 134  VAL n 
3 135  LEU n 
3 136  ASP n 
3 137  PRO n 
3 138  LYS n 
3 139  GLY n 
3 140  ALA n 
3 141  ILE n 
3 142  LEU n 
3 143  ASN n 
3 144  GLY n 
3 145  VAL n 
3 146  PRO n 
3 147  VAL n 
3 148  GLU n 
3 149  LYS n 
3 150  ARG n 
3 151  GLN n 
3 152  LEU n 
3 153  LEU n 
3 154  THR n 
3 155  ASP n 
3 156  GLU n 
3 157  GLU n 
3 158  TYR n 
3 159  ARG n 
3 160  GLU n 
3 161  LEU n 
3 162  ARG n 
3 163  TYR n 
3 164  GLY n 
3 165  LYS n 
3 166  GLN n 
3 167  GLU n 
3 168  THR n 
3 169  TYR n 
3 170  PRO n 
3 171  LEU n 
3 172  PRO n 
3 173  PRO n 
3 174  GLY n 
3 175  VAL n 
3 176  ASP n 
3 177  ALA n 
3 178  LEU n 
3 179  VAL n 
3 180  LYS n 
3 181  ASP n 
3 182  GLY n 
3 183  GLU n 
3 184  GLU n 
3 185  VAL n 
3 186  VAL n 
3 187  LYS n 
3 188  GLY n 
3 189  GLN n 
3 190  GLU n 
3 191  LEU n 
3 192  ALA n 
3 193  PRO n 
3 194  GLY n 
3 195  VAL n 
3 196  VAL n 
3 197  SER n 
3 198  ARG n 
3 199  LEU n 
3 200  ASP n 
3 201  GLY n 
3 202  VAL n 
3 203  ALA n 
3 204  LEU n 
3 205  TYR n 
3 206  ARG n 
3 207  PHE n 
3 208  PRO n 
3 209  ARG n 
3 210  ARG n 
3 211  VAL n 
3 212  ARG n 
3 213  VAL n 
3 214  GLU n 
3 215  TYR n 
3 216  VAL n 
3 217  LYS n 
3 218  LYS n 
3 219  GLU n 
3 220  ARG n 
3 221  ALA n 
3 222  GLY n 
3 223  LEU n 
3 224  ARG n 
3 225  LEU n 
3 226  PRO n 
3 227  LEU n 
3 228  ALA n 
3 229  ALA n 
3 230  TRP n 
3 231  VAL n 
3 232  GLU n 
3 233  LYS n 
3 234  GLU n 
3 235  ALA n 
3 236  TYR n 
3 237  LYS n 
3 238  PRO n 
3 239  GLY n 
3 240  GLU n 
3 241  ILE n 
3 242  LEU n 
3 243  ALA n 
3 244  GLU n 
3 245  LEU n 
3 246  PRO n 
3 247  GLU n 
3 248  PRO n 
3 249  TYR n 
3 250  LEU n 
3 251  PHE n 
3 252  ARG n 
3 253  ALA n 
3 254  GLU n 
3 255  GLU n 
3 256  GLU n 
3 257  GLY n 
3 258  VAL n 
3 259  VAL n 
3 260  GLU n 
3 261  LEU n 
3 262  LYS n 
3 263  GLU n 
3 264  LEU n 
3 265  GLU n 
3 266  GLU n 
3 267  GLY n 
3 268  ALA n 
3 269  PHE n 
3 270  LEU n 
3 271  VAL n 
3 272  LEU n 
3 273  ARG n 
3 274  ARG n 
3 275  GLU n 
3 276  ASP n 
3 277  GLU n 
3 278  PRO n 
3 279  VAL n 
3 280  ALA n 
3 281  THR n 
3 282  TYR n 
3 283  PHE n 
3 284  LEU n 
3 285  PRO n 
3 286  VAL n 
3 287  GLY n 
3 288  MET n 
3 289  THR n 
3 290  PRO n 
3 291  LEU n 
3 292  VAL n 
3 293  VAL n 
3 294  HIS n 
3 295  GLY n 
3 296  GLU n 
3 297  ILE n 
3 298  VAL n 
3 299  GLU n 
3 300  LYS n 
3 301  GLY n 
3 302  GLN n 
3 303  PRO n 
3 304  LEU n 
3 305  ALA n 
3 306  GLU n 
3 307  ALA n 
3 308  LYS n 
3 309  GLY n 
3 310  LEU n 
3 311  LEU n 
3 312  ARG n 
3 313  MET n 
3 314  PRO n 
3 315  ARG n 
3 316  GLN n 
3 317  VAL n 
3 318  ARG n 
3 319  ALA n 
3 320  ALA n 
3 321  GLN n 
3 322  VAL n 
3 323  GLU n 
3 324  ALA n 
3 325  GLU n 
3 326  GLU n 
3 327  GLU n 
3 328  GLY n 
3 329  GLU n 
3 330  THR n 
3 331  VAL n 
3 332  TYR n 
3 333  LEU n 
3 334  THR n 
3 335  LEU n 
3 336  PHE n 
3 337  LEU n 
3 338  GLU n 
3 339  TRP n 
3 340  THR n 
3 341  GLU n 
3 342  PRO n 
3 343  LYS n 
3 344  ASP n 
3 345  TYR n 
3 346  ARG n 
3 347  VAL n 
3 348  GLN n 
3 349  PRO n 
3 350  HIS n 
3 351  MET n 
3 352  ASN n 
3 353  VAL n 
3 354  VAL n 
3 355  VAL n 
3 356  PRO n 
3 357  GLU n 
3 358  GLY n 
3 359  ALA n 
3 360  ARG n 
3 361  VAL n 
3 362  GLU n 
3 363  ALA n 
3 364  GLY n 
3 365  ASP n 
3 366  LYS n 
3 367  ILE n 
3 368  VAL n 
3 369  ALA n 
3 370  ALA n 
3 371  ILE n 
3 372  ASP n 
3 373  PRO n 
3 374  GLU n 
3 375  GLU n 
3 376  GLU n 
3 377  VAL n 
3 378  ILE n 
3 379  ALA n 
3 380  GLU n 
3 381  ALA n 
3 382  GLU n 
3 383  GLY n 
3 384  VAL n 
3 385  VAL n 
3 386  HIS n 
3 387  LEU n 
3 388  HIS n 
3 389  GLU n 
3 390  PRO n 
3 391  ALA n 
3 392  SER n 
3 393  ILE n 
3 394  LEU n 
3 395  VAL n 
3 396  VAL n 
3 397  LYS n 
3 398  ALA n 
3 399  ARG n 
3 400  VAL n 
3 401  TYR n 
3 402  PRO n 
3 403  PHE n 
3 404  GLU n 
3 405  ASP n 
3 406  ASP n 
3 407  VAL n 
3 408  GLU n 
3 409  VAL n 
3 410  SER n 
3 411  THR n 
3 412  GLY n 
3 413  ASP n 
3 414  ARG n 
3 415  VAL n 
3 416  ALA n 
3 417  PRO n 
3 418  GLY n 
3 419  ASP n 
3 420  VAL n 
3 421  LEU n 
3 422  ALA n 
3 423  ASP n 
3 424  GLY n 
3 425  GLY n 
3 426  LYS n 
3 427  VAL n 
3 428  LYS n 
3 429  SER n 
3 430  ASP n 
3 431  VAL n 
3 432  TYR n 
3 433  GLY n 
3 434  ARG n 
3 435  VAL n 
3 436  GLU n 
3 437  VAL n 
3 438  ASP n 
3 439  LEU n 
3 440  VAL n 
3 441  ARG n 
3 442  ASN n 
3 443  VAL n 
3 444  VAL n 
3 445  ARG n 
3 446  VAL n 
3 447  VAL n 
3 448  GLU n 
3 449  SER n 
3 450  TYR n 
3 451  ASP n 
3 452  ILE n 
3 453  ASP n 
3 454  ALA n 
3 455  ARG n 
3 456  MET n 
3 457  GLY n 
3 458  ALA n 
3 459  GLU n 
3 460  ALA n 
3 461  ILE n 
3 462  GLN n 
3 463  GLN n 
3 464  LEU n 
3 465  LEU n 
3 466  LYS n 
3 467  GLU n 
3 468  LEU n 
3 469  ASP n 
3 470  LEU n 
3 471  GLU n 
3 472  ALA n 
3 473  LEU n 
3 474  GLU n 
3 475  LYS n 
3 476  GLU n 
3 477  LEU n 
3 478  LEU n 
3 479  GLU n 
3 480  GLU n 
3 481  MET n 
3 482  LYS n 
3 483  HIS n 
3 484  PRO n 
3 485  SER n 
3 486  ARG n 
3 487  ALA n 
3 488  ARG n 
3 489  ARG n 
3 490  ALA n 
3 491  LYS n 
3 492  ALA n 
3 493  ARG n 
3 494  LYS n 
3 495  ARG n 
3 496  LEU n 
3 497  GLU n 
3 498  VAL n 
3 499  VAL n 
3 500  ARG n 
3 501  ALA n 
3 502  PHE n 
3 503  LEU n 
3 504  ASP n 
3 505  SER n 
3 506  GLY n 
3 507  ASN n 
3 508  ARG n 
3 509  PRO n 
3 510  GLU n 
3 511  TRP n 
3 512  MET n 
3 513  ILE n 
3 514  LEU n 
3 515  GLU n 
3 516  ALA n 
3 517  VAL n 
3 518  PRO n 
3 519  VAL n 
3 520  LEU n 
3 521  PRO n 
3 522  PRO n 
3 523  ASP n 
3 524  LEU n 
3 525  ARG n 
3 526  PRO n 
3 527  MET n 
3 528  VAL n 
3 529  GLN n 
3 530  VAL n 
3 531  ASP n 
3 532  GLY n 
3 533  GLY n 
3 534  ARG n 
3 535  PHE n 
3 536  ALA n 
3 537  THR n 
3 538  SER n 
3 539  ASP n 
3 540  LEU n 
3 541  ASN n 
3 542  ASP n 
3 543  LEU n 
3 544  TYR n 
3 545  ARG n 
3 546  ARG n 
3 547  LEU n 
3 548  ILE n 
3 549  ASN n 
3 550  ARG n 
3 551  ASN n 
3 552  ASN n 
3 553  ARG n 
3 554  LEU n 
3 555  LYS n 
3 556  LYS n 
3 557  LEU n 
3 558  LEU n 
3 559  ALA n 
3 560  GLN n 
3 561  GLY n 
3 562  ALA n 
3 563  PRO n 
3 564  GLU n 
3 565  ILE n 
3 566  ILE n 
3 567  ILE n 
3 568  ARG n 
3 569  ASN n 
3 570  GLU n 
3 571  LYS n 
3 572  ARG n 
3 573  MET n 
3 574  LEU n 
3 575  GLN n 
3 576  GLU n 
3 577  ALA n 
3 578  VAL n 
3 579  ASP n 
3 580  ALA n 
3 581  LEU n 
3 582  LEU n 
3 583  ASP n 
3 584  ASN n 
3 585  GLY n 
3 586  ARG n 
3 587  ARG n 
3 588  GLY n 
3 589  ALA n 
3 590  PRO n 
3 591  VAL n 
3 592  THR n 
3 593  ASN n 
3 594  PRO n 
3 595  GLY n 
3 596  SER n 
3 597  ASP n 
3 598  ARG n 
3 599  PRO n 
3 600  LEU n 
3 601  ARG n 
3 602  SER n 
3 603  LEU n 
3 604  THR n 
3 605  ASP n 
3 606  ILE n 
3 607  LEU n 
3 608  SER n 
3 609  GLY n 
3 610  LYS n 
3 611  GLN n 
3 612  GLY n 
3 613  ARG n 
3 614  PHE n 
3 615  ARG n 
3 616  GLN n 
3 617  ASN n 
3 618  LEU n 
3 619  LEU n 
3 620  GLY n 
3 621  LYS n 
3 622  ARG n 
3 623  VAL n 
3 624  ASP n 
3 625  TYR n 
3 626  SER n 
3 627  GLY n 
3 628  ARG n 
3 629  SER n 
3 630  VAL n 
3 631  ILE n 
3 632  VAL n 
3 633  VAL n 
3 634  GLY n 
3 635  PRO n 
3 636  GLN n 
3 637  LEU n 
3 638  LYS n 
3 639  LEU n 
3 640  HIS n 
3 641  GLN n 
3 642  CYS n 
3 643  GLY n 
3 644  LEU n 
3 645  PRO n 
3 646  LYS n 
3 647  ARG n 
3 648  MET n 
3 649  ALA n 
3 650  LEU n 
3 651  GLU n 
3 652  LEU n 
3 653  PHE n 
3 654  LYS n 
3 655  PRO n 
3 656  PHE n 
3 657  LEU n 
3 658  LEU n 
3 659  LYS n 
3 660  LYS n 
3 661  MET n 
3 662  GLU n 
3 663  GLU n 
3 664  LYS n 
3 665  GLY n 
3 666  ILE n 
3 667  ALA n 
3 668  PRO n 
3 669  ASN n 
3 670  VAL n 
3 671  LYS n 
3 672  ALA n 
3 673  ALA n 
3 674  ARG n 
3 675  ARG n 
3 676  MET n 
3 677  LEU n 
3 678  GLU n 
3 679  ARG n 
3 680  GLN n 
3 681  ARG n 
3 682  ASP n 
3 683  ILE n 
3 684  LYS n 
3 685  ASP n 
3 686  GLU n 
3 687  VAL n 
3 688  TRP n 
3 689  ASP n 
3 690  ALA n 
3 691  LEU n 
3 692  GLU n 
3 693  GLU n 
3 694  VAL n 
3 695  ILE n 
3 696  HIS n 
3 697  GLY n 
3 698  LYS n 
3 699  VAL n 
3 700  VAL n 
3 701  LEU n 
3 702  LEU n 
3 703  ASN n 
3 704  ARG n 
3 705  ALA n 
3 706  PRO n 
3 707  THR n 
3 708  LEU n 
3 709  HIS n 
3 710  ARG n 
3 711  LEU n 
3 712  GLY n 
3 713  ILE n 
3 714  GLN n 
3 715  ALA n 
3 716  PHE n 
3 717  GLN n 
3 718  PRO n 
3 719  VAL n 
3 720  LEU n 
3 721  VAL n 
3 722  GLU n 
3 723  GLY n 
3 724  GLN n 
3 725  SER n 
3 726  ILE n 
3 727  GLN n 
3 728  LEU n 
3 729  HIS n 
3 730  PRO n 
3 731  LEU n 
3 732  VAL n 
3 733  CYS n 
3 734  GLU n 
3 735  ALA n 
3 736  PHE n 
3 737  ASN n 
3 738  ALA n 
3 739  ASP n 
3 740  PHE n 
3 741  ASP n 
3 742  GLY n 
3 743  ASP n 
3 744  GLN n 
3 745  MET n 
3 746  ALA n 
3 747  VAL n 
3 748  HIS n 
3 749  VAL n 
3 750  PRO n 
3 751  LEU n 
3 752  SER n 
3 753  SER n 
3 754  PHE n 
3 755  ALA n 
3 756  GLN n 
3 757  ALA n 
3 758  GLU n 
3 759  ALA n 
3 760  ARG n 
3 761  ILE n 
3 762  GLN n 
3 763  MET n 
3 764  LEU n 
3 765  SER n 
3 766  ALA n 
3 767  HIS n 
3 768  ASN n 
3 769  LEU n 
3 770  LEU n 
3 771  SER n 
3 772  PRO n 
3 773  ALA n 
3 774  SER n 
3 775  GLY n 
3 776  GLU n 
3 777  PRO n 
3 778  LEU n 
3 779  ALA n 
3 780  LYS n 
3 781  PRO n 
3 782  SER n 
3 783  ARG n 
3 784  ASP n 
3 785  ILE n 
3 786  ILE n 
3 787  LEU n 
3 788  GLY n 
3 789  LEU n 
3 790  TYR n 
3 791  TYR n 
3 792  ILE n 
3 793  THR n 
3 794  GLN n 
3 795  VAL n 
3 796  ARG n 
3 797  LYS n 
3 798  GLU n 
3 799  LYS n 
3 800  LYS n 
3 801  GLY n 
3 802  ALA n 
3 803  GLY n 
3 804  LEU n 
3 805  GLU n 
3 806  PHE n 
3 807  ALA n 
3 808  THR n 
3 809  PRO n 
3 810  GLU n 
3 811  GLU n 
3 812  ALA n 
3 813  LEU n 
3 814  ALA n 
3 815  ALA n 
3 816  HIS n 
3 817  GLU n 
3 818  ARG n 
3 819  GLY n 
3 820  GLU n 
3 821  VAL n 
3 822  ALA n 
3 823  LEU n 
3 824  ASN n 
3 825  ALA n 
3 826  PRO n 
3 827  ILE n 
3 828  LYS n 
3 829  VAL n 
3 830  ALA n 
3 831  GLY n 
3 832  ARG n 
3 833  GLU n 
3 834  THR n 
3 835  SER n 
3 836  VAL n 
3 837  GLY n 
3 838  ARG n 
3 839  LEU n 
3 840  LYS n 
3 841  TYR n 
3 842  VAL n 
3 843  PHE n 
3 844  ALA n 
3 845  ASN n 
3 846  PRO n 
3 847  ASP n 
3 848  GLU n 
3 849  ALA n 
3 850  LEU n 
3 851  LEU n 
3 852  ALA n 
3 853  VAL n 
3 854  ALA n 
3 855  HIS n 
3 856  GLY n 
3 857  ILE n 
3 858  VAL n 
3 859  ASP n 
3 860  LEU n 
3 861  GLN n 
3 862  ASP n 
3 863  VAL n 
3 864  VAL n 
3 865  THR n 
3 866  VAL n 
3 867  ARG n 
3 868  TYR n 
3 869  MET n 
3 870  GLY n 
3 871  LYS n 
3 872  ARG n 
3 873  LEU n 
3 874  GLU n 
3 875  THR n 
3 876  SER n 
3 877  PRO n 
3 878  GLY n 
3 879  ARG n 
3 880  ILE n 
3 881  LEU n 
3 882  PHE n 
3 883  ALA n 
3 884  ARG n 
3 885  ILE n 
3 886  VAL n 
3 887  ALA n 
3 888  GLU n 
3 889  ALA n 
3 890  VAL n 
3 891  GLU n 
3 892  ASP n 
3 893  GLU n 
3 894  LYS n 
3 895  VAL n 
3 896  ALA n 
3 897  TRP n 
3 898  GLU n 
3 899  LEU n 
3 900  ILE n 
3 901  GLN n 
3 902  LEU n 
3 903  ASP n 
3 904  VAL n 
3 905  PRO n 
3 906  GLN n 
3 907  GLU n 
3 908  LYS n 
3 909  ASN n 
3 910  SER n 
3 911  LEU n 
3 912  LYS n 
3 913  ASP n 
3 914  LEU n 
3 915  VAL n 
3 916  TYR n 
3 917  GLN n 
3 918  ALA n 
3 919  PHE n 
3 920  LEU n 
3 921  ARG n 
3 922  LEU n 
3 923  GLY n 
3 924  MET n 
3 925  GLU n 
3 926  LYS n 
3 927  THR n 
3 928  ALA n 
3 929  ARG n 
3 930  LEU n 
3 931  LEU n 
3 932  ASP n 
3 933  ALA n 
3 934  LEU n 
3 935  LYS n 
3 936  TYR n 
3 937  TYR n 
3 938  GLY n 
3 939  PHE n 
3 940  THR n 
3 941  PHE n 
3 942  SER n 
3 943  THR n 
3 944  THR n 
3 945  SER n 
3 946  GLY n 
3 947  ILE n 
3 948  THR n 
3 949  ILE n 
3 950  GLY n 
3 951  ILE n 
3 952  ASP n 
3 953  ASP n 
3 954  ALA n 
3 955  VAL n 
3 956  ILE n 
3 957  PRO n 
3 958  GLU n 
3 959  GLU n 
3 960  LYS n 
3 961  LYS n 
3 962  GLN n 
3 963  TYR n 
3 964  LEU n 
3 965  GLU n 
3 966  GLU n 
3 967  ALA n 
3 968  ASP n 
3 969  ARG n 
3 970  LYS n 
3 971  LEU n 
3 972  LEU n 
3 973  GLN n 
3 974  ILE n 
3 975  GLU n 
3 976  GLN n 
3 977  ALA n 
3 978  TYR n 
3 979  GLU n 
3 980  MET n 
3 981  GLY n 
3 982  PHE n 
3 983  LEU n 
3 984  THR n 
3 985  ASP n 
3 986  ARG n 
3 987  GLU n 
3 988  ARG n 
3 989  TYR n 
3 990  ASP n 
3 991  GLN n 
3 992  ILE n 
3 993  LEU n 
3 994  GLN n 
3 995  LEU n 
3 996  TRP n 
3 997  THR n 
3 998  GLU n 
3 999  THR n 
3 1000 THR n 
3 1001 GLU n 
3 1002 LYS n 
3 1003 VAL n 
3 1004 THR n 
3 1005 GLN n 
3 1006 ALA n 
3 1007 VAL n 
3 1008 PHE n 
3 1009 LYS n 
3 1010 ASN n 
3 1011 PHE n 
3 1012 GLU n 
3 1013 GLU n 
3 1014 ASN n 
3 1015 TYR n 
3 1016 PRO n 
3 1017 PHE n 
3 1018 ASN n 
3 1019 PRO n 
3 1020 LEU n 
3 1021 TYR n 
3 1022 VAL n 
3 1023 MET n 
3 1024 ALA n 
3 1025 GLN n 
3 1026 SER n 
3 1027 GLY n 
3 1028 ALA n 
3 1029 ARG n 
3 1030 GLY n 
3 1031 ASN n 
3 1032 PRO n 
3 1033 GLN n 
3 1034 GLN n 
3 1035 ILE n 
3 1036 ARG n 
3 1037 GLN n 
3 1038 LEU n 
3 1039 CYS n 
3 1040 GLY n 
3 1041 LEU n 
3 1042 ARG n 
3 1043 GLY n 
3 1044 LEU n 
3 1045 MET n 
3 1046 GLN n 
3 1047 LYS n 
3 1048 PRO n 
3 1049 SER n 
3 1050 GLY n 
3 1051 GLU n 
3 1052 THR n 
3 1053 PHE n 
3 1054 GLU n 
3 1055 VAL n 
3 1056 PRO n 
3 1057 VAL n 
3 1058 ARG n 
3 1059 SER n 
3 1060 SER n 
3 1061 PHE n 
3 1062 ARG n 
3 1063 GLU n 
3 1064 GLY n 
3 1065 LEU n 
3 1066 THR n 
3 1067 VAL n 
3 1068 LEU n 
3 1069 GLU n 
3 1070 TYR n 
3 1071 PHE n 
3 1072 ILE n 
3 1073 SER n 
3 1074 SER n 
3 1075 HIS n 
3 1076 GLY n 
3 1077 ALA n 
3 1078 ARG n 
3 1079 LYS n 
3 1080 GLY n 
3 1081 GLY n 
3 1082 ALA n 
3 1083 ASP n 
3 1084 THR n 
3 1085 ALA n 
3 1086 LEU n 
3 1087 ARG n 
3 1088 THR n 
3 1089 ALA n 
3 1090 ASP n 
3 1091 SER n 
3 1092 GLY n 
3 1093 TYR n 
3 1094 LEU n 
3 1095 THR n 
3 1096 ARG n 
3 1097 LYS n 
3 1098 LEU n 
3 1099 VAL n 
3 1100 ASP n 
3 1101 VAL n 
3 1102 THR n 
3 1103 HIS n 
3 1104 GLU n 
3 1105 ILE n 
3 1106 VAL n 
3 1107 VAL n 
3 1108 ARG n 
3 1109 GLU n 
3 1110 ALA n 
3 1111 ASP n 
3 1112 CYS n 
3 1113 GLY n 
3 1114 THR n 
3 1115 THR n 
3 1116 ASN n 
3 1117 TYR n 
3 1118 ILE n 
3 1119 SER n 
3 1120 VAL n 
3 1121 PRO n 
3 1122 LEU n 
3 1123 PHE n 
3 1124 GLN n 
3 1125 PRO n 
3 1126 ASP n 
3 1127 GLU n 
3 1128 VAL n 
3 1129 THR n 
3 1130 ARG n 
3 1131 SER n 
3 1132 LEU n 
3 1133 ARG n 
3 1134 LEU n 
3 1135 ARG n 
3 1136 LYS n 
3 1137 ARG n 
3 1138 ALA n 
3 1139 ASP n 
3 1140 ILE n 
3 1141 GLU n 
3 1142 ALA n 
3 1143 GLY n 
3 1144 LEU n 
3 1145 TYR n 
3 1146 GLY n 
3 1147 ARG n 
3 1148 VAL n 
3 1149 LEU n 
3 1150 ALA n 
3 1151 ARG n 
3 1152 GLU n 
3 1153 VAL n 
3 1154 GLU n 
3 1155 VAL n 
3 1156 LEU n 
3 1157 GLY n 
3 1158 VAL n 
3 1159 ARG n 
3 1160 LEU n 
3 1161 GLU n 
3 1162 GLU n 
3 1163 GLY n 
3 1164 ARG n 
3 1165 TYR n 
3 1166 LEU n 
3 1167 SER n 
3 1168 MET n 
3 1169 ASP n 
3 1170 ASP n 
3 1171 VAL n 
3 1172 HIS n 
3 1173 LEU n 
3 1174 LEU n 
3 1175 ILE n 
3 1176 LYS n 
3 1177 ALA n 
3 1178 ALA n 
3 1179 GLU n 
3 1180 ALA n 
3 1181 GLY n 
3 1182 GLU n 
3 1183 ILE n 
3 1184 GLN n 
3 1185 GLU n 
3 1186 VAL n 
3 1187 PRO n 
3 1188 VAL n 
3 1189 ARG n 
3 1190 SER n 
3 1191 PRO n 
3 1192 LEU n 
3 1193 THR n 
3 1194 CYS n 
3 1195 GLN n 
3 1196 THR n 
3 1197 ARG n 
3 1198 TYR n 
3 1199 GLY n 
3 1200 VAL n 
3 1201 CYS n 
3 1202 GLN n 
3 1203 LYS n 
3 1204 CYS n 
3 1205 TYR n 
3 1206 GLY n 
3 1207 TYR n 
3 1208 ASP n 
3 1209 LEU n 
3 1210 SER n 
3 1211 MET n 
3 1212 ALA n 
3 1213 ARG n 
3 1214 PRO n 
3 1215 VAL n 
3 1216 SER n 
3 1217 ILE n 
3 1218 GLY n 
3 1219 GLU n 
3 1220 ALA n 
3 1221 VAL n 
3 1222 GLY n 
3 1223 ILE n 
3 1224 VAL n 
3 1225 ALA n 
3 1226 ALA n 
3 1227 GLN n 
3 1228 SER n 
3 1229 ILE n 
3 1230 GLY n 
3 1231 GLU n 
3 1232 PRO n 
3 1233 GLY n 
3 1234 THR n 
3 1235 GLN n 
3 1236 LEU n 
3 1237 THR n 
3 1238 MET n 
3 1239 ARG n 
3 1240 THR n 
3 1241 PHE n 
3 1242 HIS n 
3 1243 THR n 
3 1244 GLY n 
3 1245 GLY n 
3 1246 VAL n 
3 1247 ALA n 
3 1248 GLY n 
3 1249 ALA n 
3 1250 ALA n 
3 1251 ASP n 
3 1252 ILE n 
3 1253 THR n 
3 1254 GLN n 
3 1255 GLY n 
3 1256 LEU n 
3 1257 PRO n 
3 1258 ARG n 
3 1259 VAL n 
3 1260 ILE n 
3 1261 GLU n 
3 1262 LEU n 
3 1263 PHE n 
3 1264 GLU n 
3 1265 ALA n 
3 1266 ARG n 
3 1267 ARG n 
3 1268 PRO n 
3 1269 LYS n 
3 1270 ALA n 
3 1271 LYS n 
3 1272 ALA n 
3 1273 VAL n 
3 1274 ILE n 
3 1275 SER n 
3 1276 GLU n 
3 1277 ILE n 
3 1278 ASP n 
3 1279 GLY n 
3 1280 VAL n 
3 1281 VAL n 
3 1282 ARG n 
3 1283 ILE n 
3 1284 GLU n 
3 1285 GLU n 
3 1286 THR n 
3 1287 GLU n 
3 1288 GLU n 
3 1289 LYS n 
3 1290 LEU n 
3 1291 SER n 
3 1292 VAL n 
3 1293 PHE n 
3 1294 VAL n 
3 1295 GLU n 
3 1296 SER n 
3 1297 GLU n 
3 1298 GLY n 
3 1299 PHE n 
3 1300 SER n 
3 1301 LYS n 
3 1302 GLU n 
3 1303 TYR n 
3 1304 LYS n 
3 1305 LEU n 
3 1306 PRO n 
3 1307 LYS n 
3 1308 GLU n 
3 1309 ALA n 
3 1310 ARG n 
3 1311 LEU n 
3 1312 LEU n 
3 1313 VAL n 
3 1314 LYS n 
3 1315 ASP n 
3 1316 GLY n 
3 1317 ASP n 
3 1318 TYR n 
3 1319 VAL n 
3 1320 GLU n 
3 1321 ALA n 
3 1322 GLY n 
3 1323 GLN n 
3 1324 PRO n 
3 1325 LEU n 
3 1326 THR n 
3 1327 ARG n 
3 1328 GLY n 
3 1329 ALA n 
3 1330 ILE n 
3 1331 ASP n 
3 1332 PRO n 
3 1333 HIS n 
3 1334 GLN n 
3 1335 LEU n 
3 1336 LEU n 
3 1337 GLU n 
3 1338 ALA n 
3 1339 LYS n 
3 1340 GLY n 
3 1341 PRO n 
3 1342 GLU n 
3 1343 ALA n 
3 1344 VAL n 
3 1345 GLU n 
3 1346 ARG n 
3 1347 TYR n 
3 1348 LEU n 
3 1349 VAL n 
3 1350 GLU n 
3 1351 GLU n 
3 1352 ILE n 
3 1353 GLN n 
3 1354 LYS n 
3 1355 VAL n 
3 1356 TYR n 
3 1357 ARG n 
3 1358 ALA n 
3 1359 GLN n 
3 1360 GLY n 
3 1361 VAL n 
3 1362 LYS n 
3 1363 LEU n 
3 1364 HIS n 
3 1365 ASP n 
3 1366 LYS n 
3 1367 HIS n 
3 1368 ILE n 
3 1369 GLU n 
3 1370 ILE n 
3 1371 VAL n 
3 1372 VAL n 
3 1373 ARG n 
3 1374 GLN n 
3 1375 MET n 
3 1376 MET n 
3 1377 LYS n 
3 1378 TYR n 
3 1379 VAL n 
3 1380 GLU n 
3 1381 VAL n 
3 1382 THR n 
3 1383 ASP n 
3 1384 PRO n 
3 1385 GLY n 
3 1386 ASP n 
3 1387 SER n 
3 1388 ARG n 
3 1389 LEU n 
3 1390 LEU n 
3 1391 GLU n 
3 1392 GLY n 
3 1393 GLN n 
3 1394 VAL n 
3 1395 LEU n 
3 1396 GLU n 
3 1397 LYS n 
3 1398 TRP n 
3 1399 ASP n 
3 1400 VAL n 
3 1401 GLU n 
3 1402 ALA n 
3 1403 LEU n 
3 1404 ASN n 
3 1405 GLU n 
3 1406 ARG n 
3 1407 LEU n 
3 1408 ILE n 
3 1409 ALA n 
3 1410 GLU n 
3 1411 GLY n 
3 1412 LYS n 
3 1413 THR n 
3 1414 PRO n 
3 1415 VAL n 
3 1416 ALA n 
3 1417 TRP n 
3 1418 LYS n 
3 1419 PRO n 
3 1420 LEU n 
3 1421 LEU n 
3 1422 MET n 
3 1423 GLY n 
3 1424 VAL n 
3 1425 THR n 
3 1426 LYS n 
3 1427 SER n 
3 1428 ALA n 
3 1429 LEU n 
3 1430 SER n 
3 1431 THR n 
3 1432 LYS n 
3 1433 SER n 
3 1434 TRP n 
3 1435 LEU n 
3 1436 SER n 
3 1437 ALA n 
3 1438 ALA n 
3 1439 SER n 
3 1440 PHE n 
3 1441 GLN n 
3 1442 ASN n 
3 1443 THR n 
3 1444 THR n 
3 1445 HIS n 
3 1446 VAL n 
3 1447 LEU n 
3 1448 THR n 
3 1449 GLU n 
3 1450 ALA n 
3 1451 ALA n 
3 1452 ILE n 
3 1453 ALA n 
3 1454 GLY n 
3 1455 LYS n 
3 1456 LYS n 
3 1457 ASP n 
3 1458 GLU n 
3 1459 LEU n 
3 1460 ILE n 
3 1461 GLY n 
3 1462 LEU n 
3 1463 LYS n 
3 1464 GLU n 
3 1465 ASN n 
3 1466 VAL n 
3 1467 ILE n 
3 1468 LEU n 
3 1469 GLY n 
3 1470 ARG n 
3 1471 LEU n 
3 1472 ILE n 
3 1473 PRO n 
3 1474 ALA n 
3 1475 GLY n 
3 1476 THR n 
3 1477 GLY n 
3 1478 SER n 
3 1479 ASP n 
3 1480 PHE n 
3 1481 VAL n 
3 1482 ARG n 
3 1483 PHE n 
3 1484 THR n 
3 1485 GLN n 
3 1486 VAL n 
3 1487 VAL n 
3 1488 ASP n 
3 1489 GLN n 
3 1490 LYS n 
3 1491 THR n 
3 1492 LEU n 
3 1493 LYS n 
3 1494 ALA n 
3 1495 ILE n 
3 1496 GLU n 
3 1497 GLU n 
3 1498 ALA n 
3 1499 ARG n 
3 1500 LYS n 
3 1501 GLU n 
3 1502 ALA n 
3 1503 VAL n 
3 1504 GLU n 
3 1505 ALA n 
3 1506 LYS n 
3 1507 GLU n 
3 1508 ARG n 
3 1509 PRO n 
3 1510 ALA n 
3 1511 ALA n 
3 1512 ARG n 
3 1513 ARG n 
3 1514 GLY n 
3 1515 VAL n 
3 1516 LYS n 
3 1517 ARG n 
3 1518 GLU n 
3 1519 GLN n 
3 1520 PRO n 
3 1521 GLY n 
3 1522 LYS n 
3 1523 GLN n 
3 1524 ALA n 
4 1    MET n 
4 2    ALA n 
4 3    GLU n 
4 4    PRO n 
4 5    GLY n 
4 6    ILE n 
4 7    ASP n 
4 8    LYS n 
4 9    LEU n 
4 10   PHE n 
4 11   GLY n 
4 12   MET n 
4 13   VAL n 
4 14   ASP n 
4 15   SER n 
4 16   LYS n 
4 17   TYR n 
4 18   ARG n 
4 19   LEU n 
4 20   THR n 
4 21   VAL n 
4 22   VAL n 
4 23   VAL n 
4 24   ALA n 
4 25   LYS n 
4 26   ARG n 
4 27   ALA n 
4 28   GLN n 
4 29   GLN n 
4 30   LEU n 
4 31   LEU n 
4 32   ARG n 
4 33   HIS n 
4 34   GLY n 
4 35   PHE n 
4 36   LYS n 
4 37   ASN n 
4 38   THR n 
4 39   VAL n 
4 40   LEU n 
4 41   GLU n 
4 42   PRO n 
4 43   GLU n 
4 44   GLU n 
4 45   ARG n 
4 46   PRO n 
4 47   LYS n 
4 48   MET n 
4 49   GLN n 
4 50   THR n 
4 51   LEU n 
4 52   GLU n 
4 53   GLY n 
4 54   LEU n 
4 55   PHE n 
4 56   ASP n 
4 57   ASP n 
4 58   PRO n 
4 59   ASN n 
4 60   ALA n 
4 61   VAL n 
4 62   THR n 
4 63   TRP n 
4 64   ALA n 
4 65   MET n 
4 66   LYS n 
4 67   GLU n 
4 68   LEU n 
4 69   LEU n 
4 70   THR n 
4 71   GLY n 
4 72   ARG n 
4 73   LEU n 
4 74   VAL n 
4 75   PHE n 
4 76   GLY n 
4 77   GLU n 
4 78   ASN n 
4 79   LEU n 
4 80   VAL n 
4 81   PRO n 
4 82   GLU n 
4 83   ASP n 
4 84   ARG n 
4 85   LEU n 
4 86   GLN n 
4 87   LYS n 
4 88   GLU n 
4 89   MET n 
4 90   GLU n 
4 91   ARG n 
4 92   LEU n 
4 93   TYR n 
4 94   PRO n 
4 95   VAL n 
4 96   GLU n 
4 97   ARG n 
4 98   GLU n 
4 99   GLU n 
5 1    MET n 
5 2    GLY n 
5 3    SER n 
5 4    SER n 
5 5    HIS n 
5 6    HIS n 
5 7    HIS n 
5 8    HIS n 
5 9    HIS n 
5 10   HIS n 
5 11   SER n 
5 12   SER n 
5 13   GLY n 
5 14   LEU n 
5 15   VAL n 
5 16   PRO n 
5 17   ARG n 
5 18   GLY n 
5 19   SER n 
5 20   HIS n 
5 21   MET n 
5 22   LYS n 
5 23   LYS n 
5 24   SER n 
5 25   LYS n 
5 26   ARG n 
5 27   LYS n 
5 28   ASN n 
5 29   ALA n 
5 30   GLN n 
5 31   ALA n 
5 32   GLN n 
5 33   GLU n 
5 34   ALA n 
5 35   GLN n 
5 36   GLU n 
5 37   THR n 
5 38   GLU n 
5 39   VAL n 
5 40   LEU n 
5 41   VAL n 
5 42   GLN n 
5 43   GLU n 
5 44   GLU n 
5 45   ALA n 
5 46   GLU n 
5 47   GLU n 
5 48   LEU n 
5 49   PRO n 
5 50   GLU n 
5 51   PHE n 
5 52   PRO n 
5 53   GLU n 
5 54   GLY n 
5 55   GLU n 
5 56   PRO n 
5 57   ASP n 
5 58   PRO n 
5 59   ASP n 
5 60   LEU n 
5 61   GLU n 
5 62   ASP n 
5 63   PRO n 
5 64   ASP n 
5 65   LEU n 
5 66   THR n 
5 67   LEU n 
5 68   GLU n 
5 69   ASP n 
5 70   ASP n 
5 71   LEU n 
5 72   LEU n 
5 73   ASP n 
5 74   LEU n 
5 75   PRO n 
5 76   GLU n 
5 77   GLU n 
5 78   GLY n 
5 79   GLU n 
5 80   GLY n 
5 81   LEU n 
5 82   ASP n 
5 83   LEU n 
5 84   GLU n 
5 85   GLU n 
5 86   GLU n 
5 87   GLU n 
5 88   GLU n 
5 89   ASP n 
5 90   LEU n 
5 91   PRO n 
5 92   ILE n 
5 93   PRO n 
5 94   LYS n 
5 95   ILE n 
5 96   SER n 
5 97   THR n 
5 98   SER n 
5 99   ASP n 
5 100  PRO n 
5 101  VAL n 
5 102  ARG n 
5 103  GLN n 
5 104  TYR n 
5 105  LEU n 
5 106  HIS n 
5 107  GLU n 
5 108  ILE n 
5 109  GLY n 
5 110  GLN n 
5 111  VAL n 
5 112  PRO n 
5 113  LEU n 
5 114  LEU n 
5 115  THR n 
5 116  LEU n 
5 117  GLU n 
5 118  GLU n 
5 119  GLU n 
5 120  VAL n 
5 121  GLU n 
5 122  LEU n 
5 123  ALA n 
5 124  ARG n 
5 125  LYS n 
5 126  VAL n 
5 127  GLU n 
5 128  GLU n 
5 129  GLY n 
5 130  MET n 
5 131  GLU n 
5 132  ALA n 
5 133  ILE n 
5 134  LYS n 
5 135  LYS n 
5 136  LEU n 
5 137  SER n 
5 138  GLU n 
5 139  ILE n 
5 140  THR n 
5 141  GLY n 
5 142  LEU n 
5 143  ASP n 
5 144  PRO n 
5 145  ASP n 
5 146  LEU n 
5 147  ILE n 
5 148  ARG n 
5 149  GLU n 
5 150  VAL n 
5 151  VAL n 
5 152  ARG n 
5 153  ALA n 
5 154  LYS n 
5 155  ILE n 
5 156  LEU n 
5 157  GLY n 
5 158  SER n 
5 159  ALA n 
5 160  ARG n 
5 161  VAL n 
5 162  ARG n 
5 163  HIS n 
5 164  ILE n 
5 165  PRO n 
5 166  GLY n 
5 167  LEU n 
5 168  LYS n 
5 169  GLU n 
5 170  THR n 
5 171  LEU n 
5 172  ASP n 
5 173  PRO n 
5 174  LYS n 
5 175  THR n 
5 176  VAL n 
5 177  GLU n 
5 178  GLU n 
5 179  ILE n 
5 180  ASP n 
5 181  GLN n 
5 182  LYS n 
5 183  LEU n 
5 184  LYS n 
5 185  SER n 
5 186  LEU n 
5 187  PRO n 
5 188  LYS n 
5 189  GLU n 
5 190  HIS n 
5 191  LYS n 
5 192  ARG n 
5 193  TYR n 
5 194  LEU n 
5 195  HIS n 
5 196  ILE n 
5 197  ALA n 
5 198  ARG n 
5 199  GLU n 
5 200  GLY n 
5 201  GLU n 
5 202  ALA n 
5 203  ALA n 
5 204  ARG n 
5 205  GLN n 
5 206  HIS n 
5 207  LEU n 
5 208  ILE n 
5 209  GLU n 
5 210  ALA n 
5 211  ASN n 
5 212  LEU n 
5 213  ARG n 
5 214  LEU n 
5 215  VAL n 
5 216  VAL n 
5 217  SER n 
5 218  ILE n 
5 219  ALA n 
5 220  LYS n 
5 221  LYS n 
5 222  TYR n 
5 223  THR n 
5 224  GLY n 
5 225  ARG n 
5 226  GLY n 
5 227  LEU n 
5 228  SER n 
5 229  PHE n 
5 230  LEU n 
5 231  ASP n 
5 232  LEU n 
5 233  ILE n 
5 234  GLN n 
5 235  GLU n 
5 236  GLY n 
5 237  ASN n 
5 238  GLN n 
5 239  GLY n 
5 240  LEU n 
5 241  ILE n 
5 242  ARG n 
5 243  ALA n 
5 244  VAL n 
5 245  GLU n 
5 246  LYS n 
5 247  PHE n 
5 248  GLU n 
5 249  TYR n 
5 250  LYS n 
5 251  ARG n 
5 252  ARG n 
5 253  PHE n 
5 254  LYS n 
5 255  PHE n 
5 256  SER n 
5 257  THR n 
5 258  TYR n 
5 259  ALA n 
5 260  THR n 
5 261  TRP n 
5 262  TRP n 
5 263  ILE n 
5 264  ARG n 
5 265  GLN n 
5 266  ALA n 
5 267  ILE n 
5 268  ASN n 
5 269  ARG n 
5 270  ALA n 
5 271  ILE n 
5 272  ALA n 
5 273  ASP n 
5 274  GLN n 
5 275  ALA n 
5 276  ARG n 
5 277  THR n 
5 278  ILE n 
5 279  ARG n 
5 280  ILE n 
5 281  PRO n 
5 282  VAL n 
5 283  HIS n 
5 284  MET n 
5 285  VAL n 
5 286  GLU n 
5 287  THR n 
5 288  ILE n 
5 289  ASN n 
5 290  LYS n 
5 291  LEU n 
5 292  SER n 
5 293  ARG n 
5 294  THR n 
5 295  ALA n 
5 296  ARG n 
5 297  GLN n 
5 298  LEU n 
5 299  GLN n 
5 300  GLN n 
5 301  GLU n 
5 302  LEU n 
5 303  GLY n 
5 304  ARG n 
5 305  GLU n 
5 306  PRO n 
5 307  THR n 
5 308  TYR n 
5 309  GLU n 
5 310  GLU n 
5 311  ILE n 
5 312  ALA n 
5 313  GLU n 
5 314  ALA n 
5 315  MET n 
5 316  GLY n 
5 317  PRO n 
5 318  GLY n 
5 319  TRP n 
5 320  ASP n 
5 321  ALA n 
5 322  LYS n 
5 323  ARG n 
5 324  VAL n 
5 325  GLU n 
5 326  GLU n 
5 327  THR n 
5 328  LEU n 
5 329  LYS n 
5 330  ILE n 
5 331  ALA n 
5 332  GLN n 
5 333  GLU n 
5 334  PRO n 
5 335  VAL n 
5 336  SER n 
5 337  LEU n 
5 338  GLU n 
5 339  THR n 
5 340  PRO n 
5 341  ILE n 
5 342  GLY n 
5 343  ASP n 
5 344  GLU n 
5 345  LYS n 
5 346  ASP n 
5 347  SER n 
5 348  PHE n 
5 349  TYR n 
5 350  GLY n 
5 351  ASP n 
5 352  PHE n 
5 353  ILE n 
5 354  PRO n 
5 355  ASP n 
5 356  GLU n 
5 357  HIS n 
5 358  LEU n 
5 359  PRO n 
5 360  SER n 
5 361  PRO n 
5 362  VAL n 
5 363  ASP n 
5 364  ALA n 
5 365  ALA n 
5 366  THR n 
5 367  GLN n 
5 368  SER n 
5 369  LEU n 
5 370  LEU n 
5 371  SER n 
5 372  GLU n 
5 373  GLU n 
5 374  LEU n 
5 375  GLU n 
5 376  LYS n 
5 377  ALA n 
5 378  LEU n 
5 379  SER n 
5 380  LYS n 
5 381  LEU n 
5 382  SER n 
5 383  GLU n 
5 384  ARG n 
5 385  GLU n 
5 386  ALA n 
5 387  MET n 
5 388  VAL n 
5 389  LEU n 
5 390  LYS n 
5 391  LEU n 
5 392  ARG n 
5 393  LYS n 
5 394  GLY n 
5 395  LEU n 
5 396  ILE n 
5 397  ASP n 
5 398  GLY n 
5 399  ARG n 
5 400  GLU n 
5 401  HIS n 
5 402  THR n 
5 403  LEU n 
5 404  GLU n 
5 405  GLU n 
5 406  VAL n 
5 407  GLY n 
5 408  ALA n 
5 409  PHE n 
5 410  PHE n 
5 411  GLY n 
5 412  VAL n 
5 413  THR n 
5 414  ARG n 
5 415  GLU n 
5 416  ARG n 
5 417  ILE n 
5 418  ARG n 
5 419  GLN n 
5 420  ILE n 
5 421  GLU n 
5 422  ASN n 
5 423  LYS n 
5 424  ALA n 
5 425  LEU n 
5 426  ARG n 
5 427  LYS n 
5 428  LEU n 
5 429  LYS n 
5 430  TYR n 
5 431  HIS n 
5 432  GLU n 
5 433  SER n 
5 434  ARG n 
5 435  THR n 
5 436  ARG n 
5 437  LYS n 
5 438  LEU n 
5 439  ARG n 
5 440  ASP n 
5 441  PHE n 
5 442  LEU n 
5 443  ASP n 
6 1    DC  n 
6 2    DC  n 
6 3    DT  n 
6 4    DG  n 
6 5    DC  n 
6 6    DA  n 
6 7    DT  n 
6 8    DC  n 
6 9    DC  n 
6 10   DG  n 
6 11   DT  n 
6 12   DG  n 
6 13   DA  n 
6 14   DG  n 
6 15   DT  n 
6 16   DC  n 
6 17   DG  n 
6 18   DA  n 
6 19   DG  n 
6 20   DG  n 
6 21   DG  n 
7 1    DT  n 
7 2    DA  n 
7 3    DT  n 
7 4    DA  n 
7 5    DA  n 
7 6    DT  n 
7 7    DG  n 
7 8    DG  n 
7 9    DG  n 
7 10   DA  n 
7 11   DG  n 
7 12   DC  n 
7 13   DT  n 
7 14   DG  n 
7 15   DT  n 
7 16   DC  n 
7 17   DA  n 
7 18   DC  n 
7 19   DG  n 
7 20   DG  n 
7 21   DA  n 
7 22   DT  n 
7 23   DG  n 
7 24   DC  n 
7 25   DA  n 
7 26   DG  n 
7 27   DG  n 
8 1    G   n 
8 2    A   n 
# 
_entity_src_gen.entity_id                          5 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'rpoD, TTHA0532' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    HB8 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermus thermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     300852 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? ? 'Thermus thermophilus' 300852 ? ? HB8 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? 'Thermus thermophilus' 300852 ? ? HB8 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? ? 'Thermus thermophilus' 300852 ? ? HB8 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? 'Thermus thermophilus' 300852 ? ? HB8 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP RPOA_THET8   Q5SHR6 1 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
1 ? 
2 UNP RPOB_THET8   Q8RQE9 2 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
1 ? 
3 UNP RPOC_THET8   Q8RQE8 3 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
1 ? 
4 UNP RPOZ_THET8   Q8RQE7 4 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
1 ? 
5 UNP Q5SKW1_THET8 Q5SKW1 5 
;MKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEGLDLEEEEEDLPIPKISTSDP
VRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEID
QKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYAT
WWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETP
IGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQI
ENKALRKLKYHESRTRKLRDFLD
;
1 ? 
6 PDB 4G7O         4G7O   6 CCTGCATCCGTGAGTCGAGGG 1 ? 
7 PDB 4G7O         4G7O   7 TATAATGGGAGCTGTCACGGATGCAGG 1 ? 
8 PDB 4G7O         4G7O   8 GA 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 4G7O A 1  ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
2  1 4G7O B 1  ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
3  2 4G7O C 1  ? 1119 ? Q8RQE9 1 ? 1119 ? 1 1119 
4  3 4G7O D 1  ? 1524 ? Q8RQE8 1 ? 1524 ? 1 1524 
5  4 4G7O E 1  ? 99   ? Q8RQE7 1 ? 99   ? 1 99   
6  5 4G7O F 21 ? 443  ? Q5SKW1 1 ? 423  ? 1 423  
7  1 4G7O K 1  ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
8  1 4G7O L 1  ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
9  2 4G7O M 1  ? 1119 ? Q8RQE9 1 ? 1119 ? 1 1119 
10 3 4G7O N 1  ? 1524 ? Q8RQE8 1 ? 1524 ? 1 1524 
11 4 4G7O O 1  ? 99   ? Q8RQE7 1 ? 99   ? 1 99   
12 5 4G7O P 21 ? 443  ? Q5SKW1 1 ? 423  ? 1 423  
13 6 4G7O G 1  ? 21   ? 4G7O   1 ? 21   ? 1 21   
14 6 4G7O Q 1  ? 21   ? 4G7O   1 ? 21   ? 1 21   
15 7 4G7O H 1  ? 27   ? 4G7O   1 ? 27   ? 1 27   
16 7 4G7O R 1  ? 27   ? 4G7O   1 ? 27   ? 1 27   
17 8 4G7O I 1  ? 2    ? 4G7O   1 ? 2    ? 1 2    
18 8 4G7O S 1  ? 2    ? 4G7O   1 ? 2    ? 1 2    
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
6  4G7O MET F 1  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -19 1  
6  4G7O GLY F 2  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -18 2  
6  4G7O SER F 3  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -17 3  
6  4G7O SER F 4  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -16 4  
6  4G7O HIS F 5  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -15 5  
6  4G7O HIS F 6  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -14 6  
6  4G7O HIS F 7  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -13 7  
6  4G7O HIS F 8  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -12 8  
6  4G7O HIS F 9  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -11 9  
6  4G7O HIS F 10 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -10 10 
6  4G7O SER F 11 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -9  11 
6  4G7O SER F 12 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -8  12 
6  4G7O GLY F 13 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -7  13 
6  4G7O LEU F 14 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -6  14 
6  4G7O VAL F 15 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -5  15 
6  4G7O PRO F 16 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -4  16 
6  4G7O ARG F 17 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -3  17 
6  4G7O GLY F 18 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -2  18 
6  4G7O SER F 19 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -1  19 
6  4G7O HIS F 20 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' 0   20 
12 4G7O MET P 1  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -19 21 
12 4G7O GLY P 2  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -18 22 
12 4G7O SER P 3  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -17 23 
12 4G7O SER P 4  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -16 24 
12 4G7O HIS P 5  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -15 25 
12 4G7O HIS P 6  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -14 26 
12 4G7O HIS P 7  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -13 27 
12 4G7O HIS P 8  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -12 28 
12 4G7O HIS P 9  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -11 29 
12 4G7O HIS P 10 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -10 30 
12 4G7O SER P 11 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -9  31 
12 4G7O SER P 12 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -8  32 
12 4G7O GLY P 13 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -7  33 
12 4G7O LEU P 14 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -6  34 
12 4G7O VAL P 15 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -5  35 
12 4G7O PRO P 16 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -4  36 
12 4G7O ARG P 17 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -3  37 
12 4G7O GLY P 18 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -2  38 
12 4G7O SER P 19 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -1  39 
12 4G7O HIS P 20 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' 0   40 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.entry_id          4G7O 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.19 
_exptl_crystal.density_percent_sol   61.44 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.7 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;100 mM Tris-HCl, pH 8.7, 200 mM potassium chloride, 50 mM magnesium chloride, 10% PEG4000, VAPOR DIFFUSION, HANGING DROP, temperature 295K
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 270' 
_diffrn_detector.pdbx_collection_date   2011-06-04 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'single crystal Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.918 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4G7O 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.993 
_reflns.number_obs                   221194 
_reflns.number_all                   224790 
_reflns.percent_possible_obs         98.4 
_reflns.pdbx_Rmerge_I_obs            0.174 
_reflns.pdbx_Rsym_value              0.174 
_reflns.pdbx_netI_over_sigmaI        10.2 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              11.4 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.993 
_reflns_shell.d_res_low              3.05 
_reflns_shell.percent_possible_all   91.2 
_reflns_shell.Rmerge_I_obs           0.870 
_reflns_shell.pdbx_Rsym_value        0.870 
_reflns_shell.meanI_over_sigI_obs    1.8 
_reflns_shell.pdbx_redundancy        7.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4G7O 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     216254 
_refine.ls_number_reflns_all                     224790 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             46.606 
_refine.ls_d_res_high                            2.993 
_refine.ls_percent_reflns_obs                    95.59 
_refine.ls_R_factor_obs                          0.2054 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2050 
_refine.ls_R_factor_R_free                       0.2472 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 0.88 
_refine.ls_number_reflns_R_free                  1899 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -4.9953 
_refine.aniso_B[2][2]                            20.3864 
_refine.aniso_B[3][3]                            -15.3911 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            9.1286 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.00 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 4G7H' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.45 
_refine.pdbx_overall_phase_error                 27.88 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        55220 
_refine_hist.pdbx_number_atoms_nucleic_acid   1730 
_refine_hist.pdbx_number_atoms_ligand         9 
_refine_hist.number_atoms_solvent             272 
_refine_hist.number_atoms_total               57231 
_refine_hist.d_res_high                       2.993 
_refine_hist.d_res_low                        46.606 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.005  ? ? 58154 'X-RAY DIFFRACTION' ? 
f_angle_d          0.909  ? ? 79019 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 16.077 ? ? 22579 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.062  ? ? 8899  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 10066 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.9926 3.0674  12265 0.3441 77.00  0.4029 . . 107 . . . . 
'X-RAY DIFFRACTION' . 3.0674 3.1503  14120 0.3148 89.00  0.3878 . . 119 . . . . 
'X-RAY DIFFRACTION' . 3.1503 3.2430  14595 0.2926 92.00  0.3319 . . 128 . . . . 
'X-RAY DIFFRACTION' . 3.2430 3.3477  14929 0.2696 94.00  0.3368 . . 134 . . . . 
'X-RAY DIFFRACTION' . 3.3477 3.4673  15249 0.2493 96.00  0.2705 . . 134 . . . . 
'X-RAY DIFFRACTION' . 3.4673 3.6060  15427 0.2348 97.00  0.2958 . . 135 . . . . 
'X-RAY DIFFRACTION' . 3.6060 3.7701  15638 0.2176 98.00  0.2948 . . 141 . . . . 
'X-RAY DIFFRACTION' . 3.7701 3.9688  15836 0.1983 99.00  0.2354 . . 143 . . . . 
'X-RAY DIFFRACTION' . 3.9688 4.2173  15931 0.1806 100.00 0.2240 . . 142 . . . . 
'X-RAY DIFFRACTION' . 4.2173 4.5426  15978 0.1676 100.00 0.2188 . . 143 . . . . 
'X-RAY DIFFRACTION' . 4.5426 4.9993  16001 0.1642 100.00 0.2160 . . 142 . . . . 
'X-RAY DIFFRACTION' . 4.9993 5.7216  16057 0.1810 100.00 0.1969 . . 144 . . . . 
'X-RAY DIFFRACTION' . 5.7216 7.2043  16112 0.1958 100.00 0.2392 . . 143 . . . . 
'X-RAY DIFFRACTION' . 7.2043 46.6116 16217 0.1802 98.00  0.2039 . . 144 . . . . 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    4G7O 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
_struct.entry_id                  4G7O 
_struct.title                     
'Crystal structure of Thermus thermophilus transcription initiation complex containing 2 nt of RNA' 
_struct.pdbx_descriptor           
;DNA-directed RNA polymerase subunit alpha (E.C.2.7.7.6), DNA-directed RNA polymerase subunit beta (E.C.2.7.7.6), DNA-directed RNA polymerase subunit beta' (E.C.2.7.7.6), DNA-directed RNA polymerase subunit omega (E.C.2.7.7.6), RNA polymerase sigma factor
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4G7O 
_struct_keywords.pdbx_keywords   'TRANSCRIPTION, TRANSFERASE/DNA' 
_struct_keywords.text            
;protein-DNA complex, transcription initiation complex, RNAP-promoter complex, RNAP-promoter open complex, open complex, RPo, RNA polymerase, transcription initiation, transcription Initiation factor sigma A, promoter DNA, nucleoid, TRANSCRIPTION, TRANSFERASE-DNA complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 1  ? 
C  N N 2  ? 
D  N N 3  ? 
E  N N 4  ? 
F  N N 5  ? 
G  N N 6  ? 
H  N N 7  ? 
I  N N 8  ? 
J  N N 1  ? 
K  N N 1  ? 
L  N N 2  ? 
M  N N 3  ? 
N  N N 4  ? 
O  N N 5  ? 
P  N N 6  ? 
Q  N N 7  ? 
R  N N 8  ? 
S  N N 9  ? 
T  N N 9  ? 
U  N N 10 ? 
V  N N 10 ? 
W  N N 10 ? 
X  N N 9  ? 
Y  N N 9  ? 
Z  N N 10 ? 
AA N N 10 ? 
BA N N 11 ? 
CA N N 11 ? 
DA N N 11 ? 
EA N N 11 ? 
FA N N 11 ? 
GA N N 11 ? 
HA N N 11 ? 
IA N N 11 ? 
JA N N 11 ? 
KA N N 11 ? 
LA N N 11 ? 
MA N N 11 ? 
NA N N 11 ? 
OA N N 11 ? 
PA N N 11 ? 
QA N N 11 ? 
RA N N 11 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   GLY A 31   ? ILE A 48   ? GLY A 31   ILE A 48   1 ? 18 
HELX_P HELX_P2   2   ASP A 74   ? LYS A 83   ? ASP A 74   LYS A 83   1 ? 10 
HELX_P HELX_P3   3   ARG A 112  ? PHE A 114  ? ARG A 112  PHE A 114  5 ? 3  
HELX_P HELX_P4   4   PRO A 152  ? GLY A 157  ? PRO A 152  GLY A 157  1 ? 6  
HELX_P HELX_P5   5   THR A 206  ? TYR A 224  ? THR A 206  TYR A 224  1 ? 19 
HELX_P HELX_P6   6   GLY B 31   ? SER B 47   ? GLY B 31   SER B 47   1 ? 17 
HELX_P HELX_P7   7   ASP B 74   ? GLU B 84   ? ASP B 74   GLU B 84   1 ? 11 
HELX_P HELX_P8   8   ARG B 112  ? PHE B 114  ? ARG B 112  PHE B 114  5 ? 3  
HELX_P HELX_P9   9   PRO B 152  ? GLY B 157  ? PRO B 152  GLY B 157  1 ? 6  
HELX_P HELX_P10  10  THR B 206  ? LEU B 222  ? THR B 206  LEU B 222  1 ? 17 
HELX_P HELX_P11  11  THR B 223  ? PHE B 225  ? THR B 223  PHE B 225  5 ? 3  
HELX_P HELX_P12  12  THR C 19   ? GLN C 31   ? THR C 19   GLN C 31   1 ? 13 
HELX_P HELX_P13  13  VAL C 42   ? PHE C 52   ? VAL C 42   PHE C 52   1 ? 11 
HELX_P HELX_P14  14  PRO C 79   ? ASP C 87   ? PRO C 79   ASP C 87   1 ? 9  
HELX_P HELX_P15  15  LEU C 193  ? LEU C 200  ? LEU C 193  LEU C 200  1 ? 8  
HELX_P HELX_P16  16  ASP C 203  ? GLY C 212  ? ASP C 203  GLY C 212  1 ? 10 
HELX_P HELX_P17  17  GLU C 216  ? MET C 222  ? GLU C 216  MET C 222  1 ? 7  
HELX_P HELX_P18  18  ASP C 223  ? ARG C 243  ? ASP C 223  ARG C 243  1 ? 21 
HELX_P HELX_P19  19  LYS C 249  ? ILE C 261  ? LYS C 249  ILE C 261  1 ? 13 
HELX_P HELX_P20  20  GLY C 270  ? GLY C 282  ? GLY C 270  GLY C 282  1 ? 13 
HELX_P HELX_P21  21  VAL C 302  ? ALA C 315  ? VAL C 302  ALA C 315  1 ? 14 
HELX_P HELX_P22  22  THR C 335  ? MET C 359  ? THR C 335  MET C 359  1 ? 25 
HELX_P HELX_P23  23  THR C 368  ? VAL C 373  ? THR C 368  VAL C 373  1 ? 6  
HELX_P HELX_P24  24  SER C 375  ? SER C 389  ? SER C 375  SER C 389  1 ? 15 
HELX_P HELX_P25  25  ASN C 399  ? ARG C 408  ? ASN C 399  ARG C 408  1 ? 10 
HELX_P HELX_P26  26  GLY C 424  ? ASP C 429  ? GLY C 424  ASP C 429  1 ? 6  
HELX_P HELX_P27  27  HIS C 431  ? TYR C 435  ? HIS C 431  TYR C 435  5 ? 5  
HELX_P HELX_P28  28  THR C 487  ? ASP C 492  ? THR C 487  ASP C 492  1 ? 6  
HELX_P HELX_P29  29  SER C 525  ? VAL C 529  ? SER C 525  VAL C 529  5 ? 5  
HELX_P HELX_P30  30  SER C 535  ? PHE C 540  ? SER C 535  PHE C 540  5 ? 6  
HELX_P HELX_P31  31  ASN C 543  ? ILE C 547  ? ASN C 543  ILE C 547  5 ? 5  
HELX_P HELX_P32  32  PHE C 549  ? ASP C 553  ? PHE C 549  ASP C 553  5 ? 5  
HELX_P HELX_P33  33  ASP C 554  ? THR C 566  ? ASP C 554  THR C 566  1 ? 13 
HELX_P HELX_P34  34  LEU C 583  ? SER C 591  ? LEU C 583  SER C 591  1 ? 9  
HELX_P HELX_P35  35  ASN C 683  ? ALA C 687  ? ASN C 683  ALA C 687  5 ? 5  
HELX_P HELX_P36  36  GLU C 692  ? ARG C 697  ? GLU C 692  ARG C 697  1 ? 6  
HELX_P HELX_P37  37  SER C 730  ? ARG C 735  ? SER C 730  ARG C 735  1 ? 6  
HELX_P HELX_P38  38  THR C 768  ? GLY C 779  ? THR C 768  GLY C 779  1 ? 12 
HELX_P HELX_P39  39  PRO C 854  ? MET C 858  ? PRO C 854  MET C 858  5 ? 5  
HELX_P HELX_P40  40  LEU C 874  ? MET C 880  ? LEU C 874  MET C 880  1 ? 7  
HELX_P HELX_P41  41  LEU C 882  ? GLY C 898  ? LEU C 882  GLY C 898  1 ? 17 
HELX_P HELX_P42  42  LYS C 910  ? GLU C 932  ? LYS C 910  GLU C 932  1 ? 23 
HELX_P HELX_P43  43  ASP C 937  ? LEU C 950  ? ASP C 937  LEU C 950  1 ? 14 
HELX_P HELX_P44  44  THR C 958  ? LEU C 968  ? THR C 958  LEU C 968  1 ? 11 
HELX_P HELX_P45  45  MET C 1000 ? MET C 1005 ? MET C 1000 MET C 1005 1 ? 6  
HELX_P HELX_P46  46  GLY C 1033 ? GLY C 1044 ? GLY C 1033 GLY C 1044 1 ? 12 
HELX_P HELX_P47  47  ALA C 1045 ? THR C 1054 ? ALA C 1045 THR C 1054 1 ? 10 
HELX_P HELX_P48  48  ASP C 1059 ? LYS C 1072 ? ASP C 1059 LYS C 1072 1 ? 14 
HELX_P HELX_P49  49  PRO C 1082 ? ALA C 1094 ? PRO C 1082 ALA C 1094 1 ? 13 
HELX_P HELX_P50  50  SER D 14   ? TRP D 21   ? SER D 14   TRP D 21   1 ? 8  
HELX_P HELX_P51  51  LYS D 82   ? TYR D 88   ? LYS D 82   TYR D 88   5 ? 7  
HELX_P HELX_P52  52  HIS D 101  ? ASP D 107  ? HIS D 101  ASP D 107  1 ? 7  
HELX_P HELX_P53  53  SER D 110  ? LEU D 116  ? SER D 110  LEU D 116  1 ? 7  
HELX_P HELX_P54  54  SER D 119  ? TYR D 128  ? SER D 119  TYR D 128  1 ? 10 
HELX_P HELX_P55  55  THR D 154  ? GLY D 164  ? THR D 154  GLY D 164  1 ? 11 
HELX_P HELX_P56  56  ASP D 423  ? LYS D 426  ? ASP D 423  LYS D 426  5 ? 4  
HELX_P HELX_P57  57  MET D 456  ? GLU D 467  ? MET D 456  GLU D 467  1 ? 12 
HELX_P HELX_P58  58  ASP D 469  ? LYS D 482  ? ASP D 469  LYS D 482  1 ? 14 
HELX_P HELX_P59  59  SER D 485  ? GLY D 506  ? SER D 485  GLY D 506  1 ? 22 
HELX_P HELX_P60  60  ARG D 508  ? TRP D 511  ? ARG D 508  TRP D 511  5 ? 4  
HELX_P HELX_P61  61  PRO D 521  ? ARG D 525  ? PRO D 521  ARG D 525  5 ? 5  
HELX_P HELX_P62  62  ASP D 539  ? GLN D 560  ? ASP D 539  GLN D 560  1 ? 22 
HELX_P HELX_P63  63  PRO D 563  ? ASN D 584  ? PRO D 563  ASN D 584  1 ? 22 
HELX_P HELX_P64  64  SER D 602  ? SER D 608  ? SER D 602  SER D 608  1 ? 7  
HELX_P HELX_P65  65  GLY D 612  ? LEU D 618  ? GLY D 612  LEU D 618  1 ? 7  
HELX_P HELX_P66  66  LYS D 646  ? PHE D 653  ? LYS D 646  PHE D 653  1 ? 8  
HELX_P HELX_P67  67  PHE D 653  ? LYS D 664  ? PHE D 653  LYS D 664  1 ? 12 
HELX_P HELX_P68  68  ASN D 669  ? ARG D 679  ? ASN D 669  ARG D 679  1 ? 11 
HELX_P HELX_P69  69  GLN D 680  ? ILE D 683  ? GLN D 680  ILE D 683  5 ? 4  
HELX_P HELX_P70  70  LYS D 684  ? ILE D 695  ? LYS D 684  ILE D 695  1 ? 12 
HELX_P HELX_P71  71  HIS D 709  ? LEU D 711  ? HIS D 709  LEU D 711  5 ? 3  
HELX_P HELX_P72  72  HIS D 729  ? LEU D 731  ? HIS D 729  LEU D 731  5 ? 3  
HELX_P HELX_P73  73  VAL D 732  ? ASN D 737  ? VAL D 732  ASN D 737  1 ? 6  
HELX_P HELX_P74  74  SER D 752  ? MET D 763  ? SER D 752  MET D 763  1 ? 12 
HELX_P HELX_P75  75  LEU D 764  ? ASN D 768  ? LEU D 764  ASN D 768  5 ? 5  
HELX_P HELX_P76  76  ARG D 783  ? GLN D 794  ? ARG D 783  GLN D 794  1 ? 12 
HELX_P HELX_P77  77  THR D 808  ? GLY D 819  ? THR D 808  GLY D 819  1 ? 12 
HELX_P HELX_P78  78  SER D 835  ? TYR D 841  ? SER D 835  TYR D 841  1 ? 7  
HELX_P HELX_P79  79  ASN D 845  ? HIS D 855  ? ASN D 845  HIS D 855  1 ? 11 
HELX_P HELX_P80  80  SER D 876  ? GLU D 891  ? SER D 876  GLU D 891  1 ? 16 
HELX_P HELX_P81  81  ASP D 892  ? ILE D 900  ? ASP D 892  ILE D 900  1 ? 9  
HELX_P HELX_P82  82  GLU D 907  ? LEU D 922  ? GLU D 907  LEU D 922  1 ? 16 
HELX_P HELX_P83  83  GLY D 923  ? GLY D 946  ? GLY D 923  GLY D 946  1 ? 24 
HELX_P HELX_P84  84  GLY D 950  ? ALA D 954  ? GLY D 950  ALA D 954  5 ? 5  
HELX_P HELX_P85  85  GLU D 958  ? MET D 980  ? GLU D 958  MET D 980  1 ? 23 
HELX_P HELX_P86  86  THR D 984  ? TYR D 1015 ? THR D 984  TYR D 1015 1 ? 32 
HELX_P HELX_P87  87  ASN D 1018 ? GLY D 1027 ? ASN D 1018 GLY D 1027 1 ? 10 
HELX_P HELX_P88  88  ASN D 1031 ? GLY D 1040 ? ASN D 1031 GLY D 1040 1 ? 10 
HELX_P HELX_P89  89  THR D 1066 ? HIS D 1103 ? THR D 1066 HIS D 1103 1 ? 38 
HELX_P HELX_P90  90  LYS D 1136 ? TYR D 1145 ? LYS D 1136 TYR D 1145 1 ? 10 
HELX_P HELX_P91  91  SER D 1167 ? ALA D 1180 ? SER D 1167 ALA D 1180 1 ? 14 
HELX_P HELX_P92  92  GLN D 1202 ? GLY D 1206 ? GLN D 1202 GLY D 1206 1 ? 5  
HELX_P HELX_P93  93  ALA D 1220 ? GLU D 1231 ? ALA D 1220 GLU D 1231 1 ? 12 
HELX_P HELX_P94  94  PRO D 1232 ? LEU D 1236 ? PRO D 1232 LEU D 1236 5 ? 5  
HELX_P HELX_P95  95  GLN D 1254 ? ALA D 1265 ? GLN D 1254 ALA D 1265 1 ? 12 
HELX_P HELX_P96  96  ASP D 1331 ? GLY D 1340 ? ASP D 1331 GLY D 1340 1 ? 10 
HELX_P HELX_P97  97  GLY D 1340 ? GLN D 1359 ? GLY D 1340 GLN D 1359 1 ? 20 
HELX_P HELX_P98  98  HIS D 1364 ? MET D 1376 ? HIS D 1364 MET D 1376 1 ? 13 
HELX_P HELX_P99  99  LYS D 1397 ? GLU D 1410 ? LYS D 1397 GLU D 1410 1 ? 14 
HELX_P HELX_P100 100 GLY D 1423 ? SER D 1430 ? GLY D 1423 SER D 1430 1 ? 8  
HELX_P HELX_P101 101 SER D 1433 ? GLN D 1441 ? SER D 1433 GLN D 1441 1 ? 9  
HELX_P HELX_P102 102 ASN D 1442 ? GLY D 1454 ? ASN D 1442 GLY D 1454 1 ? 13 
HELX_P HELX_P103 103 GLY D 1461 ? GLY D 1469 ? GLY D 1461 GLY D 1469 1 ? 9  
HELX_P HELX_P104 104 ALA D 1474 ? GLY D 1477 ? ALA D 1474 GLY D 1477 5 ? 4  
HELX_P HELX_P105 105 SER D 1478 ? PHE D 1483 ? SER D 1478 PHE D 1483 1 ? 6  
HELX_P HELX_P106 106 GLN D 1489 ? GLU D 1497 ? GLN D 1489 GLU D 1497 1 ? 9  
HELX_P HELX_P107 107 GLY E 5    ? MET E 12   ? GLY E 5    MET E 12   1 ? 8  
HELX_P HELX_P108 108 SER E 15   ? HIS E 33   ? SER E 15   HIS E 33   1 ? 19 
HELX_P HELX_P109 109 ASN E 59   ? GLY E 71   ? ASN E 59   GLY E 71   1 ? 13 
HELX_P HELX_P110 110 PRO E 81   ? TYR E 93   ? PRO E 81   TYR E 93   1 ? 13 
HELX_P HELX_P111 111 ASP F 99   ? GLY F 109  ? ASP F 79   GLY F 89   1 ? 11 
HELX_P HELX_P112 112 THR F 115  ? GLY F 141  ? THR F 95   GLY F 121  1 ? 27 
HELX_P HELX_P113 113 ASP F 143  ? GLY F 157  ? ASP F 123  GLY F 137  1 ? 15 
HELX_P HELX_P114 114 ASP F 172  ? LYS F 184  ? ASP F 152  LYS F 164  1 ? 13 
HELX_P HELX_P115 115 PRO F 187  ? ASN F 211  ? PRO F 167  ASN F 191  1 ? 25 
HELX_P HELX_P116 116 ASN F 211  ? LYS F 220  ? ASN F 191  LYS F 200  1 ? 10 
HELX_P HELX_P117 117 SER F 228  ? PHE F 247  ? SER F 208  PHE F 227  1 ? 20 
HELX_P HELX_P118 118 LYS F 254  ? ALA F 275  ? LYS F 234  ALA F 255  1 ? 22 
HELX_P HELX_P119 119 PRO F 281  ? GLY F 303  ? PRO F 261  GLY F 283  1 ? 23 
HELX_P HELX_P120 120 THR F 307  ? MET F 315  ? THR F 287  MET F 295  1 ? 9  
HELX_P HELX_P121 121 ASP F 320  ? ALA F 331  ? ASP F 300  ALA F 311  1 ? 12 
HELX_P HELX_P122 122 GLY F 350  ? ILE F 353  ? GLY F 330  ILE F 333  5 ? 4  
HELX_P HELX_P123 123 SER F 360  ? LEU F 378  ? SER F 340  LEU F 358  1 ? 19 
HELX_P HELX_P124 124 SER F 382  ? LYS F 393  ? SER F 362  LYS F 373  1 ? 12 
HELX_P HELX_P125 125 THR F 402  ? GLY F 411  ? THR F 382  GLY F 391  1 ? 10 
HELX_P HELX_P126 126 THR F 413  ? ARG F 436  ? THR F 393  ARG F 416  1 ? 24 
HELX_P HELX_P127 127 LYS F 437  ? ASP F 443  ? LYS F 417  ASP F 423  5 ? 7  
HELX_P HELX_P128 128 GLY J 31   ? ILE J 48   ? GLY K 31   ILE K 48   1 ? 18 
HELX_P HELX_P129 129 ASP J 74   ? LYS J 83   ? ASP K 74   LYS K 83   1 ? 10 
HELX_P HELX_P130 130 ARG J 112  ? PHE J 114  ? ARG K 112  PHE K 114  5 ? 3  
HELX_P HELX_P131 131 PRO J 152  ? GLY J 157  ? PRO K 152  GLY K 157  1 ? 6  
HELX_P HELX_P132 132 THR J 206  ? TYR J 224  ? THR K 206  TYR K 224  1 ? 19 
HELX_P HELX_P133 133 GLY K 31   ? SER K 47   ? GLY L 31   SER L 47   1 ? 17 
HELX_P HELX_P134 134 ASP K 74   ? GLU K 84   ? ASP L 74   GLU L 84   1 ? 11 
HELX_P HELX_P135 135 ARG K 112  ? PHE K 114  ? ARG L 112  PHE L 114  5 ? 3  
HELX_P HELX_P136 136 PRO K 152  ? GLY K 157  ? PRO L 152  GLY L 157  1 ? 6  
HELX_P HELX_P137 137 THR K 206  ? LEU K 222  ? THR L 206  LEU L 222  1 ? 17 
HELX_P HELX_P138 138 THR K 223  ? SER K 226  ? THR L 223  SER L 226  5 ? 4  
HELX_P HELX_P139 139 THR L 19   ? GLN L 31   ? THR M 19   GLN M 31   1 ? 13 
HELX_P HELX_P140 140 PRO L 35   ? ARG L 39   ? PRO M 35   ARG M 39   5 ? 5  
HELX_P HELX_P141 141 VAL L 42   ? PHE L 52   ? VAL M 42   PHE M 52   1 ? 11 
HELX_P HELX_P142 142 PRO L 79   ? ASP L 87   ? PRO M 79   ASP M 87   1 ? 9  
HELX_P HELX_P143 143 LEU L 193  ? LEU L 200  ? LEU M 193  LEU M 200  1 ? 8  
HELX_P HELX_P144 144 ASP L 203  ? GLY L 212  ? ASP M 203  GLY M 212  1 ? 10 
HELX_P HELX_P145 145 GLU L 216  ? MET L 222  ? GLU M 216  MET M 222  1 ? 7  
HELX_P HELX_P146 146 ASP L 223  ? ARG L 243  ? ASP M 223  ARG M 243  1 ? 21 
HELX_P HELX_P147 147 ARG L 250  ? ILE L 261  ? ARG M 250  ILE M 261  1 ? 12 
HELX_P HELX_P148 148 GLY L 270  ? GLY L 282  ? GLY M 270  GLY M 282  1 ? 13 
HELX_P HELX_P149 149 VAL L 302  ? ALA L 315  ? VAL M 302  ALA M 315  1 ? 14 
HELX_P HELX_P150 150 THR L 335  ? MET L 359  ? THR M 335  MET M 359  1 ? 25 
HELX_P HELX_P151 151 THR L 368  ? VAL L 373  ? THR M 368  VAL M 373  1 ? 6  
HELX_P HELX_P152 152 SER L 375  ? SER L 389  ? SER M 375  SER M 389  1 ? 15 
HELX_P HELX_P153 153 ASN L 399  ? ARG L 408  ? ASN M 399  ARG M 408  1 ? 10 
HELX_P HELX_P154 154 GLY L 424  ? ASP L 429  ? GLY M 424  ASP M 429  1 ? 6  
HELX_P HELX_P155 155 HIS L 431  ? TYR L 435  ? HIS M 431  TYR M 435  5 ? 5  
HELX_P HELX_P156 156 ALA L 488  ? ARG L 493  ? ALA M 488  ARG M 493  1 ? 6  
HELX_P HELX_P157 157 SER L 535  ? PHE L 540  ? SER M 535  PHE M 540  5 ? 6  
HELX_P HELX_P158 158 ASN L 543  ? ILE L 547  ? ASN M 543  ILE M 547  5 ? 5  
HELX_P HELX_P159 159 PHE L 549  ? ASP L 553  ? PHE M 549  ASP M 553  5 ? 5  
HELX_P HELX_P160 160 ASP L 554  ? THR L 566  ? ASP M 554  THR M 566  1 ? 13 
HELX_P HELX_P161 161 LEU L 583  ? SER L 591  ? LEU M 583  SER M 591  1 ? 9  
HELX_P HELX_P162 162 ASN L 683  ? ALA L 687  ? ASN M 683  ALA M 687  5 ? 5  
HELX_P HELX_P163 163 GLU L 692  ? ARG L 697  ? GLU M 692  ARG M 697  1 ? 6  
HELX_P HELX_P164 164 SER L 730  ? ARG L 735  ? SER M 730  ARG M 735  1 ? 6  
HELX_P HELX_P165 165 THR L 768  ? GLY L 779  ? THR M 768  GLY M 779  1 ? 12 
HELX_P HELX_P166 166 PRO L 854  ? MET L 858  ? PRO M 854  MET M 858  5 ? 5  
HELX_P HELX_P167 167 LEU L 874  ? MET L 880  ? LEU M 874  MET M 880  1 ? 7  
HELX_P HELX_P168 168 LEU L 882  ? GLY L 898  ? LEU M 882  GLY M 898  1 ? 17 
HELX_P HELX_P169 169 LYS L 910  ? GLU L 932  ? LYS M 910  GLU M 932  1 ? 23 
HELX_P HELX_P170 170 ASP L 937  ? LEU L 950  ? ASP M 937  LEU M 950  1 ? 14 
HELX_P HELX_P171 171 THR L 958  ? LEU L 968  ? THR M 958  LEU M 968  1 ? 11 
HELX_P HELX_P172 172 MET L 1000 ? MET L 1005 ? MET M 1000 MET M 1005 1 ? 6  
HELX_P HELX_P173 173 GLY L 1033 ? GLY L 1044 ? GLY M 1033 GLY M 1044 1 ? 12 
HELX_P HELX_P174 174 ALA L 1045 ? THR L 1054 ? ALA M 1045 THR M 1054 1 ? 10 
HELX_P HELX_P175 175 ASP L 1059 ? LYS L 1072 ? ASP M 1059 LYS M 1072 1 ? 14 
HELX_P HELX_P176 176 PRO L 1082 ? ALA L 1094 ? PRO M 1082 ALA M 1094 1 ? 13 
HELX_P HELX_P177 177 SER M 14   ? SER M 22   ? SER N 14   SER N 22   1 ? 9  
HELX_P HELX_P178 178 LYS M 82   ? TYR M 88   ? LYS N 82   TYR N 88   5 ? 7  
HELX_P HELX_P179 179 HIS M 101  ? ASP M 107  ? HIS N 101  ASP N 107  1 ? 7  
HELX_P HELX_P180 180 SER M 110  ? LEU M 116  ? SER N 110  LEU N 116  1 ? 7  
HELX_P HELX_P181 181 SER M 119  ? TYR M 128  ? SER N 119  TYR N 128  1 ? 10 
HELX_P HELX_P182 182 THR M 154  ? GLY M 164  ? THR N 154  GLY N 164  1 ? 11 
HELX_P HELX_P183 183 ASP M 423  ? LYS M 426  ? ASP N 423  LYS N 426  5 ? 4  
HELX_P HELX_P184 184 MET M 456  ? LEU M 468  ? MET N 456  LEU N 468  1 ? 13 
HELX_P HELX_P185 185 ASP M 469  ? LYS M 482  ? ASP N 469  LYS N 482  1 ? 14 
HELX_P HELX_P186 186 SER M 485  ? GLY M 506  ? SER N 485  GLY N 506  1 ? 22 
HELX_P HELX_P187 187 ARG M 508  ? TRP M 511  ? ARG N 508  TRP N 511  5 ? 4  
HELX_P HELX_P188 188 PRO M 521  ? ARG M 525  ? PRO N 521  ARG N 525  5 ? 5  
HELX_P HELX_P189 189 ASP M 539  ? GLN M 560  ? ASP N 539  GLN N 560  1 ? 22 
HELX_P HELX_P190 190 PRO M 563  ? ASN M 584  ? PRO N 563  ASN N 584  1 ? 22 
HELX_P HELX_P191 191 SER M 602  ? SER M 608  ? SER N 602  SER N 608  1 ? 7  
HELX_P HELX_P192 192 GLY M 612  ? LEU M 618  ? GLY N 612  LEU N 618  1 ? 7  
HELX_P HELX_P193 193 LYS M 646  ? PHE M 653  ? LYS N 646  PHE N 653  1 ? 8  
HELX_P HELX_P194 194 PHE M 653  ? LYS M 664  ? PHE N 653  LYS N 664  1 ? 12 
HELX_P HELX_P195 195 ASN M 669  ? ARG M 679  ? ASN N 669  ARG N 679  1 ? 11 
HELX_P HELX_P196 196 GLN M 680  ? ILE M 683  ? GLN N 680  ILE N 683  5 ? 4  
HELX_P HELX_P197 197 LYS M 684  ? ILE M 695  ? LYS N 684  ILE N 695  1 ? 12 
HELX_P HELX_P198 198 HIS M 709  ? LEU M 711  ? HIS N 709  LEU N 711  5 ? 3  
HELX_P HELX_P199 199 HIS M 729  ? LEU M 731  ? HIS N 729  LEU N 731  5 ? 3  
HELX_P HELX_P200 200 VAL M 732  ? ASN M 737  ? VAL N 732  ASN N 737  1 ? 6  
HELX_P HELX_P201 201 SER M 752  ? MET M 763  ? SER N 752  MET N 763  1 ? 12 
HELX_P HELX_P202 202 LEU M 764  ? ASN M 768  ? LEU N 764  ASN N 768  5 ? 5  
HELX_P HELX_P203 203 ARG M 783  ? GLN M 794  ? ARG N 783  GLN N 794  1 ? 12 
HELX_P HELX_P204 204 THR M 808  ? GLY M 819  ? THR N 808  GLY N 819  1 ? 12 
HELX_P HELX_P205 205 VAL M 836  ? TYR M 841  ? VAL N 836  TYR N 841  1 ? 6  
HELX_P HELX_P206 206 ASN M 845  ? HIS M 855  ? ASN N 845  HIS N 855  1 ? 11 
HELX_P HELX_P207 207 SER M 876  ? GLU M 891  ? SER N 876  GLU N 891  1 ? 16 
HELX_P HELX_P208 208 ASP M 892  ? ILE M 900  ? ASP N 892  ILE N 900  1 ? 9  
HELX_P HELX_P209 209 GLU M 907  ? LEU M 922  ? GLU N 907  LEU N 922  1 ? 16 
HELX_P HELX_P210 210 GLY M 923  ? GLY M 946  ? GLY N 923  GLY N 946  1 ? 24 
HELX_P HELX_P211 211 GLY M 950  ? ALA M 954  ? GLY N 950  ALA N 954  5 ? 5  
HELX_P HELX_P212 212 GLU M 958  ? MET M 980  ? GLU N 958  MET N 980  1 ? 23 
HELX_P HELX_P213 213 THR M 984  ? TYR M 1015 ? THR N 984  TYR N 1015 1 ? 32 
HELX_P HELX_P214 214 ASN M 1018 ? SER M 1026 ? ASN N 1018 SER N 1026 1 ? 9  
HELX_P HELX_P215 215 ASN M 1031 ? GLY M 1040 ? ASN N 1031 GLY N 1040 1 ? 10 
HELX_P HELX_P216 216 THR M 1066 ? HIS M 1103 ? THR N 1066 HIS N 1103 1 ? 38 
HELX_P HELX_P217 217 LYS M 1136 ? TYR M 1145 ? LYS N 1136 TYR N 1145 1 ? 10 
HELX_P HELX_P218 218 SER M 1167 ? ALA M 1180 ? SER N 1167 ALA N 1180 1 ? 14 
HELX_P HELX_P219 219 GLN M 1202 ? GLY M 1206 ? GLN N 1202 GLY N 1206 1 ? 5  
HELX_P HELX_P220 220 ALA M 1220 ? GLU M 1231 ? ALA N 1220 GLU N 1231 1 ? 12 
HELX_P HELX_P221 221 PRO M 1232 ? LEU M 1236 ? PRO N 1232 LEU N 1236 5 ? 5  
HELX_P HELX_P222 222 GLN M 1254 ? GLU M 1264 ? GLN N 1254 GLU N 1264 1 ? 11 
HELX_P HELX_P223 223 ASP M 1331 ? GLN M 1359 ? ASP N 1331 GLN N 1359 1 ? 29 
HELX_P HELX_P224 224 HIS M 1364 ? MET M 1376 ? HIS N 1364 MET N 1376 1 ? 13 
HELX_P HELX_P225 225 LYS M 1397 ? GLU M 1410 ? LYS N 1397 GLU N 1410 1 ? 14 
HELX_P HELX_P226 226 GLY M 1423 ? SER M 1430 ? GLY N 1423 SER N 1430 1 ? 8  
HELX_P HELX_P227 227 SER M 1433 ? GLN M 1441 ? SER N 1433 GLN N 1441 1 ? 9  
HELX_P HELX_P228 228 ASN M 1442 ? GLY M 1454 ? ASN N 1442 GLY N 1454 1 ? 13 
HELX_P HELX_P229 229 GLY M 1461 ? GLY M 1469 ? GLY N 1461 GLY N 1469 1 ? 9  
HELX_P HELX_P230 230 ALA M 1474 ? SER M 1478 ? ALA N 1474 SER N 1478 5 ? 5  
HELX_P HELX_P231 231 GLN M 1489 ? GLU M 1497 ? GLN N 1489 GLU N 1497 1 ? 9  
HELX_P HELX_P232 232 GLY N 5    ? MET N 12   ? GLY O 5    MET O 12   1 ? 8  
HELX_P HELX_P233 233 SER N 15   ? HIS N 33   ? SER O 15   HIS O 33   1 ? 19 
HELX_P HELX_P234 234 ASN N 59   ? GLY N 71   ? ASN O 59   GLY O 71   1 ? 13 
HELX_P HELX_P235 235 PRO N 81   ? TYR N 93   ? PRO O 81   TYR O 93   1 ? 13 
HELX_P HELX_P236 236 ASP O 99   ? GLY O 109  ? ASP P 79   GLY P 89   1 ? 11 
HELX_P HELX_P237 237 THR O 115  ? GLY O 141  ? THR P 95   GLY P 121  1 ? 27 
HELX_P HELX_P238 238 ASP O 143  ? GLY O 157  ? ASP P 123  GLY P 137  1 ? 15 
HELX_P HELX_P239 239 ASP O 172  ? LYS O 184  ? ASP P 152  LYS P 164  1 ? 13 
HELX_P HELX_P240 240 PRO O 187  ? LYS O 220  ? PRO P 167  LYS P 200  1 ? 34 
HELX_P HELX_P241 241 LYS O 221  ? THR O 223  ? LYS P 201  THR P 203  5 ? 3  
HELX_P HELX_P242 242 SER O 228  ? PHE O 247  ? SER P 208  PHE P 227  1 ? 20 
HELX_P HELX_P243 243 LYS O 254  ? ALA O 275  ? LYS P 234  ALA P 255  1 ? 22 
HELX_P HELX_P244 244 PRO O 281  ? GLY O 303  ? PRO P 261  GLY P 283  1 ? 23 
HELX_P HELX_P245 245 THR O 307  ? GLY O 316  ? THR P 287  GLY P 296  1 ? 10 
HELX_P HELX_P246 246 ASP O 320  ? ALA O 331  ? ASP P 300  ALA P 311  1 ? 12 
HELX_P HELX_P247 247 GLY O 350  ? ILE O 353  ? GLY P 330  ILE P 333  5 ? 4  
HELX_P HELX_P248 248 SER O 360  ? SER O 382  ? SER P 340  SER P 362  1 ? 23 
HELX_P HELX_P249 249 SER O 382  ? LYS O 393  ? SER P 362  LYS P 373  1 ? 12 
HELX_P HELX_P250 250 GLU O 405  ? PHE O 410  ? GLU P 385  PHE P 390  1 ? 6  
HELX_P HELX_P251 251 ARG O 416  ? LYS O 437  ? ARG P 396  LYS P 417  1 ? 22 
HELX_P HELX_P252 252 ARG O 439  ? ASP O 443  ? ARG P 419  ASP P 423  5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? D ASP 739  OD1   ? ? ? 1_555 U  MG .  MG ? ? D ASP 739  D MG 2003 1_555 ? ? ? ? ? ? ?            1.857 ? 
metalc2  metalc ? ? M ASP 739  OD1   ? ? ? 1_555 Z  MG .  MG ? ? N ASP 739  N MG 2003 1_555 ? ? ? ? ? ? ?            1.895 ? 
metalc3  metalc ? ? M ASP 743  OD1   ? ? ? 1_555 Z  MG .  MG ? ? N ASP 743  N MG 2003 1_555 ? ? ? ? ? ? ?            1.927 ? 
metalc4  metalc ? ? D ASP 743  OD1   ? ? ? 1_555 U  MG .  MG ? ? D ASP 743  D MG 2003 1_555 ? ? ? ? ? ? ?            1.975 ? 
metalc5  metalc ? ? D ASP 741  OD1   ? ? ? 1_555 U  MG .  MG ? ? D ASP 741  D MG 2003 1_555 ? ? ? ? ? ? ?            2.016 ? 
metalc6  metalc ? ? M ASP 741  OD1   ? ? ? 1_555 Z  MG .  MG ? ? N ASP 741  N MG 2003 1_555 ? ? ? ? ? ? ?            2.030 ? 
metalc7  metalc ? ? D LYS 840  O     ? ? ? 1_555 V  MG .  MG ? ? D LYS 840  D MG 2004 1_555 ? ? ? ? ? ? ?            2.092 ? 
metalc8  metalc ? ? D CYS 1201 SG    ? ? ? 1_555 S  ZN .  ZN ? ? D CYS 1201 D ZN 2001 1_555 ? ? ? ? ? ? ?            2.151 ? 
metalc9  metalc ? ? R A   2    "O3'" ? ? ? 1_555 Z  MG .  MG ? ? S A   2    N MG 2003 1_555 ? ? ? ? ? ? ?            2.162 ? 
metalc10 metalc ? ? D CYS 76   SG    ? ? ? 1_555 T  ZN .  ZN ? ? D CYS 76   D ZN 2002 1_555 ? ? ? ? ? ? ?            2.170 ? 
metalc11 metalc ? ? M LYS 840  O     ? ? ? 1_555 AA MG .  MG ? ? N LYS 840  N MG 2004 1_555 ? ? ? ? ? ? ?            2.178 ? 
metalc12 metalc ? ? M CYS 60   SG    ? ? ? 1_555 Y  ZN .  ZN ? ? N CYS 60   N ZN 2002 1_555 ? ? ? ? ? ? ?            2.202 ? 
metalc13 metalc ? ? D CYS 1112 SG    ? ? ? 1_555 S  ZN .  ZN ? ? D CYS 1112 D ZN 2001 1_555 ? ? ? ? ? ? ?            2.208 ? 
metalc14 metalc ? ? D CYS 73   SG    ? ? ? 1_555 T  ZN .  ZN ? ? D CYS 73   D ZN 2002 1_555 ? ? ? ? ? ? ?            2.210 ? 
metalc15 metalc ? ? M CYS 1204 SG    ? ? ? 1_555 X  ZN .  ZN ? ? N CYS 1204 N ZN 2001 1_555 ? ? ? ? ? ? ?            2.231 ? 
metalc16 metalc ? ? I A   2    "O3'" ? ? ? 1_555 U  MG .  MG ? ? I A   2    D MG 2003 1_555 ? ? ? ? ? ? ?            2.237 ? 
metalc17 metalc ? ? M CYS 58   SG    ? ? ? 1_555 Y  ZN .  ZN ? ? N CYS 58   N ZN 2002 1_555 ? ? ? ? ? ? ?            2.238 ? 
metalc18 metalc ? ? D CYS 1194 SG    ? ? ? 1_555 S  ZN .  ZN ? ? D CYS 1194 D ZN 2001 1_555 ? ? ? ? ? ? ?            2.240 ? 
metalc19 metalc ? ? M CYS 1201 SG    ? ? ? 1_555 X  ZN .  ZN ? ? N CYS 1201 N ZN 2001 1_555 ? ? ? ? ? ? ?            2.246 ? 
metalc20 metalc ? ? D CYS 1204 SG    ? ? ? 1_555 S  ZN .  ZN ? ? D CYS 1204 D ZN 2001 1_555 ? ? ? ? ? ? ?            2.304 ? 
metalc21 metalc ? ? M CYS 1112 SG    ? ? ? 1_555 X  ZN .  ZN ? ? N CYS 1112 N ZN 2001 1_555 ? ? ? ? ? ? ?            2.311 ? 
metalc22 metalc ? ? M CYS 76   SG    ? ? ? 1_555 Y  ZN .  ZN ? ? N CYS 76   N ZN 2002 1_555 ? ? ? ? ? ? ?            2.319 ? 
metalc23 metalc ? ? D CYS 58   SG    ? ? ? 1_555 T  ZN .  ZN ? ? D CYS 58   D ZN 2002 1_555 ? ? ? ? ? ? ?            2.322 ? 
metalc24 metalc ? ? M CYS 1194 SG    ? ? ? 1_555 X  ZN .  ZN ? ? N CYS 1194 N ZN 2001 1_555 ? ? ? ? ? ? ?            2.337 ? 
metalc25 metalc ? ? M CYS 73   SG    ? ? ? 1_555 Y  ZN .  ZN ? ? N CYS 73   N ZN 2002 1_555 ? ? ? ? ? ? ?            2.349 ? 
metalc26 metalc ? ? D CYS 60   SG    ? ? ? 1_555 T  ZN .  ZN ? ? D CYS 60   D ZN 2002 1_555 ? ? ? ? ? ? ?            2.388 ? 
metalc27 metalc ? ? D ASP 741  OD2   ? ? ? 1_555 U  MG .  MG ? ? D ASP 741  D MG 2003 1_555 ? ? ? ? ? ? ?            2.569 ? 
metalc28 metalc ? ? M ASP 741  OD2   ? ? ? 1_555 Z  MG .  MG ? ? N ASP 741  N MG 2003 1_555 ? ? ? ? ? ? ?            2.611 ? 
metalc29 metalc ? ? J VAL 170  O     ? ? ? 1_555 W  MG .  MG ? ? K VAL 170  K MG 1001 1_555 ? ? ? ? ? ? ?            2.651 ? 
hydrog1  hydrog ? ? G DG  4    N1    ? ? ? 1_555 H  DC 24 N3 ? ? G DG  4    H DC 24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? G DG  4    N2    ? ? ? 1_555 H  DC 24 O2 ? ? G DG  4    H DC 24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? G DG  4    O6    ? ? ? 1_555 H  DC 24 N4 ? ? G DG  4    H DC 24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? G DC  5    N3    ? ? ? 1_555 H  DG 23 N1 ? ? G DC  5    H DG 23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? G DC  5    N4    ? ? ? 1_555 H  DG 23 O6 ? ? G DC  5    H DG 23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? G DC  5    O2    ? ? ? 1_555 H  DG 23 N2 ? ? G DC  5    H DG 23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? G DA  6    N1    ? ? ? 1_555 H  DT 22 N3 ? ? G DA  6    H DT 22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? G DA  6    N6    ? ? ? 1_555 H  DT 22 O4 ? ? G DA  6    H DT 22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? G DT  7    N3    ? ? ? 1_555 H  DA 21 N1 ? ? G DT  7    H DA 21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? G DT  7    O4    ? ? ? 1_555 H  DA 21 N6 ? ? G DT  7    H DA 21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? G DC  8    N3    ? ? ? 1_555 H  DG 20 N1 ? ? G DC  8    H DG 20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? G DC  8    N4    ? ? ? 1_555 H  DG 20 O6 ? ? G DC  8    H DG 20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? G DC  8    O2    ? ? ? 1_555 H  DG 20 N2 ? ? G DC  8    H DG 20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? G DC  9    N3    ? ? ? 1_555 H  DG 19 N1 ? ? G DC  9    H DG 19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? G DC  9    N4    ? ? ? 1_555 H  DG 19 O6 ? ? G DC  9    H DG 19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? G DC  9    O2    ? ? ? 1_555 H  DG 19 N2 ? ? G DC  9    H DG 19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? G DG  10   N1    ? ? ? 1_555 H  DC 18 N3 ? ? G DG  10   H DC 18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? G DG  10   N2    ? ? ? 1_555 H  DC 18 O2 ? ? G DG  10   H DC 18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? G DG  10   O6    ? ? ? 1_555 H  DC 18 N4 ? ? G DG  10   H DC 18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? G DT  11   N3    ? ? ? 1_555 H  DA 17 N1 ? ? G DT  11   H DA 17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? G DT  11   O4    ? ? ? 1_555 H  DA 17 N6 ? ? G DT  11   H DA 17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? G DG  12   N1    ? ? ? 1_555 H  DC 16 N3 ? ? G DG  12   H DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? G DG  12   N2    ? ? ? 1_555 H  DC 16 O2 ? ? G DG  12   H DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? G DG  12   O6    ? ? ? 1_555 H  DC 16 N4 ? ? G DG  12   H DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? G DA  13   N1    ? ? ? 1_555 H  DT 15 N3 ? ? G DA  13   H DT 15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? G DA  13   N6    ? ? ? 1_555 H  DT 15 O4 ? ? G DA  13   H DT 15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? G DT  15   N3    ? ? ? 1_555 I  A  2  N1 ? ? G DT  15   I A  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? G DT  15   O4    ? ? ? 1_555 I  A  2  N6 ? ? G DT  15   I A  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? G DC  16   N3    ? ? ? 1_555 I  G  1  N1 ? ? G DC  16   I G  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? G DC  16   N4    ? ? ? 1_555 I  G  1  O6 ? ? G DC  16   I G  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? G DC  16   O2    ? ? ? 1_555 I  G  1  N2 ? ? G DC  16   I G  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? P DG  4    N1    ? ? ? 1_555 Q  DC 24 N3 ? ? Q DG  4    R DC 24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? P DG  4    N2    ? ? ? 1_555 Q  DC 24 O2 ? ? Q DG  4    R DC 24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? P DG  4    O6    ? ? ? 1_555 Q  DC 24 N4 ? ? Q DG  4    R DC 24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? P DC  5    N3    ? ? ? 1_555 Q  DG 23 N1 ? ? Q DC  5    R DG 23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? P DC  5    N4    ? ? ? 1_555 Q  DG 23 O6 ? ? Q DC  5    R DG 23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? P DC  5    O2    ? ? ? 1_555 Q  DG 23 N2 ? ? Q DC  5    R DG 23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? P DA  6    N1    ? ? ? 1_555 Q  DT 22 N3 ? ? Q DA  6    R DT 22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? P DA  6    N6    ? ? ? 1_555 Q  DT 22 O4 ? ? Q DA  6    R DT 22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? P DT  7    N3    ? ? ? 1_555 Q  DA 21 N1 ? ? Q DT  7    R DA 21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? P DT  7    O4    ? ? ? 1_555 Q  DA 21 N6 ? ? Q DT  7    R DA 21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? P DC  8    N3    ? ? ? 1_555 Q  DG 20 N1 ? ? Q DC  8    R DG 20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? P DC  8    N4    ? ? ? 1_555 Q  DG 20 O6 ? ? Q DC  8    R DG 20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? P DC  8    O2    ? ? ? 1_555 Q  DG 20 N2 ? ? Q DC  8    R DG 20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? P DG  10   N1    ? ? ? 1_555 Q  DC 18 N3 ? ? Q DG  10   R DC 18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? P DG  10   N2    ? ? ? 1_555 Q  DC 18 O2 ? ? Q DG  10   R DC 18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? P DG  10   O6    ? ? ? 1_555 Q  DC 18 N4 ? ? Q DG  10   R DC 18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? P DT  11   N3    ? ? ? 1_555 Q  DA 17 N1 ? ? Q DT  11   R DA 17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? P DT  11   O4    ? ? ? 1_555 Q  DA 17 N6 ? ? Q DT  11   R DA 17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? P DG  12   N1    ? ? ? 1_555 Q  DC 16 N3 ? ? Q DG  12   R DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? P DG  12   N2    ? ? ? 1_555 Q  DC 16 O2 ? ? Q DG  12   R DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ? ? P DG  12   O6    ? ? ? 1_555 Q  DC 16 N4 ? ? Q DG  12   R DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ? ? P DA  13   N1    ? ? ? 1_555 Q  DT 15 N3 ? ? Q DA  13   R DT 15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ? ? P DA  13   N6    ? ? ? 1_555 Q  DT 15 O4 ? ? Q DA  13   R DT 15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ? ? P DT  15   N3    ? ? ? 1_555 R  A  2  N1 ? ? Q DT  15   S A  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ? ? P DT  15   O4    ? ? ? 1_555 R  A  2  N6 ? ? Q DT  15   S A  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ? ? P DC  16   N3    ? ? ? 1_555 R  G  1  N1 ? ? Q DC  16   S G  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58 hydrog ? ? P DC  16   N4    ? ? ? 1_555 R  G  1  O6 ? ? Q DC  16   S G  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59 hydrog ? ? P DC  16   O2    ? ? ? 1_555 R  G  1  N2 ? ? Q DC  16   S G  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 26  A . ? GLU 26  A PRO 27  A ? PRO 27  A 1 0.12  
2 GLU 26  B . ? GLU 26  B PRO 27  B ? PRO 27  B 1 -2.37 
3 PHE 52  C . ? PHE 52  C PRO 53  C ? PRO 53  C 1 0.31  
4 VAL 108 D . ? VAL 108 D PRO 109 D ? PRO 109 D 1 -5.24 
5 ALA 705 D . ? ALA 705 D PRO 706 D ? PRO 706 D 1 5.48  
6 GLU 26  J . ? GLU 26  K PRO 27  J ? PRO 27  K 1 -0.35 
7 GLU 26  K . ? GLU 26  L PRO 27  K ? PRO 27  L 1 -2.57 
8 PHE 52  L . ? PHE 52  M PRO 53  L ? PRO 53  M 1 -5.06 
9 ALA 705 M . ? ALA 705 N PRO 706 M ? PRO 706 N 1 4.77  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 4 ? 
B  ? 4 ? 
C  ? 2 ? 
D  ? 2 ? 
E  ? 2 ? 
F  ? 4 ? 
G  ? 4 ? 
H  ? 2 ? 
I  ? 2 ? 
J  ? 2 ? 
K  ? 3 ? 
L  ? 3 ? 
M  ? 3 ? 
N  ? 4 ? 
O  ? 5 ? 
P  ? 2 ? 
Q  ? 3 ? 
R  ? 6 ? 
S  ? 2 ? 
T  ? 3 ? 
U  ? 4 ? 
V  ? 2 ? 
W  ? 2 ? 
X  ? 8 ? 
Y  ? 5 ? 
Z  ? 2 ? 
AA ? 2 ? 
AB ? 2 ? 
AC ? 4 ? 
AD ? 3 ? 
AE ? 3 ? 
AF ? 4 ? 
AG ? 2 ? 
AH ? 5 ? 
AI ? 3 ? 
AJ ? 3 ? 
AK ? 4 ? 
AL ? 2 ? 
AM ? 4 ? 
AN ? 2 ? 
AO ? 3 ? 
AP ? 7 ? 
AQ ? 3 ? 
AR ? 3 ? 
AS ? 2 ? 
AT ? 2 ? 
AU ? 2 ? 
AV ? 2 ? 
AW ? 4 ? 
AX ? 3 ? 
AY ? 2 ? 
AZ ? 2 ? 
BA ? 2 ? 
BB ? 4 ? 
BC ? 4 ? 
BD ? 2 ? 
BE ? 2 ? 
BF ? 2 ? 
BG ? 4 ? 
BH ? 4 ? 
BI ? 2 ? 
BJ ? 2 ? 
BK ? 2 ? 
BL ? 3 ? 
BM ? 3 ? 
BN ? 3 ? 
BO ? 4 ? 
BP ? 5 ? 
BQ ? 2 ? 
BR ? 3 ? 
BS ? 6 ? 
BT ? 2 ? 
BU ? 3 ? 
BV ? 4 ? 
BW ? 2 ? 
BX ? 2 ? 
BY ? 8 ? 
BZ ? 5 ? 
CA ? 2 ? 
CB ? 2 ? 
CC ? 2 ? 
CD ? 4 ? 
CE ? 2 ? 
CF ? 3 ? 
CG ? 4 ? 
CH ? 2 ? 
CI ? 5 ? 
CJ ? 3 ? 
CK ? 3 ? 
CL ? 4 ? 
CM ? 2 ? 
CN ? 4 ? 
CO ? 2 ? 
CP ? 3 ? 
CQ ? 7 ? 
CR ? 3 ? 
CS ? 3 ? 
CT ? 2 ? 
CU ? 2 ? 
CV ? 2 ? 
CW ? 2 ? 
CX ? 2 ? 
CY ? 4 ? 
CZ ? 3 ? 
DA ? 2 ? 
DB ? 2 ? 
DC ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
C  1 2 ? anti-parallel 
D  1 2 ? anti-parallel 
E  1 2 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? anti-parallel 
H  1 2 ? anti-parallel 
I  1 2 ? anti-parallel 
J  1 2 ? anti-parallel 
K  1 2 ? parallel      
K  2 3 ? parallel      
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? parallel      
N  3 4 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
O  3 4 ? anti-parallel 
O  4 5 ? anti-parallel 
P  1 2 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
R  3 4 ? parallel      
R  4 5 ? anti-parallel 
R  5 6 ? anti-parallel 
S  1 2 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
U  3 4 ? anti-parallel 
V  1 2 ? anti-parallel 
W  1 2 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
X  4 5 ? parallel      
X  5 6 ? anti-parallel 
X  6 7 ? parallel      
X  7 8 ? anti-parallel 
Y  1 2 ? anti-parallel 
Y  2 3 ? anti-parallel 
Y  3 4 ? anti-parallel 
Y  4 5 ? anti-parallel 
Z  1 2 ? anti-parallel 
AA 1 2 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AD 1 2 ? parallel      
AD 2 3 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AG 1 2 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AH 3 4 ? anti-parallel 
AH 4 5 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? anti-parallel 
AK 3 4 ? anti-parallel 
AL 1 2 ? anti-parallel 
AM 1 2 ? anti-parallel 
AM 2 3 ? anti-parallel 
AM 3 4 ? anti-parallel 
AN 1 2 ? anti-parallel 
AO 1 2 ? anti-parallel 
AO 2 3 ? parallel      
AP 1 2 ? parallel      
AP 2 3 ? anti-parallel 
AP 3 4 ? parallel      
AP 4 5 ? anti-parallel 
AP 5 6 ? anti-parallel 
AP 6 7 ? anti-parallel 
AQ 1 2 ? parallel      
AQ 2 3 ? anti-parallel 
AR 1 2 ? parallel      
AR 2 3 ? anti-parallel 
AS 1 2 ? parallel      
AT 1 2 ? anti-parallel 
AU 1 2 ? anti-parallel 
AV 1 2 ? anti-parallel 
AW 1 2 ? anti-parallel 
AW 2 3 ? anti-parallel 
AW 3 4 ? anti-parallel 
AX 1 2 ? anti-parallel 
AX 2 3 ? anti-parallel 
AY 1 2 ? anti-parallel 
AZ 1 2 ? anti-parallel 
BA 1 2 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BB 3 4 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BC 3 4 ? anti-parallel 
BD 1 2 ? anti-parallel 
BE 1 2 ? anti-parallel 
BF 1 2 ? anti-parallel 
BG 1 2 ? anti-parallel 
BG 2 3 ? anti-parallel 
BG 3 4 ? anti-parallel 
BH 1 2 ? anti-parallel 
BH 2 3 ? anti-parallel 
BH 3 4 ? anti-parallel 
BI 1 2 ? anti-parallel 
BJ 1 2 ? anti-parallel 
BK 1 2 ? anti-parallel 
BL 1 2 ? parallel      
BL 2 3 ? parallel      
BM 1 2 ? anti-parallel 
BM 2 3 ? anti-parallel 
BN 1 2 ? anti-parallel 
BN 2 3 ? anti-parallel 
BO 1 2 ? anti-parallel 
BO 2 3 ? parallel      
BO 3 4 ? anti-parallel 
BP 1 2 ? anti-parallel 
BP 2 3 ? anti-parallel 
BP 3 4 ? anti-parallel 
BP 4 5 ? anti-parallel 
BQ 1 2 ? anti-parallel 
BR 1 2 ? anti-parallel 
BR 2 3 ? anti-parallel 
BS 1 2 ? anti-parallel 
BS 2 3 ? anti-parallel 
BS 3 4 ? parallel      
BS 4 5 ? anti-parallel 
BS 5 6 ? anti-parallel 
BT 1 2 ? anti-parallel 
BU 1 2 ? anti-parallel 
BU 2 3 ? anti-parallel 
BV 1 2 ? anti-parallel 
BV 2 3 ? anti-parallel 
BV 3 4 ? anti-parallel 
BW 1 2 ? anti-parallel 
BX 1 2 ? anti-parallel 
BY 1 2 ? anti-parallel 
BY 2 3 ? anti-parallel 
BY 3 4 ? anti-parallel 
BY 4 5 ? parallel      
BY 5 6 ? anti-parallel 
BY 6 7 ? parallel      
BY 7 8 ? anti-parallel 
BZ 1 2 ? anti-parallel 
BZ 2 3 ? anti-parallel 
BZ 3 4 ? anti-parallel 
BZ 4 5 ? anti-parallel 
CA 1 2 ? anti-parallel 
CB 1 2 ? anti-parallel 
CC 1 2 ? anti-parallel 
CD 1 2 ? anti-parallel 
CD 2 3 ? anti-parallel 
CD 3 4 ? anti-parallel 
CE 1 2 ? anti-parallel 
CF 1 2 ? anti-parallel 
CF 2 3 ? anti-parallel 
CG 1 2 ? anti-parallel 
CG 2 3 ? anti-parallel 
CG 3 4 ? anti-parallel 
CH 1 2 ? anti-parallel 
CI 1 2 ? anti-parallel 
CI 2 3 ? anti-parallel 
CI 3 4 ? anti-parallel 
CI 4 5 ? anti-parallel 
CJ 1 2 ? anti-parallel 
CJ 2 3 ? anti-parallel 
CK 1 2 ? anti-parallel 
CK 2 3 ? anti-parallel 
CL 1 2 ? anti-parallel 
CL 2 3 ? anti-parallel 
CL 3 4 ? anti-parallel 
CM 1 2 ? anti-parallel 
CN 1 2 ? anti-parallel 
CN 2 3 ? anti-parallel 
CN 3 4 ? anti-parallel 
CO 1 2 ? anti-parallel 
CP 1 2 ? anti-parallel 
CP 2 3 ? parallel      
CQ 1 2 ? parallel      
CQ 2 3 ? anti-parallel 
CQ 3 4 ? parallel      
CQ 4 5 ? anti-parallel 
CQ 5 6 ? anti-parallel 
CQ 6 7 ? anti-parallel 
CR 1 2 ? parallel      
CR 2 3 ? anti-parallel 
CS 1 2 ? parallel      
CS 2 3 ? anti-parallel 
CT 1 2 ? parallel      
CU 1 2 ? anti-parallel 
CV 1 2 ? anti-parallel 
CW 1 2 ? anti-parallel 
CX 1 2 ? parallel      
CY 1 2 ? anti-parallel 
CY 2 3 ? anti-parallel 
CY 3 4 ? anti-parallel 
CZ 1 2 ? anti-parallel 
CZ 2 3 ? anti-parallel 
DA 1 2 ? anti-parallel 
DB 1 2 ? anti-parallel 
DC 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 VAL A 10   ? GLN A 16   ? VAL A 10   GLN A 16   
A  2 TYR A 20   ? LEU A 28   ? TYR A 20   LEU A 28   
A  3 LEU A 192  ? THR A 201  ? LEU A 192  THR A 201  
A  4 VAL A 174  ? THR A 184  ? VAL A 174  THR A 184  
B  1 THR A 96   ? GLU A 104  ? THR A 96   GLU A 104  
B  2 ARG A 137  ? GLY A 147  ? ARG A 137  GLY A 147  
B  3 GLY A 50   ? ILE A 58   ? GLY A 50   ILE A 58   
B  4 ILE A 165  ? PRO A 166  ? ILE A 165  PRO A 166  
C  1 VAL A 87   ? PHE A 89   ? VAL A 87   PHE A 89   
C  2 VAL A 120  ? ILE A 122  ? VAL A 120  ILE A 122  
D  1 GLU A 108  ? LYS A 110  ? GLU A 108  LYS A 110  
D  2 HIS A 128  ? THR A 131  ? HIS A 128  THR A 131  
E  1 TYR A 150  ? VAL A 151  ? TYR A 150  VAL A 151  
E  2 ALA A 169  ? VAL A 170  ? ALA A 169  VAL A 170  
F  1 VAL B 10   ? GLN B 16   ? VAL B 10   GLN B 16   
F  2 TYR B 20   ? LEU B 28   ? TYR B 20   LEU B 28   
F  3 ARG B 189  ? THR B 201  ? ARG B 189  THR B 201  
F  4 VAL B 174  ? LEU B 186  ? VAL B 174  LEU B 186  
G  1 THR B 96   ? GLU B 104  ? THR B 96   GLU B 104  
G  2 ARG B 137  ? VAL B 148  ? ARG B 137  VAL B 148  
G  3 PRO B 49   ? ILE B 58   ? PRO B 49   ILE B 58   
G  4 ALA B 164  ? PRO B 166  ? ALA B 164  PRO B 166  
H  1 VAL B 87   ? PHE B 89   ? VAL B 87   PHE B 89   
H  2 VAL B 120  ? ILE B 122  ? VAL B 120  ILE B 122  
I  1 LYS B 107  ? LYS B 110  ? LYS B 107  LYS B 110  
I  2 HIS B 128  ? LEU B 132  ? HIS B 128  LEU B 132  
J  1 TYR B 150  ? VAL B 151  ? TYR B 150  VAL B 151  
J  2 ALA B 169  ? VAL B 170  ? ALA B 169  VAL B 170  
K  1 GLU C 2    ? ARG C 5    ? GLU C 2    ARG C 5    
K  2 GLN C 899  ? ILE C 902  ? GLN C 899  ILE C 902  
K  3 VAL C 579  ? MET C 580  ? VAL C 579  MET C 580  
L  1 VAL C 65   ? LEU C 73   ? VAL C 65   LEU C 73   
L  2 GLN C 91   ? ILE C 101  ? GLN C 91   ILE C 101  
L  3 ILE C 108  ? PRO C 119  ? ILE C 108  PRO C 119  
M  1 PHE C 127  ? ILE C 129  ? PHE C 127  ILE C 129  
M  2 ALA C 132  ? ILE C 136  ? ALA C 132  ILE C 136  
M  3 SER C 392  ? PHE C 394  ? SER C 392  PHE C 394  
N  1 ARG C 331  ? ARG C 334  ? ARG C 331  ARG C 334  
N  2 SER C 138  ? ARG C 142  ? SER C 138  ARG C 142  
N  3 ARG C 409  ? SER C 411  ? ARG C 409  SER C 411  
N  4 THR C 453  ? SER C 454  ? THR C 453  SER C 454  
O  1 GLY C 145  ? PRO C 150  ? GLY C 145  PRO C 150  
O  2 TYR C 158  ? ILE C 163  ? TYR C 158  ILE C 163  
O  3 ILE C 172  ? GLU C 175  ? ILE C 172  GLU C 175  
O  4 SER C 183  ? VAL C 186  ? SER C 183  VAL C 186  
O  5 ARG C 189  ? PRO C 192  ? ARG C 189  PRO C 192  
P  1 ALA C 291  ? GLU C 294  ? ALA C 291  GLU C 294  
P  2 GLU C 297  ? ASP C 300  ? GLU C 297  ASP C 300  
Q  1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
Q  2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
Q  3 VAL C 478  ? MET C 486  ? VAL C 478  MET C 486  
R  1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
R  2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
R  3 PHE C 531  ? ASP C 533  ? PHE C 531  ASP C 533  
R  4 THR C 495  ? ALA C 497  ? THR C 495  ALA C 497  
R  5 VAL C 513  ? ARG C 517  ? VAL C 513  ARG C 517  
R  6 GLU C 520  ? VAL C 524  ? GLU C 520  VAL C 524  
S  1 LEU C 503  ? GLU C 504  ? LEU C 503  GLU C 504  
S  2 ARG C 507  ? ILE C 508  ? ARG C 507  ILE C 508  
T  1 LEU C 595  ? TYR C 596  ? LEU C 595  TYR C 596  
T  2 LEU C 654  ? ASP C 657  ? LEU C 654  ASP C 657  
T  3 ARG C 640  ? PRO C 641  ? ARG C 640  PRO C 641  
U  1 LEU C 620  ? PRO C 624  ? LEU C 620  PRO C 624  
U  2 ARG C 610  ? TYR C 615  ? ARG C 610  TYR C 615  
U  3 GLY C 601  ? VAL C 606  ? GLY C 601  VAL C 606  
U  4 ARG C 648  ? VAL C 649  ? ARG C 648  VAL C 649  
V  1 TYR C 629  ? ARG C 630  ? TYR C 629  ARG C 630  
V  2 ALA C 636  ? LEU C 637  ? ALA C 636  LEU C 637  
W  1 SER C 661  ? GLU C 662  ? SER C 661  GLU C 662  
W  2 PHE C 665  ? LEU C 666  ? PHE C 665  LEU C 666  
X  1 LYS C 971  ? VAL C 972  ? LYS C 971  VAL C 972  
X  2 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
X  3 LYS C 838  ? ALA C 840  ? LYS C 838  ALA C 840  
X  4 LYS C 846  ? LEU C 853  ? LYS C 846  LEU C 853  
X  5 ILE C 688  ? SER C 691  ? ILE C 688  SER C 691  
X  6 VAL C 869  ? LEU C 871  ? VAL C 869  LEU C 871  
X  7 GLN C 670  ? ILE C 676  ? GLN C 670  ILE C 676  
X  8 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
Y  1 GLY C 718  ? PRO C 719  ? GLY C 718  PRO C 719  
Y  2 SER C 702  ? THR C 715  ? SER C 702  THR C 715  
Y  3 VAL C 819  ? ARG C 831  ? VAL C 819  ARG C 831  
Y  4 GLY C 798  ? ARG C 807  ? GLY C 798  ARG C 807  
Y  5 GLU C 748  ? VAL C 749  ? GLU C 748  VAL C 749  
Z  1 ILE C 754  ? VAL C 756  ? ILE C 754  VAL C 756  
Z  2 LEU C 790  ? ARG C 791  ? LEU C 790  ARG C 791  
AA 1 THR C 759  ? PHE C 761  ? THR C 759  PHE C 761  
AA 2 VAL C 785  ? ASP C 787  ? VAL C 785  ASP C 787  
AB 1 ARG C 1031 ? PHE C 1032 ? ARG C 1031 PHE C 1032 
AB 2 LYS D 621  ? ARG D 622  ? LYS D 621  ARG D 622  
AC 1 PRO C 1108 ? VAL C 1109 ? PRO C 1108 VAL C 1109 
AC 2 LEU C 1097 ? LEU C 1102 ? LEU C 1097 LEU C 1102 
AC 3 LYS D 7    ? LEU D 12   ? LYS D 7    LEU D 12   
AC 4 LYS D 1456 ? ASP D 1457 ? LYS D 1456 ASP D 1457 
AD 1 SER D 22   ? GLU D 25   ? SER D 22   GLU D 25   
AD 2 MET D 90   ? ALA D 100  ? MET D 90   ALA D 100  
AD 3 ILE D 513  ? VAL D 519  ? ILE D 513  VAL D 519  
AE 1 LEU D 152  ? LEU D 153  ? LEU D 152  LEU D 153  
AE 2 TYR D 132  ? ASP D 136  ? TYR D 132  ASP D 136  
AE 3 ASP D 453  ? ARG D 455  ? ASP D 453  ARG D 455  
AF 1 GLN D 166  ? PRO D 170  ? GLN D 166  PRO D 170  
AF 2 SER D 392  ? VAL D 396  ? SER D 392  VAL D 396  
AF 3 GLY D 201  ? ARG D 206  ? GLY D 201  ARG D 206  
AF 4 GLU D 184  ? VAL D 185  ? GLU D 184  VAL D 185  
AG 1 GLU D 190  ? ALA D 192  ? GLU D 190  ALA D 192  
AG 2 VAL D 195  ? VAL D 196  ? VAL D 195  VAL D 196  
AH 1 VAL D 317  ? GLU D 327  ? VAL D 317  GLU D 327  
AH 2 THR D 330  ? ARG D 346  ? THR D 330  ARG D 346  
AH 3 ARG D 210  ? PRO D 226  ? ARG D 210  PRO D 226  
AH 4 GLY D 383  ? LEU D 387  ? GLY D 383  LEU D 387  
AH 5 ALA D 359  ? VAL D 361  ? ALA D 359  VAL D 361  
AI 1 ILE D 241  ? GLU D 244  ? ILE D 241  GLU D 244  
AI 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AI 3 TYR D 249  ? ARG D 252  ? TYR D 249  ARG D 252  
AJ 1 ILE D 241  ? GLU D 244  ? ILE D 241  GLU D 244  
AJ 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AJ 3 VAL D 286  ? PRO D 290  ? VAL D 286  PRO D 290  
AK 1 GLU D 277  ? LEU D 284  ? GLU D 277  LEU D 284  
AK 2 ALA D 268  ? ARG D 274  ? ALA D 268  ARG D 274  
AK 3 GLY D 257  ? GLU D 263  ? GLY D 257  GLU D 263  
AK 4 ILE D 297  ? VAL D 298  ? ILE D 297  VAL D 298  
AL 1 ASN D 352  ? VAL D 353  ? ASN D 352  VAL D 353  
AL 2 VAL D 368  ? ALA D 369  ? VAL D 368  ALA D 369  
AM 1 ALA D 398  ? PRO D 402  ? ALA D 398  PRO D 402  
AM 2 VAL D 443  ? GLU D 448  ? VAL D 443  GLU D 448  
AM 3 GLY D 433  ? ASP D 438  ? GLY D 433  ASP D 438  
AM 4 ARG D 414  ? VAL D 415  ? ARG D 414  VAL D 415  
AN 1 VAL D 420  ? ALA D 422  ? VAL D 420  ALA D 422  
AN 2 VAL D 427  ? LYS D 428  ? VAL D 427  LYS D 428  
AO 1 MET D 527  ? GLN D 529  ? MET D 527  GLN D 529  
AO 2 PHE D 535  ? THR D 537  ? PHE D 535  THR D 537  
AO 3 VAL F 335  ? SER F 336  ? VAL F 315  SER F 316  
AP 1 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AP 2 ILE D 726  ? LEU D 728  ? ILE D 726  LEU D 728  
AP 3 GLN D 641  ? PRO D 645  ? GLN D 641  PRO D 645  
AP 4 ILE D 713  ? VAL D 721  ? ILE D 713  VAL D 721  
AP 5 VAL D 700  ? ASN D 703  ? VAL D 700  ASN D 703  
AP 6 GLN D 744  ? HIS D 748  ? GLN D 744  HIS D 748  
AP 7 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AQ 1 GLU D 805  ? PHE D 806  ? GLU D 805  PHE D 806  
AQ 2 ILE D 827  ? VAL D 829  ? ILE D 827  VAL D 829  
AQ 3 GLU D 833  ? THR D 834  ? GLU D 833  THR D 834  
AR 1 VAL D 842  ? PHE D 843  ? VAL D 842  PHE D 843  
AR 2 VAL D 864  ? TYR D 868  ? VAL D 864  TYR D 868  
AR 3 LYS D 871  ? THR D 875  ? LYS D 871  THR D 875  
AS 1 VAL D 1106 ? GLU D 1109 ? VAL D 1106 GLU D 1109 
AS 2 GLY D 1199 ? CYS D 1201 ? GLY D 1199 CYS D 1201 
AT 1 ILE D 1118 ? PRO D 1121 ? ILE D 1118 PRO D 1121 
AT 2 GLU D 1185 ? VAL D 1188 ? GLU D 1185 VAL D 1188 
AU 1 PHE D 1123 ? ASP D 1126 ? PHE D 1123 ASP D 1126 
AU 2 SER D 1131 ? LEU D 1134 ? SER D 1131 LEU D 1134 
AV 1 VAL D 1153 ? VAL D 1155 ? VAL D 1153 VAL D 1155 
AV 2 VAL D 1158 ? LEU D 1160 ? VAL D 1158 LEU D 1160 
AW 1 SER D 1300 ? TYR D 1303 ? SER D 1300 TYR D 1303 
AW 2 LEU D 1290 ? GLU D 1295 ? LEU D 1290 GLU D 1295 
AW 3 GLY D 1279 ? GLU D 1285 ? GLY D 1279 GLU D 1285 
AW 4 TYR D 1318 ? VAL D 1319 ? TYR D 1318 VAL D 1319 
AX 1 VAL D 1394 ? GLU D 1396 ? VAL D 1394 GLU D 1396 
AX 2 TYR D 1378 ? ASP D 1383 ? TYR D 1378 ASP D 1383 
AX 3 ALA D 1416 ? LEU D 1420 ? ALA D 1416 LEU D 1420 
AY 1 GLN D 1485 ? ASP D 1488 ? GLN D 1485 ASP D 1488 
AY 2 LEU E 73   ? GLY E 76   ? LEU E 73   GLY E 76   
AZ 1 LYS E 47   ? GLN E 49   ? LYS E 47   GLN E 49   
AZ 2 LEU E 54   ? ASP E 56   ? LEU E 54   ASP E 56   
BA 1 PRO F 340  ? ILE F 341  ? PRO F 320  ILE F 321  
BA 2 SER F 347  ? PHE F 348  ? SER F 327  PHE F 328  
BB 1 VAL J 10   ? GLN J 16   ? VAL K 10   GLN K 16   
BB 2 TYR J 20   ? LEU J 28   ? TYR K 20   LEU K 28   
BB 3 LEU J 192  ? THR J 201  ? LEU K 192  THR K 201  
BB 4 VAL J 174  ? THR J 184  ? VAL K 174  THR K 184  
BC 1 THR J 96   ? GLU J 104  ? THR K 96   GLU K 104  
BC 2 ARG J 137  ? GLY J 147  ? ARG K 137  GLY K 147  
BC 3 GLY J 50   ? ILE J 58   ? GLY K 50   ILE K 58   
BC 4 ILE J 165  ? PRO J 166  ? ILE K 165  PRO K 166  
BD 1 VAL J 87   ? PHE J 89   ? VAL K 87   PHE K 89   
BD 2 VAL J 120  ? ILE J 122  ? VAL K 120  ILE K 122  
BE 1 GLU J 108  ? LYS J 110  ? GLU K 108  LYS K 110  
BE 2 HIS J 128  ? THR J 131  ? HIS K 128  THR K 131  
BF 1 TYR J 150  ? VAL J 151  ? TYR K 150  VAL K 151  
BF 2 ALA J 169  ? VAL J 170  ? ALA K 169  VAL K 170  
BG 1 VAL K 10   ? GLN K 16   ? VAL L 10   GLN L 16   
BG 2 TYR K 20   ? LEU K 28   ? TYR L 20   LEU L 28   
BG 3 ARG K 189  ? THR K 201  ? ARG L 189  THR L 201  
BG 4 VAL K 174  ? LEU K 186  ? VAL L 174  LEU L 186  
BH 1 THR K 96   ? GLU K 104  ? THR L 96   GLU L 104  
BH 2 ARG K 137  ? VAL K 148  ? ARG L 137  VAL L 148  
BH 3 PRO K 49   ? ILE K 58   ? PRO L 49   ILE L 58   
BH 4 ALA K 164  ? PRO K 166  ? ALA L 164  PRO L 166  
BI 1 VAL K 87   ? PHE K 89   ? VAL L 87   PHE L 89   
BI 2 VAL K 120  ? ILE K 122  ? VAL L 120  ILE L 122  
BJ 1 LYS K 107  ? LYS K 110  ? LYS L 107  LYS L 110  
BJ 2 HIS K 128  ? LEU K 132  ? HIS L 128  LEU L 132  
BK 1 TYR K 150  ? VAL K 151  ? TYR L 150  VAL L 151  
BK 2 ALA K 169  ? VAL K 170  ? ALA L 169  VAL L 170  
BL 1 GLU L 2    ? ARG L 5    ? GLU M 2    ARG M 5    
BL 2 GLN L 899  ? ILE L 902  ? GLN M 899  ILE M 902  
BL 3 VAL L 579  ? MET L 580  ? VAL M 579  MET M 580  
BM 1 VAL L 65   ? LEU L 73   ? VAL M 65   LEU M 73   
BM 2 GLN L 91   ? ILE L 101  ? GLN M 91   ILE M 101  
BM 3 ILE L 108  ? PRO L 119  ? ILE M 108  PRO M 119  
BN 1 PHE L 127  ? ILE L 129  ? PHE M 127  ILE M 129  
BN 2 ALA L 132  ? ILE L 136  ? ALA M 132  ILE M 136  
BN 3 SER L 392  ? PHE L 394  ? SER M 392  PHE M 394  
BO 1 ARG L 331  ? ARG L 334  ? ARG M 331  ARG M 334  
BO 2 SER L 138  ? ARG L 142  ? SER M 138  ARG M 142  
BO 3 ARG L 409  ? SER L 411  ? ARG M 409  SER M 411  
BO 4 THR L 453  ? SER L 454  ? THR M 453  SER M 454  
BP 1 GLY L 145  ? PRO L 150  ? GLY M 145  PRO M 150  
BP 2 TYR L 158  ? ILE L 163  ? TYR M 158  ILE M 163  
BP 3 ILE L 172  ? GLU L 175  ? ILE M 172  GLU M 175  
BP 4 SER L 183  ? VAL L 186  ? SER M 183  VAL M 186  
BP 5 ARG L 189  ? PRO L 192  ? ARG M 189  PRO M 192  
BQ 1 ALA L 291  ? GLU L 294  ? ALA M 291  GLU M 294  
BQ 2 GLU L 297  ? ASP L 300  ? GLU M 297  ASP M 300  
BR 1 ARG L 460  ? VAL L 461  ? ARG M 460  VAL M 461  
BR 2 ILE L 467  ? VAL L 475  ? ILE M 467  VAL M 475  
BR 3 VAL L 478  ? THR L 487  ? VAL M 478  THR M 487  
BS 1 ARG L 460  ? VAL L 461  ? ARG M 460  VAL M 461  
BS 2 ILE L 467  ? VAL L 475  ? ILE M 467  VAL M 475  
BS 3 PHE L 531  ? ASP L 533  ? PHE M 531  ASP M 533  
BS 4 THR L 495  ? ALA L 497  ? THR M 495  ALA M 497  
BS 5 VAL L 513  ? ARG L 517  ? VAL M 513  ARG M 517  
BS 6 GLU L 520  ? VAL L 524  ? GLU M 520  VAL M 524  
BT 1 LEU L 503  ? GLU L 504  ? LEU M 503  GLU M 504  
BT 2 ARG L 507  ? ILE L 508  ? ARG M 507  ILE M 508  
BU 1 LEU L 595  ? TYR L 596  ? LEU M 595  TYR M 596  
BU 2 LEU L 654  ? ASP L 657  ? LEU M 654  ASP M 657  
BU 3 ARG L 640  ? PRO L 641  ? ARG M 640  PRO M 641  
BV 1 LEU L 620  ? PRO L 624  ? LEU M 620  PRO M 624  
BV 2 ARG L 610  ? TYR L 615  ? ARG M 610  TYR M 615  
BV 3 GLY L 601  ? VAL L 606  ? GLY M 601  VAL M 606  
BV 4 ARG L 648  ? VAL L 649  ? ARG M 648  VAL M 649  
BW 1 TYR L 629  ? ARG L 630  ? TYR M 629  ARG M 630  
BW 2 ALA L 636  ? LEU L 637  ? ALA M 636  LEU M 637  
BX 1 SER L 661  ? GLU L 662  ? SER M 661  GLU M 662  
BX 2 PHE L 665  ? LEU L 666  ? PHE M 665  LEU M 666  
BY 1 LYS L 971  ? VAL L 972  ? LYS M 971  VAL M 972  
BY 2 ILE L 987  ? LYS L 996  ? ILE M 987  LYS M 996  
BY 3 LYS L 838  ? ALA L 840  ? LYS M 838  ALA M 840  
BY 4 LYS L 846  ? LEU L 853  ? LYS M 846  LEU M 853  
BY 5 ILE L 688  ? SER L 691  ? ILE M 688  SER M 691  
BY 6 VAL L 869  ? LEU L 871  ? VAL M 869  LEU M 871  
BY 7 GLN L 670  ? ILE L 676  ? GLN M 670  ILE M 676  
BY 8 ILE L 987  ? LYS L 996  ? ILE M 987  LYS M 996  
BZ 1 GLY L 718  ? PRO L 719  ? GLY M 718  PRO M 719  
BZ 2 SER L 702  ? THR L 715  ? SER M 702  THR M 715  
BZ 3 VAL L 819  ? ARG L 831  ? VAL M 819  ARG M 831  
BZ 4 GLY L 798  ? ARG L 807  ? GLY M 798  ARG M 807  
BZ 5 GLU L 748  ? VAL L 749  ? GLU M 748  VAL M 749  
CA 1 ILE L 754  ? VAL L 756  ? ILE M 754  VAL M 756  
CA 2 LEU L 790  ? ARG L 791  ? LEU M 790  ARG M 791  
CB 1 THR L 759  ? PHE L 761  ? THR M 759  PHE M 761  
CB 2 VAL L 785  ? ASP L 787  ? VAL M 785  ASP M 787  
CC 1 ARG L 1031 ? PHE L 1032 ? ARG M 1031 PHE M 1032 
CC 2 LYS M 621  ? ARG M 622  ? LYS N 621  ARG N 622  
CD 1 PRO L 1108 ? VAL L 1109 ? PRO M 1108 VAL M 1109 
CD 2 LEU L 1097 ? LEU L 1102 ? LEU M 1097 LEU M 1102 
CD 3 LYS M 7    ? LEU M 12   ? LYS N 7    LEU N 12   
CD 4 LYS M 1456 ? ASP M 1457 ? LYS N 1456 ASP N 1457 
CE 1 GLY M 91   ? ALA M 100  ? GLY N 91   ALA N 100  
CE 2 ILE M 513  ? VAL M 519  ? ILE N 513  VAL N 519  
CF 1 LEU M 152  ? LEU M 153  ? LEU N 152  LEU N 153  
CF 2 TYR M 132  ? ASP M 136  ? TYR N 132  ASP N 136  
CF 3 ASP M 453  ? ARG M 455  ? ASP N 453  ARG N 455  
CG 1 GLN M 166  ? PRO M 170  ? GLN N 166  PRO N 170  
CG 2 PRO M 390  ? VAL M 396  ? PRO N 390  VAL N 396  
CG 3 GLY M 201  ? PRO M 208  ? GLY N 201  PRO N 208  
CG 4 GLU M 184  ? VAL M 185  ? GLU N 184  VAL N 185  
CH 1 GLU M 190  ? ALA M 192  ? GLU N 190  ALA N 192  
CH 2 VAL M 195  ? VAL M 196  ? VAL N 195  VAL N 196  
CI 1 VAL M 317  ? GLU M 327  ? VAL N 317  GLU N 327  
CI 2 THR M 330  ? ARG M 346  ? THR N 330  ARG N 346  
CI 3 ARG M 210  ? PRO M 226  ? ARG N 210  PRO N 226  
CI 4 GLY M 383  ? LEU M 387  ? GLY N 383  LEU N 387  
CI 5 ALA M 359  ? VAL M 361  ? ALA N 359  VAL N 361  
CJ 1 ILE M 241  ? GLU M 244  ? ILE N 241  GLU N 244  
CJ 2 PRO M 303  ? ARG M 312  ? PRO N 303  ARG N 312  
CJ 3 TYR M 249  ? ARG M 252  ? TYR N 249  ARG N 252  
CK 1 ILE M 241  ? GLU M 244  ? ILE N 241  GLU N 244  
CK 2 PRO M 303  ? ARG M 312  ? PRO N 303  ARG N 312  
CK 3 VAL M 286  ? PRO M 290  ? VAL N 286  PRO N 290  
CL 1 GLU M 277  ? LEU M 284  ? GLU N 277  LEU N 284  
CL 2 ALA M 268  ? ARG M 274  ? ALA N 268  ARG N 274  
CL 3 GLY M 257  ? GLU M 263  ? GLY N 257  GLU N 263  
CL 4 ILE M 297  ? VAL M 298  ? ILE N 297  VAL N 298  
CM 1 ASN M 352  ? VAL M 353  ? ASN N 352  VAL N 353  
CM 2 VAL M 368  ? ALA M 369  ? VAL N 368  ALA N 369  
CN 1 ALA M 398  ? PRO M 402  ? ALA N 398  PRO N 402  
CN 2 VAL M 443  ? GLU M 448  ? VAL N 443  GLU N 448  
CN 3 GLY M 433  ? ASP M 438  ? GLY N 433  ASP N 438  
CN 4 ARG M 414  ? VAL M 415  ? ARG N 414  VAL N 415  
CO 1 VAL M 420  ? ALA M 422  ? VAL N 420  ALA N 422  
CO 2 VAL M 427  ? LYS M 428  ? VAL N 427  LYS N 428  
CP 1 MET M 527  ? GLN M 529  ? MET N 527  GLN N 529  
CP 2 PHE M 535  ? THR M 537  ? PHE N 535  THR N 537  
CP 3 VAL O 335  ? SER O 336  ? VAL P 315  SER P 316  
CQ 1 SER M 626  ? VAL M 633  ? SER N 626  VAL N 633  
CQ 2 ILE M 726  ? LEU M 728  ? ILE N 726  LEU N 728  
CQ 3 GLN M 641  ? PRO M 645  ? GLN N 641  PRO N 645  
CQ 4 ILE M 713  ? VAL M 721  ? ILE N 713  VAL N 721  
CQ 5 VAL M 700  ? ASN M 703  ? VAL N 700  ASN N 703  
CQ 6 GLN M 744  ? HIS M 748  ? GLN N 744  HIS N 748  
CQ 7 SER M 626  ? VAL M 633  ? SER N 626  VAL N 633  
CR 1 GLU M 805  ? PHE M 806  ? GLU N 805  PHE N 806  
CR 2 PRO M 826  ? VAL M 829  ? PRO N 826  VAL N 829  
CR 3 GLU M 833  ? SER M 835  ? GLU N 833  SER N 835  
CS 1 VAL M 842  ? PHE M 843  ? VAL N 842  PHE N 843  
CS 2 VAL M 864  ? TYR M 868  ? VAL N 864  TYR N 868  
CS 3 LYS M 871  ? THR M 875  ? LYS N 871  THR N 875  
CT 1 VAL M 1106 ? GLU M 1109 ? VAL N 1106 GLU N 1109 
CT 2 GLY M 1199 ? CYS M 1201 ? GLY N 1199 CYS N 1201 
CU 1 ILE M 1118 ? PRO M 1121 ? ILE N 1118 PRO N 1121 
CU 2 GLU M 1185 ? VAL M 1188 ? GLU N 1185 VAL N 1188 
CV 1 PHE M 1123 ? ASP M 1126 ? PHE N 1123 ASP N 1126 
CV 2 SER M 1131 ? LEU M 1134 ? SER N 1131 LEU N 1134 
CW 1 VAL M 1153 ? VAL M 1155 ? VAL N 1153 VAL N 1155 
CW 2 VAL M 1158 ? LEU M 1160 ? VAL N 1158 LEU N 1160 
CX 1 LYS M 1271 ? ALA M 1272 ? LYS N 1271 ALA N 1272 
CX 2 ALA M 1329 ? ILE M 1330 ? ALA N 1329 ILE N 1330 
CY 1 SER M 1300 ? LYS M 1304 ? SER N 1300 LYS N 1304 
CY 2 LEU M 1290 ? GLU M 1295 ? LEU N 1290 GLU N 1295 
CY 3 GLY M 1279 ? GLU M 1285 ? GLY N 1279 GLU N 1285 
CY 4 TYR M 1318 ? VAL M 1319 ? TYR N 1318 VAL N 1319 
CZ 1 VAL M 1394 ? GLU M 1396 ? VAL N 1394 GLU N 1396 
CZ 2 TYR M 1378 ? ASP M 1383 ? TYR N 1378 ASP N 1383 
CZ 3 ALA M 1416 ? LEU M 1420 ? ALA N 1416 LEU N 1420 
DA 1 GLN M 1485 ? ASP M 1488 ? GLN N 1485 ASP N 1488 
DA 2 LEU N 73   ? GLY N 76   ? LEU O 73   GLY O 76   
DB 1 LYS N 47   ? GLN N 49   ? LYS O 47   GLN O 49   
DB 2 LEU N 54   ? ASP N 56   ? LEU O 54   ASP O 56   
DC 1 PRO O 340  ? ILE O 341  ? PRO P 320  ILE P 321  
DC 2 SER O 347  ? PHE O 348  ? SER P 327  PHE P 328  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N ARG A 14   ? N ARG A 14   O GLU A 22   ? O GLU A 22   
A  2 3 N LEU A 25   ? N LEU A 25   O LEU A 195  ? O LEU A 195  
A  3 4 O LEU A 192  ? O LEU A 192  N THR A 184  ? N THR A 184  
B  1 2 N VAL A 97   ? N VAL A 97   O VAL A 144  ? O VAL A 144  
B  2 3 O ASP A 145  ? O ASP A 145  N ALA A 52   ? N ALA A 52   
B  3 4 N VAL A 56   ? N VAL A 56   O ILE A 165  ? O ILE A 165  
C  1 2 N ARG A 88   ? N ARG A 88   O GLU A 121  ? O GLU A 121  
D  1 2 N VAL A 109  ? N VAL A 109  O ILE A 129  ? O ILE A 129  
E  1 2 N VAL A 151  ? N VAL A 151  O ALA A 169  ? O ALA A 169  
F  1 2 N ARG B 14   ? N ARG B 14   O GLU B 22   ? O GLU B 22   
F  2 3 N LEU B 28   ? N LEU B 28   O ASP B 193  ? O ASP B 193  
F  3 4 O TRP B 200  ? O TRP B 200  N ARG B 175  ? N ARG B 175  
G  1 2 N ALA B 103  ? N ALA B 103  O LEU B 138  ? O LEU B 138  
G  2 3 O ARG B 143  ? O ARG B 143  N SER B 55   ? N SER B 55   
G  3 4 N VAL B 56   ? N VAL B 56   O ILE B 165  ? O ILE B 165  
H  1 2 N ARG B 88   ? N ARG B 88   O GLU B 121  ? O GLU B 121  
I  1 2 N VAL B 109  ? N VAL B 109  O ILE B 129  ? O ILE B 129  
J  1 2 N VAL B 151  ? N VAL B 151  O ALA B 169  ? O ALA B 169  
K  1 2 N GLU C 2    ? N GLU C 2    O ARG C 900  ? O ARG C 900  
K  2 3 O TYR C 901  ? O TYR C 901  N MET C 580  ? N MET C 580  
L  1 2 N ARG C 72   ? N ARG C 72   O TYR C 95   ? O TYR C 95   
L  2 3 N LEU C 94   ? N LEU C 94   O GLY C 116  ? O GLY C 116  
M  1 2 N PHE C 127  ? N PHE C 127  O ARG C 134  ? O ARG C 134  
M  2 3 N VAL C 135  ? N VAL C 135  O GLN C 393  ? O GLN C 393  
N  1 2 O ARG C 334  ? O ARG C 334  N GLN C 139  ? N GLN C 139  
N  2 3 N ILE C 140  ? N ILE C 140  O SER C 411  ? O SER C 411  
N  3 4 N ILE C 410  ? N ILE C 410  O THR C 453  ? O THR C 453  
O  1 2 N GLY C 145  ? N GLY C 145  O ILE C 163  ? O ILE C 163  
O  2 3 N ALA C 160  ? N ALA C 160  O LEU C 174  ? O LEU C 174  
O  3 4 N GLU C 175  ? N GLU C 175  O SER C 183  ? O SER C 183  
O  4 5 N MET C 184  ? N MET C 184  O PHE C 191  ? O PHE C 191  
P  1 2 N ARG C 292  ? N ARG C 292  O LYS C 299  ? O LYS C 299  
Q  1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
Q  2 3 N THR C 469  ? N THR C 469  O MET C 486  ? O MET C 486  
R  1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
R  2 3 N ARG C 472  ? N ARG C 472  O MET C 532  ? O MET C 532  
R  3 4 O ASP C 533  ? O ASP C 533  N ALA C 497  ? N ALA C 497  
R  4 5 N ILE C 496  ? N ILE C 496  O ARG C 516  ? O ARG C 516  
R  5 6 N VAL C 513  ? N VAL C 513  O VAL C 524  ? O VAL C 524  
S  1 2 N GLU C 504  ? N GLU C 504  O ARG C 507  ? O ARG C 507  
T  1 2 N LEU C 595  ? N LEU C 595  O LEU C 655  ? O LEU C 655  
T  2 3 O ASP C 657  ? O ASP C 657  N ARG C 640  ? N ARG C 640  
U  1 2 O VAL C 621  ? O VAL C 621  N VAL C 613  ? N VAL C 613  
U  2 3 O ARG C 614  ? O ARG C 614  N GLU C 602  ? N GLU C 602  
U  3 4 N GLY C 601  ? N GLY C 601  O VAL C 649  ? O VAL C 649  
V  1 2 N TYR C 629  ? N TYR C 629  O LEU C 637  ? O LEU C 637  
W  1 2 N GLU C 662  ? N GLU C 662  O PHE C 665  ? O PHE C 665  
X  1 2 N VAL C 972  ? N VAL C 972  O ILE C 987  ? O ILE C 987  
X  2 3 O MET C 995  ? O MET C 995  N ALA C 840  ? N ALA C 840  
X  3 4 N LEU C 839  ? N LEU C 839  O GLY C 847  ? O GLY C 847  
X  4 5 O LEU C 853  ? O LEU C 853  N ILE C 690  ? N ILE C 690  
X  5 6 N VAL C 689  ? N VAL C 689  O ILE C 870  ? O ILE C 870  
X  6 7 O VAL C 869  ? O VAL C 869  N ALA C 675  ? N ALA C 675  
X  7 8 N VAL C 674  ? N VAL C 674  O GLY C 990  ? O GLY C 990  
Y  1 2 O GLY C 718  ? O GLY C 718  N THR C 715  ? N THR C 715  
Y  2 3 N ALA C 712  ? N ALA C 712  O GLU C 821  ? O GLU C 821  
Y  3 4 O ALA C 828  ? O ALA C 828  N ILE C 799  ? N ILE C 799  
Y  4 5 O GLY C 798  ? O GLY C 798  N VAL C 749  ? N VAL C 749  
Z  1 2 N LEU C 755  ? N LEU C 755  O LEU C 790  ? O LEU C 790  
AA 1 2 N SER C 760  ? N SER C 760  O LYS C 786  ? O LYS C 786  
AB 1 2 N PHE C 1032 ? N PHE C 1032 O LYS D 621  ? O LYS D 621  
AC 1 2 O VAL C 1109 ? O VAL C 1109 N THR C 1101 ? N THR C 1101 
AC 2 3 N ASP C 1098 ? N ASP C 1098 O ALA D 11   ? O ALA D 11   
AC 3 4 N VAL D 8    ? N VAL D 8    O ASP D 1457 ? O ASP D 1457 
AD 1 2 N TYR D 23   ? N TYR D 23   O MET D 90   ? O MET D 90   
AD 2 3 N ALA D 99   ? N ALA D 99   O LEU D 514  ? O LEU D 514  
AE 1 2 O LEU D 153  ? O LEU D 153  N TYR D 132  ? N TYR D 132  
AE 2 3 N LEU D 135  ? N LEU D 135  O ASP D 453  ? O ASP D 453  
AF 1 2 N TYR D 169  ? N TYR D 169  O ILE D 393  ? O ILE D 393  
AF 2 3 O VAL D 396  ? O VAL D 396  N VAL D 202  ? N VAL D 202  
AF 3 4 O GLY D 201  ? O GLY D 201  N VAL D 185  ? N VAL D 185  
AG 1 2 N LEU D 191  ? N LEU D 191  O VAL D 195  ? O VAL D 195  
AH 1 2 N ARG D 318  ? N ARG D 318  O GLU D 338  ? O GLU D 338  
AH 2 3 O TRP D 339  ? O TRP D 339  N LYS D 217  ? N LYS D 217  
AH 3 4 N ARG D 212  ? N ARG D 212  O HIS D 386  ? O HIS D 386  
AH 4 5 O GLY D 383  ? O GLY D 383  N VAL D 361  ? N VAL D 361  
AI 1 2 N LEU D 242  ? N LEU D 242  O LEU D 311  ? O LEU D 311  
AI 2 3 O ALA D 307  ? O ALA D 307  N TYR D 249  ? N TYR D 249  
AJ 1 2 N LEU D 242  ? N LEU D 242  O LEU D 311  ? O LEU D 311  
AJ 2 3 O GLU D 306  ? O GLU D 306  N THR D 289  ? N THR D 289  
AK 1 2 O VAL D 279  ? O VAL D 279  N LEU D 272  ? N LEU D 272  
AK 2 3 O VAL D 271  ? O VAL D 271  N GLU D 260  ? N GLU D 260  
AK 3 4 N GLY D 257  ? N GLY D 257  O VAL D 298  ? O VAL D 298  
AL 1 2 N ASN D 352  ? N ASN D 352  O ALA D 369  ? O ALA D 369  
AM 1 2 N ARG D 399  ? N ARG D 399  O VAL D 446  ? O VAL D 446  
AM 2 3 O VAL D 447  ? O VAL D 447  N ARG D 434  ? N ARG D 434  
AM 3 4 O GLY D 433  ? O GLY D 433  N VAL D 415  ? N VAL D 415  
AN 1 2 N ALA D 422  ? N ALA D 422  O VAL D 427  ? O VAL D 427  
AO 1 2 N VAL D 528  ? N VAL D 528  O ALA D 536  ? O ALA D 536  
AO 2 3 N PHE D 535  ? N PHE D 535  O VAL F 335  ? O VAL F 315  
AP 1 2 N VAL D 632  ? N VAL D 632  O LEU D 728  ? O LEU D 728  
AP 2 3 O GLN D 727  ? O GLN D 727  N GLY D 643  ? N GLY D 643  
AP 3 4 N CYS D 642  ? N CYS D 642  O VAL D 719  ? O VAL D 719  
AP 4 5 O GLN D 714  ? O GLN D 714  N LEU D 702  ? N LEU D 702  
AP 5 6 N LEU D 701  ? N LEU D 701  O HIS D 748  ? O HIS D 748  
AP 6 7 O MET D 745  ? O MET D 745  N SER D 629  ? N SER D 629  
AQ 1 2 N PHE D 806  ? N PHE D 806  O LYS D 828  ? O LYS D 828  
AQ 2 3 N ILE D 827  ? N ILE D 827  O THR D 834  ? O THR D 834  
AR 1 2 N PHE D 843  ? N PHE D 843  O THR D 865  ? O THR D 865  
AR 2 3 N VAL D 866  ? N VAL D 866  O LEU D 873  ? O LEU D 873  
AS 1 2 N ARG D 1108 ? N ARG D 1108 O VAL D 1200 ? O VAL D 1200 
AT 1 2 N ILE D 1118 ? N ILE D 1118 O VAL D 1188 ? O VAL D 1188 
AU 1 2 N ASP D 1126 ? N ASP D 1126 O SER D 1131 ? O SER D 1131 
AV 1 2 N VAL D 1153 ? N VAL D 1153 O LEU D 1160 ? O LEU D 1160 
AW 1 2 O TYR D 1303 ? O TYR D 1303 N VAL D 1292 ? N VAL D 1292 
AW 2 3 O GLU D 1295 ? O GLU D 1295 N VAL D 1280 ? N VAL D 1280 
AW 3 4 N GLY D 1279 ? N GLY D 1279 O VAL D 1319 ? O VAL D 1319 
AX 1 2 O LEU D 1395 ? O LEU D 1395 N VAL D 1379 ? N VAL D 1379 
AX 2 3 N THR D 1382 ? N THR D 1382 O ALA D 1416 ? O ALA D 1416 
AY 1 2 N GLN D 1485 ? N GLN D 1485 O GLY E 76   ? O GLY E 76   
AZ 1 2 N MET E 48   ? N MET E 48   O PHE E 55   ? O PHE E 55   
BA 1 2 N ILE F 341  ? N ILE F 321  O SER F 347  ? O SER F 327  
BB 1 2 N ARG J 14   ? N ARG K 14   O GLU J 22   ? O GLU K 22   
BB 2 3 N LEU J 25   ? N LEU K 25   O LEU J 195  ? O LEU K 195  
BB 3 4 O LEU J 192  ? O LEU K 192  N THR J 184  ? N THR K 184  
BC 1 2 N VAL J 97   ? N VAL K 97   O VAL J 144  ? O VAL K 144  
BC 2 3 O ASP J 145  ? O ASP K 145  N ALA J 52   ? N ALA K 52   
BC 3 4 N VAL J 56   ? N VAL K 56   O ILE J 165  ? O ILE K 165  
BD 1 2 N ARG J 88   ? N ARG K 88   O GLU J 121  ? O GLU K 121  
BE 1 2 N VAL J 109  ? N VAL K 109  O ILE J 129  ? O ILE K 129  
BF 1 2 N VAL J 151  ? N VAL K 151  O ALA J 169  ? O ALA K 169  
BG 1 2 N ARG K 14   ? N ARG L 14   O GLU K 22   ? O GLU L 22   
BG 2 3 N LEU K 28   ? N LEU L 28   O ASP K 193  ? O ASP L 193  
BG 3 4 O TRP K 200  ? O TRP L 200  N ARG K 175  ? N ARG L 175  
BH 1 2 N ALA K 103  ? N ALA L 103  O LEU K 138  ? O LEU L 138  
BH 2 3 O GLY K 147  ? O GLY L 147  N GLY K 50   ? N GLY L 50   
BH 3 4 N VAL K 56   ? N VAL L 56   O ILE K 165  ? O ILE L 165  
BI 1 2 N ARG K 88   ? N ARG L 88   O GLU K 121  ? O GLU L 121  
BJ 1 2 N VAL K 109  ? N VAL L 109  O ILE K 129  ? O ILE L 129  
BK 1 2 N VAL K 151  ? N VAL L 151  O ALA K 169  ? O ALA L 169  
BL 1 2 N GLU L 2    ? N GLU M 2    O ARG L 900  ? O ARG M 900  
BL 2 3 O TYR L 901  ? O TYR M 901  N MET L 580  ? N MET M 580  
BM 1 2 N ARG L 72   ? N ARG M 72   O TYR L 95   ? O TYR M 95   
BM 2 3 N LEU L 94   ? N LEU M 94   O GLY L 116  ? O GLY M 116  
BN 1 2 N ILE L 129  ? N ILE M 129  O ALA L 132  ? O ALA M 132  
BN 2 3 N VAL L 135  ? N VAL M 135  O GLN L 393  ? O GLN M 393  
BO 1 2 O ARG L 334  ? O ARG M 334  N GLN L 139  ? N GLN M 139  
BO 2 3 N ILE L 140  ? N ILE M 140  O SER L 411  ? O SER M 411  
BO 3 4 N ILE L 410  ? N ILE M 410  O THR L 453  ? O THR M 453  
BP 1 2 N GLY L 145  ? N GLY M 145  O ILE L 163  ? O ILE M 163  
BP 2 3 N ILE L 162  ? N ILE M 162  O ILE L 172  ? O ILE M 172  
BP 3 4 N GLU L 175  ? N GLU M 175  O SER L 183  ? O SER M 183  
BP 4 5 N MET L 184  ? N MET M 184  O PHE L 191  ? O PHE M 191  
BQ 1 2 N ARG L 292  ? N ARG M 292  O LYS L 299  ? O LYS M 299  
BR 1 2 N ARG L 460  ? N ARG M 460  O ARG L 468  ? O ARG M 468  
BR 2 3 N THR L 469  ? N THR M 469  O MET L 486  ? O MET M 486  
BS 1 2 N ARG L 460  ? N ARG M 460  O ARG L 468  ? O ARG M 468  
BS 2 3 N ARG L 472  ? N ARG M 472  O MET L 532  ? O MET M 532  
BS 3 4 O PHE L 531  ? O PHE M 531  N ALA L 497  ? N ALA M 497  
BS 4 5 N ILE L 496  ? N ILE M 496  O ARG L 516  ? O ARG M 516  
BS 5 6 N VAL L 513  ? N VAL M 513  O VAL L 524  ? O VAL M 524  
BT 1 2 N GLU L 504  ? N GLU M 504  O ARG L 507  ? O ARG M 507  
BU 1 2 N LEU L 595  ? N LEU M 595  O LEU L 655  ? O LEU M 655  
BU 2 3 O ASP L 657  ? O ASP M 657  N ARG L 640  ? N ARG M 640  
BV 1 2 O VAL L 621  ? O VAL M 621  N VAL L 613  ? N VAL M 613  
BV 2 3 O ARG L 614  ? O ARG M 614  N GLU L 602  ? N GLU M 602  
BV 3 4 N GLY L 601  ? N GLY M 601  O VAL L 649  ? O VAL M 649  
BW 1 2 N TYR L 629  ? N TYR M 629  O LEU L 637  ? O LEU M 637  
BX 1 2 N GLU L 662  ? N GLU M 662  O PHE L 665  ? O PHE M 665  
BY 1 2 N VAL L 972  ? N VAL M 972  O ILE L 987  ? O ILE M 987  
BY 2 3 O MET L 995  ? O MET M 995  N ALA L 840  ? N ALA M 840  
BY 3 4 N LEU L 839  ? N LEU M 839  O GLY L 847  ? O GLY M 847  
BY 4 5 O LEU L 853  ? O LEU M 853  N ILE L 690  ? N ILE M 690  
BY 5 6 N VAL L 689  ? N VAL M 689  O ILE L 870  ? O ILE M 870  
BY 6 7 O VAL L 869  ? O VAL M 869  N ALA L 675  ? N ALA M 675  
BY 7 8 N VAL L 674  ? N VAL M 674  O GLY L 990  ? O GLY M 990  
BZ 1 2 O GLY L 718  ? O GLY M 718  N THR L 715  ? N THR M 715  
BZ 2 3 N SER L 702  ? N SER M 702  O ARG L 831  ? O ARG M 831  
BZ 3 4 O ALA L 828  ? O ALA M 828  N ILE L 799  ? N ILE M 799  
BZ 4 5 O GLY L 798  ? O GLY M 798  N VAL L 749  ? N VAL M 749  
CA 1 2 N LEU L 755  ? N LEU M 755  O LEU L 790  ? O LEU M 790  
CB 1 2 N SER L 760  ? N SER M 760  O LYS L 786  ? O LYS M 786  
CC 1 2 N PHE L 1032 ? N PHE M 1032 O LYS M 621  ? O LYS N 621  
CD 1 2 O VAL L 1109 ? O VAL M 1109 N THR L 1101 ? N THR M 1101 
CD 2 3 N ASP L 1098 ? N ASP M 1098 O ALA M 11   ? O ALA N 11   
CD 3 4 N VAL M 8    ? N VAL N 8    O ASP M 1457 ? O ASP N 1457 
CE 1 2 N ALA M 99   ? N ALA N 99   O LEU M 514  ? O LEU N 514  
CF 1 2 O LEU M 153  ? O LEU N 153  N TYR M 132  ? N TYR N 132  
CF 2 3 N LEU M 135  ? N LEU N 135  O ASP M 453  ? O ASP N 453  
CG 1 2 N TYR M 169  ? N TYR N 169  O ILE M 393  ? O ILE N 393  
CG 2 3 O VAL M 396  ? O VAL N 396  N VAL M 202  ? N VAL N 202  
CG 3 4 O GLY M 201  ? O GLY N 201  N VAL M 185  ? N VAL N 185  
CH 1 2 N LEU M 191  ? N LEU N 191  O VAL M 195  ? O VAL N 195  
CI 1 2 N ARG M 318  ? N ARG N 318  O GLU M 338  ? O GLU N 338  
CI 2 3 O LEU M 333  ? O LEU N 333  N LEU M 223  ? N LEU N 223  
CI 3 4 N ARG M 212  ? N ARG N 212  O HIS M 386  ? O HIS N 386  
CI 4 5 O GLY M 383  ? O GLY N 383  N VAL M 361  ? N VAL N 361  
CJ 1 2 N LEU M 242  ? N LEU N 242  O LEU M 311  ? O LEU N 311  
CJ 2 3 O ALA M 307  ? O ALA N 307  N TYR M 249  ? N TYR N 249  
CK 1 2 N LEU M 242  ? N LEU N 242  O LEU M 311  ? O LEU N 311  
CK 2 3 O LYS M 308  ? O LYS N 308  N GLY M 287  ? N GLY N 287  
CL 1 2 O VAL M 279  ? O VAL N 279  N LEU M 272  ? N LEU N 272  
CL 2 3 O ARG M 273  ? O ARG N 273  N VAL M 258  ? N VAL N 258  
CL 3 4 N GLY M 257  ? N GLY N 257  O VAL M 298  ? O VAL N 298  
CM 1 2 N ASN M 352  ? N ASN N 352  O ALA M 369  ? O ALA N 369  
CN 1 2 N ARG M 399  ? N ARG N 399  O VAL M 446  ? O VAL N 446  
CN 2 3 O VAL M 447  ? O VAL N 447  N ARG M 434  ? N ARG N 434  
CN 3 4 O GLY M 433  ? O GLY N 433  N VAL M 415  ? N VAL N 415  
CO 1 2 N ALA M 422  ? N ALA N 422  O VAL M 427  ? O VAL N 427  
CP 1 2 N VAL M 528  ? N VAL N 528  O ALA M 536  ? O ALA N 536  
CP 2 3 N PHE M 535  ? N PHE N 535  O VAL O 335  ? O VAL P 315  
CQ 1 2 N VAL M 632  ? N VAL N 632  O LEU M 728  ? O LEU N 728  
CQ 2 3 O GLN M 727  ? O GLN N 727  N GLY M 643  ? N GLY N 643  
CQ 3 4 N CYS M 642  ? N CYS N 642  O VAL M 719  ? O VAL N 719  
CQ 4 5 O GLN M 714  ? O GLN N 714  N LEU M 702  ? N LEU N 702  
CQ 5 6 N LEU M 701  ? N LEU N 701  O HIS M 748  ? O HIS N 748  
CQ 6 7 O MET M 745  ? O MET N 745  N SER M 629  ? N SER N 629  
CR 1 2 N PHE M 806  ? N PHE N 806  O LYS M 828  ? O LYS N 828  
CR 2 3 N ILE M 827  ? N ILE N 827  O THR M 834  ? O THR N 834  
CS 1 2 N PHE M 843  ? N PHE N 843  O THR M 865  ? O THR N 865  
CS 2 3 N VAL M 866  ? N VAL N 866  O LEU M 873  ? O LEU N 873  
CT 1 2 N VAL M 1106 ? N VAL N 1106 O VAL M 1200 ? O VAL N 1200 
CU 1 2 N ILE M 1118 ? N ILE N 1118 O VAL M 1188 ? O VAL N 1188 
CV 1 2 N GLN M 1124 ? N GLN N 1124 O ARG M 1133 ? O ARG N 1133 
CW 1 2 N VAL M 1153 ? N VAL N 1153 O LEU M 1160 ? O LEU N 1160 
CX 1 2 N ALA M 1272 ? N ALA N 1272 O ALA M 1329 ? O ALA N 1329 
CY 1 2 O TYR M 1303 ? O TYR N 1303 N VAL M 1292 ? N VAL N 1292 
CY 2 3 O PHE M 1293 ? O PHE N 1293 N ARG M 1282 ? N ARG N 1282 
CY 3 4 N GLY M 1279 ? N GLY N 1279 O VAL M 1319 ? O VAL N 1319 
CZ 1 2 O LEU M 1395 ? O LEU N 1395 N VAL M 1379 ? N VAL N 1379 
CZ 2 3 N THR M 1382 ? N THR N 1382 O ALA M 1416 ? O ALA N 1416 
DA 1 2 N GLN M 1485 ? N GLN N 1485 O GLY N 76   ? O GLY O 76   
DB 1 2 N MET N 48   ? N MET O 48   O PHE N 55   ? O PHE O 55   
DC 1 2 N ILE O 341  ? N ILE P 321  O SER O 347  ? O SER P 327  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN D 2001' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN D 2002' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG D 2003' 
AC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MG D 2004' 
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG K 1001' 
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN N 2001' 
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN N 2002' 
AC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG N 2003' 
AC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG N 2004' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS D 1112 ? CYS D 1112 . ? 1_555 ? 
2  AC1 4 CYS D 1194 ? CYS D 1194 . ? 1_555 ? 
3  AC1 4 CYS D 1201 ? CYS D 1201 . ? 1_555 ? 
4  AC1 4 CYS D 1204 ? CYS D 1204 . ? 1_555 ? 
5  AC2 4 CYS D 58   ? CYS D 58   . ? 1_555 ? 
6  AC2 4 CYS D 60   ? CYS D 60   . ? 1_555 ? 
7  AC2 4 CYS D 73   ? CYS D 73   . ? 1_555 ? 
8  AC2 4 CYS D 76   ? CYS D 76   . ? 1_555 ? 
9  AC3 4 ASP D 739  ? ASP D 739  . ? 1_555 ? 
10 AC3 4 ASP D 741  ? ASP D 741  . ? 1_555 ? 
11 AC3 4 ASP D 743  ? ASP D 743  . ? 1_555 ? 
12 AC3 4 A   I 2    ? A   I 2    . ? 1_555 ? 
13 AC4 2 ASP B 168  ? ASP B 168  . ? 1_555 ? 
14 AC4 2 LYS D 840  ? LYS D 840  . ? 1_555 ? 
15 AC5 4 THR J 51   ? THR K 51   . ? 1_555 ? 
16 AC5 4 VAL J 170  ? VAL K 170  . ? 1_555 ? 
17 AC5 4 PHE J 171  ? PHE K 171  . ? 1_555 ? 
18 AC5 4 SER J 172  ? SER K 172  . ? 1_555 ? 
19 AC6 4 CYS M 1112 ? CYS N 1112 . ? 1_555 ? 
20 AC6 4 CYS M 1194 ? CYS N 1194 . ? 1_555 ? 
21 AC6 4 CYS M 1201 ? CYS N 1201 . ? 1_555 ? 
22 AC6 4 CYS M 1204 ? CYS N 1204 . ? 1_555 ? 
23 AC7 4 CYS M 58   ? CYS N 58   . ? 1_555 ? 
24 AC7 4 CYS M 60   ? CYS N 60   . ? 1_555 ? 
25 AC7 4 CYS M 73   ? CYS N 73   . ? 1_555 ? 
26 AC7 4 CYS M 76   ? CYS N 76   . ? 1_555 ? 
27 AC8 4 ASP M 739  ? ASP N 739  . ? 1_555 ? 
28 AC8 4 ASP M 741  ? ASP N 741  . ? 1_555 ? 
29 AC8 4 ASP M 743  ? ASP N 743  . ? 1_555 ? 
30 AC8 4 A   R 2    ? A   S 2    . ? 1_555 ? 
31 AC9 3 GLU K 154  ? GLU L 154  . ? 1_555 ? 
32 AC9 3 ASP K 168  ? ASP L 168  . ? 1_555 ? 
33 AC9 3 LYS M 840  ? LYS N 840  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4G7O 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4G7O 
_atom_sites.fract_transf_matrix[1][1]   0.005391 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000780 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009626 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003398 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . SER A  1  4    ? 31.985  16.553  145.102 1.00 102.64 ? 4    SER A N     1 
ATOM   2     C  CA    . SER A  1  4    ? 31.763  16.064  143.744 1.00 108.57 ? 4    SER A CA    1 
ATOM   3     C  C     . SER A  1  4    ? 32.988  16.311  142.864 1.00 110.85 ? 4    SER A C     1 
ATOM   4     O  O     . SER A  1  4    ? 33.322  15.499  142.000 1.00 107.86 ? 4    SER A O     1 
ATOM   5     C  CB    . SER A  1  4    ? 30.530  16.730  143.133 1.00 105.07 ? 4    SER A CB    1 
ATOM   6     O  OG    . SER A  1  4    ? 30.176  16.120  141.906 1.00 103.04 ? 4    SER A OG    1 
ATOM   7     N  N     . LYS A  1  5    ? 33.653  17.438  143.091 1.00 112.64 ? 5    LYS A N     1 
ATOM   8     C  CA    . LYS A  1  5    ? 34.866  17.773  142.355 1.00 110.25 ? 5    LYS A CA    1 
ATOM   9     C  C     . LYS A  1  5    ? 36.025  16.890  142.814 1.00 109.28 ? 5    LYS A C     1 
ATOM   10    O  O     . LYS A  1  5    ? 36.273  16.752  144.014 1.00 107.96 ? 5    LYS A O     1 
ATOM   11    C  CB    . LYS A  1  5    ? 35.215  19.248  142.567 1.00 110.51 ? 5    LYS A CB    1 
ATOM   12    C  CG    . LYS A  1  5    ? 36.247  19.802  141.596 1.00 108.76 ? 5    LYS A CG    1 
ATOM   13    C  CD    . LYS A  1  5    ? 35.671  19.939  140.198 1.00 112.02 ? 5    LYS A CD    1 
ATOM   14    C  CE    . LYS A  1  5    ? 36.572  20.783  139.313 1.00 117.51 ? 5    LYS A CE    1 
ATOM   15    N  NZ    . LYS A  1  5    ? 36.731  22.169  139.838 1.00 112.98 ? 5    LYS A NZ    1 
ATOM   16    N  N     . LEU A  1  6    ? 36.733  16.292  141.861 1.00 100.77 ? 6    LEU A N     1 
ATOM   17    C  CA    . LEU A  1  6    ? 37.863  15.429  142.186 1.00 92.27  ? 6    LEU A CA    1 
ATOM   18    C  C     . LEU A  1  6    ? 39.056  16.245  142.677 1.00 87.61  ? 6    LEU A C     1 
ATOM   19    O  O     . LEU A  1  6    ? 39.152  17.444  142.416 1.00 89.06  ? 6    LEU A O     1 
ATOM   20    C  CB    . LEU A  1  6    ? 38.266  14.584  140.977 1.00 87.48  ? 6    LEU A CB    1 
ATOM   21    C  CG    . LEU A  1  6    ? 38.315  13.071  141.203 1.00 85.16  ? 6    LEU A CG    1 
ATOM   22    C  CD1   . LEU A  1  6    ? 39.121  12.733  142.449 1.00 85.34  ? 6    LEU A CD1   1 
ATOM   23    C  CD2   . LEU A  1  6    ? 36.914  12.496  141.301 1.00 91.65  ? 6    LEU A CD2   1 
ATOM   24    N  N     . LYS A  1  7    ? 39.962  15.586  143.392 1.00 83.03  ? 7    LYS A N     1 
ATOM   25    C  CA    . LYS A  1  7    ? 41.140  16.248  143.943 1.00 82.28  ? 7    LYS A CA    1 
ATOM   26    C  C     . LYS A  1  7    ? 42.404  15.628  143.371 1.00 72.93  ? 7    LYS A C     1 
ATOM   27    O  O     . LYS A  1  7    ? 42.413  14.448  143.021 1.00 71.11  ? 7    LYS A O     1 
ATOM   28    C  CB    . LYS A  1  7    ? 41.155  16.137  145.474 1.00 93.59  ? 7    LYS A CB    1 
ATOM   29    C  CG    . LYS A  1  7    ? 40.083  16.955  146.187 1.00 96.13  ? 7    LYS A CG    1 
ATOM   30    C  CD    . LYS A  1  7    ? 40.321  18.445  146.001 1.00 99.29  ? 7    LYS A CD    1 
ATOM   31    C  CE    . LYS A  1  7    ? 39.247  19.276  146.681 1.00 88.24  ? 7    LYS A CE    1 
ATOM   32    N  NZ    . LYS A  1  7    ? 39.473  20.738  146.482 1.00 84.31  ? 7    LYS A NZ    1 
ATOM   33    N  N     . ALA A  1  8    ? 43.470  16.422  143.297 1.00 70.96  ? 8    ALA A N     1 
ATOM   34    C  CA    . ALA A  1  8    ? 44.749  15.966  142.750 1.00 68.49  ? 8    ALA A CA    1 
ATOM   35    C  C     . ALA A  1  8    ? 45.093  14.535  143.160 1.00 75.44  ? 8    ALA A C     1 
ATOM   36    O  O     . ALA A  1  8    ? 45.066  14.198  144.346 1.00 77.37  ? 8    ALA A O     1 
ATOM   37    C  CB    . ALA A  1  8    ? 45.870  16.919  143.147 1.00 58.21  ? 8    ALA A CB    1 
ATOM   38    N  N     . PRO A  1  9    ? 45.408  13.689  142.167 1.00 75.79  ? 9    PRO A N     1 
ATOM   39    C  CA    . PRO A  1  9    ? 45.685  12.255  142.313 1.00 68.10  ? 9    PRO A CA    1 
ATOM   40    C  C     . PRO A  1  9    ? 47.101  11.940  142.770 1.00 64.71  ? 9    PRO A C     1 
ATOM   41    O  O     . PRO A  1  9    ? 48.008  12.767  142.654 1.00 64.41  ? 9    PRO A O     1 
ATOM   42    C  CB    . PRO A  1  9    ? 45.490  11.714  140.890 1.00 69.91  ? 9    PRO A CB    1 
ATOM   43    C  CG    . PRO A  1  9    ? 44.794  12.812  140.133 1.00 69.67  ? 9    PRO A CG    1 
ATOM   44    C  CD    . PRO A  1  9    ? 45.282  14.070  140.754 1.00 70.92  ? 9    PRO A CD    1 
ATOM   45    N  N     . VAL A  1  10   ? 47.266  10.727  143.287 1.00 65.02  ? 10   VAL A N     1 
ATOM   46    C  CA    . VAL A  1  10   ? 48.570  10.170  143.623 1.00 72.60  ? 10   VAL A CA    1 
ATOM   47    C  C     . VAL A  1  10   ? 49.360  9.833   142.360 1.00 69.67  ? 10   VAL A C     1 
ATOM   48    O  O     . VAL A  1  10   ? 48.828  9.233   141.408 1.00 73.63  ? 10   VAL A O     1 
ATOM   49    C  CB    . VAL A  1  10   ? 48.439  8.900   144.497 1.00 75.20  ? 10   VAL A CB    1 
ATOM   50    C  CG1   . VAL A  1  10   ? 47.775  9.231   145.825 1.00 89.29  ? 10   VAL A CG1   1 
ATOM   51    C  CG2   . VAL A  1  10   ? 47.652  7.814   143.769 1.00 70.58  ? 10   VAL A CG2   1 
ATOM   52    N  N     . PHE A  1  11   ? 50.629  10.229  142.366 1.00 60.17  ? 11   PHE A N     1 
ATOM   53    C  CA    . PHE A  1  11   ? 51.520  10.025  141.238 1.00 68.18  ? 11   PHE A CA    1 
ATOM   54    C  C     . PHE A  1  11   ? 52.650  9.076   141.613 1.00 72.29  ? 11   PHE A C     1 
ATOM   55    O  O     . PHE A  1  11   ? 53.572  9.448   142.334 1.00 73.90  ? 11   PHE A O     1 
ATOM   56    C  CB    . PHE A  1  11   ? 52.088  11.369  140.775 1.00 74.16  ? 11   PHE A CB    1 
ATOM   57    C  CG    . PHE A  1  11   ? 53.134  11.253  139.706 1.00 74.02  ? 11   PHE A CG    1 
ATOM   58    C  CD1   . PHE A  1  11   ? 54.313  11.972  139.795 1.00 76.02  ? 11   PHE A CD1   1 
ATOM   59    C  CD2   . PHE A  1  11   ? 52.943  10.420  138.618 1.00 73.32  ? 11   PHE A CD2   1 
ATOM   60    C  CE1   . PHE A  1  11   ? 55.280  11.868  138.813 1.00 74.44  ? 11   PHE A CE1   1 
ATOM   61    C  CE2   . PHE A  1  11   ? 53.907  10.312  137.631 1.00 75.53  ? 11   PHE A CE2   1 
ATOM   62    C  CZ    . PHE A  1  11   ? 55.079  11.036  137.731 1.00 72.16  ? 11   PHE A CZ    1 
ATOM   63    N  N     . THR A  1  12   ? 52.583  7.852   141.107 1.00 72.19  ? 12   THR A N     1 
ATOM   64    C  CA    . THR A  1  12   ? 53.554  6.823   141.463 1.00 64.91  ? 12   THR A CA    1 
ATOM   65    C  C     . THR A  1  12   ? 54.574  6.620   140.349 1.00 62.28  ? 12   THR A C     1 
ATOM   66    O  O     . THR A  1  12   ? 54.267  6.844   139.182 1.00 67.71  ? 12   THR A O     1 
ATOM   67    C  CB    . THR A  1  12   ? 52.842  5.497   141.720 1.00 69.10  ? 12   THR A CB    1 
ATOM   68    O  OG1   . THR A  1  12   ? 51.601  5.750   142.394 1.00 68.07  ? 12   THR A OG1   1 
ATOM   69    C  CG2   . THR A  1  12   ? 53.711  4.567   142.551 1.00 67.38  ? 12   THR A CG2   1 
ATOM   70    N  N     . VAL A  1  13   ? 55.782  6.192   140.712 1.00 61.90  ? 13   VAL A N     1 
ATOM   71    C  CA    . VAL A  1  13   ? 56.869  6.003   139.746 1.00 58.91  ? 13   VAL A CA    1 
ATOM   72    C  C     . VAL A  1  13   ? 57.643  4.706   139.976 1.00 60.13  ? 13   VAL A C     1 
ATOM   73    O  O     . VAL A  1  13   ? 58.234  4.512   141.034 1.00 72.89  ? 13   VAL A O     1 
ATOM   74    C  CB    . VAL A  1  13   ? 57.876  7.167   139.798 1.00 54.09  ? 13   VAL A CB    1 
ATOM   75    C  CG1   . VAL A  1  13   ? 59.086  6.852   138.945 1.00 59.66  ? 13   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A  1  13   ? 57.220  8.467   139.354 1.00 62.96  ? 13   VAL A CG2   1 
ATOM   77    N  N     . ARG A  1  14   ? 57.649  3.826   138.980 1.00 59.03  ? 14   ARG A N     1 
ATOM   78    C  CA    . ARG A  1  14   ? 58.341  2.544   139.093 1.00 62.98  ? 14   ARG A CA    1 
ATOM   79    C  C     . ARG A  1  14   ? 59.411  2.409   138.013 1.00 71.30  ? 14   ARG A C     1 
ATOM   80    O  O     . ARG A  1  14   ? 59.090  2.229   136.844 1.00 73.73  ? 14   ARG A O     1 
ATOM   81    C  CB    . ARG A  1  14   ? 57.346  1.384   138.971 1.00 61.75  ? 14   ARG A CB    1 
ATOM   82    C  CG    . ARG A  1  14   ? 56.228  1.395   139.993 1.00 62.51  ? 14   ARG A CG    1 
ATOM   83    C  CD    . ARG A  1  14   ? 55.394  0.128   139.898 1.00 68.70  ? 14   ARG A CD    1 
ATOM   84    N  NE    . ARG A  1  14   ? 54.329  0.218   138.900 1.00 70.58  ? 14   ARG A NE    1 
ATOM   85    C  CZ    . ARG A  1  14   ? 53.038  0.356   139.193 1.00 72.60  ? 14   ARG A CZ    1 
ATOM   86    N  NH1   . ARG A  1  14   ? 52.645  0.423   140.460 1.00 66.83  ? 14   ARG A NH1   1 
ATOM   87    N  NH2   . ARG A  1  14   ? 52.137  0.424   138.219 1.00 68.57  ? 14   ARG A NH2   1 
ATOM   88    N  N     . THR A  1  15   ? 60.681  2.468   138.399 1.00 71.77  ? 15   THR A N     1 
ATOM   89    C  CA    . THR A  1  15   ? 61.755  2.493   137.410 1.00 68.36  ? 15   THR A CA    1 
ATOM   90    C  C     . THR A  1  15   ? 62.719  1.302   137.454 1.00 75.55  ? 15   THR A C     1 
ATOM   91    O  O     . THR A  1  15   ? 63.097  0.825   138.527 1.00 77.62  ? 15   THR A O     1 
ATOM   92    C  CB    . THR A  1  15   ? 62.567  3.800   137.508 1.00 68.37  ? 15   THR A CB    1 
ATOM   93    O  OG1   . THR A  1  15   ? 63.424  3.752   138.655 1.00 71.99  ? 15   THR A OG1   1 
ATOM   94    C  CG2   . THR A  1  15   ? 61.636  4.993   137.626 1.00 58.13  ? 15   THR A CG2   1 
ATOM   95    N  N     . GLN A  1  16   ? 63.102  0.829   136.269 1.00 77.25  ? 16   GLN A N     1 
ATOM   96    C  CA    . GLN A  1  16   ? 64.183  -0.139  136.115 1.00 74.80  ? 16   GLN A CA    1 
ATOM   97    C  C     . GLN A  1  16   ? 65.345  0.532   135.399 1.00 71.03  ? 16   GLN A C     1 
ATOM   98    O  O     . GLN A  1  16   ? 65.308  0.708   134.185 1.00 79.23  ? 16   GLN A O     1 
ATOM   99    C  CB    . GLN A  1  16   ? 63.729  -1.345  135.293 1.00 73.25  ? 16   GLN A CB    1 
ATOM   100   C  CG    . GLN A  1  16   ? 62.796  -2.301  136.007 1.00 84.96  ? 16   GLN A CG    1 
ATOM   101   C  CD    . GLN A  1  16   ? 62.537  -3.558  135.197 1.00 98.91  ? 16   GLN A CD    1 
ATOM   102   O  OE1   . GLN A  1  16   ? 63.029  -3.700  134.077 1.00 102.70 ? 16   GLN A OE1   1 
ATOM   103   N  NE2   . GLN A  1  16   ? 61.762  -4.479  135.760 1.00 106.77 ? 16   GLN A NE2   1 
ATOM   104   N  N     . GLY A  1  17   ? 66.376  0.904   136.146 1.00 73.32  ? 17   GLY A N     1 
ATOM   105   C  CA    . GLY A  1  17   ? 67.520  1.573   135.557 1.00 75.99  ? 17   GLY A CA    1 
ATOM   106   C  C     . GLY A  1  17   ? 67.119  2.806   134.773 1.00 74.87  ? 17   GLY A C     1 
ATOM   107   O  O     . GLY A  1  17   ? 66.159  3.491   135.130 1.00 75.35  ? 17   GLY A O     1 
ATOM   108   N  N     . ARG A  1  18   ? 67.853  3.089   133.701 1.00 73.53  ? 18   ARG A N     1 
ATOM   109   C  CA    . ARG A  1  18   ? 67.573  4.247   132.858 1.00 73.70  ? 18   ARG A CA    1 
ATOM   110   C  C     . ARG A  1  18   ? 66.798  3.848   131.602 1.00 74.35  ? 18   ARG A C     1 
ATOM   111   O  O     . ARG A  1  18   ? 66.433  4.700   130.791 1.00 71.57  ? 18   ARG A O     1 
ATOM   112   C  CB    . ARG A  1  18   ? 68.876  4.931   132.448 1.00 73.81  ? 18   ARG A CB    1 
ATOM   113   C  CG    . ARG A  1  18   ? 69.821  5.233   133.597 1.00 68.53  ? 18   ARG A CG    1 
ATOM   114   C  CD    . ARG A  1  18   ? 71.122  5.849   133.091 1.00 69.35  ? 18   ARG A CD    1 
ATOM   115   N  NE    . ARG A  1  18   ? 70.895  7.040   132.276 1.00 65.22  ? 18   ARG A NE    1 
ATOM   116   C  CZ    . ARG A  1  18   ? 70.758  8.266   132.767 1.00 69.56  ? 18   ARG A CZ    1 
ATOM   117   N  NH1   . ARG A  1  18   ? 70.820  8.465   134.078 1.00 80.89  ? 18   ARG A NH1   1 
ATOM   118   N  NH2   . ARG A  1  18   ? 70.554  9.293   131.952 1.00 69.94  ? 18   ARG A NH2   1 
ATOM   119   N  N     . GLU A  1  19   ? 66.551  2.549   131.454 1.00 77.46  ? 19   GLU A N     1 
ATOM   120   C  CA    . GLU A  1  19   ? 65.950  2.002   130.241 1.00 76.95  ? 19   GLU A CA    1 
ATOM   121   C  C     . GLU A  1  19   ? 64.428  2.115   130.235 1.00 76.49  ? 19   GLU A C     1 
ATOM   122   O  O     . GLU A  1  19   ? 63.831  2.508   129.236 1.00 75.91  ? 19   GLU A O     1 
ATOM   123   C  CB    . GLU A  1  19   ? 66.338  0.528   130.067 1.00 84.59  ? 19   GLU A CB    1 
ATOM   124   C  CG    . GLU A  1  19   ? 67.820  0.213   130.255 1.00 94.63  ? 19   GLU A CG    1 
ATOM   125   C  CD    . GLU A  1  19   ? 68.676  0.613   129.065 1.00 91.53  ? 19   GLU A CD    1 
ATOM   126   O  OE1   . GLU A  1  19   ? 68.448  1.703   128.501 1.00 87.32  ? 19   GLU A OE1   1 
ATOM   127   O  OE2   . GLU A  1  19   ? 69.581  -0.168  128.696 1.00 97.20  ? 19   GLU A OE2   1 
ATOM   128   N  N     . TYR A  1  20   ? 63.804  1.765   131.353 1.00 74.44  ? 20   TYR A N     1 
ATOM   129   C  CA    . TYR A  1  20   ? 62.353  1.621   131.400 1.00 68.83  ? 20   TYR A CA    1 
ATOM   130   C  C     . TYR A  1  20   ? 61.715  2.303   132.602 1.00 68.65  ? 20   TYR A C     1 
ATOM   131   O  O     . TYR A  1  20   ? 62.346  2.478   133.645 1.00 69.88  ? 20   TYR A O     1 
ATOM   132   C  CB    . TYR A  1  20   ? 61.989  0.138   131.411 1.00 66.73  ? 20   TYR A CB    1 
ATOM   133   C  CG    . TYR A  1  20   ? 60.510  -0.137  131.535 1.00 64.97  ? 20   TYR A CG    1 
ATOM   134   C  CD1   . TYR A  1  20   ? 59.978  -0.664  132.699 1.00 68.42  ? 20   TYR A CD1   1 
ATOM   135   C  CD2   . TYR A  1  20   ? 59.647  0.126   130.482 1.00 62.56  ? 20   TYR A CD2   1 
ATOM   136   C  CE1   . TYR A  1  20   ? 58.621  -0.924  132.813 1.00 70.46  ? 20   TYR A CE1   1 
ATOM   137   C  CE2   . TYR A  1  20   ? 58.294  -0.126  130.584 1.00 64.06  ? 20   TYR A CE2   1 
ATOM   138   C  CZ    . TYR A  1  20   ? 57.782  -0.653  131.750 1.00 67.49  ? 20   TYR A CZ    1 
ATOM   139   O  OH    . TYR A  1  20   ? 56.429  -0.905  131.848 1.00 66.51  ? 20   TYR A OH    1 
ATOM   140   N  N     . GLY A  1  21   ? 60.451  2.682   132.450 1.00 65.04  ? 21   GLY A N     1 
ATOM   141   C  CA    . GLY A  1  21   ? 59.711  3.297   133.536 1.00 66.39  ? 21   GLY A CA    1 
ATOM   142   C  C     . GLY A  1  21   ? 58.217  3.061   133.447 1.00 64.07  ? 21   GLY A C     1 
ATOM   143   O  O     . GLY A  1  21   ? 57.676  2.827   132.370 1.00 67.58  ? 21   GLY A O     1 
ATOM   144   N  N     . GLU A  1  22   ? 57.551  3.104   134.593 1.00 61.70  ? 22   GLU A N     1 
ATOM   145   C  CA    . GLU A  1  22   ? 56.100  3.041   134.650 1.00 60.98  ? 22   GLU A CA    1 
ATOM   146   C  C     . GLU A  1  22   ? 55.647  4.215   135.493 1.00 61.13  ? 22   GLU A C     1 
ATOM   147   O  O     . GLU A  1  22   ? 56.224  4.488   136.539 1.00 61.21  ? 22   GLU A O     1 
ATOM   148   C  CB    . GLU A  1  22   ? 55.629  1.722   135.261 1.00 57.80  ? 22   GLU A CB    1 
ATOM   149   C  CG    . GLU A  1  22   ? 56.163  0.491   134.547 1.00 64.04  ? 22   GLU A CG    1 
ATOM   150   C  CD    . GLU A  1  22   ? 55.519  -0.799  135.029 1.00 74.20  ? 22   GLU A CD    1 
ATOM   151   O  OE1   . GLU A  1  22   ? 54.719  -0.744  135.988 1.00 80.09  ? 22   GLU A OE1   1 
ATOM   152   O  OE2   . GLU A  1  22   ? 55.814  -1.869  134.448 1.00 68.69  ? 22   GLU A OE2   1 
ATOM   153   N  N     . PHE A  1  23   ? 54.632  4.930   135.028 1.00 59.13  ? 23   PHE A N     1 
ATOM   154   C  CA    . PHE A  1  23   ? 54.226  6.154   135.694 1.00 56.52  ? 23   PHE A CA    1 
ATOM   155   C  C     . PHE A  1  23   ? 52.726  6.163   135.919 1.00 66.59  ? 23   PHE A C     1 
ATOM   156   O  O     . PHE A  1  23   ? 51.946  6.265   134.974 1.00 67.92  ? 23   PHE A O     1 
ATOM   157   C  CB    . PHE A  1  23   ? 54.679  7.366   134.883 1.00 56.41  ? 23   PHE A CB    1 
ATOM   158   C  CG    . PHE A  1  23   ? 56.161  7.415   134.672 1.00 67.31  ? 23   PHE A CG    1 
ATOM   159   C  CD1   . PHE A  1  23   ? 56.942  8.330   135.351 1.00 65.91  ? 23   PHE A CD1   1 
ATOM   160   C  CD2   . PHE A  1  23   ? 56.780  6.515   133.818 1.00 67.02  ? 23   PHE A CD2   1 
ATOM   161   C  CE1   . PHE A  1  23   ? 58.310  8.360   135.165 1.00 65.38  ? 23   PHE A CE1   1 
ATOM   162   C  CE2   . PHE A  1  23   ? 58.145  6.536   133.631 1.00 58.52  ? 23   PHE A CE2   1 
ATOM   163   C  CZ    . PHE A  1  23   ? 58.911  7.461   134.303 1.00 61.82  ? 23   PHE A CZ    1 
ATOM   164   N  N     . VAL A  1  24   ? 52.325  6.046   137.180 1.00 65.91  ? 24   VAL A N     1 
ATOM   165   C  CA    . VAL A  1  24   ? 50.914  5.944   137.499 1.00 61.62  ? 24   VAL A CA    1 
ATOM   166   C  C     . VAL A  1  24   ? 50.346  7.264   138.000 1.00 60.06  ? 24   VAL A C     1 
ATOM   167   O  O     . VAL A  1  24   ? 51.038  8.063   138.632 1.00 62.84  ? 24   VAL A O     1 
ATOM   168   C  CB    . VAL A  1  24   ? 50.634  4.830   138.525 1.00 57.10  ? 24   VAL A CB    1 
ATOM   169   C  CG1   . VAL A  1  24   ? 49.140  4.555   138.601 1.00 61.13  ? 24   VAL A CG1   1 
ATOM   170   C  CG2   . VAL A  1  24   ? 51.368  3.564   138.141 1.00 60.57  ? 24   VAL A CG2   1 
ATOM   171   N  N     . LEU A  1  25   ? 49.077  7.480   137.684 1.00 55.71  ? 25   LEU A N     1 
ATOM   172   C  CA    . LEU A  1  25   ? 48.342  8.645   138.124 1.00 55.73  ? 25   LEU A CA    1 
ATOM   173   C  C     . LEU A  1  25   ? 46.935  8.164   138.445 1.00 64.04  ? 25   LEU A C     1 
ATOM   174   O  O     . LEU A  1  25   ? 46.219  7.692   137.545 1.00 64.44  ? 25   LEU A O     1 
ATOM   175   C  CB    . LEU A  1  25   ? 48.292  9.683   137.008 1.00 49.47  ? 25   LEU A CB    1 
ATOM   176   C  CG    . LEU A  1  25   ? 48.456  11.135  137.440 1.00 58.18  ? 25   LEU A CG    1 
ATOM   177   C  CD1   . LEU A  1  25   ? 49.802  11.321  138.103 1.00 54.97  ? 25   LEU A CD1   1 
ATOM   178   C  CD2   . LEU A  1  25   ? 48.309  12.066  136.249 1.00 59.79  ? 25   LEU A CD2   1 
ATOM   179   N  N     . GLU A  1  26   ? 46.550  8.242   139.721 1.00 66.37  ? 26   GLU A N     1 
ATOM   180   C  CA    . GLU A  1  26   ? 45.180  7.860   140.110 1.00 65.60  ? 26   GLU A CA    1 
ATOM   181   C  C     . GLU A  1  26   ? 44.645  8.551   141.363 1.00 64.57  ? 26   GLU A C     1 
ATOM   182   O  O     . GLU A  1  26   ? 45.394  8.848   142.283 1.00 63.54  ? 26   GLU A O     1 
ATOM   183   C  CB    . GLU A  1  26   ? 45.028  6.340   140.244 1.00 59.23  ? 26   GLU A CB    1 
ATOM   184   C  CG    . GLU A  1  26   ? 45.554  5.747   141.534 1.00 68.92  ? 26   GLU A CG    1 
ATOM   185   C  CD    . GLU A  1  26   ? 45.174  4.282   141.680 1.00 77.23  ? 26   GLU A CD    1 
ATOM   186   O  OE1   . GLU A  1  26   ? 43.977  3.959   141.486 1.00 68.66  ? 26   GLU A OE1   1 
ATOM   187   O  OE2   . GLU A  1  26   ? 46.069  3.456   141.984 1.00 73.07  ? 26   GLU A OE2   1 
ATOM   188   N  N     . PRO A  1  27   ? 43.330  8.796   141.393 1.00 61.40  ? 27   PRO A N     1 
ATOM   189   C  CA    . PRO A  1  27   ? 42.445  8.425   140.295 1.00 62.09  ? 27   PRO A CA    1 
ATOM   190   C  C     . PRO A  1  27   ? 42.208  9.642   139.418 1.00 64.45  ? 27   PRO A C     1 
ATOM   191   O  O     . PRO A  1  27   ? 42.592  10.756  139.794 1.00 60.93  ? 27   PRO A O     1 
ATOM   192   C  CB    . PRO A  1  27   ? 41.156  8.052   141.022 1.00 61.98  ? 27   PRO A CB    1 
ATOM   193   C  CG    . PRO A  1  27   ? 41.177  8.894   142.300 1.00 66.52  ? 27   PRO A CG    1 
ATOM   194   C  CD    . PRO A  1  27   ? 42.580  9.458   142.471 1.00 69.92  ? 27   PRO A CD    1 
ATOM   195   N  N     . LEU A  1  28   ? 41.577  9.435   138.267 1.00 60.90  ? 28   LEU A N     1 
ATOM   196   C  CA    . LEU A  1  28   ? 41.280  10.527  137.351 1.00 59.01  ? 28   LEU A CA    1 
ATOM   197   C  C     . LEU A  1  28   ? 39.824  10.428  136.931 1.00 56.42  ? 28   LEU A C     1 
ATOM   198   O  O     . LEU A  1  28   ? 39.256  9.330   136.893 1.00 55.25  ? 28   LEU A O     1 
ATOM   199   C  CB    . LEU A  1  28   ? 42.201  10.462  136.125 1.00 56.87  ? 28   LEU A CB    1 
ATOM   200   C  CG    . LEU A  1  28   ? 43.694  10.733  136.366 1.00 59.39  ? 28   LEU A CG    1 
ATOM   201   C  CD1   . LEU A  1  28   ? 44.569  9.828   135.514 1.00 59.65  ? 28   LEU A CD1   1 
ATOM   202   C  CD2   . LEU A  1  28   ? 44.048  12.203  136.143 1.00 62.29  ? 28   LEU A CD2   1 
ATOM   203   N  N     . GLU A  1  29   ? 39.214  11.572  136.630 1.00 51.79  ? 29   GLU A N     1 
ATOM   204   C  CA    . GLU A  1  29   ? 37.848  11.572  136.129 1.00 58.42  ? 29   GLU A CA    1 
ATOM   205   C  C     . GLU A  1  29   ? 37.724  10.664  134.910 1.00 62.92  ? 29   GLU A C     1 
ATOM   206   O  O     . GLU A  1  29   ? 38.680  10.488  134.160 1.00 63.76  ? 29   GLU A O     1 
ATOM   207   C  CB    . GLU A  1  29   ? 37.389  12.991  135.797 1.00 65.88  ? 29   GLU A CB    1 
ATOM   208   C  CG    . GLU A  1  29   ? 36.966  13.809  137.012 1.00 82.97  ? 29   GLU A CG    1 
ATOM   209   C  CD    . GLU A  1  29   ? 35.703  13.272  137.682 1.00 92.25  ? 29   GLU A CD    1 
ATOM   210   O  OE1   . GLU A  1  29   ? 35.125  12.282  137.177 1.00 89.53  ? 29   GLU A OE1   1 
ATOM   211   O  OE2   . GLU A  1  29   ? 35.291  13.844  138.718 1.00 89.93  ? 29   GLU A OE2   1 
ATOM   212   N  N     . ARG A  1  30   ? 36.548  10.078  134.725 1.00 64.89  ? 30   ARG A N     1 
ATOM   213   C  CA    . ARG A  1  30   ? 36.324  9.149   133.627 1.00 64.70  ? 30   ARG A CA    1 
ATOM   214   C  C     . ARG A  1  30   ? 36.691  9.789   132.293 1.00 71.20  ? 30   ARG A C     1 
ATOM   215   O  O     . ARG A  1  30   ? 36.248  10.899  131.983 1.00 70.94  ? 30   ARG A O     1 
ATOM   216   C  CB    . ARG A  1  30   ? 34.866  8.690   133.605 1.00 76.01  ? 30   ARG A CB    1 
ATOM   217   C  CG    . ARG A  1  30   ? 34.609  7.444   132.771 1.00 83.71  ? 30   ARG A CG    1 
ATOM   218   C  CD    . ARG A  1  30   ? 33.128  7.091   132.766 1.00 87.61  ? 30   ARG A CD    1 
ATOM   219   N  NE    . ARG A  1  30   ? 32.316  8.194   132.259 1.00 84.49  ? 30   ARG A NE    1 
ATOM   220   C  CZ    . ARG A  1  30   ? 31.960  8.344   130.985 1.00 90.96  ? 30   ARG A CZ    1 
ATOM   221   N  NH1   . ARG A  1  30   ? 32.339  7.454   130.073 1.00 90.91  ? 30   ARG A NH1   1 
ATOM   222   N  NH2   . ARG A  1  30   ? 31.222  9.385   130.622 1.00 79.09  ? 30   ARG A NH2   1 
ATOM   223   N  N     . GLY A  1  31   ? 37.513  9.091   131.512 1.00 69.89  ? 31   GLY A N     1 
ATOM   224   C  CA    . GLY A  1  31   ? 37.896  9.566   130.193 1.00 66.67  ? 31   GLY A CA    1 
ATOM   225   C  C     . GLY A  1  31   ? 39.261  10.228  130.124 1.00 65.13  ? 31   GLY A C     1 
ATOM   226   O  O     . GLY A  1  31   ? 39.859  10.316  129.053 1.00 64.60  ? 31   GLY A O     1 
ATOM   227   N  N     . PHE A  1  32   ? 39.757  10.696  131.265 1.00 66.09  ? 32   PHE A N     1 
ATOM   228   C  CA    . PHE A  1  32   ? 41.035  11.401  131.303 1.00 61.10  ? 32   PHE A CA    1 
ATOM   229   C  C     . PHE A  1  32   ? 42.207  10.446  131.147 1.00 56.81  ? 32   PHE A C     1 
ATOM   230   O  O     . PHE A  1  32   ? 43.352  10.871  130.972 1.00 51.93  ? 32   PHE A O     1 
ATOM   231   C  CB    . PHE A  1  32   ? 41.169  12.207  132.594 1.00 58.92  ? 32   PHE A CB    1 
ATOM   232   C  CG    . PHE A  1  32   ? 40.581  13.579  132.506 1.00 56.88  ? 32   PHE A CG    1 
ATOM   233   C  CD1   . PHE A  1  32   ? 39.208  13.760  132.517 1.00 58.39  ? 32   PHE A CD1   1 
ATOM   234   C  CD2   . PHE A  1  32   ? 41.403  14.689  132.405 1.00 57.12  ? 32   PHE A CD2   1 
ATOM   235   C  CE1   . PHE A  1  32   ? 38.662  15.026  132.431 1.00 58.38  ? 32   PHE A CE1   1 
ATOM   236   C  CE2   . PHE A  1  32   ? 40.864  15.960  132.320 1.00 58.37  ? 32   PHE A CE2   1 
ATOM   237   C  CZ    . PHE A  1  32   ? 39.489  16.128  132.335 1.00 60.62  ? 32   PHE A CZ    1 
ATOM   238   N  N     . GLY A  1  33   ? 41.908  9.154   131.214 1.00 60.50  ? 33   GLY A N     1 
ATOM   239   C  CA    . GLY A  1  33   ? 42.907  8.136   130.972 1.00 61.24  ? 33   GLY A CA    1 
ATOM   240   C  C     . GLY A  1  33   ? 43.605  8.412   129.660 1.00 60.15  ? 33   GLY A C     1 
ATOM   241   O  O     . GLY A  1  33   ? 44.822  8.577   129.621 1.00 57.60  ? 33   GLY A O     1 
ATOM   242   N  N     . VAL A  1  34   ? 42.830  8.481   128.582 1.00 59.81  ? 34   VAL A N     1 
ATOM   243   C  CA    . VAL A  1  34   ? 43.407  8.769   127.277 1.00 57.02  ? 34   VAL A CA    1 
ATOM   244   C  C     . VAL A  1  34   ? 43.613  10.264  127.057 1.00 57.63  ? 34   VAL A C     1 
ATOM   245   O  O     . VAL A  1  34   ? 44.597  10.667  126.438 1.00 64.43  ? 34   VAL A O     1 
ATOM   246   C  CB    . VAL A  1  34   ? 42.576  8.182   126.113 1.00 55.42  ? 34   VAL A CB    1 
ATOM   247   C  CG1   . VAL A  1  34   ? 42.105  6.771   126.442 1.00 55.95  ? 34   VAL A CG1   1 
ATOM   248   C  CG2   . VAL A  1  34   ? 41.409  9.072   125.801 1.00 52.07  ? 34   VAL A CG2   1 
ATOM   249   N  N     . THR A  1  35   ? 42.697  11.089  127.552 1.00 49.03  ? 35   THR A N     1 
ATOM   250   C  CA    . THR A  1  35   ? 42.855  12.530  127.393 1.00 48.36  ? 35   THR A CA    1 
ATOM   251   C  C     . THR A  1  35   ? 44.255  12.968  127.807 1.00 51.70  ? 35   THR A C     1 
ATOM   252   O  O     . THR A  1  35   ? 44.864  13.821  127.164 1.00 53.76  ? 35   THR A O     1 
ATOM   253   C  CB    . THR A  1  35   ? 41.813  13.323  128.182 1.00 52.30  ? 35   THR A CB    1 
ATOM   254   O  OG1   . THR A  1  35   ? 40.513  13.018  127.673 1.00 54.37  ? 35   THR A OG1   1 
ATOM   255   C  CG2   . THR A  1  35   ? 42.066  14.814  128.037 1.00 41.17  ? 35   THR A CG2   1 
ATOM   256   N  N     . LEU A  1  36   ? 44.770  12.380  128.879 1.00 54.65  ? 36   LEU A N     1 
ATOM   257   C  CA    . LEU A  1  36   ? 46.142  12.666  129.276 1.00 54.06  ? 36   LEU A CA    1 
ATOM   258   C  C     . LEU A  1  36   ? 47.131  11.711  128.620 1.00 56.91  ? 36   LEU A C     1 
ATOM   259   O  O     . LEU A  1  36   ? 48.212  12.118  128.198 1.00 54.20  ? 36   LEU A O     1 
ATOM   260   C  CB    . LEU A  1  36   ? 46.298  12.609  130.793 1.00 52.26  ? 36   LEU A CB    1 
ATOM   261   C  CG    . LEU A  1  36   ? 46.079  13.940  131.493 1.00 58.30  ? 36   LEU A CG    1 
ATOM   262   C  CD1   . LEU A  1  36   ? 46.393  13.807  132.972 1.00 68.86  ? 36   LEU A CD1   1 
ATOM   263   C  CD2   . LEU A  1  36   ? 46.953  14.999  130.844 1.00 57.64  ? 36   LEU A CD2   1 
ATOM   264   N  N     . GLY A  1  37   ? 46.752  10.441  128.536 1.00 60.30  ? 37   GLY A N     1 
ATOM   265   C  CA    . GLY A  1  37   ? 47.639  9.404   128.040 1.00 61.01  ? 37   GLY A CA    1 
ATOM   266   C  C     . GLY A  1  37   ? 48.175  9.628   126.638 1.00 55.80  ? 37   GLY A C     1 
ATOM   267   O  O     . GLY A  1  37   ? 49.381  9.562   126.408 1.00 50.79  ? 37   GLY A O     1 
ATOM   268   N  N     . ASN A  1  38   ? 47.276  9.893   125.699 1.00 50.73  ? 38   ASN A N     1 
ATOM   269   C  CA    . ASN A  1  38   ? 47.640  9.946   124.290 1.00 54.05  ? 38   ASN A CA    1 
ATOM   270   C  C     . ASN A  1  38   ? 48.543  11.106  123.888 1.00 52.32  ? 38   ASN A C     1 
ATOM   271   O  O     . ASN A  1  38   ? 49.601  10.891  123.299 1.00 56.32  ? 38   ASN A O     1 
ATOM   272   C  CB    . ASN A  1  38   ? 46.391  9.941   123.418 1.00 58.40  ? 38   ASN A CB    1 
ATOM   273   C  CG    . ASN A  1  38   ? 46.605  9.221   122.111 1.00 52.54  ? 38   ASN A CG    1 
ATOM   274   O  OD1   . ASN A  1  38   ? 47.117  8.098   122.083 1.00 46.18  ? 38   ASN A OD1   1 
ATOM   275   N  ND2   . ASN A  1  38   ? 46.224  9.864   121.015 1.00 53.31  ? 38   ASN A ND2   1 
ATOM   276   N  N     . PRO A  1  39   ? 48.130  12.341  124.194 1.00 48.46  ? 39   PRO A N     1 
ATOM   277   C  CA    . PRO A  1  39   ? 48.928  13.487  123.764 1.00 49.74  ? 39   PRO A CA    1 
ATOM   278   C  C     . PRO A  1  39   ? 50.362  13.353  124.259 1.00 56.08  ? 39   PRO A C     1 
ATOM   279   O  O     . PRO A  1  39   ? 51.294  13.837  123.613 1.00 52.35  ? 39   PRO A O     1 
ATOM   280   C  CB    . PRO A  1  39   ? 48.236  14.669  124.446 1.00 44.64  ? 39   PRO A CB    1 
ATOM   281   C  CG    . PRO A  1  39   ? 46.868  14.208  124.694 1.00 51.56  ? 39   PRO A CG    1 
ATOM   282   C  CD    . PRO A  1  39   ? 46.982  12.755  125.010 1.00 55.23  ? 39   PRO A CD    1 
ATOM   283   N  N     . LEU A  1  40   ? 50.536  12.694  125.400 1.00 53.39  ? 40   LEU A N     1 
ATOM   284   C  CA    . LEU A  1  40   ? 51.874  12.469  125.925 1.00 52.71  ? 40   LEU A CA    1 
ATOM   285   C  C     . LEU A  1  40   ? 52.586  11.417  125.091 1.00 54.51  ? 40   LEU A C     1 
ATOM   286   O  O     . LEU A  1  40   ? 53.731  11.610  124.685 1.00 57.69  ? 40   LEU A O     1 
ATOM   287   C  CB    . LEU A  1  40   ? 51.834  12.063  127.398 1.00 52.39  ? 40   LEU A CB    1 
ATOM   288   C  CG    . LEU A  1  40   ? 51.384  13.160  128.368 1.00 54.64  ? 40   LEU A CG    1 
ATOM   289   C  CD1   . LEU A  1  40   ? 51.327  12.623  129.785 1.00 50.24  ? 40   LEU A CD1   1 
ATOM   290   C  CD2   . LEU A  1  40   ? 52.299  14.380  128.283 1.00 49.43  ? 40   LEU A CD2   1 
ATOM   291   N  N     . ARG A  1  41   ? 51.904  10.310  124.821 1.00 52.61  ? 41   ARG A N     1 
ATOM   292   C  CA    . ARG A  1  41   ? 52.489  9.279   123.977 1.00 51.05  ? 41   ARG A CA    1 
ATOM   293   C  C     . ARG A  1  41   ? 52.955  9.889   122.670 1.00 50.49  ? 41   ARG A C     1 
ATOM   294   O  O     . ARG A  1  41   ? 54.091  9.685   122.257 1.00 57.13  ? 41   ARG A O     1 
ATOM   295   C  CB    . ARG A  1  41   ? 51.502  8.154   123.691 1.00 47.21  ? 41   ARG A CB    1 
ATOM   296   C  CG    . ARG A  1  41   ? 52.103  7.049   122.855 1.00 46.71  ? 41   ARG A CG    1 
ATOM   297   C  CD    . ARG A  1  41   ? 51.153  5.885   122.676 1.00 51.11  ? 41   ARG A CD    1 
ATOM   298   N  NE    . ARG A  1  41   ? 51.755  4.845   121.850 1.00 53.81  ? 41   ARG A NE    1 
ATOM   299   C  CZ    . ARG A  1  41   ? 51.702  4.835   120.524 1.00 55.35  ? 41   ARG A CZ    1 
ATOM   300   N  NH1   . ARG A  1  41   ? 51.066  5.807   119.883 1.00 53.73  ? 41   ARG A NH1   1 
ATOM   301   N  NH2   . ARG A  1  41   ? 52.280  3.856   119.842 1.00 52.24  ? 41   ARG A NH2   1 
ATOM   302   N  N     . ARG A  1  42   ? 52.080  10.649  122.024 1.00 45.18  ? 42   ARG A N     1 
ATOM   303   C  CA    . ARG A  1  42   ? 52.436  11.276  120.756 1.00 50.05  ? 42   ARG A CA    1 
ATOM   304   C  C     . ARG A  1  42   ? 53.696  12.132  120.903 1.00 52.52  ? 42   ARG A C     1 
ATOM   305   O  O     . ARG A  1  42   ? 54.688  11.929  120.198 1.00 52.95  ? 42   ARG A O     1 
ATOM   306   C  CB    . ARG A  1  42   ? 51.259  12.090  120.196 1.00 45.88  ? 42   ARG A CB    1 
ATOM   307   C  CG    . ARG A  1  42   ? 50.063  11.227  119.807 1.00 43.67  ? 42   ARG A CG    1 
ATOM   308   C  CD    . ARG A  1  42   ? 48.898  12.050  119.302 1.00 43.77  ? 42   ARG A CD    1 
ATOM   309   N  NE    . ARG A  1  42   ? 49.250  12.862  118.144 1.00 50.80  ? 42   ARG A NE    1 
ATOM   310   C  CZ    . ARG A  1  42   ? 49.405  12.385  116.910 1.00 51.94  ? 42   ARG A CZ    1 
ATOM   311   N  NH1   . ARG A  1  42   ? 49.250  11.091  116.667 1.00 49.23  ? 42   ARG A NH1   1 
ATOM   312   N  NH2   . ARG A  1  42   ? 49.723  13.202  115.914 1.00 47.16  ? 42   ARG A NH2   1 
ATOM   313   N  N     . ILE A  1  43   ? 53.664  13.069  121.841 1.00 53.34  ? 43   ILE A N     1 
ATOM   314   C  CA    . ILE A  1  43   ? 54.801  13.944  122.069 1.00 54.43  ? 43   ILE A CA    1 
ATOM   315   C  C     . ILE A  1  43   ? 56.070  13.150  122.358 1.00 52.43  ? 43   ILE A C     1 
ATOM   316   O  O     . ILE A  1  43   ? 57.126  13.451  121.814 1.00 54.88  ? 43   ILE A O     1 
ATOM   317   C  CB    . ILE A  1  43   ? 54.519  14.940  123.205 1.00 52.07  ? 43   ILE A CB    1 
ATOM   318   C  CG1   . ILE A  1  43   ? 53.365  15.858  122.803 1.00 54.20  ? 43   ILE A CG1   1 
ATOM   319   C  CG2   . ILE A  1  43   ? 55.757  15.759  123.517 1.00 50.36  ? 43   ILE A CG2   1 
ATOM   320   C  CD1   . ILE A  1  43   ? 52.975  16.856  123.843 1.00 51.70  ? 43   ILE A CD1   1 
ATOM   321   N  N     . LEU A  1  44   ? 55.959  12.132  123.205 1.00 51.79  ? 44   LEU A N     1 
ATOM   322   C  CA    . LEU A  1  44   ? 57.094  11.269  123.532 1.00 54.70  ? 44   LEU A CA    1 
ATOM   323   C  C     . LEU A  1  44   ? 57.695  10.610  122.292 1.00 57.47  ? 44   LEU A C     1 
ATOM   324   O  O     . LEU A  1  44   ? 58.909  10.627  122.086 1.00 59.80  ? 44   LEU A O     1 
ATOM   325   C  CB    . LEU A  1  44   ? 56.666  10.173  124.509 1.00 53.91  ? 44   LEU A CB    1 
ATOM   326   C  CG    . LEU A  1  44   ? 56.199  10.579  125.907 1.00 53.77  ? 44   LEU A CG    1 
ATOM   327   C  CD1   . LEU A  1  44   ? 55.422  9.434   126.516 1.00 52.33  ? 44   LEU A CD1   1 
ATOM   328   C  CD2   . LEU A  1  44   ? 57.369  10.981  126.800 1.00 50.22  ? 44   LEU A CD2   1 
ATOM   329   N  N     . LEU A  1  45   ? 56.834  10.019  121.473 1.00 53.75  ? 45   LEU A N     1 
ATOM   330   C  CA    . LEU A  1  45   ? 57.283  9.288   120.304 1.00 46.02  ? 45   LEU A CA    1 
ATOM   331   C  C     . LEU A  1  45   ? 57.905  10.210  119.263 1.00 55.38  ? 45   LEU A C     1 
ATOM   332   O  O     . LEU A  1  45   ? 58.692  9.767   118.419 1.00 58.17  ? 45   LEU A O     1 
ATOM   333   C  CB    . LEU A  1  45   ? 56.125  8.501   119.695 1.00 37.04  ? 45   LEU A CB    1 
ATOM   334   C  CG    . LEU A  1  45   ? 55.762  7.248   120.481 1.00 42.12  ? 45   LEU A CG    1 
ATOM   335   C  CD1   . LEU A  1  45   ? 54.628  6.492   119.823 1.00 42.17  ? 45   LEU A CD1   1 
ATOM   336   C  CD2   . LEU A  1  45   ? 56.979  6.362   120.647 1.00 42.68  ? 45   LEU A CD2   1 
ATOM   337   N  N     . SER A  1  46   ? 57.570  11.493  119.330 1.00 53.18  ? 46   SER A N     1 
ATOM   338   C  CA    . SER A  1  46   ? 57.965  12.418  118.275 1.00 52.54  ? 46   SER A CA    1 
ATOM   339   C  C     . SER A  1  46   ? 58.987  13.473  118.689 1.00 58.03  ? 46   SER A C     1 
ATOM   340   O  O     . SER A  1  46   ? 60.077  13.548  118.117 1.00 63.30  ? 46   SER A O     1 
ATOM   341   C  CB    . SER A  1  46   ? 56.730  13.115  117.705 1.00 49.76  ? 46   SER A CB    1 
ATOM   342   O  OG    . SER A  1  46   ? 56.069  13.873  118.702 1.00 51.00  ? 46   SER A OG    1 
ATOM   343   N  N     . SER A  1  47   ? 58.629  14.279  119.686 1.00 57.59  ? 47   SER A N     1 
ATOM   344   C  CA    . SER A  1  47   ? 59.295  15.555  119.923 1.00 55.15  ? 47   SER A CA    1 
ATOM   345   C  C     . SER A  1  47   ? 60.330  15.568  121.049 1.00 52.75  ? 47   SER A C     1 
ATOM   346   O  O     . SER A  1  47   ? 60.784  16.637  121.466 1.00 50.42  ? 47   SER A O     1 
ATOM   347   C  CB    . SER A  1  47   ? 58.248  16.642  120.171 1.00 53.53  ? 47   SER A CB    1 
ATOM   348   O  OG    . SER A  1  47   ? 57.258  16.616  119.162 1.00 56.36  ? 47   SER A OG    1 
ATOM   349   N  N     . ILE A  1  48   ? 60.708  14.393  121.540 1.00 54.21  ? 48   ILE A N     1 
ATOM   350   C  CA    . ILE A  1  48   ? 61.700  14.321  122.614 1.00 60.06  ? 48   ILE A CA    1 
ATOM   351   C  C     . ILE A  1  48   ? 63.127  14.284  122.072 1.00 62.11  ? 48   ILE A C     1 
ATOM   352   O  O     . ILE A  1  48   ? 63.525  13.316  121.421 1.00 69.18  ? 48   ILE A O     1 
ATOM   353   C  CB    . ILE A  1  48   ? 61.464  13.106  123.531 1.00 62.00  ? 48   ILE A CB    1 
ATOM   354   C  CG1   . ILE A  1  48   ? 60.132  13.254  124.273 1.00 55.61  ? 48   ILE A CG1   1 
ATOM   355   C  CG2   . ILE A  1  48   ? 62.607  12.947  124.508 1.00 57.82  ? 48   ILE A CG2   1 
ATOM   356   C  CD1   . ILE A  1  48   ? 59.858  14.661  124.743 1.00 52.03  ? 48   ILE A CD1   1 
ATOM   357   N  N     . PRO A  1  49   ? 63.895  15.350  122.332 1.00 60.35  ? 49   PRO A N     1 
ATOM   358   C  CA    . PRO A  1  49   ? 65.287  15.482  121.894 1.00 63.82  ? 49   PRO A CA    1 
ATOM   359   C  C     . PRO A  1  49   ? 66.161  14.318  122.353 1.00 64.62  ? 49   PRO A C     1 
ATOM   360   O  O     . PRO A  1  49   ? 65.945  13.765  123.433 1.00 61.85  ? 49   PRO A O     1 
ATOM   361   C  CB    . PRO A  1  49   ? 65.737  16.776  122.572 1.00 62.55  ? 49   PRO A CB    1 
ATOM   362   C  CG    . PRO A  1  49   ? 64.490  17.583  122.693 1.00 60.15  ? 49   PRO A CG    1 
ATOM   363   C  CD    . PRO A  1  49   ? 63.399  16.580  122.972 1.00 64.26  ? 49   PRO A CD    1 
ATOM   364   N  N     . GLY A  1  50   ? 67.127  13.949  121.516 1.00 64.37  ? 50   GLY A N     1 
ATOM   365   C  CA    . GLY A  1  50   ? 68.085  12.904  121.830 1.00 63.35  ? 50   GLY A CA    1 
ATOM   366   C  C     . GLY A  1  50   ? 69.404  13.152  121.121 1.00 62.78  ? 50   GLY A C     1 
ATOM   367   O  O     . GLY A  1  50   ? 69.697  14.282  120.732 1.00 64.05  ? 50   GLY A O     1 
ATOM   368   N  N     . THR A  1  51   ? 70.206  12.104  120.958 1.00 63.90  ? 51   THR A N     1 
ATOM   369   C  CA    . THR A  1  51   ? 71.454  12.214  120.205 1.00 66.89  ? 51   THR A CA    1 
ATOM   370   C  C     . THR A  1  51   ? 71.612  11.077  119.203 1.00 66.76  ? 51   THR A C     1 
ATOM   371   O  O     . THR A  1  51   ? 71.267  9.929   119.486 1.00 66.10  ? 51   THR A O     1 
ATOM   372   C  CB    . THR A  1  51   ? 72.694  12.227  121.119 1.00 64.88  ? 51   THR A CB    1 
ATOM   373   O  OG1   . THR A  1  51   ? 72.752  11.007  121.870 1.00 57.39  ? 51   THR A OG1   1 
ATOM   374   C  CG2   . THR A  1  51   ? 72.662  13.425  122.057 1.00 63.89  ? 51   THR A CG2   1 
ATOM   375   N  N     . ALA A  1  52   ? 72.150  11.410  118.033 1.00 64.89  ? 52   ALA A N     1 
ATOM   376   C  CA    . ALA A  1  52   ? 72.379  10.427  116.980 1.00 59.05  ? 52   ALA A CA    1 
ATOM   377   C  C     . ALA A  1  52   ? 73.642  10.721  116.178 1.00 55.76  ? 52   ALA A C     1 
ATOM   378   O  O     . ALA A  1  52   ? 74.117  11.854  116.138 1.00 56.68  ? 52   ALA A O     1 
ATOM   379   C  CB    . ALA A  1  52   ? 71.182  10.360  116.059 1.00 63.59  ? 52   ALA A CB    1 
ATOM   380   N  N     . VAL A  1  53   ? 74.178  9.687   115.538 1.00 60.74  ? 53   VAL A N     1 
ATOM   381   C  CA    . VAL A  1  53   ? 75.353  9.823   114.682 1.00 56.11  ? 53   VAL A CA    1 
ATOM   382   C  C     . VAL A  1  53   ? 74.943  10.493  113.388 1.00 50.79  ? 53   VAL A C     1 
ATOM   383   O  O     . VAL A  1  53   ? 74.125  9.952   112.655 1.00 52.52  ? 53   VAL A O     1 
ATOM   384   C  CB    . VAL A  1  53   ? 75.942  8.445   114.326 1.00 52.22  ? 53   VAL A CB    1 
ATOM   385   C  CG1   . VAL A  1  53   ? 77.137  8.597   113.414 1.00 52.94  ? 53   VAL A CG1   1 
ATOM   386   C  CG2   . VAL A  1  53   ? 76.317  7.686   115.588 1.00 57.89  ? 53   VAL A CG2   1 
ATOM   387   N  N     . THR A  1  54   ? 75.503  11.668  113.110 1.00 52.87  ? 54   THR A N     1 
ATOM   388   C  CA    . THR A  1  54   ? 75.147  12.420  111.906 1.00 56.39  ? 54   THR A CA    1 
ATOM   389   C  C     . THR A  1  54   ? 76.061  12.163  110.704 1.00 59.77  ? 54   THR A C     1 
ATOM   390   O  O     . THR A  1  54   ? 75.615  12.240  109.560 1.00 64.08  ? 54   THR A O     1 
ATOM   391   C  CB    . THR A  1  54   ? 75.078  13.940  112.170 1.00 57.81  ? 54   THR A CB    1 
ATOM   392   O  OG1   . THR A  1  54   ? 76.291  14.378  112.788 1.00 59.78  ? 54   THR A OG1   1 
ATOM   393   C  CG2   . THR A  1  54   ? 73.926  14.263  113.092 1.00 59.90  ? 54   THR A CG2   1 
ATOM   394   N  N     . SER A  1  55   ? 77.330  11.860  110.965 1.00 55.74  ? 55   SER A N     1 
ATOM   395   C  CA    . SER A  1  55   ? 78.328  11.724  109.902 1.00 56.56  ? 55   SER A CA    1 
ATOM   396   C  C     . SER A  1  55   ? 79.448  10.741  110.269 1.00 57.02  ? 55   SER A C     1 
ATOM   397   O  O     . SER A  1  55   ? 79.717  10.510  111.441 1.00 57.44  ? 55   SER A O     1 
ATOM   398   C  CB    . SER A  1  55   ? 78.914  13.099  109.567 1.00 57.55  ? 55   SER A CB    1 
ATOM   399   O  OG    . SER A  1  55   ? 79.998  13.002  108.661 1.00 60.55  ? 55   SER A OG    1 
ATOM   400   N  N     . VAL A  1  56   ? 80.069  10.106  109.226 1.00 55.39  ? 56   VAL A N     1 
ATOM   401   C  CA    . VAL A  1  56   ? 81.164  9.180   109.475 1.00 56.53  ? 56   VAL A CA    1 
ATOM   402   C  C     . VAL A  1  56   ? 82.314  9.358   108.478 1.00 67.64  ? 56   VAL A C     1 
ATOM   403   O  O     . VAL A  1  56   ? 82.083  9.550   107.282 1.00 68.65  ? 56   VAL A O     1 
ATOM   404   C  CB    . VAL A  1  56   ? 80.684  7.709   109.407 1.00 54.28  ? 56   VAL A CB    1 
ATOM   405   C  CG1   . VAL A  1  56   ? 81.846  6.750   109.590 1.00 59.92  ? 56   VAL A CG1   1 
ATOM   406   C  CG2   . VAL A  1  56   ? 79.658  7.444   110.471 1.00 63.03  ? 56   VAL A CG2   1 
ATOM   407   N  N     . TYR A  1  57   ? 83.544  9.281   108.974 1.00 66.21  ? 57   TYR A N     1 
ATOM   408   C  CA    . TYR A  1  57   ? 84.719  9.374   108.117 1.00 62.23  ? 57   TYR A CA    1 
ATOM   409   C  C     . TYR A  1  57   ? 85.646  8.183   108.331 1.00 68.61  ? 57   TYR A C     1 
ATOM   410   O  O     . TYR A  1  57   ? 86.244  8.034   109.396 1.00 74.25  ? 57   TYR A O     1 
ATOM   411   C  CB    . TYR A  1  57   ? 85.478  10.677  108.372 1.00 68.96  ? 57   TYR A CB    1 
ATOM   412   C  CG    . TYR A  1  57   ? 86.859  10.700  107.758 1.00 76.28  ? 57   TYR A CG    1 
ATOM   413   C  CD1   . TYR A  1  57   ? 87.050  11.108  106.445 1.00 77.56  ? 57   TYR A CD1   1 
ATOM   414   C  CD2   . TYR A  1  57   ? 87.972  10.307  108.490 1.00 80.30  ? 57   TYR A CD2   1 
ATOM   415   C  CE1   . TYR A  1  57   ? 88.310  11.128  105.879 1.00 82.62  ? 57   TYR A CE1   1 
ATOM   416   C  CE2   . TYR A  1  57   ? 89.236  10.324  107.932 1.00 81.66  ? 57   TYR A CE2   1 
ATOM   417   C  CZ    . TYR A  1  57   ? 89.399  10.735  106.627 1.00 89.17  ? 57   TYR A CZ    1 
ATOM   418   O  OH    . TYR A  1  57   ? 90.656  10.754  106.068 1.00 102.37 ? 57   TYR A OH    1 
ATOM   419   N  N     . ILE A  1  58   ? 85.760  7.337   107.312 1.00 72.64  ? 58   ILE A N     1 
ATOM   420   C  CA    . ILE A  1  58   ? 86.621  6.164   107.386 1.00 72.37  ? 58   ILE A CA    1 
ATOM   421   C  C     . ILE A  1  58   ? 87.907  6.382   106.596 1.00 79.41  ? 58   ILE A C     1 
ATOM   422   O  O     . ILE A  1  58   ? 87.871  6.753   105.423 1.00 85.56  ? 58   ILE A O     1 
ATOM   423   C  CB    . ILE A  1  58   ? 85.909  4.906   106.857 1.00 74.69  ? 58   ILE A CB    1 
ATOM   424   C  CG1   . ILE A  1  58   ? 84.464  4.863   107.357 1.00 70.15  ? 58   ILE A CG1   1 
ATOM   425   C  CG2   . ILE A  1  58   ? 86.660  3.653   107.278 1.00 72.37  ? 58   ILE A CG2   1 
ATOM   426   C  CD1   . ILE A  1  58   ? 84.087  3.556   108.020 1.00 69.75  ? 58   ILE A CD1   1 
ATOM   427   N  N     . GLU A  1  59   ? 89.041  6.152   107.248 1.00 79.31  ? 59   GLU A N     1 
ATOM   428   C  CA    . GLU A  1  59   ? 90.340  6.335   106.612 1.00 80.60  ? 59   GLU A CA    1 
ATOM   429   C  C     . GLU A  1  59   ? 90.526  5.379   105.439 1.00 83.58  ? 59   GLU A C     1 
ATOM   430   O  O     . GLU A  1  59   ? 90.593  4.163   105.622 1.00 87.34  ? 59   GLU A O     1 
ATOM   431   C  CB    . GLU A  1  59   ? 91.465  6.143   107.630 1.00 88.31  ? 59   GLU A CB    1 
ATOM   432   C  CG    . GLU A  1  59   ? 92.674  7.034   107.394 1.00 90.90  ? 59   GLU A CG    1 
ATOM   433   C  CD    . GLU A  1  59   ? 93.934  6.485   108.033 1.00 98.92  ? 59   GLU A CD    1 
ATOM   434   O  OE1   . GLU A  1  59   ? 94.183  6.793   109.218 1.00 101.90 ? 59   GLU A OE1   1 
ATOM   435   O  OE2   . GLU A  1  59   ? 94.675  5.746   107.351 1.00 96.85  ? 59   GLU A OE2   1 
ATOM   436   N  N     . ASP A  1  60   ? 90.612  5.936   104.236 1.00 85.25  ? 60   ASP A N     1 
ATOM   437   C  CA    . ASP A  1  60   ? 90.813  5.135   103.034 1.00 82.95  ? 60   ASP A CA    1 
ATOM   438   C  C     . ASP A  1  60   ? 89.487  4.736   102.394 1.00 78.24  ? 60   ASP A C     1 
ATOM   439   O  O     . ASP A  1  60   ? 89.430  3.802   101.595 1.00 79.61  ? 60   ASP A O     1 
ATOM   440   C  CB    . ASP A  1  60   ? 91.640  3.889   103.353 1.00 88.59  ? 60   ASP A CB    1 
ATOM   441   C  CG    . ASP A  1  60   ? 93.131  4.132   103.230 1.00 93.77  ? 60   ASP A CG    1 
ATOM   442   O  OD1   . ASP A  1  60   ? 93.522  5.103   102.548 1.00 88.80  ? 60   ASP A OD1   1 
ATOM   443   O  OD2   . ASP A  1  60   ? 93.913  3.354   103.815 1.00 101.55 ? 60   ASP A OD2   1 
ATOM   444   N  N     . VAL A  1  61   ? 88.423  5.449   102.750 1.00 75.38  ? 61   VAL A N     1 
ATOM   445   C  CA    . VAL A  1  61   ? 87.103  5.181   102.192 1.00 64.95  ? 61   VAL A CA    1 
ATOM   446   C  C     . VAL A  1  61   ? 86.580  6.477   101.564 1.00 65.82  ? 61   VAL A C     1 
ATOM   447   O  O     . VAL A  1  61   ? 86.529  7.511   102.230 1.00 62.31  ? 61   VAL A O     1 
ATOM   448   C  CB    . VAL A  1  61   ? 86.128  4.665   103.251 1.00 59.32  ? 61   VAL A CB    1 
ATOM   449   C  CG1   . VAL A  1  61   ? 84.714  4.718   102.742 1.00 62.44  ? 61   VAL A CG1   1 
ATOM   450   C  CG2   . VAL A  1  61   ? 86.494  3.242   103.647 1.00 62.88  ? 61   VAL A CG2   1 
ATOM   451   N  N     . LEU A  1  62   ? 86.215  6.432   100.283 1.00 61.56  ? 62   LEU A N     1 
ATOM   452   C  CA    . LEU A  1  62   ? 85.762  7.624   99.573  1.00 58.54  ? 62   LEU A CA    1 
ATOM   453   C  C     . LEU A  1  62   ? 84.263  7.864   99.698  1.00 60.00  ? 62   LEU A C     1 
ATOM   454   O  O     . LEU A  1  62   ? 83.802  8.997   99.589  1.00 60.58  ? 62   LEU A O     1 
ATOM   455   C  CB    . LEU A  1  62   ? 86.164  7.542   98.105  1.00 54.16  ? 62   LEU A CB    1 
ATOM   456   C  CG    . LEU A  1  62   ? 87.683  7.503   97.938  1.00 45.96  ? 62   LEU A CG    1 
ATOM   457   C  CD1   . LEU A  1  62   ? 88.067  7.289   96.488  1.00 55.19  ? 62   LEU A CD1   1 
ATOM   458   C  CD2   . LEU A  1  62   ? 88.271  8.788   98.468  1.00 51.98  ? 62   LEU A CD2   1 
ATOM   459   N  N     . HIS A  1  63   ? 83.348  6.829   99.982  1.00 51.99  ? 63   HIS A N     1 
ATOM   460   C  CA    . HIS A  1  63   ? 81.894  6.855   99.961  1.00 55.11  ? 63   HIS A CA    1 
ATOM   461   C  C     . HIS A  1  63   ? 81.300  5.591   100.576 1.00 57.85  ? 63   HIS A C     1 
ATOM   462   O  O     . HIS A  1  63   ? 82.014  4.617   100.821 1.00 56.31  ? 63   HIS A O     1 
ATOM   463   C  CB    . HIS A  1  63   ? 81.409  7.001   98.525  1.00 59.66  ? 63   HIS A CB    1 
ATOM   464   C  CG    . HIS A  1  63   ? 81.874  5.901   97.626  1.00 53.41  ? 63   HIS A CG    1 
ATOM   465   N  ND1   . HIS A  1  63   ? 81.419  4.605   97.738  1.00 54.00  ? 63   HIS A ND1   1 
ATOM   466   C  CD2   . HIS A  1  63   ? 82.767  5.900   96.609  1.00 56.44  ? 63   HIS A CD2   1 
ATOM   467   C  CE1   . HIS A  1  63   ? 82.004  3.854   96.823  1.00 55.37  ? 63   HIS A CE1   1 
ATOM   468   N  NE2   . HIS A  1  63   ? 82.828  4.615   96.125  1.00 60.24  ? 63   HIS A NE2   1 
ATOM   469   N  N     . GLU A  1  64   ? 79.986  5.609   100.799 1.00 55.78  ? 64   GLU A N     1 
ATOM   470   C  CA    . GLU A  1  64   ? 79.299  4.541   101.526 1.00 54.22  ? 64   GLU A CA    1 
ATOM   471   C  C     . GLU A  1  64   ? 79.356  3.186   100.824 1.00 54.22  ? 64   GLU A C     1 
ATOM   472   O  O     . GLU A  1  64   ? 79.244  2.142   101.464 1.00 54.23  ? 64   GLU A O     1 
ATOM   473   C  CB    . GLU A  1  64   ? 77.842  4.935   101.793 1.00 56.21  ? 64   GLU A CB    1 
ATOM   474   C  CG    . GLU A  1  64   ? 77.034  3.901   102.570 1.00 58.38  ? 64   GLU A CG    1 
ATOM   475   C  CD    . GLU A  1  64   ? 75.696  4.441   103.066 1.00 66.31  ? 64   GLU A CD    1 
ATOM   476   O  OE1   . GLU A  1  64   ? 75.405  5.638   102.842 1.00 69.62  ? 64   GLU A OE1   1 
ATOM   477   O  OE2   . GLU A  1  64   ? 74.934  3.667   103.684 1.00 68.87  ? 64   GLU A OE2   1 
ATOM   478   N  N     . PHE A  1  65   ? 79.540  3.200   99.509  1.00 55.37  ? 65   PHE A N     1 
ATOM   479   C  CA    . PHE A  1  65   ? 79.480  1.965   98.730  1.00 56.15  ? 65   PHE A CA    1 
ATOM   480   C  C     . PHE A  1  65   ? 80.841  1.308   98.611  1.00 60.77  ? 65   PHE A C     1 
ATOM   481   O  O     . PHE A  1  65   ? 81.056  0.438   97.764  1.00 56.82  ? 65   PHE A O     1 
ATOM   482   C  CB    . PHE A  1  65   ? 78.881  2.240   97.358  1.00 50.02  ? 65   PHE A CB    1 
ATOM   483   C  CG    . PHE A  1  65   ? 77.573  2.962   97.427  1.00 51.02  ? 65   PHE A CG    1 
ATOM   484   C  CD1   . PHE A  1  65   ? 77.521  4.347   97.349  1.00 52.44  ? 65   PHE A CD1   1 
ATOM   485   C  CD2   . PHE A  1  65   ? 76.397  2.261   97.624  1.00 48.62  ? 65   PHE A CD2   1 
ATOM   486   C  CE1   . PHE A  1  65   ? 76.316  5.016   97.432  1.00 50.54  ? 65   PHE A CE1   1 
ATOM   487   C  CE2   . PHE A  1  65   ? 75.190  2.922   97.713  1.00 51.07  ? 65   PHE A CE2   1 
ATOM   488   C  CZ    . PHE A  1  65   ? 75.148  4.303   97.616  1.00 52.53  ? 65   PHE A CZ    1 
ATOM   489   N  N     . SER A  1  66   ? 81.752  1.737   99.481  1.00 63.96  ? 66   SER A N     1 
ATOM   490   C  CA    . SER A  1  66   ? 83.087  1.163   99.565  1.00 60.69  ? 66   SER A CA    1 
ATOM   491   C  C     . SER A  1  66   ? 83.085  -0.137  100.365 1.00 54.14  ? 66   SER A C     1 
ATOM   492   O  O     . SER A  1  66   ? 82.061  -0.579  100.872 1.00 50.47  ? 66   SER A O     1 
ATOM   493   C  CB    . SER A  1  66   ? 84.057  2.163   100.204 1.00 60.76  ? 66   SER A CB    1 
ATOM   494   O  OG    . SER A  1  66   ? 84.165  3.355   99.441  1.00 66.67  ? 66   SER A OG    1 
ATOM   495   N  N     . THR A  1  67   ? 84.252  -0.751  100.458 1.00 62.43  ? 67   THR A N     1 
ATOM   496   C  CA    . THR A  1  67   ? 84.439  -1.933  101.273 1.00 60.29  ? 67   THR A CA    1 
ATOM   497   C  C     . THR A  1  67   ? 85.875  -1.879  101.759 1.00 62.26  ? 67   THR A C     1 
ATOM   498   O  O     . THR A  1  67   ? 86.774  -1.549  100.988 1.00 69.04  ? 67   THR A O     1 
ATOM   499   C  CB    . THR A  1  67   ? 84.193  -3.218  100.463 1.00 61.48  ? 67   THR A CB    1 
ATOM   500   O  OG1   . THR A  1  67   ? 84.645  -4.350  101.213 1.00 70.69  ? 67   THR A OG1   1 
ATOM   501   C  CG2   . THR A  1  67   ? 84.945  -3.169  99.146  1.00 62.52  ? 67   THR A CG2   1 
ATOM   502   N  N     . ILE A  1  68   ? 86.095  -2.169  103.036 1.00 61.59  ? 68   ILE A N     1 
ATOM   503   C  CA    . ILE A  1  68   ? 87.435  -2.035  103.607 1.00 65.94  ? 68   ILE A CA    1 
ATOM   504   C  C     . ILE A  1  68   ? 88.151  -3.372  103.663 1.00 62.35  ? 68   ILE A C     1 
ATOM   505   O  O     . ILE A  1  68   ? 87.572  -4.363  104.098 1.00 63.05  ? 68   ILE A O     1 
ATOM   506   C  CB    . ILE A  1  68   ? 87.403  -1.447  105.024 1.00 65.44  ? 68   ILE A CB    1 
ATOM   507   C  CG1   . ILE A  1  68   ? 86.574  -0.162  105.053 1.00 66.70  ? 68   ILE A CG1   1 
ATOM   508   C  CG2   . ILE A  1  68   ? 88.819  -1.185  105.509 1.00 68.09  ? 68   ILE A CG2   1 
ATOM   509   C  CD1   . ILE A  1  68   ? 86.182  0.279   106.451 1.00 59.39  ? 68   ILE A CD1   1 
ATOM   510   N  N     . PRO A  1  69   ? 89.413  -3.406  103.206 1.00 66.63  ? 69   PRO A N     1 
ATOM   511   C  CA    . PRO A  1  69   ? 90.214  -4.634  103.256 1.00 58.93  ? 69   PRO A CA    1 
ATOM   512   C  C     . PRO A  1  69   ? 90.516  -5.002  104.698 1.00 60.30  ? 69   PRO A C     1 
ATOM   513   O  O     . PRO A  1  69   ? 90.888  -4.135  105.492 1.00 63.28  ? 69   PRO A O     1 
ATOM   514   C  CB    . PRO A  1  69   ? 91.502  -4.248  102.524 1.00 50.11  ? 69   PRO A CB    1 
ATOM   515   C  CG    . PRO A  1  69   ? 91.134  -3.055  101.692 1.00 55.22  ? 69   PRO A CG    1 
ATOM   516   C  CD    . PRO A  1  69   ? 90.112  -2.319  102.499 1.00 66.56  ? 69   PRO A CD    1 
ATOM   517   N  N     . GLY A  1  70   ? 90.341  -6.276  105.033 1.00 62.07  ? 70   GLY A N     1 
ATOM   518   C  CA    . GLY A  1  70   ? 90.537  -6.745  106.392 1.00 62.41  ? 70   GLY A CA    1 
ATOM   519   C  C     . GLY A  1  70   ? 89.241  -6.789  107.177 1.00 64.03  ? 70   GLY A C     1 
ATOM   520   O  O     . GLY A  1  70   ? 89.115  -7.544  108.138 1.00 72.44  ? 70   GLY A O     1 
ATOM   521   N  N     . VAL A  1  71   ? 88.273  -5.981  106.758 1.00 63.60  ? 71   VAL A N     1 
ATOM   522   C  CA    . VAL A  1  71   ? 86.988  -5.874  107.444 1.00 60.57  ? 71   VAL A CA    1 
ATOM   523   C  C     . VAL A  1  71   ? 85.906  -6.716  106.760 1.00 64.89  ? 71   VAL A C     1 
ATOM   524   O  O     . VAL A  1  71   ? 85.829  -6.769  105.533 1.00 71.23  ? 71   VAL A O     1 
ATOM   525   C  CB    . VAL A  1  71   ? 86.519  -4.412  107.502 1.00 58.91  ? 71   VAL A CB    1 
ATOM   526   C  CG1   . VAL A  1  71   ? 85.253  -4.296  108.329 1.00 62.77  ? 71   VAL A CG1   1 
ATOM   527   C  CG2   . VAL A  1  71   ? 87.617  -3.526  108.062 1.00 58.71  ? 71   VAL A CG2   1 
ATOM   528   N  N     . LYS A  1  72   ? 85.068  -7.368  107.559 1.00 62.17  ? 72   LYS A N     1 
ATOM   529   C  CA    . LYS A  1  72   ? 84.024  -8.242  107.032 1.00 63.04  ? 72   LYS A CA    1 
ATOM   530   C  C     . LYS A  1  72   ? 82.842  -7.425  106.527 1.00 66.39  ? 72   LYS A C     1 
ATOM   531   O  O     . LYS A  1  72   ? 82.266  -7.712  105.469 1.00 66.55  ? 72   LYS A O     1 
ATOM   532   C  CB    . LYS A  1  72   ? 83.551  -9.212  108.118 1.00 56.62  ? 72   LYS A CB    1 
ATOM   533   C  CG    . LYS A  1  72   ? 82.680  -10.342 107.612 1.00 51.89  ? 72   LYS A CG    1 
ATOM   534   C  CD    . LYS A  1  72   ? 82.036  -11.104 108.755 1.00 55.10  ? 72   LYS A CD    1 
ATOM   535   C  CE    . LYS A  1  72   ? 81.261  -12.315 108.244 1.00 59.56  ? 72   LYS A CE    1 
ATOM   536   N  NZ    . LYS A  1  72   ? 80.396  -12.954 109.287 1.00 59.76  ? 72   LYS A NZ    1 
ATOM   537   N  N     . GLU A  1  73   ? 82.486  -6.406  107.301 1.00 63.09  ? 73   GLU A N     1 
ATOM   538   C  CA    . GLU A  1  73   ? 81.349  -5.553  106.998 1.00 62.88  ? 73   GLU A CA    1 
ATOM   539   C  C     . GLU A  1  73   ? 81.682  -4.555  105.893 1.00 59.46  ? 73   GLU A C     1 
ATOM   540   O  O     . GLU A  1  73   ? 82.757  -3.963  105.892 1.00 62.84  ? 73   GLU A O     1 
ATOM   541   C  CB    . GLU A  1  73   ? 80.912  -4.801  108.261 1.00 59.95  ? 73   GLU A CB    1 
ATOM   542   C  CG    . GLU A  1  73   ? 80.139  -5.638  109.279 1.00 63.83  ? 73   GLU A CG    1 
ATOM   543   C  CD    . GLU A  1  73   ? 81.014  -6.600  110.066 1.00 65.64  ? 73   GLU A CD    1 
ATOM   544   O  OE1   . GLU A  1  73   ? 82.230  -6.633  109.815 1.00 69.33  ? 73   GLU A OE1   1 
ATOM   545   O  OE2   . GLU A  1  73   ? 80.485  -7.322  110.940 1.00 66.09  ? 73   GLU A OE2   1 
ATOM   546   N  N     . ASP A  1  74   ? 80.763  -4.380  104.949 1.00 59.87  ? 74   ASP A N     1 
ATOM   547   C  CA    . ASP A  1  74   ? 80.864  -3.289  103.982 1.00 58.27  ? 74   ASP A CA    1 
ATOM   548   C  C     . ASP A  1  74   ? 80.576  -1.983  104.713 1.00 57.94  ? 74   ASP A C     1 
ATOM   549   O  O     . ASP A  1  74   ? 79.968  -1.994  105.784 1.00 61.38  ? 74   ASP A O     1 
ATOM   550   C  CB    . ASP A  1  74   ? 79.881  -3.489  102.822 1.00 56.08  ? 74   ASP A CB    1 
ATOM   551   C  CG    . ASP A  1  74   ? 78.500  -3.925  103.290 1.00 70.07  ? 74   ASP A CG    1 
ATOM   552   O  OD1   . ASP A  1  74   ? 78.044  -3.444  104.348 1.00 73.55  ? 74   ASP A OD1   1 
ATOM   553   O  OD2   . ASP A  1  74   ? 77.867  -4.756  102.603 1.00 76.36  ? 74   ASP A OD2   1 
ATOM   554   N  N     . VAL A  1  75   ? 81.014  -0.860  104.156 1.00 52.87  ? 75   VAL A N     1 
ATOM   555   C  CA    . VAL A  1  75   ? 80.784  0.417   104.819 1.00 54.13  ? 75   VAL A CA    1 
ATOM   556   C  C     . VAL A  1  75   ? 79.296  0.621   105.113 1.00 55.08  ? 75   VAL A C     1 
ATOM   557   O  O     . VAL A  1  75   ? 78.928  1.245   106.104 1.00 53.48  ? 75   VAL A O     1 
ATOM   558   C  CB    . VAL A  1  75   ? 81.329  1.584   104.004 1.00 43.83  ? 75   VAL A CB    1 
ATOM   559   C  CG1   . VAL A  1  75   ? 81.058  2.894   104.716 1.00 47.81  ? 75   VAL A CG1   1 
ATOM   560   C  CG2   . VAL A  1  75   ? 82.802  1.404   103.798 1.00 56.85  ? 75   VAL A CG2   1 
ATOM   561   N  N     . VAL A  1  76   ? 78.445  0.073   104.255 1.00 55.44  ? 76   VAL A N     1 
ATOM   562   C  CA    . VAL A  1  76   ? 77.004  0.163   104.443 1.00 57.85  ? 76   VAL A CA    1 
ATOM   563   C  C     . VAL A  1  76   ? 76.566  -0.437  105.778 1.00 63.95  ? 76   VAL A C     1 
ATOM   564   O  O     . VAL A  1  76   ? 75.847  0.211   106.550 1.00 62.11  ? 76   VAL A O     1 
ATOM   565   C  CB    . VAL A  1  76   ? 76.241  -0.510  103.280 1.00 58.46  ? 76   VAL A CB    1 
ATOM   566   C  CG1   . VAL A  1  76   ? 74.968  -1.178  103.777 1.00 60.23  ? 76   VAL A CG1   1 
ATOM   567   C  CG2   . VAL A  1  76   ? 75.927  0.508   102.199 1.00 53.35  ? 76   VAL A CG2   1 
ATOM   568   N  N     . GLU A  1  77   ? 77.008  -1.666  106.051 1.00 64.09  ? 77   GLU A N     1 
ATOM   569   C  CA    . GLU A  1  77   ? 76.627  -2.358  107.282 1.00 57.03  ? 77   GLU A CA    1 
ATOM   570   C  C     . GLU A  1  77   ? 77.234  -1.676  108.491 1.00 58.19  ? 77   GLU A C     1 
ATOM   571   O  O     . GLU A  1  77   ? 76.614  -1.611  109.548 1.00 62.83  ? 77   GLU A O     1 
ATOM   572   C  CB    . GLU A  1  77   ? 77.032  -3.834  107.258 1.00 53.39  ? 77   GLU A CB    1 
ATOM   573   C  CG    . GLU A  1  77   ? 76.587  -4.598  108.504 1.00 54.20  ? 77   GLU A CG    1 
ATOM   574   C  CD    . GLU A  1  77   ? 76.648  -6.113  108.340 1.00 56.92  ? 77   GLU A CD    1 
ATOM   575   O  OE1   . GLU A  1  77   ? 75.973  -6.824  109.117 1.00 58.19  ? 77   GLU A OE1   1 
ATOM   576   O  OE2   . GLU A  1  77   ? 77.368  -6.595  107.438 1.00 50.03  ? 77   GLU A OE2   1 
ATOM   577   N  N     . ILE A  1  78   ? 78.450  -1.166  108.334 1.00 58.12  ? 78   ILE A N     1 
ATOM   578   C  CA    . ILE A  1  78   ? 79.102  -0.445  109.421 1.00 60.60  ? 78   ILE A CA    1 
ATOM   579   C  C     . ILE A  1  78   ? 78.290  0.787   109.801 1.00 58.97  ? 78   ILE A C     1 
ATOM   580   O  O     . ILE A  1  78   ? 78.004  1.005   110.974 1.00 62.27  ? 78   ILE A O     1 
ATOM   581   C  CB    . ILE A  1  78   ? 80.541  -0.034  109.062 1.00 57.71  ? 78   ILE A CB    1 
ATOM   582   C  CG1   . ILE A  1  78   ? 81.421  -1.278  108.915 1.00 62.05  ? 78   ILE A CG1   1 
ATOM   583   C  CG2   . ILE A  1  78   ? 81.106  0.893   110.123 1.00 54.87  ? 78   ILE A CG2   1 
ATOM   584   C  CD1   . ILE A  1  78   ? 82.826  -0.985  108.442 1.00 58.23  ? 78   ILE A CD1   1 
ATOM   585   N  N     . ILE A  1  79   ? 77.916  1.585   108.808 1.00 54.68  ? 79   ILE A N     1 
ATOM   586   C  CA    . ILE A  1  79   ? 77.078  2.748   109.055 1.00 56.27  ? 79   ILE A CA    1 
ATOM   587   C  C     . ILE A  1  79   ? 75.775  2.304   109.717 1.00 62.51  ? 79   ILE A C     1 
ATOM   588   O  O     . ILE A  1  79   ? 75.275  2.947   110.644 1.00 61.87  ? 79   ILE A O     1 
ATOM   589   C  CB    . ILE A  1  79   ? 76.747  3.503   107.753 1.00 58.21  ? 79   ILE A CB    1 
ATOM   590   C  CG1   . ILE A  1  79   ? 78.027  3.968   107.045 1.00 53.68  ? 79   ILE A CG1   1 
ATOM   591   C  CG2   . ILE A  1  79   ? 75.841  4.689   108.047 1.00 53.64  ? 79   ILE A CG2   1 
ATOM   592   C  CD1   . ILE A  1  79   ? 78.683  5.160   107.680 1.00 49.80  ? 79   ILE A CD1   1 
ATOM   593   N  N     . LEU A  1  80   ? 75.231  1.192   109.235 1.00 61.48  ? 80   LEU A N     1 
ATOM   594   C  CA    . LEU A  1  80   ? 73.986  0.661   109.779 1.00 57.14  ? 80   LEU A CA    1 
ATOM   595   C  C     . LEU A  1  80   ? 74.132  0.319   111.256 1.00 57.70  ? 80   LEU A C     1 
ATOM   596   O  O     . LEU A  1  80   ? 73.163  0.384   112.007 1.00 60.36  ? 80   LEU A O     1 
ATOM   597   C  CB    . LEU A  1  80   ? 73.543  -0.574  108.993 1.00 52.46  ? 80   LEU A CB    1 
ATOM   598   C  CG    . LEU A  1  80   ? 72.171  -0.491  108.328 1.00 42.12  ? 80   LEU A CG    1 
ATOM   599   C  CD1   . LEU A  1  80   ? 72.090  0.731   107.434 1.00 49.42  ? 80   LEU A CD1   1 
ATOM   600   C  CD2   . LEU A  1  80   ? 71.898  -1.756  107.544 1.00 45.11  ? 80   LEU A CD2   1 
ATOM   601   N  N     . ASN A  1  81   ? 75.343  -0.059  111.660 1.00 61.69  ? 81   ASN A N     1 
ATOM   602   C  CA    . ASN A  1  81   ? 75.633  -0.366  113.059 1.00 55.84  ? 81   ASN A CA    1 
ATOM   603   C  C     . ASN A  1  81   ? 75.833  0.899   113.879 1.00 60.68  ? 81   ASN A C     1 
ATOM   604   O  O     . ASN A  1  81   ? 75.307  1.016   114.981 1.00 65.26  ? 81   ASN A O     1 
ATOM   605   C  CB    . ASN A  1  81   ? 76.853  -1.275  113.184 1.00 52.29  ? 81   ASN A CB    1 
ATOM   606   C  CG    . ASN A  1  81   ? 76.615  -2.652  112.594 1.00 60.18  ? 81   ASN A CG    1 
ATOM   607   O  OD1   . ASN A  1  81   ? 75.471  -3.070  112.411 1.00 57.39  ? 81   ASN A OD1   1 
ATOM   608   N  ND2   . ASN A  1  81   ? 77.698  -3.369  112.296 1.00 60.56  ? 81   ASN A ND2   1 
ATOM   609   N  N     . LEU A  1  82   ? 76.585  1.849   113.333 1.00 57.97  ? 82   LEU A N     1 
ATOM   610   C  CA    . LEU A  1  82   ? 76.770  3.143   113.977 1.00 61.03  ? 82   LEU A CA    1 
ATOM   611   C  C     . LEU A  1  82   ? 75.427  3.841   114.185 1.00 66.25  ? 82   LEU A C     1 
ATOM   612   O  O     . LEU A  1  82   ? 75.269  4.683   115.072 1.00 65.73  ? 82   LEU A O     1 
ATOM   613   C  CB    . LEU A  1  82   ? 77.684  4.024   113.135 1.00 55.35  ? 82   LEU A CB    1 
ATOM   614   C  CG    . LEU A  1  82   ? 79.058  3.435   112.839 1.00 61.74  ? 82   LEU A CG    1 
ATOM   615   C  CD1   . LEU A  1  82   ? 79.797  4.295   111.821 1.00 63.63  ? 82   LEU A CD1   1 
ATOM   616   C  CD2   . LEU A  1  82   ? 79.860  3.288   114.122 1.00 60.14  ? 82   LEU A CD2   1 
ATOM   617   N  N     . LYS A  1  83   ? 74.461  3.485   113.352 1.00 65.19  ? 83   LYS A N     1 
ATOM   618   C  CA    . LYS A  1  83   ? 73.119  4.025   113.459 1.00 65.63  ? 83   LYS A CA    1 
ATOM   619   C  C     . LYS A  1  83   ? 72.475  3.579   114.776 1.00 67.36  ? 83   LYS A C     1 
ATOM   620   O  O     . LYS A  1  83   ? 71.523  4.194   115.256 1.00 74.77  ? 83   LYS A O     1 
ATOM   621   C  CB    . LYS A  1  83   ? 72.285  3.548   112.270 1.00 60.94  ? 83   LYS A CB    1 
ATOM   622   C  CG    . LYS A  1  83   ? 71.678  4.650   111.435 1.00 54.61  ? 83   LYS A CG    1 
ATOM   623   C  CD    . LYS A  1  83   ? 70.697  4.057   110.438 1.00 66.29  ? 83   LYS A CD    1 
ATOM   624   C  CE    . LYS A  1  83   ? 69.812  5.126   109.813 1.00 72.31  ? 83   LYS A CE    1 
ATOM   625   N  NZ    . LYS A  1  83   ? 68.734  4.551   108.950 1.00 68.94  ? 83   LYS A NZ    1 
ATOM   626   N  N     . GLU A  1  84   ? 73.006  2.507   115.356 1.00 63.87  ? 84   GLU A N     1 
ATOM   627   C  CA    . GLU A  1  84   ? 72.447  1.924   116.572 1.00 69.65  ? 84   GLU A CA    1 
ATOM   628   C  C     . GLU A  1  84   ? 73.170  2.400   117.833 1.00 71.60  ? 84   GLU A C     1 
ATOM   629   O  O     . GLU A  1  84   ? 72.811  2.028   118.950 1.00 76.38  ? 84   GLU A O     1 
ATOM   630   C  CB    . GLU A  1  84   ? 72.476  0.393   116.491 1.00 67.32  ? 84   GLU A CB    1 
ATOM   631   C  CG    . GLU A  1  84   ? 71.495  -0.191  115.490 1.00 74.59  ? 84   GLU A CG    1 
ATOM   632   C  CD    . GLU A  1  84   ? 70.051  0.168   115.810 1.00 95.37  ? 84   GLU A CD    1 
ATOM   633   O  OE1   . GLU A  1  84   ? 69.729  0.349   117.007 1.00 99.50  ? 84   GLU A OE1   1 
ATOM   634   O  OE2   . GLU A  1  84   ? 69.240  0.274   114.863 1.00 96.10  ? 84   GLU A OE2   1 
ATOM   635   N  N     . LEU A  1  85   ? 74.186  3.230   117.645 1.00 67.49  ? 85   LEU A N     1 
ATOM   636   C  CA    . LEU A  1  85   ? 74.986  3.730   118.753 1.00 65.98  ? 85   LEU A CA    1 
ATOM   637   C  C     . LEU A  1  85   ? 74.228  4.776   119.565 1.00 63.10  ? 85   LEU A C     1 
ATOM   638   O  O     . LEU A  1  85   ? 73.832  5.820   119.040 1.00 59.56  ? 85   LEU A O     1 
ATOM   639   C  CB    . LEU A  1  85   ? 76.279  4.339   118.215 1.00 65.39  ? 85   LEU A CB    1 
ATOM   640   C  CG    . LEU A  1  85   ? 77.290  4.848   119.235 1.00 56.49  ? 85   LEU A CG    1 
ATOM   641   C  CD1   . LEU A  1  85   ? 78.071  3.685   119.805 1.00 56.94  ? 85   LEU A CD1   1 
ATOM   642   C  CD2   . LEU A  1  85   ? 78.220  5.840   118.575 1.00 65.78  ? 85   LEU A CD2   1 
ATOM   643   N  N     . VAL A  1  86   ? 74.035  4.497   120.849 1.00 62.90  ? 86   VAL A N     1 
ATOM   644   C  CA    . VAL A  1  86   ? 73.362  5.444   121.731 1.00 63.20  ? 86   VAL A CA    1 
ATOM   645   C  C     . VAL A  1  86   ? 74.352  6.133   122.664 1.00 61.36  ? 86   VAL A C     1 
ATOM   646   O  O     . VAL A  1  86   ? 74.908  5.515   123.571 1.00 60.40  ? 86   VAL A O     1 
ATOM   647   C  CB    . VAL A  1  86   ? 72.237  4.772   122.541 1.00 64.15  ? 86   VAL A CB    1 
ATOM   648   C  CG1   . VAL A  1  86   ? 72.624  3.362   122.924 1.00 61.58  ? 86   VAL A CG1   1 
ATOM   649   C  CG2   . VAL A  1  86   ? 71.885  5.604   123.772 1.00 67.03  ? 86   VAL A CG2   1 
ATOM   650   N  N     . VAL A  1  87   ? 74.572  7.420   122.430 1.00 63.85  ? 87   VAL A N     1 
ATOM   651   C  CA    . VAL A  1  87   ? 75.560  8.165   123.198 1.00 68.30  ? 87   VAL A CA    1 
ATOM   652   C  C     . VAL A  1  87   ? 74.944  9.320   123.970 1.00 68.08  ? 87   VAL A C     1 
ATOM   653   O  O     . VAL A  1  87   ? 74.262  10.176  123.404 1.00 66.51  ? 87   VAL A O     1 
ATOM   654   C  CB    . VAL A  1  87   ? 76.712  8.691   122.308 1.00 73.01  ? 87   VAL A CB    1 
ATOM   655   C  CG1   . VAL A  1  87   ? 76.269  8.806   120.855 1.00 71.47  ? 87   VAL A CG1   1 
ATOM   656   C  CG2   . VAL A  1  87   ? 77.226  10.025  122.836 1.00 70.23  ? 87   VAL A CG2   1 
ATOM   657   N  N     . ARG A  1  88   ? 75.208  9.330   125.271 1.00 68.90  ? 88   ARG A N     1 
ATOM   658   C  CA    . ARG A  1  88   ? 74.677  10.325  126.184 1.00 67.75  ? 88   ARG A CA    1 
ATOM   659   C  C     . ARG A  1  88   ? 75.666  11.463  126.396 1.00 71.12  ? 88   ARG A C     1 
ATOM   660   O  O     . ARG A  1  88   ? 76.849  11.230  126.645 1.00 72.38  ? 88   ARG A O     1 
ATOM   661   C  CB    . ARG A  1  88   ? 74.362  9.661   127.519 1.00 68.93  ? 88   ARG A CB    1 
ATOM   662   C  CG    . ARG A  1  88   ? 73.938  10.616  128.608 1.00 76.76  ? 88   ARG A CG    1 
ATOM   663   C  CD    . ARG A  1  88   ? 73.921  9.909   129.948 1.00 74.19  ? 88   ARG A CD    1 
ATOM   664   N  NE    . ARG A  1  88   ? 73.395  10.758  131.011 1.00 75.34  ? 88   ARG A NE    1 
ATOM   665   C  CZ    . ARG A  1  88   ? 73.441  10.446  132.301 1.00 75.16  ? 88   ARG A CZ    1 
ATOM   666   N  NH1   . ARG A  1  88   ? 73.999  9.305   132.691 1.00 74.21  ? 88   ARG A NH1   1 
ATOM   667   N  NH2   . ARG A  1  88   ? 72.937  11.277  133.201 1.00 79.34  ? 88   ARG A NH2   1 
ATOM   668   N  N     . PHE A  1  89   ? 75.173  12.692  126.283 1.00 70.29  ? 89   PHE A N     1 
ATOM   669   C  CA    . PHE A  1  89   ? 75.962  13.876  126.585 1.00 70.08  ? 89   PHE A CA    1 
ATOM   670   C  C     . PHE A  1  89   ? 75.687  14.295  128.022 1.00 84.62  ? 89   PHE A C     1 
ATOM   671   O  O     . PHE A  1  89   ? 74.550  14.612  128.372 1.00 88.05  ? 89   PHE A O     1 
ATOM   672   C  CB    . PHE A  1  89   ? 75.591  15.031  125.655 1.00 74.56  ? 89   PHE A CB    1 
ATOM   673   C  CG    . PHE A  1  89   ? 75.951  14.801  124.214 1.00 83.49  ? 89   PHE A CG    1 
ATOM   674   C  CD1   . PHE A  1  89   ? 76.406  13.565  123.782 1.00 78.29  ? 89   PHE A CD1   1 
ATOM   675   C  CD2   . PHE A  1  89   ? 75.845  15.832  123.291 1.00 83.27  ? 89   PHE A CD2   1 
ATOM   676   C  CE1   . PHE A  1  89   ? 76.742  13.362  122.454 1.00 76.36  ? 89   PHE A CE1   1 
ATOM   677   C  CE2   . PHE A  1  89   ? 76.181  15.636  121.961 1.00 76.58  ? 89   PHE A CE2   1 
ATOM   678   C  CZ    . PHE A  1  89   ? 76.630  14.400  121.542 1.00 73.32  ? 89   PHE A CZ    1 
ATOM   679   N  N     . LEU A  1  90   ? 76.724  14.299  128.855 1.00 85.32  ? 90   LEU A N     1 
ATOM   680   C  CA    . LEU A  1  90   ? 76.564  14.683  130.255 1.00 76.33  ? 90   LEU A CA    1 
ATOM   681   C  C     . LEU A  1  90   ? 76.351  16.188  130.407 1.00 76.37  ? 90   LEU A C     1 
ATOM   682   O  O     . LEU A  1  90   ? 75.501  16.621  131.178 1.00 75.74  ? 90   LEU A O     1 
ATOM   683   C  CB    . LEU A  1  90   ? 77.754  14.213  131.096 1.00 76.38  ? 90   LEU A CB    1 
ATOM   684   C  CG    . LEU A  1  90   ? 77.774  12.729  131.483 1.00 76.37  ? 90   LEU A CG    1 
ATOM   685   C  CD1   . LEU A  1  90   ? 76.428  12.310  132.031 1.00 72.20  ? 90   LEU A CD1   1 
ATOM   686   C  CD2   . LEU A  1  90   ? 78.172  11.843  130.318 1.00 80.37  ? 90   LEU A CD2   1 
ATOM   687   N  N     . ASN A  1  91   ? 77.112  16.981  129.664 1.00 79.32  ? 91   ASN A N     1 
ATOM   688   C  CA    . ASN A  1  91   ? 76.958  18.430  129.712 1.00 82.54  ? 91   ASN A CA    1 
ATOM   689   C  C     . ASN A  1  91   ? 75.949  18.943  128.685 1.00 87.94  ? 91   ASN A C     1 
ATOM   690   O  O     . ASN A  1  91   ? 76.198  18.885  127.483 1.00 90.88  ? 91   ASN A O     1 
ATOM   691   C  CB    . ASN A  1  91   ? 78.311  19.115  129.523 1.00 87.59  ? 91   ASN A CB    1 
ATOM   692   C  CG    . ASN A  1  91   ? 78.206  20.627  129.529 1.00 94.73  ? 91   ASN A CG    1 
ATOM   693   O  OD1   . ASN A  1  91   ? 77.154  21.189  129.838 1.00 91.83  ? 91   ASN A OD1   1 
ATOM   694   N  ND2   . ASN A  1  91   ? 79.304  21.297  129.191 1.00 100.76 ? 91   ASN A ND2   1 
ATOM   695   N  N     . PRO A  1  92   ? 74.803  19.448  129.166 1.00 86.43  ? 92   PRO A N     1 
ATOM   696   C  CA    . PRO A  1  92   ? 73.692  19.967  128.357 1.00 87.78  ? 92   PRO A CA    1 
ATOM   697   C  C     . PRO A  1  92   ? 74.067  21.154  127.473 1.00 90.35  ? 92   PRO A C     1 
ATOM   698   O  O     . PRO A  1  92   ? 73.282  21.537  126.608 1.00 94.10  ? 92   PRO A O     1 
ATOM   699   C  CB    . PRO A  1  92   ? 72.680  20.417  129.413 1.00 84.45  ? 92   PRO A CB    1 
ATOM   700   C  CG    . PRO A  1  92   ? 72.973  19.567  130.589 1.00 82.29  ? 92   PRO A CG    1 
ATOM   701   C  CD    . PRO A  1  92   ? 74.462  19.414  130.596 1.00 82.66  ? 92   PRO A CD    1 
ATOM   702   N  N     . SER A  1  93   ? 75.237  21.739  127.693 1.00 91.61  ? 93   SER A N     1 
ATOM   703   C  CA    . SER A  1  93   ? 75.682  22.853  126.868 1.00 93.73  ? 93   SER A CA    1 
ATOM   704   C  C     . SER A  1  93   ? 76.358  22.321  125.608 1.00 94.67  ? 93   SER A C     1 
ATOM   705   O  O     . SER A  1  93   ? 76.633  23.069  124.669 1.00 91.71  ? 93   SER A O     1 
ATOM   706   C  CB    . SER A  1  93   ? 76.647  23.743  127.652 1.00 97.36  ? 93   SER A CB    1 
ATOM   707   O  OG    . SER A  1  93   ? 76.049  24.213  128.849 1.00 99.11  ? 93   SER A OG    1 
ATOM   708   N  N     . LEU A  1  94   ? 76.607  21.016  125.599 1.00 93.59  ? 94   LEU A N     1 
ATOM   709   C  CA    . LEU A  1  94   ? 77.338  20.355  124.523 1.00 91.43  ? 94   LEU A CA    1 
ATOM   710   C  C     . LEU A  1  94   ? 76.407  19.827  123.436 1.00 89.61  ? 94   LEU A C     1 
ATOM   711   O  O     . LEU A  1  94   ? 75.591  18.940  123.686 1.00 88.33  ? 94   LEU A O     1 
ATOM   712   C  CB    . LEU A  1  94   ? 78.155  19.200  125.100 1.00 89.35  ? 94   LEU A CB    1 
ATOM   713   C  CG    . LEU A  1  94   ? 78.905  18.315  124.107 1.00 80.05  ? 94   LEU A CG    1 
ATOM   714   C  CD1   . LEU A  1  94   ? 80.146  19.027  123.590 1.00 75.85  ? 94   LEU A CD1   1 
ATOM   715   C  CD2   . LEU A  1  94   ? 79.258  16.979  124.746 1.00 76.20  ? 94   LEU A CD2   1 
ATOM   716   N  N     . GLN A  1  95   ? 76.539  20.364  122.228 1.00 87.71  ? 95   GLN A N     1 
ATOM   717   C  CA    . GLN A  1  95   ? 75.641  19.990  121.141 1.00 90.69  ? 95   GLN A CA    1 
ATOM   718   C  C     . GLN A  1  95   ? 76.298  19.115  120.072 1.00 82.39  ? 95   GLN A C     1 
ATOM   719   O  O     . GLN A  1  95   ? 75.630  18.657  119.146 1.00 88.25  ? 95   GLN A O     1 
ATOM   720   C  CB    . GLN A  1  95   ? 75.003  21.232  120.507 1.00 95.54  ? 95   GLN A CB    1 
ATOM   721   C  CG    . GLN A  1  95   ? 74.042  21.971  121.431 1.00 105.68 ? 95   GLN A CG    1 
ATOM   722   C  CD    . GLN A  1  95   ? 73.422  23.191  120.780 1.00 122.61 ? 95   GLN A CD    1 
ATOM   723   O  OE1   . GLN A  1  95   ? 73.133  23.189  119.584 1.00 127.99 ? 95   GLN A OE1   1 
ATOM   724   N  NE2   . GLN A  1  95   ? 73.222  24.244  121.564 1.00 122.73 ? 95   GLN A NE2   1 
ATOM   725   N  N     . THR A  1  96   ? 77.597  18.872  120.197 1.00 77.95  ? 96   THR A N     1 
ATOM   726   C  CA    . THR A  1  96   ? 78.283  18.040  119.211 1.00 74.59  ? 96   THR A CA    1 
ATOM   727   C  C     . THR A  1  96   ? 79.568  17.388  119.718 1.00 72.36  ? 96   THR A C     1 
ATOM   728   O  O     . THR A  1  96   ? 80.353  17.995  120.448 1.00 75.50  ? 96   THR A O     1 
ATOM   729   C  CB    . THR A  1  96   ? 78.598  18.822  117.921 1.00 76.06  ? 96   THR A CB    1 
ATOM   730   O  OG1   . THR A  1  96   ? 79.094  17.920  116.923 1.00 72.78  ? 96   THR A OG1   1 
ATOM   731   C  CG2   . THR A  1  96   ? 79.637  19.901  118.189 1.00 77.34  ? 96   THR A CG2   1 
ATOM   732   N  N     . VAL A  1  97   ? 79.777  16.146  119.299 1.00 67.21  ? 97   VAL A N     1 
ATOM   733   C  CA    . VAL A  1  97   ? 80.942  15.372  119.697 1.00 64.81  ? 97   VAL A CA    1 
ATOM   734   C  C     . VAL A  1  97   ? 81.512  14.687  118.470 1.00 67.72  ? 97   VAL A C     1 
ATOM   735   O  O     . VAL A  1  97   ? 80.796  14.453  117.504 1.00 70.10  ? 97   VAL A O     1 
ATOM   736   C  CB    . VAL A  1  97   ? 80.555  14.288  120.716 1.00 66.96  ? 97   VAL A CB    1 
ATOM   737   C  CG1   . VAL A  1  97   ? 81.716  13.352  120.978 1.00 64.50  ? 97   VAL A CG1   1 
ATOM   738   C  CG2   . VAL A  1  97   ? 80.079  14.924  122.009 1.00 79.56  ? 97   VAL A CG2   1 
ATOM   739   N  N     . THR A  1  98   ? 82.804  14.383  118.494 1.00 69.69  ? 98   THR A N     1 
ATOM   740   C  CA    . THR A  1  98   ? 83.388  13.530  117.468 1.00 66.48  ? 98   THR A CA    1 
ATOM   741   C  C     . THR A  1  98   ? 84.166  12.399  118.123 1.00 62.38  ? 98   THR A C     1 
ATOM   742   O  O     . THR A  1  98   ? 85.186  12.628  118.767 1.00 67.56  ? 98   THR A O     1 
ATOM   743   C  CB    . THR A  1  98   ? 84.314  14.305  116.517 1.00 67.22  ? 98   THR A CB    1 
ATOM   744   O  OG1   . THR A  1  98   ? 83.571  15.335  115.851 1.00 65.51  ? 98   THR A OG1   1 
ATOM   745   C  CG2   . THR A  1  98   ? 84.906  13.359  115.483 1.00 64.89  ? 98   THR A CG2   1 
ATOM   746   N  N     . LEU A  1  99   ? 83.668  11.179  117.966 1.00 63.27  ? 99   LEU A N     1 
ATOM   747   C  CA    . LEU A  1  99   ? 84.325  10.004  118.521 1.00 63.64  ? 99   LEU A CA    1 
ATOM   748   C  C     . LEU A  1  99   ? 85.370  9.473   117.553 1.00 66.60  ? 99   LEU A C     1 
ATOM   749   O  O     . LEU A  1  99   ? 85.148  9.433   116.343 1.00 65.80  ? 99   LEU A O     1 
ATOM   750   C  CB    . LEU A  1  99   ? 83.307  8.906   118.840 1.00 64.92  ? 99   LEU A CB    1 
ATOM   751   C  CG    . LEU A  1  99   ? 82.407  9.076   120.068 1.00 61.86  ? 99   LEU A CG    1 
ATOM   752   C  CD1   . LEU A  1  99   ? 81.523  10.296  119.948 1.00 60.61  ? 99   LEU A CD1   1 
ATOM   753   C  CD2   . LEU A  1  99   ? 81.563  7.835   120.255 1.00 62.19  ? 99   LEU A CD2   1 
ATOM   754   N  N     . LEU A  1  100  ? 86.514  9.073   118.094 1.00 76.58  ? 100  LEU A N     1 
ATOM   755   C  CA    . LEU A  1  100  ? 87.588  8.509   117.289 1.00 67.39  ? 100  LEU A CA    1 
ATOM   756   C  C     . LEU A  1  100  ? 87.749  7.036   117.623 1.00 68.46  ? 100  LEU A C     1 
ATOM   757   O  O     . LEU A  1  100  ? 87.707  6.647   118.789 1.00 74.26  ? 100  LEU A O     1 
ATOM   758   C  CB    . LEU A  1  100  ? 88.901  9.247   117.545 1.00 64.58  ? 100  LEU A CB    1 
ATOM   759   C  CG    . LEU A  1  100  ? 89.066  10.658  116.972 1.00 74.38  ? 100  LEU A CG    1 
ATOM   760   C  CD1   . LEU A  1  100  ? 88.064  11.642  117.549 1.00 66.49  ? 100  LEU A CD1   1 
ATOM   761   C  CD2   . LEU A  1  100  ? 90.481  11.150  117.221 1.00 96.38  ? 100  LEU A CD2   1 
ATOM   762   N  N     . LEU A  1  101  ? 87.916  6.215   116.597 1.00 67.72  ? 101  LEU A N     1 
ATOM   763   C  CA    . LEU A  1  101  ? 88.134  4.794   116.805 1.00 66.01  ? 101  LEU A CA    1 
ATOM   764   C  C     . LEU A  1  101  ? 89.270  4.337   115.911 1.00 67.79  ? 101  LEU A C     1 
ATOM   765   O  O     . LEU A  1  101  ? 89.210  4.494   114.701 1.00 71.23  ? 101  LEU A O     1 
ATOM   766   C  CB    . LEU A  1  101  ? 86.863  4.002   116.503 1.00 64.42  ? 101  LEU A CB    1 
ATOM   767   C  CG    . LEU A  1  101  ? 86.850  2.512   116.864 1.00 69.24  ? 101  LEU A CG    1 
ATOM   768   C  CD1   . LEU A  1  101  ? 85.425  2.030   117.085 1.00 74.75  ? 101  LEU A CD1   1 
ATOM   769   C  CD2   . LEU A  1  101  ? 87.544  1.656   115.812 1.00 62.43  ? 101  LEU A CD2   1 
ATOM   770   N  N     . LYS A  1  102  ? 90.316  3.788   116.512 1.00 68.21  ? 102  LYS A N     1 
ATOM   771   C  CA    . LYS A  1  102  ? 91.434  3.264   115.747 1.00 64.25  ? 102  LYS A CA    1 
ATOM   772   C  C     . LYS A  1  102  ? 91.706  1.853   116.224 1.00 67.61  ? 102  LYS A C     1 
ATOM   773   O  O     . LYS A  1  102  ? 92.069  1.642   117.379 1.00 85.51  ? 102  LYS A O     1 
ATOM   774   C  CB    . LYS A  1  102  ? 92.668  4.148   115.929 1.00 71.74  ? 102  LYS A CB    1 
ATOM   775   C  CG    . LYS A  1  102  ? 92.456  5.598   115.502 1.00 81.96  ? 102  LYS A CG    1 
ATOM   776   C  CD    . LYS A  1  102  ? 93.561  6.513   116.019 1.00 91.72  ? 102  LYS A CD    1 
ATOM   777   C  CE    . LYS A  1  102  ? 94.930  6.126   115.466 1.00 95.33  ? 102  LYS A CE    1 
ATOM   778   N  NZ    . LYS A  1  102  ? 95.043  6.358   113.997 1.00 85.96  ? 102  LYS A NZ    1 
ATOM   779   N  N     . ALA A  1  103  ? 91.509  0.883   115.342 1.00 65.51  ? 103  ALA A N     1 
ATOM   780   C  CA    . ALA A  1  103  ? 91.657  -0.515  115.722 1.00 73.54  ? 103  ALA A CA    1 
ATOM   781   C  C     . ALA A  1  103  ? 92.271  -1.334  114.600 1.00 74.14  ? 103  ALA A C     1 
ATOM   782   O  O     . ALA A  1  103  ? 92.319  -0.889  113.454 1.00 77.33  ? 103  ALA A O     1 
ATOM   783   C  CB    . ALA A  1  103  ? 90.308  -1.098  116.126 1.00 69.89  ? 103  ALA A CB    1 
ATOM   784   N  N     . GLU A  1  104  ? 92.735  -2.533  114.939 1.00 70.73  ? 104  GLU A N     1 
ATOM   785   C  CA    . GLU A  1  104  ? 93.262  -3.457  113.945 1.00 73.97  ? 104  GLU A CA    1 
ATOM   786   C  C     . GLU A  1  104  ? 93.395  -4.871  114.492 1.00 74.32  ? 104  GLU A C     1 
ATOM   787   O  O     . GLU A  1  104  ? 92.894  -5.175  115.575 1.00 75.91  ? 104  GLU A O     1 
ATOM   788   C  CB    . GLU A  1  104  ? 94.607  -2.964  113.410 1.00 89.09  ? 104  GLU A CB    1 
ATOM   789   C  CG    . GLU A  1  104  ? 95.655  -2.695  114.474 1.00 90.51  ? 104  GLU A CG    1 
ATOM   790   C  CD    . GLU A  1  104  ? 96.992  -2.290  113.875 1.00 110.89 ? 104  GLU A CD    1 
ATOM   791   O  OE1   . GLU A  1  104  ? 97.965  -2.134  114.643 1.00 119.91 ? 104  GLU A OE1   1 
ATOM   792   O  OE2   . GLU A  1  104  ? 97.070  -2.131  112.635 1.00 109.80 ? 104  GLU A OE2   1 
ATOM   793   N  N     . GLY A  1  105  ? 94.060  -5.735  113.729 1.00 75.75  ? 105  GLY A N     1 
ATOM   794   C  CA    . GLY A  1  105  ? 94.323  -7.097  114.156 1.00 78.44  ? 105  GLY A CA    1 
ATOM   795   C  C     . GLY A  1  105  ? 93.049  -7.884  114.378 1.00 84.36  ? 105  GLY A C     1 
ATOM   796   O  O     . GLY A  1  105  ? 91.963  -7.311  114.381 1.00 87.49  ? 105  GLY A O     1 
ATOM   797   N  N     . PRO A  1  106  ? 93.176  -9.202  114.591 1.00 84.94  ? 106  PRO A N     1 
ATOM   798   C  CA    . PRO A  1  106  ? 92.035  -10.118 114.715 1.00 82.88  ? 106  PRO A CA    1 
ATOM   799   C  C     . PRO A  1  106  ? 91.148  -9.816  115.915 1.00 82.76  ? 106  PRO A C     1 
ATOM   800   O  O     . PRO A  1  106  ? 91.194  -10.547 116.904 1.00 95.79  ? 106  PRO A O     1 
ATOM   801   C  CB    . PRO A  1  106  ? 92.702  -11.488 114.886 1.00 82.26  ? 106  PRO A CB    1 
ATOM   802   C  CG    . PRO A  1  106  ? 94.057  -11.186 115.418 1.00 93.54  ? 106  PRO A CG    1 
ATOM   803   C  CD    . PRO A  1  106  ? 94.460  -9.901  114.759 1.00 92.69  ? 106  PRO A CD    1 
ATOM   804   N  N     . LYS A  1  107  ? 90.352  -8.755  115.825 1.00 76.80  ? 107  LYS A N     1 
ATOM   805   C  CA    . LYS A  1  107  ? 89.435  -8.396  116.901 1.00 81.38  ? 107  LYS A CA    1 
ATOM   806   C  C     . LYS A  1  107  ? 88.041  -8.077  116.376 1.00 73.43  ? 107  LYS A C     1 
ATOM   807   O  O     . LYS A  1  107  ? 87.866  -7.741  115.212 1.00 74.43  ? 107  LYS A O     1 
ATOM   808   C  CB    . LYS A  1  107  ? 89.958  -7.190  117.678 1.00 79.55  ? 107  LYS A CB    1 
ATOM   809   C  CG    . LYS A  1  107  ? 89.543  -5.855  117.087 1.00 69.50  ? 107  LYS A CG    1 
ATOM   810   C  CD    . LYS A  1  107  ? 90.003  -4.699  117.958 1.00 77.85  ? 107  LYS A CD    1 
ATOM   811   C  CE    . LYS A  1  107  ? 89.418  -4.791  119.358 1.00 70.31  ? 107  LYS A CE    1 
ATOM   812   N  NZ    . LYS A  1  107  ? 89.849  -3.645  120.204 1.00 74.44  ? 107  LYS A NZ    1 
ATOM   813   N  N     . GLU A  1  108  ? 87.051  -8.185  117.251 1.00 73.15  ? 108  GLU A N     1 
ATOM   814   C  CA    . GLU A  1  108  ? 85.703  -7.742  116.943 1.00 72.66  ? 108  GLU A CA    1 
ATOM   815   C  C     . GLU A  1  108  ? 85.453  -6.415  117.642 1.00 70.61  ? 108  GLU A C     1 
ATOM   816   O  O     . GLU A  1  108  ? 85.224  -6.381  118.848 1.00 76.76  ? 108  GLU A O     1 
ATOM   817   C  CB    . GLU A  1  108  ? 84.687  -8.773  117.419 1.00 76.01  ? 108  GLU A CB    1 
ATOM   818   C  CG    . GLU A  1  108  ? 84.906  -10.161 116.853 1.00 83.41  ? 108  GLU A CG    1 
ATOM   819   C  CD    . GLU A  1  108  ? 83.923  -11.170 117.406 1.00 98.78  ? 108  GLU A CD    1 
ATOM   820   O  OE1   . GLU A  1  108  ? 83.024  -10.768 118.177 1.00 97.35  ? 108  GLU A OE1   1 
ATOM   821   O  OE2   . GLU A  1  108  ? 84.050  -12.365 117.073 1.00 108.09 ? 108  GLU A OE2   1 
ATOM   822   N  N     . VAL A  1  109  ? 85.498  -5.326  116.884 1.00 64.99  ? 109  VAL A N     1 
ATOM   823   C  CA    . VAL A  1  109  ? 85.334  -3.989  117.443 1.00 65.56  ? 109  VAL A CA    1 
ATOM   824   C  C     . VAL A  1  109  ? 83.937  -3.754  118.029 1.00 71.52  ? 109  VAL A C     1 
ATOM   825   O  O     . VAL A  1  109  ? 82.932  -4.188  117.463 1.00 73.00  ? 109  VAL A O     1 
ATOM   826   C  CB    . VAL A  1  109  ? 85.621  -2.914  116.383 1.00 60.60  ? 109  VAL A CB    1 
ATOM   827   C  CG1   . VAL A  1  109  ? 85.643  -1.534  117.016 1.00 67.42  ? 109  VAL A CG1   1 
ATOM   828   C  CG2   . VAL A  1  109  ? 86.935  -3.203  115.698 1.00 60.42  ? 109  VAL A CG2   1 
ATOM   829   N  N     . LYS A  1  110  ? 83.884  -3.067  119.167 1.00 70.94  ? 110  LYS A N     1 
ATOM   830   C  CA    . LYS A  1  110  ? 82.619  -2.707  119.796 1.00 67.17  ? 110  LYS A CA    1 
ATOM   831   C  C     . LYS A  1  110  ? 82.610  -1.215  120.097 1.00 71.76  ? 110  LYS A C     1 
ATOM   832   O  O     . LYS A  1  110  ? 83.610  -0.527  119.892 1.00 73.34  ? 110  LYS A O     1 
ATOM   833   C  CB    . LYS A  1  110  ? 82.413  -3.494  121.083 1.00 64.00  ? 110  LYS A CB    1 
ATOM   834   C  CG    . LYS A  1  110  ? 82.739  -4.966  120.964 1.00 64.06  ? 110  LYS A CG    1 
ATOM   835   C  CD    . LYS A  1  110  ? 81.726  -5.702  120.121 1.00 64.34  ? 110  LYS A CD    1 
ATOM   836   C  CE    . LYS A  1  110  ? 82.080  -7.176  120.013 1.00 71.20  ? 110  LYS A CE    1 
ATOM   837   N  NZ    . LYS A  1  110  ? 80.960  -7.989  119.456 1.00 79.67  ? 110  LYS A NZ    1 
ATOM   838   N  N     . ALA A  1  111  ? 81.479  -0.714  120.580 1.00 67.46  ? 111  ALA A N     1 
ATOM   839   C  CA    . ALA A  1  111  ? 81.340  0.711   120.840 1.00 67.35  ? 111  ALA A CA    1 
ATOM   840   C  C     . ALA A  1  111  ? 82.310  1.155   121.924 1.00 73.76  ? 111  ALA A C     1 
ATOM   841   O  O     . ALA A  1  111  ? 82.726  2.314   121.962 1.00 72.49  ? 111  ALA A O     1 
ATOM   842   C  CB    . ALA A  1  111  ? 79.910  1.038   121.233 1.00 72.28  ? 111  ALA A CB    1 
ATOM   843   N  N     . ARG A  1  112  ? 82.672  0.221   122.799 1.00 80.30  ? 112  ARG A N     1 
ATOM   844   C  CA    . ARG A  1  112  ? 83.573  0.509   123.913 1.00 79.67  ? 112  ARG A CA    1 
ATOM   845   C  C     . ARG A  1  112  ? 84.999  0.761   123.442 1.00 74.82  ? 112  ARG A C     1 
ATOM   846   O  O     . ARG A  1  112  ? 85.856  1.166   124.224 1.00 78.69  ? 112  ARG A O     1 
ATOM   847   C  CB    . ARG A  1  112  ? 83.573  -0.642  124.922 1.00 76.85  ? 112  ARG A CB    1 
ATOM   848   C  CG    . ARG A  1  112  ? 84.215  -1.918  124.401 1.00 77.71  ? 112  ARG A CG    1 
ATOM   849   C  CD    . ARG A  1  112  ? 84.350  -2.951  125.503 1.00 78.66  ? 112  ARG A CD    1 
ATOM   850   N  NE    . ARG A  1  112  ? 83.058  -3.302  126.083 1.00 84.27  ? 112  ARG A NE    1 
ATOM   851   C  CZ    . ARG A  1  112  ? 82.346  -4.362  125.720 1.00 92.52  ? 112  ARG A CZ    1 
ATOM   852   N  NH1   . ARG A  1  112  ? 82.811  -5.179  124.779 1.00 86.94  ? 112  ARG A NH1   1 
ATOM   853   N  NH2   . ARG A  1  112  ? 81.174  -4.608  126.300 1.00 85.82  ? 112  ARG A NH2   1 
ATOM   854   N  N     . ASP A  1  113  ? 85.251  0.516   122.162 1.00 76.34  ? 113  ASP A N     1 
ATOM   855   C  CA    . ASP A  1  113  ? 86.592  0.679   121.619 1.00 72.56  ? 113  ASP A CA    1 
ATOM   856   C  C     . ASP A  1  113  ? 86.823  2.090   121.092 1.00 70.17  ? 113  ASP A C     1 
ATOM   857   O  O     . ASP A  1  113  ? 87.882  2.395   120.551 1.00 73.65  ? 113  ASP A O     1 
ATOM   858   C  CB    . ASP A  1  113  ? 86.868  -0.377  120.554 1.00 69.20  ? 113  ASP A CB    1 
ATOM   859   C  CG    . ASP A  1  113  ? 86.828  -1.787  121.118 1.00 77.85  ? 113  ASP A CG    1 
ATOM   860   O  OD1   . ASP A  1  113  ? 87.286  -1.979  122.266 1.00 82.49  ? 113  ASP A OD1   1 
ATOM   861   O  OD2   . ASP A  1  113  ? 86.328  -2.700  120.425 1.00 73.26  ? 113  ASP A OD2   1 
ATOM   862   N  N     . PHE A  1  114  ? 85.828  2.951   121.265 1.00 71.01  ? 114  PHE A N     1 
ATOM   863   C  CA    . PHE A  1  114  ? 85.987  4.361   120.952 1.00 71.44  ? 114  PHE A CA    1 
ATOM   864   C  C     . PHE A  1  114  ? 86.854  5.002   122.014 1.00 74.13  ? 114  PHE A C     1 
ATOM   865   O  O     . PHE A  1  114  ? 86.745  4.661   123.190 1.00 78.91  ? 114  PHE A O     1 
ATOM   866   C  CB    . PHE A  1  114  ? 84.628  5.063   120.923 1.00 76.95  ? 114  PHE A CB    1 
ATOM   867   C  CG    . PHE A  1  114  ? 83.837  4.809   119.673 1.00 75.59  ? 114  PHE A CG    1 
ATOM   868   C  CD1   . PHE A  1  114  ? 82.823  3.867   119.658 1.00 72.10  ? 114  PHE A CD1   1 
ATOM   869   C  CD2   . PHE A  1  114  ? 84.110  5.516   118.511 1.00 73.37  ? 114  PHE A CD2   1 
ATOM   870   C  CE1   . PHE A  1  114  ? 82.097  3.636   118.509 1.00 71.97  ? 114  PHE A CE1   1 
ATOM   871   C  CE2   . PHE A  1  114  ? 83.389  5.287   117.357 1.00 67.60  ? 114  PHE A CE2   1 
ATOM   872   C  CZ    . PHE A  1  114  ? 82.381  4.348   117.354 1.00 68.50  ? 114  PHE A CZ    1 
ATOM   873   N  N     . LEU A  1  115  ? 87.716  5.929   121.610 1.00 74.18  ? 115  LEU A N     1 
ATOM   874   C  CA    . LEU A  1  115  ? 88.509  6.673   122.579 1.00 79.47  ? 115  LEU A CA    1 
ATOM   875   C  C     . LEU A  1  115  ? 87.586  7.521   123.439 1.00 81.52  ? 115  LEU A C     1 
ATOM   876   O  O     . LEU A  1  115  ? 86.861  8.371   122.919 1.00 79.07  ? 115  LEU A O     1 
ATOM   877   C  CB    . LEU A  1  115  ? 89.555  7.550   121.889 1.00 83.72  ? 115  LEU A CB    1 
ATOM   878   C  CG    . LEU A  1  115  ? 90.688  6.805   121.180 1.00 89.53  ? 115  LEU A CG    1 
ATOM   879   C  CD1   . LEU A  1  115  ? 91.739  7.781   120.659 1.00 94.71  ? 115  LEU A CD1   1 
ATOM   880   C  CD2   . LEU A  1  115  ? 91.320  5.780   122.109 1.00 90.00  ? 115  LEU A CD2   1 
ATOM   881   N  N     . PRO A  1  116  ? 87.611  7.280   124.761 1.00 82.96  ? 116  PRO A N     1 
ATOM   882   C  CA    . PRO A  1  116  ? 86.729  7.917   125.744 1.00 80.95  ? 116  PRO A CA    1 
ATOM   883   C  C     . PRO A  1  116  ? 86.822  9.437   125.722 1.00 81.15  ? 116  PRO A C     1 
ATOM   884   O  O     . PRO A  1  116  ? 87.915  9.991   125.599 1.00 80.65  ? 116  PRO A O     1 
ATOM   885   C  CB    . PRO A  1  116  ? 87.251  7.375   127.079 1.00 74.84  ? 116  PRO A CB    1 
ATOM   886   C  CG    . PRO A  1  116  ? 87.888  6.080   126.736 1.00 71.46  ? 116  PRO A CG    1 
ATOM   887   C  CD    . PRO A  1  116  ? 88.521  6.312   125.396 1.00 81.85  ? 116  PRO A CD    1 
ATOM   888   N  N     . VAL A  1  117  ? 85.675  10.100  125.835 1.00 78.17  ? 117  VAL A N     1 
ATOM   889   C  CA    . VAL A  1  117  ? 85.630  11.554  125.870 1.00 81.67  ? 117  VAL A CA    1 
ATOM   890   C  C     . VAL A  1  117  ? 84.941  12.031  127.150 1.00 92.89  ? 117  VAL A C     1 
ATOM   891   O  O     . VAL A  1  117  ? 84.071  11.343  127.694 1.00 91.26  ? 117  VAL A O     1 
ATOM   892   C  CB    . VAL A  1  117  ? 84.904  12.125  124.634 1.00 74.28  ? 117  VAL A CB    1 
ATOM   893   C  CG1   . VAL A  1  117  ? 84.851  13.647  124.689 1.00 71.88  ? 117  VAL A CG1   1 
ATOM   894   C  CG2   . VAL A  1  117  ? 85.582  11.658  123.358 1.00 69.87  ? 117  VAL A CG2   1 
ATOM   895   N  N     . ALA A  1  118  ? 85.343  13.205  127.630 1.00 93.63  ? 118  ALA A N     1 
ATOM   896   C  CA    . ALA A  1  118  ? 84.760  13.789  128.831 1.00 92.27  ? 118  ALA A CA    1 
ATOM   897   C  C     . ALA A  1  118  ? 83.325  14.243  128.583 1.00 88.63  ? 118  ALA A C     1 
ATOM   898   O  O     . ALA A  1  118  ? 83.024  14.850  127.550 1.00 81.77  ? 118  ALA A O     1 
ATOM   899   C  CB    . ALA A  1  118  ? 85.608  14.954  129.315 1.00 93.23  ? 118  ALA A CB    1 
ATOM   900   N  N     . ASP A  1  119  ? 82.448  13.948  129.540 1.00 83.76  ? 119  ASP A N     1 
ATOM   901   C  CA    . ASP A  1  119  ? 81.039  14.318  129.444 1.00 86.44  ? 119  ASP A CA    1 
ATOM   902   C  C     . ASP A  1  119  ? 80.325  13.574  128.320 1.00 82.69  ? 119  ASP A C     1 
ATOM   903   O  O     . ASP A  1  119  ? 79.343  14.066  127.764 1.00 80.86  ? 119  ASP A O     1 
ATOM   904   C  CB    . ASP A  1  119  ? 80.877  15.830  129.257 1.00 88.95  ? 119  ASP A CB    1 
ATOM   905   C  CG    . ASP A  1  119  ? 81.159  16.611  130.527 1.00 92.59  ? 119  ASP A CG    1 
ATOM   906   O  OD1   . ASP A  1  119  ? 81.307  15.979  131.599 1.00 90.27  ? 119  ASP A OD1   1 
ATOM   907   O  OD2   . ASP A  1  119  ? 81.217  17.858  130.452 1.00 91.36  ? 119  ASP A OD2   1 
ATOM   908   N  N     . VAL A  1  120  ? 80.825  12.390  127.988 1.00 77.07  ? 120  VAL A N     1 
ATOM   909   C  CA    . VAL A  1  120  ? 80.202  11.566  126.961 1.00 74.91  ? 120  VAL A CA    1 
ATOM   910   C  C     . VAL A  1  120  ? 80.218  10.101  127.375 1.00 72.66  ? 120  VAL A C     1 
ATOM   911   O  O     . VAL A  1  120  ? 81.284  9.512   127.559 1.00 79.10  ? 120  VAL A O     1 
ATOM   912   C  CB    . VAL A  1  120  ? 80.905  11.719  125.600 1.00 70.28  ? 120  VAL A CB    1 
ATOM   913   C  CG1   . VAL A  1  120  ? 80.391  10.681  124.620 1.00 70.23  ? 120  VAL A CG1   1 
ATOM   914   C  CG2   . VAL A  1  120  ? 80.702  13.120  125.051 1.00 70.14  ? 120  VAL A CG2   1 
ATOM   915   N  N     . GLU A  1  121  ? 79.034  9.513   127.519 1.00 64.12  ? 121  GLU A N     1 
ATOM   916   C  CA    . GLU A  1  121  ? 78.933  8.126   127.954 1.00 70.08  ? 121  GLU A CA    1 
ATOM   917   C  C     . GLU A  1  121  ? 78.232  7.267   126.913 1.00 71.46  ? 121  GLU A C     1 
ATOM   918   O  O     . GLU A  1  121  ? 77.158  7.612   126.439 1.00 72.92  ? 121  GLU A O     1 
ATOM   919   C  CB    . GLU A  1  121  ? 78.187  8.029   129.288 1.00 74.72  ? 121  GLU A CB    1 
ATOM   920   C  CG    . GLU A  1  121  ? 78.013  6.602   129.788 1.00 70.44  ? 121  GLU A CG    1 
ATOM   921   C  CD    . GLU A  1  121  ? 77.050  6.497   130.949 1.00 82.33  ? 121  GLU A CD    1 
ATOM   922   O  OE1   . GLU A  1  121  ? 76.550  7.551   131.403 1.00 88.47  ? 121  GLU A OE1   1 
ATOM   923   O  OE2   . GLU A  1  121  ? 76.792  5.359   131.403 1.00 86.20  ? 121  GLU A OE2   1 
ATOM   924   N  N     . ILE A  1  122  ? 78.837  6.139   126.567 1.00 66.40  ? 122  ILE A N     1 
ATOM   925   C  CA    . ILE A  1  122  ? 78.239  5.228   125.601 1.00 66.57  ? 122  ILE A CA    1 
ATOM   926   C  C     . ILE A  1  122  ? 77.378  4.187   126.302 1.00 65.86  ? 122  ILE A C     1 
ATOM   927   O  O     . ILE A  1  122  ? 77.891  3.263   126.935 1.00 67.62  ? 122  ILE A O     1 
ATOM   928   C  CB    . ILE A  1  122  ? 79.315  4.544   124.740 1.00 66.94  ? 122  ILE A CB    1 
ATOM   929   C  CG1   . ILE A  1  122  ? 79.940  5.565   123.785 1.00 55.77  ? 122  ILE A CG1   1 
ATOM   930   C  CG2   . ILE A  1  122  ? 78.723  3.368   123.975 1.00 63.09  ? 122  ILE A CG2   1 
ATOM   931   C  CD1   . ILE A  1  122  ? 81.441  5.464   123.693 1.00 60.86  ? 122  ILE A CD1   1 
ATOM   932   N  N     . MET A  1  123  ? 76.065  4.344   126.176 1.00 62.36  ? 123  MET A N     1 
ATOM   933   C  CA    . MET A  1  123  ? 75.115  3.521   126.918 1.00 66.41  ? 123  MET A CA    1 
ATOM   934   C  C     . MET A  1  123  ? 75.156  2.042   126.530 1.00 66.54  ? 123  MET A C     1 
ATOM   935   O  O     . MET A  1  123  ? 74.776  1.179   127.327 1.00 69.53  ? 123  MET A O     1 
ATOM   936   C  CB    . MET A  1  123  ? 73.693  4.068   126.756 1.00 65.34  ? 123  MET A CB    1 
ATOM   937   C  CG    . MET A  1  123  ? 73.577  5.573   126.943 1.00 66.97  ? 123  MET A CG    1 
ATOM   938   S  SD    . MET A  1  123  ? 74.192  6.134   128.539 1.00 78.49  ? 123  MET A SD    1 
ATOM   939   C  CE    . MET A  1  123  ? 73.460  4.907   129.624 1.00 68.00  ? 123  MET A CE    1 
ATOM   940   N  N     . ASN A  1  124  ? 75.604  1.754   125.309 1.00 64.20  ? 124  ASN A N     1 
ATOM   941   C  CA    . ASN A  1  124  ? 75.704  0.372   124.839 1.00 65.33  ? 124  ASN A CA    1 
ATOM   942   C  C     . ASN A  1  124  ? 77.085  0.035   124.290 1.00 73.80  ? 124  ASN A C     1 
ATOM   943   O  O     . ASN A  1  124  ? 77.253  -0.174  123.090 1.00 75.06  ? 124  ASN A O     1 
ATOM   944   C  CB    . ASN A  1  124  ? 74.624  0.059   123.799 1.00 63.13  ? 124  ASN A CB    1 
ATOM   945   C  CG    . ASN A  1  124  ? 74.726  0.932   122.555 1.00 67.38  ? 124  ASN A CG    1 
ATOM   946   O  OD1   . ASN A  1  124  ? 75.334  2.004   122.574 1.00 63.43  ? 124  ASN A OD1   1 
ATOM   947   N  ND2   . ASN A  1  124  ? 74.113  0.475   121.468 1.00 61.95  ? 124  ASN A ND2   1 
ATOM   948   N  N     . PRO A  1  125  ? 78.082  -0.028  125.177 1.00 71.40  ? 125  PRO A N     1 
ATOM   949   C  CA    . PRO A  1  125  ? 79.456  -0.299  124.759 1.00 71.80  ? 125  PRO A CA    1 
ATOM   950   C  C     . PRO A  1  125  ? 79.575  -1.688  124.150 1.00 72.70  ? 125  PRO A C     1 
ATOM   951   O  O     . PRO A  1  125  ? 80.560  -1.986  123.477 1.00 77.63  ? 125  PRO A O     1 
ATOM   952   C  CB    . PRO A  1  125  ? 80.234  -0.225  126.074 1.00 74.34  ? 125  PRO A CB    1 
ATOM   953   C  CG    . PRO A  1  125  ? 79.232  -0.550  127.114 1.00 68.90  ? 125  PRO A CG    1 
ATOM   954   C  CD    . PRO A  1  125  ? 77.959  0.060   126.639 1.00 67.53  ? 125  PRO A CD    1 
ATOM   955   N  N     . ASP A  1  126  ? 78.573  -2.526  124.380 1.00 68.90  ? 126  ASP A N     1 
ATOM   956   C  CA    . ASP A  1  126  ? 78.607  -3.897  123.886 1.00 79.07  ? 126  ASP A CA    1 
ATOM   957   C  C     . ASP A  1  126  ? 78.245  -3.976  122.396 1.00 81.04  ? 126  ASP A C     1 
ATOM   958   O  O     . ASP A  1  126  ? 78.397  -5.026  121.762 1.00 77.46  ? 126  ASP A O     1 
ATOM   959   C  CB    . ASP A  1  126  ? 77.671  -4.777  124.720 1.00 87.03  ? 126  ASP A CB    1 
ATOM   960   C  CG    . ASP A  1  126  ? 78.317  -6.087  125.138 1.00 96.55  ? 126  ASP A CG    1 
ATOM   961   O  OD1   . ASP A  1  126  ? 78.917  -6.759  124.271 1.00 97.74  ? 126  ASP A OD1   1 
ATOM   962   O  OD2   . ASP A  1  126  ? 78.229  -6.440  126.336 1.00 97.78  ? 126  ASP A OD2   1 
ATOM   963   N  N     . LEU A  1  127  ? 77.783  -2.856  121.843 1.00 72.42  ? 127  LEU A N     1 
ATOM   964   C  CA    . LEU A  1  127  ? 77.321  -2.803  120.456 1.00 70.35  ? 127  LEU A CA    1 
ATOM   965   C  C     . LEU A  1  127  ? 78.408  -3.190  119.466 1.00 72.62  ? 127  LEU A C     1 
ATOM   966   O  O     . LEU A  1  127  ? 79.450  -2.540  119.398 1.00 75.87  ? 127  LEU A O     1 
ATOM   967   C  CB    . LEU A  1  127  ? 76.813  -1.400  120.110 1.00 72.44  ? 127  LEU A CB    1 
ATOM   968   C  CG    . LEU A  1  127  ? 76.388  -1.175  118.654 1.00 64.33  ? 127  LEU A CG    1 
ATOM   969   C  CD1   . LEU A  1  127  ? 75.187  -2.029  118.310 1.00 58.39  ? 127  LEU A CD1   1 
ATOM   970   C  CD2   . LEU A  1  127  ? 76.082  0.289   118.396 1.00 66.62  ? 127  LEU A CD2   1 
ATOM   971   N  N     . HIS A  1  128  ? 78.155  -4.237  118.687 1.00 73.56  ? 128  HIS A N     1 
ATOM   972   C  CA    . HIS A  1  128  ? 79.106  -4.667  117.666 1.00 72.95  ? 128  HIS A CA    1 
ATOM   973   C  C     . HIS A  1  128  ? 79.182  -3.638  116.548 1.00 67.37  ? 128  HIS A C     1 
ATOM   974   O  O     . HIS A  1  128  ? 78.157  -3.153  116.075 1.00 69.30  ? 128  HIS A O     1 
ATOM   975   C  CB    . HIS A  1  128  ? 78.703  -6.028  117.095 1.00 73.69  ? 128  HIS A CB    1 
ATOM   976   C  CG    . HIS A  1  128  ? 79.684  -6.585  116.111 1.00 71.78  ? 128  HIS A CG    1 
ATOM   977   N  ND1   . HIS A  1  128  ? 80.158  -5.860  115.040 1.00 74.18  ? 128  HIS A ND1   1 
ATOM   978   C  CD2   . HIS A  1  128  ? 80.272  -7.802  116.030 1.00 77.11  ? 128  HIS A CD2   1 
ATOM   979   C  CE1   . HIS A  1  128  ? 81.001  -6.602  114.345 1.00 72.74  ? 128  HIS A CE1   1 
ATOM   980   N  NE2   . HIS A  1  128  ? 81.089  -7.785  114.926 1.00 75.52  ? 128  HIS A NE2   1 
ATOM   981   N  N     . ILE A  1  129  ? 80.396  -3.307  116.123 1.00 66.69  ? 129  ILE A N     1 
ATOM   982   C  CA    . ILE A  1  129  ? 80.570  -2.339  115.044 1.00 66.55  ? 129  ILE A CA    1 
ATOM   983   C  C     . ILE A  1  129  ? 81.150  -2.948  113.768 1.00 68.33  ? 129  ILE A C     1 
ATOM   984   O  O     . ILE A  1  129  ? 80.508  -2.919  112.720 1.00 73.14  ? 129  ILE A O     1 
ATOM   985   C  CB    . ILE A  1  129  ? 81.402  -1.134  115.488 1.00 65.78  ? 129  ILE A CB    1 
ATOM   986   C  CG1   . ILE A  1  129  ? 80.576  -0.270  116.441 1.00 66.14  ? 129  ILE A CG1   1 
ATOM   987   C  CG2   . ILE A  1  129  ? 81.847  -0.324  114.285 1.00 64.72  ? 129  ILE A CG2   1 
ATOM   988   C  CD1   . ILE A  1  129  ? 81.131  1.108   116.652 1.00 70.49  ? 129  ILE A CD1   1 
ATOM   989   N  N     . ALA A  1  130  ? 82.355  -3.498  113.855 1.00 65.77  ? 130  ALA A N     1 
ATOM   990   C  CA    . ALA A  1  130  ? 82.968  -4.162  112.708 1.00 68.49  ? 130  ALA A CA    1 
ATOM   991   C  C     . ALA A  1  130  ? 83.780  -5.366  113.153 1.00 69.47  ? 130  ALA A C     1 
ATOM   992   O  O     . ALA A  1  130  ? 84.371  -5.358  114.230 1.00 73.72  ? 130  ALA A O     1 
ATOM   993   C  CB    . ALA A  1  130  ? 83.848  -3.193  111.936 1.00 63.57  ? 130  ALA A CB    1 
ATOM   994   N  N     . THR A  1  131  ? 83.803  -6.407  112.329 1.00 67.86  ? 131  THR A N     1 
ATOM   995   C  CA    . THR A  1  131  ? 84.655  -7.557  112.605 1.00 69.55  ? 131  THR A CA    1 
ATOM   996   C  C     . THR A  1  131  ? 85.934  -7.452  111.789 1.00 70.44  ? 131  THR A C     1 
ATOM   997   O  O     . THR A  1  131  ? 85.889  -7.374  110.564 1.00 69.37  ? 131  THR A O     1 
ATOM   998   C  CB    . THR A  1  131  ? 83.948  -8.894  112.311 1.00 70.45  ? 131  THR A CB    1 
ATOM   999   O  OG1   . THR A  1  131  ? 83.009  -9.183  113.358 1.00 75.29  ? 131  THR A OG1   1 
ATOM   1000  C  CG2   . THR A  1  131  ? 84.966  -10.018 112.240 1.00 66.99  ? 131  THR A CG2   1 
ATOM   1001  N  N     . LEU A  1  132  ? 87.073  -7.434  112.474 1.00 73.89  ? 132  LEU A N     1 
ATOM   1002  C  CA    . LEU A  1  132  ? 88.359  -7.267  111.804 1.00 65.63  ? 132  LEU A CA    1 
ATOM   1003  C  C     . LEU A  1  132  ? 89.178  -8.551  111.763 1.00 69.92  ? 132  LEU A C     1 
ATOM   1004  O  O     . LEU A  1  132  ? 88.969  -9.474  112.549 1.00 71.28  ? 132  LEU A O     1 
ATOM   1005  C  CB    . LEU A  1  132  ? 89.165  -6.129  112.432 1.00 60.70  ? 132  LEU A CB    1 
ATOM   1006  C  CG    . LEU A  1  132  ? 88.840  -4.716  111.947 1.00 58.35  ? 132  LEU A CG    1 
ATOM   1007  C  CD1   . LEU A  1  132  ? 87.394  -4.362  112.210 1.00 66.34  ? 132  LEU A CD1   1 
ATOM   1008  C  CD2   . LEU A  1  132  ? 89.754  -3.695  112.595 1.00 67.83  ? 132  LEU A CD2   1 
ATOM   1009  N  N     . GLU A  1  133  ? 90.121  -8.584  110.833 1.00 75.13  ? 133  GLU A N     1 
ATOM   1010  C  CA    . GLU A  1  133  ? 90.865  -9.785  110.498 1.00 74.20  ? 133  GLU A CA    1 
ATOM   1011  C  C     . GLU A  1  133  ? 92.351  -9.429  110.508 1.00 79.18  ? 133  GLU A C     1 
ATOM   1012  O  O     . GLU A  1  133  ? 92.710  -8.256  110.628 1.00 77.31  ? 133  GLU A O     1 
ATOM   1013  C  CB    . GLU A  1  133  ? 90.418  -10.249 109.110 1.00 77.61  ? 133  GLU A CB    1 
ATOM   1014  C  CG    . GLU A  1  133  ? 91.112  -11.464 108.541 1.00 85.15  ? 133  GLU A CG    1 
ATOM   1015  C  CD    . GLU A  1  133  ? 90.942  -11.548 107.037 1.00 79.70  ? 133  GLU A CD    1 
ATOM   1016  O  OE1   . GLU A  1  133  ? 91.019  -10.494 106.369 1.00 76.14  ? 133  GLU A OE1   1 
ATOM   1017  O  OE2   . GLU A  1  133  ? 90.723  -12.661 106.523 1.00 78.47  ? 133  GLU A OE2   1 
ATOM   1018  N  N     . GLU A  1  134  ? 93.216  -10.430 110.392 1.00 85.44  ? 134  GLU A N     1 
ATOM   1019  C  CA    . GLU A  1  134  ? 94.655  -10.179 110.337 1.00 87.93  ? 134  GLU A CA    1 
ATOM   1020  C  C     . GLU A  1  134  ? 95.010  -9.113  109.303 1.00 81.20  ? 134  GLU A C     1 
ATOM   1021  O  O     . GLU A  1  134  ? 94.705  -9.252  108.118 1.00 79.72  ? 134  GLU A O     1 
ATOM   1022  C  CB    . GLU A  1  134  ? 95.426  -11.471 110.048 1.00 93.14  ? 134  GLU A CB    1 
ATOM   1023  C  CG    . GLU A  1  134  ? 96.097  -12.074 111.273 1.00 97.71  ? 134  GLU A CG    1 
ATOM   1024  C  CD    . GLU A  1  134  ? 97.134  -11.146 111.885 1.00 100.32 ? 134  GLU A CD    1 
ATOM   1025  O  OE1   . GLU A  1  134  ? 97.312  -11.184 113.122 1.00 93.74  ? 134  GLU A OE1   1 
ATOM   1026  O  OE2   . GLU A  1  134  ? 97.774  -10.384 111.128 1.00 103.15 ? 134  GLU A OE2   1 
ATOM   1027  N  N     . GLY A  1  135  ? 95.656  -8.048  109.763 1.00 77.94  ? 135  GLY A N     1 
ATOM   1028  C  CA    . GLY A  1  135  ? 96.101  -6.991  108.876 1.00 79.71  ? 135  GLY A CA    1 
ATOM   1029  C  C     . GLY A  1  135  ? 95.013  -5.987  108.565 1.00 77.50  ? 135  GLY A C     1 
ATOM   1030  O  O     . GLY A  1  135  ? 95.267  -4.943  107.963 1.00 79.43  ? 135  GLY A O     1 
ATOM   1031  N  N     . GLY A  1  136  ? 93.790  -6.309  108.969 1.00 78.48  ? 136  GLY A N     1 
ATOM   1032  C  CA    . GLY A  1  136  ? 92.674  -5.402  108.786 1.00 76.51  ? 136  GLY A CA    1 
ATOM   1033  C  C     . GLY A  1  136  ? 92.762  -4.215  109.723 1.00 75.57  ? 136  GLY A C     1 
ATOM   1034  O  O     . GLY A  1  136  ? 92.824  -4.379  110.939 1.00 80.15  ? 136  GLY A O     1 
ATOM   1035  N  N     . ARG A  1  137  ? 92.770  -3.015  109.155 1.00 76.59  ? 137  ARG A N     1 
ATOM   1036  C  CA    . ARG A  1  137  ? 92.836  -1.796  109.949 1.00 78.89  ? 137  ARG A CA    1 
ATOM   1037  C  C     . ARG A  1  137  ? 91.563  -0.977  109.784 1.00 75.44  ? 137  ARG A C     1 
ATOM   1038  O  O     . ARG A  1  137  ? 91.167  -0.653  108.667 1.00 78.81  ? 137  ARG A O     1 
ATOM   1039  C  CB    . ARG A  1  137  ? 94.043  -0.950  109.539 1.00 86.21  ? 137  ARG A CB    1 
ATOM   1040  C  CG    . ARG A  1  137  ? 95.379  -1.658  109.648 1.00 100.90 ? 137  ARG A CG    1 
ATOM   1041  C  CD    . ARG A  1  137  ? 96.455  -0.883  108.906 1.00 118.57 ? 137  ARG A CD    1 
ATOM   1042  N  NE    . ARG A  1  137  ? 97.650  -1.687  108.669 1.00 131.25 ? 137  ARG A NE    1 
ATOM   1043  C  CZ    . ARG A  1  137  ? 98.476  -1.508  107.643 1.00 136.02 ? 137  ARG A CZ    1 
ATOM   1044  N  NH1   . ARG A  1  137  ? 98.232  -0.555  106.754 1.00 139.63 ? 137  ARG A NH1   1 
ATOM   1045  N  NH2   . ARG A  1  137  ? 99.541  -2.286  107.502 1.00 136.50 ? 137  ARG A NH2   1 
ATOM   1046  N  N     . LEU A  1  138  ? 90.925  -0.639  110.898 1.00 72.23  ? 138  LEU A N     1 
ATOM   1047  C  CA    . LEU A  1  138  ? 89.750  0.222   110.853 1.00 72.68  ? 138  LEU A CA    1 
ATOM   1048  C  C     . LEU A  1  138  ? 89.968  1.487   111.675 1.00 66.95  ? 138  LEU A C     1 
ATOM   1049  O  O     . LEU A  1  138  ? 90.035  1.440   112.899 1.00 77.52  ? 138  LEU A O     1 
ATOM   1050  C  CB    . LEU A  1  138  ? 88.509  -0.525  111.340 1.00 74.22  ? 138  LEU A CB    1 
ATOM   1051  C  CG    . LEU A  1  138  ? 87.225  0.304   111.378 1.00 71.58  ? 138  LEU A CG    1 
ATOM   1052  C  CD1   . LEU A  1  138  ? 86.987  0.988   110.043 1.00 66.42  ? 138  LEU A CD1   1 
ATOM   1053  C  CD2   . LEU A  1  138  ? 86.037  -0.560  111.765 1.00 71.50  ? 138  LEU A CD2   1 
ATOM   1054  N  N     . ASN A  1  139  ? 90.078  2.618   110.992 1.00 63.43  ? 139  ASN A N     1 
ATOM   1055  C  CA    . ASN A  1  139  ? 90.318  3.891   111.652 1.00 65.49  ? 139  ASN A CA    1 
ATOM   1056  C  C     . ASN A  1  139  ? 89.303  4.932   111.189 1.00 69.36  ? 139  ASN A C     1 
ATOM   1057  O  O     . ASN A  1  139  ? 89.308  5.339   110.030 1.00 77.55  ? 139  ASN A O     1 
ATOM   1058  C  CB    . ASN A  1  139  ? 91.758  4.351   111.385 1.00 68.15  ? 139  ASN A CB    1 
ATOM   1059  C  CG    . ASN A  1  139  ? 91.964  5.837   111.636 1.00 78.88  ? 139  ASN A CG    1 
ATOM   1060  O  OD1   . ASN A  1  139  ? 91.194  6.479   112.354 1.00 81.20  ? 139  ASN A OD1   1 
ATOM   1061  N  ND2   . ASN A  1  139  ? 93.012  6.393   111.038 1.00 84.66  ? 139  ASN A ND2   1 
ATOM   1062  N  N     . MET A  1  140  ? 88.429  5.360   112.095 1.00 63.25  ? 140  MET A N     1 
ATOM   1063  C  CA    . MET A  1  140  ? 87.347  6.265   111.730 1.00 67.51  ? 140  MET A CA    1 
ATOM   1064  C  C     . MET A  1  140  ? 87.030  7.356   112.745 1.00 64.73  ? 140  MET A C     1 
ATOM   1065  O  O     . MET A  1  140  ? 87.363  7.252   113.924 1.00 73.13  ? 140  MET A O     1 
ATOM   1066  C  CB    . MET A  1  140  ? 86.071  5.479   111.418 1.00 68.27  ? 140  MET A CB    1 
ATOM   1067  C  CG    . MET A  1  140  ? 85.685  4.445   112.454 1.00 63.26  ? 140  MET A CG    1 
ATOM   1068  S  SD    . MET A  1  140  ? 84.144  3.640   111.985 1.00 71.66  ? 140  MET A SD    1 
ATOM   1069  C  CE    . MET A  1  140  ? 84.208  2.143   112.960 1.00 74.97  ? 140  MET A CE    1 
ATOM   1070  N  N     . GLU A  1  141  ? 86.382  8.405   112.249 1.00 59.39  ? 141  GLU A N     1 
ATOM   1071  C  CA    . GLU A  1  141  ? 85.868  9.490   113.064 1.00 63.86  ? 141  GLU A CA    1 
ATOM   1072  C  C     . GLU A  1  141  ? 84.366  9.559   112.845 1.00 66.92  ? 141  GLU A C     1 
ATOM   1073  O  O     . GLU A  1  141  ? 83.909  9.843   111.739 1.00 69.16  ? 141  GLU A O     1 
ATOM   1074  C  CB    . GLU A  1  141  ? 86.482  10.824  112.638 1.00 62.97  ? 141  GLU A CB    1 
ATOM   1075  C  CG    . GLU A  1  141  ? 87.991  10.869  112.649 1.00 68.83  ? 141  GLU A CG    1 
ATOM   1076  C  CD    . GLU A  1  141  ? 88.518  12.173  112.087 1.00 83.46  ? 141  GLU A CD    1 
ATOM   1077  O  OE1   . GLU A  1  141  ? 87.692  13.069  111.801 1.00 81.51  ? 141  GLU A OE1   1 
ATOM   1078  O  OE2   . GLU A  1  141  ? 89.751  12.304  111.927 1.00 87.09  ? 141  GLU A OE2   1 
ATOM   1079  N  N     . VAL A  1  142  ? 83.594  9.293   113.889 1.00 63.56  ? 142  VAL A N     1 
ATOM   1080  C  CA    . VAL A  1  142  ? 82.146  9.395   113.775 1.00 60.59  ? 142  VAL A CA    1 
ATOM   1081  C  C     . VAL A  1  142  ? 81.620  10.589  114.561 1.00 57.37  ? 142  VAL A C     1 
ATOM   1082  O  O     . VAL A  1  142  ? 81.842  10.704  115.760 1.00 62.72  ? 142  VAL A O     1 
ATOM   1083  C  CB    . VAL A  1  142  ? 81.434  8.086   114.197 1.00 60.33  ? 142  VAL A CB    1 
ATOM   1084  C  CG1   . VAL A  1  142  ? 82.446  7.041   114.639 1.00 61.15  ? 142  VAL A CG1   1 
ATOM   1085  C  CG2   . VAL A  1  142  ? 80.401  8.353   115.277 1.00 56.85  ? 142  VAL A CG2   1 
ATOM   1086  N  N     . ARG A  1  143  ? 80.944  11.493  113.864 1.00 56.06  ? 143  ARG A N     1 
ATOM   1087  C  CA    . ARG A  1  143  ? 80.356  12.656  114.501 1.00 52.28  ? 143  ARG A CA    1 
ATOM   1088  C  C     . ARG A  1  143  ? 78.989  12.323  115.083 1.00 58.15  ? 143  ARG A C     1 
ATOM   1089  O  O     . ARG A  1  143  ? 78.189  11.629  114.461 1.00 58.03  ? 143  ARG A O     1 
ATOM   1090  C  CB    . ARG A  1  143  ? 80.243  13.811  113.511 1.00 51.19  ? 143  ARG A CB    1 
ATOM   1091  C  CG    . ARG A  1  143  ? 79.322  14.923  113.966 1.00 57.54  ? 143  ARG A CG    1 
ATOM   1092  C  CD    . ARG A  1  143  ? 79.532  16.170  113.133 1.00 60.78  ? 143  ARG A CD    1 
ATOM   1093  N  NE    . ARG A  1  143  ? 78.522  17.187  113.398 1.00 60.53  ? 143  ARG A NE    1 
ATOM   1094  C  CZ    . ARG A  1  143  ? 78.538  18.405  112.869 1.00 65.86  ? 143  ARG A CZ    1 
ATOM   1095  N  NH1   . ARG A  1  143  ? 79.519  18.757  112.051 1.00 70.43  ? 143  ARG A NH1   1 
ATOM   1096  N  NH2   . ARG A  1  143  ? 77.580  19.274  113.162 1.00 66.61  ? 143  ARG A NH2   1 
ATOM   1097  N  N     . VAL A  1  144  ? 78.738  12.816  116.291 1.00 63.57  ? 144  VAL A N     1 
ATOM   1098  C  CA    . VAL A  1  144  ? 77.462  12.634  116.965 1.00 56.64  ? 144  VAL A CA    1 
ATOM   1099  C  C     . VAL A  1  144  ? 76.884  13.989  117.344 1.00 60.10  ? 144  VAL A C     1 
ATOM   1100  O  O     . VAL A  1  144  ? 77.576  14.832  117.909 1.00 64.56  ? 144  VAL A O     1 
ATOM   1101  C  CB    . VAL A  1  144  ? 77.617  11.779  118.228 1.00 53.95  ? 144  VAL A CB    1 
ATOM   1102  C  CG1   . VAL A  1  144  ? 76.349  11.817  119.049 1.00 57.05  ? 144  VAL A CG1   1 
ATOM   1103  C  CG2   . VAL A  1  144  ? 77.975  10.352  117.859 1.00 54.05  ? 144  VAL A CG2   1 
ATOM   1104  N  N     . ASP A  1  145  ? 75.613  14.198  117.022 1.00 63.11  ? 145  ASP A N     1 
ATOM   1105  C  CA    . ASP A  1  145  ? 74.946  15.468  117.285 1.00 65.24  ? 145  ASP A CA    1 
ATOM   1106  C  C     . ASP A  1  145  ? 73.712  15.263  118.148 1.00 66.42  ? 145  ASP A C     1 
ATOM   1107  O  O     . ASP A  1  145  ? 73.163  14.163  118.207 1.00 67.46  ? 145  ASP A O     1 
ATOM   1108  C  CB    . ASP A  1  145  ? 74.524  16.132  115.971 1.00 64.15  ? 145  ASP A CB    1 
ATOM   1109  C  CG    . ASP A  1  145  ? 75.679  16.794  115.248 1.00 69.13  ? 145  ASP A CG    1 
ATOM   1110  O  OD1   . ASP A  1  145  ? 76.845  16.481  115.563 1.00 73.66  ? 145  ASP A OD1   1 
ATOM   1111  O  OD2   . ASP A  1  145  ? 75.418  17.627  114.356 1.00 73.94  ? 145  ASP A OD2   1 
ATOM   1112  N  N     . ARG A  1  146  ? 73.277  16.326  118.817 1.00 67.72  ? 146  ARG A N     1 
ATOM   1113  C  CA    . ARG A  1  146  ? 71.996  16.312  119.505 1.00 63.73  ? 146  ARG A CA    1 
ATOM   1114  C  C     . ARG A  1  146  ? 70.979  16.969  118.583 1.00 67.29  ? 146  ARG A C     1 
ATOM   1115  O  O     . ARG A  1  146  ? 71.299  17.939  117.892 1.00 67.42  ? 146  ARG A O     1 
ATOM   1116  C  CB    . ARG A  1  146  ? 72.077  17.051  120.839 1.00 68.77  ? 146  ARG A CB    1 
ATOM   1117  C  CG    . ARG A  1  146  ? 70.776  17.013  121.632 1.00 83.31  ? 146  ARG A CG    1 
ATOM   1118  C  CD    . ARG A  1  146  ? 70.866  17.815  122.925 1.00 93.22  ? 146  ARG A CD    1 
ATOM   1119  N  NE    . ARG A  1  146  ? 71.537  17.088  124.002 1.00 93.22  ? 146  ARG A NE    1 
ATOM   1120  C  CZ    . ARG A  1  146  ? 72.475  17.614  124.785 1.00 92.14  ? 146  ARG A CZ    1 
ATOM   1121  N  NH1   . ARG A  1  146  ? 72.860  18.870  124.604 1.00 92.05  ? 146  ARG A NH1   1 
ATOM   1122  N  NH2   . ARG A  1  146  ? 73.030  16.884  125.745 1.00 83.01  ? 146  ARG A NH2   1 
ATOM   1123  N  N     . GLY A  1  147  ? 69.763  16.429  118.557 1.00 62.64  ? 147  GLY A N     1 
ATOM   1124  C  CA    . GLY A  1  147  ? 68.729  16.919  117.660 1.00 62.26  ? 147  GLY A CA    1 
ATOM   1125  C  C     . GLY A  1  147  ? 67.373  16.319  117.965 1.00 61.04  ? 147  GLY A C     1 
ATOM   1126  O  O     . GLY A  1  147  ? 67.203  15.641  118.975 1.00 64.03  ? 147  GLY A O     1 
ATOM   1127  N  N     . VAL A  1  148  ? 66.401  16.561  117.093 1.00 59.69  ? 148  VAL A N     1 
ATOM   1128  C  CA    . VAL A  1  148  ? 65.047  16.085  117.348 1.00 64.31  ? 148  VAL A CA    1 
ATOM   1129  C  C     . VAL A  1  148  ? 64.467  15.302  116.177 1.00 64.16  ? 148  VAL A C     1 
ATOM   1130  O  O     . VAL A  1  148  ? 64.662  15.659  115.017 1.00 66.84  ? 148  VAL A O     1 
ATOM   1131  C  CB    . VAL A  1  148  ? 64.095  17.248  117.681 1.00 66.75  ? 148  VAL A CB    1 
ATOM   1132  C  CG1   . VAL A  1  148  ? 62.810  16.710  118.278 1.00 60.80  ? 148  VAL A CG1   1 
ATOM   1133  C  CG2   . VAL A  1  148  ? 64.760  18.221  118.642 1.00 66.54  ? 148  VAL A CG2   1 
ATOM   1134  N  N     . GLY A  1  149  ? 63.746  14.233  116.492 1.00 65.80  ? 149  GLY A N     1 
ATOM   1135  C  CA    . GLY A  1  149  ? 63.060  13.455  115.477 1.00 67.41  ? 149  GLY A CA    1 
ATOM   1136  C  C     . GLY A  1  149  ? 63.968  12.697  114.526 1.00 63.87  ? 149  GLY A C     1 
ATOM   1137  O  O     . GLY A  1  149  ? 65.082  12.301  114.875 1.00 61.89  ? 149  GLY A O     1 
ATOM   1138  N  N     . TYR A  1  150  ? 63.475  12.495  113.309 1.00 63.78  ? 150  TYR A N     1 
ATOM   1139  C  CA    . TYR A  1  150  ? 64.181  11.721  112.298 1.00 64.46  ? 150  TYR A CA    1 
ATOM   1140  C  C     . TYR A  1  150  ? 64.616  12.611  111.136 1.00 64.14  ? 150  TYR A C     1 
ATOM   1141  O  O     . TYR A  1  150  ? 63.784  13.121  110.383 1.00 63.29  ? 150  TYR A O     1 
ATOM   1142  C  CB    . TYR A  1  150  ? 63.288  10.576  111.808 1.00 65.07  ? 150  TYR A CB    1 
ATOM   1143  C  CG    . TYR A  1  150  ? 63.740  9.910   110.528 1.00 65.00  ? 150  TYR A CG    1 
ATOM   1144  C  CD1   . TYR A  1  150  ? 64.786  8.995   110.525 1.00 61.43  ? 150  TYR A CD1   1 
ATOM   1145  C  CD2   . TYR A  1  150  ? 63.109  10.186  109.326 1.00 62.22  ? 150  TYR A CD2   1 
ATOM   1146  C  CE1   . TYR A  1  150  ? 65.197  8.380   109.354 1.00 57.25  ? 150  TYR A CE1   1 
ATOM   1147  C  CE2   . TYR A  1  150  ? 63.515  9.579   108.151 1.00 64.90  ? 150  TYR A CE2   1 
ATOM   1148  C  CZ    . TYR A  1  150  ? 64.557  8.676   108.172 1.00 62.15  ? 150  TYR A CZ    1 
ATOM   1149  O  OH    . TYR A  1  150  ? 64.956  8.068   107.005 1.00 66.81  ? 150  TYR A OH    1 
ATOM   1150  N  N     . VAL A  1  151  ? 65.926  12.803  111.004 1.00 64.63  ? 151  VAL A N     1 
ATOM   1151  C  CA    . VAL A  1  151  ? 66.480  13.624  109.933 1.00 61.12  ? 151  VAL A CA    1 
ATOM   1152  C  C     . VAL A  1  151  ? 67.406  12.808  109.042 1.00 62.74  ? 151  VAL A C     1 
ATOM   1153  O  O     . VAL A  1  151  ? 68.509  12.442  109.453 1.00 61.41  ? 151  VAL A O     1 
ATOM   1154  C  CB    . VAL A  1  151  ? 67.248  14.824  110.490 1.00 53.41  ? 151  VAL A CB    1 
ATOM   1155  C  CG1   . VAL A  1  151  ? 67.877  15.610  109.365 1.00 58.05  ? 151  VAL A CG1   1 
ATOM   1156  C  CG2   . VAL A  1  151  ? 66.315  15.705  111.302 1.00 60.88  ? 151  VAL A CG2   1 
ATOM   1157  N  N     . PRO A  1  152  ? 66.952  12.518  107.814 1.00 61.47  ? 152  PRO A N     1 
ATOM   1158  C  CA    . PRO A  1  152  ? 67.677  11.676  106.860 1.00 62.97  ? 152  PRO A CA    1 
ATOM   1159  C  C     . PRO A  1  152  ? 68.944  12.347  106.372 1.00 62.56  ? 152  PRO A C     1 
ATOM   1160  O  O     . PRO A  1  152  ? 69.003  13.574  106.305 1.00 63.75  ? 152  PRO A O     1 
ATOM   1161  C  CB    . PRO A  1  152  ? 66.689  11.530  105.696 1.00 63.93  ? 152  PRO A CB    1 
ATOM   1162  C  CG    . PRO A  1  152  ? 65.364  11.906  106.255 1.00 61.13  ? 152  PRO A CG    1 
ATOM   1163  C  CD    . PRO A  1  152  ? 65.653  12.949  107.279 1.00 60.61  ? 152  PRO A CD    1 
ATOM   1164  N  N     . ALA A  1  153  ? 69.942  11.541  106.027 1.00 60.96  ? 153  ALA A N     1 
ATOM   1165  C  CA    . ALA A  1  153  ? 71.205  12.054  105.517 1.00 58.93  ? 153  ALA A CA    1 
ATOM   1166  C  C     . ALA A  1  153  ? 70.980  13.096  104.423 1.00 61.09  ? 153  ALA A C     1 
ATOM   1167  O  O     . ALA A  1  153  ? 71.650  14.124  104.385 1.00 64.46  ? 153  ALA A O     1 
ATOM   1168  C  CB    . ALA A  1  153  ? 72.061  10.915  105.003 1.00 60.21  ? 153  ALA A CB    1 
ATOM   1169  N  N     . GLU A  1  154  ? 70.025  12.833  103.541 1.00 61.15  ? 154  GLU A N     1 
ATOM   1170  C  CA    . GLU A  1  154  ? 69.739  13.750  102.447 1.00 60.66  ? 154  GLU A CA    1 
ATOM   1171  C  C     . GLU A  1  154  ? 69.386  15.144  102.959 1.00 63.44  ? 154  GLU A C     1 
ATOM   1172  O  O     . GLU A  1  154  ? 69.730  16.141  102.334 1.00 67.96  ? 154  GLU A O     1 
ATOM   1173  C  CB    . GLU A  1  154  ? 68.614  13.205  101.565 1.00 67.96  ? 154  GLU A CB    1 
ATOM   1174  C  CG    . GLU A  1  154  ? 68.782  11.741  101.170 1.00 70.54  ? 154  GLU A CG    1 
ATOM   1175  C  CD    . GLU A  1  154  ? 68.270  10.779  102.239 1.00 93.03  ? 154  GLU A CD    1 
ATOM   1176  O  OE1   . GLU A  1  154  ? 67.032  10.683  102.406 1.00 105.91 ? 154  GLU A OE1   1 
ATOM   1177  O  OE2   . GLU A  1  154  ? 69.099  10.118  102.910 1.00 86.02  ? 154  GLU A OE2   1 
ATOM   1178  N  N     . LYS A  1  155  ? 68.706  15.214  104.098 1.00 67.89  ? 155  LYS A N     1 
ATOM   1179  C  CA    . LYS A  1  155  ? 68.287  16.498  104.657 1.00 65.38  ? 155  LYS A CA    1 
ATOM   1180  C  C     . LYS A  1  155  ? 69.435  17.316  105.243 1.00 70.06  ? 155  LYS A C     1 
ATOM   1181  O  O     . LYS A  1  155  ? 69.614  18.480  104.886 1.00 76.62  ? 155  LYS A O     1 
ATOM   1182  C  CB    . LYS A  1  155  ? 67.202  16.308  105.719 1.00 59.61  ? 155  LYS A CB    1 
ATOM   1183  C  CG    . LYS A  1  155  ? 65.785  16.354  105.183 1.00 75.28  ? 155  LYS A CG    1 
ATOM   1184  C  CD    . LYS A  1  155  ? 65.525  17.635  104.402 1.00 92.38  ? 155  LYS A CD    1 
ATOM   1185  C  CE    . LYS A  1  155  ? 64.067  17.734  103.963 1.00 102.24 ? 155  LYS A CE    1 
ATOM   1186  N  NZ    . LYS A  1  155  ? 63.597  16.516  103.235 1.00 101.27 ? 155  LYS A NZ    1 
ATOM   1187  N  N     . HIS A  1  156  ? 70.204  16.713  106.146 1.00 66.70  ? 156  HIS A N     1 
ATOM   1188  C  CA    . HIS A  1  156  ? 71.231  17.455  106.872 1.00 62.90  ? 156  HIS A CA    1 
ATOM   1189  C  C     . HIS A  1  156  ? 72.568  17.564  106.135 1.00 68.29  ? 156  HIS A C     1 
ATOM   1190  O  O     . HIS A  1  156  ? 73.300  18.538  106.312 1.00 73.98  ? 156  HIS A O     1 
ATOM   1191  C  CB    . HIS A  1  156  ? 71.421  16.894  108.289 1.00 63.06  ? 156  HIS A CB    1 
ATOM   1192  C  CG    . HIS A  1  156  ? 71.969  15.499  108.339 1.00 60.66  ? 156  HIS A CG    1 
ATOM   1193  N  ND1   . HIS A  1  156  ? 73.287  15.204  108.056 1.00 61.58  ? 156  HIS A ND1   1 
ATOM   1194  C  CD2   . HIS A  1  156  ? 71.388  14.324  108.679 1.00 55.36  ? 156  HIS A CD2   1 
ATOM   1195  C  CE1   . HIS A  1  156  ? 73.488  13.907  108.204 1.00 59.41  ? 156  HIS A CE1   1 
ATOM   1196  N  NE2   . HIS A  1  156  ? 72.351  13.350  108.582 1.00 54.66  ? 156  HIS A NE2   1 
ATOM   1197  N  N     . GLY A  1  157  ? 72.873  16.570  105.305 1.00 68.71  ? 157  GLY A N     1 
ATOM   1198  C  CA    . GLY A  1  157  ? 74.092  16.561  104.509 1.00 66.06  ? 157  GLY A CA    1 
ATOM   1199  C  C     . GLY A  1  157  ? 75.337  16.957  105.275 1.00 65.14  ? 157  GLY A C     1 
ATOM   1200  O  O     . GLY A  1  157  ? 76.132  17.771  104.811 1.00 70.94  ? 157  GLY A O     1 
ATOM   1201  N  N     . ILE A  1  158  ? 75.512  16.374  106.454 1.00 67.52  ? 158  ILE A N     1 
ATOM   1202  C  CA    . ILE A  1  158  ? 76.600  16.769  107.344 1.00 71.43  ? 158  ILE A CA    1 
ATOM   1203  C  C     . ILE A  1  158  ? 77.908  16.034  107.056 1.00 71.80  ? 158  ILE A C     1 
ATOM   1204  O  O     . ILE A  1  158  ? 77.983  14.807  107.145 1.00 69.30  ? 158  ILE A O     1 
ATOM   1205  C  CB    . ILE A  1  158  ? 76.213  16.580  108.827 1.00 68.66  ? 158  ILE A CB    1 
ATOM   1206  C  CG1   . ILE A  1  158  ? 75.136  17.588  109.226 1.00 65.67  ? 158  ILE A CG1   1 
ATOM   1207  C  CG2   . ILE A  1  158  ? 77.430  16.730  109.721 1.00 63.40  ? 158  ILE A CG2   1 
ATOM   1208  C  CD1   . ILE A  1  158  ? 74.673  17.442  110.660 1.00 66.56  ? 158  ILE A CD1   1 
ATOM   1209  N  N     . LYS A  1  159  ? 78.937  16.802  106.713 1.00 71.68  ? 159  LYS A N     1 
ATOM   1210  C  CA    . LYS A  1  159  ? 80.265  16.255  106.482 1.00 72.33  ? 159  LYS A CA    1 
ATOM   1211  C  C     . LYS A  1  159  ? 81.307  17.145  107.139 1.00 79.94  ? 159  LYS A C     1 
ATOM   1212  O  O     . LYS A  1  159  ? 81.406  18.330  106.816 1.00 81.77  ? 159  LYS A O     1 
ATOM   1213  C  CB    . LYS A  1  159  ? 80.542  16.146  104.981 1.00 68.48  ? 159  LYS A CB    1 
ATOM   1214  C  CG    . LYS A  1  159  ? 79.549  15.270  104.244 1.00 66.65  ? 159  LYS A CG    1 
ATOM   1215  C  CD    . LYS A  1  159  ? 79.517  15.570  102.760 1.00 67.75  ? 159  LYS A CD    1 
ATOM   1216  C  CE    . LYS A  1  159  ? 80.548  14.766  101.991 1.00 65.90  ? 159  LYS A CE    1 
ATOM   1217  N  NZ    . LYS A  1  159  ? 80.284  14.821  100.521 1.00 68.39  ? 159  LYS A NZ    1 
ATOM   1218  N  N     . ASP A  1  160  ? 82.077  16.577  108.065 1.00 76.76  ? 160  ASP A N     1 
ATOM   1219  C  CA    . ASP A  1  160  ? 83.179  17.305  108.685 1.00 78.08  ? 160  ASP A CA    1 
ATOM   1220  C  C     . ASP A  1  160  ? 84.363  17.457  107.722 1.00 80.80  ? 160  ASP A C     1 
ATOM   1221  O  O     . ASP A  1  160  ? 85.016  18.500  107.682 1.00 81.27  ? 160  ASP A O     1 
ATOM   1222  C  CB    . ASP A  1  160  ? 83.615  16.633  109.990 1.00 82.53  ? 160  ASP A CB    1 
ATOM   1223  C  CG    . ASP A  1  160  ? 82.690  16.957  111.155 1.00 85.33  ? 160  ASP A CG    1 
ATOM   1224  O  OD1   . ASP A  1  160  ? 81.928  17.945  111.054 1.00 76.63  ? 160  ASP A OD1   1 
ATOM   1225  O  OD2   . ASP A  1  160  ? 82.735  16.232  112.176 1.00 81.08  ? 160  ASP A OD2   1 
ATOM   1226  N  N     . ARG A  1  161  ? 84.631  16.417  106.940 1.00 75.14  ? 161  ARG A N     1 
ATOM   1227  C  CA    . ARG A  1  161  ? 85.675  16.492  105.926 1.00 71.99  ? 161  ARG A CA    1 
ATOM   1228  C  C     . ARG A  1  161  ? 85.200  16.009  104.553 1.00 78.35  ? 161  ARG A C     1 
ATOM   1229  O  O     . ARG A  1  161  ? 84.061  15.568  104.399 1.00 81.09  ? 161  ARG A O     1 
ATOM   1230  C  CB    . ARG A  1  161  ? 86.921  15.732  106.375 1.00 76.68  ? 161  ARG A CB    1 
ATOM   1231  C  CG    . ARG A  1  161  ? 86.698  14.271  106.689 1.00 73.88  ? 161  ARG A CG    1 
ATOM   1232  C  CD    . ARG A  1  161  ? 88.000  13.645  107.148 1.00 82.73  ? 161  ARG A CD    1 
ATOM   1233  N  NE    . ARG A  1  161  ? 88.414  14.156  108.451 1.00 88.67  ? 161  ARG A NE    1 
ATOM   1234  C  CZ    . ARG A  1  161  ? 89.639  14.033  108.951 1.00 92.51  ? 161  ARG A CZ    1 
ATOM   1235  N  NH1   . ARG A  1  161  ? 90.586  13.422  108.249 1.00 86.39  ? 161  ARG A NH1   1 
ATOM   1236  N  NH2   . ARG A  1  161  ? 89.918  14.529  110.154 1.00 86.68  ? 161  ARG A NH2   1 
ATOM   1237  N  N     . ILE A  1  162  ? 86.085  16.095  103.562 1.00 80.81  ? 162  ILE A N     1 
ATOM   1238  C  CA    . ILE A  1  162  ? 85.744  15.824  102.164 1.00 75.84  ? 162  ILE A CA    1 
ATOM   1239  C  C     . ILE A  1  162  ? 85.144  14.439  101.909 1.00 70.92  ? 162  ILE A C     1 
ATOM   1240  O  O     . ILE A  1  162  ? 84.214  14.301  101.117 1.00 74.75  ? 162  ILE A O     1 
ATOM   1241  C  CB    . ILE A  1  162  ? 86.970  16.021  101.240 1.00 76.24  ? 162  ILE A CB    1 
ATOM   1242  C  CG1   . ILE A  1  162  ? 87.432  17.481  101.262 1.00 79.30  ? 162  ILE A CG1   1 
ATOM   1243  C  CG2   . ILE A  1  162  ? 86.645  15.595  99.819  1.00 71.00  ? 162  ILE A CG2   1 
ATOM   1244  C  CD1   . ILE A  1  162  ? 86.559  18.417  100.450 1.00 75.27  ? 162  ILE A CD1   1 
ATOM   1245  N  N     . ASN A  1  163  ? 85.678  13.417  102.570 1.00 72.06  ? 163  ASN A N     1 
ATOM   1246  C  CA    . ASN A  1  163  ? 85.216  12.047  102.354 1.00 71.06  ? 163  ASN A CA    1 
ATOM   1247  C  C     . ASN A  1  163  ? 84.210  11.565  103.394 1.00 69.43  ? 163  ASN A C     1 
ATOM   1248  O  O     . ASN A  1  163  ? 83.871  10.383  103.440 1.00 64.15  ? 163  ASN A O     1 
ATOM   1249  C  CB    . ASN A  1  163  ? 86.401  11.084  102.311 1.00 77.83  ? 163  ASN A CB    1 
ATOM   1250  C  CG    . ASN A  1  163  ? 87.278  11.297  101.099 1.00 79.77  ? 163  ASN A CG    1 
ATOM   1251  O  OD1   . ASN A  1  163  ? 86.790  11.609  100.010 1.00 80.22  ? 163  ASN A OD1   1 
ATOM   1252  N  ND2   . ASN A  1  163  ? 88.585  11.133  101.281 1.00 81.48  ? 163  ASN A ND2   1 
ATOM   1253  N  N     . ALA A  1  164  ? 83.744  12.480  104.235 1.00 74.43  ? 164  ALA A N     1 
ATOM   1254  C  CA    . ALA A  1  164  ? 82.785  12.136  105.271 1.00 64.53  ? 164  ALA A CA    1 
ATOM   1255  C  C     . ALA A  1  164  ? 81.457  11.705  104.656 1.00 62.07  ? 164  ALA A C     1 
ATOM   1256  O  O     . ALA A  1  164  ? 80.985  12.291  103.685 1.00 64.52  ? 164  ALA A O     1 
ATOM   1257  C  CB    . ALA A  1  164  ? 82.586  13.304  106.211 1.00 68.95  ? 164  ALA A CB    1 
ATOM   1258  N  N     . ILE A  1  165  ? 80.864  10.670  105.237 1.00 60.11  ? 165  ILE A N     1 
ATOM   1259  C  CA    . ILE A  1  165  ? 79.599  10.115  104.773 1.00 55.38  ? 165  ILE A CA    1 
ATOM   1260  C  C     . ILE A  1  165  ? 78.450  10.528  105.691 1.00 60.97  ? 165  ILE A C     1 
ATOM   1261  O  O     . ILE A  1  165  ? 78.337  10.019  106.811 1.00 61.19  ? 165  ILE A O     1 
ATOM   1262  C  CB    . ILE A  1  165  ? 79.666  8.578   104.776 1.00 51.46  ? 165  ILE A CB    1 
ATOM   1263  C  CG1   . ILE A  1  165  ? 80.750  8.086   103.819 1.00 57.57  ? 165  ILE A CG1   1 
ATOM   1264  C  CG2   . ILE A  1  165  ? 78.324  7.978   104.421 1.00 56.98  ? 165  ILE A CG2   1 
ATOM   1265  C  CD1   . ILE A  1  165  ? 81.000  6.598   103.900 1.00 53.65  ? 165  ILE A CD1   1 
ATOM   1266  N  N     . PRO A  1  166  ? 77.595  11.457  105.232 1.00 57.69  ? 166  PRO A N     1 
ATOM   1267  C  CA    . PRO A  1  166  ? 76.426  11.794  106.045 1.00 57.28  ? 166  PRO A CA    1 
ATOM   1268  C  C     . PRO A  1  166  ? 75.632  10.542  106.400 1.00 59.23  ? 166  PRO A C     1 
ATOM   1269  O  O     . PRO A  1  166  ? 75.467  9.659   105.559 1.00 60.82  ? 166  PRO A O     1 
ATOM   1270  C  CB    . PRO A  1  166  ? 75.614  12.698  105.120 1.00 58.74  ? 166  PRO A CB    1 
ATOM   1271  C  CG    . PRO A  1  166  ? 76.636  13.360  104.275 1.00 60.15  ? 166  PRO A CG    1 
ATOM   1272  C  CD    . PRO A  1  166  ? 77.704  12.317  104.043 1.00 59.62  ? 166  PRO A CD    1 
ATOM   1273  N  N     . VAL A  1  167  ? 75.161  10.466  107.641 1.00 61.86  ? 167  VAL A N     1 
ATOM   1274  C  CA    . VAL A  1  167  ? 74.395  9.319   108.112 1.00 57.10  ? 167  VAL A CA    1 
ATOM   1275  C  C     . VAL A  1  167  ? 73.001  9.760   108.536 1.00 55.07  ? 167  VAL A C     1 
ATOM   1276  O  O     . VAL A  1  167  ? 72.819  10.890  108.989 1.00 55.48  ? 167  VAL A O     1 
ATOM   1277  C  CB    . VAL A  1  167  ? 75.098  8.639   109.297 1.00 53.12  ? 167  VAL A CB    1 
ATOM   1278  C  CG1   . VAL A  1  167  ? 74.294  7.446   109.788 1.00 58.45  ? 167  VAL A CG1   1 
ATOM   1279  C  CG2   . VAL A  1  167  ? 76.501  8.212   108.897 1.00 53.90  ? 167  VAL A CG2   1 
ATOM   1280  N  N     . ASP A  1  168  ? 72.018  8.879   108.372 1.00 55.49  ? 168  ASP A N     1 
ATOM   1281  C  CA    . ASP A  1  168  ? 70.657  9.169   108.815 1.00 60.32  ? 168  ASP A CA    1 
ATOM   1282  C  C     . ASP A  1  168  ? 70.591  9.236   110.334 1.00 57.52  ? 168  ASP A C     1 
ATOM   1283  O  O     . ASP A  1  168  ? 71.065  8.335   111.027 1.00 56.34  ? 168  ASP A O     1 
ATOM   1284  C  CB    . ASP A  1  168  ? 69.681  8.104   108.321 1.00 66.15  ? 168  ASP A CB    1 
ATOM   1285  C  CG    . ASP A  1  168  ? 69.441  8.173   106.830 1.00 72.43  ? 168  ASP A CG    1 
ATOM   1286  O  OD1   . ASP A  1  168  ? 69.391  9.295   106.279 1.00 69.07  ? 168  ASP A OD1   1 
ATOM   1287  O  OD2   . ASP A  1  168  ? 69.300  7.096   106.214 1.00 79.66  ? 168  ASP A OD2   1 
ATOM   1288  N  N     . ALA A  1  169  ? 69.989  10.300  110.850 1.00 53.98  ? 169  ALA A N     1 
ATOM   1289  C  CA    . ALA A  1  169  ? 69.891  10.479  112.292 1.00 56.34  ? 169  ALA A CA    1 
ATOM   1290  C  C     . ALA A  1  169  ? 68.481  10.237  112.842 1.00 58.56  ? 169  ALA A C     1 
ATOM   1291  O  O     . ALA A  1  169  ? 67.555  11.003  112.571 1.00 57.86  ? 169  ALA A O     1 
ATOM   1292  C  CB    . ALA A  1  169  ? 70.383  11.861  112.683 1.00 56.44  ? 169  ALA A CB    1 
ATOM   1293  N  N     . VAL A  1  170  ? 68.328  9.159   113.604 1.00 52.11  ? 170  VAL A N     1 
ATOM   1294  C  CA    . VAL A  1  170  ? 67.138  8.965   114.410 1.00 55.42  ? 170  VAL A CA    1 
ATOM   1295  C  C     . VAL A  1  170  ? 67.452  9.514   115.794 1.00 63.29  ? 170  VAL A C     1 
ATOM   1296  O  O     . VAL A  1  170  ? 68.081  8.844   116.616 1.00 67.06  ? 170  VAL A O     1 
ATOM   1297  C  CB    . VAL A  1  170  ? 66.760  7.483   114.536 1.00 50.45  ? 170  VAL A CB    1 
ATOM   1298  C  CG1   . VAL A  1  170  ? 65.345  7.353   115.074 1.00 52.59  ? 170  VAL A CG1   1 
ATOM   1299  C  CG2   . VAL A  1  170  ? 66.904  6.779   113.198 1.00 54.58  ? 170  VAL A CG2   1 
ATOM   1300  N  N     . PHE A  1  171  ? 67.021  10.743  116.049 1.00 62.69  ? 171  PHE A N     1 
ATOM   1301  C  CA    . PHE A  1  171  ? 67.393  11.428  117.280 1.00 62.85  ? 171  PHE A CA    1 
ATOM   1302  C  C     . PHE A  1  171  ? 66.674  10.897  118.522 1.00 64.23  ? 171  PHE A C     1 
ATOM   1303  O  O     . PHE A  1  171  ? 67.310  10.616  119.538 1.00 61.90  ? 171  PHE A O     1 
ATOM   1304  C  CB    . PHE A  1  171  ? 67.180  12.934  117.124 1.00 58.38  ? 171  PHE A CB    1 
ATOM   1305  C  CG    . PHE A  1  171  ? 68.240  13.607  116.309 1.00 60.27  ? 171  PHE A CG    1 
ATOM   1306  C  CD1   . PHE A  1  171  ? 69.580  13.347  116.550 1.00 61.31  ? 171  PHE A CD1   1 
ATOM   1307  C  CD2   . PHE A  1  171  ? 67.906  14.491  115.297 1.00 61.42  ? 171  PHE A CD2   1 
ATOM   1308  C  CE1   . PHE A  1  171  ? 70.569  13.960  115.805 1.00 55.02  ? 171  PHE A CE1   1 
ATOM   1309  C  CE2   . PHE A  1  171  ? 68.896  15.110  114.546 1.00 55.22  ? 171  PHE A CE2   1 
ATOM   1310  C  CZ    . PHE A  1  171  ? 70.228  14.843  114.803 1.00 49.00  ? 171  PHE A CZ    1 
ATOM   1311  N  N     . SER A  1  172  ? 65.354  10.752  118.425 1.00 64.22  ? 172  SER A N     1 
ATOM   1312  C  CA    . SER A  1  172  ? 64.520  10.370  119.563 1.00 64.41  ? 172  SER A CA    1 
ATOM   1313  C  C     . SER A  1  172  ? 65.136  9.252   120.399 1.00 66.52  ? 172  SER A C     1 
ATOM   1314  O  O     . SER A  1  172  ? 65.424  8.170   119.883 1.00 68.62  ? 172  SER A O     1 
ATOM   1315  C  CB    . SER A  1  172  ? 63.115  9.969   119.101 1.00 67.07  ? 172  SER A CB    1 
ATOM   1316  O  OG    . SER A  1  172  ? 62.302  9.594   120.202 1.00 63.21  ? 172  SER A OG    1 
ATOM   1317  N  N     . PRO A  1  173  ? 65.344  9.527   121.695 1.00 65.50  ? 173  PRO A N     1 
ATOM   1318  C  CA    . PRO A  1  173  ? 65.876  8.596   122.695 1.00 60.24  ? 173  PRO A CA    1 
ATOM   1319  C  C     . PRO A  1  173  ? 64.806  7.614   123.156 1.00 58.88  ? 173  PRO A C     1 
ATOM   1320  O  O     . PRO A  1  173  ? 65.114  6.633   123.837 1.00 56.18  ? 173  PRO A O     1 
ATOM   1321  C  CB    . PRO A  1  173  ? 66.258  9.520   123.849 1.00 57.10  ? 173  PRO A CB    1 
ATOM   1322  C  CG    . PRO A  1  173  ? 65.314  10.672  123.724 1.00 60.34  ? 173  PRO A CG    1 
ATOM   1323  C  CD    . PRO A  1  173  ? 65.120  10.872  122.254 1.00 64.95  ? 173  PRO A CD    1 
ATOM   1324  N  N     . VAL A  1  174  ? 63.559  7.881   122.779 1.00 58.92  ? 174  VAL A N     1 
ATOM   1325  C  CA    . VAL A  1  174  ? 62.430  7.049   123.183 1.00 58.93  ? 174  VAL A CA    1 
ATOM   1326  C  C     . VAL A  1  174  ? 62.227  5.874   122.231 1.00 59.08  ? 174  VAL A C     1 
ATOM   1327  O  O     . VAL A  1  174  ? 61.957  6.067   121.046 1.00 63.92  ? 174  VAL A O     1 
ATOM   1328  C  CB    . VAL A  1  174  ? 61.133  7.861   123.205 1.00 53.78  ? 174  VAL A CB    1 
ATOM   1329  C  CG1   . VAL A  1  174  ? 59.974  6.989   123.651 1.00 56.92  ? 174  VAL A CG1   1 
ATOM   1330  C  CG2   . VAL A  1  174  ? 61.290  9.073   124.102 1.00 57.55  ? 174  VAL A CG2   1 
ATOM   1331  N  N     . ARG A  1  175  ? 62.344  4.658   122.754 1.00 56.59  ? 175  ARG A N     1 
ATOM   1332  C  CA    . ARG A  1  175  ? 62.156  3.465   121.937 1.00 54.96  ? 175  ARG A CA    1 
ATOM   1333  C  C     . ARG A  1  175  ? 60.681  3.058   121.828 1.00 54.70  ? 175  ARG A C     1 
ATOM   1334  O  O     . ARG A  1  175  ? 60.205  2.703   120.748 1.00 51.37  ? 175  ARG A O     1 
ATOM   1335  C  CB    . ARG A  1  175  ? 63.016  2.303   122.458 1.00 51.61  ? 175  ARG A CB    1 
ATOM   1336  C  CG    . ARG A  1  175  ? 64.509  2.614   122.500 1.00 63.43  ? 175  ARG A CG    1 
ATOM   1337  C  CD    . ARG A  1  175  ? 65.366  1.532   121.826 1.00 75.19  ? 175  ARG A CD    1 
ATOM   1338  N  NE    . ARG A  1  175  ? 66.733  1.993   121.559 1.00 84.97  ? 175  ARG A NE    1 
ATOM   1339  C  CZ    . ARG A  1  175  ? 67.147  2.514   120.402 1.00 94.86  ? 175  ARG A CZ    1 
ATOM   1340  N  NH1   . ARG A  1  175  ? 66.307  2.638   119.381 1.00 94.53  ? 175  ARG A NH1   1 
ATOM   1341  N  NH2   . ARG A  1  175  ? 68.408  2.909   120.261 1.00 89.04  ? 175  ARG A NH2   1 
ATOM   1342  N  N     . ARG A  1  176  ? 59.957  3.120   122.942 1.00 57.24  ? 176  ARG A N     1 
ATOM   1343  C  CA    . ARG A  1  176  ? 58.562  2.685   122.961 1.00 55.88  ? 176  ARG A CA    1 
ATOM   1344  C  C     . ARG A  1  176  ? 57.728  3.366   124.049 1.00 59.64  ? 176  ARG A C     1 
ATOM   1345  O  O     . ARG A  1  176  ? 58.239  3.718   125.115 1.00 59.16  ? 176  ARG A O     1 
ATOM   1346  C  CB    . ARG A  1  176  ? 58.485  1.163   123.111 1.00 53.07  ? 176  ARG A CB    1 
ATOM   1347  C  CG    . ARG A  1  176  ? 57.071  0.624   123.171 1.00 54.57  ? 176  ARG A CG    1 
ATOM   1348  C  CD    . ARG A  1  176  ? 56.926  -0.633  122.343 1.00 57.14  ? 176  ARG A CD    1 
ATOM   1349  N  NE    . ARG A  1  176  ? 57.692  -1.753  122.877 1.00 59.63  ? 176  ARG A NE    1 
ATOM   1350  C  CZ    . ARG A  1  176  ? 57.193  -2.667  123.700 1.00 69.65  ? 176  ARG A CZ    1 
ATOM   1351  N  NH1   . ARG A  1  176  ? 55.925  -2.588  124.089 1.00 68.60  ? 176  ARG A NH1   1 
ATOM   1352  N  NH2   . ARG A  1  176  ? 57.958  -3.661  124.133 1.00 81.70  ? 176  ARG A NH2   1 
ATOM   1353  N  N     . VAL A  1  177  ? 56.439  3.544   123.771 1.00 60.80  ? 177  VAL A N     1 
ATOM   1354  C  CA    . VAL A  1  177  ? 55.518  4.148   124.731 1.00 56.38  ? 177  VAL A CA    1 
ATOM   1355  C  C     . VAL A  1  177  ? 54.153  3.480   124.704 1.00 53.20  ? 177  VAL A C     1 
ATOM   1356  O  O     . VAL A  1  177  ? 53.506  3.408   123.662 1.00 54.22  ? 177  VAL A O     1 
ATOM   1357  C  CB    . VAL A  1  177  ? 55.300  5.646   124.459 1.00 53.21  ? 177  VAL A CB    1 
ATOM   1358  C  CG1   . VAL A  1  177  ? 54.267  6.202   125.425 1.00 49.60  ? 177  VAL A CG1   1 
ATOM   1359  C  CG2   . VAL A  1  177  ? 56.611  6.405   124.567 1.00 54.72  ? 177  VAL A CG2   1 
ATOM   1360  N  N     . ALA A  1  178  ? 53.712  3.001   125.857 1.00 58.98  ? 178  ALA A N     1 
ATOM   1361  C  CA    . ALA A  1  178  ? 52.366  2.460   125.985 1.00 59.34  ? 178  ALA A CA    1 
ATOM   1362  C  C     . ALA A  1  178  ? 51.671  3.146   127.151 1.00 61.01  ? 178  ALA A C     1 
ATOM   1363  O  O     . ALA A  1  178  ? 52.336  3.710   128.018 1.00 62.92  ? 178  ALA A O     1 
ATOM   1364  C  CB    . ALA A  1  178  ? 52.420  0.959   126.206 1.00 50.45  ? 178  ALA A CB    1 
ATOM   1365  N  N     . PHE A  1  179  ? 50.341  3.131   127.165 1.00 59.98  ? 179  PHE A N     1 
ATOM   1366  C  CA    . PHE A  1  179  ? 49.622  3.550   128.368 1.00 57.55  ? 179  PHE A CA    1 
ATOM   1367  C  C     . PHE A  1  179  ? 48.364  2.741   128.659 1.00 59.78  ? 179  PHE A C     1 
ATOM   1368  O  O     . PHE A  1  179  ? 47.493  2.569   127.807 1.00 58.56  ? 179  PHE A O     1 
ATOM   1369  C  CB    . PHE A  1  179  ? 49.377  5.072   128.439 1.00 55.31  ? 179  PHE A CB    1 
ATOM   1370  C  CG    . PHE A  1  179  ? 48.310  5.586   127.512 1.00 53.29  ? 179  PHE A CG    1 
ATOM   1371  C  CD1   . PHE A  1  179  ? 46.973  5.334   127.753 1.00 54.24  ? 179  PHE A CD1   1 
ATOM   1372  C  CD2   . PHE A  1  179  ? 48.646  6.375   126.428 1.00 55.91  ? 179  PHE A CD2   1 
ATOM   1373  C  CE1   . PHE A  1  179  ? 45.994  5.826   126.908 1.00 53.00  ? 179  PHE A CE1   1 
ATOM   1374  C  CE2   . PHE A  1  179  ? 47.670  6.867   125.582 1.00 57.50  ? 179  PHE A CE2   1 
ATOM   1375  C  CZ    . PHE A  1  179  ? 46.342  6.596   125.828 1.00 54.83  ? 179  PHE A CZ    1 
ATOM   1376  N  N     . GLN A  1  180  ? 48.305  2.235   129.884 1.00 67.80  ? 180  GLN A N     1 
ATOM   1377  C  CA    . GLN A  1  180  ? 47.186  1.450   130.365 1.00 61.24  ? 180  GLN A CA    1 
ATOM   1378  C  C     . GLN A  1  180  ? 46.179  2.369   131.048 1.00 58.04  ? 180  GLN A C     1 
ATOM   1379  O  O     . GLN A  1  180  ? 46.559  3.279   131.788 1.00 60.56  ? 180  GLN A O     1 
ATOM   1380  C  CB    . GLN A  1  180  ? 47.694  0.411   131.362 1.00 62.39  ? 180  GLN A CB    1 
ATOM   1381  C  CG    . GLN A  1  180  ? 46.751  -0.746  131.604 1.00 71.17  ? 180  GLN A CG    1 
ATOM   1382  C  CD    . GLN A  1  180  ? 46.935  -1.859  130.598 1.00 77.09  ? 180  GLN A CD    1 
ATOM   1383  O  OE1   . GLN A  1  180  ? 47.636  -1.696  129.595 1.00 73.17  ? 180  GLN A OE1   1 
ATOM   1384  N  NE2   . GLN A  1  180  ? 46.313  -3.006  130.863 1.00 78.48  ? 180  GLN A NE2   1 
ATOM   1385  N  N     . VAL A  1  181  ? 44.898  2.143   130.780 1.00 53.45  ? 181  VAL A N     1 
ATOM   1386  C  CA    . VAL A  1  181  ? 43.834  2.837   131.490 1.00 58.30  ? 181  VAL A CA    1 
ATOM   1387  C  C     . VAL A  1  181  ? 42.953  1.813   132.171 1.00 60.56  ? 181  VAL A C     1 
ATOM   1388  O  O     . VAL A  1  181  ? 42.209  1.094   131.506 1.00 58.89  ? 181  VAL A O     1 
ATOM   1389  C  CB    . VAL A  1  181  ? 42.963  3.678   130.551 1.00 56.97  ? 181  VAL A CB    1 
ATOM   1390  C  CG1   . VAL A  1  181  ? 41.682  4.096   131.260 1.00 57.73  ? 181  VAL A CG1   1 
ATOM   1391  C  CG2   . VAL A  1  181  ? 43.732  4.892   130.066 1.00 54.66  ? 181  VAL A CG2   1 
ATOM   1392  N  N     . GLU A  1  182  ? 43.036  1.741   133.496 1.00 68.16  ? 182  GLU A N     1 
ATOM   1393  C  CA    . GLU A  1  182  ? 42.301  0.705   134.218 1.00 68.37  ? 182  GLU A CA    1 
ATOM   1394  C  C     . GLU A  1  182  ? 41.214  1.289   135.106 1.00 65.50  ? 182  GLU A C     1 
ATOM   1395  O  O     . GLU A  1  182  ? 41.257  2.463   135.450 1.00 61.47  ? 182  GLU A O     1 
ATOM   1396  C  CB    . GLU A  1  182  ? 43.257  -0.143  135.046 1.00 64.12  ? 182  GLU A CB    1 
ATOM   1397  C  CG    . GLU A  1  182  ? 44.568  -0.418  134.354 1.00 66.19  ? 182  GLU A CG    1 
ATOM   1398  C  CD    . GLU A  1  182  ? 45.390  -1.456  135.078 1.00 80.75  ? 182  GLU A CD    1 
ATOM   1399  O  OE1   . GLU A  1  182  ? 44.800  -2.455  135.545 1.00 77.44  ? 182  GLU A OE1   1 
ATOM   1400  O  OE2   . GLU A  1  182  ? 46.621  -1.269  135.186 1.00 85.78  ? 182  GLU A OE2   1 
ATOM   1401  N  N     . ASP A  1  183  ? 40.237  0.469   135.485 1.00 72.50  ? 183  ASP A N     1 
ATOM   1402  C  CA    . ASP A  1  183  ? 39.134  0.922   136.339 1.00 75.40  ? 183  ASP A CA    1 
ATOM   1403  C  C     . ASP A  1  183  ? 39.563  1.264   137.771 1.00 69.67  ? 183  ASP A C     1 
ATOM   1404  O  O     . ASP A  1  183  ? 40.415  0.590   138.349 1.00 66.25  ? 183  ASP A O     1 
ATOM   1405  C  CB    . ASP A  1  183  ? 38.016  -0.122  136.364 1.00 75.31  ? 183  ASP A CB    1 
ATOM   1406  C  CG    . ASP A  1  183  ? 36.640  0.502   136.490 1.00 82.22  ? 183  ASP A CG    1 
ATOM   1407  O  OD1   . ASP A  1  183  ? 36.559  1.696   136.846 1.00 81.20  ? 183  ASP A OD1   1 
ATOM   1408  O  OD2   . ASP A  1  183  ? 35.641  -0.201  136.233 1.00 84.21  ? 183  ASP A OD2   1 
ATOM   1409  N  N     . THR A  1  184  ? 38.965  2.312   138.335 1.00 72.36  ? 184  THR A N     1 
ATOM   1410  C  CA    . THR A  1  184  ? 39.258  2.733   139.708 1.00 75.36  ? 184  THR A CA    1 
ATOM   1411  C  C     . THR A  1  184  ? 38.031  3.293   140.440 1.00 81.69  ? 184  THR A C     1 
ATOM   1412  O  O     . THR A  1  184  ? 37.080  3.752   139.807 1.00 79.71  ? 184  THR A O     1 
ATOM   1413  C  CB    . THR A  1  184  ? 40.387  3.779   139.748 1.00 69.09  ? 184  THR A CB    1 
ATOM   1414  O  OG1   . THR A  1  184  ? 41.403  3.354   140.664 1.00 62.60  ? 184  THR A OG1   1 
ATOM   1415  C  CG2   . THR A  1  184  ? 39.847  5.130   140.189 1.00 75.12  ? 184  THR A CG2   1 
ATOM   1416  N  N     . ARG A  1  185  ? 38.062  3.255   141.771 1.00 85.37  ? 185  ARG A N     1 
ATOM   1417  C  CA    . ARG A  1  185  ? 36.991  3.828   142.591 1.00 91.44  ? 185  ARG A CA    1 
ATOM   1418  C  C     . ARG A  1  185  ? 37.471  4.528   143.833 1.00 90.05  ? 185  ARG A C     1 
ATOM   1419  O  O     . ARG A  1  185  ? 38.572  4.271   144.324 1.00 84.74  ? 185  ARG A O     1 
ATOM   1420  C  CB    . ARG A  1  185  ? 35.980  2.761   142.990 1.00 105.20 ? 185  ARG A CB    1 
ATOM   1421  C  CG    . ARG A  1  185  ? 36.442  1.730   143.990 1.00 105.39 ? 185  ARG A CG    1 
ATOM   1422  C  CD    . ARG A  1  185  ? 35.339  0.707   144.046 1.00 115.06 ? 185  ARG A CD    1 
ATOM   1423  N  NE    . ARG A  1  185  ? 34.160  1.413   144.556 1.00 126.58 ? 185  ARG A NE    1 
ATOM   1424  C  CZ    . ARG A  1  185  ? 32.920  0.934   144.577 1.00 129.86 ? 185  ARG A CZ    1 
ATOM   1425  N  NH1   . ARG A  1  185  ? 32.663  -0.279  144.107 1.00 127.75 ? 185  ARG A NH1   1 
ATOM   1426  N  NH2   . ARG A  1  185  ? 31.933  1.682   145.064 1.00 125.51 ? 185  ARG A NH2   1 
ATOM   1427  N  N     . LEU A  1  186  ? 36.659  5.466   144.303 1.00 97.72  ? 186  LEU A N     1 
ATOM   1428  C  CA    . LEU A  1  186  ? 36.900  6.060   145.605 1.00 110.58 ? 186  LEU A CA    1 
ATOM   1429  C  C     . LEU A  1  186  ? 35.751  5.598   146.517 1.00 118.66 ? 186  LEU A C     1 
ATOM   1430  O  O     . LEU A  1  186  ? 35.477  6.171   147.563 1.00 112.45 ? 186  LEU A O     1 
ATOM   1431  C  CB    . LEU A  1  186  ? 36.997  7.583   145.540 1.00 95.92  ? 186  LEU A CB    1 
ATOM   1432  C  CG    . LEU A  1  186  ? 37.933  8.108   146.640 1.00 102.79 ? 186  LEU A CG    1 
ATOM   1433  C  CD1   . LEU A  1  186  ? 38.912  7.047   147.141 1.00 107.22 ? 186  LEU A CD1   1 
ATOM   1434  C  CD2   . LEU A  1  186  ? 38.674  9.404   146.269 1.00 99.98  ? 186  LEU A CD2   1 
ATOM   1435  N  N     . GLY A  1  187  ? 35.132  4.489   146.108 1.00 117.50 ? 187  GLY A N     1 
ATOM   1436  C  CA    . GLY A  1  187  ? 33.958  3.909   146.735 1.00 112.46 ? 187  GLY A CA    1 
ATOM   1437  C  C     . GLY A  1  187  ? 32.689  4.695   146.496 1.00 119.84 ? 187  GLY A C     1 
ATOM   1438  O  O     . GLY A  1  187  ? 31.683  4.094   146.093 1.00 121.07 ? 187  GLY A O     1 
ATOM   1439  N  N     . GLN A  1  188  ? 32.657  6.006   146.762 1.00 119.28 ? 188  GLN A N     1 
ATOM   1440  C  CA    . GLN A  1  188  ? 31.414  6.704   146.443 1.00 118.45 ? 188  GLN A CA    1 
ATOM   1441  C  C     . GLN A  1  188  ? 31.262  6.695   144.910 1.00 114.32 ? 188  GLN A C     1 
ATOM   1442  O  O     . GLN A  1  188  ? 30.169  6.442   144.391 1.00 103.25 ? 188  GLN A O     1 
ATOM   1443  C  CB    . GLN A  1  188  ? 31.432  8.138   146.995 1.00 117.94 ? 188  GLN A CB    1 
ATOM   1444  C  CG    . GLN A  1  188  ? 32.485  9.078   146.415 1.00 118.61 ? 188  GLN A CG    1 
ATOM   1445  C  CD    . GLN A  1  188  ? 33.823  8.993   147.139 1.00 123.55 ? 188  GLN A CD    1 
ATOM   1446  O  OE1   . GLN A  1  188  ? 33.962  8.292   148.142 1.00 125.70 ? 188  GLN A OE1   1 
ATOM   1447  N  NE2   . GLN A  1  188  ? 34.810  9.721   146.638 1.00 120.97 ? 188  GLN A NE2   1 
ATOM   1448  N  N     . ARG A  1  189  ? 32.358  6.986   144.194 1.00 116.65 ? 189  ARG A N     1 
ATOM   1449  C  CA    . ARG A  1  189  ? 32.350  7.085   142.729 1.00 105.76 ? 189  ARG A CA    1 
ATOM   1450  C  C     . ARG A  1  189  ? 32.856  5.844   142.047 1.00 98.83  ? 189  ARG A C     1 
ATOM   1451  O  O     . ARG A  1  189  ? 33.929  5.342   142.382 1.00 95.31  ? 189  ARG A O     1 
ATOM   1452  C  CB    . ARG A  1  189  ? 33.230  8.239   142.277 1.00 91.05  ? 189  ARG A CB    1 
ATOM   1453  C  CG    . ARG A  1  189  ? 33.071  9.519   143.037 1.00 89.99  ? 189  ARG A CG    1 
ATOM   1454  C  CD    . ARG A  1  189  ? 34.339  10.316  143.019 1.00 85.62  ? 189  ARG A CD    1 
ATOM   1455  N  NE    . ARG A  1  189  ? 33.975  11.727  143.057 1.00 91.52  ? 189  ARG A NE    1 
ATOM   1456  C  CZ    . ARG A  1  189  ? 33.760  12.446  141.963 1.00 100.26 ? 189  ARG A CZ    1 
ATOM   1457  N  NH1   . ARG A  1  189  ? 33.858  11.879  140.764 1.00 97.38  ? 189  ARG A NH1   1 
ATOM   1458  N  NH2   . ARG A  1  189  ? 33.419  13.716  142.064 1.00 106.57 ? 189  ARG A NH2   1 
ATOM   1459  N  N     . THR A  1  190  ? 32.105  5.342   141.084 1.00 97.90  ? 190  THR A N     1 
ATOM   1460  C  CA    . THR A  1  190  ? 32.619  4.262   140.263 1.00 102.74 ? 190  THR A CA    1 
ATOM   1461  C  C     . THR A  1  190  ? 32.973  4.868   138.907 1.00 99.49  ? 190  THR A C     1 
ATOM   1462  O  O     . THR A  1  190  ? 32.724  6.047   138.659 1.00 94.60  ? 190  THR A O     1 
ATOM   1463  C  CB    . THR A  1  190  ? 31.577  3.147   140.071 1.00 101.22 ? 190  THR A CB    1 
ATOM   1464  O  OG1   . THR A  1  190  ? 30.292  3.721   139.786 1.00 92.99  ? 190  THR A OG1   1 
ATOM   1465  C  CG2   . THR A  1  190  ? 31.493  2.286   141.325 1.00 107.46 ? 190  THR A CG2   1 
ATOM   1466  N  N     . ASP A  1  191  ? 33.621  4.058   138.079 1.00 93.74  ? 191  ASP A N     1 
ATOM   1467  C  CA    . ASP A  1  191  ? 34.020  4.413   136.727 1.00 93.75  ? 191  ASP A CA    1 
ATOM   1468  C  C     . ASP A  1  191  ? 35.182  5.396   136.669 1.00 87.84  ? 191  ASP A C     1 
ATOM   1469  O  O     . ASP A  1  191  ? 35.390  6.032   135.643 1.00 87.24  ? 191  ASP A O     1 
ATOM   1470  C  CB    . ASP A  1  191  ? 32.814  4.966   135.935 1.00 100.72 ? 191  ASP A CB    1 
ATOM   1471  C  CG    . ASP A  1  191  ? 32.919  4.733   134.420 1.00 111.38 ? 191  ASP A CG    1 
ATOM   1472  O  OD1   . ASP A  1  191  ? 33.986  4.287   133.924 1.00 101.43 ? 191  ASP A OD1   1 
ATOM   1473  O  OD2   . ASP A  1  191  ? 31.922  5.029   133.716 1.00 110.84 ? 191  ASP A OD2   1 
ATOM   1474  N  N     . LEU A  1  192  ? 35.920  5.514   137.769 1.00 82.80  ? 192  LEU A N     1 
ATOM   1475  C  CA    . LEU A  1  192  ? 37.183  6.244   137.791 1.00 75.79  ? 192  LEU A CA    1 
ATOM   1476  C  C     . LEU A  1  192  ? 38.263  5.441   137.067 1.00 76.13  ? 192  LEU A C     1 
ATOM   1477  O  O     . LEU A  1  192  ? 38.246  4.211   137.094 1.00 79.63  ? 192  LEU A O     1 
ATOM   1478  C  CB    . LEU A  1  192  ? 37.613  6.534   139.229 1.00 80.27  ? 192  LEU A CB    1 
ATOM   1479  C  CG    . LEU A  1  192  ? 36.858  7.655   139.946 1.00 76.38  ? 192  LEU A CG    1 
ATOM   1480  C  CD1   . LEU A  1  192  ? 37.773  8.381   140.920 1.00 69.53  ? 192  LEU A CD1   1 
ATOM   1481  C  CD2   . LEU A  1  192  ? 36.260  8.627   138.941 1.00 69.75  ? 192  LEU A CD2   1 
ATOM   1482  N  N     . ASP A  1  193  ? 39.198  6.130   136.419 1.00 69.15  ? 193  ASP A N     1 
ATOM   1483  C  CA    . ASP A  1  193  ? 40.268  5.451   135.689 1.00 73.08  ? 193  ASP A CA    1 
ATOM   1484  C  C     . ASP A  1  193  ? 41.677  5.854   136.134 1.00 65.41  ? 193  ASP A C     1 
ATOM   1485  O  O     . ASP A  1  193  ? 41.981  7.039   136.268 1.00 62.33  ? 193  ASP A O     1 
ATOM   1486  C  CB    . ASP A  1  193  ? 40.112  5.669   134.181 1.00 74.72  ? 193  ASP A CB    1 
ATOM   1487  C  CG    . ASP A  1  193  ? 39.818  7.113   133.827 1.00 73.24  ? 193  ASP A CG    1 
ATOM   1488  O  OD1   . ASP A  1  193  ? 40.177  8.006   134.622 1.00 80.38  ? 193  ASP A OD1   1 
ATOM   1489  O  OD2   . ASP A  1  193  ? 39.227  7.354   132.754 1.00 62.78  ? 193  ASP A OD2   1 
ATOM   1490  N  N     . LYS A  1  194  ? 42.531  4.857   136.354 1.00 62.83  ? 194  LYS A N     1 
ATOM   1491  C  CA    . LYS A  1  194  ? 43.937  5.090   136.665 1.00 63.18  ? 194  LYS A CA    1 
ATOM   1492  C  C     . LYS A  1  194  ? 44.766  4.956   135.405 1.00 70.19  ? 194  LYS A C     1 
ATOM   1493  O  O     . LYS A  1  194  ? 44.518  4.070   134.570 1.00 68.89  ? 194  LYS A O     1 
ATOM   1494  C  CB    . LYS A  1  194  ? 44.451  4.092   137.701 1.00 61.61  ? 194  LYS A CB    1 
ATOM   1495  C  CG    . LYS A  1  194  ? 44.507  2.665   137.196 1.00 67.92  ? 194  LYS A CG    1 
ATOM   1496  C  CD    . LYS A  1  194  ? 44.967  1.703   138.280 1.00 68.51  ? 194  LYS A CD    1 
ATOM   1497  C  CE    . LYS A  1  194  ? 46.397  1.976   138.699 1.00 67.75  ? 194  LYS A CE    1 
ATOM   1498  N  NZ    . LYS A  1  194  ? 46.917  0.862   139.544 1.00 63.49  ? 194  LYS A NZ    1 
ATOM   1499  N  N     . LEU A  1  195  ? 45.762  5.829   135.286 1.00 65.81  ? 195  LEU A N     1 
ATOM   1500  C  CA    . LEU A  1  195  ? 46.571  5.901   134.081 1.00 57.68  ? 195  LEU A CA    1 
ATOM   1501  C  C     . LEU A  1  195  ? 48.003  5.462   134.333 1.00 61.33  ? 195  LEU A C     1 
ATOM   1502  O  O     . LEU A  1  195  ? 48.640  5.909   135.283 1.00 60.94  ? 195  LEU A O     1 
ATOM   1503  C  CB    . LEU A  1  195  ? 46.576  7.329   133.555 1.00 53.78  ? 195  LEU A CB    1 
ATOM   1504  C  CG    . LEU A  1  195  ? 47.575  7.568   132.434 1.00 58.28  ? 195  LEU A CG    1 
ATOM   1505  C  CD1   . LEU A  1  195  ? 47.195  6.726   131.222 1.00 56.67  ? 195  LEU A CD1   1 
ATOM   1506  C  CD2   . LEU A  1  195  ? 47.639  9.048   132.092 1.00 58.27  ? 195  LEU A CD2   1 
ATOM   1507  N  N     . THR A  1  196  ? 48.523  4.599   133.470 1.00 66.00  ? 196  THR A N     1 
ATOM   1508  C  CA    . THR A  1  196  ? 49.915  4.190   133.597 1.00 64.30  ? 196  THR A CA    1 
ATOM   1509  C  C     . THR A  1  196  ? 50.677  4.349   132.284 1.00 66.92  ? 196  THR A C     1 
ATOM   1510  O  O     . THR A  1  196  ? 50.339  3.728   131.282 1.00 69.46  ? 196  THR A O     1 
ATOM   1511  C  CB    . THR A  1  196  ? 50.035  2.744   134.080 1.00 65.71  ? 196  THR A CB    1 
ATOM   1512  O  OG1   . THR A  1  196  ? 49.106  2.518   135.147 1.00 75.91  ? 196  THR A OG1   1 
ATOM   1513  C  CG2   . THR A  1  196  ? 51.448  2.472   134.566 1.00 65.53  ? 196  THR A CG2   1 
ATOM   1514  N  N     . LEU A  1  197  ? 51.703  5.192   132.297 1.00 61.28  ? 197  LEU A N     1 
ATOM   1515  C  CA    . LEU A  1  197  ? 52.555  5.373   131.136 1.00 57.46  ? 197  LEU A CA    1 
ATOM   1516  C  C     . LEU A  1  197  ? 53.779  4.489   131.266 1.00 66.16  ? 197  LEU A C     1 
ATOM   1517  O  O     . LEU A  1  197  ? 54.620  4.718   132.133 1.00 69.92  ? 197  LEU A O     1 
ATOM   1518  C  CB    . LEU A  1  197  ? 53.000  6.827   131.023 1.00 56.83  ? 197  LEU A CB    1 
ATOM   1519  C  CG    . LEU A  1  197  ? 51.979  7.814   130.472 1.00 58.51  ? 197  LEU A CG    1 
ATOM   1520  C  CD1   . LEU A  1  197  ? 52.509  9.237   130.575 1.00 56.71  ? 197  LEU A CD1   1 
ATOM   1521  C  CD2   . LEU A  1  197  ? 51.652  7.459   129.037 1.00 57.03  ? 197  LEU A CD2   1 
ATOM   1522  N  N     . ARG A  1  198  ? 53.882  3.498   130.387 1.00 61.60  ? 198  ARG A N     1 
ATOM   1523  C  CA    . ARG A  1  198  ? 55.058  2.650   130.335 1.00 55.68  ? 198  ARG A CA    1 
ATOM   1524  C  C     . ARG A  1  198  ? 55.943  3.208   129.237 1.00 58.46  ? 198  ARG A C     1 
ATOM   1525  O  O     . ARG A  1  198  ? 55.512  3.364   128.096 1.00 64.52  ? 198  ARG A O     1 
ATOM   1526  C  CB    . ARG A  1  198  ? 54.670  1.205   130.025 1.00 51.87  ? 198  ARG A CB    1 
ATOM   1527  C  CG    . ARG A  1  198  ? 53.266  0.831   130.472 1.00 55.71  ? 198  ARG A CG    1 
ATOM   1528  C  CD    . ARG A  1  198  ? 53.230  -0.569  131.061 1.00 60.57  ? 198  ARG A CD    1 
ATOM   1529  N  NE    . ARG A  1  198  ? 53.158  -1.596  130.025 1.00 56.39  ? 198  ARG A NE    1 
ATOM   1530  C  CZ    . ARG A  1  198  ? 54.024  -2.596  129.905 1.00 68.47  ? 198  ARG A CZ    1 
ATOM   1531  N  NH1   . ARG A  1  198  ? 53.881  -3.485  128.932 1.00 82.74  ? 198  ARG A NH1   1 
ATOM   1532  N  NH2   . ARG A  1  198  ? 55.033  -2.709  130.757 1.00 61.92  ? 198  ARG A NH2   1 
ATOM   1533  N  N     . ILE A  1  199  ? 57.182  3.521   129.593 1.00 58.63  ? 199  ILE A N     1 
ATOM   1534  C  CA    . ILE A  1  199  ? 58.080  4.231   128.688 1.00 53.55  ? 199  ILE A CA    1 
ATOM   1535  C  C     . ILE A  1  199  ? 59.468  3.604   128.644 1.00 62.35  ? 199  ILE A C     1 
ATOM   1536  O  O     . ILE A  1  199  ? 60.172  3.549   129.661 1.00 64.80  ? 199  ILE A O     1 
ATOM   1537  C  CB    . ILE A  1  199  ? 58.226  5.706   129.096 1.00 48.66  ? 199  ILE A CB    1 
ATOM   1538  C  CG1   . ILE A  1  199  ? 56.878  6.416   129.017 1.00 51.71  ? 199  ILE A CG1   1 
ATOM   1539  C  CG2   . ILE A  1  199  ? 59.227  6.403   128.208 1.00 59.67  ? 199  ILE A CG2   1 
ATOM   1540  C  CD1   . ILE A  1  199  ? 56.943  7.875   129.371 1.00 48.35  ? 199  ILE A CD1   1 
ATOM   1541  N  N     . TRP A  1  200  ? 59.855  3.136   127.459 1.00 60.60  ? 200  TRP A N     1 
ATOM   1542  C  CA    . TRP A  1  200  ? 61.187  2.590   127.245 1.00 56.97  ? 200  TRP A CA    1 
ATOM   1543  C  C     . TRP A  1  200  ? 62.104  3.613   126.584 1.00 60.03  ? 200  TRP A C     1 
ATOM   1544  O  O     . TRP A  1  200  ? 61.656  4.445   125.798 1.00 58.53  ? 200  TRP A O     1 
ATOM   1545  C  CB    . TRP A  1  200  ? 61.119  1.358   126.362 1.00 50.88  ? 200  TRP A CB    1 
ATOM   1546  C  CG    . TRP A  1  200  ? 60.358  0.215   126.929 1.00 54.55  ? 200  TRP A CG    1 
ATOM   1547  C  CD1   . TRP A  1  200  ? 60.876  -0.923  127.474 1.00 54.56  ? 200  TRP A CD1   1 
ATOM   1548  C  CD2   . TRP A  1  200  ? 58.935  0.070   126.973 1.00 59.38  ? 200  TRP A CD2   1 
ATOM   1549  N  NE1   . TRP A  1  200  ? 59.864  -1.764  127.862 1.00 54.48  ? 200  TRP A NE1   1 
ATOM   1550  C  CE2   . TRP A  1  200  ? 58.661  -1.179  127.565 1.00 59.56  ? 200  TRP A CE2   1 
ATOM   1551  C  CE3   . TRP A  1  200  ? 57.865  0.874   126.571 1.00 58.84  ? 200  TRP A CE3   1 
ATOM   1552  C  CZ2   . TRP A  1  200  ? 57.359  -1.643  127.765 1.00 57.96  ? 200  TRP A CZ2   1 
ATOM   1553  C  CZ3   . TRP A  1  200  ? 56.575  0.413   126.772 1.00 53.54  ? 200  TRP A CZ3   1 
ATOM   1554  C  CH2   . TRP A  1  200  ? 56.334  -0.833  127.362 1.00 55.05  ? 200  TRP A CH2   1 
ATOM   1555  N  N     . THR A  1  201  ? 63.395  3.530   126.887 1.00 65.50  ? 201  THR A N     1 
ATOM   1556  C  CA    . THR A  1  201  ? 64.371  4.479   126.362 1.00 63.23  ? 201  THR A CA    1 
ATOM   1557  C  C     . THR A  1  201  ? 65.687  3.781   126.010 1.00 69.64  ? 201  THR A C     1 
ATOM   1558  O  O     . THR A  1  201  ? 65.928  2.649   126.432 1.00 73.27  ? 201  THR A O     1 
ATOM   1559  C  CB    . THR A  1  201  ? 64.621  5.614   127.378 1.00 65.87  ? 201  THR A CB    1 
ATOM   1560  O  OG1   . THR A  1  201  ? 63.427  6.396   127.516 1.00 66.32  ? 201  THR A OG1   1 
ATOM   1561  C  CG2   . THR A  1  201  ? 65.735  6.513   126.916 1.00 68.43  ? 201  THR A CG2   1 
ATOM   1562  N  N     . ASP A  1  202  ? 66.521  4.448   125.216 1.00 66.33  ? 202  ASP A N     1 
ATOM   1563  C  CA    . ASP A  1  202  ? 67.854  3.941   124.900 1.00 66.27  ? 202  ASP A CA    1 
ATOM   1564  C  C     . ASP A  1  202  ? 68.813  4.150   126.070 1.00 70.37  ? 202  ASP A C     1 
ATOM   1565  O  O     . ASP A  1  202  ? 69.895  3.559   126.114 1.00 72.37  ? 202  ASP A O     1 
ATOM   1566  C  CB    . ASP A  1  202  ? 68.409  4.604   123.633 1.00 71.13  ? 202  ASP A CB    1 
ATOM   1567  C  CG    . ASP A  1  202  ? 68.482  6.123   123.739 1.00 70.62  ? 202  ASP A CG    1 
ATOM   1568  O  OD1   . ASP A  1  202  ? 68.407  6.651   124.866 1.00 69.26  ? 202  ASP A OD1   1 
ATOM   1569  O  OD2   . ASP A  1  202  ? 68.624  6.791   122.689 1.00 69.93  ? 202  ASP A OD2   1 
ATOM   1570  N  N     . GLY A  1  203  ? 68.409  4.997   127.013 1.00 67.05  ? 203  GLY A N     1 
ATOM   1571  C  CA    . GLY A  1  203  ? 69.215  5.269   128.185 1.00 63.02  ? 203  GLY A CA    1 
ATOM   1572  C  C     . GLY A  1  203  ? 69.889  6.626   128.157 1.00 63.00  ? 203  GLY A C     1 
ATOM   1573  O  O     . GLY A  1  203  ? 70.379  7.095   129.180 1.00 63.26  ? 203  GLY A O     1 
ATOM   1574  N  N     . SER A  1  204  ? 69.926  7.261   126.990 1.00 66.58  ? 204  SER A N     1 
ATOM   1575  C  CA    . SER A  1  204  ? 70.566  8.567   126.872 1.00 68.03  ? 204  SER A CA    1 
ATOM   1576  C  C     . SER A  1  204  ? 69.795  9.600   127.686 1.00 62.67  ? 204  SER A C     1 
ATOM   1577  O  O     . SER A  1  204  ? 70.383  10.433  128.368 1.00 67.84  ? 204  SER A O     1 
ATOM   1578  C  CB    . SER A  1  204  ? 70.706  8.994   125.405 1.00 67.16  ? 204  SER A CB    1 
ATOM   1579  O  OG    . SER A  1  204  ? 69.467  8.948   124.722 1.00 73.10  ? 204  SER A OG    1 
ATOM   1580  N  N     . VAL A  1  205  ? 68.474  9.546   127.603 1.00 58.67  ? 205  VAL A N     1 
ATOM   1581  C  CA    . VAL A  1  205  ? 67.644  10.230  128.580 1.00 67.52  ? 205  VAL A CA    1 
ATOM   1582  C  C     . VAL A  1  205  ? 66.796  9.171   129.269 1.00 69.50  ? 205  VAL A C     1 
ATOM   1583  O  O     . VAL A  1  205  ? 66.781  8.015   128.858 1.00 64.12  ? 205  VAL A O     1 
ATOM   1584  C  CB    . VAL A  1  205  ? 66.751  11.320  127.967 1.00 59.54  ? 205  VAL A CB    1 
ATOM   1585  C  CG1   . VAL A  1  205  ? 67.500  12.067  126.880 1.00 60.23  ? 205  VAL A CG1   1 
ATOM   1586  C  CG2   . VAL A  1  205  ? 65.487  10.714  127.432 1.00 60.14  ? 205  VAL A CG2   1 
ATOM   1587  N  N     . THR A  1  206  ? 66.094  9.572   130.318 1.00 72.89  ? 206  THR A N     1 
ATOM   1588  C  CA    . THR A  1  206  ? 65.432  8.625   131.195 1.00 67.08  ? 206  THR A CA    1 
ATOM   1589  C  C     . THR A  1  206  ? 63.928  8.690   131.034 1.00 64.76  ? 206  THR A C     1 
ATOM   1590  O  O     . THR A  1  206  ? 63.373  9.775   130.856 1.00 63.60  ? 206  THR A O     1 
ATOM   1591  C  CB    . THR A  1  206  ? 65.816  8.903   132.652 1.00 69.44  ? 206  THR A CB    1 
ATOM   1592  O  OG1   . THR A  1  206  ? 67.108  8.336   132.908 1.00 70.57  ? 206  THR A OG1   1 
ATOM   1593  C  CG2   . THR A  1  206  ? 64.792  8.311   133.616 1.00 73.01  ? 206  THR A CG2   1 
ATOM   1594  N  N     . PRO A  1  207  ? 63.261  7.523   131.086 1.00 63.22  ? 207  PRO A N     1 
ATOM   1595  C  CA    . PRO A  1  207  ? 61.804  7.520   130.959 1.00 64.53  ? 207  PRO A CA    1 
ATOM   1596  C  C     . PRO A  1  207  ? 61.211  8.724   131.679 1.00 63.58  ? 207  PRO A C     1 
ATOM   1597  O  O     . PRO A  1  207  ? 60.378  9.422   131.106 1.00 62.24  ? 207  PRO A O     1 
ATOM   1598  C  CB    . PRO A  1  207  ? 61.405  6.214   131.649 1.00 62.83  ? 207  PRO A CB    1 
ATOM   1599  C  CG    . PRO A  1  207  ? 62.558  5.297   131.368 1.00 60.91  ? 207  PRO A CG    1 
ATOM   1600  C  CD    . PRO A  1  207  ? 63.795  6.172   131.347 1.00 61.75  ? 207  PRO A CD    1 
ATOM   1601  N  N     . LEU A  1  208  ? 61.664  8.983   132.904 1.00 63.06  ? 208  LEU A N     1 
ATOM   1602  C  CA    . LEU A  1  208  ? 61.195  10.140  133.655 1.00 60.95  ? 208  LEU A CA    1 
ATOM   1603  C  C     . LEU A  1  208  ? 61.548  11.457  132.968 1.00 58.53  ? 208  LEU A C     1 
ATOM   1604  O  O     . LEU A  1  208  ? 60.671  12.279  132.707 1.00 58.41  ? 208  LEU A O     1 
ATOM   1605  C  CB    . LEU A  1  208  ? 61.754  10.143  135.076 1.00 67.99  ? 208  LEU A CB    1 
ATOM   1606  C  CG    . LEU A  1  208  ? 61.263  11.333  135.910 1.00 60.20  ? 208  LEU A CG    1 
ATOM   1607  C  CD1   . LEU A  1  208  ? 60.007  10.970  136.671 1.00 43.06  ? 208  LEU A CD1   1 
ATOM   1608  C  CD2   . LEU A  1  208  ? 62.348  11.821  136.857 1.00 62.61  ? 208  LEU A CD2   1 
ATOM   1609  N  N     . GLU A  1  209  ? 62.832  11.663  132.686 1.00 59.77  ? 209  GLU A N     1 
ATOM   1610  C  CA    . GLU A  1  209  ? 63.263  12.884  132.016 1.00 62.72  ? 209  GLU A CA    1 
ATOM   1611  C  C     . GLU A  1  209  ? 62.394  13.097  130.784 1.00 63.61  ? 209  GLU A C     1 
ATOM   1612  O  O     . GLU A  1  209  ? 61.876  14.195  130.544 1.00 60.93  ? 209  GLU A O     1 
ATOM   1613  C  CB    . GLU A  1  209  ? 64.729  12.782  131.604 1.00 64.03  ? 209  GLU A CB    1 
ATOM   1614  C  CG    . GLU A  1  209  ? 65.651  12.240  132.681 1.00 65.83  ? 209  GLU A CG    1 
ATOM   1615  C  CD    . GLU A  1  209  ? 67.117  12.317  132.279 1.00 81.44  ? 209  GLU A CD    1 
ATOM   1616  O  OE1   . GLU A  1  209  ? 67.925  11.493  132.763 1.00 77.08  ? 209  GLU A OE1   1 
ATOM   1617  O  OE2   . GLU A  1  209  ? 67.460  13.209  131.473 1.00 93.41  ? 209  GLU A OE2   1 
ATOM   1618  N  N     . ALA A  1  210  ? 62.234  12.026  130.012 1.00 60.28  ? 210  ALA A N     1 
ATOM   1619  C  CA    . ALA A  1  210  ? 61.387  12.038  128.830 1.00 57.68  ? 210  ALA A CA    1 
ATOM   1620  C  C     . ALA A  1  210  ? 60.008  12.589  129.160 1.00 58.31  ? 210  ALA A C     1 
ATOM   1621  O  O     . ALA A  1  210  ? 59.571  13.583  128.577 1.00 50.67  ? 210  ALA A O     1 
ATOM   1622  C  CB    . ALA A  1  210  ? 61.269  10.633  128.259 1.00 58.79  ? 210  ALA A CB    1 
ATOM   1623  N  N     . LEU A  1  211  ? 59.331  11.935  130.102 1.00 62.32  ? 211  LEU A N     1 
ATOM   1624  C  CA    . LEU A  1  211  ? 57.991  12.333  130.520 1.00 58.08  ? 211  LEU A CA    1 
ATOM   1625  C  C     . LEU A  1  211  ? 57.928  13.823  130.831 1.00 58.91  ? 211  LEU A C     1 
ATOM   1626  O  O     . LEU A  1  211  ? 57.132  14.555  130.250 1.00 59.19  ? 211  LEU A O     1 
ATOM   1627  C  CB    . LEU A  1  211  ? 57.540  11.514  131.730 1.00 54.58  ? 211  LEU A CB    1 
ATOM   1628  C  CG    . LEU A  1  211  ? 56.196  11.876  132.372 1.00 63.16  ? 211  LEU A CG    1 
ATOM   1629  C  CD1   . LEU A  1  211  ? 55.100  12.018  131.331 1.00 55.72  ? 211  LEU A CD1   1 
ATOM   1630  C  CD2   . LEU A  1  211  ? 55.808  10.844  133.428 1.00 65.37  ? 211  LEU A CD2   1 
ATOM   1631  N  N     . ASN A  1  212  ? 58.786  14.271  131.737 1.00 57.45  ? 212  ASN A N     1 
ATOM   1632  C  CA    . ASN A  1  212  ? 58.809  15.676  132.112 1.00 58.84  ? 212  ASN A CA    1 
ATOM   1633  C  C     . ASN A  1  212  ? 58.962  16.599  130.903 1.00 60.53  ? 212  ASN A C     1 
ATOM   1634  O  O     . ASN A  1  212  ? 58.240  17.594  130.778 1.00 59.14  ? 212  ASN A O     1 
ATOM   1635  C  CB    . ASN A  1  212  ? 59.893  15.933  133.161 1.00 59.63  ? 212  ASN A CB    1 
ATOM   1636  C  CG    . ASN A  1  212  ? 59.679  15.112  134.425 1.00 60.75  ? 212  ASN A CG    1 
ATOM   1637  O  OD1   . ASN A  1  212  ? 60.599  14.470  134.932 1.00 60.79  ? 212  ASN A OD1   1 
ATOM   1638  N  ND2   . ASN A  1  212  ? 58.450  15.120  134.929 1.00 58.15  ? 212  ASN A ND2   1 
ATOM   1639  N  N     . GLN A  1  213  ? 59.880  16.261  130.002 1.00 58.76  ? 213  GLN A N     1 
ATOM   1640  C  CA    . GLN A  1  213  ? 60.054  17.059  128.794 1.00 55.56  ? 213  GLN A CA    1 
ATOM   1641  C  C     . GLN A  1  213  ? 58.765  17.098  127.973 1.00 57.00  ? 213  GLN A C     1 
ATOM   1642  O  O     . GLN A  1  213  ? 58.384  18.143  127.443 1.00 54.60  ? 213  GLN A O     1 
ATOM   1643  C  CB    . GLN A  1  213  ? 61.210  16.520  127.961 1.00 56.93  ? 213  GLN A CB    1 
ATOM   1644  C  CG    . GLN A  1  213  ? 62.531  16.517  128.701 1.00 64.36  ? 213  GLN A CG    1 
ATOM   1645  C  CD    . GLN A  1  213  ? 63.714  16.286  127.787 1.00 70.65  ? 213  GLN A CD    1 
ATOM   1646  O  OE1   . GLN A  1  213  ? 63.967  17.070  126.869 1.00 73.88  ? 213  GLN A OE1   1 
ATOM   1647  N  NE2   . GLN A  1  213  ? 64.450  15.205  128.032 1.00 70.59  ? 213  GLN A NE2   1 
ATOM   1648  N  N     . ALA A  1  214  ? 58.092  15.955  127.889 1.00 54.92  ? 214  ALA A N     1 
ATOM   1649  C  CA    . ALA A  1  214  ? 56.824  15.846  127.179 1.00 54.54  ? 214  ALA A CA    1 
ATOM   1650  C  C     . ALA A  1  214  ? 55.770  16.790  127.761 1.00 55.75  ? 214  ALA A C     1 
ATOM   1651  O  O     . ALA A  1  214  ? 55.127  17.561  127.036 1.00 50.68  ? 214  ALA A O     1 
ATOM   1652  C  CB    . ALA A  1  214  ? 56.329  14.407  127.217 1.00 50.39  ? 214  ALA A CB    1 
ATOM   1653  N  N     . VAL A  1  215  ? 55.592  16.724  129.076 1.00 58.33  ? 215  VAL A N     1 
ATOM   1654  C  CA    . VAL A  1  215  ? 54.615  17.575  129.739 1.00 61.10  ? 215  VAL A CA    1 
ATOM   1655  C  C     . VAL A  1  215  ? 54.949  19.038  129.485 1.00 58.54  ? 215  VAL A C     1 
ATOM   1656  O  O     . VAL A  1  215  ? 54.085  19.824  129.092 1.00 58.53  ? 215  VAL A O     1 
ATOM   1657  C  CB    . VAL A  1  215  ? 54.545  17.317  131.259 1.00 58.01  ? 215  VAL A CB    1 
ATOM   1658  C  CG1   . VAL A  1  215  ? 53.115  17.417  131.731 1.00 51.61  ? 215  VAL A CG1   1 
ATOM   1659  C  CG2   . VAL A  1  215  ? 55.100  15.948  131.593 1.00 60.97  ? 215  VAL A CG2   1 
ATOM   1660  N  N     . GLU A  1  216  ? 56.207  19.403  129.701 1.00 55.88  ? 216  GLU A N     1 
ATOM   1661  C  CA    . GLU A  1  216  ? 56.618  20.776  129.456 1.00 56.86  ? 216  GLU A CA    1 
ATOM   1662  C  C     . GLU A  1  216  ? 56.243  21.207  128.036 1.00 61.64  ? 216  GLU A C     1 
ATOM   1663  O  O     . GLU A  1  216  ? 55.675  22.283  127.840 1.00 62.38  ? 216  GLU A O     1 
ATOM   1664  C  CB    . GLU A  1  216  ? 58.112  20.958  129.719 1.00 60.51  ? 216  GLU A CB    1 
ATOM   1665  C  CG    . GLU A  1  216  ? 58.626  22.376  129.470 1.00 66.37  ? 216  GLU A CG    1 
ATOM   1666  C  CD    . GLU A  1  216  ? 57.829  23.440  130.215 1.00 73.53  ? 216  GLU A CD    1 
ATOM   1667  O  OE1   . GLU A  1  216  ? 57.202  23.114  131.254 1.00 73.76  ? 216  GLU A OE1   1 
ATOM   1668  O  OE2   . GLU A  1  216  ? 57.826  24.605  129.752 1.00 67.15  ? 216  GLU A OE2   1 
ATOM   1669  N  N     . ILE A  1  217  ? 56.543  20.360  127.052 1.00 59.60  ? 217  ILE A N     1 
ATOM   1670  C  CA    . ILE A  1  217  ? 56.172  20.640  125.662 1.00 60.26  ? 217  ILE A CA    1 
ATOM   1671  C  C     . ILE A  1  217  ? 54.678  20.913  125.533 1.00 55.58  ? 217  ILE A C     1 
ATOM   1672  O  O     . ILE A  1  217  ? 54.261  21.910  124.932 1.00 52.97  ? 217  ILE A O     1 
ATOM   1673  C  CB    . ILE A  1  217  ? 56.538  19.473  124.724 1.00 56.22  ? 217  ILE A CB    1 
ATOM   1674  C  CG1   . ILE A  1  217  ? 58.055  19.346  124.598 1.00 53.87  ? 217  ILE A CG1   1 
ATOM   1675  C  CG2   . ILE A  1  217  ? 55.917  19.671  123.350 1.00 48.46  ? 217  ILE A CG2   1 
ATOM   1676  C  CD1   . ILE A  1  217  ? 58.494  18.131  123.816 1.00 55.76  ? 217  ILE A CD1   1 
ATOM   1677  N  N     . LEU A  1  218  ? 53.876  20.023  126.107 1.00 51.68  ? 218  LEU A N     1 
ATOM   1678  C  CA    . LEU A  1  218  ? 52.428  20.140  126.016 1.00 52.41  ? 218  LEU A CA    1 
ATOM   1679  C  C     . LEU A  1  218  ? 51.907  21.443  126.632 1.00 59.44  ? 218  LEU A C     1 
ATOM   1680  O  O     . LEU A  1  218  ? 51.169  22.184  125.974 1.00 55.39  ? 218  LEU A O     1 
ATOM   1681  C  CB    . LEU A  1  218  ? 51.748  18.918  126.641 1.00 55.07  ? 218  LEU A CB    1 
ATOM   1682  C  CG    . LEU A  1  218  ? 50.225  18.783  126.490 1.00 53.09  ? 218  LEU A CG    1 
ATOM   1683  C  CD1   . LEU A  1  218  ? 49.733  19.363  125.176 1.00 46.87  ? 218  LEU A CD1   1 
ATOM   1684  C  CD2   . LEU A  1  218  ? 49.788  17.331  126.632 1.00 44.52  ? 218  LEU A CD2   1 
ATOM   1685  N  N     . ARG A  1  219  ? 52.293  21.726  127.878 1.00 57.43  ? 219  ARG A N     1 
ATOM   1686  C  CA    . ARG A  1  219  ? 51.829  22.937  128.551 1.00 59.55  ? 219  ARG A CA    1 
ATOM   1687  C  C     . ARG A  1  219  ? 52.272  24.166  127.777 1.00 61.21  ? 219  ARG A C     1 
ATOM   1688  O  O     . ARG A  1  219  ? 51.482  25.084  127.521 1.00 64.81  ? 219  ARG A O     1 
ATOM   1689  C  CB    . ARG A  1  219  ? 52.322  23.014  130.000 1.00 62.74  ? 219  ARG A CB    1 
ATOM   1690  C  CG    . ARG A  1  219  ? 53.831  23.172  130.171 1.00 70.00  ? 219  ARG A CG    1 
ATOM   1691  C  CD    . ARG A  1  219  ? 54.190  24.000  131.420 1.00 62.99  ? 219  ARG A CD    1 
ATOM   1692  N  NE    . ARG A  1  219  ? 53.926  25.426  131.222 1.00 65.34  ? 219  ARG A NE    1 
ATOM   1693  C  CZ    . ARG A  1  219  ? 54.798  26.285  130.696 1.00 63.86  ? 219  ARG A CZ    1 
ATOM   1694  N  NH1   . ARG A  1  219  ? 54.470  27.563  130.550 1.00 63.30  ? 219  ARG A NH1   1 
ATOM   1695  N  NH2   . ARG A  1  219  ? 56.000  25.870  130.313 1.00 50.98  ? 219  ARG A NH2   1 
ATOM   1696  N  N     . GLU A  1  220  ? 53.542  24.167  127.395 1.00 58.61  ? 220  GLU A N     1 
ATOM   1697  C  CA    . GLU A  1  220  ? 54.083  25.235  126.580 1.00 61.98  ? 220  GLU A CA    1 
ATOM   1698  C  C     . GLU A  1  220  ? 53.184  25.449  125.368 1.00 60.79  ? 220  GLU A C     1 
ATOM   1699  O  O     . GLU A  1  220  ? 52.944  26.582  124.955 1.00 57.69  ? 220  GLU A O     1 
ATOM   1700  C  CB    . GLU A  1  220  ? 55.506  24.895  126.150 1.00 59.68  ? 220  GLU A CB    1 
ATOM   1701  C  CG    . GLU A  1  220  ? 56.230  26.027  125.446 1.00 69.76  ? 220  GLU A CG    1 
ATOM   1702  C  CD    . GLU A  1  220  ? 57.623  25.629  125.002 1.00 90.08  ? 220  GLU A CD    1 
ATOM   1703  O  OE1   . GLU A  1  220  ? 58.316  24.919  125.768 1.00 92.04  ? 220  GLU A OE1   1 
ATOM   1704  O  OE2   . GLU A  1  220  ? 58.019  26.019  123.882 1.00 97.05  ? 220  GLU A OE2   1 
ATOM   1705  N  N     . HIS A  1  221  ? 52.672  24.358  124.808 1.00 56.45  ? 221  HIS A N     1 
ATOM   1706  C  CA    . HIS A  1  221  ? 51.773  24.465  123.668 1.00 60.19  ? 221  HIS A CA    1 
ATOM   1707  C  C     . HIS A  1  221  ? 50.444  25.092  124.061 1.00 66.04  ? 221  HIS A C     1 
ATOM   1708  O  O     . HIS A  1  221  ? 49.899  25.922  123.332 1.00 66.34  ? 221  HIS A O     1 
ATOM   1709  C  CB    . HIS A  1  221  ? 51.544  23.103  123.016 1.00 61.61  ? 221  HIS A CB    1 
ATOM   1710  C  CG    . HIS A  1  221  ? 52.506  22.798  121.911 1.00 61.61  ? 221  HIS A CG    1 
ATOM   1711  N  ND1   . HIS A  1  221  ? 53.735  22.217  122.134 1.00 59.30  ? 221  HIS A ND1   1 
ATOM   1712  C  CD2   . HIS A  1  221  ? 52.423  23.008  120.577 1.00 59.50  ? 221  HIS A CD2   1 
ATOM   1713  C  CE1   . HIS A  1  221  ? 54.366  22.076  120.982 1.00 60.40  ? 221  HIS A CE1   1 
ATOM   1714  N  NE2   . HIS A  1  221  ? 53.591  22.548  120.023 1.00 61.74  ? 221  HIS A NE2   1 
ATOM   1715  N  N     . LEU A  1  222  ? 49.922  24.690  125.214 1.00 65.55  ? 222  LEU A N     1 
ATOM   1716  C  CA    . LEU A  1  222  ? 48.687  25.269  125.721 1.00 63.80  ? 222  LEU A CA    1 
ATOM   1717  C  C     . LEU A  1  222  ? 48.825  26.786  125.848 1.00 67.34  ? 222  LEU A C     1 
ATOM   1718  O  O     . LEU A  1  222  ? 47.854  27.527  125.679 1.00 68.78  ? 222  LEU A O     1 
ATOM   1719  C  CB    . LEU A  1  222  ? 48.312  24.629  127.057 1.00 59.02  ? 222  LEU A CB    1 
ATOM   1720  C  CG    . LEU A  1  222  ? 47.901  23.158  126.929 1.00 62.50  ? 222  LEU A CG    1 
ATOM   1721  C  CD1   . LEU A  1  222  ? 47.961  22.447  128.262 1.00 56.46  ? 222  LEU A CD1   1 
ATOM   1722  C  CD2   . LEU A  1  222  ? 46.513  23.025  126.312 1.00 60.61  ? 222  LEU A CD2   1 
ATOM   1723  N  N     . THR A  1  223  ? 50.043  27.241  126.130 1.00 64.66  ? 223  THR A N     1 
ATOM   1724  C  CA    . THR A  1  223  ? 50.343  28.671  126.152 1.00 63.95  ? 223  THR A CA    1 
ATOM   1725  C  C     . THR A  1  223  ? 49.897  29.388  124.879 1.00 74.64  ? 223  THR A C     1 
ATOM   1726  O  O     . THR A  1  223  ? 49.412  30.517  124.933 1.00 76.84  ? 223  THR A O     1 
ATOM   1727  C  CB    . THR A  1  223  ? 51.845  28.913  126.316 1.00 65.30  ? 223  THR A CB    1 
ATOM   1728  O  OG1   . THR A  1  223  ? 52.269  28.432  127.595 1.00 62.61  ? 223  THR A OG1   1 
ATOM   1729  C  CG2   . THR A  1  223  ? 52.164  30.397  126.192 1.00 72.26  ? 223  THR A CG2   1 
ATOM   1730  N  N     . TYR A  1  224  ? 50.065  28.728  123.735 1.00 78.51  ? 224  TYR A N     1 
ATOM   1731  C  CA    . TYR A  1  224  ? 49.817  29.347  122.430 1.00 74.71  ? 224  TYR A CA    1 
ATOM   1732  C  C     . TYR A  1  224  ? 48.366  29.799  122.239 1.00 76.44  ? 224  TYR A C     1 
ATOM   1733  O  O     . TYR A  1  224  ? 48.060  30.547  121.306 1.00 75.60  ? 224  TYR A O     1 
ATOM   1734  C  CB    . TYR A  1  224  ? 50.232  28.399  121.298 1.00 66.61  ? 224  TYR A CB    1 
ATOM   1735  C  CG    . TYR A  1  224  ? 51.674  27.938  121.371 1.00 71.70  ? 224  TYR A CG    1 
ATOM   1736  C  CD1   . TYR A  1  224  ? 52.667  28.767  121.877 1.00 69.42  ? 224  TYR A CD1   1 
ATOM   1737  C  CD2   . TYR A  1  224  ? 52.044  26.669  120.935 1.00 71.33  ? 224  TYR A CD2   1 
ATOM   1738  C  CE1   . TYR A  1  224  ? 53.988  28.349  121.945 1.00 64.95  ? 224  TYR A CE1   1 
ATOM   1739  C  CE2   . TYR A  1  224  ? 53.362  26.242  121.000 1.00 63.65  ? 224  TYR A CE2   1 
ATOM   1740  C  CZ    . TYR A  1  224  ? 54.329  27.088  121.505 1.00 65.89  ? 224  TYR A CZ    1 
ATOM   1741  O  OH    . TYR A  1  224  ? 55.642  26.672  121.578 1.00 65.97  ? 224  TYR A OH    1 
ATOM   1742  N  N     . PHE A  1  225  ? 47.480  29.348  123.126 1.00 70.24  ? 225  PHE A N     1 
ATOM   1743  C  CA    . PHE A  1  225  ? 46.069  29.720  123.056 1.00 78.49  ? 225  PHE A CA    1 
ATOM   1744  C  C     . PHE A  1  225  ? 45.806  31.059  123.742 1.00 83.39  ? 225  PHE A C     1 
ATOM   1745  O  O     . PHE A  1  225  ? 44.658  31.476  123.904 1.00 79.65  ? 225  PHE A O     1 
ATOM   1746  C  CB    . PHE A  1  225  ? 45.191  28.632  123.681 1.00 73.95  ? 225  PHE A CB    1 
ATOM   1747  C  CG    . PHE A  1  225  ? 45.052  27.395  122.832 1.00 75.65  ? 225  PHE A CG    1 
ATOM   1748  C  CD1   . PHE A  1  225  ? 45.946  26.343  122.959 1.00 75.08  ? 225  PHE A CD1   1 
ATOM   1749  C  CD2   . PHE A  1  225  ? 44.022  27.281  121.905 1.00 73.82  ? 225  PHE A CD2   1 
ATOM   1750  C  CE1   . PHE A  1  225  ? 45.817  25.203  122.174 1.00 70.69  ? 225  PHE A CE1   1 
ATOM   1751  C  CE2   . PHE A  1  225  ? 43.890  26.142  121.115 1.00 59.12  ? 225  PHE A CE2   1 
ATOM   1752  C  CZ    . PHE A  1  225  ? 44.785  25.106  121.251 1.00 60.02  ? 225  PHE A CZ    1 
ATOM   1753  N  N     . SER A  1  226  ? 46.883  31.734  124.126 1.00 83.28  ? 226  SER A N     1 
ATOM   1754  C  CA    . SER A  1  226  ? 46.791  32.960  124.912 1.00 89.99  ? 226  SER A CA    1 
ATOM   1755  C  C     . SER A  1  226  ? 46.224  34.166  124.157 1.00 99.73  ? 226  SER A C     1 
ATOM   1756  O  O     . SER A  1  226  ? 45.268  34.798  124.615 1.00 97.59  ? 226  SER A O     1 
ATOM   1757  C  CB    . SER A  1  226  ? 48.164  33.317  125.496 1.00 92.37  ? 226  SER A CB    1 
ATOM   1758  O  OG    . SER A  1  226  ? 48.643  32.304  126.367 1.00 87.09  ? 226  SER A OG    1 
ATOM   1759  N  N     . ASN A  1  227  ? 46.810  34.478  123.005 1.00 96.01  ? 227  ASN A N     1 
ATOM   1760  C  CA    . ASN A  1  227  ? 46.545  35.748  122.331 1.00 98.48  ? 227  ASN A CA    1 
ATOM   1761  C  C     . ASN A  1  227  ? 45.638  35.633  121.113 1.00 100.77 ? 227  ASN A C     1 
ATOM   1762  O  O     . ASN A  1  227  ? 46.113  35.356  120.011 1.00 105.61 ? 227  ASN A O     1 
ATOM   1763  C  CB    . ASN A  1  227  ? 47.864  36.407  121.913 1.00 109.88 ? 227  ASN A CB    1 
ATOM   1764  C  CG    . ASN A  1  227  ? 48.826  36.593  123.081 1.00 115.64 ? 227  ASN A CG    1 
ATOM   1765  O  OD1   . ASN A  1  227  ? 48.564  36.141  124.195 1.00 105.02 ? 227  ASN A OD1   1 
ATOM   1766  N  ND2   . ASN A  1  227  ? 49.950  37.255  122.824 1.00 123.69 ? 227  ASN A ND2   1 
ATOM   1767  N  N     . PRO A  1  228  ? 44.333  35.873  121.305 1.00 98.99  ? 228  PRO A N     1 
ATOM   1768  C  CA    . PRO A  1  228  ? 43.318  35.754  120.251 1.00 95.18  ? 228  PRO A CA    1 
ATOM   1769  C  C     . PRO A  1  228  ? 43.432  36.847  119.193 1.00 97.24  ? 228  PRO A C     1 
ATOM   1770  O  O     . PRO A  1  228  ? 44.166  37.812  119.401 1.00 101.29 ? 228  PRO A O     1 
ATOM   1771  C  CB    . PRO A  1  228  ? 42.010  35.913  121.020 1.00 93.05  ? 228  PRO A CB    1 
ATOM   1772  C  CG    . PRO A  1  228  ? 42.370  36.776  122.173 1.00 101.53 ? 228  PRO A CG    1 
ATOM   1773  C  CD    . PRO A  1  228  ? 43.755  36.352  122.571 1.00 98.48  ? 228  PRO A CD    1 
ATOM   1774  N  N     . GLN A  1  229  ? 42.714  36.683  118.081 1.00 93.31  ? 229  GLN A N     1 
ATOM   1775  C  CA    . GLN A  1  229  ? 42.702  37.660  116.991 1.00 88.28  ? 229  GLN A CA    1 
ATOM   1776  C  C     . GLN A  1  229  ? 41.644  37.318  115.944 1.00 76.66  ? 229  GLN A C     1 
ATOM   1777  O  O     . GLN A  1  229  ? 40.836  38.165  115.562 1.00 69.32  ? 229  GLN A O     1 
ATOM   1778  C  CB    . GLN A  1  229  ? 44.084  37.766  116.336 1.00 88.86  ? 229  GLN A CB    1 
ATOM   1779  C  CG    . GLN A  1  229  ? 44.978  38.835  116.952 1.00 98.41  ? 229  GLN A CG    1 
ATOM   1780  C  CD    . GLN A  1  229  ? 46.453  38.503  116.848 1.00 108.22 ? 229  GLN A CD    1 
ATOM   1781  O  OE1   . GLN A  1  229  ? 46.858  37.674  116.034 1.00 115.04 ? 229  GLN A OE1   1 
ATOM   1782  N  NE2   . GLN A  1  229  ? 47.265  39.146  117.681 1.00 107.64 ? 229  GLN A NE2   1 
ATOM   1783  N  N     . LYS B  1  7    ? 58.356  28.905  115.226 1.00 95.81  ? 7    LYS B N     1 
ATOM   1784  C  CA    . LYS B  1  7    ? 57.899  30.201  115.717 1.00 107.46 ? 7    LYS B CA    1 
ATOM   1785  C  C     . LYS B  1  7    ? 56.757  30.043  116.716 1.00 106.79 ? 7    LYS B C     1 
ATOM   1786  O  O     . LYS B  1  7    ? 56.433  28.930  117.129 1.00 104.95 ? 7    LYS B O     1 
ATOM   1787  C  CB    . LYS B  1  7    ? 57.457  31.088  114.550 1.00 107.54 ? 7    LYS B CB    1 
ATOM   1788  C  CG    . LYS B  1  7    ? 58.239  32.386  114.413 1.00 111.52 ? 7    LYS B CG    1 
ATOM   1789  C  CD    . LYS B  1  7    ? 57.791  33.416  115.434 1.00 109.61 ? 7    LYS B CD    1 
ATOM   1790  C  CE    . LYS B  1  7    ? 58.445  34.765  115.178 1.00 110.10 ? 7    LYS B CE    1 
ATOM   1791  N  NZ    . LYS B  1  7    ? 57.853  35.833  116.030 1.00 120.97 ? 7    LYS B NZ    1 
ATOM   1792  N  N     . ALA B  1  8    ? 56.155  31.164  117.105 1.00 105.33 ? 8    ALA B N     1 
ATOM   1793  C  CA    . ALA B  1  8    ? 55.024  31.155  118.029 1.00 91.70  ? 8    ALA B CA    1 
ATOM   1794  C  C     . ALA B  1  8    ? 53.701  31.205  117.272 1.00 86.95  ? 8    ALA B C     1 
ATOM   1795  O  O     . ALA B  1  8    ? 53.366  32.221  116.665 1.00 87.57  ? 8    ALA B O     1 
ATOM   1796  C  CB    . ALA B  1  8    ? 55.122  32.316  119.007 1.00 94.77  ? 8    ALA B CB    1 
ATOM   1797  N  N     . PRO B  1  9    ? 52.946  30.101  117.318 1.00 80.46  ? 9    PRO B N     1 
ATOM   1798  C  CA    . PRO B  1  9    ? 51.672  29.915  116.616 1.00 73.66  ? 9    PRO B CA    1 
ATOM   1799  C  C     . PRO B  1  9    ? 50.732  31.084  116.838 1.00 69.80  ? 9    PRO B C     1 
ATOM   1800  O  O     . PRO B  1  9    ? 50.775  31.695  117.902 1.00 79.10  ? 9    PRO B O     1 
ATOM   1801  C  CB    . PRO B  1  9    ? 51.096  28.666  117.281 1.00 74.88  ? 9    PRO B CB    1 
ATOM   1802  C  CG    . PRO B  1  9    ? 52.292  27.901  117.722 1.00 78.52  ? 9    PRO B CG    1 
ATOM   1803  C  CD    . PRO B  1  9    ? 53.294  28.934  118.146 1.00 80.11  ? 9    PRO B CD    1 
ATOM   1804  N  N     . VAL B  1  10   ? 49.887  31.387  115.858 1.00 68.08  ? 10   VAL B N     1 
ATOM   1805  C  CA    . VAL B  1  10   ? 48.958  32.506  115.998 1.00 72.95  ? 10   VAL B CA    1 
ATOM   1806  C  C     . VAL B  1  10   ? 47.502  32.074  116.193 1.00 75.62  ? 10   VAL B C     1 
ATOM   1807  O  O     . VAL B  1  10   ? 46.920  31.388  115.349 1.00 72.63  ? 10   VAL B O     1 
ATOM   1808  C  CB    . VAL B  1  10   ? 49.068  33.487  114.823 1.00 69.64  ? 10   VAL B CB    1 
ATOM   1809  C  CG1   . VAL B  1  10   ? 50.456  34.102  114.794 1.00 71.67  ? 10   VAL B CG1   1 
ATOM   1810  C  CG2   . VAL B  1  10   ? 48.762  32.785  113.511 1.00 78.08  ? 10   VAL B CG2   1 
ATOM   1811  N  N     . PHE B  1  11   ? 46.926  32.487  117.318 1.00 74.04  ? 11   PHE B N     1 
ATOM   1812  C  CA    . PHE B  1  11   ? 45.561  32.121  117.672 1.00 72.42  ? 11   PHE B CA    1 
ATOM   1813  C  C     . PHE B  1  11   ? 44.581  33.116  117.056 1.00 73.85  ? 11   PHE B C     1 
ATOM   1814  O  O     . PHE B  1  11   ? 44.809  34.323  117.091 1.00 80.83  ? 11   PHE B O     1 
ATOM   1815  C  CB    . PHE B  1  11   ? 45.422  32.064  119.197 1.00 80.98  ? 11   PHE B CB    1 
ATOM   1816  C  CG    . PHE B  1  11   ? 44.104  31.520  119.672 1.00 84.92  ? 11   PHE B CG    1 
ATOM   1817  C  CD1   . PHE B  1  11   ? 43.646  30.289  119.233 1.00 81.16  ? 11   PHE B CD1   1 
ATOM   1818  C  CD2   . PHE B  1  11   ? 43.333  32.234  120.579 1.00 86.75  ? 11   PHE B CD2   1 
ATOM   1819  C  CE1   . PHE B  1  11   ? 42.434  29.786  119.675 1.00 79.59  ? 11   PHE B CE1   1 
ATOM   1820  C  CE2   . PHE B  1  11   ? 42.123  31.737  121.023 1.00 85.75  ? 11   PHE B CE2   1 
ATOM   1821  C  CZ    . PHE B  1  11   ? 41.673  30.509  120.571 1.00 79.79  ? 11   PHE B CZ    1 
ATOM   1822  N  N     . THR B  1  12   ? 43.500  32.605  116.477 1.00 70.93  ? 12   THR B N     1 
ATOM   1823  C  CA    . THR B  1  12   ? 42.555  33.440  115.744 1.00 73.85  ? 12   THR B CA    1 
ATOM   1824  C  C     . THR B  1  12   ? 41.123  33.043  116.061 1.00 75.10  ? 12   THR B C     1 
ATOM   1825  O  O     . THR B  1  12   ? 40.832  31.861  116.236 1.00 74.92  ? 12   THR B O     1 
ATOM   1826  C  CB    . THR B  1  12   ? 42.768  33.315  114.230 1.00 70.72  ? 12   THR B CB    1 
ATOM   1827  O  OG1   . THR B  1  12   ? 44.159  33.478  113.929 1.00 69.51  ? 12   THR B OG1   1 
ATOM   1828  C  CG2   . THR B  1  12   ? 41.959  34.369  113.489 1.00 75.19  ? 12   THR B CG2   1 
ATOM   1829  N  N     . VAL B  1  13   ? 40.228  34.025  116.119 1.00 76.42  ? 13   VAL B N     1 
ATOM   1830  C  CA    . VAL B  1  13   ? 38.865  33.773  116.578 1.00 73.53  ? 13   VAL B CA    1 
ATOM   1831  C  C     . VAL B  1  13   ? 37.769  34.404  115.718 1.00 75.14  ? 13   VAL B C     1 
ATOM   1832  O  O     . VAL B  1  13   ? 37.854  35.571  115.337 1.00 81.18  ? 13   VAL B O     1 
ATOM   1833  C  CB    . VAL B  1  13   ? 38.675  34.264  118.019 1.00 72.94  ? 13   VAL B CB    1 
ATOM   1834  C  CG1   . VAL B  1  13   ? 37.389  33.704  118.588 1.00 77.03  ? 13   VAL B CG1   1 
ATOM   1835  C  CG2   . VAL B  1  13   ? 39.863  33.866  118.884 1.00 72.95  ? 13   VAL B CG2   1 
ATOM   1836  N  N     . ARG B  1  14   ? 36.740  33.617  115.420 1.00 75.12  ? 14   ARG B N     1 
ATOM   1837  C  CA    . ARG B  1  14   ? 35.530  34.120  114.776 1.00 80.53  ? 14   ARG B CA    1 
ATOM   1838  C  C     . ARG B  1  14   ? 34.346  33.727  115.645 1.00 82.25  ? 14   ARG B C     1 
ATOM   1839  O  O     . ARG B  1  14   ? 34.218  32.567  116.021 1.00 79.34  ? 14   ARG B O     1 
ATOM   1840  C  CB    . ARG B  1  14   ? 35.360  33.524  113.376 1.00 86.98  ? 14   ARG B CB    1 
ATOM   1841  C  CG    . ARG B  1  14   ? 36.333  34.059  112.334 1.00 103.30 ? 14   ARG B CG    1 
ATOM   1842  C  CD    . ARG B  1  14   ? 36.154  33.367  110.983 1.00 111.19 ? 14   ARG B CD    1 
ATOM   1843  N  NE    . ARG B  1  14   ? 36.589  31.971  111.016 1.00 112.41 ? 14   ARG B NE    1 
ATOM   1844  C  CZ    . ARG B  1  14   ? 37.769  31.541  110.577 1.00 114.91 ? 14   ARG B CZ    1 
ATOM   1845  N  NH1   . ARG B  1  14   ? 38.640  32.397  110.057 1.00 107.52 ? 14   ARG B NH1   1 
ATOM   1846  N  NH2   . ARG B  1  14   ? 38.077  30.251  110.653 1.00 109.08 ? 14   ARG B NH2   1 
ATOM   1847  N  N     . THR B  1  15   ? 33.483  34.681  115.976 1.00 88.68  ? 15   THR B N     1 
ATOM   1848  C  CA    . THR B  1  15   ? 32.394  34.389  116.908 1.00 91.12  ? 15   THR B CA    1 
ATOM   1849  C  C     . THR B  1  15   ? 31.012  34.829  116.426 1.00 92.98  ? 15   THR B C     1 
ATOM   1850  O  O     . THR B  1  15   ? 30.847  35.909  115.859 1.00 95.22  ? 15   THR B O     1 
ATOM   1851  C  CB    . THR B  1  15   ? 32.657  34.991  118.314 1.00 82.45  ? 15   THR B CB    1 
ATOM   1852  O  OG1   . THR B  1  15   ? 32.501  36.415  118.272 1.00 89.58  ? 15   THR B OG1   1 
ATOM   1853  C  CG2   . THR B  1  15   ? 34.058  34.649  118.796 1.00 70.90  ? 15   THR B CG2   1 
ATOM   1854  N  N     . GLN B  1  16   ? 30.024  33.970  116.660 1.00 90.99  ? 16   GLN B N     1 
ATOM   1855  C  CA    . GLN B  1  16   ? 28.625  34.308  116.433 1.00 99.16  ? 16   GLN B CA    1 
ATOM   1856  C  C     . GLN B  1  16   ? 27.883  34.308  117.763 1.00 98.46  ? 16   GLN B C     1 
ATOM   1857  O  O     . GLN B  1  16   ? 27.601  33.250  118.326 1.00 90.62  ? 16   GLN B O     1 
ATOM   1858  C  CB    . GLN B  1  16   ? 27.972  33.306  115.481 1.00 105.86 ? 16   GLN B CB    1 
ATOM   1859  C  CG    . GLN B  1  16   ? 28.427  33.421  114.036 1.00 115.19 ? 16   GLN B CG    1 
ATOM   1860  C  CD    . GLN B  1  16   ? 27.299  33.823  113.105 1.00 129.11 ? 16   GLN B CD    1 
ATOM   1861  O  OE1   . GLN B  1  16   ? 26.601  34.811  113.344 1.00 124.54 ? 16   GLN B OE1   1 
ATOM   1862  N  NE2   . GLN B  1  16   ? 27.110  33.052  112.039 1.00 134.66 ? 16   GLN B NE2   1 
ATOM   1863  N  N     . GLY B  1  17   ? 27.570  35.498  118.263 1.00 103.41 ? 17   GLY B N     1 
ATOM   1864  C  CA    . GLY B  1  17   ? 26.898  35.627  119.542 1.00 94.71  ? 17   GLY B CA    1 
ATOM   1865  C  C     . GLY B  1  17   ? 27.655  34.922  120.648 1.00 88.60  ? 17   GLY B C     1 
ATOM   1866  O  O     . GLY B  1  17   ? 28.889  34.876  120.644 1.00 84.44  ? 17   GLY B O     1 
ATOM   1867  N  N     . ARG B  1  18   ? 26.910  34.370  121.599 1.00 82.18  ? 18   ARG B N     1 
ATOM   1868  C  CA    . ARG B  1  18   ? 27.504  33.657  122.720 1.00 83.32  ? 18   ARG B CA    1 
ATOM   1869  C  C     . ARG B  1  18   ? 27.489  32.146  122.490 1.00 82.70  ? 18   ARG B C     1 
ATOM   1870  O  O     . ARG B  1  18   ? 28.026  31.383  123.295 1.00 79.03  ? 18   ARG B O     1 
ATOM   1871  C  CB    . ARG B  1  18   ? 26.753  33.985  124.017 1.00 86.32  ? 18   ARG B CB    1 
ATOM   1872  C  CG    . ARG B  1  18   ? 26.955  35.404  124.548 1.00 76.62  ? 18   ARG B CG    1 
ATOM   1873  C  CD    . ARG B  1  18   ? 26.137  35.646  125.818 1.00 69.90  ? 18   ARG B CD    1 
ATOM   1874  N  NE    . ARG B  1  18   ? 26.419  34.664  126.865 1.00 69.24  ? 18   ARG B NE    1 
ATOM   1875  C  CZ    . ARG B  1  18   ? 27.449  34.741  127.706 1.00 78.04  ? 18   ARG B CZ    1 
ATOM   1876  N  NH1   . ARG B  1  18   ? 27.630  33.803  128.628 1.00 77.44  ? 18   ARG B NH1   1 
ATOM   1877  N  NH2   . ARG B  1  18   ? 28.305  35.753  127.626 1.00 73.45  ? 18   ARG B NH2   1 
ATOM   1878  N  N     . GLU B  1  19   ? 26.879  31.714  121.390 1.00 84.78  ? 19   GLU B N     1 
ATOM   1879  C  CA    . GLU B  1  19   ? 26.593  30.292  121.199 1.00 80.63  ? 19   GLU B CA    1 
ATOM   1880  C  C     . GLU B  1  19   ? 27.508  29.538  120.223 1.00 75.11  ? 19   GLU B C     1 
ATOM   1881  O  O     . GLU B  1  19   ? 27.399  28.320  120.093 1.00 70.36  ? 19   GLU B O     1 
ATOM   1882  C  CB    . GLU B  1  19   ? 25.127  30.101  120.799 1.00 73.44  ? 19   GLU B CB    1 
ATOM   1883  C  CG    . GLU B  1  19   ? 24.144  30.719  121.778 1.00 74.63  ? 19   GLU B CG    1 
ATOM   1884  C  CD    . GLU B  1  19   ? 22.701  30.447  121.406 1.00 78.86  ? 19   GLU B CD    1 
ATOM   1885  O  OE1   . GLU B  1  19   ? 21.808  31.100  121.985 1.00 78.51  ? 19   GLU B OE1   1 
ATOM   1886  O  OE2   . GLU B  1  19   ? 22.459  29.580  120.539 1.00 79.71  ? 19   GLU B OE2   1 
ATOM   1887  N  N     . TYR B  1  20   ? 28.410  30.242  119.545 1.00 77.76  ? 20   TYR B N     1 
ATOM   1888  C  CA    . TYR B  1  20   ? 29.269  29.576  118.564 1.00 77.99  ? 20   TYR B CA    1 
ATOM   1889  C  C     . TYR B  1  20   ? 30.606  30.265  118.289 1.00 74.42  ? 20   TYR B C     1 
ATOM   1890  O  O     . TYR B  1  20   ? 30.699  31.492  118.277 1.00 72.77  ? 20   TYR B O     1 
ATOM   1891  C  CB    . TYR B  1  20   ? 28.522  29.373  117.243 1.00 75.51  ? 20   TYR B CB    1 
ATOM   1892  C  CG    . TYR B  1  20   ? 29.395  28.793  116.155 1.00 73.88  ? 20   TYR B CG    1 
ATOM   1893  C  CD1   . TYR B  1  20   ? 29.766  29.552  115.056 1.00 74.66  ? 20   TYR B CD1   1 
ATOM   1894  C  CD2   . TYR B  1  20   ? 29.869  27.493  116.241 1.00 74.99  ? 20   TYR B CD2   1 
ATOM   1895  C  CE1   . TYR B  1  20   ? 30.572  29.025  114.065 1.00 77.33  ? 20   TYR B CE1   1 
ATOM   1896  C  CE2   . TYR B  1  20   ? 30.677  26.957  115.258 1.00 72.62  ? 20   TYR B CE2   1 
ATOM   1897  C  CZ    . TYR B  1  20   ? 31.026  27.726  114.171 1.00 74.91  ? 20   TYR B CZ    1 
ATOM   1898  O  OH    . TYR B  1  20   ? 31.829  27.191  113.184 1.00 68.50  ? 20   TYR B OH    1 
ATOM   1899  N  N     . GLY B  1  21   ? 31.639  29.462  118.046 1.00 72.19  ? 21   GLY B N     1 
ATOM   1900  C  CA    . GLY B  1  21   ? 32.953  30.006  117.750 1.00 71.97  ? 21   GLY B CA    1 
ATOM   1901  C  C     . GLY B  1  21   ? 33.864  29.117  116.921 1.00 70.15  ? 21   GLY B C     1 
ATOM   1902  O  O     . GLY B  1  21   ? 33.797  27.891  116.999 1.00 71.23  ? 21   GLY B O     1 
ATOM   1903  N  N     . GLU B  1  22   ? 34.716  29.750  116.119 1.00 69.02  ? 22   GLU B N     1 
ATOM   1904  C  CA    . GLU B  1  22   ? 35.772  29.063  115.385 1.00 68.38  ? 22   GLU B CA    1 
ATOM   1905  C  C     . GLU B  1  22   ? 37.122  29.592  115.834 1.00 66.78  ? 22   GLU B C     1 
ATOM   1906  O  O     . GLU B  1  22   ? 37.321  30.802  115.943 1.00 70.84  ? 22   GLU B O     1 
ATOM   1907  C  CB    . GLU B  1  22   ? 35.631  29.280  113.884 1.00 75.58  ? 22   GLU B CB    1 
ATOM   1908  C  CG    . GLU B  1  22   ? 34.287  28.888  113.318 1.00 85.58  ? 22   GLU B CG    1 
ATOM   1909  C  CD    . GLU B  1  22   ? 34.267  28.933  111.801 1.00 98.91  ? 22   GLU B CD    1 
ATOM   1910  O  OE1   . GLU B  1  22   ? 35.290  28.556  111.182 1.00 103.52 ? 22   GLU B OE1   1 
ATOM   1911  O  OE2   . GLU B  1  22   ? 33.234  29.352  111.233 1.00 93.07  ? 22   GLU B OE2   1 
ATOM   1912  N  N     . PHE B  1  23   ? 38.049  28.677  116.078 1.00 61.82  ? 23   PHE B N     1 
ATOM   1913  C  CA    . PHE B  1  23   ? 39.340  29.017  116.648 1.00 65.77  ? 23   PHE B CA    1 
ATOM   1914  C  C     . PHE B  1  23   ? 40.443  28.353  115.851 1.00 67.62  ? 23   PHE B C     1 
ATOM   1915  O  O     . PHE B  1  23   ? 40.532  27.128  115.798 1.00 70.13  ? 23   PHE B O     1 
ATOM   1916  C  CB    . PHE B  1  23   ? 39.396  28.569  118.109 1.00 65.26  ? 23   PHE B CB    1 
ATOM   1917  C  CG    . PHE B  1  23   ? 38.217  29.019  118.911 1.00 69.50  ? 23   PHE B CG    1 
ATOM   1918  C  CD1   . PHE B  1  23   ? 38.235  30.237  119.565 1.00 67.30  ? 23   PHE B CD1   1 
ATOM   1919  C  CD2   . PHE B  1  23   ? 37.077  28.239  118.983 1.00 69.84  ? 23   PHE B CD2   1 
ATOM   1920  C  CE1   . PHE B  1  23   ? 37.146  30.659  120.285 1.00 65.55  ? 23   PHE B CE1   1 
ATOM   1921  C  CE2   . PHE B  1  23   ? 35.983  28.657  119.702 1.00 65.10  ? 23   PHE B CE2   1 
ATOM   1922  C  CZ    . PHE B  1  23   ? 36.017  29.869  120.353 1.00 67.40  ? 23   PHE B CZ    1 
ATOM   1923  N  N     . VAL B  1  24   ? 41.285  29.168  115.232 1.00 67.30  ? 24   VAL B N     1 
ATOM   1924  C  CA    . VAL B  1  24   ? 42.346  28.642  114.394 1.00 67.13  ? 24   VAL B CA    1 
ATOM   1925  C  C     . VAL B  1  24   ? 43.721  28.857  115.011 1.00 68.59  ? 24   VAL B C     1 
ATOM   1926  O  O     . VAL B  1  24   ? 44.056  29.955  115.447 1.00 74.42  ? 24   VAL B O     1 
ATOM   1927  C  CB    . VAL B  1  24   ? 42.306  29.261  112.993 1.00 69.72  ? 24   VAL B CB    1 
ATOM   1928  C  CG1   . VAL B  1  24   ? 43.495  28.780  112.179 1.00 72.82  ? 24   VAL B CG1   1 
ATOM   1929  C  CG2   . VAL B  1  24   ? 40.993  28.913  112.302 1.00 69.55  ? 24   VAL B CG2   1 
ATOM   1930  N  N     . LEU B  1  25   ? 44.509  27.790  115.046 1.00 66.93  ? 25   LEU B N     1 
ATOM   1931  C  CA    . LEU B  1  25   ? 45.869  27.850  115.549 1.00 69.04  ? 25   LEU B CA    1 
ATOM   1932  C  C     . LEU B  1  25   ? 46.808  27.259  114.506 1.00 71.07  ? 25   LEU B C     1 
ATOM   1933  O  O     . LEU B  1  25   ? 46.742  26.069  114.204 1.00 63.00  ? 25   LEU B O     1 
ATOM   1934  C  CB    . LEU B  1  25   ? 45.988  27.078  116.864 1.00 61.44  ? 25   LEU B CB    1 
ATOM   1935  C  CG    . LEU B  1  25   ? 47.291  27.250  117.647 1.00 62.46  ? 25   LEU B CG    1 
ATOM   1936  C  CD1   . LEU B  1  25   ? 47.498  28.703  118.029 1.00 73.83  ? 25   LEU B CD1   1 
ATOM   1937  C  CD2   . LEU B  1  25   ? 47.298  26.374  118.881 1.00 60.63  ? 25   LEU B CD2   1 
ATOM   1938  N  N     . GLU B  1  26   ? 47.663  28.111  113.944 1.00 75.53  ? 26   GLU B N     1 
ATOM   1939  C  CA    . GLU B  1  26   ? 48.681  27.698  112.981 1.00 67.46  ? 26   GLU B CA    1 
ATOM   1940  C  C     . GLU B  1  26   ? 49.865  28.663  113.027 1.00 65.13  ? 26   GLU B C     1 
ATOM   1941  O  O     . GLU B  1  26   ? 49.702  29.833  113.373 1.00 69.90  ? 26   GLU B O     1 
ATOM   1942  C  CB    . GLU B  1  26   ? 48.098  27.637  111.565 1.00 68.11  ? 26   GLU B CB    1 
ATOM   1943  C  CG    . GLU B  1  26   ? 47.540  28.962  111.048 1.00 69.32  ? 26   GLU B CG    1 
ATOM   1944  C  CD    . GLU B  1  26   ? 47.300  28.946  109.543 1.00 80.10  ? 26   GLU B CD    1 
ATOM   1945  O  OE1   . GLU B  1  26   ? 48.207  28.519  108.789 1.00 77.23  ? 26   GLU B OE1   1 
ATOM   1946  O  OE2   . GLU B  1  26   ? 46.203  29.364  109.112 1.00 81.10  ? 26   GLU B OE2   1 
ATOM   1947  N  N     . PRO B  1  27   ? 51.069  28.179  112.693 1.00 63.75  ? 27   PRO B N     1 
ATOM   1948  C  CA    . PRO B  1  27   ? 51.431  26.809  112.324 1.00 59.47  ? 27   PRO B CA    1 
ATOM   1949  C  C     . PRO B  1  27   ? 51.850  25.992  113.536 1.00 59.94  ? 27   PRO B C     1 
ATOM   1950  O  O     . PRO B  1  27   ? 52.363  26.552  114.502 1.00 65.22  ? 27   PRO B O     1 
ATOM   1951  C  CB    . PRO B  1  27   ? 52.659  27.023  111.456 1.00 64.07  ? 27   PRO B CB    1 
ATOM   1952  C  CG    . PRO B  1  27   ? 53.329  28.180  112.101 1.00 64.26  ? 27   PRO B CG    1 
ATOM   1953  C  CD    . PRO B  1  27   ? 52.211  29.095  112.534 1.00 69.07  ? 27   PRO B CD    1 
ATOM   1954  N  N     . LEU B  1  28   ? 51.643  24.679  113.479 1.00 62.46  ? 28   LEU B N     1 
ATOM   1955  C  CA    . LEU B  1  28   ? 52.094  23.775  114.533 1.00 60.71  ? 28   LEU B CA    1 
ATOM   1956  C  C     . LEU B  1  28   ? 52.997  22.734  113.909 1.00 53.24  ? 28   LEU B C     1 
ATOM   1957  O  O     . LEU B  1  28   ? 52.828  22.385  112.749 1.00 56.42  ? 28   LEU B O     1 
ATOM   1958  C  CB    . LEU B  1  28   ? 50.914  23.053  115.193 1.00 58.84  ? 28   LEU B CB    1 
ATOM   1959  C  CG    . LEU B  1  28   ? 49.716  23.805  115.771 1.00 49.13  ? 28   LEU B CG    1 
ATOM   1960  C  CD1   . LEU B  1  28   ? 48.657  22.792  116.149 1.00 52.90  ? 28   LEU B CD1   1 
ATOM   1961  C  CD2   . LEU B  1  28   ? 50.113  24.641  116.968 1.00 51.88  ? 28   LEU B CD2   1 
ATOM   1962  N  N     . GLU B  1  29   ? 53.936  22.214  114.684 1.00 58.94  ? 29   GLU B N     1 
ATOM   1963  C  CA    . GLU B  1  29   ? 54.815  21.173  114.180 1.00 65.66  ? 29   GLU B CA    1 
ATOM   1964  C  C     . GLU B  1  29   ? 53.989  19.982  113.720 1.00 64.24  ? 29   GLU B C     1 
ATOM   1965  O  O     . GLU B  1  29   ? 52.814  19.880  114.048 1.00 58.68  ? 29   GLU B O     1 
ATOM   1966  C  CB    . GLU B  1  29   ? 55.822  20.752  115.246 1.00 63.64  ? 29   GLU B CB    1 
ATOM   1967  C  CG    . GLU B  1  29   ? 57.030  20.029  114.680 1.00 80.24  ? 29   GLU B CG    1 
ATOM   1968  C  CD    . GLU B  1  29   ? 57.779  20.862  113.651 1.00 94.04  ? 29   GLU B CD    1 
ATOM   1969  O  OE1   . GLU B  1  29   ? 57.792  20.470  112.463 1.00 86.60  ? 29   GLU B OE1   1 
ATOM   1970  O  OE2   . GLU B  1  29   ? 58.353  21.906  114.033 1.00 94.82  ? 29   GLU B OE2   1 
ATOM   1971  N  N     . ARG B  1  30   ? 54.597  19.086  112.951 1.00 68.50  ? 30   ARG B N     1 
ATOM   1972  C  CA    . ARG B  1  30   ? 53.851  17.967  112.392 1.00 66.50  ? 30   ARG B CA    1 
ATOM   1973  C  C     . ARG B  1  30   ? 53.211  17.120  113.487 1.00 59.78  ? 30   ARG B C     1 
ATOM   1974  O  O     . ARG B  1  30   ? 53.893  16.658  114.400 1.00 58.71  ? 30   ARG B O     1 
ATOM   1975  C  CB    . ARG B  1  30   ? 54.739  17.092  111.502 1.00 61.57  ? 30   ARG B CB    1 
ATOM   1976  C  CG    . ARG B  1  30   ? 54.010  15.885  110.935 1.00 60.54  ? 30   ARG B CG    1 
ATOM   1977  C  CD    . ARG B  1  30   ? 54.941  14.939  110.207 1.00 63.60  ? 30   ARG B CD    1 
ATOM   1978  N  NE    . ARG B  1  30   ? 55.872  14.248  111.095 1.00 60.47  ? 30   ARG B NE    1 
ATOM   1979  C  CZ    . ARG B  1  30   ? 56.808  13.401  110.672 1.00 55.73  ? 30   ARG B CZ    1 
ATOM   1980  N  NH1   . ARG B  1  30   ? 56.935  13.140  109.380 1.00 56.19  ? 30   ARG B NH1   1 
ATOM   1981  N  NH2   . ARG B  1  30   ? 57.620  12.815  111.537 1.00 55.14  ? 30   ARG B NH2   1 
ATOM   1982  N  N     . GLY B  1  31   ? 51.898  16.927  113.386 1.00 57.08  ? 31   GLY B N     1 
ATOM   1983  C  CA    . GLY B  1  31   ? 51.180  16.026  114.268 1.00 60.11  ? 31   GLY B CA    1 
ATOM   1984  C  C     . GLY B  1  31   ? 50.483  16.709  115.428 1.00 62.42  ? 31   GLY B C     1 
ATOM   1985  O  O     . GLY B  1  31   ? 49.487  16.205  115.952 1.00 56.91  ? 31   GLY B O     1 
ATOM   1986  N  N     . PHE B  1  32   ? 50.996  17.869  115.821 1.00 64.88  ? 32   PHE B N     1 
ATOM   1987  C  CA    . PHE B  1  32   ? 50.517  18.548  117.020 1.00 59.81  ? 32   PHE B CA    1 
ATOM   1988  C  C     . PHE B  1  32   ? 49.075  19.024  116.931 1.00 56.43  ? 32   PHE B C     1 
ATOM   1989  O  O     . PHE B  1  32   ? 48.425  19.233  117.955 1.00 61.05  ? 32   PHE B O     1 
ATOM   1990  C  CB    . PHE B  1  32   ? 51.459  19.689  117.416 1.00 61.56  ? 32   PHE B CB    1 
ATOM   1991  C  CG    . PHE B  1  32   ? 52.523  19.266  118.385 1.00 61.47  ? 32   PHE B CG    1 
ATOM   1992  C  CD1   . PHE B  1  32   ? 53.662  18.617  117.944 1.00 59.71  ? 32   PHE B CD1   1 
ATOM   1993  C  CD2   . PHE B  1  32   ? 52.366  19.486  119.743 1.00 64.09  ? 32   PHE B CD2   1 
ATOM   1994  C  CE1   . PHE B  1  32   ? 54.633  18.209  118.834 1.00 57.75  ? 32   PHE B CE1   1 
ATOM   1995  C  CE2   . PHE B  1  32   ? 53.334  19.079  120.640 1.00 65.99  ? 32   PHE B CE2   1 
ATOM   1996  C  CZ    . PHE B  1  32   ? 54.470  18.439  120.184 1.00 62.84  ? 32   PHE B CZ    1 
ATOM   1997  N  N     . GLY B  1  33   ? 48.574  19.173  115.711 1.00 56.76  ? 33   GLY B N     1 
ATOM   1998  C  CA    . GLY B  1  33   ? 47.193  19.566  115.500 1.00 55.39  ? 33   GLY B CA    1 
ATOM   1999  C  C     . GLY B  1  33   ? 46.210  18.668  116.225 1.00 52.70  ? 33   GLY B C     1 
ATOM   2000  O  O     . GLY B  1  33   ? 45.302  19.151  116.897 1.00 57.03  ? 33   GLY B O     1 
ATOM   2001  N  N     . VAL B  1  34   ? 46.389  17.358  116.095 1.00 54.88  ? 34   VAL B N     1 
ATOM   2002  C  CA    . VAL B  1  34   ? 45.500  16.397  116.747 1.00 54.61  ? 34   VAL B CA    1 
ATOM   2003  C  C     . VAL B  1  34   ? 45.889  16.173  118.206 1.00 51.34  ? 34   VAL B C     1 
ATOM   2004  O  O     . VAL B  1  34   ? 45.038  15.873  119.045 1.00 60.10  ? 34   VAL B O     1 
ATOM   2005  C  CB    . VAL B  1  34   ? 45.481  15.049  116.008 1.00 52.83  ? 34   VAL B CB    1 
ATOM   2006  C  CG1   . VAL B  1  34   ? 45.314  15.281  114.522 1.00 58.84  ? 34   VAL B CG1   1 
ATOM   2007  C  CG2   . VAL B  1  34   ? 46.754  14.276  116.282 1.00 50.68  ? 34   VAL B CG2   1 
ATOM   2008  N  N     . THR B  1  35   ? 47.175  16.324  118.499 1.00 51.26  ? 35   THR B N     1 
ATOM   2009  C  CA    . THR B  1  35   ? 47.666  16.255  119.868 1.00 53.76  ? 35   THR B CA    1 
ATOM   2010  C  C     . THR B  1  35   ? 46.940  17.257  120.759 1.00 53.14  ? 35   THR B C     1 
ATOM   2011  O  O     . THR B  1  35   ? 46.511  16.915  121.857 1.00 51.41  ? 35   THR B O     1 
ATOM   2012  C  CB    . THR B  1  35   ? 49.189  16.502  119.948 1.00 54.59  ? 35   THR B CB    1 
ATOM   2013  O  OG1   . THR B  1  35   ? 49.887  15.426  119.310 1.00 50.30  ? 35   THR B OG1   1 
ATOM   2014  C  CG2   . THR B  1  35   ? 49.635  16.591  121.397 1.00 51.06  ? 35   THR B CG2   1 
ATOM   2015  N  N     . LEU B  1  36   ? 46.803  18.494  120.293 1.00 51.98  ? 36   LEU B N     1 
ATOM   2016  C  CA    . LEU B  1  36   ? 46.030  19.479  121.036 1.00 49.06  ? 36   LEU B CA    1 
ATOM   2017  C  C     . LEU B  1  36   ? 44.541  19.254  120.838 1.00 49.54  ? 36   LEU B C     1 
ATOM   2018  O  O     . LEU B  1  36   ? 43.779  19.202  121.797 1.00 53.00  ? 36   LEU B O     1 
ATOM   2019  C  CB    . LEU B  1  36   ? 46.398  20.893  120.608 1.00 46.65  ? 36   LEU B CB    1 
ATOM   2020  C  CG    . LEU B  1  36   ? 47.885  21.176  120.757 1.00 49.15  ? 36   LEU B CG    1 
ATOM   2021  C  CD1   . LEU B  1  36   ? 48.177  22.642  120.511 1.00 55.04  ? 36   LEU B CD1   1 
ATOM   2022  C  CD2   . LEU B  1  36   ? 48.332  20.759  122.141 1.00 52.09  ? 36   LEU B CD2   1 
ATOM   2023  N  N     . GLY B  1  37   ? 44.134  19.110  119.584 1.00 48.32  ? 37   GLY B N     1 
ATOM   2024  C  CA    . GLY B  1  37   ? 42.725  19.007  119.243 1.00 53.45  ? 37   GLY B CA    1 
ATOM   2025  C  C     . GLY B  1  37   ? 41.901  17.966  119.979 1.00 51.36  ? 37   GLY B C     1 
ATOM   2026  O  O     . GLY B  1  37   ? 40.803  18.262  120.436 1.00 50.47  ? 37   GLY B O     1 
ATOM   2027  N  N     . ASN B  1  38   ? 42.406  16.743  120.085 1.00 52.84  ? 38   ASN B N     1 
ATOM   2028  C  CA    . ASN B  1  38   ? 41.618  15.674  120.701 1.00 55.03  ? 38   ASN B CA    1 
ATOM   2029  C  C     . ASN B  1  38   ? 41.326  15.883  122.182 1.00 56.28  ? 38   ASN B C     1 
ATOM   2030  O  O     . ASN B  1  38   ? 40.165  15.895  122.585 1.00 57.40  ? 38   ASN B O     1 
ATOM   2031  C  CB    . ASN B  1  38   ? 42.251  14.302  120.455 1.00 59.54  ? 38   ASN B CB    1 
ATOM   2032  C  CG    . ASN B  1  38   ? 41.966  13.779  119.067 1.00 60.17  ? 38   ASN B CG    1 
ATOM   2033  O  OD1   . ASN B  1  38   ? 40.829  13.837  118.601 1.00 54.67  ? 38   ASN B OD1   1 
ATOM   2034  N  ND2   . ASN B  1  38   ? 42.999  13.283  118.389 1.00 60.73  ? 38   ASN B ND2   1 
ATOM   2035  N  N     . PRO B  1  39   ? 42.379  16.054  122.999 1.00 56.61  ? 39   PRO B N     1 
ATOM   2036  C  CA    . PRO B  1  39   ? 42.180  16.297  124.432 1.00 56.06  ? 39   PRO B CA    1 
ATOM   2037  C  C     . PRO B  1  39   ? 41.163  17.405  124.666 1.00 52.63  ? 39   PRO B C     1 
ATOM   2038  O  O     . PRO B  1  39   ? 40.170  17.192  125.351 1.00 55.46  ? 39   PRO B O     1 
ATOM   2039  C  CB    . PRO B  1  39   ? 43.561  16.756  124.903 1.00 47.60  ? 39   PRO B CB    1 
ATOM   2040  C  CG    . PRO B  1  39   ? 44.497  16.099  123.962 1.00 54.26  ? 39   PRO B CG    1 
ATOM   2041  C  CD    . PRO B  1  39   ? 43.805  16.083  122.631 1.00 53.39  ? 39   PRO B CD    1 
ATOM   2042  N  N     . LEU B  1  40   ? 41.404  18.570  124.078 1.00 48.29  ? 40   LEU B N     1 
ATOM   2043  C  CA    . LEU B  1  40   ? 40.516  19.702  124.266 1.00 48.62  ? 40   LEU B CA    1 
ATOM   2044  C  C     . LEU B  1  40   ? 39.070  19.334  123.974 1.00 51.42  ? 40   LEU B C     1 
ATOM   2045  O  O     . LEU B  1  40   ? 38.155  19.803  124.649 1.00 53.67  ? 40   LEU B O     1 
ATOM   2046  C  CB    . LEU B  1  40   ? 40.950  20.883  123.402 1.00 46.31  ? 40   LEU B CB    1 
ATOM   2047  C  CG    . LEU B  1  40   ? 42.293  21.502  123.790 1.00 55.72  ? 40   LEU B CG    1 
ATOM   2048  C  CD1   . LEU B  1  40   ? 42.640  22.666  122.870 1.00 58.25  ? 40   LEU B CD1   1 
ATOM   2049  C  CD2   . LEU B  1  40   ? 42.279  21.945  125.245 1.00 50.31  ? 40   LEU B CD2   1 
ATOM   2050  N  N     . ARG B  1  41   ? 38.860  18.490  122.973 1.00 51.90  ? 41   ARG B N     1 
ATOM   2051  C  CA    . ARG B  1  41   ? 37.501  18.102  122.612 1.00 54.32  ? 41   ARG B CA    1 
ATOM   2052  C  C     . ARG B  1  41   ? 36.891  17.193  123.677 1.00 52.48  ? 41   ARG B C     1 
ATOM   2053  O  O     . ARG B  1  41   ? 35.763  17.410  124.119 1.00 53.48  ? 41   ARG B O     1 
ATOM   2054  C  CB    . ARG B  1  41   ? 37.466  17.414  121.248 1.00 51.36  ? 41   ARG B CB    1 
ATOM   2055  C  CG    . ARG B  1  41   ? 36.125  16.792  120.943 1.00 50.72  ? 41   ARG B CG    1 
ATOM   2056  C  CD    . ARG B  1  41   ? 36.141  15.948  119.687 1.00 49.59  ? 41   ARG B CD    1 
ATOM   2057  N  NE    . ARG B  1  41   ? 34.809  15.417  119.403 1.00 54.88  ? 41   ARG B NE    1 
ATOM   2058  C  CZ    . ARG B  1  41   ? 34.394  14.213  119.786 1.00 55.18  ? 41   ARG B CZ    1 
ATOM   2059  N  NH1   . ARG B  1  41   ? 35.216  13.409  120.452 1.00 53.00  ? 41   ARG B NH1   1 
ATOM   2060  N  NH2   . ARG B  1  41   ? 33.163  13.811  119.497 1.00 45.34  ? 41   ARG B NH2   1 
ATOM   2061  N  N     . ARG B  1  42   ? 37.642  16.174  124.081 1.00 50.52  ? 42   ARG B N     1 
ATOM   2062  C  CA    . ARG B  1  42   ? 37.198  15.272  125.132 1.00 51.91  ? 42   ARG B CA    1 
ATOM   2063  C  C     . ARG B  1  42   ? 36.816  16.067  126.373 1.00 52.37  ? 42   ARG B C     1 
ATOM   2064  O  O     . ARG B  1  42   ? 35.744  15.877  126.940 1.00 57.48  ? 42   ARG B O     1 
ATOM   2065  C  CB    . ARG B  1  42   ? 38.290  14.257  125.467 1.00 50.50  ? 42   ARG B CB    1 
ATOM   2066  C  CG    . ARG B  1  42   ? 38.501  13.206  124.399 1.00 50.18  ? 42   ARG B CG    1 
ATOM   2067  C  CD    . ARG B  1  42   ? 39.688  12.304  124.720 1.00 52.03  ? 42   ARG B CD    1 
ATOM   2068  N  NE    . ARG B  1  42   ? 39.428  11.409  125.841 1.00 43.21  ? 42   ARG B NE    1 
ATOM   2069  C  CZ    . ARG B  1  42   ? 38.747  10.269  125.744 1.00 52.02  ? 42   ARG B CZ    1 
ATOM   2070  N  NH1   . ARG B  1  42   ? 38.259  9.875   124.576 1.00 51.20  ? 42   ARG B NH1   1 
ATOM   2071  N  NH2   . ARG B  1  42   ? 38.556  9.514   126.818 1.00 58.57  ? 42   ARG B NH2   1 
ATOM   2072  N  N     . ILE B  1  43   ? 37.700  16.965  126.784 1.00 49.42  ? 43   ILE B N     1 
ATOM   2073  C  CA    . ILE B  1  43   ? 37.439  17.856  127.902 1.00 47.45  ? 43   ILE B CA    1 
ATOM   2074  C  C     . ILE B  1  43   ? 36.195  18.708  127.667 1.00 53.30  ? 43   ILE B C     1 
ATOM   2075  O  O     . ILE B  1  43   ? 35.275  18.719  128.487 1.00 55.74  ? 43   ILE B O     1 
ATOM   2076  C  CB    . ILE B  1  43   ? 38.643  18.769  128.152 1.00 44.16  ? 43   ILE B CB    1 
ATOM   2077  C  CG1   . ILE B  1  43   ? 39.783  17.956  128.769 1.00 46.25  ? 43   ILE B CG1   1 
ATOM   2078  C  CG2   . ILE B  1  43   ? 38.257  19.933  129.043 1.00 49.27  ? 43   ILE B CG2   1 
ATOM   2079  C  CD1   . ILE B  1  43   ? 41.062  18.738  128.961 1.00 54.06  ? 43   ILE B CD1   1 
ATOM   2080  N  N     . LEU B  1  44   ? 36.165  19.408  126.538 1.00 52.46  ? 44   LEU B N     1 
ATOM   2081  C  CA    . LEU B  1  44   ? 35.051  20.292  126.208 1.00 54.28  ? 44   LEU B CA    1 
ATOM   2082  C  C     . LEU B  1  44   ? 33.697  19.591  126.189 1.00 56.55  ? 44   LEU B C     1 
ATOM   2083  O  O     . LEU B  1  44   ? 32.656  20.241  126.270 1.00 62.77  ? 44   LEU B O     1 
ATOM   2084  C  CB    . LEU B  1  44   ? 35.293  20.962  124.858 1.00 57.61  ? 44   LEU B CB    1 
ATOM   2085  C  CG    . LEU B  1  44   ? 36.286  22.121  124.835 1.00 56.20  ? 44   LEU B CG    1 
ATOM   2086  C  CD1   . LEU B  1  44   ? 36.725  22.406  123.414 1.00 49.18  ? 44   LEU B CD1   1 
ATOM   2087  C  CD2   . LEU B  1  44   ? 35.671  23.358  125.473 1.00 61.76  ? 44   LEU B CD2   1 
ATOM   2088  N  N     . LEU B  1  45   ? 33.711  18.270  126.068 1.00 51.31  ? 45   LEU B N     1 
ATOM   2089  C  CA    . LEU B  1  45   ? 32.470  17.508  125.990 1.00 56.05  ? 45   LEU B CA    1 
ATOM   2090  C  C     . LEU B  1  45   ? 32.117  16.842  127.314 1.00 57.70  ? 45   LEU B C     1 
ATOM   2091  O  O     . LEU B  1  45   ? 31.026  16.285  127.469 1.00 56.42  ? 45   LEU B O     1 
ATOM   2092  C  CB    . LEU B  1  45   ? 32.558  16.452  124.888 1.00 55.10  ? 45   LEU B CB    1 
ATOM   2093  C  CG    . LEU B  1  45   ? 32.422  16.953  123.452 1.00 52.38  ? 45   LEU B CG    1 
ATOM   2094  C  CD1   . LEU B  1  45   ? 32.704  15.826  122.477 1.00 48.77  ? 45   LEU B CD1   1 
ATOM   2095  C  CD2   . LEU B  1  45   ? 31.036  17.524  123.235 1.00 47.54  ? 45   LEU B CD2   1 
ATOM   2096  N  N     . SER B  1  46   ? 33.036  16.904  128.269 1.00 52.88  ? 46   SER B N     1 
ATOM   2097  C  CA    . SER B  1  46   ? 32.820  16.241  129.546 1.00 58.58  ? 46   SER B CA    1 
ATOM   2098  C  C     . SER B  1  46   ? 32.990  17.160  130.770 1.00 65.59  ? 46   SER B C     1 
ATOM   2099  O  O     . SER B  1  46   ? 32.068  17.313  131.572 1.00 69.81  ? 46   SER B O     1 
ATOM   2100  C  CB    . SER B  1  46   ? 33.724  15.009  129.661 1.00 58.76  ? 46   SER B CB    1 
ATOM   2101  O  OG    . SER B  1  46   ? 35.087  15.349  129.476 1.00 58.85  ? 46   SER B OG    1 
ATOM   2102  N  N     . SER B  1  47   ? 34.157  17.787  130.896 1.00 62.26  ? 47   SER B N     1 
ATOM   2103  C  CA    . SER B  1  47   ? 34.538  18.453  132.141 1.00 57.58  ? 47   SER B CA    1 
ATOM   2104  C  C     . SER B  1  47   ? 34.201  19.944  132.254 1.00 61.15  ? 47   SER B C     1 
ATOM   2105  O  O     . SER B  1  47   ? 34.647  20.607  133.191 1.00 62.35  ? 47   SER B O     1 
ATOM   2106  C  CB    . SER B  1  47   ? 36.034  18.256  132.391 1.00 64.26  ? 47   SER B CB    1 
ATOM   2107  O  OG    . SER B  1  47   ? 36.341  16.880  132.498 1.00 72.04  ? 47   SER B OG    1 
ATOM   2108  N  N     . ILE B  1  48   ? 33.434  20.485  131.313 1.00 65.71  ? 48   ILE B N     1 
ATOM   2109  C  CA    . ILE B  1  48   ? 33.041  21.890  131.422 1.00 63.38  ? 48   ILE B CA    1 
ATOM   2110  C  C     . ILE B  1  48   ? 31.774  22.000  132.253 1.00 66.34  ? 48   ILE B C     1 
ATOM   2111  O  O     . ILE B  1  48   ? 30.755  21.388  131.919 1.00 65.65  ? 48   ILE B O     1 
ATOM   2112  C  CB    . ILE B  1  48   ? 32.851  22.575  130.055 1.00 63.77  ? 48   ILE B CB    1 
ATOM   2113  C  CG1   . ILE B  1  48   ? 34.091  23.394  129.681 1.00 61.55  ? 48   ILE B CG1   1 
ATOM   2114  C  CG2   . ILE B  1  48   ? 31.691  23.526  130.116 1.00 62.92  ? 48   ILE B CG2   1 
ATOM   2115  C  CD1   . ILE B  1  48   ? 35.376  22.605  129.616 1.00 60.14  ? 48   ILE B CD1   1 
ATOM   2116  N  N     . PRO B  1  49   ? 31.851  22.769  133.356 1.00 74.13  ? 49   PRO B N     1 
ATOM   2117  C  CA    . PRO B  1  49   ? 30.833  22.985  134.393 1.00 62.98  ? 49   PRO B CA    1 
ATOM   2118  C  C     . PRO B  1  49   ? 29.576  23.678  133.883 1.00 64.58  ? 49   PRO B C     1 
ATOM   2119  O  O     . PRO B  1  49   ? 29.657  24.798  133.377 1.00 67.90  ? 49   PRO B O     1 
ATOM   2120  C  CB    . PRO B  1  49   ? 31.547  23.905  135.386 1.00 53.27  ? 49   PRO B CB    1 
ATOM   2121  C  CG    . PRO B  1  49   ? 32.985  23.651  135.173 1.00 61.20  ? 49   PRO B CG    1 
ATOM   2122  C  CD    . PRO B  1  49   ? 33.112  23.447  133.697 1.00 71.80  ? 49   PRO B CD    1 
ATOM   2123  N  N     . GLY B  1  50   ? 28.429  23.025  134.042 1.00 64.79  ? 50   GLY B N     1 
ATOM   2124  C  CA    . GLY B  1  50   ? 27.162  23.584  133.607 1.00 64.69  ? 50   GLY B CA    1 
ATOM   2125  C  C     . GLY B  1  50   ? 25.999  23.132  134.474 1.00 72.48  ? 50   GLY B C     1 
ATOM   2126  O  O     . GLY B  1  50   ? 26.201  22.531  135.530 1.00 73.85  ? 50   GLY B O     1 
ATOM   2127  N  N     . THR B  1  51   ? 24.779  23.413  134.026 1.00 68.38  ? 51   THR B N     1 
ATOM   2128  C  CA    . THR B  1  51   ? 23.590  23.131  134.825 1.00 64.86  ? 51   THR B CA    1 
ATOM   2129  C  C     . THR B  1  51   ? 22.544  22.348  134.043 1.00 64.39  ? 51   THR B C     1 
ATOM   2130  O  O     . THR B  1  51   ? 22.224  22.687  132.903 1.00 73.57  ? 51   THR B O     1 
ATOM   2131  C  CB    . THR B  1  51   ? 22.933  24.435  135.312 1.00 68.23  ? 51   THR B CB    1 
ATOM   2132  O  OG1   . THR B  1  51   ? 21.977  24.884  134.341 1.00 67.96  ? 51   THR B OG1   1 
ATOM   2133  C  CG2   . THR B  1  51   ? 23.982  25.517  135.524 1.00 70.44  ? 51   THR B CG2   1 
ATOM   2134  N  N     . ALA B  1  52   ? 21.992  21.314  134.665 1.00 61.93  ? 52   ALA B N     1 
ATOM   2135  C  CA    . ALA B  1  52   ? 20.961  20.511  134.015 1.00 65.10  ? 52   ALA B CA    1 
ATOM   2136  C  C     . ALA B  1  52   ? 19.735  20.281  134.896 1.00 69.05  ? 52   ALA B C     1 
ATOM   2137  O  O     . ALA B  1  52   ? 19.764  20.508  136.100 1.00 72.51  ? 52   ALA B O     1 
ATOM   2138  C  CB    . ALA B  1  52   ? 21.537  19.182  133.571 1.00 61.19  ? 52   ALA B CB    1 
ATOM   2139  N  N     . VAL B  1  53   ? 18.658  19.821  134.278 1.00 64.39  ? 53   VAL B N     1 
ATOM   2140  C  CA    . VAL B  1  53   ? 17.467  19.413  135.004 1.00 65.82  ? 53   VAL B CA    1 
ATOM   2141  C  C     . VAL B  1  53   ? 17.546  17.922  135.328 1.00 75.26  ? 53   VAL B C     1 
ATOM   2142  O  O     . VAL B  1  53   ? 17.481  17.079  134.431 1.00 78.27  ? 53   VAL B O     1 
ATOM   2143  C  CB    . VAL B  1  53   ? 16.199  19.691  134.175 1.00 70.51  ? 53   VAL B CB    1 
ATOM   2144  C  CG1   . VAL B  1  53   ? 15.024  18.871  134.691 1.00 75.44  ? 53   VAL B CG1   1 
ATOM   2145  C  CG2   . VAL B  1  53   ? 15.885  21.182  134.173 1.00 68.57  ? 53   VAL B CG2   1 
ATOM   2146  N  N     . THR B  1  54   ? 17.687  17.600  136.611 1.00 78.01  ? 54   THR B N     1 
ATOM   2147  C  CA    . THR B  1  54   ? 17.906  16.216  137.034 1.00 80.82  ? 54   THR B CA    1 
ATOM   2148  C  C     . THR B  1  54   ? 16.631  15.402  137.257 1.00 79.74  ? 54   THR B C     1 
ATOM   2149  O  O     . THR B  1  54   ? 16.575  14.221  136.911 1.00 79.31  ? 54   THR B O     1 
ATOM   2150  C  CB    . THR B  1  54   ? 18.781  16.141  138.299 1.00 83.52  ? 54   THR B CB    1 
ATOM   2151  O  OG1   . THR B  1  54   ? 18.812  17.425  138.933 1.00 87.27  ? 54   THR B OG1   1 
ATOM   2152  C  CG2   . THR B  1  54   ? 20.202  15.737  137.937 1.00 84.09  ? 54   THR B CG2   1 
ATOM   2153  N  N     . SER B  1  55   ? 15.611  16.021  137.841 1.00 83.71  ? 55   SER B N     1 
ATOM   2154  C  CA    . SER B  1  55   ? 14.382  15.293  138.143 1.00 87.21  ? 55   SER B CA    1 
ATOM   2155  C  C     . SER B  1  55   ? 13.166  16.209  138.144 1.00 79.53  ? 55   SER B C     1 
ATOM   2156  O  O     . SER B  1  55   ? 13.291  17.410  138.359 1.00 75.78  ? 55   SER B O     1 
ATOM   2157  C  CB    . SER B  1  55   ? 14.504  14.570  139.486 1.00 87.52  ? 55   SER B CB    1 
ATOM   2158  O  OG    . SER B  1  55   ? 13.521  13.559  139.617 1.00 94.09  ? 55   SER B OG    1 
ATOM   2159  N  N     . VAL B  1  56   ? 11.990  15.634  137.905 1.00 80.44  ? 56   VAL B N     1 
ATOM   2160  C  CA    . VAL B  1  56   ? 10.770  16.427  137.788 1.00 85.15  ? 56   VAL B CA    1 
ATOM   2161  C  C     . VAL B  1  56   ? 9.543   15.755  138.390 1.00 92.38  ? 56   VAL B C     1 
ATOM   2162  O  O     . VAL B  1  56   ? 9.316   14.560  138.191 1.00 93.48  ? 56   VAL B O     1 
ATOM   2163  C  CB    . VAL B  1  56   ? 10.469  16.771  136.325 1.00 78.15  ? 56   VAL B CB    1 
ATOM   2164  C  CG1   . VAL B  1  56   ? 9.049   17.283  136.177 1.00 78.28  ? 56   VAL B CG1   1 
ATOM   2165  C  CG2   . VAL B  1  56   ? 11.466  17.794  135.823 1.00 84.74  ? 56   VAL B CG2   1 
ATOM   2166  N  N     . TYR B  1  57   ? 8.758   16.544  139.123 1.00 90.79  ? 57   TYR B N     1 
ATOM   2167  C  CA    . TYR B  1  57   ? 7.505   16.082  139.706 1.00 91.07  ? 57   TYR B CA    1 
ATOM   2168  C  C     . TYR B  1  57   ? 6.324   16.858  139.140 1.00 87.34  ? 57   TYR B C     1 
ATOM   2169  O  O     . TYR B  1  57   ? 6.298   18.093  139.183 1.00 79.75  ? 57   TYR B O     1 
ATOM   2170  C  CB    . TYR B  1  57   ? 7.538   16.224  141.231 1.00 102.86 ? 57   TYR B CB    1 
ATOM   2171  C  CG    . TYR B  1  57   ? 6.200   15.985  141.903 1.00 106.05 ? 57   TYR B CG    1 
ATOM   2172  C  CD1   . TYR B  1  57   ? 5.738   14.694  142.138 1.00 106.16 ? 57   TYR B CD1   1 
ATOM   2173  C  CD2   . TYR B  1  57   ? 5.401   17.050  142.306 1.00 100.80 ? 57   TYR B CD2   1 
ATOM   2174  C  CE1   . TYR B  1  57   ? 4.517   14.470  142.749 1.00 108.35 ? 57   TYR B CE1   1 
ATOM   2175  C  CE2   . TYR B  1  57   ? 4.179   16.837  142.917 1.00 104.19 ? 57   TYR B CE2   1 
ATOM   2176  C  CZ    . TYR B  1  57   ? 3.741   15.546  143.137 1.00 111.49 ? 57   TYR B CZ    1 
ATOM   2177  O  OH    . TYR B  1  57   ? 2.524   15.329  143.747 1.00 108.81 ? 57   TYR B OH    1 
ATOM   2178  N  N     . ILE B  1  58   ? 5.356   16.122  138.599 1.00 91.11  ? 58   ILE B N     1 
ATOM   2179  C  CA    . ILE B  1  58   ? 4.112   16.705  138.115 1.00 99.35  ? 58   ILE B CA    1 
ATOM   2180  C  C     . ILE B  1  58   ? 2.987   16.222  139.011 1.00 104.87 ? 58   ILE B C     1 
ATOM   2181  O  O     . ILE B  1  58   ? 2.825   15.018  139.209 1.00 106.85 ? 58   ILE B O     1 
ATOM   2182  C  CB    . ILE B  1  58   ? 3.786   16.276  136.678 1.00 103.47 ? 58   ILE B CB    1 
ATOM   2183  C  CG1   . ILE B  1  58   ? 5.050   16.232  135.812 1.00 99.68  ? 58   ILE B CG1   1 
ATOM   2184  C  CG2   . ILE B  1  58   ? 2.733   17.198  136.082 1.00 103.52 ? 58   ILE B CG2   1 
ATOM   2185  C  CD1   . ILE B  1  58   ? 5.607   17.586  135.455 1.00 92.54  ? 58   ILE B CD1   1 
ATOM   2186  N  N     . GLU B  1  59   ? 2.205   17.162  139.535 1.00 105.27 ? 59   GLU B N     1 
ATOM   2187  C  CA    . GLU B  1  59   ? 1.245   16.869  140.598 1.00 113.55 ? 59   GLU B CA    1 
ATOM   2188  C  C     . GLU B  1  59   ? 0.463   15.569  140.396 1.00 116.67 ? 59   GLU B C     1 
ATOM   2189  O  O     . GLU B  1  59   ? 0.676   14.589  141.112 1.00 115.29 ? 59   GLU B O     1 
ATOM   2190  C  CB    . GLU B  1  59   ? 0.283   18.044  140.810 1.00 118.09 ? 59   GLU B CB    1 
ATOM   2191  C  CG    . GLU B  1  59   ? -0.540  17.935  142.093 1.00 118.57 ? 59   GLU B CG    1 
ATOM   2192  C  CD    . GLU B  1  59   ? -1.521  19.080  142.277 1.00 119.85 ? 59   GLU B CD    1 
ATOM   2193  O  OE1   . GLU B  1  59   ? -1.551  19.994  141.425 1.00 116.27 ? 59   GLU B OE1   1 
ATOM   2194  O  OE2   . GLU B  1  59   ? -2.266  19.063  143.281 1.00 119.88 ? 59   GLU B OE2   1 
ATOM   2195  N  N     . ASP B  1  60   ? -0.513  15.635  139.496 1.00 117.75 ? 60   ASP B N     1 
ATOM   2196  C  CA    . ASP B  1  60   ? -1.395  14.518  139.187 1.00 120.77 ? 60   ASP B CA    1 
ATOM   2197  C  C     . ASP B  1  60   ? -0.639  13.356  138.568 1.00 118.86 ? 60   ASP B C     1 
ATOM   2198  O  O     . ASP B  1  60   ? -0.924  12.193  138.851 1.00 123.77 ? 60   ASP B O     1 
ATOM   2199  C  CB    . ASP B  1  60   ? -2.522  14.969  138.256 1.00 128.40 ? 60   ASP B CB    1 
ATOM   2200  C  CG    . ASP B  1  60   ? -3.612  15.729  138.986 1.00 131.19 ? 60   ASP B CG    1 
ATOM   2201  O  OD1   . ASP B  1  60   ? -3.624  15.700  140.235 1.00 121.69 ? 60   ASP B OD1   1 
ATOM   2202  O  OD2   . ASP B  1  60   ? -4.457  16.354  138.312 1.00 130.01 ? 60   ASP B OD2   1 
ATOM   2203  N  N     . VAL B  1  61   ? 0.321   13.680  137.710 1.00 117.98 ? 61   VAL B N     1 
ATOM   2204  C  CA    . VAL B  1  61   ? 1.015   12.665  136.937 1.00 114.61 ? 61   VAL B CA    1 
ATOM   2205  C  C     . VAL B  1  61   ? 1.753   11.686  137.838 1.00 112.38 ? 61   VAL B C     1 
ATOM   2206  O  O     . VAL B  1  61   ? 2.388   12.070  138.819 1.00 112.68 ? 61   VAL B O     1 
ATOM   2207  C  CB    . VAL B  1  61   ? 2.021   13.296  135.957 1.00 108.58 ? 61   VAL B CB    1 
ATOM   2208  C  CG1   . VAL B  1  61   ? 2.078   14.803  136.152 1.00 107.74 ? 61   VAL B CG1   1 
ATOM   2209  C  CG2   . VAL B  1  61   ? 3.398   12.675  136.140 1.00 110.63 ? 61   VAL B CG2   1 
ATOM   2210  N  N     . LEU B  1  62   ? 1.655   10.413  137.479 1.00 110.05 ? 62   LEU B N     1 
ATOM   2211  C  CA    . LEU B  1  62   ? 2.308   9.328   138.206 1.00 113.12 ? 62   LEU B CA    1 
ATOM   2212  C  C     . LEU B  1  62   ? 3.607   8.761   137.597 1.00 113.92 ? 62   LEU B C     1 
ATOM   2213  O  O     . LEU B  1  62   ? 4.389   8.141   138.314 1.00 112.30 ? 62   LEU B O     1 
ATOM   2214  C  CB    . LEU B  1  62   ? 1.298   8.208   138.472 1.00 119.97 ? 62   LEU B CB    1 
ATOM   2215  C  CG    . LEU B  1  62   ? -0.048  8.737   138.986 1.00 124.30 ? 62   LEU B CG    1 
ATOM   2216  C  CD1   . LEU B  1  62   ? -1.031  7.607   139.226 1.00 115.44 ? 62   LEU B CD1   1 
ATOM   2217  C  CD2   . LEU B  1  62   ? 0.124   9.581   140.249 1.00 119.39 ? 62   LEU B CD2   1 
ATOM   2218  N  N     . HIS B  1  63   ? 3.854   8.992   136.304 1.00 127.22 ? 63   HIS B N     1 
ATOM   2219  C  CA    . HIS B  1  63   ? 5.077   8.489   135.638 1.00 124.16 ? 63   HIS B CA    1 
ATOM   2220  C  C     . HIS B  1  63   ? 5.401   9.164   134.293 1.00 117.85 ? 63   HIS B C     1 
ATOM   2221  O  O     . HIS B  1  63   ? 4.713   10.092  133.876 1.00 116.53 ? 63   HIS B O     1 
ATOM   2222  C  CB    . HIS B  1  63   ? 5.094   6.948   135.506 1.00 120.84 ? 63   HIS B CB    1 
ATOM   2223  C  CG    . HIS B  1  63   ? 4.018   6.377   134.628 1.00 125.18 ? 63   HIS B CG    1 
ATOM   2224  N  ND1   . HIS B  1  63   ? 3.028   7.142   134.049 1.00 127.86 ? 63   HIS B ND1   1 
ATOM   2225  C  CD2   . HIS B  1  63   ? 3.776   5.101   134.241 1.00 125.20 ? 63   HIS B CD2   1 
ATOM   2226  C  CE1   . HIS B  1  63   ? 2.228   6.364   133.340 1.00 127.45 ? 63   HIS B CE1   1 
ATOM   2227  N  NE2   . HIS B  1  63   ? 2.662   5.121   133.438 1.00 128.41 ? 63   HIS B NE2   1 
ATOM   2228  N  N     . GLU B  1  64   ? 6.449   8.688   133.625 1.00 114.10 ? 64   GLU B N     1 
ATOM   2229  C  CA    . GLU B  1  64   ? 6.968   9.330   132.411 1.00 112.95 ? 64   GLU B CA    1 
ATOM   2230  C  C     . GLU B  1  64   ? 6.030   9.297   131.202 1.00 115.14 ? 64   GLU B C     1 
ATOM   2231  O  O     . GLU B  1  64   ? 5.943   10.263  130.445 1.00 114.74 ? 64   GLU B O     1 
ATOM   2232  C  CB    . GLU B  1  64   ? 8.312   8.710   132.012 1.00 116.04 ? 64   GLU B CB    1 
ATOM   2233  C  CG    . GLU B  1  64   ? 9.523   9.582   132.317 1.00 122.92 ? 64   GLU B CG    1 
ATOM   2234  C  CD    . GLU B  1  64   ? 10.783  9.131   131.593 1.00 114.31 ? 64   GLU B CD    1 
ATOM   2235  O  OE1   . GLU B  1  64   ? 11.148  9.787   130.594 1.00 116.92 ? 64   GLU B OE1   1 
ATOM   2236  O  OE2   . GLU B  1  64   ? 11.411  8.138   132.024 1.00 107.96 ? 64   GLU B OE2   1 
ATOM   2237  N  N     . PHE B  1  65   ? 5.347   8.175   131.013 1.00 114.11 ? 65   PHE B N     1 
ATOM   2238  C  CA    . PHE B  1  65   ? 4.573   7.945   129.800 1.00 117.54 ? 65   PHE B CA    1 
ATOM   2239  C  C     . PHE B  1  65   ? 3.098   8.281   129.978 1.00 121.49 ? 65   PHE B C     1 
ATOM   2240  O  O     . PHE B  1  65   ? 2.290   8.087   129.068 1.00 121.12 ? 65   PHE B O     1 
ATOM   2241  C  CB    . PHE B  1  65   ? 4.772   6.505   129.332 1.00 116.50 ? 65   PHE B CB    1 
ATOM   2242  C  CG    . PHE B  1  65   ? 6.218   6.112   129.235 1.00 118.36 ? 65   PHE B CG    1 
ATOM   2243  C  CD1   . PHE B  1  65   ? 6.911   6.259   128.048 1.00 113.93 ? 65   PHE B CD1   1 
ATOM   2244  C  CD2   . PHE B  1  65   ? 6.893   5.628   130.342 1.00 118.19 ? 65   PHE B CD2   1 
ATOM   2245  C  CE1   . PHE B  1  65   ? 8.246   5.914   127.964 1.00 104.46 ? 65   PHE B CE1   1 
ATOM   2246  C  CE2   . PHE B  1  65   ? 8.228   5.284   130.265 1.00 109.81 ? 65   PHE B CE2   1 
ATOM   2247  C  CZ    . PHE B  1  65   ? 8.904   5.426   129.074 1.00 106.68 ? 65   PHE B CZ    1 
ATOM   2248  N  N     . SER B  1  66   ? 2.755   8.791   131.157 1.00 124.48 ? 66   SER B N     1 
ATOM   2249  C  CA    . SER B  1  66   ? 1.391   9.213   131.435 1.00 120.37 ? 66   SER B CA    1 
ATOM   2250  C  C     . SER B  1  66   ? 1.033   10.377  130.529 1.00 118.94 ? 66   SER B C     1 
ATOM   2251  O  O     . SER B  1  66   ? 1.906   11.102  130.051 1.00 118.82 ? 66   SER B O     1 
ATOM   2252  C  CB    . SER B  1  66   ? 1.246   9.647   132.895 1.00 122.33 ? 66   SER B CB    1 
ATOM   2253  O  OG    . SER B  1  66   ? 2.404   9.326   133.644 1.00 125.48 ? 66   SER B OG    1 
ATOM   2254  N  N     . THR B  1  67   ? -0.259  10.548  130.285 1.00 117.75 ? 67   THR B N     1 
ATOM   2255  C  CA    . THR B  1  67   ? -0.719  11.665  129.478 1.00 119.58 ? 67   THR B CA    1 
ATOM   2256  C  C     . THR B  1  67   ? -1.600  12.613  130.292 1.00 113.19 ? 67   THR B C     1 
ATOM   2257  O  O     . THR B  1  67   ? -2.591  12.204  130.892 1.00 110.96 ? 67   THR B O     1 
ATOM   2258  C  CB    . THR B  1  67   ? -1.425  11.189  128.181 1.00 119.93 ? 67   THR B CB    1 
ATOM   2259  O  OG1   . THR B  1  67   ? -1.954  12.320  127.475 1.00 118.77 ? 67   THR B OG1   1 
ATOM   2260  C  CG2   . THR B  1  67   ? -2.544  10.197  128.489 1.00 119.43 ? 67   THR B CG2   1 
ATOM   2261  N  N     . ILE B  1  68   ? -1.213  13.882  130.327 1.00 109.47 ? 68   ILE B N     1 
ATOM   2262  C  CA    . ILE B  1  68   ? -1.972  14.895  131.043 1.00 103.40 ? 68   ILE B CA    1 
ATOM   2263  C  C     . ILE B  1  68   ? -3.246  15.279  130.292 1.00 113.75 ? 68   ILE B C     1 
ATOM   2264  O  O     . ILE B  1  68   ? -3.206  15.541  129.084 1.00 114.53 ? 68   ILE B O     1 
ATOM   2265  C  CB    . ILE B  1  68   ? -1.140  16.170  131.234 1.00 101.49 ? 68   ILE B CB    1 
ATOM   2266  C  CG1   . ILE B  1  68   ? 0.142   15.872  132.001 1.00 94.91  ? 68   ILE B CG1   1 
ATOM   2267  C  CG2   . ILE B  1  68   ? -1.940  17.233  131.959 1.00 110.26 ? 68   ILE B CG2   1 
ATOM   2268  C  CD1   . ILE B  1  68   ? 0.980   17.101  132.246 1.00 103.32 ? 68   ILE B CD1   1 
ATOM   2269  N  N     . PRO B  1  69   ? -4.364  15.223  131.008 1.00 116.23 ? 69   PRO B N     1 
ATOM   2270  C  CA    . PRO B  1  69   ? -5.650  15.682  130.490 1.00 110.26 ? 69   PRO B CA    1 
ATOM   2271  C  C     . PRO B  1  69   ? -5.675  17.195  130.552 1.00 103.02 ? 69   PRO B C     1 
ATOM   2272  O  O     . PRO B  1  69   ? -5.295  17.775  131.568 1.00 94.70  ? 69   PRO B O     1 
ATOM   2273  C  CB    . PRO B  1  69   ? -6.654  15.096  131.483 1.00 102.58 ? 69   PRO B CB    1 
ATOM   2274  C  CG    . PRO B  1  69   ? -5.983  13.874  132.010 1.00 100.27 ? 69   PRO B CG    1 
ATOM   2275  C  CD    . PRO B  1  69   ? -4.519  14.207  132.064 1.00 107.50 ? 69   PRO B CD    1 
ATOM   2276  N  N     . GLY B  1  70   ? -6.112  17.828  129.474 1.00 103.36 ? 70   GLY B N     1 
ATOM   2277  C  CA    . GLY B  1  70   ? -6.124  19.272  129.414 1.00 111.57 ? 70   GLY B CA    1 
ATOM   2278  C  C     . GLY B  1  70   ? -4.771  19.824  129.017 1.00 112.32 ? 70   GLY B C     1 
ATOM   2279  O  O     . GLY B  1  70   ? -4.602  21.040  128.925 1.00 110.60 ? 70   GLY B O     1 
ATOM   2280  N  N     . VAL B  1  71   ? -3.805  18.943  128.760 1.00 115.21 ? 71   VAL B N     1 
ATOM   2281  C  CA    . VAL B  1  71   ? -2.553  19.405  128.173 1.00 109.08 ? 71   VAL B CA    1 
ATOM   2282  C  C     . VAL B  1  71   ? -2.174  18.529  126.984 1.00 103.62 ? 71   VAL B C     1 
ATOM   2283  O  O     . VAL B  1  71   ? -2.189  17.300  127.075 1.00 97.78  ? 71   VAL B O     1 
ATOM   2284  C  CB    . VAL B  1  71   ? -1.408  19.394  129.195 1.00 104.25 ? 71   VAL B CB    1 
ATOM   2285  C  CG1   . VAL B  1  71   ? -0.102  19.767  128.520 1.00 101.96 ? 71   VAL B CG1   1 
ATOM   2286  C  CG2   . VAL B  1  71   ? -1.715  20.346  130.340 1.00 108.55 ? 71   VAL B CG2   1 
ATOM   2287  N  N     . LYS B  1  72   ? -1.831  19.170  125.872 1.00 104.79 ? 72   LYS B N     1 
ATOM   2288  C  CA    . LYS B  1  72   ? -1.565  18.455  124.629 1.00 104.22 ? 72   LYS B CA    1 
ATOM   2289  C  C     . LYS B  1  72   ? -0.364  17.513  124.716 1.00 101.29 ? 72   LYS B C     1 
ATOM   2290  O  O     . LYS B  1  72   ? -0.504  16.303  124.531 1.00 102.30 ? 72   LYS B O     1 
ATOM   2291  C  CB    . LYS B  1  72   ? -1.396  19.436  123.465 1.00 101.01 ? 72   LYS B CB    1 
ATOM   2292  C  CG    . LYS B  1  72   ? -1.245  18.753  122.117 1.00 110.15 ? 72   LYS B CG    1 
ATOM   2293  C  CD    . LYS B  1  72   ? -1.298  19.747  120.967 1.00 120.33 ? 72   LYS B CD    1 
ATOM   2294  C  CE    . LYS B  1  72   ? -1.179  19.035  119.627 1.00 128.96 ? 72   LYS B CE    1 
ATOM   2295  N  NZ    . LYS B  1  72   ? -1.355  19.967  118.481 1.00 128.56 ? 72   LYS B NZ    1 
ATOM   2296  N  N     . GLU B  1  73   ? 0.811   18.067  125.002 1.00 91.16  ? 73   GLU B N     1 
ATOM   2297  C  CA    . GLU B  1  73   ? 2.033   17.271  125.041 1.00 88.34  ? 73   GLU B CA    1 
ATOM   2298  C  C     . GLU B  1  73   ? 2.088   16.291  126.205 1.00 85.78  ? 73   GLU B C     1 
ATOM   2299  O  O     . GLU B  1  73   ? 1.976   16.686  127.361 1.00 90.46  ? 73   GLU B O     1 
ATOM   2300  C  CB    . GLU B  1  73   ? 3.268   18.172  125.073 1.00 90.92  ? 73   GLU B CB    1 
ATOM   2301  C  CG    . GLU B  1  73   ? 3.078   19.473  125.813 1.00 86.98  ? 73   GLU B CG    1 
ATOM   2302  C  CD    . GLU B  1  73   ? 2.427   20.523  124.947 1.00 93.55  ? 73   GLU B CD    1 
ATOM   2303  O  OE1   . GLU B  1  73   ? 1.187   20.643  125.006 1.00 104.94 ? 73   GLU B OE1   1 
ATOM   2304  O  OE2   . GLU B  1  73   ? 3.148   21.219  124.200 1.00 87.43  ? 73   GLU B OE2   1 
ATOM   2305  N  N     . ASP B  1  74   ? 2.278   15.012  125.889 1.00 87.76  ? 74   ASP B N     1 
ATOM   2306  C  CA    . ASP B  1  74   ? 2.465   13.985  126.909 1.00 94.16  ? 74   ASP B CA    1 
ATOM   2307  C  C     . ASP B  1  74   ? 3.703   14.267  127.755 1.00 92.05  ? 74   ASP B C     1 
ATOM   2308  O  O     . ASP B  1  74   ? 4.576   15.041  127.357 1.00 90.33  ? 74   ASP B O     1 
ATOM   2309  C  CB    . ASP B  1  74   ? 2.551   12.587  126.283 1.00 100.08 ? 74   ASP B CB    1 
ATOM   2310  C  CG    . ASP B  1  74   ? 3.571   12.504  125.160 1.00 96.84  ? 74   ASP B CG    1 
ATOM   2311  O  OD1   . ASP B  1  74   ? 4.784   12.583  125.449 1.00 93.93  ? 74   ASP B OD1   1 
ATOM   2312  O  OD2   . ASP B  1  74   ? 3.160   12.350  123.988 1.00 93.95  ? 74   ASP B OD2   1 
ATOM   2313  N  N     . VAL B  1  75   ? 3.769   13.630  128.920 1.00 90.45  ? 75   VAL B N     1 
ATOM   2314  C  CA    . VAL B  1  75   ? 4.824   13.887  129.895 1.00 94.52  ? 75   VAL B CA    1 
ATOM   2315  C  C     . VAL B  1  75   ? 6.219   13.894  129.272 1.00 90.00  ? 75   VAL B C     1 
ATOM   2316  O  O     . VAL B  1  75   ? 7.065   14.729  129.616 1.00 80.02  ? 75   VAL B O     1 
ATOM   2317  C  CB    . VAL B  1  75   ? 4.787   12.849  131.026 1.00 102.81 ? 75   VAL B CB    1 
ATOM   2318  C  CG1   . VAL B  1  75   ? 5.720   13.263  132.151 1.00 100.70 ? 75   VAL B CG1   1 
ATOM   2319  C  CG2   . VAL B  1  75   ? 3.364   12.677  131.536 1.00 98.23  ? 75   VAL B CG2   1 
ATOM   2320  N  N     . VAL B  1  76   ? 6.447   12.960  128.354 1.00 91.07  ? 76   VAL B N     1 
ATOM   2321  C  CA    . VAL B  1  76   ? 7.741   12.819  127.696 1.00 86.47  ? 76   VAL B CA    1 
ATOM   2322  C  C     . VAL B  1  76   ? 8.153   14.096  126.972 1.00 81.48  ? 76   VAL B C     1 
ATOM   2323  O  O     . VAL B  1  76   ? 9.261   14.607  127.167 1.00 74.57  ? 76   VAL B O     1 
ATOM   2324  C  CB    . VAL B  1  76   ? 7.730   11.664  126.682 1.00 88.51  ? 76   VAL B CB    1 
ATOM   2325  C  CG1   . VAL B  1  76   ? 9.140   11.368  126.221 1.00 82.22  ? 76   VAL B CG1   1 
ATOM   2326  C  CG2   . VAL B  1  76   ? 7.097   10.422  127.294 1.00 97.93  ? 76   VAL B CG2   1 
ATOM   2327  N  N     . GLU B  1  77   ? 7.260   14.609  126.132 1.00 81.01  ? 77   GLU B N     1 
ATOM   2328  C  CA    . GLU B  1  77   ? 7.545   15.831  125.393 1.00 80.22  ? 77   GLU B CA    1 
ATOM   2329  C  C     . GLU B  1  77   ? 7.907   16.940  126.373 1.00 76.67  ? 77   GLU B C     1 
ATOM   2330  O  O     . GLU B  1  77   ? 8.816   17.745  126.134 1.00 76.04  ? 77   GLU B O     1 
ATOM   2331  C  CB    . GLU B  1  77   ? 6.342   16.238  124.539 1.00 85.07  ? 77   GLU B CB    1 
ATOM   2332  C  CG    . GLU B  1  77   ? 6.589   17.437  123.623 1.00 86.24  ? 77   GLU B CG    1 
ATOM   2333  C  CD    . GLU B  1  77   ? 7.544   17.133  122.474 1.00 81.69  ? 77   GLU B CD    1 
ATOM   2334  O  OE1   . GLU B  1  77   ? 8.198   18.078  121.983 1.00 78.34  ? 77   GLU B OE1   1 
ATOM   2335  O  OE2   . GLU B  1  77   ? 7.634   15.958  122.055 1.00 81.34  ? 77   GLU B OE2   1 
ATOM   2336  N  N     . ILE B  1  78   ? 7.204   16.964  127.495 1.00 81.28  ? 78   ILE B N     1 
ATOM   2337  C  CA    . ILE B  1  78   ? 7.428   18.000  128.486 1.00 81.48  ? 78   ILE B CA    1 
ATOM   2338  C  C     . ILE B  1  78   ? 8.837   17.901  129.056 1.00 71.99  ? 78   ILE B C     1 
ATOM   2339  O  O     . ILE B  1  78   ? 9.578   18.888  129.087 1.00 66.51  ? 78   ILE B O     1 
ATOM   2340  C  CB    . ILE B  1  78   ? 6.386   17.938  129.615 1.00 84.37  ? 78   ILE B CB    1 
ATOM   2341  C  CG1   . ILE B  1  78   ? 4.996   17.677  129.031 1.00 87.20  ? 78   ILE B CG1   1 
ATOM   2342  C  CG2   . ILE B  1  78   ? 6.401   19.228  130.426 1.00 77.40  ? 78   ILE B CG2   1 
ATOM   2343  C  CD1   . ILE B  1  78   ? 3.902   17.562  130.070 1.00 89.67  ? 78   ILE B CD1   1 
ATOM   2344  N  N     . ILE B  1  79   ? 9.214   16.706  129.496 1.00 72.50  ? 79   ILE B N     1 
ATOM   2345  C  CA    . ILE B  1  79   ? 10.542  16.531  130.064 1.00 75.08  ? 79   ILE B CA    1 
ATOM   2346  C  C     . ILE B  1  79   ? 11.612  16.870  129.030 1.00 72.70  ? 79   ILE B C     1 
ATOM   2347  O  O     . ILE B  1  79   ? 12.674  17.368  129.390 1.00 66.86  ? 79   ILE B O     1 
ATOM   2348  C  CB    . ILE B  1  79   ? 10.773  15.116  130.656 1.00 78.30  ? 79   ILE B CB    1 
ATOM   2349  C  CG1   . ILE B  1  79   ? 10.862  14.070  129.548 1.00 89.33  ? 79   ILE B CG1   1 
ATOM   2350  C  CG2   . ILE B  1  79   ? 9.676   14.755  131.642 1.00 73.95  ? 79   ILE B CG2   1 
ATOM   2351  C  CD1   . ILE B  1  79   ? 10.965  12.643  130.065 1.00 97.71  ? 79   ILE B CD1   1 
ATOM   2352  N  N     . LEU B  1  80   ? 11.329  16.615  127.752 1.00 78.49  ? 80   LEU B N     1 
ATOM   2353  C  CA    . LEU B  1  80   ? 12.259  16.972  126.674 1.00 69.64  ? 80   LEU B CA    1 
ATOM   2354  C  C     . LEU B  1  80   ? 12.462  18.490  126.616 1.00 69.96  ? 80   LEU B C     1 
ATOM   2355  O  O     . LEU B  1  80   ? 13.603  18.993  126.699 1.00 65.66  ? 80   LEU B O     1 
ATOM   2356  C  CB    . LEU B  1  80   ? 11.732  16.457  125.336 1.00 64.70  ? 80   LEU B CB    1 
ATOM   2357  C  CG    . LEU B  1  80   ? 12.255  15.134  124.783 1.00 58.61  ? 80   LEU B CG    1 
ATOM   2358  C  CD1   . LEU B  1  80   ? 12.348  14.095  125.879 1.00 71.02  ? 80   LEU B CD1   1 
ATOM   2359  C  CD2   . LEU B  1  80   ? 11.368  14.645  123.650 1.00 62.64  ? 80   LEU B CD2   1 
ATOM   2360  N  N     . ASN B  1  81   ? 11.352  19.219  126.488 1.00 72.75  ? 81   ASN B N     1 
ATOM   2361  C  CA    . ASN B  1  81   ? 11.412  20.674  126.523 1.00 72.67  ? 81   ASN B CA    1 
ATOM   2362  C  C     . ASN B  1  81   ? 12.220  21.133  127.726 1.00 71.54  ? 81   ASN B C     1 
ATOM   2363  O  O     . ASN B  1  81   ? 13.016  22.067  127.640 1.00 65.53  ? 81   ASN B O     1 
ATOM   2364  C  CB    . ASN B  1  81   ? 10.013  21.271  126.558 1.00 70.11  ? 81   ASN B CB    1 
ATOM   2365  C  CG    . ASN B  1  81   ? 9.257   21.055  125.257 1.00 81.06  ? 81   ASN B CG    1 
ATOM   2366  O  OD1   . ASN B  1  81   ? 8.354   20.219  125.184 1.00 81.20  ? 81   ASN B OD1   1 
ATOM   2367  N  ND2   . ASN B  1  81   ? 9.622   21.813  124.220 1.00 85.31  ? 81   ASN B ND2   1 
ATOM   2368  N  N     . LEU B  1  82   ? 12.030  20.455  128.850 1.00 72.26  ? 82   LEU B N     1 
ATOM   2369  C  CA    . LEU B  1  82   ? 12.798  20.764  130.047 1.00 73.23  ? 82   LEU B CA    1 
ATOM   2370  C  C     . LEU B  1  82   ? 14.280  20.592  129.783 1.00 69.18  ? 82   LEU B C     1 
ATOM   2371  O  O     . LEU B  1  82   ? 15.070  21.475  130.100 1.00 74.16  ? 82   LEU B O     1 
ATOM   2372  C  CB    . LEU B  1  82   ? 12.353  19.886  131.215 1.00 81.06  ? 82   LEU B CB    1 
ATOM   2373  C  CG    . LEU B  1  82   ? 11.002  20.273  131.819 1.00 75.24  ? 82   LEU B CG    1 
ATOM   2374  C  CD1   . LEU B  1  82   ? 10.584  19.267  132.874 1.00 63.15  ? 82   LEU B CD1   1 
ATOM   2375  C  CD2   . LEU B  1  82   ? 11.073  21.680  132.396 1.00 70.37  ? 82   LEU B CD2   1 
ATOM   2376  N  N     . LYS B  1  83   ? 14.653  19.458  129.198 1.00 72.72  ? 83   LYS B N     1 
ATOM   2377  C  CA    . LYS B  1  83   ? 16.043  19.217  128.832 1.00 68.03  ? 83   LYS B CA    1 
ATOM   2378  C  C     . LYS B  1  83   ? 16.578  20.420  128.075 1.00 69.28  ? 83   LYS B C     1 
ATOM   2379  O  O     . LYS B  1  83   ? 17.759  20.755  128.185 1.00 65.88  ? 83   LYS B O     1 
ATOM   2380  C  CB    . LYS B  1  83   ? 16.168  17.978  127.956 1.00 62.29  ? 83   LYS B CB    1 
ATOM   2381  C  CG    . LYS B  1  83   ? 15.956  16.672  128.674 1.00 63.20  ? 83   LYS B CG    1 
ATOM   2382  C  CD    . LYS B  1  83   ? 16.152  15.503  127.725 1.00 61.45  ? 83   LYS B CD    1 
ATOM   2383  C  CE    . LYS B  1  83   ? 16.045  14.170  128.445 1.00 65.93  ? 83   LYS B CE    1 
ATOM   2384  N  NZ    . LYS B  1  83   ? 16.221  13.042  127.489 1.00 72.16  ? 83   LYS B NZ    1 
ATOM   2385  N  N     . GLU B  1  84   ? 15.710  21.077  127.309 1.00 70.20  ? 84   GLU B N     1 
ATOM   2386  C  CA    . GLU B  1  84   ? 16.165  22.244  126.551 1.00 73.73  ? 84   GLU B CA    1 
ATOM   2387  C  C     . GLU B  1  84   ? 16.269  23.541  127.363 1.00 77.22  ? 84   GLU B C     1 
ATOM   2388  O  O     . GLU B  1  84   ? 16.704  24.569  126.851 1.00 79.38  ? 84   GLU B O     1 
ATOM   2389  C  CB    . GLU B  1  84   ? 15.322  22.441  125.295 1.00 75.78  ? 84   GLU B CB    1 
ATOM   2390  C  CG    . GLU B  1  84   ? 15.376  21.240  124.359 1.00 78.52  ? 84   GLU B CG    1 
ATOM   2391  C  CD    . GLU B  1  84   ? 15.095  21.600  122.920 1.00 85.19  ? 84   GLU B CD    1 
ATOM   2392  O  OE1   . GLU B  1  84   ? 15.028  22.809  122.607 1.00 87.34  ? 84   GLU B OE1   1 
ATOM   2393  O  OE2   . GLU B  1  84   ? 14.946  20.668  122.101 1.00 87.71  ? 84   GLU B OE2   1 
ATOM   2394  N  N     . LEU B  1  85   ? 15.904  23.487  128.636 1.00 79.83  ? 85   LEU B N     1 
ATOM   2395  C  CA    . LEU B  1  85   ? 15.964  24.673  129.488 1.00 80.38  ? 85   LEU B CA    1 
ATOM   2396  C  C     . LEU B  1  85   ? 17.405  25.046  129.849 1.00 77.84  ? 85   LEU B C     1 
ATOM   2397  O  O     . LEU B  1  85   ? 18.145  24.240  130.415 1.00 79.02  ? 85   LEU B O     1 
ATOM   2398  C  CB    . LEU B  1  85   ? 15.130  24.444  130.751 1.00 81.04  ? 85   LEU B CB    1 
ATOM   2399  C  CG    . LEU B  1  85   ? 14.987  25.601  131.740 1.00 76.31  ? 85   LEU B CG    1 
ATOM   2400  C  CD1   . LEU B  1  85   ? 14.469  26.856  131.059 1.00 80.10  ? 85   LEU B CD1   1 
ATOM   2401  C  CD2   . LEU B  1  85   ? 14.071  25.186  132.874 1.00 77.17  ? 85   LEU B CD2   1 
ATOM   2402  N  N     . VAL B  1  86   ? 17.796  26.271  129.513 1.00 74.96  ? 86   VAL B N     1 
ATOM   2403  C  CA    . VAL B  1  86   ? 19.143  26.753  129.805 1.00 76.36  ? 86   VAL B CA    1 
ATOM   2404  C  C     . VAL B  1  86   ? 19.173  27.658  131.035 1.00 81.23  ? 86   VAL B C     1 
ATOM   2405  O  O     . VAL B  1  86   ? 18.729  28.804  130.984 1.00 85.84  ? 86   VAL B O     1 
ATOM   2406  C  CB    . VAL B  1  86   ? 19.733  27.521  128.611 1.00 77.43  ? 86   VAL B CB    1 
ATOM   2407  C  CG1   . VAL B  1  86   ? 21.157  27.978  128.917 1.00 76.17  ? 86   VAL B CG1   1 
ATOM   2408  C  CG2   . VAL B  1  86   ? 19.705  26.649  127.375 1.00 83.73  ? 86   VAL B CG2   1 
ATOM   2409  N  N     . VAL B  1  87   ? 19.716  27.146  132.135 1.00 80.31  ? 87   VAL B N     1 
ATOM   2410  C  CA    . VAL B  1  87   ? 19.681  27.861  133.409 1.00 80.09  ? 87   VAL B CA    1 
ATOM   2411  C  C     . VAL B  1  87   ? 21.070  28.263  133.900 1.00 75.48  ? 87   VAL B C     1 
ATOM   2412  O  O     . VAL B  1  87   ? 22.006  27.465  133.879 1.00 70.83  ? 87   VAL B O     1 
ATOM   2413  C  CB    . VAL B  1  87   ? 18.970  27.026  134.492 1.00 76.49  ? 87   VAL B CB    1 
ATOM   2414  C  CG1   . VAL B  1  87   ? 19.050  27.719  135.843 1.00 79.27  ? 87   VAL B CG1   1 
ATOM   2415  C  CG2   . VAL B  1  87   ? 17.523  26.771  134.095 1.00 72.30  ? 87   VAL B CG2   1 
ATOM   2416  N  N     . ARG B  1  88   ? 21.191  29.504  134.360 1.00 79.66  ? 88   ARG B N     1 
ATOM   2417  C  CA    . ARG B  1  88   ? 22.489  30.060  134.722 1.00 86.14  ? 88   ARG B CA    1 
ATOM   2418  C  C     . ARG B  1  88   ? 22.540  30.477  136.190 1.00 90.05  ? 88   ARG B C     1 
ATOM   2419  O  O     . ARG B  1  88   ? 21.866  31.421  136.596 1.00 91.67  ? 88   ARG B O     1 
ATOM   2420  C  CB    . ARG B  1  88   ? 22.778  31.261  133.825 1.00 87.38  ? 88   ARG B CB    1 
ATOM   2421  C  CG    . ARG B  1  88   ? 24.107  31.959  134.038 1.00 80.85  ? 88   ARG B CG    1 
ATOM   2422  C  CD    . ARG B  1  88   ? 24.186  33.114  133.055 1.00 88.44  ? 88   ARG B CD    1 
ATOM   2423  N  NE    . ARG B  1  88   ? 25.452  33.835  133.082 1.00 91.17  ? 88   ARG B NE    1 
ATOM   2424  C  CZ    . ARG B  1  88   ? 25.786  34.766  132.194 1.00 94.18  ? 88   ARG B CZ    1 
ATOM   2425  N  NH1   . ARG B  1  88   ? 24.947  35.078  131.213 1.00 88.02  ? 88   ARG B NH1   1 
ATOM   2426  N  NH2   . ARG B  1  88   ? 26.958  35.383  132.281 1.00 92.64  ? 88   ARG B NH2   1 
ATOM   2427  N  N     . PHE B  1  89   ? 23.341  29.770  136.982 1.00 85.82  ? 89   PHE B N     1 
ATOM   2428  C  CA    . PHE B  1  89   ? 23.507  30.106  138.392 1.00 84.56  ? 89   PHE B CA    1 
ATOM   2429  C  C     . PHE B  1  89   ? 24.483  31.269  138.559 1.00 89.58  ? 89   PHE B C     1 
ATOM   2430  O  O     . PHE B  1  89   ? 25.654  31.164  138.195 1.00 88.16  ? 89   PHE B O     1 
ATOM   2431  C  CB    . PHE B  1  89   ? 24.005  28.897  139.195 1.00 80.69  ? 89   PHE B CB    1 
ATOM   2432  C  CG    . PHE B  1  89   ? 22.997  27.783  139.323 1.00 78.64  ? 89   PHE B CG    1 
ATOM   2433  C  CD1   . PHE B  1  89   ? 21.745  27.878  138.726 1.00 74.70  ? 89   PHE B CD1   1 
ATOM   2434  C  CD2   . PHE B  1  89   ? 23.301  26.641  140.054 1.00 76.23  ? 89   PHE B CD2   1 
ATOM   2435  C  CE1   . PHE B  1  89   ? 20.817  26.848  138.847 1.00 67.72  ? 89   PHE B CE1   1 
ATOM   2436  C  CE2   . PHE B  1  89   ? 22.379  25.612  140.181 1.00 75.14  ? 89   PHE B CE2   1 
ATOM   2437  C  CZ    . PHE B  1  89   ? 21.135  25.716  139.574 1.00 67.89  ? 89   PHE B CZ    1 
ATOM   2438  N  N     . LEU B  1  90   ? 24.001  32.375  139.116 1.00 94.27  ? 90   LEU B N     1 
ATOM   2439  C  CA    . LEU B  1  90   ? 24.847  33.540  139.348 1.00 94.67  ? 90   LEU B CA    1 
ATOM   2440  C  C     . LEU B  1  90   ? 25.644  33.415  140.649 1.00 100.14 ? 90   LEU B C     1 
ATOM   2441  O  O     . LEU B  1  90   ? 26.620  34.135  140.864 1.00 99.57  ? 90   LEU B O     1 
ATOM   2442  C  CB    . LEU B  1  90   ? 24.006  34.816  139.355 1.00 97.26  ? 90   LEU B CB    1 
ATOM   2443  C  CG    . LEU B  1  90   ? 23.204  35.087  138.082 1.00 96.66  ? 90   LEU B CG    1 
ATOM   2444  C  CD1   . LEU B  1  90   ? 22.392  36.365  138.221 1.00 102.64 ? 90   LEU B CD1   1 
ATOM   2445  C  CD2   . LEU B  1  90   ? 24.128  35.163  136.879 1.00 99.03  ? 90   LEU B CD2   1 
ATOM   2446  N  N     . ASN B  1  91   ? 25.218  32.499  141.514 1.00 98.72  ? 91   ASN B N     1 
ATOM   2447  C  CA    . ASN B  1  91   ? 25.937  32.207  142.747 1.00 94.82  ? 91   ASN B CA    1 
ATOM   2448  C  C     . ASN B  1  91   ? 26.950  31.095  142.517 1.00 94.54  ? 91   ASN B C     1 
ATOM   2449  O  O     . ASN B  1  91   ? 26.577  29.933  142.374 1.00 95.18  ? 91   ASN B O     1 
ATOM   2450  C  CB    . ASN B  1  91   ? 24.959  31.798  143.850 1.00 100.92 ? 91   ASN B CB    1 
ATOM   2451  C  CG    . ASN B  1  91   ? 25.639  31.598  145.198 1.00 102.44 ? 91   ASN B CG    1 
ATOM   2452  O  OD1   . ASN B  1  91   ? 26.839  31.328  145.271 1.00 99.27  ? 91   ASN B OD1   1 
ATOM   2453  N  ND2   . ASN B  1  91   ? 24.867  31.726  146.274 1.00 101.23 ? 91   ASN B ND2   1 
ATOM   2454  N  N     . PRO B  1  92   ? 28.241  31.449  142.486 1.00 94.15  ? 92   PRO B N     1 
ATOM   2455  C  CA    . PRO B  1  92   ? 29.315  30.485  142.225 1.00 93.51  ? 92   PRO B CA    1 
ATOM   2456  C  C     . PRO B  1  92   ? 29.266  29.248  143.128 1.00 96.32  ? 92   PRO B C     1 
ATOM   2457  O  O     . PRO B  1  92   ? 29.811  28.209  142.759 1.00 99.29  ? 92   PRO B O     1 
ATOM   2458  C  CB    . PRO B  1  92   ? 30.591  31.296  142.500 1.00 95.67  ? 92   PRO B CB    1 
ATOM   2459  C  CG    . PRO B  1  92   ? 30.141  32.513  143.253 1.00 98.17  ? 92   PRO B CG    1 
ATOM   2460  C  CD    . PRO B  1  92   ? 28.765  32.797  142.754 1.00 94.84  ? 92   PRO B CD    1 
ATOM   2461  N  N     . SER B  1  93   ? 28.622  29.357  144.286 1.00 96.93  ? 93   SER B N     1 
ATOM   2462  C  CA    . SER B  1  93   ? 28.604  28.266  145.257 1.00 97.47  ? 93   SER B CA    1 
ATOM   2463  C  C     . SER B  1  93   ? 27.312  27.445  145.217 1.00 96.08  ? 93   SER B C     1 
ATOM   2464  O  O     . SER B  1  93   ? 27.155  26.483  145.971 1.00 96.90  ? 93   SER B O     1 
ATOM   2465  C  CB    . SER B  1  93   ? 28.827  28.809  146.672 1.00 96.13  ? 93   SER B CB    1 
ATOM   2466  O  OG    . SER B  1  93   ? 30.089  29.440  146.784 1.00 91.80  ? 93   SER B OG    1 
ATOM   2467  N  N     . LEU B  1  94   ? 26.392  27.826  144.337 1.00 90.27  ? 94   LEU B N     1 
ATOM   2468  C  CA    . LEU B  1  94   ? 25.086  27.177  144.256 1.00 82.80  ? 94   LEU B CA    1 
ATOM   2469  C  C     . LEU B  1  94   ? 25.153  25.843  143.520 1.00 80.11  ? 94   LEU B C     1 
ATOM   2470  O  O     . LEU B  1  94   ? 25.496  25.799  142.341 1.00 89.93  ? 94   LEU B O     1 
ATOM   2471  C  CB    . LEU B  1  94   ? 24.091  28.095  143.549 1.00 84.06  ? 94   LEU B CB    1 
ATOM   2472  C  CG    . LEU B  1  94   ? 22.636  27.992  144.014 1.00 78.84  ? 94   LEU B CG    1 
ATOM   2473  C  CD1   . LEU B  1  94   ? 21.624  28.723  143.137 1.00 70.55  ? 94   LEU B CD1   1 
ATOM   2474  C  CD2   . LEU B  1  94   ? 22.181  26.602  144.441 1.00 75.40  ? 94   LEU B CD2   1 
ATOM   2475  N  N     . GLN B  1  95   ? 24.799  24.762  144.209 1.00 73.24  ? 95   GLN B N     1 
ATOM   2476  C  CA    . GLN B  1  95   ? 24.927  23.419  143.652 1.00 72.20  ? 95   GLN B CA    1 
ATOM   2477  C  C     . GLN B  1  95   ? 23.607  22.824  143.167 1.00 65.21  ? 95   GLN B C     1 
ATOM   2478  O  O     . GLN B  1  95   ? 23.600  21.754  142.558 1.00 67.94  ? 95   GLN B O     1 
ATOM   2479  C  CB    . GLN B  1  95   ? 25.563  22.472  144.672 1.00 76.76  ? 95   GLN B CB    1 
ATOM   2480  C  CG    . GLN B  1  95   ? 26.836  22.997  145.321 1.00 87.44  ? 95   GLN B CG    1 
ATOM   2481  C  CD    . GLN B  1  95   ? 28.040  22.945  144.399 1.00 100.04 ? 95   GLN B CD    1 
ATOM   2482  O  OE1   . GLN B  1  95   ? 27.956  22.458  143.271 1.00 95.60  ? 95   GLN B OE1   1 
ATOM   2483  N  NE2   . GLN B  1  95   ? 29.174  23.446  144.880 1.00 105.11 ? 95   GLN B NE2   1 
ATOM   2484  N  N     . THR B  1  96   ? 22.495  23.503  143.442 1.00 68.68  ? 96   THR B N     1 
ATOM   2485  C  CA    . THR B  1  96   ? 21.175  23.017  143.017 1.00 74.07  ? 96   THR B CA    1 
ATOM   2486  C  C     . THR B  1  96   ? 20.020  23.941  143.407 1.00 64.70  ? 96   THR B C     1 
ATOM   2487  O  O     . THR B  1  96   ? 20.145  24.760  144.312 1.00 61.56  ? 96   THR B O     1 
ATOM   2488  C  CB    . THR B  1  96   ? 20.870  21.593  143.549 1.00 74.02  ? 96   THR B CB    1 
ATOM   2489  O  OG1   . THR B  1  96   ? 19.465  21.326  143.431 1.00 68.81  ? 96   THR B OG1   1 
ATOM   2490  C  CG2   . THR B  1  96   ? 21.281  21.465  145.004 1.00 76.84  ? 96   THR B CG2   1 
ATOM   2491  N  N     . VAL B  1  97   ? 18.895  23.787  142.714 1.00 59.40  ? 97   VAL B N     1 
ATOM   2492  C  CA    . VAL B  1  97   ? 17.729  24.635  142.915 1.00 61.40  ? 97   VAL B CA    1 
ATOM   2493  C  C     . VAL B  1  97   ? 16.474  23.878  142.511 1.00 70.15  ? 97   VAL B C     1 
ATOM   2494  O  O     . VAL B  1  97   ? 16.541  22.963  141.701 1.00 71.71  ? 97   VAL B O     1 
ATOM   2495  C  CB    . VAL B  1  97   ? 17.810  25.918  142.066 1.00 61.76  ? 97   VAL B CB    1 
ATOM   2496  C  CG1   . VAL B  1  97   ? 16.504  26.693  142.142 1.00 71.73  ? 97   VAL B CG1   1 
ATOM   2497  C  CG2   . VAL B  1  97   ? 18.969  26.791  142.519 1.00 65.65  ? 97   VAL B CG2   1 
ATOM   2498  N  N     . THR B  1  98   ? 15.331  24.245  143.083 1.00 71.50  ? 98   THR B N     1 
ATOM   2499  C  CA    . THR B  1  98   ? 14.059  23.704  142.622 1.00 73.90  ? 98   THR B CA    1 
ATOM   2500  C  C     . THR B  1  98   ? 13.192  24.827  142.081 1.00 75.73  ? 98   THR B C     1 
ATOM   2501  O  O     . THR B  1  98   ? 12.976  25.834  142.750 1.00 78.79  ? 98   THR B O     1 
ATOM   2502  C  CB    . THR B  1  98   ? 13.291  22.953  143.727 1.00 75.40  ? 98   THR B CB    1 
ATOM   2503  O  OG1   . THR B  1  98   ? 14.022  21.782  144.117 1.00 78.59  ? 98   THR B OG1   1 
ATOM   2504  C  CG2   . THR B  1  98   ? 11.915  22.536  143.222 1.00 75.87  ? 98   THR B CG2   1 
ATOM   2505  N  N     . LEU B  1  99   ? 12.711  24.657  140.857 1.00 81.30  ? 99   LEU B N     1 
ATOM   2506  C  CA    . LEU B  1  99   ? 11.845  25.650  140.248 1.00 79.49  ? 99   LEU B CA    1 
ATOM   2507  C  C     . LEU B  1  99   ? 10.421  25.141  140.271 1.00 80.91  ? 99   LEU B C     1 
ATOM   2508  O  O     . LEU B  1  99   ? 10.156  23.984  139.944 1.00 81.72  ? 99   LEU B O     1 
ATOM   2509  C  CB    . LEU B  1  99   ? 12.283  25.952  138.815 1.00 87.67  ? 99   LEU B CB    1 
ATOM   2510  C  CG    . LEU B  1  99   ? 13.462  26.911  138.625 1.00 85.43  ? 99   LEU B CG    1 
ATOM   2511  C  CD1   . LEU B  1  99   ? 14.696  26.416  139.354 1.00 71.70  ? 99   LEU B CD1   1 
ATOM   2512  C  CD2   . LEU B  1  99   ? 13.756  27.111  137.141 1.00 90.86  ? 99   LEU B CD2   1 
ATOM   2513  N  N     . LEU B  1  100  ? 9.504   26.005  140.681 1.00 86.49  ? 100  LEU B N     1 
ATOM   2514  C  CA    . LEU B  1  100  ? 8.105   25.630  140.742 1.00 87.07  ? 100  LEU B CA    1 
ATOM   2515  C  C     . LEU B  1  100  ? 7.360   26.374  139.658 1.00 86.30  ? 100  LEU B C     1 
ATOM   2516  O  O     . LEU B  1  100  ? 7.662   27.538  139.368 1.00 83.40  ? 100  LEU B O     1 
ATOM   2517  C  CB    . LEU B  1  100  ? 7.500   25.970  142.108 1.00 89.23  ? 100  LEU B CB    1 
ATOM   2518  C  CG    . LEU B  1  100  ? 8.212   25.511  143.383 1.00 90.41  ? 100  LEU B CG    1 
ATOM   2519  C  CD1   . LEU B  1  100  ? 9.230   26.552  143.835 1.00 88.02  ? 100  LEU B CD1   1 
ATOM   2520  C  CD2   . LEU B  1  100  ? 7.203   25.243  144.492 1.00 95.13  ? 100  LEU B CD2   1 
ATOM   2521  N  N     . LEU B  1  101  ? 6.390   25.696  139.057 1.00 81.43  ? 101  LEU B N     1 
ATOM   2522  C  CA    . LEU B  1  101  ? 5.528   26.333  138.078 1.00 90.59  ? 101  LEU B CA    1 
ATOM   2523  C  C     . LEU B  1  101  ? 4.107   25.796  138.177 1.00 94.85  ? 101  LEU B C     1 
ATOM   2524  O  O     . LEU B  1  101  ? 3.886   24.584  138.188 1.00 89.33  ? 101  LEU B O     1 
ATOM   2525  C  CB    . LEU B  1  101  ? 6.080   26.143  136.663 1.00 96.18  ? 101  LEU B CB    1 
ATOM   2526  C  CG    . LEU B  1  101  ? 5.242   26.726  135.523 1.00 98.70  ? 101  LEU B CG    1 
ATOM   2527  C  CD1   . LEU B  1  101  ? 6.135   27.426  134.517 1.00 101.26 ? 101  LEU B CD1   1 
ATOM   2528  C  CD2   . LEU B  1  101  ? 4.395   25.645  134.854 1.00 97.02  ? 101  LEU B CD2   1 
ATOM   2529  N  N     . LYS B  1  102  ? 3.148   26.712  138.263 1.00 97.20  ? 102  LYS B N     1 
ATOM   2530  C  CA    . LYS B  1  102  ? 1.742   26.345  138.233 1.00 98.39  ? 102  LYS B CA    1 
ATOM   2531  C  C     . LYS B  1  102  ? 0.959   27.337  137.388 1.00 99.64  ? 102  LYS B C     1 
ATOM   2532  O  O     . LYS B  1  102  ? 1.184   28.546  137.463 1.00 92.63  ? 102  LYS B O     1 
ATOM   2533  C  CB    . LYS B  1  102  ? 1.156   26.283  139.644 1.00 106.45 ? 102  LYS B CB    1 
ATOM   2534  C  CG    . LYS B  1  102  ? -0.201  25.589  139.708 1.00 114.86 ? 102  LYS B CG    1 
ATOM   2535  C  CD    . LYS B  1  102  ? -0.858  25.723  141.080 1.00 121.46 ? 102  LYS B CD    1 
ATOM   2536  C  CE    . LYS B  1  102  ? -1.570  27.064  141.241 1.00 125.71 ? 102  LYS B CE    1 
ATOM   2537  N  NZ    . LYS B  1  102  ? -2.720  27.216  140.298 1.00 113.29 ? 102  LYS B NZ    1 
ATOM   2538  N  N     . ALA B  1  103  ? 0.048   26.811  136.575 1.00 106.35 ? 103  ALA B N     1 
ATOM   2539  C  CA    . ALA B  1  103  ? -0.836  27.633  135.755 1.00 113.14 ? 103  ALA B CA    1 
ATOM   2540  C  C     . ALA B  1  103  ? -1.979  26.773  135.234 1.00 115.74 ? 103  ALA B C     1 
ATOM   2541  O  O     . ALA B  1  103  ? -2.018  25.568  135.492 1.00 113.41 ? 103  ALA B O     1 
ATOM   2542  C  CB    . ALA B  1  103  ? -0.073  28.270  134.603 1.00 106.36 ? 103  ALA B CB    1 
ATOM   2543  N  N     . GLU B  1  104  ? -2.902  27.382  134.498 1.00 115.16 ? 104  GLU B N     1 
ATOM   2544  C  CA    . GLU B  1  104  ? -4.078  26.657  134.035 1.00 114.19 ? 104  GLU B CA    1 
ATOM   2545  C  C     . GLU B  1  104  ? -4.850  27.385  132.941 1.00 116.59 ? 104  GLU B C     1 
ATOM   2546  O  O     . GLU B  1  104  ? -4.408  28.414  132.428 1.00 117.25 ? 104  GLU B O     1 
ATOM   2547  C  CB    . GLU B  1  104  ? -5.001  26.367  135.218 1.00 129.30 ? 104  GLU B CB    1 
ATOM   2548  C  CG    . GLU B  1  104  ? -5.240  27.570  136.119 1.00 130.08 ? 104  GLU B CG    1 
ATOM   2549  C  CD    . GLU B  1  104  ? -6.056  27.227  137.349 1.00 134.84 ? 104  GLU B CD    1 
ATOM   2550  O  OE1   . GLU B  1  104  ? -5.997  27.992  138.336 1.00 138.78 ? 104  GLU B OE1   1 
ATOM   2551  O  OE2   . GLU B  1  104  ? -6.758  26.193  137.329 1.00 134.06 ? 104  GLU B OE2   1 
ATOM   2552  N  N     . GLY B  1  105  ? -6.009  26.834  132.588 1.00 120.72 ? 105  GLY B N     1 
ATOM   2553  C  CA    . GLY B  1  105  ? -6.890  27.446  131.611 1.00 125.93 ? 105  GLY B CA    1 
ATOM   2554  C  C     . GLY B  1  105  ? -6.276  27.481  130.228 1.00 129.96 ? 105  GLY B C     1 
ATOM   2555  O  O     . GLY B  1  105  ? -5.289  26.797  129.967 1.00 133.31 ? 105  GLY B O     1 
ATOM   2556  N  N     . PRO B  1  106  ? -6.856  28.288  129.330 1.00 133.30 ? 106  PRO B N     1 
ATOM   2557  C  CA    . PRO B  1  106  ? -6.363  28.410  127.955 1.00 133.15 ? 106  PRO B CA    1 
ATOM   2558  C  C     . PRO B  1  106  ? -5.075  29.227  127.896 1.00 132.78 ? 106  PRO B C     1 
ATOM   2559  O  O     . PRO B  1  106  ? -5.128  30.439  127.683 1.00 132.11 ? 106  PRO B O     1 
ATOM   2560  C  CB    . PRO B  1  106  ? -7.495  29.158  127.250 1.00 135.25 ? 106  PRO B CB    1 
ATOM   2561  C  CG    . PRO B  1  106  ? -8.114  29.981  128.328 1.00 142.23 ? 106  PRO B CG    1 
ATOM   2562  C  CD    . PRO B  1  106  ? -8.026  29.148  129.579 1.00 140.52 ? 106  PRO B CD    1 
ATOM   2563  N  N     . LYS B  1  107  ? -3.933  28.571  128.086 1.00 129.08 ? 107  LYS B N     1 
ATOM   2564  C  CA    . LYS B  1  107  ? -2.652  29.273  128.093 1.00 125.02 ? 107  LYS B CA    1 
ATOM   2565  C  C     . LYS B  1  107  ? -1.494  28.379  127.661 1.00 116.56 ? 107  LYS B C     1 
ATOM   2566  O  O     . LYS B  1  107  ? -1.486  27.182  127.940 1.00 107.90 ? 107  LYS B O     1 
ATOM   2567  C  CB    . LYS B  1  107  ? -2.364  29.856  129.482 1.00 127.95 ? 107  LYS B CB    1 
ATOM   2568  C  CG    . LYS B  1  107  ? -1.010  30.551  129.599 1.00 119.54 ? 107  LYS B CG    1 
ATOM   2569  C  CD    . LYS B  1  107  ? -0.737  31.015  131.023 1.00 119.85 ? 107  LYS B CD    1 
ATOM   2570  C  CE    . LYS B  1  107  ? 0.604   31.728  131.124 1.00 113.78 ? 107  LYS B CE    1 
ATOM   2571  N  NZ    . LYS B  1  107  ? 0.887   32.188  132.513 1.00 112.73 ? 107  LYS B NZ    1 
ATOM   2572  N  N     . GLU B  1  108  ? -0.517  28.975  126.982 1.00 118.07 ? 108  GLU B N     1 
ATOM   2573  C  CA    . GLU B  1  108  ? 0.700   28.268  126.598 1.00 113.43 ? 108  GLU B CA    1 
ATOM   2574  C  C     . GLU B  1  108  ? 1.862   28.635  127.517 1.00 111.42 ? 108  GLU B C     1 
ATOM   2575  O  O     . GLU B  1  108  ? 2.314   29.782  127.539 1.00 109.16 ? 108  GLU B O     1 
ATOM   2576  C  CB    . GLU B  1  108  ? 1.062   28.560  125.143 1.00 107.68 ? 108  GLU B CB    1 
ATOM   2577  C  CG    . GLU B  1  108  ? 0.144   27.887  124.138 1.00 116.56 ? 108  GLU B CG    1 
ATOM   2578  C  CD    . GLU B  1  108  ? 0.634   28.027  122.709 1.00 119.04 ? 108  GLU B CD    1 
ATOM   2579  O  OE1   . GLU B  1  108  ? 1.644   28.730  122.488 1.00 119.06 ? 108  GLU B OE1   1 
ATOM   2580  O  OE2   . GLU B  1  108  ? 0.008   27.431  121.808 1.00 117.55 ? 108  GLU B OE2   1 
ATOM   2581  N  N     . VAL B  1  109  ? 2.346   27.648  128.264 1.00 106.05 ? 109  VAL B N     1 
ATOM   2582  C  CA    . VAL B  1  109  ? 3.355   27.875  129.291 1.00 102.46 ? 109  VAL B CA    1 
ATOM   2583  C  C     . VAL B  1  109  ? 4.765   27.973  128.723 1.00 99.43  ? 109  VAL B C     1 
ATOM   2584  O  O     . VAL B  1  109  ? 5.214   27.086  127.998 1.00 96.57  ? 109  VAL B O     1 
ATOM   2585  C  CB    . VAL B  1  109  ? 3.335   26.755  130.348 1.00 104.52 ? 109  VAL B CB    1 
ATOM   2586  C  CG1   . VAL B  1  109  ? 4.211   27.130  131.531 1.00 100.80 ? 109  VAL B CG1   1 
ATOM   2587  C  CG2   . VAL B  1  109  ? 1.911   26.484  130.805 1.00 111.31 ? 109  VAL B CG2   1 
ATOM   2588  N  N     . LYS B  1  110  ? 5.467   29.030  129.138 1.00 100.41 ? 110  LYS B N     1 
ATOM   2589  C  CA    . LYS B  1  110  ? 6.824   29.350  128.692 1.00 96.47  ? 110  LYS B CA    1 
ATOM   2590  C  C     . LYS B  1  110  ? 7.767   29.537  129.887 1.00 97.06  ? 110  LYS B C     1 
ATOM   2591  O  O     . LYS B  1  110  ? 7.322   29.803  131.004 1.00 102.85 ? 110  LYS B O     1 
ATOM   2592  C  CB    . LYS B  1  110  ? 6.820   30.607  127.820 1.00 92.89  ? 110  LYS B CB    1 
ATOM   2593  C  CG    . LYS B  1  110  ? 5.887   30.528  126.622 1.00 91.63  ? 110  LYS B CG    1 
ATOM   2594  C  CD    . LYS B  1  110  ? 6.611   30.006  125.392 1.00 98.74  ? 110  LYS B CD    1 
ATOM   2595  C  CE    . LYS B  1  110  ? 5.647   29.779  124.239 1.00 98.56  ? 110  LYS B CE    1 
ATOM   2596  N  NZ    . LYS B  1  110  ? 5.747   28.396  123.696 1.00 93.31  ? 110  LYS B NZ    1 
ATOM   2597  N  N     . ALA B  1  111  ? 9.066   29.377  129.645 1.00 96.63  ? 111  ALA B N     1 
ATOM   2598  C  CA    . ALA B  1  111  ? 10.059  29.223  130.701 1.00 97.31  ? 111  ALA B CA    1 
ATOM   2599  C  C     . ALA B  1  111  ? 10.020  30.388  131.679 1.00 101.93 ? 111  ALA B C     1 
ATOM   2600  O  O     . ALA B  1  111  ? 10.474  30.267  132.815 1.00 101.89 ? 111  ALA B O     1 
ATOM   2601  C  CB    . ALA B  1  111  ? 11.449  29.075  130.108 1.00 96.13  ? 111  ALA B CB    1 
ATOM   2602  N  N     . ARG B  1  112  ? 9.476   31.516  131.233 1.00 106.05 ? 112  ARG B N     1 
ATOM   2603  C  CA    . ARG B  1  112  ? 9.393   32.709  132.072 1.00 107.07 ? 112  ARG B CA    1 
ATOM   2604  C  C     . ARG B  1  112  ? 8.393   32.520  133.214 1.00 103.52 ? 112  ARG B C     1 
ATOM   2605  O  O     . ARG B  1  112  ? 8.457   33.211  134.231 1.00 97.62  ? 112  ARG B O     1 
ATOM   2606  C  CB    . ARG B  1  112  ? 9.022   33.933  131.227 1.00 107.00 ? 112  ARG B CB    1 
ATOM   2607  C  CG    . ARG B  1  112  ? 7.620   33.888  130.626 1.00 108.51 ? 112  ARG B CG    1 
ATOM   2608  C  CD    . ARG B  1  112  ? 7.468   34.877  129.474 1.00 114.26 ? 112  ARG B CD    1 
ATOM   2609  N  NE    . ARG B  1  112  ? 8.389   36.007  129.591 1.00 123.55 ? 112  ARG B NE    1 
ATOM   2610  C  CZ    . ARG B  1  112  ? 9.376   36.264  128.735 1.00 115.45 ? 112  ARG B CZ    1 
ATOM   2611  N  NH1   . ARG B  1  112  ? 9.570   35.477  127.684 1.00 106.34 ? 112  ARG B NH1   1 
ATOM   2612  N  NH2   . ARG B  1  112  ? 10.166  37.314  128.925 1.00 110.26 ? 112  ARG B NH2   1 
ATOM   2613  N  N     . ASP B  1  113  ? 7.480   31.568  133.040 1.00 102.76 ? 113  ASP B N     1 
ATOM   2614  C  CA    . ASP B  1  113  ? 6.440   31.300  134.029 1.00 100.04 ? 113  ASP B CA    1 
ATOM   2615  C  C     . ASP B  1  113  ? 6.979   30.571  135.258 1.00 103.45 ? 113  ASP B C     1 
ATOM   2616  O  O     . ASP B  1  113  ? 6.253   30.356  136.230 1.00 104.59 ? 113  ASP B O     1 
ATOM   2617  C  CB    . ASP B  1  113  ? 5.296   30.499  133.403 1.00 98.37  ? 113  ASP B CB    1 
ATOM   2618  C  CG    . ASP B  1  113  ? 4.666   31.210  132.222 1.00 105.47 ? 113  ASP B CG    1 
ATOM   2619  O  OD1   . ASP B  1  113  ? 4.869   32.435  132.086 1.00 105.34 ? 113  ASP B OD1   1 
ATOM   2620  O  OD2   . ASP B  1  113  ? 3.964   30.544  131.432 1.00 108.40 ? 113  ASP B OD2   1 
ATOM   2621  N  N     . PHE B  1  114  ? 8.247   30.180  135.210 1.00 101.91 ? 114  PHE B N     1 
ATOM   2622  C  CA    . PHE B  1  114  ? 8.895   29.598  136.378 1.00 101.23 ? 114  PHE B CA    1 
ATOM   2623  C  C     . PHE B  1  114  ? 9.155   30.693  137.402 1.00 101.88 ? 114  PHE B C     1 
ATOM   2624  O  O     . PHE B  1  114  ? 9.745   31.726  137.076 1.00 100.98 ? 114  PHE B O     1 
ATOM   2625  C  CB    . PHE B  1  114  ? 10.208  28.905  135.997 1.00 101.63 ? 114  PHE B CB    1 
ATOM   2626  C  CG    . PHE B  1  114  ? 10.040  27.472  135.563 1.00 99.22  ? 114  PHE B CG    1 
ATOM   2627  C  CD1   . PHE B  1  114  ? 9.553   26.519  136.445 1.00 93.25  ? 114  PHE B CD1   1 
ATOM   2628  C  CD2   . PHE B  1  114  ? 10.389  27.072  134.284 1.00 92.96  ? 114  PHE B CD2   1 
ATOM   2629  C  CE1   . PHE B  1  114  ? 9.401   25.199  136.057 1.00 87.57  ? 114  PHE B CE1   1 
ATOM   2630  C  CE2   . PHE B  1  114  ? 10.240  25.753  133.891 1.00 90.01  ? 114  PHE B CE2   1 
ATOM   2631  C  CZ    . PHE B  1  114  ? 9.745   24.815  134.781 1.00 87.71  ? 114  PHE B CZ    1 
ATOM   2632  N  N     . LEU B  1  115  ? 8.712   30.465  138.636 1.00 100.68 ? 115  LEU B N     1 
ATOM   2633  C  CA    . LEU B  1  115  ? 8.841   31.462  139.696 1.00 100.22 ? 115  LEU B CA    1 
ATOM   2634  C  C     . LEU B  1  115  ? 10.290  31.881  139.913 1.00 92.52  ? 115  LEU B C     1 
ATOM   2635  O  O     . LEU B  1  115  ? 11.144  31.042  140.203 1.00 89.33  ? 115  LEU B O     1 
ATOM   2636  C  CB    . LEU B  1  115  ? 8.242   30.941  141.002 1.00 98.68  ? 115  LEU B CB    1 
ATOM   2637  C  CG    . LEU B  1  115  ? 6.753   30.602  140.943 1.00 96.14  ? 115  LEU B CG    1 
ATOM   2638  C  CD1   . LEU B  1  115  ? 6.271   30.083  142.288 1.00 93.16  ? 115  LEU B CD1   1 
ATOM   2639  C  CD2   . LEU B  1  115  ? 5.940   31.813  140.501 1.00 82.57  ? 115  LEU B CD2   1 
ATOM   2640  N  N     . PRO B  1  116  ? 10.566  33.190  139.777 1.00 91.32  ? 116  PRO B N     1 
ATOM   2641  C  CA    . PRO B  1  116  ? 11.911  33.765  139.900 1.00 88.34  ? 116  PRO B CA    1 
ATOM   2642  C  C     . PRO B  1  116  ? 12.595  33.278  141.167 1.00 86.57  ? 116  PRO B C     1 
ATOM   2643  O  O     . PRO B  1  116  ? 11.954  33.210  142.217 1.00 98.62  ? 116  PRO B O     1 
ATOM   2644  C  CB    . PRO B  1  116  ? 11.639  35.268  139.994 1.00 85.56  ? 116  PRO B CB    1 
ATOM   2645  C  CG    . PRO B  1  116  ? 10.354  35.455  139.264 1.00 91.20  ? 116  PRO B CG    1 
ATOM   2646  C  CD    . PRO B  1  116  ? 9.541   34.225  139.554 1.00 90.22  ? 116  PRO B CD    1 
ATOM   2647  N  N     . VAL B  1  117  ? 13.875  32.940  141.079 1.00 75.46  ? 117  VAL B N     1 
ATOM   2648  C  CA    . VAL B  1  117  ? 14.557  32.340  142.216 1.00 82.02  ? 117  VAL B CA    1 
ATOM   2649  C  C     . VAL B  1  117  ? 15.953  32.910  142.443 1.00 84.09  ? 117  VAL B C     1 
ATOM   2650  O  O     . VAL B  1  117  ? 16.728  33.060  141.504 1.00 87.98  ? 117  VAL B O     1 
ATOM   2651  C  CB    . VAL B  1  117  ? 14.656  30.801  142.066 1.00 82.53  ? 117  VAL B CB    1 
ATOM   2652  C  CG1   . VAL B  1  117  ? 15.488  30.205  143.194 1.00 72.94  ? 117  VAL B CG1   1 
ATOM   2653  C  CG2   . VAL B  1  117  ? 13.273  30.171  142.034 1.00 84.13  ? 117  VAL B CG2   1 
ATOM   2654  N  N     . ALA B  1  118  ? 16.250  33.230  143.700 1.00 92.15  ? 118  ALA B N     1 
ATOM   2655  C  CA    . ALA B  1  118  ? 17.590  33.619  144.122 1.00 98.95  ? 118  ALA B CA    1 
ATOM   2656  C  C     . ALA B  1  118  ? 18.345  34.349  143.026 1.00 97.38  ? 118  ALA B C     1 
ATOM   2657  O  O     . ALA B  1  118  ? 17.832  35.284  142.414 1.00 93.09  ? 118  ALA B O     1 
ATOM   2658  C  CB    . ALA B  1  118  ? 18.376  32.384  144.566 1.00 98.16  ? 118  ALA B CB    1 
ATOM   2659  N  N     . ASP B  1  119  ? 19.575  33.911  142.791 1.00 94.29  ? 119  ASP B N     1 
ATOM   2660  C  CA    . ASP B  1  119  ? 20.345  34.361  141.644 1.00 99.51  ? 119  ASP B CA    1 
ATOM   2661  C  C     . ASP B  1  119  ? 20.283  33.281  140.570 1.00 97.37  ? 119  ASP B C     1 
ATOM   2662  O  O     . ASP B  1  119  ? 21.090  32.350  140.547 1.00 86.76  ? 119  ASP B O     1 
ATOM   2663  C  CB    . ASP B  1  119  ? 21.791  34.642  142.043 1.00 106.43 ? 119  ASP B CB    1 
ATOM   2664  C  CG    . ASP B  1  119  ? 21.901  35.709  143.112 1.00 106.91 ? 119  ASP B CG    1 
ATOM   2665  O  OD1   . ASP B  1  119  ? 21.070  36.644  143.102 1.00 92.98  ? 119  ASP B OD1   1 
ATOM   2666  O  OD2   . ASP B  1  119  ? 22.815  35.603  143.959 1.00 113.74 ? 119  ASP B OD2   1 
ATOM   2667  N  N     . VAL B  1  120  ? 19.305  33.415  139.684 1.00 100.11 ? 120  VAL B N     1 
ATOM   2668  C  CA    . VAL B  1  120  ? 19.088  32.449  138.622 1.00 97.14  ? 120  VAL B CA    1 
ATOM   2669  C  C     . VAL B  1  120  ? 18.674  33.161  137.344 1.00 101.17 ? 120  VAL B C     1 
ATOM   2670  O  O     . VAL B  1  120  ? 17.700  33.916  137.336 1.00 103.31 ? 120  VAL B O     1 
ATOM   2671  C  CB    . VAL B  1  120  ? 17.998  31.427  138.999 1.00 88.01  ? 120  VAL B CB    1 
ATOM   2672  C  CG1   . VAL B  1  120  ? 17.480  30.724  137.758 1.00 94.59  ? 120  VAL B CG1   1 
ATOM   2673  C  CG2   . VAL B  1  120  ? 18.534  30.417  140.008 1.00 83.20  ? 120  VAL B CG2   1 
ATOM   2674  N  N     . GLU B  1  121  ? 19.423  32.925  136.270 1.00 98.35  ? 121  GLU B N     1 
ATOM   2675  C  CA    . GLU B  1  121  ? 19.051  33.431  134.959 1.00 96.33  ? 121  GLU B CA    1 
ATOM   2676  C  C     . GLU B  1  121  ? 18.361  32.339  134.165 1.00 89.94  ? 121  GLU B C     1 
ATOM   2677  O  O     . GLU B  1  121  ? 18.816  31.194  134.132 1.00 87.82  ? 121  GLU B O     1 
ATOM   2678  C  CB    . GLU B  1  121  ? 20.274  33.921  134.180 1.00 92.80  ? 121  GLU B CB    1 
ATOM   2679  C  CG    . GLU B  1  121  ? 20.867  35.226  134.671 1.00 96.75  ? 121  GLU B CG    1 
ATOM   2680  C  CD    . GLU B  1  121  ? 21.737  35.893  133.620 1.00 98.75  ? 121  GLU B CD    1 
ATOM   2681  O  OE1   . GLU B  1  121  ? 21.256  36.072  132.480 1.00 96.58  ? 121  GLU B OE1   1 
ATOM   2682  O  OE2   . GLU B  1  121  ? 22.900  36.234  133.930 1.00 94.17  ? 121  GLU B OE2   1 
ATOM   2683  N  N     . ILE B  1  122  ? 17.250  32.699  133.541 1.00 87.50  ? 122  ILE B N     1 
ATOM   2684  C  CA    . ILE B  1  122  ? 16.661  31.863  132.517 1.00 86.18  ? 122  ILE B CA    1 
ATOM   2685  C  C     . ILE B  1  122  ? 17.038  32.455  131.160 1.00 85.94  ? 122  ILE B C     1 
ATOM   2686  O  O     . ILE B  1  122  ? 16.489  33.472  130.733 1.00 84.04  ? 122  ILE B O     1 
ATOM   2687  C  CB    . ILE B  1  122  ? 15.142  31.739  132.689 1.00 83.91  ? 122  ILE B CB    1 
ATOM   2688  C  CG1   . ILE B  1  122  ? 14.836  30.927  133.949 1.00 82.38  ? 122  ILE B CG1   1 
ATOM   2689  C  CG2   . ILE B  1  122  ? 14.516  31.071  131.477 1.00 86.33  ? 122  ILE B CG2   1 
ATOM   2690  C  CD1   . ILE B  1  122  ? 13.382  30.568  134.109 1.00 99.46  ? 122  ILE B CD1   1 
ATOM   2691  N  N     . MET B  1  123  ? 18.002  31.816  130.505 1.00 86.95  ? 123  MET B N     1 
ATOM   2692  C  CA    . MET B  1  123  ? 18.558  32.305  129.251 1.00 83.05  ? 123  MET B CA    1 
ATOM   2693  C  C     . MET B  1  123  ? 17.529  32.279  128.130 1.00 82.26  ? 123  MET B C     1 
ATOM   2694  O  O     . MET B  1  123  ? 17.505  33.172  127.283 1.00 77.38  ? 123  MET B O     1 
ATOM   2695  C  CB    . MET B  1  123  ? 19.778  31.470  128.856 1.00 83.20  ? 123  MET B CB    1 
ATOM   2696  C  CG    . MET B  1  123  ? 20.809  31.320  129.962 1.00 80.72  ? 123  MET B CG    1 
ATOM   2697  S  SD    . MET B  1  123  ? 21.520  32.892  130.467 1.00 84.53  ? 123  MET B SD    1 
ATOM   2698  C  CE    . MET B  1  123  ? 23.066  32.886  129.570 1.00 71.66  ? 123  MET B CE    1 
ATOM   2699  N  N     . ASN B  1  124  ? 16.682  31.253  128.133 1.00 81.41  ? 124  ASN B N     1 
ATOM   2700  C  CA    . ASN B  1  124  ? 15.660  31.086  127.108 1.00 82.24  ? 124  ASN B CA    1 
ATOM   2701  C  C     . ASN B  1  124  ? 14.253  31.161  127.678 1.00 89.93  ? 124  ASN B C     1 
ATOM   2702  O  O     . ASN B  1  124  ? 13.543  30.156  127.712 1.00 91.83  ? 124  ASN B O     1 
ATOM   2703  C  CB    . ASN B  1  124  ? 15.849  29.750  126.390 1.00 83.11  ? 124  ASN B CB    1 
ATOM   2704  C  CG    . ASN B  1  124  ? 16.086  28.602  127.352 1.00 80.26  ? 124  ASN B CG    1 
ATOM   2705  O  OD1   . ASN B  1  124  ? 16.850  28.729  128.306 1.00 79.88  ? 124  ASN B OD1   1 
ATOM   2706  N  ND2   . ASN B  1  124  ? 15.429  27.475  127.108 1.00 78.32  ? 124  ASN B ND2   1 
ATOM   2707  N  N     . PRO B  1  125  ? 13.838  32.360  128.114 1.00 91.46  ? 125  PRO B N     1 
ATOM   2708  C  CA    . PRO B  1  125  ? 12.534  32.565  128.751 1.00 95.15  ? 125  PRO B CA    1 
ATOM   2709  C  C     . PRO B  1  125  ? 11.385  32.176  127.827 1.00 100.17 ? 125  PRO B C     1 
ATOM   2710  O  O     . PRO B  1  125  ? 10.289  31.860  128.296 1.00 97.71  ? 125  PRO B O     1 
ATOM   2711  C  CB    . PRO B  1  125  ? 12.500  34.076  128.999 1.00 95.88  ? 125  PRO B CB    1 
ATOM   2712  C  CG    . PRO B  1  125  ? 13.923  34.514  128.943 1.00 89.73  ? 125  PRO B CG    1 
ATOM   2713  C  CD    . PRO B  1  125  ? 14.568  33.625  127.943 1.00 91.50  ? 125  PRO B CD    1 
ATOM   2714  N  N     . ASP B  1  126  ? 11.642  32.198  126.523 1.00 99.42  ? 126  ASP B N     1 
ATOM   2715  C  CA    . ASP B  1  126  ? 10.602  31.950  125.532 1.00 99.57  ? 126  ASP B CA    1 
ATOM   2716  C  C     . ASP B  1  126  ? 10.465  30.471  125.184 1.00 93.65  ? 126  ASP B C     1 
ATOM   2717  O  O     . ASP B  1  126  ? 9.668   30.099  124.318 1.00 85.81  ? 126  ASP B O     1 
ATOM   2718  C  CB    . ASP B  1  126  ? 10.868  32.768  124.268 1.00 103.55 ? 126  ASP B CB    1 
ATOM   2719  C  CG    . ASP B  1  126  ? 11.035  34.245  124.560 1.00 111.92 ? 126  ASP B CG    1 
ATOM   2720  O  OD1   . ASP B  1  126  ? 10.006  34.935  124.732 1.00 113.27 ? 126  ASP B OD1   1 
ATOM   2721  O  OD2   . ASP B  1  126  ? 12.194  34.713  124.619 1.00 111.09 ? 126  ASP B OD2   1 
ATOM   2722  N  N     . LEU B  1  127  ? 11.244  29.631  125.859 1.00 90.09  ? 127  LEU B N     1 
ATOM   2723  C  CA    . LEU B  1  127  ? 11.154  28.196  125.637 1.00 90.34  ? 127  LEU B CA    1 
ATOM   2724  C  C     . LEU B  1  127  ? 9.762   27.698  125.992 1.00 86.04  ? 127  LEU B C     1 
ATOM   2725  O  O     . LEU B  1  127  ? 9.287   27.896  127.106 1.00 90.74  ? 127  LEU B O     1 
ATOM   2726  C  CB    . LEU B  1  127  ? 12.208  27.442  126.448 1.00 83.22  ? 127  LEU B CB    1 
ATOM   2727  C  CG    . LEU B  1  127  ? 12.088  25.914  126.391 1.00 81.04  ? 127  LEU B CG    1 
ATOM   2728  C  CD1   . LEU B  1  127  ? 12.008  25.415  124.949 1.00 93.33  ? 127  LEU B CD1   1 
ATOM   2729  C  CD2   . LEU B  1  127  ? 13.239  25.248  127.129 1.00 80.42  ? 127  LEU B CD2   1 
ATOM   2730  N  N     . HIS B  1  128  ? 9.109   27.058  125.034 1.00 80.67  ? 128  HIS B N     1 
ATOM   2731  C  CA    . HIS B  1  128  ? 7.791   26.492  125.259 1.00 83.69  ? 128  HIS B CA    1 
ATOM   2732  C  C     . HIS B  1  128  ? 7.908   25.252  126.138 1.00 87.11  ? 128  HIS B C     1 
ATOM   2733  O  O     . HIS B  1  128  ? 8.873   24.496  126.023 1.00 87.76  ? 128  HIS B O     1 
ATOM   2734  C  CB    . HIS B  1  128  ? 7.157   26.140  123.914 1.00 89.36  ? 128  HIS B CB    1 
ATOM   2735  C  CG    . HIS B  1  128  ? 5.877   25.370  124.022 1.00 90.07  ? 128  HIS B CG    1 
ATOM   2736  N  ND1   . HIS B  1  128  ? 4.641   25.975  123.968 1.00 91.10  ? 128  HIS B ND1   1 
ATOM   2737  C  CD2   . HIS B  1  128  ? 5.643   24.043  124.156 1.00 90.43  ? 128  HIS B CD2   1 
ATOM   2738  C  CE1   . HIS B  1  128  ? 3.699   25.053  124.073 1.00 94.67  ? 128  HIS B CE1   1 
ATOM   2739  N  NE2   . HIS B  1  128  ? 4.281   23.873  124.189 1.00 90.68  ? 128  HIS B NE2   1 
ATOM   2740  N  N     . ILE B  1  129  ? 6.936   25.054  127.026 1.00 92.18  ? 129  ILE B N     1 
ATOM   2741  C  CA    . ILE B  1  129  ? 6.891   23.846  127.847 1.00 87.25  ? 129  ILE B CA    1 
ATOM   2742  C  C     . ILE B  1  129  ? 5.678   22.983  127.521 1.00 87.29  ? 129  ILE B C     1 
ATOM   2743  O  O     . ILE B  1  129  ? 5.823   21.822  127.145 1.00 92.74  ? 129  ILE B O     1 
ATOM   2744  C  CB    . ILE B  1  129  ? 6.901   24.145  129.353 1.00 81.83  ? 129  ILE B CB    1 
ATOM   2745  C  CG1   . ILE B  1  129  ? 8.289   24.598  129.813 1.00 70.11  ? 129  ILE B CG1   1 
ATOM   2746  C  CG2   . ILE B  1  129  ? 6.502   22.902  130.125 1.00 90.26  ? 129  ILE B CG2   1 
ATOM   2747  C  CD1   . ILE B  1  129  ? 8.636   26.005  129.434 1.00 77.23  ? 129  ILE B CD1   1 
ATOM   2748  N  N     . ALA B  1  130  ? 4.483   23.545  127.671 1.00 87.02  ? 130  ALA B N     1 
ATOM   2749  C  CA    . ALA B  1  130  ? 3.264   22.811  127.344 1.00 90.92  ? 130  ALA B CA    1 
ATOM   2750  C  C     . ALA B  1  130  ? 2.113   23.736  126.970 1.00 97.16  ? 130  ALA B C     1 
ATOM   2751  O  O     . ALA B  1  130  ? 2.081   24.896  127.378 1.00 100.26 ? 130  ALA B O     1 
ATOM   2752  C  CB    . ALA B  1  130  ? 2.863   21.911  128.495 1.00 91.23  ? 130  ALA B CB    1 
ATOM   2753  N  N     . THR B  1  131  ? 1.176   23.216  126.181 1.00 103.05 ? 131  THR B N     1 
ATOM   2754  C  CA    . THR B  1  131  ? -0.039  23.951  125.837 1.00 106.47 ? 131  THR B CA    1 
ATOM   2755  C  C     . THR B  1  131  ? -1.201  23.456  126.688 1.00 111.40 ? 131  THR B C     1 
ATOM   2756  O  O     . THR B  1  131  ? -1.483  22.256  126.741 1.00 106.20 ? 131  THR B O     1 
ATOM   2757  C  CB    . THR B  1  131  ? -0.414  23.813  124.344 1.00 108.49 ? 131  THR B CB    1 
ATOM   2758  O  OG1   . THR B  1  131  ? -0.759  22.451  124.051 1.00 109.44 ? 131  THR B OG1   1 
ATOM   2759  C  CG2   . THR B  1  131  ? 0.738   24.258  123.450 1.00 105.50 ? 131  THR B CG2   1 
ATOM   2760  N  N     . LEU B  1  132  ? -1.866  24.391  127.357 1.00 119.88 ? 132  LEU B N     1 
ATOM   2761  C  CA    . LEU B  1  132  ? -2.968  24.070  128.253 1.00 117.52 ? 132  LEU B CA    1 
ATOM   2762  C  C     . LEU B  1  132  ? -4.285  24.634  127.735 1.00 119.98 ? 132  LEU B C     1 
ATOM   2763  O  O     . LEU B  1  132  ? -4.354  25.786  127.297 1.00 120.12 ? 132  LEU B O     1 
ATOM   2764  C  CB    . LEU B  1  132  ? -2.686  24.603  129.657 1.00 112.13 ? 132  LEU B CB    1 
ATOM   2765  C  CG    . LEU B  1  132  ? -1.677  23.841  130.518 1.00 109.79 ? 132  LEU B CG    1 
ATOM   2766  C  CD1   . LEU B  1  132  ? -0.329  23.750  129.835 1.00 113.82 ? 132  LEU B CD1   1 
ATOM   2767  C  CD2   . LEU B  1  132  ? -1.536  24.498  131.883 1.00 116.95 ? 132  LEU B CD2   1 
ATOM   2768  N  N     . GLU B  1  133  ? -5.326  23.811  127.794 1.00 120.06 ? 133  GLU B N     1 
ATOM   2769  C  CA    . GLU B  1  133  ? -6.648  24.196  127.322 1.00 129.26 ? 133  GLU B CA    1 
ATOM   2770  C  C     . GLU B  1  133  ? -7.552  24.573  128.492 1.00 132.35 ? 133  GLU B C     1 
ATOM   2771  O  O     . GLU B  1  133  ? -7.106  24.646  129.637 1.00 128.71 ? 133  GLU B O     1 
ATOM   2772  C  CB    . GLU B  1  133  ? -7.274  23.041  126.544 1.00 128.78 ? 133  GLU B CB    1 
ATOM   2773  C  CG    . GLU B  1  133  ? -6.370  22.458  125.477 1.00 127.30 ? 133  GLU B CG    1 
ATOM   2774  C  CD    . GLU B  1  133  ? -6.552  20.961  125.321 1.00 128.62 ? 133  GLU B CD    1 
ATOM   2775  O  OE1   . GLU B  1  133  ? -6.731  20.274  126.350 1.00 118.74 ? 133  GLU B OE1   1 
ATOM   2776  O  OE2   . GLU B  1  133  ? -6.518  20.475  124.171 1.00 135.78 ? 133  GLU B OE2   1 
ATOM   2777  N  N     . GLU B  1  134  ? -8.827  24.810  128.199 1.00 134.87 ? 134  GLU B N     1 
ATOM   2778  C  CA    . GLU B  1  134  ? -9.797  25.117  129.241 1.00 136.77 ? 134  GLU B CA    1 
ATOM   2779  C  C     . GLU B  1  134  ? -9.834  24.006  130.283 1.00 133.19 ? 134  GLU B C     1 
ATOM   2780  O  O     . GLU B  1  134  ? -9.987  22.831  129.947 1.00 126.72 ? 134  GLU B O     1 
ATOM   2781  C  CB    . GLU B  1  134  ? -11.189 25.320  128.639 1.00 141.62 ? 134  GLU B CB    1 
ATOM   2782  C  CG    . GLU B  1  134  ? -11.292 26.506  127.694 1.00 145.86 ? 134  GLU B CG    1 
ATOM   2783  C  CD    . GLU B  1  134  ? -11.090 27.837  128.396 1.00 148.65 ? 134  GLU B CD    1 
ATOM   2784  O  OE1   . GLU B  1  134  ? -10.947 28.862  127.695 1.00 149.09 ? 134  GLU B OE1   1 
ATOM   2785  O  OE2   . GLU B  1  134  ? -11.080 27.860  129.647 1.00 142.44 ? 134  GLU B OE2   1 
ATOM   2786  N  N     . GLY B  1  135  ? -9.685  24.384  131.548 1.00 131.96 ? 135  GLY B N     1 
ATOM   2787  C  CA    . GLY B  1  135  ? -9.739  23.427  132.637 1.00 133.02 ? 135  GLY B CA    1 
ATOM   2788  C  C     . GLY B  1  135  ? -8.447  22.653  132.813 1.00 131.54 ? 135  GLY B C     1 
ATOM   2789  O  O     . GLY B  1  135  ? -8.313  21.853  133.739 1.00 129.90 ? 135  GLY B O     1 
ATOM   2790  N  N     . GLY B  1  136  ? -7.495  22.887  131.917 1.00 130.64 ? 136  GLY B N     1 
ATOM   2791  C  CA    . GLY B  1  136  ? -6.206  22.226  131.989 1.00 123.57 ? 136  GLY B CA    1 
ATOM   2792  C  C     . GLY B  1  136  ? -5.319  22.824  133.061 1.00 112.98 ? 136  GLY B C     1 
ATOM   2793  O  O     . GLY B  1  136  ? -5.103  24.035  133.092 1.00 107.12 ? 136  GLY B O     1 
ATOM   2794  N  N     . ARG B  1  137  ? -4.797  21.972  133.937 1.00 112.45 ? 137  ARG B N     1 
ATOM   2795  C  CA    . ARG B  1  137  ? -3.978  22.437  135.050 1.00 118.87 ? 137  ARG B CA    1 
ATOM   2796  C  C     . ARG B  1  137  ? -2.572  21.854  135.027 1.00 112.20 ? 137  ARG B C     1 
ATOM   2797  O  O     . ARG B  1  137  ? -2.386  20.661  134.783 1.00 104.05 ? 137  ARG B O     1 
ATOM   2798  C  CB    . ARG B  1  137  ? -4.638  22.096  136.388 1.00 129.72 ? 137  ARG B CB    1 
ATOM   2799  C  CG    . ARG B  1  137  ? -5.979  22.764  136.626 1.00 135.81 ? 137  ARG B CG    1 
ATOM   2800  C  CD    . ARG B  1  137  ? -6.431  22.552  138.060 1.00 143.30 ? 137  ARG B CD    1 
ATOM   2801  N  NE    . ARG B  1  137  ? -7.806  22.988  138.274 1.00 156.40 ? 137  ARG B NE    1 
ATOM   2802  C  CZ    . ARG B  1  137  ? -8.420  22.958  139.451 1.00 160.57 ? 137  ARG B CZ    1 
ATOM   2803  N  NH1   . ARG B  1  137  ? -7.778  22.516  140.525 1.00 155.94 ? 137  ARG B NH1   1 
ATOM   2804  N  NH2   . ARG B  1  137  ? -9.675  23.372  139.557 1.00 162.63 ? 137  ARG B NH2   1 
ATOM   2805  N  N     . LEU B  1  138  ? -1.587  22.705  135.300 1.00 111.49 ? 138  LEU B N     1 
ATOM   2806  C  CA    . LEU B  1  138  ? -0.200  22.268  135.391 1.00 112.16 ? 138  LEU B CA    1 
ATOM   2807  C  C     . LEU B  1  138  ? 0.466   22.767  136.672 1.00 102.32 ? 138  LEU B C     1 
ATOM   2808  O  O     . LEU B  1  138  ? 0.609   23.972  136.885 1.00 101.68 ? 138  LEU B O     1 
ATOM   2809  C  CB    . LEU B  1  138  ? 0.599   22.738  134.174 1.00 115.10 ? 138  LEU B CB    1 
ATOM   2810  C  CG    . LEU B  1  138  ? 2.016   22.170  134.072 1.00 107.69 ? 138  LEU B CG    1 
ATOM   2811  C  CD1   . LEU B  1  138  ? 1.966   20.686  133.728 1.00 97.92  ? 138  LEU B CD1   1 
ATOM   2812  C  CD2   . LEU B  1  138  ? 2.839   22.938  133.049 1.00 104.02 ? 138  LEU B CD2   1 
ATOM   2813  N  N     . ASN B  1  139  ? 0.870   21.827  137.518 1.00 93.15  ? 139  ASN B N     1 
ATOM   2814  C  CA    . ASN B  1  139  ? 1.580   22.145  138.747 1.00 100.94 ? 139  ASN B CA    1 
ATOM   2815  C  C     . ASN B  1  139  ? 2.777   21.213  138.873 1.00 98.67  ? 139  ASN B C     1 
ATOM   2816  O  O     . ASN B  1  139  ? 2.609   20.002  139.027 1.00 99.35  ? 139  ASN B O     1 
ATOM   2817  C  CB    . ASN B  1  139  ? 0.650   21.984  139.953 1.00 108.02 ? 139  ASN B CB    1 
ATOM   2818  C  CG    . ASN B  1  139  ? 1.253   22.520  141.241 1.00 105.50 ? 139  ASN B CG    1 
ATOM   2819  O  OD1   . ASN B  1  139  ? 1.913   23.559  141.248 1.00 107.50 ? 139  ASN B OD1   1 
ATOM   2820  N  ND2   . ASN B  1  139  ? 1.027   21.807  142.340 1.00 100.42 ? 139  ASN B ND2   1 
ATOM   2821  N  N     . MET B  1  140  ? 3.984   21.769  138.799 1.00 93.83  ? 140  MET B N     1 
ATOM   2822  C  CA    . MET B  1  140  ? 5.184   20.935  138.788 1.00 92.08  ? 140  MET B CA    1 
ATOM   2823  C  C     . MET B  1  140  ? 6.433   21.589  139.376 1.00 85.12  ? 140  MET B C     1 
ATOM   2824  O  O     . MET B  1  140  ? 6.598   22.816  139.354 1.00 76.29  ? 140  MET B O     1 
ATOM   2825  C  CB    . MET B  1  140  ? 5.490   20.465  137.365 1.00 99.25  ? 140  MET B CB    1 
ATOM   2826  C  CG    . MET B  1  140  ? 6.153   21.524  136.495 1.00 102.38 ? 140  MET B CG    1 
ATOM   2827  S  SD    . MET B  1  140  ? 6.878   20.850  134.986 1.00 94.97  ? 140  MET B SD    1 
ATOM   2828  C  CE    . MET B  1  140  ? 5.411   20.592  133.993 1.00 103.76 ? 140  MET B CE    1 
ATOM   2829  N  N     . GLU B  1  141  ? 7.319   20.740  139.885 1.00 86.30  ? 141  GLU B N     1 
ATOM   2830  C  CA    . GLU B  1  141  ? 8.596   21.188  140.423 1.00 90.95  ? 141  GLU B CA    1 
ATOM   2831  C  C     . GLU B  1  141  ? 9.743   20.452  139.739 1.00 88.15  ? 141  GLU B C     1 
ATOM   2832  O  O     . GLU B  1  141  ? 9.742   19.221  139.653 1.00 83.92  ? 141  GLU B O     1 
ATOM   2833  C  CB    . GLU B  1  141  ? 8.655   20.965  141.935 1.00 92.71  ? 141  GLU B CB    1 
ATOM   2834  C  CG    . GLU B  1  141  ? 7.656   21.795  142.718 1.00 98.55  ? 141  GLU B CG    1 
ATOM   2835  C  CD    . GLU B  1  141  ? 7.664   21.473  144.200 1.00 112.81 ? 141  GLU B CD    1 
ATOM   2836  O  OE1   . GLU B  1  141  ? 8.564   20.726  144.643 1.00 113.75 ? 141  GLU B OE1   1 
ATOM   2837  O  OE2   . GLU B  1  141  ? 6.766   21.964  144.919 1.00 117.03 ? 141  GLU B OE2   1 
ATOM   2838  N  N     . VAL B  1  142  ? 10.718  21.215  139.252 1.00 82.62  ? 142  VAL B N     1 
ATOM   2839  C  CA    . VAL B  1  142  ? 11.843  20.646  138.523 1.00 77.48  ? 142  VAL B CA    1 
ATOM   2840  C  C     . VAL B  1  142  ? 13.163  20.986  139.208 1.00 77.12  ? 142  VAL B C     1 
ATOM   2841  O  O     . VAL B  1  142  ? 13.407  22.137  139.579 1.00 78.67  ? 142  VAL B O     1 
ATOM   2842  C  CB    . VAL B  1  142  ? 11.870  21.138  137.060 1.00 78.72  ? 142  VAL B CB    1 
ATOM   2843  C  CG1   . VAL B  1  142  ? 10.509  20.941  136.414 1.00 82.43  ? 142  VAL B CG1   1 
ATOM   2844  C  CG2   . VAL B  1  142  ? 12.267  22.602  136.993 1.00 79.42  ? 142  VAL B CG2   1 
ATOM   2845  N  N     . ARG B  1  143  ? 14.010  19.976  139.380 1.00 72.17  ? 143  ARG B N     1 
ATOM   2846  C  CA    . ARG B  1  143  ? 15.286  20.162  140.054 1.00 77.56  ? 143  ARG B CA    1 
ATOM   2847  C  C     . ARG B  1  143  ? 16.425  20.422  139.072 1.00 75.97  ? 143  ARG B C     1 
ATOM   2848  O  O     . ARG B  1  143  ? 16.662  19.642  138.154 1.00 76.30  ? 143  ARG B O     1 
ATOM   2849  C  CB    . ARG B  1  143  ? 15.622  18.962  140.942 1.00 79.73  ? 143  ARG B CB    1 
ATOM   2850  C  CG    . ARG B  1  143  ? 16.921  19.144  141.713 1.00 79.59  ? 143  ARG B CG    1 
ATOM   2851  C  CD    . ARG B  1  143  ? 17.219  17.973  142.620 1.00 78.75  ? 143  ARG B CD    1 
ATOM   2852  N  NE    . ARG B  1  143  ? 18.468  18.167  143.346 1.00 80.97  ? 143  ARG B NE    1 
ATOM   2853  C  CZ    . ARG B  1  143  ? 18.859  17.414  144.367 1.00 88.16  ? 143  ARG B CZ    1 
ATOM   2854  N  NH1   . ARG B  1  143  ? 18.092  16.416  144.787 1.00 89.83  ? 143  ARG B NH1   1 
ATOM   2855  N  NH2   . ARG B  1  143  ? 20.012  17.663  144.972 1.00 91.42  ? 143  ARG B NH2   1 
ATOM   2856  N  N     . VAL B  1  144  ? 17.128  21.525  139.295 1.00 69.74  ? 144  VAL B N     1 
ATOM   2857  C  CA    . VAL B  1  144  ? 18.230  21.945  138.453 1.00 70.27  ? 144  VAL B CA    1 
ATOM   2858  C  C     . VAL B  1  144  ? 19.543  21.875  139.226 1.00 74.42  ? 144  VAL B C     1 
ATOM   2859  O  O     . VAL B  1  144  ? 19.729  22.574  140.218 1.00 73.80  ? 144  VAL B O     1 
ATOM   2860  C  CB    . VAL B  1  144  ? 18.001  23.378  137.936 1.00 69.36  ? 144  VAL B CB    1 
ATOM   2861  C  CG1   . VAL B  1  144  ? 19.282  23.957  137.355 1.00 71.10  ? 144  VAL B CG1   1 
ATOM   2862  C  CG2   . VAL B  1  144  ? 16.872  23.395  136.911 1.00 70.45  ? 144  VAL B CG2   1 
ATOM   2863  N  N     . ASP B  1  145  ? 20.452  21.023  138.765 1.00 78.59  ? 145  ASP B N     1 
ATOM   2864  C  CA    . ASP B  1  145  ? 21.724  20.826  139.445 1.00 73.03  ? 145  ASP B CA    1 
ATOM   2865  C  C     . ASP B  1  145  ? 22.911  21.306  138.625 1.00 73.82  ? 145  ASP B C     1 
ATOM   2866  O  O     . ASP B  1  145  ? 22.894  21.259  137.396 1.00 77.07  ? 145  ASP B O     1 
ATOM   2867  C  CB    . ASP B  1  145  ? 21.912  19.350  139.790 1.00 77.82  ? 145  ASP B CB    1 
ATOM   2868  C  CG    . ASP B  1  145  ? 20.998  18.895  140.905 1.00 89.30  ? 145  ASP B CG    1 
ATOM   2869  O  OD1   . ASP B  1  145  ? 19.821  18.588  140.618 1.00 92.39  ? 145  ASP B OD1   1 
ATOM   2870  O  OD2   . ASP B  1  145  ? 21.456  18.843  142.068 1.00 90.22  ? 145  ASP B OD2   1 
ATOM   2871  N  N     . ARG B  1  146  ? 23.945  21.769  139.318 1.00 72.78  ? 146  ARG B N     1 
ATOM   2872  C  CA    . ARG B  1  146  ? 25.211  22.079  138.680 1.00 71.46  ? 146  ARG B CA    1 
ATOM   2873  C  C     . ARG B  1  146  ? 26.023  20.796  138.542 1.00 72.55  ? 146  ARG B C     1 
ATOM   2874  O  O     . ARG B  1  146  ? 26.304  20.121  139.531 1.00 79.80  ? 146  ARG B O     1 
ATOM   2875  C  CB    . ARG B  1  146  ? 25.980  23.111  139.501 1.00 74.10  ? 146  ARG B CB    1 
ATOM   2876  C  CG    . ARG B  1  146  ? 27.420  23.304  139.065 1.00 82.97  ? 146  ARG B CG    1 
ATOM   2877  C  CD    . ARG B  1  146  ? 28.099  24.372  139.900 1.00 90.93  ? 146  ARG B CD    1 
ATOM   2878  N  NE    . ARG B  1  146  ? 27.491  25.682  139.693 1.00 96.52  ? 146  ARG B NE    1 
ATOM   2879  C  CZ    . ARG B  1  146  ? 27.845  26.784  140.347 1.00 94.35  ? 146  ARG B CZ    1 
ATOM   2880  N  NH1   . ARG B  1  146  ? 28.806  26.736  141.259 1.00 96.09  ? 146  ARG B NH1   1 
ATOM   2881  N  NH2   . ARG B  1  146  ? 27.236  27.933  140.090 1.00 89.30  ? 146  ARG B NH2   1 
ATOM   2882  N  N     . GLY B  1  147  ? 26.384  20.452  137.311 1.00 70.53  ? 147  GLY B N     1 
ATOM   2883  C  CA    . GLY B  1  147  ? 27.168  19.257  137.055 1.00 70.73  ? 147  GLY B CA    1 
ATOM   2884  C  C     . GLY B  1  147  ? 27.983  19.357  135.781 1.00 65.09  ? 147  GLY B C     1 
ATOM   2885  O  O     . GLY B  1  147  ? 28.027  20.405  135.138 1.00 67.79  ? 147  GLY B O     1 
ATOM   2886  N  N     . VAL B  1  148  ? 28.637  18.263  135.413 1.00 63.99  ? 148  VAL B N     1 
ATOM   2887  C  CA    . VAL B  1  148  ? 29.425  18.239  134.187 1.00 66.24  ? 148  VAL B CA    1 
ATOM   2888  C  C     . VAL B  1  148  ? 29.175  16.973  133.371 1.00 68.35  ? 148  VAL B C     1 
ATOM   2889  O  O     . VAL B  1  148  ? 28.907  15.903  133.926 1.00 67.39  ? 148  VAL B O     1 
ATOM   2890  C  CB    . VAL B  1  148  ? 30.932  18.345  134.477 1.00 59.28  ? 148  VAL B CB    1 
ATOM   2891  C  CG1   . VAL B  1  148  ? 31.237  19.609  135.265 1.00 64.21  ? 148  VAL B CG1   1 
ATOM   2892  C  CG2   . VAL B  1  148  ? 31.412  17.111  135.216 1.00 47.54  ? 148  VAL B CG2   1 
ATOM   2893  N  N     . GLY B  1  149  ? 29.269  17.099  132.051 1.00 58.74  ? 149  GLY B N     1 
ATOM   2894  C  CA    . GLY B  1  149  ? 29.109  15.953  131.182 1.00 54.86  ? 149  GLY B CA    1 
ATOM   2895  C  C     . GLY B  1  149  ? 27.657  15.600  130.950 1.00 54.06  ? 149  GLY B C     1 
ATOM   2896  O  O     . GLY B  1  149  ? 26.806  16.477  130.836 1.00 62.11  ? 149  GLY B O     1 
ATOM   2897  N  N     . TYR B  1  150  ? 27.377  14.307  130.874 1.00 49.25  ? 150  TYR B N     1 
ATOM   2898  C  CA    . TYR B  1  150  ? 26.032  13.835  130.582 1.00 56.00  ? 150  TYR B CA    1 
ATOM   2899  C  C     . TYR B  1  150  ? 25.736  12.608  131.429 1.00 66.40  ? 150  TYR B C     1 
ATOM   2900  O  O     . TYR B  1  150  ? 26.381  11.570  131.287 1.00 65.99  ? 150  TYR B O     1 
ATOM   2901  C  CB    . TYR B  1  150  ? 25.906  13.493  129.098 1.00 52.07  ? 150  TYR B CB    1 
ATOM   2902  C  CG    . TYR B  1  150  ? 24.524  13.072  128.646 1.00 53.26  ? 150  TYR B CG    1 
ATOM   2903  C  CD1   . TYR B  1  150  ? 23.625  14.008  128.147 1.00 57.99  ? 150  TYR B CD1   1 
ATOM   2904  C  CD2   . TYR B  1  150  ? 24.128  11.739  128.689 1.00 51.01  ? 150  TYR B CD2   1 
ATOM   2905  C  CE1   . TYR B  1  150  ? 22.366  13.636  127.719 1.00 58.42  ? 150  TYR B CE1   1 
ATOM   2906  C  CE2   . TYR B  1  150  ? 22.872  11.355  128.258 1.00 52.59  ? 150  TYR B CE2   1 
ATOM   2907  C  CZ    . TYR B  1  150  ? 21.993  12.309  127.775 1.00 56.82  ? 150  TYR B CZ    1 
ATOM   2908  O  OH    . TYR B  1  150  ? 20.736  11.941  127.347 1.00 51.91  ? 150  TYR B OH    1 
ATOM   2909  N  N     . VAL B  1  151  ? 24.765  12.729  132.322 1.00 66.67  ? 151  VAL B N     1 
ATOM   2910  C  CA    . VAL B  1  151  ? 24.390  11.602  133.154 1.00 65.07  ? 151  VAL B CA    1 
ATOM   2911  C  C     . VAL B  1  151  ? 22.952  11.197  132.865 1.00 67.92  ? 151  VAL B C     1 
ATOM   2912  O  O     . VAL B  1  151  ? 22.021  11.959  133.135 1.00 63.86  ? 151  VAL B O     1 
ATOM   2913  C  CB    . VAL B  1  151  ? 24.566  11.922  134.643 1.00 59.97  ? 151  VAL B CB    1 
ATOM   2914  C  CG1   . VAL B  1  151  ? 24.562  10.641  135.457 1.00 61.25  ? 151  VAL B CG1   1 
ATOM   2915  C  CG2   . VAL B  1  151  ? 25.866  12.678  134.861 1.00 54.01  ? 151  VAL B CG2   1 
ATOM   2916  N  N     . PRO B  1  152  ? 22.774  9.997   132.286 1.00 66.27  ? 152  PRO B N     1 
ATOM   2917  C  CA    . PRO B  1  152  ? 21.456  9.424   131.993 1.00 68.68  ? 152  PRO B CA    1 
ATOM   2918  C  C     . PRO B  1  152  ? 20.612  9.394   133.256 1.00 71.79  ? 152  PRO B C     1 
ATOM   2919  O  O     . PRO B  1  152  ? 21.167  9.388   134.352 1.00 73.46  ? 152  PRO B O     1 
ATOM   2920  C  CB    . PRO B  1  152  ? 21.787  7.993   131.561 1.00 65.87  ? 152  PRO B CB    1 
ATOM   2921  C  CG    . PRO B  1  152  ? 23.181  8.064   131.060 1.00 60.94  ? 152  PRO B CG    1 
ATOM   2922  C  CD    . PRO B  1  152  ? 23.873  9.101   131.888 1.00 54.42  ? 152  PRO B CD    1 
ATOM   2923  N  N     . ALA B  1  153  ? 19.293  9.372   133.111 1.00 73.58  ? 153  ALA B N     1 
ATOM   2924  C  CA    . ALA B  1  153  ? 18.406  9.362   134.269 1.00 73.40  ? 153  ALA B CA    1 
ATOM   2925  C  C     . ALA B  1  153  ? 18.790  8.274   135.266 1.00 71.60  ? 153  ALA B C     1 
ATOM   2926  O  O     . ALA B  1  153  ? 19.076  8.554   136.431 1.00 70.29  ? 153  ALA B O     1 
ATOM   2927  C  CB    . ALA B  1  153  ? 16.965  9.189   133.830 1.00 73.25  ? 153  ALA B CB    1 
ATOM   2928  N  N     . GLU B  1  154  ? 18.812  7.035   134.790 1.00 65.98  ? 154  GLU B N     1 
ATOM   2929  C  CA    . GLU B  1  154  ? 19.081  5.881   135.638 1.00 67.39  ? 154  GLU B CA    1 
ATOM   2930  C  C     . GLU B  1  154  ? 20.440  5.909   136.352 1.00 73.20  ? 154  GLU B C     1 
ATOM   2931  O  O     . GLU B  1  154  ? 20.669  5.137   137.279 1.00 74.21  ? 154  GLU B O     1 
ATOM   2932  C  CB    . GLU B  1  154  ? 18.947  4.588   134.827 1.00 66.11  ? 154  GLU B CB    1 
ATOM   2933  C  CG    . GLU B  1  154  ? 17.642  4.470   134.047 1.00 72.70  ? 154  GLU B CG    1 
ATOM   2934  C  CD    . GLU B  1  154  ? 17.640  5.305   132.776 1.00 91.21  ? 154  GLU B CD    1 
ATOM   2935  O  OE1   . GLU B  1  154  ? 18.653  5.995   132.523 1.00 93.38  ? 154  GLU B OE1   1 
ATOM   2936  O  OE2   . GLU B  1  154  ? 16.632  5.269   132.030 1.00 84.59  ? 154  GLU B OE2   1 
ATOM   2937  N  N     . LYS B  1  155  ? 21.341  6.788   135.926 1.00 79.53  ? 155  LYS B N     1 
ATOM   2938  C  CA    . LYS B  1  155  ? 22.692  6.808   136.496 1.00 77.04  ? 155  LYS B CA    1 
ATOM   2939  C  C     . LYS B  1  155  ? 22.837  7.708   137.726 1.00 74.74  ? 155  LYS B C     1 
ATOM   2940  O  O     . LYS B  1  155  ? 23.575  7.378   138.654 1.00 72.73  ? 155  LYS B O     1 
ATOM   2941  C  CB    . LYS B  1  155  ? 23.741  7.166   135.434 1.00 73.06  ? 155  LYS B CB    1 
ATOM   2942  C  CG    . LYS B  1  155  ? 24.005  6.050   134.430 1.00 82.67  ? 155  LYS B CG    1 
ATOM   2943  C  CD    . LYS B  1  155  ? 24.581  4.814   135.110 1.00 91.60  ? 155  LYS B CD    1 
ATOM   2944  C  CE    . LYS B  1  155  ? 24.474  3.584   134.216 1.00 101.63 ? 155  LYS B CE    1 
ATOM   2945  N  NZ    . LYS B  1  155  ? 25.120  3.781   132.885 1.00 100.02 ? 155  LYS B NZ    1 
ATOM   2946  N  N     . HIS B  1  156  ? 22.150  8.846   137.728 1.00 76.51  ? 156  HIS B N     1 
ATOM   2947  C  CA    . HIS B  1  156  ? 22.155  9.725   138.894 1.00 76.87  ? 156  HIS B CA    1 
ATOM   2948  C  C     . HIS B  1  156  ? 21.033  9.301   139.834 1.00 87.68  ? 156  HIS B C     1 
ATOM   2949  O  O     . HIS B  1  156  ? 21.201  9.281   141.061 1.00 75.02  ? 156  HIS B O     1 
ATOM   2950  C  CB    . HIS B  1  156  ? 21.993  11.191  138.483 1.00 70.21  ? 156  HIS B CB    1 
ATOM   2951  C  CG    . HIS B  1  156  ? 20.681  11.498  137.830 1.00 73.70  ? 156  HIS B CG    1 
ATOM   2952  N  ND1   . HIS B  1  156  ? 19.615  12.030  138.520 1.00 82.94  ? 156  HIS B ND1   1 
ATOM   2953  C  CD2   . HIS B  1  156  ? 20.262  11.344  136.552 1.00 74.22  ? 156  HIS B CD2   1 
ATOM   2954  C  CE1   . HIS B  1  156  ? 18.596  12.194  137.695 1.00 83.60  ? 156  HIS B CE1   1 
ATOM   2955  N  NE2   . HIS B  1  156  ? 18.963  11.787  136.494 1.00 78.31  ? 156  HIS B NE2   1 
ATOM   2956  N  N     . GLY B  1  157  ? 19.893  8.955   139.235 1.00 90.61  ? 157  GLY B N     1 
ATOM   2957  C  CA    . GLY B  1  157  ? 18.739  8.443   139.953 1.00 89.27  ? 157  GLY B CA    1 
ATOM   2958  C  C     . GLY B  1  157  ? 18.346  9.255   141.170 1.00 98.80  ? 157  GLY B C     1 
ATOM   2959  O  O     . GLY B  1  157  ? 18.254  8.722   142.279 1.00 115.70 ? 157  GLY B O     1 
ATOM   2960  N  N     . ILE B  1  158  ? 18.107  10.548  140.971 1.00 92.06  ? 158  ILE B N     1 
ATOM   2961  C  CA    . ILE B  1  158  ? 17.749  11.410  142.090 1.00 101.23 ? 158  ILE B CA    1 
ATOM   2962  C  C     . ILE B  1  158  ? 16.235  11.582  142.217 1.00 102.67 ? 158  ILE B C     1 
ATOM   2963  O  O     . ILE B  1  158  ? 15.520  11.709  141.217 1.00 90.11  ? 158  ILE B O     1 
ATOM   2964  C  CB    . ILE B  1  158  ? 18.466  12.787  142.034 1.00 89.41  ? 158  ILE B CB    1 
ATOM   2965  C  CG1   . ILE B  1  158  ? 17.731  13.758  141.113 1.00 89.69  ? 158  ILE B CG1   1 
ATOM   2966  C  CG2   . ILE B  1  158  ? 19.919  12.624  141.621 1.00 87.85  ? 158  ILE B CG2   1 
ATOM   2967  C  CD1   . ILE B  1  158  ? 16.785  14.682  141.843 1.00 92.09  ? 158  ILE B CD1   1 
ATOM   2968  N  N     . LYS B  1  159  ? 15.724  11.521  143.448 1.00 107.84 ? 159  LYS B N     1 
ATOM   2969  C  CA    . LYS B  1  159  ? 14.325  11.877  143.716 1.00 108.20 ? 159  LYS B CA    1 
ATOM   2970  C  C     . LYS B  1  159  ? 14.119  12.730  144.980 1.00 104.96 ? 159  LYS B C     1 
ATOM   2971  O  O     . LYS B  1  159  ? 14.427  12.285  146.085 1.00 104.89 ? 159  LYS B O     1 
ATOM   2972  C  CB    . LYS B  1  159  ? 13.461  10.615  143.794 1.00 100.83 ? 159  LYS B CB    1 
ATOM   2973  C  CG    . LYS B  1  159  ? 12.871  10.185  142.461 1.00 110.26 ? 159  LYS B CG    1 
ATOM   2974  C  CD    . LYS B  1  159  ? 11.842  9.082   142.642 1.00 114.02 ? 159  LYS B CD    1 
ATOM   2975  C  CE    . LYS B  1  159  ? 11.790  8.169   141.428 1.00 110.75 ? 159  LYS B CE    1 
ATOM   2976  N  NZ    . LYS B  1  159  ? 12.117  6.759   141.778 1.00 110.39 ? 159  LYS B NZ    1 
ATOM   2977  N  N     . ASP B  1  160  ? 13.589  13.942  144.818 1.00 104.05 ? 160  ASP B N     1 
ATOM   2978  C  CA    . ASP B  1  160  ? 13.172  14.778  145.951 1.00 109.43 ? 160  ASP B CA    1 
ATOM   2979  C  C     . ASP B  1  160  ? 11.964  14.227  146.722 1.00 103.63 ? 160  ASP B C     1 
ATOM   2980  O  O     . ASP B  1  160  ? 11.921  14.248  147.952 1.00 99.94  ? 160  ASP B O     1 
ATOM   2981  C  CB    . ASP B  1  160  ? 12.883  16.205  145.480 1.00 115.71 ? 160  ASP B CB    1 
ATOM   2982  C  CG    . ASP B  1  160  ? 14.141  17.038  145.334 1.00 105.78 ? 160  ASP B CG    1 
ATOM   2983  O  OD1   . ASP B  1  160  ? 15.155  16.702  145.981 1.00 104.00 ? 160  ASP B OD1   1 
ATOM   2984  O  OD2   . ASP B  1  160  ? 14.116  18.027  144.573 1.00 94.45  ? 160  ASP B OD2   1 
ATOM   2985  N  N     . ARG B  1  161  ? 10.990  13.741  145.960 1.00 101.86 ? 161  ARG B N     1 
ATOM   2986  C  CA    . ARG B  1  161  ? 9.730   13.200  146.441 1.00 98.49  ? 161  ARG B CA    1 
ATOM   2987  C  C     . ARG B  1  161  ? 9.300   12.034  145.561 1.00 95.87  ? 161  ARG B C     1 
ATOM   2988  O  O     . ARG B  1  161  ? 9.811   11.860  144.458 1.00 99.79  ? 161  ARG B O     1 
ATOM   2989  C  CB    . ARG B  1  161  ? 8.656   14.283  146.419 1.00 99.31  ? 161  ARG B CB    1 
ATOM   2990  C  CG    . ARG B  1  161  ? 8.123   14.589  145.036 1.00 102.67 ? 161  ARG B CG    1 
ATOM   2991  C  CD    . ARG B  1  161  ? 6.954   15.547  145.104 1.00 104.90 ? 161  ARG B CD    1 
ATOM   2992  N  NE    . ARG B  1  161  ? 7.368   16.870  145.556 1.00 106.91 ? 161  ARG B NE    1 
ATOM   2993  C  CZ    . ARG B  1  161  ? 6.568   17.723  146.183 1.00 104.56 ? 161  ARG B CZ    1 
ATOM   2994  N  NH1   . ARG B  1  161  ? 5.311   17.384  146.436 1.00 102.29 ? 161  ARG B NH1   1 
ATOM   2995  N  NH2   . ARG B  1  161  ? 7.025   18.911  146.564 1.00 93.40  ? 161  ARG B NH2   1 
ATOM   2996  N  N     . ILE B  1  162  ? 8.367   11.224  146.046 1.00 103.51 ? 162  ILE B N     1 
ATOM   2997  C  CA    . ILE B  1  162  ? 7.818   10.154  145.224 1.00 112.69 ? 162  ILE B CA    1 
ATOM   2998  C  C     . ILE B  1  162  ? 6.927   10.791  144.155 1.00 111.99 ? 162  ILE B C     1 
ATOM   2999  O  O     . ILE B  1  162  ? 6.451   11.915  144.342 1.00 108.81 ? 162  ILE B O     1 
ATOM   3000  C  CB    . ILE B  1  162  ? 7.034   9.129   146.073 1.00 111.68 ? 162  ILE B CB    1 
ATOM   3001  C  CG1   . ILE B  1  162  ? 6.674   7.888   145.248 1.00 115.69 ? 162  ILE B CG1   1 
ATOM   3002  C  CG2   . ILE B  1  162  ? 5.796   9.769   146.661 1.00 104.24 ? 162  ILE B CG2   1 
ATOM   3003  C  CD1   . ILE B  1  162  ? 7.846   7.285   144.489 1.00 115.84 ? 162  ILE B CD1   1 
ATOM   3004  N  N     . ASN B  1  163  ? 6.728   10.074  143.046 1.00 108.55 ? 163  ASN B N     1 
ATOM   3005  C  CA    . ASN B  1  163  ? 6.037   10.563  141.840 1.00 111.07 ? 163  ASN B CA    1 
ATOM   3006  C  C     . ASN B  1  163  ? 6.884   11.507  140.990 1.00 109.69 ? 163  ASN B C     1 
ATOM   3007  O  O     . ASN B  1  163  ? 6.462   11.935  139.910 1.00 106.04 ? 163  ASN B O     1 
ATOM   3008  C  CB    . ASN B  1  163  ? 4.665   11.189  142.134 1.00 113.46 ? 163  ASN B CB    1 
ATOM   3009  C  CG    . ASN B  1  163  ? 3.568   10.154  142.267 1.00 118.11 ? 163  ASN B CG    1 
ATOM   3010  O  OD1   . ASN B  1  163  ? 3.771   8.968   141.989 1.00 112.12 ? 163  ASN B OD1   1 
ATOM   3011  N  ND2   . ASN B  1  163  ? 2.387   10.602  142.682 1.00 122.72 ? 163  ASN B ND2   1 
ATOM   3012  N  N     . ALA B  1  164  ? 8.058   11.854  141.504 1.00 105.58 ? 164  ALA B N     1 
ATOM   3013  C  CA    . ALA B  1  164  ? 9.042   12.569  140.717 1.00 104.08 ? 164  ALA B CA    1 
ATOM   3014  C  C     . ALA B  1  164  ? 9.602   11.597  139.690 1.00 103.03 ? 164  ALA B C     1 
ATOM   3015  O  O     . ALA B  1  164  ? 9.830   10.427  139.998 1.00 94.61  ? 164  ALA B O     1 
ATOM   3016  C  CB    . ALA B  1  164  ? 10.151  13.104  141.608 1.00 97.83  ? 164  ALA B CB    1 
ATOM   3017  N  N     . ILE B  1  165  ? 9.829   12.076  138.475 1.00 100.57 ? 165  ILE B N     1 
ATOM   3018  C  CA    . ILE B  1  165  ? 10.426  11.242  137.444 1.00 95.73  ? 165  ILE B CA    1 
ATOM   3019  C  C     . ILE B  1  165  ? 11.795  11.807  137.113 1.00 91.85  ? 165  ILE B C     1 
ATOM   3020  O  O     . ILE B  1  165  ? 11.924  12.993  136.812 1.00 87.39  ? 165  ILE B O     1 
ATOM   3021  C  CB    . ILE B  1  165  ? 9.565   11.210  136.170 1.00 94.63  ? 165  ILE B CB    1 
ATOM   3022  C  CG1   . ILE B  1  165  ? 8.430   12.230  136.268 1.00 96.54  ? 165  ILE B CG1   1 
ATOM   3023  C  CG2   . ILE B  1  165  ? 9.012   9.813   135.936 1.00 102.17 ? 165  ILE B CG2   1 
ATOM   3024  C  CD1   . ILE B  1  165  ? 7.289   11.968  135.309 1.00 99.66  ? 165  ILE B CD1   1 
ATOM   3025  N  N     . PRO B  1  166  ? 12.820  10.965  137.171 1.00 89.81  ? 166  PRO B N     1 
ATOM   3026  C  CA    . PRO B  1  166  ? 14.178  11.455  136.920 1.00 87.03  ? 166  PRO B CA    1 
ATOM   3027  C  C     . PRO B  1  166  ? 14.427  11.711  135.435 1.00 80.40  ? 166  PRO B C     1 
ATOM   3028  O  O     . PRO B  1  166  ? 13.921  10.979  134.583 1.00 78.34  ? 166  PRO B O     1 
ATOM   3029  C  CB    . PRO B  1  166  ? 15.057  10.310  137.431 1.00 85.41  ? 166  PRO B CB    1 
ATOM   3030  C  CG    . PRO B  1  166  ? 14.219  9.098   137.263 1.00 82.87  ? 166  PRO B CG    1 
ATOM   3031  C  CD    . PRO B  1  166  ? 12.803  9.531   137.509 1.00 91.43  ? 166  PRO B CD    1 
ATOM   3032  N  N     . VAL B  1  167  ? 15.200  12.750  135.141 1.00 72.45  ? 167  VAL B N     1 
ATOM   3033  C  CA    . VAL B  1  167  ? 15.441  13.168  133.767 1.00 78.13  ? 167  VAL B CA    1 
ATOM   3034  C  C     . VAL B  1  167  ? 16.914  13.046  133.375 1.00 81.46  ? 167  VAL B C     1 
ATOM   3035  O  O     . VAL B  1  167  ? 17.803  13.308  134.189 1.00 74.09  ? 167  VAL B O     1 
ATOM   3036  C  CB    . VAL B  1  167  ? 14.964  14.619  133.544 1.00 76.20  ? 167  VAL B CB    1 
ATOM   3037  C  CG1   . VAL B  1  167  ? 15.740  15.276  132.415 1.00 74.41  ? 167  VAL B CG1   1 
ATOM   3038  C  CG2   . VAL B  1  167  ? 13.476  14.644  133.262 1.00 77.39  ? 167  VAL B CG2   1 
ATOM   3039  N  N     . ASP B  1  168  ? 17.162  12.638  132.128 1.00 78.71  ? 168  ASP B N     1 
ATOM   3040  C  CA    . ASP B  1  168  ? 18.516  12.564  131.589 1.00 64.64  ? 168  ASP B CA    1 
ATOM   3041  C  C     . ASP B  1  168  ? 19.171  13.943  131.714 1.00 65.83  ? 168  ASP B C     1 
ATOM   3042  O  O     . ASP B  1  168  ? 18.632  14.945  131.249 1.00 65.31  ? 168  ASP B O     1 
ATOM   3043  C  CB    . ASP B  1  168  ? 18.486  12.101  130.129 1.00 66.41  ? 168  ASP B CB    1 
ATOM   3044  C  CG    . ASP B  1  168  ? 17.727  10.791  129.937 1.00 74.49  ? 168  ASP B CG    1 
ATOM   3045  O  OD1   . ASP B  1  168  ? 18.283  9.726   130.277 1.00 75.37  ? 168  ASP B OD1   1 
ATOM   3046  O  OD2   . ASP B  1  168  ? 16.577  10.821  129.440 1.00 75.99  ? 168  ASP B OD2   1 
ATOM   3047  N  N     . ALA B  1  169  ? 20.333  13.991  132.351 1.00 62.35  ? 169  ALA B N     1 
ATOM   3048  C  CA    . ALA B  1  169  ? 20.949  15.261  132.727 1.00 62.67  ? 169  ALA B CA    1 
ATOM   3049  C  C     . ALA B  1  169  ? 21.936  15.804  131.701 1.00 69.00  ? 169  ALA B C     1 
ATOM   3050  O  O     . ALA B  1  169  ? 23.062  15.318  131.600 1.00 68.43  ? 169  ALA B O     1 
ATOM   3051  C  CB    . ALA B  1  169  ? 21.634  15.123  134.078 1.00 61.35  ? 169  ALA B CB    1 
ATOM   3052  N  N     . VAL B  1  170  ? 21.524  16.825  130.960 1.00 67.76  ? 170  VAL B N     1 
ATOM   3053  C  CA    . VAL B  1  170  ? 22.422  17.468  130.017 1.00 62.91  ? 170  VAL B CA    1 
ATOM   3054  C  C     . VAL B  1  170  ? 23.146  18.634  130.677 1.00 57.45  ? 170  VAL B C     1 
ATOM   3055  O  O     . VAL B  1  170  ? 22.738  19.793  130.545 1.00 54.80  ? 170  VAL B O     1 
ATOM   3056  C  CB    . VAL B  1  170  ? 21.672  17.980  128.763 1.00 64.91  ? 170  VAL B CB    1 
ATOM   3057  C  CG1   . VAL B  1  170  ? 22.657  18.598  127.773 1.00 65.78  ? 170  VAL B CG1   1 
ATOM   3058  C  CG2   . VAL B  1  170  ? 20.895  16.850  128.109 1.00 63.88  ? 170  VAL B CG2   1 
ATOM   3059  N  N     . PHE B  1  171  ? 24.232  18.322  131.375 1.00 49.41  ? 171  PHE B N     1 
ATOM   3060  C  CA    . PHE B  1  171  ? 25.005  19.350  132.060 1.00 61.23  ? 171  PHE B CA    1 
ATOM   3061  C  C     . PHE B  1  171  ? 25.776  20.243  131.097 1.00 65.73  ? 171  PHE B C     1 
ATOM   3062  O  O     . PHE B  1  171  ? 25.616  21.470  131.103 1.00 64.86  ? 171  PHE B O     1 
ATOM   3063  C  CB    . PHE B  1  171  ? 25.975  18.729  133.070 1.00 62.91  ? 171  PHE B CB    1 
ATOM   3064  C  CG    . PHE B  1  171  ? 25.297  18.001  134.193 1.00 68.15  ? 171  PHE B CG    1 
ATOM   3065  C  CD1   . PHE B  1  171  ? 24.625  18.699  135.180 1.00 67.38  ? 171  PHE B CD1   1 
ATOM   3066  C  CD2   . PHE B  1  171  ? 25.332  16.621  134.264 1.00 65.19  ? 171  PHE B CD2   1 
ATOM   3067  C  CE1   . PHE B  1  171  ? 24.000  18.038  136.213 1.00 65.37  ? 171  PHE B CE1   1 
ATOM   3068  C  CE2   . PHE B  1  171  ? 24.707  15.953  135.298 1.00 66.56  ? 171  PHE B CE2   1 
ATOM   3069  C  CZ    . PHE B  1  171  ? 24.040  16.662  136.274 1.00 63.06  ? 171  PHE B CZ    1 
ATOM   3070  N  N     . SER B  1  172  ? 26.606  19.611  130.272 1.00 66.81  ? 172  SER B N     1 
ATOM   3071  C  CA    . SER B  1  172  ? 27.534  20.319  129.394 1.00 66.46  ? 172  SER B CA    1 
ATOM   3072  C  C     . SER B  1  172  ? 26.863  21.451  128.624 1.00 63.69  ? 172  SER B C     1 
ATOM   3073  O  O     . SER B  1  172  ? 25.950  21.215  127.834 1.00 65.00  ? 172  SER B O     1 
ATOM   3074  C  CB    . SER B  1  172  ? 28.214  19.342  128.422 1.00 72.15  ? 172  SER B CB    1 
ATOM   3075  O  OG    . SER B  1  172  ? 29.268  19.961  127.695 1.00 67.47  ? 172  SER B OG    1 
ATOM   3076  N  N     . PRO B  1  173  ? 27.325  22.688  128.859 1.00 63.51  ? 173  PRO B N     1 
ATOM   3077  C  CA    . PRO B  1  173  ? 26.859  23.885  128.155 1.00 65.16  ? 173  PRO B CA    1 
ATOM   3078  C  C     . PRO B  1  173  ? 27.388  23.871  126.731 1.00 67.12  ? 173  PRO B C     1 
ATOM   3079  O  O     . PRO B  1  173  ? 26.916  24.615  125.871 1.00 68.60  ? 173  PRO B O     1 
ATOM   3080  C  CB    . PRO B  1  173  ? 27.522  25.015  128.936 1.00 70.29  ? 173  PRO B CB    1 
ATOM   3081  C  CG    . PRO B  1  173  ? 28.785  24.405  129.451 1.00 57.26  ? 173  PRO B CG    1 
ATOM   3082  C  CD    . PRO B  1  173  ? 28.417  22.994  129.801 1.00 62.67  ? 173  PRO B CD    1 
ATOM   3083  N  N     . VAL B  1  174  ? 28.384  23.025  126.499 1.00 67.29  ? 174  VAL B N     1 
ATOM   3084  C  CA    . VAL B  1  174  ? 28.910  22.800  125.163 1.00 65.49  ? 174  VAL B CA    1 
ATOM   3085  C  C     . VAL B  1  174  ? 28.005  21.807  124.444 1.00 65.04  ? 174  VAL B C     1 
ATOM   3086  O  O     . VAL B  1  174  ? 27.891  20.651  124.853 1.00 62.71  ? 174  VAL B O     1 
ATOM   3087  C  CB    . VAL B  1  174  ? 30.347  22.250  125.207 1.00 60.04  ? 174  VAL B CB    1 
ATOM   3088  C  CG1   . VAL B  1  174  ? 30.801  21.866  123.822 1.00 61.26  ? 174  VAL B CG1   1 
ATOM   3089  C  CG2   . VAL B  1  174  ? 31.290  23.275  125.809 1.00 54.12  ? 174  VAL B CG2   1 
ATOM   3090  N  N     . ARG B  1  175  ? 27.349  22.272  123.385 1.00 63.99  ? 175  ARG B N     1 
ATOM   3091  C  CA    . ARG B  1  175  ? 26.419  21.440  122.638 1.00 63.23  ? 175  ARG B CA    1 
ATOM   3092  C  C     . ARG B  1  175  ? 27.151  20.600  121.600 1.00 64.65  ? 175  ARG B C     1 
ATOM   3093  O  O     . ARG B  1  175  ? 26.762  19.459  121.313 1.00 57.11  ? 175  ARG B O     1 
ATOM   3094  C  CB    . ARG B  1  175  ? 25.345  22.296  121.964 1.00 61.47  ? 175  ARG B CB    1 
ATOM   3095  C  CG    . ARG B  1  175  ? 24.426  23.000  122.937 1.00 71.50  ? 175  ARG B CG    1 
ATOM   3096  C  CD    . ARG B  1  175  ? 23.019  23.137  122.375 1.00 87.34  ? 175  ARG B CD    1 
ATOM   3097  N  NE    . ARG B  1  175  ? 22.069  23.578  123.396 1.00 99.60  ? 175  ARG B NE    1 
ATOM   3098  C  CZ    . ARG B  1  175  ? 21.486  22.775  124.284 1.00 92.97  ? 175  ARG B CZ    1 
ATOM   3099  N  NH1   . ARG B  1  175  ? 21.747  21.472  124.294 1.00 84.76  ? 175  ARG B NH1   1 
ATOM   3100  N  NH2   . ARG B  1  175  ? 20.638  23.278  125.169 1.00 90.76  ? 175  ARG B NH2   1 
ATOM   3101  N  N     . ARG B  1  176  ? 28.213  21.160  121.029 1.00 68.89  ? 176  ARG B N     1 
ATOM   3102  C  CA    . ARG B  1  176  ? 28.960  20.414  120.017 1.00 61.58  ? 176  ARG B CA    1 
ATOM   3103  C  C     . ARG B  1  176  ? 30.413  20.851  119.897 1.00 57.40  ? 176  ARG B C     1 
ATOM   3104  O  O     . ARG B  1  176  ? 30.741  22.007  120.129 1.00 61.73  ? 176  ARG B O     1 
ATOM   3105  C  CB    . ARG B  1  176  ? 28.256  20.502  118.657 1.00 61.25  ? 176  ARG B CB    1 
ATOM   3106  C  CG    . ARG B  1  176  ? 29.033  19.880  117.501 1.00 70.06  ? 176  ARG B CG    1 
ATOM   3107  C  CD    . ARG B  1  176  ? 28.101  19.198  116.512 1.00 70.52  ? 176  ARG B CD    1 
ATOM   3108  N  NE    . ARG B  1  176  ? 27.795  20.013  115.337 1.00 67.14  ? 176  ARG B NE    1 
ATOM   3109  C  CZ    . ARG B  1  176  ? 28.267  19.770  114.118 1.00 62.21  ? 176  ARG B CZ    1 
ATOM   3110  N  NH1   . ARG B  1  176  ? 29.074  18.738  113.910 1.00 67.72  ? 176  ARG B NH1   1 
ATOM   3111  N  NH2   . ARG B  1  176  ? 27.934  20.555  113.106 1.00 56.88  ? 176  ARG B NH2   1 
ATOM   3112  N  N     . VAL B  1  177  ? 31.284  19.912  119.549 1.00 58.22  ? 177  VAL B N     1 
ATOM   3113  C  CA    . VAL B  1  177  ? 32.670  20.236  119.228 1.00 61.03  ? 177  VAL B CA    1 
ATOM   3114  C  C     . VAL B  1  177  ? 33.138  19.482  117.993 1.00 59.94  ? 177  VAL B C     1 
ATOM   3115  O  O     . VAL B  1  177  ? 33.034  18.257  117.922 1.00 62.16  ? 177  VAL B O     1 
ATOM   3116  C  CB    . VAL B  1  177  ? 33.628  19.877  120.369 1.00 58.48  ? 177  VAL B CB    1 
ATOM   3117  C  CG1   . VAL B  1  177  ? 35.040  20.320  120.016 1.00 57.58  ? 177  VAL B CG1   1 
ATOM   3118  C  CG2   . VAL B  1  177  ? 33.173  20.505  121.667 1.00 57.92  ? 177  VAL B CG2   1 
ATOM   3119  N  N     . ALA B  1  178  ? 33.661  20.218  117.022 1.00 61.89  ? 178  ALA B N     1 
ATOM   3120  C  CA    . ALA B  1  178  ? 34.261  19.598  115.848 1.00 59.48  ? 178  ALA B CA    1 
ATOM   3121  C  C     . ALA B  1  178  ? 35.652  20.170  115.657 1.00 58.29  ? 178  ALA B C     1 
ATOM   3122  O  O     . ALA B  1  178  ? 35.855  21.357  115.844 1.00 60.02  ? 178  ALA B O     1 
ATOM   3123  C  CB    . ALA B  1  178  ? 33.413  19.861  114.616 1.00 60.25  ? 178  ALA B CB    1 
ATOM   3124  N  N     . PHE B  1  179  ? 36.622  19.341  115.302 1.00 55.21  ? 179  PHE B N     1 
ATOM   3125  C  CA    . PHE B  1  179  ? 37.932  19.889  114.990 1.00 57.41  ? 179  PHE B CA    1 
ATOM   3126  C  C     . PHE B  1  179  ? 38.546  19.236  113.761 1.00 65.28  ? 179  PHE B C     1 
ATOM   3127  O  O     . PHE B  1  179  ? 38.305  18.061  113.472 1.00 65.23  ? 179  PHE B O     1 
ATOM   3128  C  CB    . PHE B  1  179  ? 38.877  19.829  116.195 1.00 55.35  ? 179  PHE B CB    1 
ATOM   3129  C  CG    . PHE B  1  179  ? 39.615  18.527  116.334 1.00 57.65  ? 179  PHE B CG    1 
ATOM   3130  C  CD1   . PHE B  1  179  ? 40.928  18.408  115.895 1.00 57.09  ? 179  PHE B CD1   1 
ATOM   3131  C  CD2   . PHE B  1  179  ? 39.004  17.428  116.917 1.00 53.74  ? 179  PHE B CD2   1 
ATOM   3132  C  CE1   . PHE B  1  179  ? 41.613  17.215  116.030 1.00 56.31  ? 179  PHE B CE1   1 
ATOM   3133  C  CE2   . PHE B  1  179  ? 39.683  16.232  117.057 1.00 55.16  ? 179  PHE B CE2   1 
ATOM   3134  C  CZ    . PHE B  1  179  ? 40.988  16.125  116.613 1.00 57.99  ? 179  PHE B CZ    1 
ATOM   3135  N  N     . GLN B  1  180  ? 39.333  20.023  113.037 1.00 63.92  ? 180  GLN B N     1 
ATOM   3136  C  CA    . GLN B  1  180  ? 39.921  19.583  111.786 1.00 58.82  ? 180  GLN B CA    1 
ATOM   3137  C  C     . GLN B  1  180  ? 41.356  20.070  111.704 1.00 61.47  ? 180  GLN B C     1 
ATOM   3138  O  O     . GLN B  1  180  ? 41.636  21.249  111.900 1.00 66.27  ? 180  GLN B O     1 
ATOM   3139  C  CB    . GLN B  1  180  ? 39.118  20.136  110.610 1.00 62.19  ? 180  GLN B CB    1 
ATOM   3140  C  CG    . GLN B  1  180  ? 39.499  19.562  109.265 1.00 78.06  ? 180  GLN B CG    1 
ATOM   3141  C  CD    . GLN B  1  180  ? 38.832  20.297  108.119 1.00 92.70  ? 180  GLN B CD    1 
ATOM   3142  O  OE1   . GLN B  1  180  ? 38.279  21.384  108.304 1.00 92.17  ? 180  GLN B OE1   1 
ATOM   3143  N  NE2   . GLN B  1  180  ? 38.879  19.708  106.927 1.00 92.16  ? 180  GLN B NE2   1 
ATOM   3144  N  N     . VAL B  1  181  ? 42.269  19.153  111.425 1.00 63.30  ? 181  VAL B N     1 
ATOM   3145  C  CA    . VAL B  1  181  ? 43.655  19.517  111.205 1.00 60.70  ? 181  VAL B CA    1 
ATOM   3146  C  C     . VAL B  1  181  ? 43.974  19.385  109.724 1.00 68.58  ? 181  VAL B C     1 
ATOM   3147  O  O     . VAL B  1  181  ? 43.669  18.365  109.107 1.00 65.66  ? 181  VAL B O     1 
ATOM   3148  C  CB    . VAL B  1  181  ? 44.598  18.605  111.989 1.00 55.82  ? 181  VAL B CB    1 
ATOM   3149  C  CG1   . VAL B  1  181  ? 46.044  18.998  111.736 1.00 60.73  ? 181  VAL B CG1   1 
ATOM   3150  C  CG2   . VAL B  1  181  ? 44.274  18.667  113.465 1.00 64.18  ? 181  VAL B CG2   1 
ATOM   3151  N  N     . GLU B  1  182  ? 44.577  20.416  109.147 1.00 71.36  ? 182  GLU B N     1 
ATOM   3152  C  CA    . GLU B  1  182  ? 44.985  20.325  107.750 1.00 69.05  ? 182  GLU B CA    1 
ATOM   3153  C  C     . GLU B  1  182  ? 46.410  20.817  107.536 1.00 69.48  ? 182  GLU B C     1 
ATOM   3154  O  O     . GLU B  1  182  ? 46.905  21.654  108.286 1.00 69.82  ? 182  GLU B O     1 
ATOM   3155  C  CB    . GLU B  1  182  ? 43.990  21.040  106.831 1.00 74.72  ? 182  GLU B CB    1 
ATOM   3156  C  CG    . GLU B  1  182  ? 43.693  22.480  107.194 1.00 78.86  ? 182  GLU B CG    1 
ATOM   3157  C  CD    . GLU B  1  182  ? 42.453  23.000  106.489 1.00 84.68  ? 182  GLU B CD    1 
ATOM   3158  O  OE1   . GLU B  1  182  ? 41.529  22.193  106.238 1.00 78.05  ? 182  GLU B OE1   1 
ATOM   3159  O  OE2   . GLU B  1  182  ? 42.406  24.212  106.181 1.00 85.29  ? 182  GLU B OE2   1 
ATOM   3160  N  N     . ASP B  1  183  ? 47.071  20.275  106.520 1.00 73.45  ? 183  ASP B N     1 
ATOM   3161  C  CA    . ASP B  1  183  ? 48.473  20.588  106.271 1.00 71.62  ? 183  ASP B CA    1 
ATOM   3162  C  C     . ASP B  1  183  ? 48.679  22.060  105.947 1.00 73.62  ? 183  ASP B C     1 
ATOM   3163  O  O     . ASP B  1  183  ? 47.820  22.701  105.336 1.00 70.67  ? 183  ASP B O     1 
ATOM   3164  C  CB    . ASP B  1  183  ? 49.032  19.713  105.147 1.00 78.65  ? 183  ASP B CB    1 
ATOM   3165  C  CG    . ASP B  1  183  ? 49.259  18.276  105.584 1.00 93.93  ? 183  ASP B CG    1 
ATOM   3166  O  OD1   . ASP B  1  183  ? 50.120  17.599  104.984 1.00 101.86 ? 183  ASP B OD1   1 
ATOM   3167  O  OD2   . ASP B  1  183  ? 48.582  17.824  106.532 1.00 96.35  ? 183  ASP B OD2   1 
ATOM   3168  N  N     . THR B  1  184  ? 49.825  22.586  106.369 1.00 74.23  ? 184  THR B N     1 
ATOM   3169  C  CA    . THR B  1  184  ? 50.188  23.972  106.108 1.00 79.04  ? 184  THR B CA    1 
ATOM   3170  C  C     . THR B  1  184  ? 51.669  24.098  105.790 1.00 82.02  ? 184  THR B C     1 
ATOM   3171  O  O     . THR B  1  184  ? 52.508  23.375  106.347 1.00 77.64  ? 184  THR B O     1 
ATOM   3172  C  CB    . THR B  1  184  ? 49.821  24.902  107.283 1.00 76.25  ? 184  THR B CB    1 
ATOM   3173  O  OG1   . THR B  1  184  ? 48.481  25.373  107.110 1.00 72.22  ? 184  THR B OG1   1 
ATOM   3174  C  CG2   . THR B  1  184  ? 50.744  26.104  107.328 1.00 84.57  ? 184  THR B CG2   1 
ATOM   3175  N  N     . ARG B  1  185  ? 51.961  25.015  104.872 1.00 95.04  ? 185  ARG B N     1 
ATOM   3176  C  CA    . ARG B  1  185  ? 53.316  25.316  104.444 1.00 103.12 ? 185  ARG B CA    1 
ATOM   3177  C  C     . ARG B  1  185  ? 53.810  26.606  105.084 1.00 102.34 ? 185  ARG B C     1 
ATOM   3178  O  O     . ARG B  1  185  ? 53.163  27.649  104.980 1.00 103.10 ? 185  ARG B O     1 
ATOM   3179  C  CB    . ARG B  1  185  ? 53.368  25.461  102.918 1.00 109.21 ? 185  ARG B CB    1 
ATOM   3180  C  CG    . ARG B  1  185  ? 53.393  24.146  102.154 1.00 118.33 ? 185  ARG B CG    1 
ATOM   3181  C  CD    . ARG B  1  185  ? 52.905  24.311  100.718 1.00 129.45 ? 185  ARG B CD    1 
ATOM   3182  N  NE    . ARG B  1  185  ? 51.463  24.546  100.663 1.00 142.08 ? 185  ARG B NE    1 
ATOM   3183  C  CZ    . ARG B  1  185  ? 50.547  23.582  100.632 1.00 133.31 ? 185  ARG B CZ    1 
ATOM   3184  N  NH1   . ARG B  1  185  ? 50.920  22.309  100.648 1.00 131.10 ? 185  ARG B NH1   1 
ATOM   3185  N  NH2   . ARG B  1  185  ? 49.256  23.887  100.587 1.00 123.76 ? 185  ARG B NH2   1 
ATOM   3186  N  N     . LEU B  1  186  ? 54.952  26.530  105.756 1.00 98.99  ? 186  LEU B N     1 
ATOM   3187  C  CA    . LEU B  1  186  ? 55.668  27.728  106.168 1.00 105.11 ? 186  LEU B CA    1 
ATOM   3188  C  C     . LEU B  1  186  ? 57.059  27.681  105.550 1.00 112.91 ? 186  LEU B C     1 
ATOM   3189  O  O     . LEU B  1  186  ? 57.927  26.930  106.002 1.00 109.10 ? 186  LEU B O     1 
ATOM   3190  C  CB    . LEU B  1  186  ? 55.748  27.837  107.692 1.00 108.53 ? 186  LEU B CB    1 
ATOM   3191  C  CG    . LEU B  1  186  ? 56.376  29.110  108.278 1.00 109.01 ? 186  LEU B CG    1 
ATOM   3192  C  CD1   . LEU B  1  186  ? 57.904  29.060  108.255 1.00 110.12 ? 186  LEU B CD1   1 
ATOM   3193  C  CD2   . LEU B  1  186  ? 55.856  30.358  107.566 1.00 105.87 ? 186  LEU B CD2   1 
ATOM   3194  N  N     . GLY B  1  187  ? 57.257  28.485  104.509 1.00 112.68 ? 187  GLY B N     1 
ATOM   3195  C  CA    . GLY B  1  187  ? 58.498  28.483  103.762 1.00 116.33 ? 187  GLY B CA    1 
ATOM   3196  C  C     . GLY B  1  187  ? 58.788  27.126  103.152 1.00 120.67 ? 187  GLY B C     1 
ATOM   3197  O  O     . GLY B  1  187  ? 58.046  26.647  102.292 1.00 108.36 ? 187  GLY B O     1 
ATOM   3198  N  N     . GLN B  1  188  ? 59.874  26.509  103.607 1.00 131.05 ? 188  GLN B N     1 
ATOM   3199  C  CA    . GLN B  1  188  ? 60.327  25.223  103.091 1.00 136.45 ? 188  GLN B CA    1 
ATOM   3200  C  C     . GLN B  1  188  ? 59.581  24.062  103.746 1.00 134.70 ? 188  GLN B C     1 
ATOM   3201  O  O     . GLN B  1  188  ? 59.606  22.934  103.249 1.00 134.15 ? 188  GLN B O     1 
ATOM   3202  C  CB    . GLN B  1  188  ? 61.827  25.073  103.342 1.00 142.09 ? 188  GLN B CB    1 
ATOM   3203  C  CG    . GLN B  1  188  ? 62.180  25.014  104.822 1.00 145.56 ? 188  GLN B CG    1 
ATOM   3204  C  CD    . GLN B  1  188  ? 63.527  25.634  105.133 1.00 154.82 ? 188  GLN B CD    1 
ATOM   3205  O  OE1   . GLN B  1  188  ? 64.295  25.969  104.229 1.00 150.74 ? 188  GLN B OE1   1 
ATOM   3206  N  NE2   . GLN B  1  188  ? 63.818  25.799  106.420 1.00 150.47 ? 188  GLN B NE2   1 
ATOM   3207  N  N     . ARG B  1  189  ? 58.921  24.349  104.864 1.00 125.49 ? 189  ARG B N     1 
ATOM   3208  C  CA    . ARG B  1  189  ? 58.217  23.330  105.636 1.00 110.94 ? 189  ARG B CA    1 
ATOM   3209  C  C     . ARG B  1  189  ? 56.795  23.122  105.125 1.00 106.91 ? 189  ARG B C     1 
ATOM   3210  O  O     . ARG B  1  189  ? 55.946  24.003  105.268 1.00 100.48 ? 189  ARG B O     1 
ATOM   3211  C  CB    . ARG B  1  189  ? 58.159  23.741  107.105 1.00 111.62 ? 189  ARG B CB    1 
ATOM   3212  C  CG    . ARG B  1  189  ? 59.503  23.955  107.769 1.00 113.66 ? 189  ARG B CG    1 
ATOM   3213  C  CD    . ARG B  1  189  ? 59.314  24.633  109.118 1.00 115.16 ? 189  ARG B CD    1 
ATOM   3214  N  NE    . ARG B  1  189  ? 60.507  24.574  109.959 1.00 123.91 ? 189  ARG B NE    1 
ATOM   3215  C  CZ    . ARG B  1  189  ? 60.687  23.694  110.939 1.00 116.35 ? 189  ARG B CZ    1 
ATOM   3216  N  NH1   . ARG B  1  189  ? 61.802  23.718  111.656 1.00 117.96 ? 189  ARG B NH1   1 
ATOM   3217  N  NH2   . ARG B  1  189  ? 59.751  22.791  111.205 1.00 101.87 ? 189  ARG B NH2   1 
ATOM   3218  N  N     . THR B  1  190  ? 56.533  21.952  104.547 1.00 104.97 ? 190  THR B N     1 
ATOM   3219  C  CA    . THR B  1  190  ? 55.212  21.653  103.992 1.00 111.04 ? 190  THR B CA    1 
ATOM   3220  C  C     . THR B  1  190  ? 54.392  20.750  104.921 1.00 103.01 ? 190  THR B C     1 
ATOM   3221  O  O     . THR B  1  190  ? 53.208  20.491  104.676 1.00 96.58  ? 190  THR B O     1 
ATOM   3222  C  CB    . THR B  1  190  ? 55.321  20.991  102.590 1.00 115.25 ? 190  THR B CB    1 
ATOM   3223  O  OG1   . THR B  1  190  ? 56.129  21.803  101.729 1.00 117.14 ? 190  THR B OG1   1 
ATOM   3224  C  CG2   . THR B  1  190  ? 53.945  20.814  101.956 1.00 115.07 ? 190  THR B CG2   1 
ATOM   3225  N  N     . ASP B  1  191  ? 55.020  20.286  105.995 1.00 93.19  ? 191  ASP B N     1 
ATOM   3226  C  CA    . ASP B  1  191  ? 54.396  19.294  106.861 1.00 82.81  ? 191  ASP B CA    1 
ATOM   3227  C  C     . ASP B  1  191  ? 53.648  19.879  108.055 1.00 79.88  ? 191  ASP B C     1 
ATOM   3228  O  O     . ASP B  1  191  ? 53.169  19.138  108.911 1.00 74.89  ? 191  ASP B O     1 
ATOM   3229  C  CB    . ASP B  1  191  ? 55.443  18.294  107.351 1.00 78.31  ? 191  ASP B CB    1 
ATOM   3230  C  CG    . ASP B  1  191  ? 55.248  16.917  106.757 1.00 89.24  ? 191  ASP B CG    1 
ATOM   3231  O  OD1   . ASP B  1  191  ? 54.545  16.815  105.728 1.00 103.18 ? 191  ASP B OD1   1 
ATOM   3232  O  OD2   . ASP B  1  191  ? 55.792  15.936  107.311 1.00 88.56  ? 191  ASP B OD2   1 
ATOM   3233  N  N     . LEU B  1  192  ? 53.534  21.201  108.112 1.00 80.53  ? 192  LEU B N     1 
ATOM   3234  C  CA    . LEU B  1  192  ? 53.018  21.833  109.320 1.00 71.52  ? 192  LEU B CA    1 
ATOM   3235  C  C     . LEU B  1  192  ? 51.530  21.556  109.534 1.00 71.31  ? 192  LEU B C     1 
ATOM   3236  O  O     . LEU B  1  192  ? 50.840  21.112  108.617 1.00 77.15  ? 192  LEU B O     1 
ATOM   3237  C  CB    . LEU B  1  192  ? 53.324  23.332  109.317 1.00 75.68  ? 192  LEU B CB    1 
ATOM   3238  C  CG    . LEU B  1  192  ? 54.693  23.708  109.902 1.00 70.25  ? 192  LEU B CG    1 
ATOM   3239  C  CD1   . LEU B  1  192  ? 55.733  22.615  109.693 1.00 70.53  ? 192  LEU B CD1   1 
ATOM   3240  C  CD2   . LEU B  1  192  ? 55.175  25.033  109.346 1.00 80.71  ? 192  LEU B CD2   1 
ATOM   3241  N  N     . ASP B  1  193  ? 51.053  21.790  110.755 1.00 67.48  ? 193  ASP B N     1 
ATOM   3242  C  CA    . ASP B  1  193  ? 49.662  21.518  111.109 1.00 61.39  ? 193  ASP B CA    1 
ATOM   3243  C  C     . ASP B  1  193  ? 48.887  22.797  111.353 1.00 60.43  ? 193  ASP B C     1 
ATOM   3244  O  O     . ASP B  1  193  ? 49.364  23.703  112.028 1.00 61.28  ? 193  ASP B O     1 
ATOM   3245  C  CB    . ASP B  1  193  ? 49.582  20.645  112.360 1.00 56.66  ? 193  ASP B CB    1 
ATOM   3246  C  CG    . ASP B  1  193  ? 49.567  19.162  112.045 1.00 63.88  ? 193  ASP B CG    1 
ATOM   3247  O  OD1   . ASP B  1  193  ? 50.068  18.765  110.969 1.00 68.14  ? 193  ASP B OD1   1 
ATOM   3248  O  OD2   . ASP B  1  193  ? 49.053  18.391  112.882 1.00 59.77  ? 193  ASP B OD2   1 
ATOM   3249  N  N     . LYS B  1  194  ? 47.688  22.866  110.795 1.00 60.18  ? 194  LYS B N     1 
ATOM   3250  C  CA    . LYS B  1  194  ? 46.791  23.972  111.064 1.00 58.21  ? 194  LYS B CA    1 
ATOM   3251  C  C     . LYS B  1  194  ? 45.558  23.407  111.729 1.00 65.04  ? 194  LYS B C     1 
ATOM   3252  O  O     . LYS B  1  194  ? 44.877  22.542  111.164 1.00 70.78  ? 194  LYS B O     1 
ATOM   3253  C  CB    . LYS B  1  194  ? 46.400  24.697  109.778 1.00 58.05  ? 194  LYS B CB    1 
ATOM   3254  C  CG    . LYS B  1  194  ? 45.285  25.703  109.970 1.00 61.63  ? 194  LYS B CG    1 
ATOM   3255  C  CD    . LYS B  1  194  ? 44.837  26.319  108.657 1.00 69.88  ? 194  LYS B CD    1 
ATOM   3256  C  CE    . LYS B  1  194  ? 43.675  27.272  108.883 1.00 70.62  ? 194  LYS B CE    1 
ATOM   3257  N  NZ    . LYS B  1  194  ? 43.187  27.881  107.622 1.00 73.64  ? 194  LYS B NZ    1 
ATOM   3258  N  N     . LEU B  1  195  ? 45.278  23.898  112.932 1.00 65.84  ? 195  LEU B N     1 
ATOM   3259  C  CA    . LEU B  1  195  ? 44.169  23.393  113.733 1.00 66.34  ? 195  LEU B CA    1 
ATOM   3260  C  C     . LEU B  1  195  ? 42.965  24.334  113.709 1.00 65.35  ? 195  LEU B C     1 
ATOM   3261  O  O     . LEU B  1  195  ? 43.071  25.505  114.059 1.00 69.94  ? 195  LEU B O     1 
ATOM   3262  C  CB    . LEU B  1  195  ? 44.631  23.147  115.171 1.00 61.25  ? 195  LEU B CB    1 
ATOM   3263  C  CG    . LEU B  1  195  ? 43.560  22.801  116.198 1.00 57.91  ? 195  LEU B CG    1 
ATOM   3264  C  CD1   . LEU B  1  195  ? 42.696  21.656  115.714 1.00 63.50  ? 195  LEU B CD1   1 
ATOM   3265  C  CD2   . LEU B  1  195  ? 44.228  22.451  117.504 1.00 57.70  ? 195  LEU B CD2   1 
ATOM   3266  N  N     . THR B  1  196  ? 41.823  23.814  113.275 1.00 63.49  ? 196  THR B N     1 
ATOM   3267  C  CA    . THR B  1  196  ? 40.580  24.570  113.288 1.00 57.41  ? 196  THR B CA    1 
ATOM   3268  C  C     . THR B  1  196  ? 39.634  23.900  114.265 1.00 61.04  ? 196  THR B C     1 
ATOM   3269  O  O     . THR B  1  196  ? 39.400  22.694  114.185 1.00 60.79  ? 196  THR B O     1 
ATOM   3270  C  CB    . THR B  1  196  ? 39.929  24.625  111.896 1.00 62.88  ? 196  THR B CB    1 
ATOM   3271  O  OG1   . THR B  1  196  ? 40.708  25.463  111.032 1.00 64.64  ? 196  THR B OG1   1 
ATOM   3272  C  CG2   . THR B  1  196  ? 38.521  25.176  111.990 1.00 62.83  ? 196  THR B CG2   1 
ATOM   3273  N  N     . LEU B  1  197  ? 39.097  24.687  115.191 1.00 67.16  ? 197  LEU B N     1 
ATOM   3274  C  CA    . LEU B  1  197  ? 38.267  24.155  116.260 1.00 56.27  ? 197  LEU B CA    1 
ATOM   3275  C  C     . LEU B  1  197  ? 36.931  24.894  116.351 1.00 54.90  ? 197  LEU B C     1 
ATOM   3276  O  O     . LEU B  1  197  ? 36.887  26.101  116.547 1.00 61.83  ? 197  LEU B O     1 
ATOM   3277  C  CB    . LEU B  1  197  ? 39.040  24.221  117.574 1.00 54.84  ? 197  LEU B CB    1 
ATOM   3278  C  CG    . LEU B  1  197  ? 38.490  23.399  118.739 1.00 60.34  ? 197  LEU B CG    1 
ATOM   3279  C  CD1   . LEU B  1  197  ? 37.624  22.215  118.325 1.00 67.84  ? 197  LEU B CD1   1 
ATOM   3280  C  CD2   . LEU B  1  197  ? 39.497  23.067  119.842 1.00 44.68  ? 197  LEU B CD2   1 
ATOM   3281  N  N     . ARG B  1  198  ? 35.841  24.157  116.188 1.00 52.05  ? 198  ARG B N     1 
ATOM   3282  C  CA    . ARG B  1  198  ? 34.506  24.736  116.178 1.00 61.40  ? 198  ARG B CA    1 
ATOM   3283  C  C     . ARG B  1  198  ? 33.713  24.295  117.398 1.00 63.04  ? 198  ARG B C     1 
ATOM   3284  O  O     . ARG B  1  198  ? 33.525  23.092  117.620 1.00 64.16  ? 198  ARG B O     1 
ATOM   3285  C  CB    . ARG B  1  198  ? 33.761  24.343  114.900 1.00 68.59  ? 198  ARG B CB    1 
ATOM   3286  C  CG    . ARG B  1  198  ? 34.388  24.883  113.620 1.00 69.16  ? 198  ARG B CG    1 
ATOM   3287  C  CD    . ARG B  1  198  ? 33.474  24.670  112.421 1.00 66.41  ? 198  ARG B CD    1 
ATOM   3288  N  NE    . ARG B  1  198  ? 33.387  23.265  112.039 1.00 68.00  ? 198  ARG B NE    1 
ATOM   3289  C  CZ    . ARG B  1  198  ? 32.346  22.726  111.412 1.00 75.37  ? 198  ARG B CZ    1 
ATOM   3290  N  NH1   . ARG B  1  198  ? 31.290  23.473  111.104 1.00 69.09  ? 198  ARG B NH1   1 
ATOM   3291  N  NH2   . ARG B  1  198  ? 32.356  21.434  111.103 1.00 77.29  ? 198  ARG B NH2   1 
ATOM   3292  N  N     . ILE B  1  199  ? 33.250  25.275  118.180 1.00 68.08  ? 199  ILE B N     1 
ATOM   3293  C  CA    . ILE B  1  199  ? 32.530  25.009  119.429 1.00 65.67  ? 199  ILE B CA    1 
ATOM   3294  C  C     . ILE B  1  199  ? 31.139  25.641  119.489 1.00 67.36  ? 199  ILE B C     1 
ATOM   3295  O  O     . ILE B  1  199  ? 30.972  26.847  119.258 1.00 71.33  ? 199  ILE B O     1 
ATOM   3296  C  CB    . ILE B  1  199  ? 33.313  25.484  120.668 1.00 59.79  ? 199  ILE B CB    1 
ATOM   3297  C  CG1   . ILE B  1  199  ? 34.785  25.079  120.577 1.00 64.68  ? 199  ILE B CG1   1 
ATOM   3298  C  CG2   . ILE B  1  199  ? 32.691  24.915  121.920 1.00 55.45  ? 199  ILE B CG2   1 
ATOM   3299  C  CD1   . ILE B  1  199  ? 35.579  25.380  121.836 1.00 59.16  ? 199  ILE B CD1   1 
ATOM   3300  N  N     . TRP B  1  200  ? 30.155  24.806  119.813 1.00 62.48  ? 200  TRP B N     1 
ATOM   3301  C  CA    . TRP B  1  200  ? 28.770  25.221  119.974 1.00 65.18  ? 200  TRP B CA    1 
ATOM   3302  C  C     . TRP B  1  200  ? 28.351  25.105  121.436 1.00 67.93  ? 200  TRP B C     1 
ATOM   3303  O  O     . TRP B  1  200  ? 28.372  24.003  122.017 1.00 62.69  ? 200  TRP B O     1 
ATOM   3304  C  CB    . TRP B  1  200  ? 27.841  24.342  119.137 1.00 66.14  ? 200  TRP B CB    1 
ATOM   3305  C  CG    . TRP B  1  200  ? 27.966  24.502  117.664 1.00 65.82  ? 200  TRP B CG    1 
ATOM   3306  C  CD1   . TRP B  1  200  ? 27.171  25.255  116.852 1.00 70.64  ? 200  TRP B CD1   1 
ATOM   3307  C  CD2   . TRP B  1  200  ? 28.929  23.871  116.813 1.00 68.94  ? 200  TRP B CD2   1 
ATOM   3308  N  NE1   . TRP B  1  200  ? 27.585  25.140  115.545 1.00 71.51  ? 200  TRP B NE1   1 
ATOM   3309  C  CE2   . TRP B  1  200  ? 28.663  24.296  115.496 1.00 66.06  ? 200  TRP B CE2   1 
ATOM   3310  C  CE3   . TRP B  1  200  ? 29.994  22.993  117.036 1.00 68.81  ? 200  TRP B CE3   1 
ATOM   3311  C  CZ2   . TRP B  1  200  ? 29.422  23.874  114.412 1.00 61.56  ? 200  TRP B CZ2   1 
ATOM   3312  C  CZ3   . TRP B  1  200  ? 30.744  22.574  115.959 1.00 65.07  ? 200  TRP B CZ3   1 
ATOM   3313  C  CH2   . TRP B  1  200  ? 30.456  23.015  114.663 1.00 63.65  ? 200  TRP B CH2   1 
ATOM   3314  N  N     . THR B  1  201  ? 27.940  26.247  121.993 1.00 72.98  ? 201  THR B N     1 
ATOM   3315  C  CA    . THR B  1  201  ? 27.506  26.394  123.383 1.00 66.00  ? 201  THR B CA    1 
ATOM   3316  C  C     . THR B  1  201  ? 26.019  26.737  123.456 1.00 65.37  ? 201  THR B C     1 
ATOM   3317  O  O     . THR B  1  201  ? 25.457  27.260  122.497 1.00 67.77  ? 201  THR B O     1 
ATOM   3318  C  CB    . THR B  1  201  ? 28.296  27.528  124.071 1.00 72.59  ? 201  THR B CB    1 
ATOM   3319  O  OG1   . THR B  1  201  ? 29.649  27.111  124.294 1.00 74.39  ? 201  THR B OG1   1 
ATOM   3320  C  CG2   . THR B  1  201  ? 27.678  27.890  125.395 1.00 77.07  ? 201  THR B CG2   1 
ATOM   3321  N  N     . ASP B  1  202  ? 25.386  26.445  124.592 1.00 73.17  ? 202  ASP B N     1 
ATOM   3322  C  CA    . ASP B  1  202  ? 23.970  26.770  124.796 1.00 79.96  ? 202  ASP B CA    1 
ATOM   3323  C  C     . ASP B  1  202  ? 23.732  28.232  125.202 1.00 78.57  ? 202  ASP B C     1 
ATOM   3324  O  O     . ASP B  1  202  ? 22.583  28.661  125.373 1.00 75.97  ? 202  ASP B O     1 
ATOM   3325  C  CB    . ASP B  1  202  ? 23.320  25.820  125.814 1.00 74.11  ? 202  ASP B CB    1 
ATOM   3326  C  CG    . ASP B  1  202  ? 23.958  25.904  127.188 1.00 75.55  ? 202  ASP B CG    1 
ATOM   3327  O  OD1   . ASP B  1  202  ? 24.638  26.912  127.474 1.00 76.65  ? 202  ASP B OD1   1 
ATOM   3328  O  OD2   . ASP B  1  202  ? 23.775  24.962  127.988 1.00 77.75  ? 202  ASP B OD2   1 
ATOM   3329  N  N     . GLY B  1  203  ? 24.816  28.991  125.353 1.00 74.47  ? 203  GLY B N     1 
ATOM   3330  C  CA    . GLY B  1  203  ? 24.716  30.409  125.646 1.00 72.64  ? 203  GLY B CA    1 
ATOM   3331  C  C     . GLY B  1  203  ? 25.080  30.770  127.072 1.00 77.89  ? 203  GLY B C     1 
ATOM   3332  O  O     . GLY B  1  203  ? 25.439  31.916  127.353 1.00 75.03  ? 203  GLY B O     1 
ATOM   3333  N  N     . SER B  1  204  ? 24.985  29.794  127.972 1.00 79.94  ? 204  SER B N     1 
ATOM   3334  C  CA    . SER B  1  204  ? 25.340  30.003  129.371 1.00 71.39  ? 204  SER B CA    1 
ATOM   3335  C  C     . SER B  1  204  ? 26.827  30.331  129.490 1.00 75.66  ? 204  SER B C     1 
ATOM   3336  O  O     . SER B  1  204  ? 27.205  31.346  130.076 1.00 79.40  ? 204  SER B O     1 
ATOM   3337  C  CB    . SER B  1  204  ? 24.970  28.782  130.216 1.00 70.92  ? 204  SER B CB    1 
ATOM   3338  O  OG    . SER B  1  204  ? 25.516  27.589  129.681 1.00 71.20  ? 204  SER B OG    1 
ATOM   3339  N  N     . VAL B  1  205  ? 27.669  29.472  128.924 1.00 78.52  ? 205  VAL B N     1 
ATOM   3340  C  CA    . VAL B  1  205  ? 29.083  29.791  128.781 1.00 75.96  ? 205  VAL B CA    1 
ATOM   3341  C  C     . VAL B  1  205  ? 29.312  30.294  127.365 1.00 75.25  ? 205  VAL B C     1 
ATOM   3342  O  O     . VAL B  1  205  ? 28.399  30.299  126.545 1.00 79.05  ? 205  VAL B O     1 
ATOM   3343  C  CB    . VAL B  1  205  ? 29.985  28.571  129.030 1.00 70.79  ? 205  VAL B CB    1 
ATOM   3344  C  CG1   . VAL B  1  205  ? 31.303  29.015  129.643 1.00 74.43  ? 205  VAL B CG1   1 
ATOM   3345  C  CG2   . VAL B  1  205  ? 29.300  27.596  129.951 1.00 74.75  ? 205  VAL B CG2   1 
ATOM   3346  N  N     . THR B  1  206  ? 30.530  30.725  127.076 1.00 72.14  ? 206  THR B N     1 
ATOM   3347  C  CA    . THR B  1  206  ? 30.851  31.189  125.741 1.00 71.82  ? 206  THR B CA    1 
ATOM   3348  C  C     . THR B  1  206  ? 31.864  30.241  125.117 1.00 75.29  ? 206  THR B C     1 
ATOM   3349  O  O     . THR B  1  206  ? 32.696  29.670  125.826 1.00 71.06  ? 206  THR B O     1 
ATOM   3350  C  CB    . THR B  1  206  ? 31.370  32.640  125.764 1.00 73.59  ? 206  THR B CB    1 
ATOM   3351  O  OG1   . THR B  1  206  ? 30.383  33.503  125.184 1.00 73.04  ? 206  THR B OG1   1 
ATOM   3352  C  CG2   . THR B  1  206  ? 32.675  32.775  124.991 1.00 75.42  ? 206  THR B CG2   1 
ATOM   3353  N  N     . PRO B  1  207  ? 31.780  30.045  123.790 1.00 73.68  ? 207  PRO B N     1 
ATOM   3354  C  CA    . PRO B  1  207  ? 32.719  29.143  123.125 1.00 66.11  ? 207  PRO B CA    1 
ATOM   3355  C  C     . PRO B  1  207  ? 34.146  29.461  123.547 1.00 61.20  ? 207  PRO B C     1 
ATOM   3356  O  O     . PRO B  1  207  ? 34.884  28.557  123.930 1.00 60.73  ? 207  PRO B O     1 
ATOM   3357  C  CB    . PRO B  1  207  ? 32.499  29.453  121.648 1.00 66.96  ? 207  PRO B CB    1 
ATOM   3358  C  CG    . PRO B  1  207  ? 31.071  29.850  121.578 1.00 69.40  ? 207  PRO B CG    1 
ATOM   3359  C  CD    . PRO B  1  207  ? 30.823  30.635  122.838 1.00 72.18  ? 207  PRO B CD    1 
ATOM   3360  N  N     . LEU B  1  208  ? 34.522  30.733  123.504 1.00 56.89  ? 208  LEU B N     1 
ATOM   3361  C  CA    . LEU B  1  208  ? 35.841  31.125  123.981 1.00 61.60  ? 208  LEU B CA    1 
ATOM   3362  C  C     . LEU B  1  208  ? 36.012  30.772  125.460 1.00 67.84  ? 208  LEU B C     1 
ATOM   3363  O  O     . LEU B  1  208  ? 37.024  30.182  125.851 1.00 66.46  ? 208  LEU B O     1 
ATOM   3364  C  CB    . LEU B  1  208  ? 36.087  32.613  123.740 1.00 62.23  ? 208  LEU B CB    1 
ATOM   3365  C  CG    . LEU B  1  208  ? 37.443  33.156  124.196 1.00 63.52  ? 208  LEU B CG    1 
ATOM   3366  C  CD1   . LEU B  1  208  ? 38.553  32.168  123.892 1.00 66.86  ? 208  LEU B CD1   1 
ATOM   3367  C  CD2   . LEU B  1  208  ? 37.729  34.503  123.549 1.00 58.53  ? 208  LEU B CD2   1 
ATOM   3368  N  N     . GLU B  1  209  ? 35.016  31.125  126.273 1.00 68.17  ? 209  GLU B N     1 
ATOM   3369  C  CA    . GLU B  1  209  ? 35.018  30.785  127.694 1.00 66.40  ? 209  GLU B CA    1 
ATOM   3370  C  C     . GLU B  1  209  ? 35.224  29.285  127.875 1.00 62.09  ? 209  GLU B C     1 
ATOM   3371  O  O     . GLU B  1  209  ? 36.136  28.853  128.582 1.00 59.63  ? 209  GLU B O     1 
ATOM   3372  C  CB    . GLU B  1  209  ? 33.710  31.224  128.366 1.00 73.81  ? 209  GLU B CB    1 
ATOM   3373  C  CG    . GLU B  1  209  ? 33.553  32.740  128.554 1.00 79.60  ? 209  GLU B CG    1 
ATOM   3374  C  CD    . GLU B  1  209  ? 32.187  33.136  129.123 1.00 81.08  ? 209  GLU B CD    1 
ATOM   3375  O  OE1   . GLU B  1  209  ? 31.885  34.350  129.190 1.00 74.73  ? 209  GLU B OE1   1 
ATOM   3376  O  OE2   . GLU B  1  209  ? 31.411  32.233  129.504 1.00 80.81  ? 209  GLU B OE2   1 
ATOM   3377  N  N     . ALA B  1  210  ? 34.376  28.499  127.216 1.00 66.09  ? 210  ALA B N     1 
ATOM   3378  C  CA    . ALA B  1  210  ? 34.449  27.041  127.289 1.00 64.78  ? 210  ALA B CA    1 
ATOM   3379  C  C     . ALA B  1  210  ? 35.853  26.542  126.971 1.00 65.50  ? 210  ALA B C     1 
ATOM   3380  O  O     . ALA B  1  210  ? 36.433  25.748  127.720 1.00 63.81  ? 210  ALA B O     1 
ATOM   3381  C  CB    . ALA B  1  210  ? 33.441  26.415  126.343 1.00 54.63  ? 210  ALA B CB    1 
ATOM   3382  N  N     . LEU B  1  211  ? 36.394  27.019  125.855 1.00 64.62  ? 211  LEU B N     1 
ATOM   3383  C  CA    . LEU B  1  211  ? 37.727  26.625  125.428 1.00 62.82  ? 211  LEU B CA    1 
ATOM   3384  C  C     . LEU B  1  211  ? 38.729  26.894  126.534 1.00 66.14  ? 211  LEU B C     1 
ATOM   3385  O  O     . LEU B  1  211  ? 39.415  25.984  126.987 1.00 66.47  ? 211  LEU B O     1 
ATOM   3386  C  CB    . LEU B  1  211  ? 38.134  27.359  124.148 1.00 63.42  ? 211  LEU B CB    1 
ATOM   3387  C  CG    . LEU B  1  211  ? 39.570  27.109  123.666 1.00 64.98  ? 211  LEU B CG    1 
ATOM   3388  C  CD1   . LEU B  1  211  ? 39.871  25.619  123.580 1.00 53.09  ? 211  LEU B CD1   1 
ATOM   3389  C  CD2   . LEU B  1  211  ? 39.835  27.798  122.333 1.00 58.32  ? 211  LEU B CD2   1 
ATOM   3390  N  N     . ASN B  1  212  ? 38.799  28.145  126.975 1.00 69.25  ? 212  ASN B N     1 
ATOM   3391  C  CA    . ASN B  1  212  ? 39.754  28.524  128.011 1.00 71.42  ? 212  ASN B CA    1 
ATOM   3392  C  C     . ASN B  1  212  ? 39.639  27.672  129.276 1.00 64.14  ? 212  ASN B C     1 
ATOM   3393  O  O     . ASN B  1  212  ? 40.652  27.296  129.877 1.00 62.91  ? 212  ASN B O     1 
ATOM   3394  C  CB    . ASN B  1  212  ? 39.646  30.017  128.325 1.00 64.45  ? 212  ASN B CB    1 
ATOM   3395  C  CG    . ASN B  1  212  ? 40.202  30.881  127.210 1.00 66.60  ? 212  ASN B CG    1 
ATOM   3396  O  OD1   . ASN B  1  212  ? 39.535  31.790  126.719 1.00 63.97  ? 212  ASN B OD1   1 
ATOM   3397  N  ND2   . ASN B  1  212  ? 41.430  30.590  126.795 1.00 66.41  ? 212  ASN B ND2   1 
ATOM   3398  N  N     . GLN B  1  213  ? 38.408  27.353  129.667 1.00 60.88  ? 213  GLN B N     1 
ATOM   3399  C  CA    . GLN B  1  213  ? 38.189  26.476  130.817 1.00 69.91  ? 213  GLN B CA    1 
ATOM   3400  C  C     . GLN B  1  213  ? 38.779  25.099  130.552 1.00 68.30  ? 213  GLN B C     1 
ATOM   3401  O  O     . GLN B  1  213  ? 39.366  24.481  131.444 1.00 59.77  ? 213  GLN B O     1 
ATOM   3402  C  CB    . GLN B  1  213  ? 36.700  26.351  131.142 1.00 65.77  ? 213  GLN B CB    1 
ATOM   3403  C  CG    . GLN B  1  213  ? 36.063  27.634  131.639 1.00 63.33  ? 213  GLN B CG    1 
ATOM   3404  C  CD    . GLN B  1  213  ? 34.603  27.453  131.991 1.00 69.14  ? 213  GLN B CD    1 
ATOM   3405  O  OE1   . GLN B  1  213  ? 34.203  26.409  132.512 1.00 73.26  ? 213  GLN B OE1   1 
ATOM   3406  N  NE2   . GLN B  1  213  ? 33.794  28.468  131.702 1.00 65.82  ? 213  GLN B NE2   1 
ATOM   3407  N  N     . ALA B  1  214  ? 38.618  24.630  129.317 1.00 68.45  ? 214  ALA B N     1 
ATOM   3408  C  CA    . ALA B  1  214  ? 39.155  23.337  128.908 1.00 61.44  ? 214  ALA B CA    1 
ATOM   3409  C  C     . ALA B  1  214  ? 40.684  23.315  128.964 1.00 61.79  ? 214  ALA B C     1 
ATOM   3410  O  O     . ALA B  1  214  ? 41.284  22.468  129.640 1.00 59.69  ? 214  ALA B O     1 
ATOM   3411  C  CB    . ALA B  1  214  ? 38.664  22.987  127.517 1.00 57.36  ? 214  ALA B CB    1 
ATOM   3412  N  N     . VAL B  1  215  ? 41.311  24.251  128.255 1.00 59.59  ? 215  VAL B N     1 
ATOM   3413  C  CA    . VAL B  1  215  ? 42.764  24.338  128.248 1.00 63.16  ? 215  VAL B CA    1 
ATOM   3414  C  C     . VAL B  1  215  ? 43.262  24.412  129.683 1.00 66.69  ? 215  VAL B C     1 
ATOM   3415  O  O     . VAL B  1  215  ? 44.259  23.788  130.032 1.00 59.05  ? 215  VAL B O     1 
ATOM   3416  C  CB    . VAL B  1  215  ? 43.282  25.546  127.429 1.00 60.49  ? 215  VAL B CB    1 
ATOM   3417  C  CG1   . VAL B  1  215  ? 42.325  25.862  126.302 1.00 65.00  ? 215  VAL B CG1   1 
ATOM   3418  C  CG2   . VAL B  1  215  ? 43.454  26.765  128.307 1.00 74.83  ? 215  VAL B CG2   1 
ATOM   3419  N  N     . GLU B  1  216  ? 42.545  25.155  130.521 1.00 69.88  ? 216  GLU B N     1 
ATOM   3420  C  CA    . GLU B  1  216  ? 42.941  25.297  131.914 1.00 66.08  ? 216  GLU B CA    1 
ATOM   3421  C  C     . GLU B  1  216  ? 42.888  23.955  132.626 1.00 62.07  ? 216  GLU B C     1 
ATOM   3422  O  O     . GLU B  1  216  ? 43.842  23.555  133.291 1.00 61.44  ? 216  GLU B O     1 
ATOM   3423  C  CB    . GLU B  1  216  ? 42.059  26.316  132.631 1.00 65.76  ? 216  GLU B CB    1 
ATOM   3424  C  CG    . GLU B  1  216  ? 42.279  26.367  134.139 1.00 75.95  ? 216  GLU B CG    1 
ATOM   3425  C  CD    . GLU B  1  216  ? 43.723  26.656  134.531 1.00 79.45  ? 216  GLU B CD    1 
ATOM   3426  O  OE1   . GLU B  1  216  ? 44.047  26.496  135.727 1.00 82.97  ? 216  GLU B OE1   1 
ATOM   3427  O  OE2   . GLU B  1  216  ? 44.532  27.044  133.658 1.00 73.53  ? 216  GLU B OE2   1 
ATOM   3428  N  N     . ILE B  1  217  ? 41.766  23.262  132.480 1.00 62.23  ? 217  ILE B N     1 
ATOM   3429  C  CA    . ILE B  1  217  ? 41.617  21.942  133.073 1.00 64.04  ? 217  ILE B CA    1 
ATOM   3430  C  C     . ILE B  1  217  ? 42.812  21.078  132.708 1.00 64.99  ? 217  ILE B C     1 
ATOM   3431  O  O     . ILE B  1  217  ? 43.404  20.420  133.571 1.00 62.34  ? 217  ILE B O     1 
ATOM   3432  C  CB    . ILE B  1  217  ? 40.332  21.253  132.595 1.00 53.09  ? 217  ILE B CB    1 
ATOM   3433  C  CG1   . ILE B  1  217  ? 39.111  22.054  133.046 1.00 45.65  ? 217  ILE B CG1   1 
ATOM   3434  C  CG2   . ILE B  1  217  ? 40.279  19.813  133.095 1.00 42.90  ? 217  ILE B CG2   1 
ATOM   3435  C  CD1   . ILE B  1  217  ? 37.807  21.531  132.483 1.00 60.13  ? 217  ILE B CD1   1 
ATOM   3436  N  N     . LEU B  1  218  ? 43.172  21.098  131.425 1.00 62.76  ? 218  LEU B N     1 
ATOM   3437  C  CA    . LEU B  1  218  ? 44.285  20.292  130.940 1.00 61.79  ? 218  LEU B CA    1 
ATOM   3438  C  C     . LEU B  1  218  ? 45.608  20.701  131.597 1.00 64.58  ? 218  LEU B C     1 
ATOM   3439  O  O     . LEU B  1  218  ? 46.331  19.863  132.152 1.00 62.05  ? 218  LEU B O     1 
ATOM   3440  C  CB    . LEU B  1  218  ? 44.388  20.384  129.418 1.00 64.44  ? 218  LEU B CB    1 
ATOM   3441  C  CG    . LEU B  1  218  ? 45.402  19.445  128.754 1.00 64.40  ? 218  LEU B CG    1 
ATOM   3442  C  CD1   . LEU B  1  218  ? 45.087  17.990  129.080 1.00 52.63  ? 218  LEU B CD1   1 
ATOM   3443  C  CD2   . LEU B  1  218  ? 45.452  19.671  127.244 1.00 57.45  ? 218  LEU B CD2   1 
ATOM   3444  N  N     . ARG B  1  219  ? 45.917  21.992  131.536 1.00 58.85  ? 219  ARG B N     1 
ATOM   3445  C  CA    . ARG B  1  219  ? 47.141  22.510  132.129 1.00 64.15  ? 219  ARG B CA    1 
ATOM   3446  C  C     . ARG B  1  219  ? 47.270  22.028  133.563 1.00 70.12  ? 219  ARG B C     1 
ATOM   3447  O  O     . ARG B  1  219  ? 48.316  21.512  133.969 1.00 66.20  ? 219  ARG B O     1 
ATOM   3448  C  CB    . ARG B  1  219  ? 47.145  24.037  132.112 1.00 65.36  ? 219  ARG B CB    1 
ATOM   3449  C  CG    . ARG B  1  219  ? 48.433  24.639  132.654 1.00 71.73  ? 219  ARG B CG    1 
ATOM   3450  C  CD    . ARG B  1  219  ? 48.224  26.069  133.114 1.00 76.93  ? 219  ARG B CD    1 
ATOM   3451  N  NE    . ARG B  1  219  ? 47.176  26.153  134.125 1.00 74.94  ? 219  ARG B NE    1 
ATOM   3452  C  CZ    . ARG B  1  219  ? 47.351  25.839  135.405 1.00 74.98  ? 219  ARG B CZ    1 
ATOM   3453  N  NH1   . ARG B  1  219  ? 48.533  25.419  135.833 1.00 71.57  ? 219  ARG B NH1   1 
ATOM   3454  N  NH2   . ARG B  1  219  ? 46.341  25.941  136.256 1.00 75.24  ? 219  ARG B NH2   1 
ATOM   3455  N  N     . GLU B  1  220  ? 46.201  22.219  134.330 1.00 71.53  ? 220  GLU B N     1 
ATOM   3456  C  CA    . GLU B  1  220  ? 46.171  21.818  135.728 1.00 66.88  ? 220  GLU B CA    1 
ATOM   3457  C  C     . GLU B  1  220  ? 46.427  20.324  135.854 1.00 64.38  ? 220  GLU B C     1 
ATOM   3458  O  O     . GLU B  1  220  ? 47.179  19.886  136.724 1.00 66.37  ? 220  GLU B O     1 
ATOM   3459  C  CB    . GLU B  1  220  ? 44.825  22.176  136.360 1.00 75.18  ? 220  GLU B CB    1 
ATOM   3460  C  CG    . GLU B  1  220  ? 44.631  21.622  137.762 1.00 82.39  ? 220  GLU B CG    1 
ATOM   3461  C  CD    . GLU B  1  220  ? 43.299  22.020  138.366 1.00 90.41  ? 220  GLU B CD    1 
ATOM   3462  O  OE1   . GLU B  1  220  ? 42.414  22.473  137.610 1.00 86.60  ? 220  GLU B OE1   1 
ATOM   3463  O  OE2   . GLU B  1  220  ? 43.136  21.879  139.596 1.00 91.24  ? 220  GLU B OE2   1 
ATOM   3464  N  N     . HIS B  1  221  ? 45.800  19.544  134.980 1.00 62.12  ? 221  HIS B N     1 
ATOM   3465  C  CA    . HIS B  1  221  ? 46.003  18.102  134.991 1.00 62.62  ? 221  HIS B CA    1 
ATOM   3466  C  C     . HIS B  1  221  ? 47.454  17.724  134.727 1.00 64.50  ? 221  HIS B C     1 
ATOM   3467  O  O     . HIS B  1  221  ? 47.913  16.659  135.141 1.00 60.11  ? 221  HIS B O     1 
ATOM   3468  C  CB    . HIS B  1  221  ? 45.100  17.424  133.971 1.00 60.88  ? 221  HIS B CB    1 
ATOM   3469  C  CG    . HIS B  1  221  ? 43.856  16.847  134.564 1.00 63.32  ? 221  HIS B CG    1 
ATOM   3470  N  ND1   . HIS B  1  221  ? 43.814  15.591  135.132 1.00 67.33  ? 221  HIS B ND1   1 
ATOM   3471  C  CD2   . HIS B  1  221  ? 42.604  17.351  134.670 1.00 58.03  ? 221  HIS B CD2   1 
ATOM   3472  C  CE1   . HIS B  1  221  ? 42.590  15.349  135.565 1.00 66.76  ? 221  HIS B CE1   1 
ATOM   3473  N  NE2   . HIS B  1  221  ? 41.836  16.401  135.298 1.00 67.20  ? 221  HIS B NE2   1 
ATOM   3474  N  N     . LEU B  1  222  ? 48.173  18.601  134.035 1.00 66.61  ? 222  LEU B N     1 
ATOM   3475  C  CA    . LEU B  1  222  ? 49.571  18.353  133.704 1.00 61.39  ? 222  LEU B CA    1 
ATOM   3476  C  C     . LEU B  1  222  ? 50.475  18.551  134.916 1.00 63.26  ? 222  LEU B C     1 
ATOM   3477  O  O     . LEU B  1  222  ? 51.640  18.156  134.904 1.00 61.39  ? 222  LEU B O     1 
ATOM   3478  C  CB    . LEU B  1  222  ? 50.020  19.265  132.561 1.00 65.74  ? 222  LEU B CB    1 
ATOM   3479  C  CG    . LEU B  1  222  ? 49.417  18.976  131.185 1.00 64.22  ? 222  LEU B CG    1 
ATOM   3480  C  CD1   . LEU B  1  222  ? 50.009  19.901  130.134 1.00 60.06  ? 222  LEU B CD1   1 
ATOM   3481  C  CD2   . LEU B  1  222  ? 49.627  17.519  130.802 1.00 61.23  ? 222  LEU B CD2   1 
ATOM   3482  N  N     . THR B  1  223  ? 49.930  19.165  135.960 1.00 69.55  ? 223  THR B N     1 
ATOM   3483  C  CA    . THR B  1  223  ? 50.691  19.427  137.176 1.00 62.95  ? 223  THR B CA    1 
ATOM   3484  C  C     . THR B  1  223  ? 50.630  18.244  138.137 1.00 61.71  ? 223  THR B C     1 
ATOM   3485  O  O     . THR B  1  223  ? 51.271  18.254  139.187 1.00 74.03  ? 223  THR B O     1 
ATOM   3486  C  CB    . THR B  1  223  ? 50.182  20.687  137.898 1.00 53.12  ? 223  THR B CB    1 
ATOM   3487  O  OG1   . THR B  1  223  ? 48.836  20.475  138.342 1.00 68.59  ? 223  THR B OG1   1 
ATOM   3488  C  CG2   . THR B  1  223  ? 50.218  21.886  136.964 1.00 61.04  ? 223  THR B CG2   1 
ATOM   3489  N  N     . TYR B  1  224  ? 49.857  17.228  137.771 1.00 61.80  ? 224  TYR B N     1 
ATOM   3490  C  CA    . TYR B  1  224  ? 49.706  16.043  138.607 1.00 60.61  ? 224  TYR B CA    1 
ATOM   3491  C  C     . TYR B  1  224  ? 50.984  15.211  138.628 1.00 64.79  ? 224  TYR B C     1 
ATOM   3492  O  O     . TYR B  1  224  ? 51.269  14.519  139.606 1.00 74.73  ? 224  TYR B O     1 
ATOM   3493  C  CB    . TYR B  1  224  ? 48.525  15.196  138.130 1.00 64.71  ? 224  TYR B CB    1 
ATOM   3494  C  CG    . TYR B  1  224  ? 47.181  15.853  138.354 1.00 71.36  ? 224  TYR B CG    1 
ATOM   3495  C  CD1   . TYR B  1  224  ? 47.095  17.172  138.777 1.00 66.42  ? 224  TYR B CD1   1 
ATOM   3496  C  CD2   . TYR B  1  224  ? 46.001  15.154  138.144 1.00 73.18  ? 224  TYR B CD2   1 
ATOM   3497  C  CE1   . TYR B  1  224  ? 45.870  17.778  138.984 1.00 67.38  ? 224  TYR B CE1   1 
ATOM   3498  C  CE2   . TYR B  1  224  ? 44.771  15.752  138.348 1.00 77.86  ? 224  TYR B CE2   1 
ATOM   3499  C  CZ    . TYR B  1  224  ? 44.712  17.063  138.768 1.00 72.98  ? 224  TYR B CZ    1 
ATOM   3500  O  OH    . TYR B  1  224  ? 43.491  17.662  138.973 1.00 69.60  ? 224  TYR B OH    1 
ATOM   3501  N  N     . PHE B  1  225  ? 51.753  15.285  137.547 1.00 70.70  ? 225  PHE B N     1 
ATOM   3502  C  CA    . PHE B  1  225  ? 53.025  14.580  137.465 1.00 71.22  ? 225  PHE B CA    1 
ATOM   3503  C  C     . PHE B  1  225  ? 54.106  15.369  138.193 1.00 76.54  ? 225  PHE B C     1 
ATOM   3504  O  O     . PHE B  1  225  ? 55.229  15.499  137.705 1.00 76.15  ? 225  PHE B O     1 
ATOM   3505  C  CB    . PHE B  1  225  ? 53.429  14.367  136.005 1.00 62.37  ? 225  PHE B CB    1 
ATOM   3506  C  CG    . PHE B  1  225  ? 52.400  13.637  135.191 1.00 60.81  ? 225  PHE B CG    1 
ATOM   3507  C  CD1   . PHE B  1  225  ? 51.455  14.336  134.458 1.00 57.91  ? 225  PHE B CD1   1 
ATOM   3508  C  CD2   . PHE B  1  225  ? 52.378  12.253  135.157 1.00 59.26  ? 225  PHE B CD2   1 
ATOM   3509  C  CE1   . PHE B  1  225  ? 50.508  13.668  133.706 1.00 53.00  ? 225  PHE B CE1   1 
ATOM   3510  C  CE2   . PHE B  1  225  ? 51.433  11.579  134.407 1.00 54.23  ? 225  PHE B CE2   1 
ATOM   3511  C  CZ    . PHE B  1  225  ? 50.496  12.287  133.681 1.00 46.13  ? 225  PHE B CZ    1 
ATOM   3512  N  N     . SER B  1  226  ? 53.758  15.899  139.360 1.00 82.27  ? 226  SER B N     1 
ATOM   3513  C  CA    . SER B  1  226  ? 54.675  16.732  140.128 1.00 86.14  ? 226  SER B CA    1 
ATOM   3514  C  C     . SER B  1  226  ? 55.427  15.946  141.197 1.00 96.14  ? 226  SER B C     1 
ATOM   3515  O  O     . SER B  1  226  ? 56.652  15.839  141.151 1.00 102.44 ? 226  SER B O     1 
ATOM   3516  C  CB    . SER B  1  226  ? 53.923  17.900  140.770 1.00 91.69  ? 226  SER B CB    1 
ATOM   3517  O  OG    . SER B  1  226  ? 53.426  18.790  139.786 1.00 94.22  ? 226  SER B OG    1 
ATOM   3518  N  N     . ASN B  1  227  ? 54.692  15.402  142.162 1.00 90.57  ? 227  ASN B N     1 
ATOM   3519  C  CA    . ASN B  1  227  ? 55.311  14.693  143.273 1.00 93.62  ? 227  ASN B CA    1 
ATOM   3520  C  C     . ASN B  1  227  ? 54.840  13.260  143.495 1.00 93.18  ? 227  ASN B C     1 
ATOM   3521  O  O     . ASN B  1  227  ? 53.645  13.011  143.679 1.00 89.21  ? 227  ASN B O     1 
ATOM   3522  C  CB    . ASN B  1  227  ? 55.153  15.490  144.568 1.00 104.94 ? 227  ASN B CB    1 
ATOM   3523  C  CG    . ASN B  1  227  ? 55.819  14.810  145.752 1.00 117.59 ? 227  ASN B CG    1 
ATOM   3524  O  OD1   . ASN B  1  227  ? 56.798  14.084  145.583 1.00 116.65 ? 227  ASN B OD1   1 
ATOM   3525  N  ND2   . ASN B  1  227  ? 55.287  15.031  146.954 1.00 115.41 ? 227  ASN B ND2   1 
ATOM   3526  N  N     . PRO B  1  228  ? 55.792  12.314  143.488 1.00 93.37  ? 228  PRO B N     1 
ATOM   3527  C  CA    . PRO B  1  228  ? 55.553  10.913  143.858 1.00 88.82  ? 228  PRO B CA    1 
ATOM   3528  C  C     . PRO B  1  228  ? 55.353  10.742  145.364 1.00 89.62  ? 228  PRO B C     1 
ATOM   3529  O  O     . PRO B  1  228  ? 54.998  9.647   145.810 1.00 84.50  ? 228  PRO B O     1 
ATOM   3530  C  CB    . PRO B  1  228  ? 56.842  10.206  143.420 1.00 78.13  ? 228  PRO B CB    1 
ATOM   3531  C  CG    . PRO B  1  228  ? 57.475  11.132  142.421 1.00 79.54  ? 228  PRO B CG    1 
ATOM   3532  C  CD    . PRO B  1  228  ? 57.132  12.507  142.910 1.00 86.34  ? 228  PRO B CD    1 
ATOM   3533  N  N     . MET C  2  1    ? 66.131  -18.120 114.218 1.00 100.43 ? 1    MET C N     1 
ATOM   3534  C  CA    . MET C  2  1    ? 64.750  -18.403 114.588 1.00 106.67 ? 1    MET C CA    1 
ATOM   3535  C  C     . MET C  2  1    ? 64.352  -19.836 114.246 1.00 107.79 ? 1    MET C C     1 
ATOM   3536  O  O     . MET C  2  1    ? 64.720  -20.360 113.194 1.00 109.94 ? 1    MET C O     1 
ATOM   3537  C  CB    . MET C  2  1    ? 63.797  -17.414 113.909 1.00 104.30 ? 1    MET C CB    1 
ATOM   3538  C  CG    . MET C  2  1    ? 63.914  -15.986 114.428 1.00 116.11 ? 1    MET C CG    1 
ATOM   3539  S  SD    . MET C  2  1    ? 62.683  -14.860 113.737 1.00 117.60 ? 1    MET C SD    1 
ATOM   3540  C  CE    . MET C  2  1    ? 62.996  -13.375 114.696 1.00 97.18  ? 1    MET C CE    1 
ATOM   3541  N  N     . GLU C  2  2    ? 63.600  -20.463 115.146 1.00 104.81 ? 2    GLU C N     1 
ATOM   3542  C  CA    . GLU C  2  2    ? 63.078  -21.810 114.930 1.00 100.75 ? 2    GLU C CA    1 
ATOM   3543  C  C     . GLU C  2  2    ? 62.289  -21.886 113.617 1.00 91.42  ? 2    GLU C C     1 
ATOM   3544  O  O     . GLU C  2  2    ? 61.582  -20.943 113.256 1.00 85.03  ? 2    GLU C O     1 
ATOM   3545  C  CB    . GLU C  2  2    ? 62.193  -22.213 116.117 1.00 95.72  ? 2    GLU C CB    1 
ATOM   3546  C  CG    . GLU C  2  2    ? 61.560  -23.593 116.017 1.00 95.85  ? 2    GLU C CG    1 
ATOM   3547  C  CD    . GLU C  2  2    ? 62.559  -24.711 116.220 1.00 109.82 ? 2    GLU C CD    1 
ATOM   3548  O  OE1   . GLU C  2  2    ? 63.762  -24.415 116.382 1.00 113.73 ? 2    GLU C OE1   1 
ATOM   3549  O  OE2   . GLU C  2  2    ? 62.141  -25.888 116.219 1.00 115.45 ? 2    GLU C OE2   1 
ATOM   3550  N  N     . ILE C  2  3    ? 62.419  -22.999 112.899 1.00 82.07  ? 3    ILE C N     1 
ATOM   3551  C  CA    . ILE C  2  3    ? 61.679  -23.191 111.654 1.00 76.36  ? 3    ILE C CA    1 
ATOM   3552  C  C     . ILE C  2  3    ? 60.830  -24.452 111.700 1.00 75.76  ? 3    ILE C C     1 
ATOM   3553  O  O     . ILE C  2  3    ? 61.359  -25.559 111.685 1.00 78.65  ? 3    ILE C O     1 
ATOM   3554  C  CB    . ILE C  2  3    ? 62.616  -23.313 110.445 1.00 75.56  ? 3    ILE C CB    1 
ATOM   3555  C  CG1   . ILE C  2  3    ? 63.655  -22.189 110.442 1.00 81.68  ? 3    ILE C CG1   1 
ATOM   3556  C  CG2   . ILE C  2  3    ? 61.808  -23.319 109.159 1.00 61.38  ? 3    ILE C CG2   1 
ATOM   3557  C  CD1   . ILE C  2  3    ? 63.115  -20.855 109.991 1.00 79.15  ? 3    ILE C CD1   1 
ATOM   3558  N  N     . LYS C  2  4    ? 59.514  -24.286 111.744 1.00 71.03  ? 4    LYS C N     1 
ATOM   3559  C  CA    . LYS C  2  4    ? 58.606  -25.427 111.757 1.00 64.14  ? 4    LYS C CA    1 
ATOM   3560  C  C     . LYS C  2  4    ? 57.994  -25.659 110.381 1.00 65.18  ? 4    LYS C C     1 
ATOM   3561  O  O     . LYS C  2  4    ? 57.379  -24.755 109.817 1.00 69.54  ? 4    LYS C O     1 
ATOM   3562  C  CB    . LYS C  2  4    ? 57.494  -25.214 112.787 1.00 63.20  ? 4    LYS C CB    1 
ATOM   3563  C  CG    . LYS C  2  4    ? 56.464  -26.333 112.812 1.00 70.57  ? 4    LYS C CG    1 
ATOM   3564  C  CD    . LYS C  2  4    ? 55.537  -26.216 114.008 1.00 74.66  ? 4    LYS C CD    1 
ATOM   3565  C  CE    . LYS C  2  4    ? 54.615  -27.423 114.109 1.00 80.27  ? 4    LYS C CE    1 
ATOM   3566  N  NZ    . LYS C  2  4    ? 53.732  -27.335 115.304 1.00 81.86  ? 4    LYS C NZ    1 
ATOM   3567  N  N     . ARG C  2  5    ? 58.152  -26.865 109.840 1.00 56.93  ? 5    ARG C N     1 
ATOM   3568  C  CA    . ARG C  2  5    ? 57.542  -27.181 108.550 1.00 60.07  ? 5    ARG C CA    1 
ATOM   3569  C  C     . ARG C  2  5    ? 56.340  -28.118 108.643 1.00 60.65  ? 5    ARG C C     1 
ATOM   3570  O  O     . ARG C  2  5    ? 56.375  -29.130 109.341 1.00 58.97  ? 5    ARG C O     1 
ATOM   3571  C  CB    . ARG C  2  5    ? 58.578  -27.714 107.557 1.00 65.67  ? 5    ARG C CB    1 
ATOM   3572  C  CG    . ARG C  2  5    ? 59.397  -28.903 108.035 1.00 69.53  ? 5    ARG C CG    1 
ATOM   3573  C  CD    . ARG C  2  5    ? 60.443  -29.300 106.991 1.00 72.47  ? 5    ARG C CD    1 
ATOM   3574  N  NE    . ARG C  2  5    ? 59.849  -29.535 105.673 1.00 83.38  ? 5    ARG C NE    1 
ATOM   3575  C  CZ    . ARG C  2  5    ? 60.347  -29.066 104.531 1.00 76.29  ? 5    ARG C CZ    1 
ATOM   3576  N  NH1   . ARG C  2  5    ? 61.453  -28.333 104.542 1.00 65.68  ? 5    ARG C NH1   1 
ATOM   3577  N  NH2   . ARG C  2  5    ? 59.739  -29.328 103.377 1.00 63.71  ? 5    ARG C NH2   1 
ATOM   3578  N  N     . PHE C  2  6    ? 55.272  -27.760 107.937 1.00 58.64  ? 6    PHE C N     1 
ATOM   3579  C  CA    . PHE C  2  6    ? 54.040  -28.540 107.940 1.00 59.93  ? 6    PHE C CA    1 
ATOM   3580  C  C     . PHE C  2  6    ? 53.995  -29.533 106.777 1.00 74.27  ? 6    PHE C C     1 
ATOM   3581  O  O     . PHE C  2  6    ? 54.739  -29.398 105.803 1.00 82.18  ? 6    PHE C O     1 
ATOM   3582  C  CB    . PHE C  2  6    ? 52.826  -27.614 107.844 1.00 59.43  ? 6    PHE C CB    1 
ATOM   3583  C  CG    . PHE C  2  6    ? 52.744  -26.587 108.941 1.00 64.51  ? 6    PHE C CG    1 
ATOM   3584  C  CD1   . PHE C  2  6    ? 51.984  -26.823 110.072 1.00 68.63  ? 6    PHE C CD1   1 
ATOM   3585  C  CD2   . PHE C  2  6    ? 53.413  -25.379 108.835 1.00 62.25  ? 6    PHE C CD2   1 
ATOM   3586  C  CE1   . PHE C  2  6    ? 51.901  -25.884 111.077 1.00 61.15  ? 6    PHE C CE1   1 
ATOM   3587  C  CE2   . PHE C  2  6    ? 53.332  -24.431 109.842 1.00 55.37  ? 6    PHE C CE2   1 
ATOM   3588  C  CZ    . PHE C  2  6    ? 52.576  -24.686 110.960 1.00 61.18  ? 6    PHE C CZ    1 
ATOM   3589  N  N     . GLY C  2  7    ? 53.122  -30.532 106.879 1.00 82.11  ? 7    GLY C N     1 
ATOM   3590  C  CA    . GLY C  2  7    ? 52.845  -31.414 105.757 1.00 87.26  ? 7    GLY C CA    1 
ATOM   3591  C  C     . GLY C  2  7    ? 53.540  -32.762 105.789 1.00 94.42  ? 7    GLY C C     1 
ATOM   3592  O  O     . GLY C  2  7    ? 54.715  -32.860 106.146 1.00 93.10  ? 7    GLY C O     1 
ATOM   3593  N  N     . ARG C  2  8    ? 52.811  -33.803 105.395 1.00 94.55  ? 8    ARG C N     1 
ATOM   3594  C  CA    . ARG C  2  8    ? 53.328  -35.165 105.471 1.00 101.60 ? 8    ARG C CA    1 
ATOM   3595  C  C     . ARG C  2  8    ? 53.738  -35.760 104.122 1.00 110.76 ? 8    ARG C C     1 
ATOM   3596  O  O     . ARG C  2  8    ? 54.240  -36.884 104.065 1.00 117.44 ? 8    ARG C O     1 
ATOM   3597  C  CB    . ARG C  2  8    ? 52.329  -36.088 106.173 1.00 109.57 ? 8    ARG C CB    1 
ATOM   3598  C  CG    . ARG C  2  8    ? 50.977  -36.211 105.490 1.00 114.15 ? 8    ARG C CG    1 
ATOM   3599  C  CD    . ARG C  2  8    ? 50.143  -37.297 106.159 1.00 129.06 ? 8    ARG C CD    1 
ATOM   3600  N  NE    . ARG C  2  8    ? 48.859  -37.510 105.497 1.00 137.92 ? 8    ARG C NE    1 
ATOM   3601  C  CZ    . ARG C  2  8    ? 48.068  -38.555 105.722 1.00 131.69 ? 8    ARG C CZ    1 
ATOM   3602  N  NH1   . ARG C  2  8    ? 48.430  -39.491 106.592 1.00 130.89 ? 8    ARG C NH1   1 
ATOM   3603  N  NH2   . ARG C  2  8    ? 46.916  -38.667 105.073 1.00 121.87 ? 8    ARG C NH2   1 
ATOM   3604  N  N     . ILE C  2  9    ? 53.533  -35.014 103.040 1.00 110.54 ? 9    ILE C N     1 
ATOM   3605  C  CA    . ILE C  2  9    ? 53.935  -35.488 101.714 1.00 109.40 ? 9    ILE C CA    1 
ATOM   3606  C  C     . ILE C  2  9    ? 55.457  -35.599 101.587 1.00 106.27 ? 9    ILE C C     1 
ATOM   3607  O  O     . ILE C  2  9    ? 56.183  -34.647 101.875 1.00 95.44  ? 9    ILE C O     1 
ATOM   3608  C  CB    . ILE C  2  9    ? 53.372  -34.599 100.581 1.00 105.72 ? 9    ILE C CB    1 
ATOM   3609  C  CG1   . ILE C  2  9    ? 51.867  -34.829 100.424 1.00 94.68  ? 9    ILE C CG1   1 
ATOM   3610  C  CG2   . ILE C  2  9    ? 54.078  -34.893 99.269  1.00 99.71  ? 9    ILE C CG2   1 
ATOM   3611  C  CD1   . ILE C  2  9    ? 51.278  -34.215 99.175  1.00 78.29  ? 9    ILE C CD1   1 
ATOM   3612  N  N     . ARG C  2  10   ? 55.927  -36.768 101.155 1.00 110.97 ? 10   ARG C N     1 
ATOM   3613  C  CA    . ARG C  2  10   ? 57.357  -37.034 101.024 1.00 111.19 ? 10   ARG C CA    1 
ATOM   3614  C  C     . ARG C  2  10   ? 57.821  -36.912 99.576  1.00 108.77 ? 10   ARG C C     1 
ATOM   3615  O  O     . ARG C  2  10   ? 57.267  -37.551 98.681  1.00 108.94 ? 10   ARG C O     1 
ATOM   3616  C  CB    . ARG C  2  10   ? 57.695  -38.435 101.541 1.00 120.08 ? 10   ARG C CB    1 
ATOM   3617  C  CG    . ARG C  2  10   ? 56.980  -38.830 102.823 1.00 128.34 ? 10   ARG C CG    1 
ATOM   3618  C  CD    . ARG C  2  10   ? 57.397  -40.223 103.283 1.00 139.46 ? 10   ARG C CD    1 
ATOM   3619  N  NE    . ARG C  2  10   ? 57.244  -41.238 102.240 1.00 144.70 ? 10   ARG C NE    1 
ATOM   3620  C  CZ    . ARG C  2  10   ? 56.145  -41.966 102.051 1.00 134.99 ? 10   ARG C CZ    1 
ATOM   3621  N  NH1   . ARG C  2  10   ? 55.084  -41.794 102.830 1.00 127.90 ? 10   ARG C NH1   1 
ATOM   3622  N  NH2   . ARG C  2  10   ? 56.105  -42.868 101.077 1.00 114.27 ? 10   ARG C NH2   1 
ATOM   3623  N  N     . GLU C  2  11   ? 58.845  -36.096 99.352  1.00 102.05 ? 11   GLU C N     1 
ATOM   3624  C  CA    . GLU C  2  11   ? 59.417  -35.936 98.021  1.00 89.84  ? 11   GLU C CA    1 
ATOM   3625  C  C     . GLU C  2  11   ? 60.458  -37.020 97.768  1.00 86.20  ? 11   GLU C C     1 
ATOM   3626  O  O     . GLU C  2  11   ? 61.551  -36.983 98.332  1.00 89.51  ? 11   GLU C O     1 
ATOM   3627  C  CB    . GLU C  2  11   ? 60.055  -34.552 97.880  1.00 97.83  ? 11   GLU C CB    1 
ATOM   3628  C  CG    . GLU C  2  11   ? 61.011  -34.189 99.017  1.00 111.63 ? 11   GLU C CG    1 
ATOM   3629  C  CD    . GLU C  2  11   ? 62.229  -33.406 98.546  1.00 105.96 ? 11   GLU C CD    1 
ATOM   3630  O  OE1   . GLU C  2  11   ? 62.235  -32.165 98.699  1.00 105.76 ? 11   GLU C OE1   1 
ATOM   3631  O  OE2   . GLU C  2  11   ? 63.183  -34.032 98.030  1.00 83.60  ? 11   GLU C OE2   1 
ATOM   3632  N  N     . VAL C  2  12   ? 60.124  -37.986 96.919  1.00 77.26  ? 12   VAL C N     1 
ATOM   3633  C  CA    . VAL C  2  12   ? 61.038  -39.092 96.646  1.00 71.77  ? 12   VAL C CA    1 
ATOM   3634  C  C     . VAL C  2  12   ? 62.257  -38.641 95.857  1.00 70.42  ? 12   VAL C C     1 
ATOM   3635  O  O     . VAL C  2  12   ? 63.274  -39.331 95.821  1.00 76.20  ? 12   VAL C O     1 
ATOM   3636  C  CB    . VAL C  2  12   ? 60.345  -40.220 95.881  1.00 75.03  ? 12   VAL C CB    1 
ATOM   3637  C  CG1   . VAL C  2  12   ? 59.256  -40.824 96.732  1.00 83.04  ? 12   VAL C CG1   1 
ATOM   3638  C  CG2   . VAL C  2  12   ? 59.776  -39.696 94.580  1.00 77.15  ? 12   VAL C CG2   1 
ATOM   3639  N  N     . ILE C  2  13   ? 62.131  -37.502 95.190  1.00 72.43  ? 13   ILE C N     1 
ATOM   3640  C  CA    . ILE C  2  13   ? 63.248  -36.916 94.470  1.00 64.06  ? 13   ILE C CA    1 
ATOM   3641  C  C     . ILE C  2  13   ? 63.229  -35.408 94.648  1.00 60.47  ? 13   ILE C C     1 
ATOM   3642  O  O     . ILE C  2  13   ? 62.163  -34.807 94.782  1.00 68.74  ? 13   ILE C O     1 
ATOM   3643  C  CB    . ILE C  2  13   ? 63.192  -37.249 92.969  1.00 61.68  ? 13   ILE C CB    1 
ATOM   3644  C  CG1   . ILE C  2  13   ? 61.788  -36.992 92.419  1.00 59.36  ? 13   ILE C CG1   1 
ATOM   3645  C  CG2   . ILE C  2  13   ? 63.606  -38.692 92.728  1.00 67.99  ? 13   ILE C CG2   1 
ATOM   3646  C  CD1   . ILE C  2  13   ? 61.707  -37.036 90.909  1.00 65.81  ? 13   ILE C CD1   1 
ATOM   3647  N  N     . PRO C  2  14   ? 64.404  -34.793 94.640  1.00 54.70  ? 14   PRO C N     1 
ATOM   3648  C  CA    . PRO C  2  14   ? 64.476  -33.330 94.681  1.00 57.62  ? 14   PRO C CA    1 
ATOM   3649  C  C     . PRO C  2  14   ? 64.213  -32.720 93.311  1.00 58.59  ? 14   PRO C C     1 
ATOM   3650  O  O     . PRO C  2  14   ? 64.075  -33.440 92.323  1.00 61.20  ? 14   PRO C O     1 
ATOM   3651  C  CB    . PRO C  2  14   ? 65.926  -33.073 95.077  1.00 55.86  ? 14   PRO C CB    1 
ATOM   3652  C  CG    . PRO C  2  14   ? 66.658  -34.247 94.550  1.00 52.36  ? 14   PRO C CG    1 
ATOM   3653  C  CD    . PRO C  2  14   ? 65.734  -35.409 94.757  1.00 53.51  ? 14   PRO C CD    1 
ATOM   3654  N  N     . LEU C  2  15   ? 64.150  -31.396 93.252  1.00 55.74  ? 15   LEU C N     1 
ATOM   3655  C  CA    . LEU C  2  15   ? 63.972  -30.710 91.983  1.00 54.41  ? 15   LEU C CA    1 
ATOM   3656  C  C     . LEU C  2  15   ? 65.225  -30.867 91.145  1.00 57.13  ? 15   LEU C C     1 
ATOM   3657  O  O     . LEU C  2  15   ? 66.337  -30.818 91.671  1.00 61.27  ? 15   LEU C O     1 
ATOM   3658  C  CB    . LEU C  2  15   ? 63.695  -29.225 92.210  1.00 57.46  ? 15   LEU C CB    1 
ATOM   3659  C  CG    . LEU C  2  15   ? 62.246  -28.748 92.247  1.00 51.21  ? 15   LEU C CG    1 
ATOM   3660  C  CD1   . LEU C  2  15   ? 61.409  -29.674 93.081  1.00 57.50  ? 15   LEU C CD1   1 
ATOM   3661  C  CD2   . LEU C  2  15   ? 62.193  -27.344 92.800  1.00 45.98  ? 15   LEU C CD2   1 
ATOM   3662  N  N     . PRO C  2  16   ? 65.051  -31.056 89.832  1.00 56.20  ? 16   PRO C N     1 
ATOM   3663  C  CA    . PRO C  2  16   ? 66.187  -31.132 88.914  1.00 55.53  ? 16   PRO C CA    1 
ATOM   3664  C  C     . PRO C  2  16   ? 66.924  -29.806 88.914  1.00 57.49  ? 16   PRO C C     1 
ATOM   3665  O  O     . PRO C  2  16   ? 66.350  -28.797 89.321  1.00 58.51  ? 16   PRO C O     1 
ATOM   3666  C  CB    . PRO C  2  16   ? 65.522  -31.349 87.555  1.00 56.50  ? 16   PRO C CB    1 
ATOM   3667  C  CG    . PRO C  2  16   ? 64.176  -31.894 87.863  1.00 60.53  ? 16   PRO C CG    1 
ATOM   3668  C  CD    . PRO C  2  16   ? 63.768  -31.233 89.138  1.00 57.38  ? 16   PRO C CD    1 
ATOM   3669  N  N     . PRO C  2  17   ? 68.188  -29.799 88.474  1.00 59.41  ? 17   PRO C N     1 
ATOM   3670  C  CA    . PRO C  2  17   ? 68.849  -28.499 88.350  1.00 59.91  ? 17   PRO C CA    1 
ATOM   3671  C  C     . PRO C  2  17   ? 67.951  -27.607 87.507  1.00 60.75  ? 17   PRO C C     1 
ATOM   3672  O  O     . PRO C  2  17   ? 67.586  -27.981 86.392  1.00 57.90  ? 17   PRO C O     1 
ATOM   3673  C  CB    . PRO C  2  17   ? 70.130  -28.833 87.594  1.00 57.88  ? 17   PRO C CB    1 
ATOM   3674  C  CG    . PRO C  2  17   ? 70.373  -30.276 87.889  1.00 56.02  ? 17   PRO C CG    1 
ATOM   3675  C  CD    . PRO C  2  17   ? 69.028  -30.907 87.993  1.00 53.84  ? 17   PRO C CD    1 
ATOM   3676  N  N     . LEU C  2  18   ? 67.583  -26.450 88.038  1.00 59.52  ? 18   LEU C N     1 
ATOM   3677  C  CA    . LEU C  2  18   ? 66.556  -25.630 87.406  1.00 54.81  ? 18   LEU C CA    1 
ATOM   3678  C  C     . LEU C  2  18   ? 66.973  -25.011 86.068  1.00 55.51  ? 18   LEU C C     1 
ATOM   3679  O  O     . LEU C  2  18   ? 66.129  -24.797 85.202  1.00 57.83  ? 18   LEU C O     1 
ATOM   3680  C  CB    . LEU C  2  18   ? 66.050  -24.565 88.384  1.00 54.67  ? 18   LEU C CB    1 
ATOM   3681  C  CG    . LEU C  2  18   ? 65.414  -25.145 89.655  1.00 50.97  ? 18   LEU C CG    1 
ATOM   3682  C  CD1   . LEU C  2  18   ? 65.084  -24.052 90.653  1.00 49.50  ? 18   LEU C CD1   1 
ATOM   3683  C  CD2   . LEU C  2  18   ? 64.170  -25.965 89.334  1.00 44.61  ? 18   LEU C CD2   1 
ATOM   3684  N  N     . THR C  2  19   ? 68.265  -24.737 85.891  1.00 50.81  ? 19   THR C N     1 
ATOM   3685  C  CA    . THR C  2  19   ? 68.742  -24.152 84.641  1.00 48.04  ? 19   THR C CA    1 
ATOM   3686  C  C     . THR C  2  19   ? 69.271  -25.206 83.664  1.00 54.36  ? 19   THR C C     1 
ATOM   3687  O  O     . THR C  2  19   ? 69.928  -24.874 82.670  1.00 53.28  ? 19   THR C O     1 
ATOM   3688  C  CB    . THR C  2  19   ? 69.833  -23.104 84.885  1.00 52.31  ? 19   THR C CB    1 
ATOM   3689  O  OG1   . THR C  2  19   ? 70.953  -23.720 85.529  1.00 62.57  ? 19   THR C OG1   1 
ATOM   3690  C  CG2   . THR C  2  19   ? 69.304  -21.984 85.758  1.00 54.32  ? 19   THR C CG2   1 
ATOM   3691  N  N     . GLU C  2  20   ? 68.981  -26.474 83.942  1.00 53.71  ? 20   GLU C N     1 
ATOM   3692  C  CA    . GLU C  2  20   ? 69.480  -27.559 83.108  1.00 48.67  ? 20   GLU C CA    1 
ATOM   3693  C  C     . GLU C  2  20   ? 68.932  -27.489 81.698  1.00 48.53  ? 20   GLU C C     1 
ATOM   3694  O  O     . GLU C  2  20   ? 69.565  -27.969 80.767  1.00 57.18  ? 20   GLU C O     1 
ATOM   3695  C  CB    . GLU C  2  20   ? 69.151  -28.920 83.712  1.00 53.76  ? 20   GLU C CB    1 
ATOM   3696  C  CG    . GLU C  2  20   ? 67.697  -29.313 83.584  1.00 65.65  ? 20   GLU C CG    1 
ATOM   3697  C  CD    . GLU C  2  20   ? 67.486  -30.803 83.757  1.00 72.54  ? 20   GLU C CD    1 
ATOM   3698  O  OE1   . GLU C  2  20   ? 68.439  -31.569 83.488  1.00 68.94  ? 20   GLU C OE1   1 
ATOM   3699  O  OE2   . GLU C  2  20   ? 66.370  -31.204 84.158  1.00 65.48  ? 20   GLU C OE2   1 
ATOM   3700  N  N     . ILE C  2  21   ? 67.755  -26.901 81.530  1.00 54.41  ? 21   ILE C N     1 
ATOM   3701  C  CA    . ILE C  2  21   ? 67.173  -26.784 80.195  1.00 51.81  ? 21   ILE C CA    1 
ATOM   3702  C  C     . ILE C  2  21   ? 68.089  -25.971 79.278  1.00 47.46  ? 21   ILE C C     1 
ATOM   3703  O  O     . ILE C  2  21   ? 68.185  -26.241 78.085  1.00 42.28  ? 21   ILE C O     1 
ATOM   3704  C  CB    . ILE C  2  21   ? 65.756  -26.160 80.224  1.00 44.61  ? 21   ILE C CB    1 
ATOM   3705  C  CG1   . ILE C  2  21   ? 65.133  -26.193 78.828  1.00 41.26  ? 21   ILE C CG1   1 
ATOM   3706  C  CG2   . ILE C  2  21   ? 65.797  -24.742 80.768  1.00 38.97  ? 21   ILE C CG2   1 
ATOM   3707  C  CD1   . ILE C  2  21   ? 63.780  -25.546 78.745  1.00 33.80  ? 21   ILE C CD1   1 
ATOM   3708  N  N     . GLN C  2  22   ? 68.765  -24.981 79.850  1.00 45.35  ? 22   GLN C N     1 
ATOM   3709  C  CA    . GLN C  2  22   ? 69.705  -24.161 79.110  1.00 44.56  ? 22   GLN C CA    1 
ATOM   3710  C  C     . GLN C  2  22   ? 71.052  -24.868 79.046  1.00 43.85  ? 22   GLN C C     1 
ATOM   3711  O  O     . GLN C  2  22   ? 71.568  -25.196 77.971  1.00 44.33  ? 22   GLN C O     1 
ATOM   3712  C  CB    . GLN C  2  22   ? 69.867  -22.815 79.817  1.00 40.33  ? 22   GLN C CB    1 
ATOM   3713  C  CG    . GLN C  2  22   ? 68.658  -21.906 79.733  1.00 35.62  ? 22   GLN C CG    1 
ATOM   3714  C  CD    . GLN C  2  22   ? 68.561  -21.191 78.402  1.00 47.25  ? 22   GLN C CD    1 
ATOM   3715  O  OE1   . GLN C  2  22   ? 69.478  -20.466 77.991  1.00 52.50  ? 22   GLN C OE1   1 
ATOM   3716  N  NE2   . GLN C  2  22   ? 67.451  -21.393 77.715  1.00 46.14  ? 22   GLN C NE2   1 
ATOM   3717  N  N     . VAL C  2  23   ? 71.602  -25.106 80.229  1.00 48.15  ? 23   VAL C N     1 
ATOM   3718  C  CA    . VAL C  2  23   ? 72.939  -25.658 80.405  1.00 50.61  ? 23   VAL C CA    1 
ATOM   3719  C  C     . VAL C  2  23   ? 73.194  -26.962 79.635  1.00 49.30  ? 23   VAL C C     1 
ATOM   3720  O  O     . VAL C  2  23   ? 74.166  -27.071 78.879  1.00 47.90  ? 23   VAL C O     1 
ATOM   3721  C  CB    . VAL C  2  23   ? 73.234  -25.830 81.912  1.00 40.34  ? 23   VAL C CB    1 
ATOM   3722  C  CG1   . VAL C  2  23   ? 73.701  -27.229 82.228  1.00 40.46  ? 23   VAL C CG1   1 
ATOM   3723  C  CG2   . VAL C  2  23   ? 74.242  -24.790 82.367  1.00 54.10  ? 23   VAL C CG2   1 
ATOM   3724  N  N     . GLU C  2  24   ? 72.311  -27.937 79.818  1.00 50.36  ? 24   GLU C N     1 
ATOM   3725  C  CA    . GLU C  2  24   ? 72.462  -29.249 79.200  1.00 49.86  ? 24   GLU C CA    1 
ATOM   3726  C  C     . GLU C  2  24   ? 72.276  -29.176 77.693  1.00 48.10  ? 24   GLU C C     1 
ATOM   3727  O  O     . GLU C  2  24   ? 72.985  -29.830 76.929  1.00 51.94  ? 24   GLU C O     1 
ATOM   3728  C  CB    . GLU C  2  24   ? 71.458  -30.233 79.801  1.00 57.97  ? 24   GLU C CB    1 
ATOM   3729  C  CG    . GLU C  2  24   ? 71.680  -31.673 79.375  1.00 70.72  ? 24   GLU C CG    1 
ATOM   3730  C  CD    . GLU C  2  24   ? 73.070  -32.172 79.734  1.00 77.56  ? 24   GLU C CD    1 
ATOM   3731  O  OE1   . GLU C  2  24   ? 73.627  -31.719 80.766  1.00 61.09  ? 24   GLU C OE1   1 
ATOM   3732  O  OE2   . GLU C  2  24   ? 73.606  -33.011 78.977  1.00 81.90  ? 24   GLU C OE2   1 
ATOM   3733  N  N     . SER C  2  25   ? 71.307  -28.375 77.274  1.00 51.08  ? 25   SER C N     1 
ATOM   3734  C  CA    . SER C  2  25   ? 71.050  -28.148 75.861  1.00 46.36  ? 25   SER C CA    1 
ATOM   3735  C  C     . SER C  2  25   ? 72.306  -27.649 75.158  1.00 41.96  ? 25   SER C C     1 
ATOM   3736  O  O     . SER C  2  25   ? 72.775  -28.264 74.197  1.00 47.66  ? 25   SER C O     1 
ATOM   3737  C  CB    . SER C  2  25   ? 69.905  -27.147 75.691  1.00 45.73  ? 25   SER C CB    1 
ATOM   3738  O  OG    . SER C  2  25   ? 69.769  -26.734 74.348  1.00 47.18  ? 25   SER C OG    1 
ATOM   3739  N  N     . TYR C  2  26   ? 72.859  -26.540 75.638  1.00 44.13  ? 26   TYR C N     1 
ATOM   3740  C  CA    . TYR C  2  26   ? 74.034  -25.978 74.980  1.00 43.16  ? 26   TYR C CA    1 
ATOM   3741  C  C     . TYR C  2  26   ? 75.203  -26.940 75.059  1.00 48.30  ? 26   TYR C C     1 
ATOM   3742  O  O     . TYR C  2  26   ? 75.961  -27.104 74.095  1.00 46.04  ? 26   TYR C O     1 
ATOM   3743  C  CB    . TYR C  2  26   ? 74.432  -24.650 75.595  1.00 32.21  ? 26   TYR C CB    1 
ATOM   3744  C  CG    . TYR C  2  26   ? 75.097  -23.722 74.613  1.00 34.96  ? 26   TYR C CG    1 
ATOM   3745  C  CD1   . TYR C  2  26   ? 74.465  -23.370 73.429  1.00 36.92  ? 26   TYR C CD1   1 
ATOM   3746  C  CD2   . TYR C  2  26   ? 76.343  -23.182 74.873  1.00 39.54  ? 26   TYR C CD2   1 
ATOM   3747  C  CE1   . TYR C  2  26   ? 75.055  -22.509 72.531  1.00 36.59  ? 26   TYR C CE1   1 
ATOM   3748  C  CE2   . TYR C  2  26   ? 76.942  -22.318 73.982  1.00 38.78  ? 26   TYR C CE2   1 
ATOM   3749  C  CZ    . TYR C  2  26   ? 76.291  -21.986 72.813  1.00 37.80  ? 26   TYR C CZ    1 
ATOM   3750  O  OH    . TYR C  2  26   ? 76.879  -21.127 71.920  1.00 46.79  ? 26   TYR C OH    1 
ATOM   3751  N  N     . ARG C  2  27   ? 75.349  -27.572 76.218  1.00 48.39  ? 27   ARG C N     1 
ATOM   3752  C  CA    . ARG C  2  27   ? 76.402  -28.556 76.404  1.00 48.70  ? 27   ARG C CA    1 
ATOM   3753  C  C     . ARG C  2  27   ? 76.370  -29.563 75.260  1.00 50.47  ? 27   ARG C C     1 
ATOM   3754  O  O     . ARG C  2  27   ? 77.377  -29.786 74.587  1.00 50.22  ? 27   ARG C O     1 
ATOM   3755  C  CB    . ARG C  2  27   ? 76.242  -29.258 77.752  1.00 49.65  ? 27   ARG C CB    1 
ATOM   3756  C  CG    . ARG C  2  27   ? 77.302  -30.285 78.062  1.00 44.04  ? 27   ARG C CG    1 
ATOM   3757  C  CD    . ARG C  2  27   ? 77.123  -30.830 79.458  1.00 60.27  ? 27   ARG C CD    1 
ATOM   3758  N  NE    . ARG C  2  27   ? 77.689  -32.167 79.584  1.00 80.61  ? 27   ARG C NE    1 
ATOM   3759  C  CZ    . ARG C  2  27   ? 77.162  -33.253 79.025  1.00 89.77  ? 27   ARG C CZ    1 
ATOM   3760  N  NH1   . ARG C  2  27   ? 76.058  -33.158 78.292  1.00 70.94  ? 27   ARG C NH1   1 
ATOM   3761  N  NH2   . ARG C  2  27   ? 77.743  -34.434 79.193  1.00 101.20 ? 27   ARG C NH2   1 
ATOM   3762  N  N     . ARG C  2  28   ? 75.201  -30.151 75.031  1.00 46.60  ? 28   ARG C N     1 
ATOM   3763  C  CA    . ARG C  2  28   ? 75.048  -31.149 73.984  1.00 50.36  ? 28   ARG C CA    1 
ATOM   3764  C  C     . ARG C  2  28   ? 75.257  -30.564 72.591  1.00 49.98  ? 28   ARG C C     1 
ATOM   3765  O  O     . ARG C  2  28   ? 75.731  -31.246 71.685  1.00 48.41  ? 28   ARG C O     1 
ATOM   3766  C  CB    . ARG C  2  28   ? 73.678  -31.823 74.083  1.00 60.78  ? 28   ARG C CB    1 
ATOM   3767  C  CG    . ARG C  2  28   ? 73.323  -32.700 72.885  1.00 74.37  ? 28   ARG C CG    1 
ATOM   3768  C  CD    . ARG C  2  28   ? 72.290  -33.749 73.266  1.00 90.38  ? 28   ARG C CD    1 
ATOM   3769  N  NE    . ARG C  2  28   ? 72.751  -34.555 74.395  1.00 104.82 ? 28   ARG C NE    1 
ATOM   3770  C  CZ    . ARG C  2  28   ? 73.464  -35.671 74.277  1.00 110.34 ? 28   ARG C CZ    1 
ATOM   3771  N  NH1   . ARG C  2  28   ? 73.796  -36.125 73.073  1.00 100.17 ? 28   ARG C NH1   1 
ATOM   3772  N  NH2   . ARG C  2  28   ? 73.844  -36.337 75.362  1.00 104.19 ? 28   ARG C NH2   1 
ATOM   3773  N  N     . ALA C  2  29   ? 74.906  -29.297 72.418  1.00 50.26  ? 29   ALA C N     1 
ATOM   3774  C  CA    . ALA C  2  29   ? 75.060  -28.660 71.116  1.00 47.10  ? 29   ALA C CA    1 
ATOM   3775  C  C     . ALA C  2  29   ? 76.524  -28.447 70.731  1.00 49.08  ? 29   ALA C C     1 
ATOM   3776  O  O     . ALA C  2  29   ? 76.884  -28.599 69.568  1.00 47.73  ? 29   ALA C O     1 
ATOM   3777  C  CB    . ALA C  2  29   ? 74.296  -27.348 71.072  1.00 45.59  ? 29   ALA C CB    1 
ATOM   3778  N  N     . LEU C  2  30   ? 77.363  -28.092 71.701  1.00 49.42  ? 30   LEU C N     1 
ATOM   3779  C  CA    . LEU C  2  30   ? 78.780  -27.839 71.424  1.00 45.34  ? 30   LEU C CA    1 
ATOM   3780  C  C     . LEU C  2  30   ? 79.650  -29.099 71.458  1.00 50.92  ? 30   LEU C C     1 
ATOM   3781  O  O     . LEU C  2  30   ? 80.521  -29.277 70.609  1.00 52.52  ? 30   LEU C O     1 
ATOM   3782  C  CB    . LEU C  2  30   ? 79.353  -26.802 72.394  1.00 48.11  ? 30   LEU C CB    1 
ATOM   3783  C  CG    . LEU C  2  30   ? 78.867  -25.360 72.285  1.00 39.39  ? 30   LEU C CG    1 
ATOM   3784  C  CD1   . LEU C  2  30   ? 79.490  -24.518 73.381  1.00 36.70  ? 30   LEU C CD1   1 
ATOM   3785  C  CD2   . LEU C  2  30   ? 79.178  -24.785 70.923  1.00 43.51  ? 30   LEU C CD2   1 
ATOM   3786  N  N     . GLN C  2  31   ? 79.424  -29.962 72.445  1.00 58.22  ? 31   GLN C N     1 
ATOM   3787  C  CA    . GLN C  2  31   ? 80.224  -31.178 72.607  1.00 56.80  ? 31   GLN C CA    1 
ATOM   3788  C  C     . GLN C  2  31   ? 81.711  -30.875 72.721  1.00 58.28  ? 31   GLN C C     1 
ATOM   3789  O  O     . GLN C  2  31   ? 82.540  -31.606 72.181  1.00 60.21  ? 31   GLN C O     1 
ATOM   3790  C  CB    . GLN C  2  31   ? 79.989  -32.147 71.449  1.00 50.23  ? 31   GLN C CB    1 
ATOM   3791  C  CG    . GLN C  2  31   ? 78.838  -33.100 71.665  1.00 56.20  ? 31   GLN C CG    1 
ATOM   3792  C  CD    . GLN C  2  31   ? 78.634  -34.029 70.490  1.00 58.00  ? 31   GLN C CD    1 
ATOM   3793  O  OE1   . GLN C  2  31   ? 78.429  -35.229 70.664  1.00 66.58  ? 31   GLN C OE1   1 
ATOM   3794  N  NE2   . GLN C  2  31   ? 78.682  -33.478 69.282  1.00 49.23  ? 31   GLN C NE2   1 
ATOM   3795  N  N     . ALA C  2  32   ? 82.039  -29.804 73.437  1.00 60.41  ? 32   ALA C N     1 
ATOM   3796  C  CA    . ALA C  2  32   ? 83.413  -29.328 73.531  1.00 61.14  ? 32   ALA C CA    1 
ATOM   3797  C  C     . ALA C  2  32   ? 84.311  -30.276 74.315  1.00 65.93  ? 32   ALA C C     1 
ATOM   3798  O  O     . ALA C  2  32   ? 85.495  -30.423 73.995  1.00 65.49  ? 32   ALA C O     1 
ATOM   3799  C  CB    . ALA C  2  32   ? 83.451  -27.933 74.138  1.00 57.80  ? 32   ALA C CB    1 
ATOM   3800  N  N     . ASP C  2  33   ? 83.746  -30.916 75.336  1.00 65.03  ? 33   ASP C N     1 
ATOM   3801  C  CA    . ASP C  2  33   ? 84.520  -31.790 76.217  1.00 74.13  ? 33   ASP C CA    1 
ATOM   3802  C  C     . ASP C  2  33   ? 84.686  -33.187 75.640  1.00 72.65  ? 33   ASP C C     1 
ATOM   3803  O  O     . ASP C  2  33   ? 85.530  -33.959 76.090  1.00 75.42  ? 33   ASP C O     1 
ATOM   3804  C  CB    . ASP C  2  33   ? 83.883  -31.869 77.606  1.00 85.73  ? 33   ASP C CB    1 
ATOM   3805  C  CG    . ASP C  2  33   ? 84.062  -30.589 78.407  1.00 89.74  ? 33   ASP C CG    1 
ATOM   3806  O  OD1   . ASP C  2  33   ? 84.986  -29.806 78.089  1.00 92.98  ? 33   ASP C OD1   1 
ATOM   3807  O  OD2   . ASP C  2  33   ? 83.281  -30.371 79.359  1.00 78.10  ? 33   ASP C OD2   1 
ATOM   3808  N  N     . VAL C  2  34   ? 83.878  -33.505 74.637  1.00 69.15  ? 34   VAL C N     1 
ATOM   3809  C  CA    . VAL C  2  34   ? 83.985  -34.785 73.950  1.00 67.98  ? 34   VAL C CA    1 
ATOM   3810  C  C     . VAL C  2  34   ? 85.095  -34.770 72.893  1.00 66.82  ? 34   VAL C C     1 
ATOM   3811  O  O     . VAL C  2  34   ? 85.183  -33.832 72.100  1.00 62.90  ? 34   VAL C O     1 
ATOM   3812  C  CB    . VAL C  2  34   ? 82.647  -35.163 73.292  1.00 63.78  ? 34   VAL C CB    1 
ATOM   3813  C  CG1   . VAL C  2  34   ? 82.782  -36.444 72.474  1.00 58.61  ? 34   VAL C CG1   1 
ATOM   3814  C  CG2   . VAL C  2  34   ? 81.576  -35.308 74.352  1.00 68.42  ? 34   VAL C CG2   1 
ATOM   3815  N  N     . PRO C  2  35   ? 85.959  -35.804 72.900  1.00 68.37  ? 35   PRO C N     1 
ATOM   3816  C  CA    . PRO C  2  35   ? 86.985  -36.036 71.876  1.00 58.35  ? 35   PRO C CA    1 
ATOM   3817  C  C     . PRO C  2  35   ? 86.379  -36.301 70.497  1.00 58.32  ? 35   PRO C C     1 
ATOM   3818  O  O     . PRO C  2  35   ? 85.546  -37.193 70.345  1.00 64.76  ? 35   PRO C O     1 
ATOM   3819  C  CB    . PRO C  2  35   ? 87.709  -37.286 72.384  1.00 55.70  ? 35   PRO C CB    1 
ATOM   3820  C  CG    . PRO C  2  35   ? 86.767  -37.924 73.335  1.00 68.07  ? 35   PRO C CG    1 
ATOM   3821  C  CD    . PRO C  2  35   ? 86.046  -36.795 73.984  1.00 68.42  ? 35   PRO C CD    1 
ATOM   3822  N  N     . PRO C  2  36   ? 86.820  -35.537 69.491  1.00 49.76  ? 36   PRO C N     1 
ATOM   3823  C  CA    . PRO C  2  36   ? 86.265  -35.462 68.137  1.00 52.83  ? 36   PRO C CA    1 
ATOM   3824  C  C     . PRO C  2  36   ? 85.828  -36.791 67.526  1.00 64.68  ? 36   PRO C C     1 
ATOM   3825  O  O     . PRO C  2  36   ? 84.859  -36.811 66.771  1.00 73.26  ? 36   PRO C O     1 
ATOM   3826  C  CB    . PRO C  2  36   ? 87.415  -34.866 67.335  1.00 55.87  ? 36   PRO C CB    1 
ATOM   3827  C  CG    . PRO C  2  36   ? 88.099  -33.982 68.309  1.00 59.29  ? 36   PRO C CG    1 
ATOM   3828  C  CD    . PRO C  2  36   ? 88.001  -34.672 69.641  1.00 53.93  ? 36   PRO C CD    1 
ATOM   3829  N  N     . GLU C  2  37   ? 86.524  -37.880 67.826  1.00 68.31  ? 37   GLU C N     1 
ATOM   3830  C  CA    . GLU C  2  37   ? 86.163  -39.164 67.238  1.00 72.40  ? 37   GLU C CA    1 
ATOM   3831  C  C     . GLU C  2  37   ? 85.018  -39.829 68.000  1.00 77.90  ? 37   GLU C C     1 
ATOM   3832  O  O     . GLU C  2  37   ? 84.508  -40.868 67.582  1.00 84.59  ? 37   GLU C O     1 
ATOM   3833  C  CB    . GLU C  2  37   ? 87.369  -40.101 67.176  1.00 77.34  ? 37   GLU C CB    1 
ATOM   3834  C  CG    . GLU C  2  37   ? 87.927  -40.509 68.531  1.00 81.40  ? 37   GLU C CG    1 
ATOM   3835  C  CD    . GLU C  2  37   ? 88.905  -39.494 69.093  1.00 78.60  ? 37   GLU C CD    1 
ATOM   3836  O  OE1   . GLU C  2  37   ? 89.258  -38.540 68.367  1.00 72.73  ? 37   GLU C OE1   1 
ATOM   3837  O  OE2   . GLU C  2  37   ? 89.326  -39.654 70.260  1.00 78.19  ? 37   GLU C OE2   1 
ATOM   3838  N  N     . LYS C  2  38   ? 84.749  -39.327 69.200  1.00 73.15  ? 38   LYS C N     1 
ATOM   3839  C  CA    . LYS C  2  38   ? 83.724  -39.909 70.055  1.00 74.48  ? 38   LYS C CA    1 
ATOM   3840  C  C     . LYS C  2  38   ? 82.425  -39.138 69.928  1.00 79.71  ? 38   LYS C C     1 
ATOM   3841  O  O     . LYS C  2  38   ? 81.407  -39.508 70.513  1.00 82.88  ? 38   LYS C O     1 
ATOM   3842  C  CB    . LYS C  2  38   ? 84.186  -39.923 71.513  1.00 73.20  ? 38   LYS C CB    1 
ATOM   3843  C  CG    . LYS C  2  38   ? 85.125  -41.068 71.856  1.00 70.80  ? 38   LYS C CG    1 
ATOM   3844  C  CD    . LYS C  2  38   ? 85.724  -40.892 73.241  1.00 69.42  ? 38   LYS C CD    1 
ATOM   3845  C  CE    . LYS C  2  38   ? 86.223  -42.214 73.800  1.00 81.25  ? 38   LYS C CE    1 
ATOM   3846  N  NZ    . LYS C  2  38   ? 86.823  -42.053 75.153  1.00 80.93  ? 38   LYS C NZ    1 
ATOM   3847  N  N     . ARG C  2  39   ? 82.470  -38.057 69.160  1.00 72.63  ? 39   ARG C N     1 
ATOM   3848  C  CA    . ARG C  2  39   ? 81.310  -37.199 69.005  1.00 69.20  ? 39   ARG C CA    1 
ATOM   3849  C  C     . ARG C  2  39   ? 80.190  -37.901 68.255  1.00 73.16  ? 39   ARG C C     1 
ATOM   3850  O  O     . ARG C  2  39   ? 80.421  -38.582 67.256  1.00 74.21  ? 39   ARG C O     1 
ATOM   3851  C  CB    . ARG C  2  39   ? 81.695  -35.906 68.283  1.00 60.61  ? 39   ARG C CB    1 
ATOM   3852  C  CG    . ARG C  2  39   ? 82.743  -35.080 69.009  1.00 57.44  ? 39   ARG C CG    1 
ATOM   3853  C  CD    . ARG C  2  39   ? 82.698  -33.624 68.575  1.00 52.43  ? 39   ARG C CD    1 
ATOM   3854  N  NE    . ARG C  2  39   ? 83.384  -32.750 69.522  1.00 50.93  ? 39   ARG C NE    1 
ATOM   3855  C  CZ    . ARG C  2  39   ? 84.424  -31.983 69.211  1.00 49.88  ? 39   ARG C CZ    1 
ATOM   3856  N  NH1   . ARG C  2  39   ? 84.902  -31.980 67.975  1.00 53.37  ? 39   ARG C NH1   1 
ATOM   3857  N  NH2   . ARG C  2  39   ? 84.987  -31.219 70.137  1.00 52.47  ? 39   ARG C NH2   1 
ATOM   3858  N  N     . GLU C  2  40   ? 78.970  -37.713 68.741  1.00 74.05  ? 40   GLU C N     1 
ATOM   3859  C  CA    . GLU C  2  40   ? 77.770  -38.136 68.025  1.00 73.50  ? 40   GLU C CA    1 
ATOM   3860  C  C     . GLU C  2  40   ? 77.423  -37.122 66.948  1.00 71.85  ? 40   GLU C C     1 
ATOM   3861  O  O     . GLU C  2  40   ? 77.910  -35.987 66.983  1.00 65.92  ? 40   GLU C O     1 
ATOM   3862  C  CB    . GLU C  2  40   ? 76.601  -38.312 68.977  1.00 63.53  ? 40   GLU C CB    1 
ATOM   3863  C  CG    . GLU C  2  40   ? 77.002  -38.940 70.291  1.00 79.58  ? 40   GLU C CG    1 
ATOM   3864  C  CD    . GLU C  2  40   ? 75.886  -39.745 70.909  1.00 98.40  ? 40   GLU C CD    1 
ATOM   3865  O  OE1   . GLU C  2  40   ? 74.805  -39.839 70.286  1.00 93.93  ? 40   GLU C OE1   1 
ATOM   3866  O  OE2   . GLU C  2  40   ? 76.094  -40.291 72.014  1.00 114.30 ? 40   GLU C OE2   1 
ATOM   3867  N  N     . ASN C  2  41   ? 76.578  -37.526 66.001  1.00 73.93  ? 41   ASN C N     1 
ATOM   3868  C  CA    . ASN C  2  41   ? 76.199  -36.636 64.920  1.00 69.11  ? 41   ASN C CA    1 
ATOM   3869  C  C     . ASN C  2  41   ? 74.963  -35.895 65.444  1.00 65.29  ? 41   ASN C C     1 
ATOM   3870  O  O     . ASN C  2  41   ? 73.824  -36.334 65.258  1.00 66.24  ? 41   ASN C O     1 
ATOM   3871  C  CB    . ASN C  2  41   ? 75.825  -37.542 63.738  1.00 69.28  ? 41   ASN C CB    1 
ATOM   3872  C  CG    . ASN C  2  41   ? 75.527  -36.786 62.452  1.00 72.01  ? 41   ASN C CG    1 
ATOM   3873  O  OD1   . ASN C  2  41   ? 75.219  -35.605 62.468  1.00 74.99  ? 41   ASN C OD1   1 
ATOM   3874  N  ND2   . ASN C  2  41   ? 75.596  -37.493 61.322  1.00 74.94  ? 41   ASN C ND2   1 
ATOM   3875  N  N     . VAL C  2  42   ? 75.232  -34.793 66.141  1.00 67.84  ? 42   VAL C N     1 
ATOM   3876  C  CA    . VAL C  2  42   ? 74.213  -33.892 66.664  1.00 65.38  ? 42   VAL C CA    1 
ATOM   3877  C  C     . VAL C  2  42   ? 74.816  -32.501 66.860  1.00 56.92  ? 42   VAL C C     1 
ATOM   3878  O  O     . VAL C  2  42   ? 76.035  -32.355 66.948  1.00 63.45  ? 42   VAL C O     1 
ATOM   3879  C  CB    . VAL C  2  42   ? 73.646  -34.394 68.003  1.00 56.65  ? 42   VAL C CB    1 
ATOM   3880  C  CG1   . VAL C  2  42   ? 73.242  -35.856 67.894  1.00 58.28  ? 42   VAL C CG1   1 
ATOM   3881  C  CG2   . VAL C  2  42   ? 74.663  -34.196 69.116  1.00 57.13  ? 42   VAL C CG2   1 
ATOM   3882  N  N     . GLY C  2  43   ? 73.964  -31.483 66.932  1.00 55.97  ? 43   GLY C N     1 
ATOM   3883  C  CA    . GLY C  2  43   ? 74.412  -30.122 67.167  1.00 56.22  ? 43   GLY C CA    1 
ATOM   3884  C  C     . GLY C  2  43   ? 75.338  -29.574 66.101  1.00 52.11  ? 43   GLY C C     1 
ATOM   3885  O  O     . GLY C  2  43   ? 75.059  -29.674 64.907  1.00 59.63  ? 43   GLY C O     1 
ATOM   3886  N  N     . ILE C  2  44   ? 76.469  -29.031 66.538  1.00 48.54  ? 44   ILE C N     1 
ATOM   3887  C  CA    . ILE C  2  44   ? 77.473  -28.499 65.625  1.00 51.13  ? 44   ILE C CA    1 
ATOM   3888  C  C     . ILE C  2  44   ? 78.044  -29.589 64.720  1.00 53.53  ? 44   ILE C C     1 
ATOM   3889  O  O     . ILE C  2  44   ? 78.277  -29.360 63.534  1.00 56.03  ? 44   ILE C O     1 
ATOM   3890  C  CB    . ILE C  2  44   ? 78.626  -27.822 66.388  1.00 51.05  ? 44   ILE C CB    1 
ATOM   3891  C  CG1   . ILE C  2  44   ? 78.133  -26.550 67.078  1.00 51.49  ? 44   ILE C CG1   1 
ATOM   3892  C  CG2   . ILE C  2  44   ? 79.777  -27.508 65.445  1.00 56.86  ? 44   ILE C CG2   1 
ATOM   3893  C  CD1   . ILE C  2  44   ? 76.879  -25.969 66.462  1.00 53.99  ? 44   ILE C CD1   1 
ATOM   3894  N  N     . GLN C  2  45   ? 78.270  -30.772 65.284  1.00 51.87  ? 45   GLN C N     1 
ATOM   3895  C  CA    . GLN C  2  45   ? 78.839  -31.880 64.523  1.00 53.31  ? 45   GLN C CA    1 
ATOM   3896  C  C     . GLN C  2  45   ? 77.915  -32.281 63.379  1.00 63.40  ? 45   GLN C C     1 
ATOM   3897  O  O     . GLN C  2  45   ? 78.368  -32.547 62.266  1.00 66.70  ? 45   GLN C O     1 
ATOM   3898  C  CB    . GLN C  2  45   ? 79.096  -33.080 65.437  1.00 52.21  ? 45   GLN C CB    1 
ATOM   3899  C  CG    . GLN C  2  45   ? 79.807  -34.237 64.756  1.00 61.56  ? 45   GLN C CG    1 
ATOM   3900  C  CD    . GLN C  2  45   ? 81.300  -34.010 64.629  1.00 60.15  ? 45   GLN C CD    1 
ATOM   3901  O  OE1   . GLN C  2  45   ? 81.873  -33.173 65.325  1.00 63.09  ? 45   GLN C OE1   1 
ATOM   3902  N  NE2   . GLN C  2  45   ? 81.939  -34.758 63.738  1.00 61.62  ? 45   GLN C NE2   1 
ATOM   3903  N  N     . ALA C  2  46   ? 76.617  -32.310 63.659  1.00 62.60  ? 46   ALA C N     1 
ATOM   3904  C  CA    . ALA C  2  46   ? 75.607  -32.552 62.629  1.00 62.48  ? 46   ALA C CA    1 
ATOM   3905  C  C     . ALA C  2  46   ? 75.606  -31.492 61.540  1.00 59.27  ? 46   ALA C C     1 
ATOM   3906  O  O     . ALA C  2  46   ? 75.507  -31.817 60.370  1.00 63.88  ? 46   ALA C O     1 
ATOM   3907  C  CB    . ALA C  2  46   ? 74.238  -32.626 63.250  1.00 64.02  ? 46   ALA C CB    1 
ATOM   3908  N  N     . ALA C  2  47   ? 75.690  -30.224 61.928  1.00 58.56  ? 47   ALA C N     1 
ATOM   3909  C  CA    . ALA C  2  47   ? 75.703  -29.132 60.960  1.00 61.69  ? 47   ALA C CA    1 
ATOM   3910  C  C     . ALA C  2  47   ? 76.861  -29.277 59.988  1.00 62.42  ? 47   ALA C C     1 
ATOM   3911  O  O     . ALA C  2  47   ? 76.669  -29.291 58.765  1.00 62.81  ? 47   ALA C O     1 
ATOM   3912  C  CB    . ALA C  2  47   ? 75.792  -27.800 61.675  1.00 60.89  ? 47   ALA C CB    1 
ATOM   3913  N  N     . PHE C  2  48   ? 78.065  -29.378 60.549  1.00 64.29  ? 48   PHE C N     1 
ATOM   3914  C  CA    . PHE C  2  48   ? 79.274  -29.539 59.750  1.00 63.98  ? 48   PHE C CA    1 
ATOM   3915  C  C     . PHE C  2  48   ? 79.075  -30.660 58.790  1.00 64.96  ? 48   PHE C C     1 
ATOM   3916  O  O     . PHE C  2  48   ? 79.325  -30.561 57.591  1.00 63.36  ? 48   PHE C O     1 
ATOM   3917  C  CB    . PHE C  2  48   ? 80.455  -29.873 60.639  1.00 54.31  ? 48   PHE C CB    1 
ATOM   3918  C  CG    . PHE C  2  48   ? 81.219  -28.680 61.060  1.00 47.97  ? 48   PHE C CG    1 
ATOM   3919  C  CD1   . PHE C  2  48   ? 81.370  -28.363 62.394  1.00 45.48  ? 48   PHE C CD1   1 
ATOM   3920  C  CD2   . PHE C  2  48   ? 81.785  -27.864 60.106  1.00 50.77  ? 48   PHE C CD2   1 
ATOM   3921  C  CE1   . PHE C  2  48   ? 82.089  -27.250 62.768  1.00 51.30  ? 48   PHE C CE1   1 
ATOM   3922  C  CE2   . PHE C  2  48   ? 82.497  -26.755 60.464  1.00 53.88  ? 48   PHE C CE2   1 
ATOM   3923  C  CZ    . PHE C  2  48   ? 82.653  -26.440 61.797  1.00 54.23  ? 48   PHE C CZ    1 
ATOM   3924  N  N     . ARG C  2  49   ? 78.622  -31.788 59.328  1.00 63.68  ? 49   ARG C N     1 
ATOM   3925  C  CA    . ARG C  2  49   ? 78.459  -33.002 58.535  1.00 64.63  ? 49   ARG C CA    1 
ATOM   3926  C  C     . ARG C  2  49   ? 77.431  -32.843 57.419  1.00 67.09  ? 49   ARG C C     1 
ATOM   3927  O  O     . ARG C  2  49   ? 77.645  -33.309 56.300  1.00 80.84  ? 49   ARG C O     1 
ATOM   3928  C  CB    . ARG C  2  49   ? 78.072  -34.178 59.435  1.00 62.18  ? 49   ARG C CB    1 
ATOM   3929  C  CG    . ARG C  2  49   ? 79.199  -34.677 60.323  1.00 69.14  ? 49   ARG C CG    1 
ATOM   3930  C  CD    . ARG C  2  49   ? 80.080  -35.676 59.590  1.00 74.50  ? 49   ARG C CD    1 
ATOM   3931  N  NE    . ARG C  2  49   ? 79.473  -37.002 59.535  1.00 88.67  ? 49   ARG C NE    1 
ATOM   3932  C  CZ    . ARG C  2  49   ? 78.945  -37.537 58.439  1.00 99.10  ? 49   ARG C CZ    1 
ATOM   3933  N  NH1   . ARG C  2  49   ? 78.413  -38.751 58.480  1.00 104.77 ? 49   ARG C NH1   1 
ATOM   3934  N  NH2   . ARG C  2  49   ? 78.948  -36.857 57.300  1.00 86.67  ? 49   ARG C NH2   1 
ATOM   3935  N  N     . GLU C  2  50   ? 76.317  -32.185 57.723  1.00 66.08  ? 50   GLU C N     1 
ATOM   3936  C  CA    . GLU C  2  50   ? 75.270  -31.980 56.730  1.00 68.60  ? 50   GLU C CA    1 
ATOM   3937  C  C     . GLU C  2  50   ? 75.778  -31.127 55.574  1.00 68.16  ? 50   GLU C C     1 
ATOM   3938  O  O     . GLU C  2  50   ? 75.497  -31.407 54.410  1.00 75.63  ? 50   GLU C O     1 
ATOM   3939  C  CB    . GLU C  2  50   ? 74.050  -31.318 57.372  1.00 71.98  ? 50   GLU C CB    1 
ATOM   3940  C  CG    . GLU C  2  50   ? 72.783  -32.156 57.313  1.00 85.33  ? 50   GLU C CG    1 
ATOM   3941  C  CD    . GLU C  2  50   ? 71.612  -31.490 58.006  1.00 98.01  ? 50   GLU C CD    1 
ATOM   3942  O  OE1   . GLU C  2  50   ? 71.836  -30.797 59.021  1.00 91.28  ? 50   GLU C OE1   1 
ATOM   3943  O  OE2   . GLU C  2  50   ? 70.467  -31.659 57.537  1.00 101.84 ? 50   GLU C OE2   1 
ATOM   3944  N  N     . THR C  2  51   ? 76.531  -30.086 55.909  1.00 62.57  ? 51   THR C N     1 
ATOM   3945  C  CA    . THR C  2  51   ? 77.110  -29.195 54.911  1.00 64.60  ? 51   THR C CA    1 
ATOM   3946  C  C     . THR C  2  51   ? 78.115  -29.909 54.014  1.00 71.03  ? 51   THR C C     1 
ATOM   3947  O  O     . THR C  2  51   ? 78.166  -29.672 52.808  1.00 71.33  ? 51   THR C O     1 
ATOM   3948  C  CB    . THR C  2  51   ? 77.796  -27.983 55.569  1.00 63.37  ? 51   THR C CB    1 
ATOM   3949  O  OG1   . THR C  2  51   ? 76.887  -27.351 56.478  1.00 69.90  ? 51   THR C OG1   1 
ATOM   3950  C  CG2   . THR C  2  51   ? 78.230  -26.979 54.513  1.00 58.81  ? 51   THR C CG2   1 
ATOM   3951  N  N     . PHE C  2  52   ? 78.921  -30.778 54.616  1.00 71.24  ? 52   PHE C N     1 
ATOM   3952  C  CA    . PHE C  2  52   ? 80.021  -31.433 53.904  1.00 69.48  ? 52   PHE C CA    1 
ATOM   3953  C  C     . PHE C  2  52   ? 79.689  -32.885 53.546  1.00 77.24  ? 52   PHE C C     1 
ATOM   3954  O  O     . PHE C  2  52   ? 78.824  -33.498 54.170  1.00 76.70  ? 52   PHE C O     1 
ATOM   3955  C  CB    . PHE C  2  52   ? 81.302  -31.390 54.742  1.00 66.95  ? 52   PHE C CB    1 
ATOM   3956  C  CG    . PHE C  2  52   ? 81.817  -30.000 55.006  1.00 64.97  ? 52   PHE C CG    1 
ATOM   3957  C  CD1   . PHE C  2  52   ? 82.706  -29.399 54.135  1.00 62.05  ? 52   PHE C CD1   1 
ATOM   3958  C  CD2   . PHE C  2  52   ? 81.429  -29.303 56.141  1.00 63.83  ? 52   PHE C CD2   1 
ATOM   3959  C  CE1   . PHE C  2  52   ? 83.191  -28.125 54.384  1.00 62.39  ? 52   PHE C CE1   1 
ATOM   3960  C  CE2   . PHE C  2  52   ? 81.910  -28.030 56.397  1.00 59.03  ? 52   PHE C CE2   1 
ATOM   3961  C  CZ    . PHE C  2  52   ? 82.793  -27.440 55.518  1.00 57.36  ? 52   PHE C CZ    1 
ATOM   3962  N  N     . PRO C  2  53   ? 80.380  -33.448 52.537  1.00 84.23  ? 53   PRO C N     1 
ATOM   3963  C  CA    . PRO C  2  53   ? 81.438  -32.832 51.725  1.00 73.85  ? 53   PRO C CA    1 
ATOM   3964  C  C     . PRO C  2  53   ? 80.916  -31.862 50.669  1.00 71.91  ? 53   PRO C C     1 
ATOM   3965  O  O     . PRO C  2  53   ? 79.776  -31.980 50.221  1.00 77.44  ? 53   PRO C O     1 
ATOM   3966  C  CB    . PRO C  2  53   ? 82.084  -34.036 51.040  1.00 77.48  ? 53   PRO C CB    1 
ATOM   3967  C  CG    . PRO C  2  53   ? 80.986  -35.020 50.924  1.00 80.45  ? 53   PRO C CG    1 
ATOM   3968  C  CD    . PRO C  2  53   ? 80.166  -34.860 52.171  1.00 82.32  ? 53   PRO C CD    1 
ATOM   3969  N  N     . ILE C  2  54   ? 81.760  -30.911 50.281  1.00 67.48  ? 54   ILE C N     1 
ATOM   3970  C  CA    . ILE C  2  54   ? 81.422  -29.928 49.261  1.00 75.00  ? 54   ILE C CA    1 
ATOM   3971  C  C     . ILE C  2  54   ? 81.843  -30.413 47.872  1.00 88.42  ? 54   ILE C C     1 
ATOM   3972  O  O     . ILE C  2  54   ? 83.023  -30.395 47.526  1.00 90.52  ? 54   ILE C O     1 
ATOM   3973  C  CB    . ILE C  2  54   ? 82.078  -28.571 49.571  1.00 71.49  ? 54   ILE C CB    1 
ATOM   3974  C  CG1   . ILE C  2  54   ? 81.558  -28.033 50.908  1.00 71.07  ? 54   ILE C CG1   1 
ATOM   3975  C  CG2   . ILE C  2  54   ? 81.819  -27.580 48.449  1.00 73.48  ? 54   ILE C CG2   1 
ATOM   3976  C  CD1   . ILE C  2  54   ? 82.172  -26.722 51.324  1.00 66.29  ? 54   ILE C CD1   1 
ATOM   3977  N  N     . GLU C  2  55   ? 80.858  -30.831 47.081  1.00 94.29  ? 55   GLU C N     1 
ATOM   3978  C  CA    . GLU C  2  55   ? 81.089  -31.483 45.794  1.00 94.03  ? 55   GLU C CA    1 
ATOM   3979  C  C     . GLU C  2  55   ? 81.285  -30.496 44.642  1.00 98.18  ? 55   GLU C C     1 
ATOM   3980  O  O     . GLU C  2  55   ? 81.467  -29.302 44.860  1.00 96.67  ? 55   GLU C O     1 
ATOM   3981  C  CB    . GLU C  2  55   ? 79.904  -32.398 45.474  1.00 104.97 ? 55   GLU C CB    1 
ATOM   3982  C  CG    . GLU C  2  55   ? 80.259  -33.643 44.683  1.00 118.61 ? 55   GLU C CG    1 
ATOM   3983  C  CD    . GLU C  2  55   ? 80.940  -34.691 45.536  1.00 119.08 ? 55   GLU C CD    1 
ATOM   3984  O  OE1   . GLU C  2  55   ? 80.701  -34.707 46.766  1.00 109.94 ? 55   GLU C OE1   1 
ATOM   3985  O  OE2   . GLU C  2  55   ? 81.717  -35.495 44.976  1.00 116.69 ? 55   GLU C OE2   1 
ATOM   3986  N  N     . GLU C  2  56   ? 81.244  -31.010 43.415  1.00 106.13 ? 56   GLU C N     1 
ATOM   3987  C  CA    . GLU C  2  56   ? 81.300  -30.177 42.216  1.00 104.65 ? 56   GLU C CA    1 
ATOM   3988  C  C     . GLU C  2  56   ? 80.101  -30.431 41.306  1.00 104.76 ? 56   GLU C C     1 
ATOM   3989  O  O     . GLU C  2  56   ? 79.635  -31.563 41.178  1.00 103.21 ? 56   GLU C O     1 
ATOM   3990  C  CB    . GLU C  2  56   ? 82.599  -30.416 41.444  1.00 97.12  ? 56   GLU C CB    1 
ATOM   3991  C  CG    . GLU C  2  56   ? 83.773  -29.577 41.919  1.00 102.68 ? 56   GLU C CG    1 
ATOM   3992  C  CD    . GLU C  2  56   ? 83.566  -28.087 41.688  1.00 109.59 ? 56   GLU C CD    1 
ATOM   3993  O  OE1   . GLU C  2  56   ? 84.469  -27.447 41.104  1.00 112.03 ? 56   GLU C OE1   1 
ATOM   3994  O  OE2   . GLU C  2  56   ? 82.508  -27.554 42.094  1.00 99.02  ? 56   GLU C OE2   1 
ATOM   3995  N  N     . LEU C  2  64   ? 87.333  -31.436 42.210  1.00 102.28 ? 64   LEU C N     1 
ATOM   3996  C  CA    . LEU C  2  64   ? 87.588  -30.951 43.567  1.00 99.94  ? 64   LEU C CA    1 
ATOM   3997  C  C     . LEU C  2  64   ? 86.495  -31.326 44.578  1.00 99.46  ? 64   LEU C C     1 
ATOM   3998  O  O     . LEU C  2  64   ? 85.302  -31.160 44.317  1.00 98.87  ? 64   LEU C O     1 
ATOM   3999  C  CB    . LEU C  2  64   ? 87.805  -29.437 43.561  1.00 90.91  ? 64   LEU C CB    1 
ATOM   4000  C  CG    . LEU C  2  64   ? 89.226  -28.967 43.256  1.00 98.18  ? 64   LEU C CG    1 
ATOM   4001  C  CD1   . LEU C  2  64   ? 89.296  -27.454 43.121  1.00 84.17  ? 64   LEU C CD1   1 
ATOM   4002  C  CD2   . LEU C  2  64   ? 90.170  -29.452 44.340  1.00 102.48 ? 64   LEU C CD2   1 
ATOM   4003  N  N     . VAL C  2  65   ? 86.923  -31.832 45.733  1.00 91.82  ? 65   VAL C N     1 
ATOM   4004  C  CA    . VAL C  2  65   ? 86.018  -32.203 46.815  1.00 83.57  ? 65   VAL C CA    1 
ATOM   4005  C  C     . VAL C  2  65   ? 86.603  -31.802 48.165  1.00 88.46  ? 65   VAL C C     1 
ATOM   4006  O  O     . VAL C  2  65   ? 87.622  -32.346 48.591  1.00 91.02  ? 65   VAL C O     1 
ATOM   4007  C  CB    . VAL C  2  65   ? 85.749  -33.721 46.830  1.00 84.14  ? 65   VAL C CB    1 
ATOM   4008  C  CG1   . VAL C  2  65   ? 85.080  -34.131 48.137  1.00 86.66  ? 65   VAL C CG1   1 
ATOM   4009  C  CG2   . VAL C  2  65   ? 84.905  -34.127 45.628  1.00 94.27  ? 65   VAL C CG2   1 
ATOM   4010  N  N     . LEU C  2  66   ? 85.957  -30.852 48.838  1.00 87.03  ? 66   LEU C N     1 
ATOM   4011  C  CA    . LEU C  2  66   ? 86.400  -30.409 50.163  1.00 80.78  ? 66   LEU C CA    1 
ATOM   4012  C  C     . LEU C  2  66   ? 85.623  -31.115 51.271  1.00 70.34  ? 66   LEU C C     1 
ATOM   4013  O  O     . LEU C  2  66   ? 84.407  -30.990 51.356  1.00 76.80  ? 66   LEU C O     1 
ATOM   4014  C  CB    . LEU C  2  66   ? 86.256  -28.893 50.299  1.00 72.89  ? 66   LEU C CB    1 
ATOM   4015  C  CG    . LEU C  2  66   ? 86.660  -28.301 51.644  1.00 60.14  ? 66   LEU C CG    1 
ATOM   4016  C  CD1   . LEU C  2  66   ? 87.942  -28.950 52.133  1.00 73.73  ? 66   LEU C CD1   1 
ATOM   4017  C  CD2   . LEU C  2  66   ? 86.819  -26.794 51.528  1.00 54.68  ? 66   LEU C CD2   1 
ATOM   4018  N  N     . ASP C  2  67   ? 86.325  -31.853 52.122  1.00 70.91  ? 67   ASP C N     1 
ATOM   4019  C  CA    . ASP C  2  67   ? 85.658  -32.700 53.104  1.00 71.04  ? 67   ASP C CA    1 
ATOM   4020  C  C     . ASP C  2  67   ? 85.980  -32.307 54.548  1.00 72.81  ? 67   ASP C C     1 
ATOM   4021  O  O     . ASP C  2  67   ? 87.061  -31.805 54.847  1.00 77.37  ? 67   ASP C O     1 
ATOM   4022  C  CB    . ASP C  2  67   ? 86.003  -34.172 52.856  1.00 77.43  ? 67   ASP C CB    1 
ATOM   4023  C  CG    . ASP C  2  67   ? 84.992  -35.125 53.474  1.00 91.69  ? 67   ASP C CG    1 
ATOM   4024  O  OD1   . ASP C  2  67   ? 83.821  -34.723 53.656  1.00 85.51  ? 67   ASP C OD1   1 
ATOM   4025  O  OD2   . ASP C  2  67   ? 85.366  -36.282 53.767  1.00 101.87 ? 67   ASP C OD2   1 
ATOM   4026  N  N     . PHE C  2  68   ? 85.026  -32.543 55.439  1.00 68.31  ? 68   PHE C N     1 
ATOM   4027  C  CA    . PHE C  2  68   ? 85.169  -32.199 56.846  1.00 62.36  ? 68   PHE C CA    1 
ATOM   4028  C  C     . PHE C  2  68   ? 85.638  -33.403 57.648  1.00 62.28  ? 68   PHE C C     1 
ATOM   4029  O  O     . PHE C  2  68   ? 85.040  -34.477 57.578  1.00 63.65  ? 68   PHE C O     1 
ATOM   4030  C  CB    . PHE C  2  68   ? 83.834  -31.677 57.389  1.00 65.45  ? 68   PHE C CB    1 
ATOM   4031  C  CG    . PHE C  2  68   ? 83.728  -31.691 58.893  1.00 58.29  ? 68   PHE C CG    1 
ATOM   4032  C  CD1   . PHE C  2  68   ? 84.283  -30.678 59.650  1.00 55.03  ? 68   PHE C CD1   1 
ATOM   4033  C  CD2   . PHE C  2  68   ? 83.047  -32.707 59.543  1.00 54.99  ? 68   PHE C CD2   1 
ATOM   4034  C  CE1   . PHE C  2  68   ? 84.180  -30.688 61.021  1.00 52.40  ? 68   PHE C CE1   1 
ATOM   4035  C  CE2   . PHE C  2  68   ? 82.937  -32.721 60.914  1.00 53.15  ? 68   PHE C CE2   1 
ATOM   4036  C  CZ    . PHE C  2  68   ? 83.505  -31.712 61.655  1.00 56.83  ? 68   PHE C CZ    1 
ATOM   4037  N  N     . LEU C  2  69   ? 86.714  -33.217 58.408  1.00 58.72  ? 69   LEU C N     1 
ATOM   4038  C  CA    . LEU C  2  69   ? 87.259  -34.279 59.248  1.00 64.63  ? 69   LEU C CA    1 
ATOM   4039  C  C     . LEU C  2  69   ? 86.750  -34.173 60.681  1.00 60.75  ? 69   LEU C C     1 
ATOM   4040  O  O     . LEU C  2  69   ? 86.062  -35.063 61.175  1.00 63.44  ? 69   LEU C O     1 
ATOM   4041  C  CB    . LEU C  2  69   ? 88.790  -34.239 59.243  1.00 64.02  ? 69   LEU C CB    1 
ATOM   4042  C  CG    . LEU C  2  69   ? 89.451  -34.422 57.880  1.00 70.50  ? 69   LEU C CG    1 
ATOM   4043  C  CD1   . LEU C  2  69   ? 90.959  -34.357 58.010  1.00 76.08  ? 69   LEU C CD1   1 
ATOM   4044  C  CD2   . LEU C  2  69   ? 89.013  -35.733 57.254  1.00 67.92  ? 69   LEU C CD2   1 
ATOM   4045  N  N     . GLU C  2  70   ? 87.106  -33.079 61.344  1.00 54.65  ? 70   GLU C N     1 
ATOM   4046  C  CA    . GLU C  2  70   ? 86.703  -32.842 62.719  1.00 55.54  ? 70   GLU C CA    1 
ATOM   4047  C  C     . GLU C  2  70   ? 86.800  -31.352 62.990  1.00 57.77  ? 70   GLU C C     1 
ATOM   4048  O  O     . GLU C  2  70   ? 87.367  -30.618 62.189  1.00 57.59  ? 70   GLU C O     1 
ATOM   4049  C  CB    . GLU C  2  70   ? 87.613  -33.607 63.679  1.00 55.80  ? 70   GLU C CB    1 
ATOM   4050  C  CG    . GLU C  2  70   ? 89.078  -33.219 63.574  1.00 59.27  ? 70   GLU C CG    1 
ATOM   4051  C  CD    . GLU C  2  70   ? 89.959  -33.979 64.543  1.00 67.63  ? 70   GLU C CD    1 
ATOM   4052  O  OE1   . GLU C  2  70   ? 90.199  -33.471 65.660  1.00 72.17  ? 70   GLU C OE1   1 
ATOM   4053  O  OE2   . GLU C  2  70   ? 90.413  -35.085 64.185  1.00 68.51  ? 70   GLU C OE2   1 
ATOM   4054  N  N     . TYR C  2  71   ? 86.239  -30.898 64.107  1.00 56.05  ? 71   TYR C N     1 
ATOM   4055  C  CA    . TYR C  2  71   ? 86.387  -29.501 64.512  1.00 56.20  ? 71   TYR C CA    1 
ATOM   4056  C  C     . TYR C  2  71   ? 86.831  -29.465 65.961  1.00 52.12  ? 71   TYR C C     1 
ATOM   4057  O  O     . TYR C  2  71   ? 86.757  -30.475 66.654  1.00 56.18  ? 71   TYR C O     1 
ATOM   4058  C  CB    . TYR C  2  71   ? 85.066  -28.741 64.365  1.00 55.31  ? 71   TYR C CB    1 
ATOM   4059  C  CG    . TYR C  2  71   ? 84.057  -29.103 65.428  1.00 54.84  ? 71   TYR C CG    1 
ATOM   4060  C  CD1   . TYR C  2  71   ? 83.976  -28.380 66.610  1.00 49.42  ? 71   TYR C CD1   1 
ATOM   4061  C  CD2   . TYR C  2  71   ? 83.207  -30.185 65.261  1.00 54.63  ? 71   TYR C CD2   1 
ATOM   4062  C  CE1   . TYR C  2  71   ? 83.068  -28.717 67.590  1.00 49.38  ? 71   TYR C CE1   1 
ATOM   4063  C  CE2   . TYR C  2  71   ? 82.296  -30.529 66.234  1.00 56.22  ? 71   TYR C CE2   1 
ATOM   4064  C  CZ    . TYR C  2  71   ? 82.228  -29.791 67.399  1.00 50.10  ? 71   TYR C CZ    1 
ATOM   4065  O  OH    . TYR C  2  71   ? 81.313  -30.136 68.371  1.00 49.69  ? 71   TYR C OH    1 
ATOM   4066  N  N     . ARG C  2  72   ? 87.297  -28.311 66.420  1.00 47.91  ? 72   ARG C N     1 
ATOM   4067  C  CA    . ARG C  2  72   ? 87.608  -28.153 67.833  1.00 57.48  ? 72   ARG C CA    1 
ATOM   4068  C  C     . ARG C  2  72   ? 87.318  -26.737 68.315  1.00 55.72  ? 72   ARG C C     1 
ATOM   4069  O  O     . ARG C  2  72   ? 87.334  -25.789 67.531  1.00 53.64  ? 72   ARG C O     1 
ATOM   4070  C  CB    . ARG C  2  72   ? 89.067  -28.510 68.110  1.00 61.04  ? 72   ARG C CB    1 
ATOM   4071  C  CG    . ARG C  2  72   ? 90.038  -27.471 67.614  1.00 51.00  ? 72   ARG C CG    1 
ATOM   4072  C  CD    . ARG C  2  72   ? 91.475  -27.799 67.969  1.00 45.18  ? 72   ARG C CD    1 
ATOM   4073  N  NE    . ARG C  2  72   ? 92.367  -26.811 67.373  1.00 48.36  ? 72   ARG C NE    1 
ATOM   4074  C  CZ    . ARG C  2  72   ? 92.741  -25.693 67.982  1.00 44.63  ? 72   ARG C CZ    1 
ATOM   4075  N  NH1   . ARG C  2  72   ? 92.318  -25.440 69.210  1.00 49.08  ? 72   ARG C NH1   1 
ATOM   4076  N  NH2   . ARG C  2  72   ? 93.540  -24.835 67.370  1.00 44.54  ? 72   ARG C NH2   1 
ATOM   4077  N  N     . LEU C  2  73   ? 87.053  -26.609 69.612  1.00 51.31  ? 73   LEU C N     1 
ATOM   4078  C  CA    . LEU C  2  73   ? 86.821  -25.311 70.237  1.00 51.47  ? 73   LEU C CA    1 
ATOM   4079  C  C     . LEU C  2  73   ? 87.986  -24.943 71.153  1.00 52.03  ? 73   LEU C C     1 
ATOM   4080  O  O     . LEU C  2  73   ? 88.457  -25.771 71.931  1.00 61.28  ? 73   LEU C O     1 
ATOM   4081  C  CB    . LEU C  2  73   ? 85.516  -25.332 71.037  1.00 54.95  ? 73   LEU C CB    1 
ATOM   4082  C  CG    . LEU C  2  73   ? 84.207  -25.306 70.245  1.00 46.39  ? 73   LEU C CG    1 
ATOM   4083  C  CD1   . LEU C  2  73   ? 83.103  -26.071 70.971  1.00 43.03  ? 73   LEU C CD1   1 
ATOM   4084  C  CD2   . LEU C  2  73   ? 83.797  -23.879 69.973  1.00 42.81  ? 73   LEU C CD2   1 
ATOM   4085  N  N     . GLY C  2  74   ? 88.450  -23.701 71.062  1.00 49.35  ? 74   GLY C N     1 
ATOM   4086  C  CA    . GLY C  2  74   ? 89.543  -23.244 71.899  1.00 52.96  ? 74   GLY C CA    1 
ATOM   4087  C  C     . GLY C  2  74   ? 89.098  -22.785 73.276  1.00 50.86  ? 74   GLY C C     1 
ATOM   4088  O  O     . GLY C  2  74   ? 88.031  -23.165 73.759  1.00 52.42  ? 74   GLY C O     1 
ATOM   4089  N  N     . GLU C  2  75   ? 89.937  -21.983 73.920  1.00 48.66  ? 75   GLU C N     1 
ATOM   4090  C  CA    . GLU C  2  75   ? 89.594  -21.369 75.189  1.00 46.65  ? 75   GLU C CA    1 
ATOM   4091  C  C     . GLU C  2  75   ? 89.237  -19.912 74.939  1.00 52.93  ? 75   GLU C C     1 
ATOM   4092  O  O     . GLU C  2  75   ? 89.704  -19.314 73.967  1.00 57.86  ? 75   GLU C O     1 
ATOM   4093  C  CB    . GLU C  2  75   ? 90.769  -21.457 76.168  1.00 51.13  ? 75   GLU C CB    1 
ATOM   4094  C  CG    . GLU C  2  75   ? 91.235  -22.872 76.481  1.00 57.26  ? 75   GLU C CG    1 
ATOM   4095  C  CD    . GLU C  2  75   ? 90.275  -23.630 77.388  1.00 71.36  ? 75   GLU C CD    1 
ATOM   4096  O  OE1   . GLU C  2  75   ? 89.828  -24.729 76.989  1.00 79.34  ? 75   GLU C OE1   1 
ATOM   4097  O  OE2   . GLU C  2  75   ? 89.974  -23.134 78.500  1.00 67.07  ? 75   GLU C OE2   1 
ATOM   4098  N  N     . PRO C  2  76   ? 88.398  -19.333 75.811  1.00 53.64  ? 76   PRO C N     1 
ATOM   4099  C  CA    . PRO C  2  76   ? 88.039  -17.913 75.718  1.00 53.18  ? 76   PRO C CA    1 
ATOM   4100  C  C     . PRO C  2  76   ? 89.262  -17.005 75.839  1.00 54.02  ? 76   PRO C C     1 
ATOM   4101  O  O     . PRO C  2  76   ? 90.014  -17.119 76.806  1.00 56.43  ? 76   PRO C O     1 
ATOM   4102  C  CB    . PRO C  2  76   ? 87.126  -17.708 76.927  1.00 51.33  ? 76   PRO C CB    1 
ATOM   4103  C  CG    . PRO C  2  76   ? 86.587  -19.059 77.227  1.00 47.58  ? 76   PRO C CG    1 
ATOM   4104  C  CD    . PRO C  2  76   ? 87.668  -20.024 76.887  1.00 48.52  ? 76   PRO C CD    1 
ATOM   4105  N  N     . PRO C  2  77   ? 89.458  -16.112 74.860  1.00 46.45  ? 77   PRO C N     1 
ATOM   4106  C  CA    . PRO C  2  77   ? 90.546  -15.130 74.849  1.00 51.40  ? 77   PRO C CA    1 
ATOM   4107  C  C     . PRO C  2  77   ? 90.507  -14.230 76.080  1.00 53.94  ? 77   PRO C C     1 
ATOM   4108  O  O     . PRO C  2  77   ? 91.535  -13.700 76.511  1.00 55.66  ? 77   PRO C O     1 
ATOM   4109  C  CB    . PRO C  2  77   ? 90.249  -14.301 73.598  1.00 52.83  ? 77   PRO C CB    1 
ATOM   4110  C  CG    . PRO C  2  77   ? 89.471  -15.205 72.724  1.00 57.73  ? 77   PRO C CG    1 
ATOM   4111  C  CD    . PRO C  2  77   ? 88.637  -16.039 73.642  1.00 51.03  ? 77   PRO C CD    1 
ATOM   4112  N  N     . PHE C  2  78   ? 89.312  -14.049 76.628  1.00 54.35  ? 78   PHE C N     1 
ATOM   4113  C  CA    . PHE C  2  78   ? 89.126  -13.243 77.823  1.00 55.28  ? 78   PHE C CA    1 
ATOM   4114  C  C     . PHE C  2  78   ? 88.096  -13.894 78.731  1.00 60.14  ? 78   PHE C C     1 
ATOM   4115  O  O     . PHE C  2  78   ? 87.185  -14.566 78.253  1.00 56.42  ? 78   PHE C O     1 
ATOM   4116  C  CB    . PHE C  2  78   ? 88.658  -11.845 77.452  1.00 52.37  ? 78   PHE C CB    1 
ATOM   4117  C  CG    . PHE C  2  78   ? 89.526  -11.169 76.441  1.00 54.12  ? 78   PHE C CG    1 
ATOM   4118  C  CD1   . PHE C  2  78   ? 89.332  -11.387 75.093  1.00 49.78  ? 78   PHE C CD1   1 
ATOM   4119  C  CD2   . PHE C  2  78   ? 90.531  -10.306 76.839  1.00 56.99  ? 78   PHE C CD2   1 
ATOM   4120  C  CE1   . PHE C  2  78   ? 90.125  -10.763 74.162  1.00 53.74  ? 78   PHE C CE1   1 
ATOM   4121  C  CE2   . PHE C  2  78   ? 91.327  -9.677  75.912  1.00 53.24  ? 78   PHE C CE2   1 
ATOM   4122  C  CZ    . PHE C  2  78   ? 91.126  -9.905  74.573  1.00 54.89  ? 78   PHE C CZ    1 
ATOM   4123  N  N     . PRO C  2  79   ? 88.244  -13.699 80.050  1.00 64.74  ? 79   PRO C N     1 
ATOM   4124  C  CA    . PRO C  2  79   ? 87.295  -14.220 81.037  1.00 61.77  ? 79   PRO C CA    1 
ATOM   4125  C  C     . PRO C  2  79   ? 85.998  -13.401 81.053  1.00 66.35  ? 79   PRO C C     1 
ATOM   4126  O  O     . PRO C  2  79   ? 85.957  -12.291 80.518  1.00 65.66  ? 79   PRO C O     1 
ATOM   4127  C  CB    . PRO C  2  79   ? 88.053  -14.059 82.356  1.00 65.75  ? 79   PRO C CB    1 
ATOM   4128  C  CG    . PRO C  2  79   ? 88.953  -12.888 82.124  1.00 68.86  ? 79   PRO C CG    1 
ATOM   4129  C  CD    . PRO C  2  79   ? 89.359  -12.968 80.681  1.00 67.44  ? 79   PRO C CD    1 
ATOM   4130  N  N     . GLN C  2  80   ? 84.951  -13.949 81.661  1.00 65.23  ? 80   GLN C N     1 
ATOM   4131  C  CA    . GLN C  2  80   ? 83.641  -13.308 81.659  1.00 60.35  ? 80   GLN C CA    1 
ATOM   4132  C  C     . GLN C  2  80   ? 83.670  -11.861 82.160  1.00 64.92  ? 80   GLN C C     1 
ATOM   4133  O  O     . GLN C  2  80   ? 83.148  -10.962 81.503  1.00 65.32  ? 80   GLN C O     1 
ATOM   4134  C  CB    . GLN C  2  80   ? 82.647  -14.143 82.457  1.00 51.98  ? 80   GLN C CB    1 
ATOM   4135  C  CG    . GLN C  2  80   ? 82.465  -15.538 81.899  1.00 58.58  ? 80   GLN C CG    1 
ATOM   4136  C  CD    . GLN C  2  80   ? 81.674  -16.448 82.821  1.00 60.70  ? 80   GLN C CD    1 
ATOM   4137  O  OE1   . GLN C  2  80   ? 80.878  -15.987 83.643  1.00 62.21  ? 80   GLN C OE1   1 
ATOM   4138  N  NE2   . GLN C  2  80   ? 81.895  -17.754 82.692  1.00 60.93  ? 80   GLN C NE2   1 
ATOM   4139  N  N     . ASP C  2  81   ? 84.332  -11.624 83.287  1.00 69.43  ? 81   ASP C N     1 
ATOM   4140  C  CA    . ASP C  2  81   ? 84.383  -10.281 83.858  1.00 70.07  ? 81   ASP C CA    1 
ATOM   4141  C  C     . ASP C  2  81   ? 85.055  -9.306  82.894  1.00 70.81  ? 81   ASP C C     1 
ATOM   4142  O  O     . ASP C  2  81   ? 84.614  -8.168  82.737  1.00 68.44  ? 81   ASP C O     1 
ATOM   4143  C  CB    . ASP C  2  81   ? 85.129  -10.297 85.193  1.00 79.21  ? 81   ASP C CB    1 
ATOM   4144  C  CG    . ASP C  2  81   ? 86.341  -11.209 85.173  1.00 90.00  ? 81   ASP C CG    1 
ATOM   4145  O  OD1   . ASP C  2  81   ? 86.157  -12.443 85.129  1.00 80.26  ? 81   ASP C OD1   1 
ATOM   4146  O  OD2   . ASP C  2  81   ? 87.477  -10.691 85.199  1.00 90.35  ? 81   ASP C OD2   1 
ATOM   4147  N  N     . GLU C  2  82   ? 86.121  -9.765  82.247  1.00 70.47  ? 82   GLU C N     1 
ATOM   4148  C  CA    . GLU C  2  82   ? 86.811  -8.991  81.230  1.00 70.90  ? 82   GLU C CA    1 
ATOM   4149  C  C     . GLU C  2  82   ? 85.863  -8.656  80.089  1.00 67.95  ? 82   GLU C C     1 
ATOM   4150  O  O     . GLU C  2  82   ? 85.831  -7.525  79.608  1.00 66.43  ? 82   GLU C O     1 
ATOM   4151  C  CB    . GLU C  2  82   ? 88.020  -9.766  80.705  1.00 71.24  ? 82   GLU C CB    1 
ATOM   4152  C  CG    . GLU C  2  82   ? 88.698  -9.117  79.513  1.00 72.03  ? 82   GLU C CG    1 
ATOM   4153  C  CD    . GLU C  2  82   ? 90.080  -8.606  79.839  1.00 74.25  ? 82   GLU C CD    1 
ATOM   4154  O  OE1   . GLU C  2  82   ? 90.683  -9.116  80.806  1.00 76.32  ? 82   GLU C OE1   1 
ATOM   4155  O  OE2   . GLU C  2  82   ? 90.558  -7.695  79.130  1.00 76.40  ? 82   GLU C OE2   1 
ATOM   4156  N  N     . CYS C  2  83   ? 85.085  -9.645  79.666  1.00 68.96  ? 83   CYS C N     1 
ATOM   4157  C  CA    . CYS C  2  83   ? 84.142  -9.451  78.572  1.00 67.55  ? 83   CYS C CA    1 
ATOM   4158  C  C     . CYS C  2  83   ? 83.134  -8.368  78.912  1.00 67.15  ? 83   CYS C C     1 
ATOM   4159  O  O     . CYS C  2  83   ? 82.968  -7.407  78.161  1.00 68.33  ? 83   CYS C O     1 
ATOM   4160  C  CB    . CYS C  2  83   ? 83.412  -10.752 78.249  1.00 63.75  ? 83   CYS C CB    1 
ATOM   4161  S  SG    . CYS C  2  83   ? 84.483  -12.084 77.695  1.00 61.81  ? 83   CYS C SG    1 
ATOM   4162  N  N     . ARG C  2  84   ? 82.467  -8.530  80.051  1.00 68.15  ? 84   ARG C N     1 
ATOM   4163  C  CA    . ARG C  2  84   ? 81.454  -7.576  80.488  1.00 65.78  ? 84   ARG C CA    1 
ATOM   4164  C  C     . ARG C  2  84   ? 82.012  -6.157  80.582  1.00 69.18  ? 84   ARG C C     1 
ATOM   4165  O  O     . ARG C  2  84   ? 81.310  -5.187  80.288  1.00 69.01  ? 84   ARG C O     1 
ATOM   4166  C  CB    . ARG C  2  84   ? 80.830  -8.002  81.823  1.00 56.98  ? 84   ARG C CB    1 
ATOM   4167  C  CG    . ARG C  2  84   ? 80.086  -9.326  81.772  1.00 53.36  ? 84   ARG C CG    1 
ATOM   4168  C  CD    . ARG C  2  84   ? 79.266  -9.566  83.030  1.00 44.37  ? 84   ARG C CD    1 
ATOM   4169  N  NE    . ARG C  2  84   ? 78.678  -10.907 83.066  1.00 46.28  ? 84   ARG C NE    1 
ATOM   4170  C  CZ    . ARG C  2  84   ? 79.146  -11.914 83.801  1.00 50.83  ? 84   ARG C CZ    1 
ATOM   4171  N  NH1   . ARG C  2  84   ? 80.208  -11.737 84.576  1.00 56.49  ? 84   ARG C NH1   1 
ATOM   4172  N  NH2   . ARG C  2  84   ? 78.550  -13.100 83.767  1.00 45.35  ? 84   ARG C NH2   1 
ATOM   4173  N  N     . GLU C  2  85   ? 83.241  -6.035  81.072  1.00 69.26  ? 85   GLU C N     1 
ATOM   4174  C  CA    . GLU C  2  85   ? 83.889  -4.733  81.191  1.00 73.90  ? 85   GLU C CA    1 
ATOM   4175  C  C     . GLU C  2  85   ? 84.163  -4.060  79.847  1.00 78.48  ? 85   GLU C C     1 
ATOM   4176  O  O     . GLU C  2  85   ? 83.966  -2.854  79.694  1.00 81.41  ? 85   GLU C O     1 
ATOM   4177  C  CB    . GLU C  2  85   ? 85.192  -4.859  81.984  1.00 80.45  ? 85   GLU C CB    1 
ATOM   4178  C  CG    . GLU C  2  85   ? 86.159  -3.706  81.774  1.00 89.79  ? 85   GLU C CG    1 
ATOM   4179  C  CD    . GLU C  2  85   ? 86.535  -3.017  83.071  1.00 108.22 ? 85   GLU C CD    1 
ATOM   4180  O  OE1   . GLU C  2  85   ? 85.764  -3.127  84.048  1.00 106.90 ? 85   GLU C OE1   1 
ATOM   4181  O  OE2   . GLU C  2  85   ? 87.599  -2.366  83.114  1.00 102.65 ? 85   GLU C OE2   1 
ATOM   4182  N  N     . LYS C  2  86   ? 84.629  -4.846  78.881  1.00 78.02  ? 86   LYS C N     1 
ATOM   4183  C  CA    . LYS C  2  86   ? 85.075  -4.312  77.596  1.00 74.18  ? 86   LYS C CA    1 
ATOM   4184  C  C     . LYS C  2  86   ? 84.025  -4.304  76.486  1.00 72.63  ? 86   LYS C C     1 
ATOM   4185  O  O     . LYS C  2  86   ? 84.301  -3.845  75.378  1.00 76.99  ? 86   LYS C O     1 
ATOM   4186  C  CB    . LYS C  2  86   ? 86.324  -5.060  77.119  1.00 72.80  ? 86   LYS C CB    1 
ATOM   4187  C  CG    . LYS C  2  86   ? 87.340  -5.334  78.216  1.00 78.72  ? 86   LYS C CG    1 
ATOM   4188  C  CD    . LYS C  2  86   ? 88.758  -5.329  77.669  1.00 78.06  ? 86   LYS C CD    1 
ATOM   4189  C  CE    . LYS C  2  86   ? 89.719  -4.655  78.634  1.00 82.60  ? 86   LYS C CE    1 
ATOM   4190  N  NZ    . LYS C  2  86   ? 90.705  -3.794  77.924  1.00 87.93  ? 86   LYS C NZ    1 
ATOM   4191  N  N     . ASP C  2  87   ? 82.832  -4.815  76.769  1.00 69.75  ? 87   ASP C N     1 
ATOM   4192  C  CA    . ASP C  2  87   ? 81.807  -4.935  75.724  1.00 70.93  ? 87   ASP C CA    1 
ATOM   4193  C  C     . ASP C  2  87   ? 82.187  -5.991  74.669  1.00 67.23  ? 87   ASP C C     1 
ATOM   4194  O  O     . ASP C  2  87   ? 82.007  -5.793  73.465  1.00 63.51  ? 87   ASP C O     1 
ATOM   4195  C  CB    . ASP C  2  87   ? 81.492  -3.575  75.071  1.00 71.23  ? 87   ASP C CB    1 
ATOM   4196  C  CG    . ASP C  2  87   ? 80.744  -2.624  76.006  1.00 83.05  ? 87   ASP C CG    1 
ATOM   4197  O  OD1   . ASP C  2  87   ? 80.537  -2.962  77.197  1.00 88.28  ? 87   ASP C OD1   1 
ATOM   4198  O  OD2   . ASP C  2  87   ? 80.369  -1.523  75.543  1.00 85.60  ? 87   ASP C OD2   1 
ATOM   4199  N  N     . LEU C  2  88   ? 82.696  -7.122  75.152  1.00 65.72  ? 88   LEU C N     1 
ATOM   4200  C  CA    . LEU C  2  88   ? 83.078  -8.244  74.307  1.00 63.22  ? 88   LEU C CA    1 
ATOM   4201  C  C     . LEU C  2  88   ? 82.093  -9.393  74.471  1.00 62.11  ? 88   LEU C C     1 
ATOM   4202  O  O     . LEU C  2  88   ? 81.530  -9.580  75.543  1.00 65.44  ? 88   LEU C O     1 
ATOM   4203  C  CB    . LEU C  2  88   ? 84.465  -8.756  74.701  1.00 62.43  ? 88   LEU C CB    1 
ATOM   4204  C  CG    . LEU C  2  88   ? 85.638  -7.776  74.765  1.00 64.27  ? 88   LEU C CG    1 
ATOM   4205  C  CD1   . LEU C  2  88   ? 86.878  -8.468  75.316  1.00 58.79  ? 88   LEU C CD1   1 
ATOM   4206  C  CD2   . LEU C  2  88   ? 85.928  -7.176  73.402  1.00 63.45  ? 88   LEU C CD2   1 
ATOM   4207  N  N     . THR C  2  89   ? 81.872  -10.139 73.398  1.00 52.10  ? 89   THR C N     1 
ATOM   4208  C  CA    . THR C  2  89   ? 81.150  -11.392 73.497  1.00 50.84  ? 89   THR C CA    1 
ATOM   4209  C  C     . THR C  2  89   ? 82.068  -12.384 74.195  1.00 52.29  ? 89   THR C C     1 
ATOM   4210  O  O     . THR C  2  89   ? 83.277  -12.375 73.971  1.00 55.23  ? 89   THR C O     1 
ATOM   4211  C  CB    . THR C  2  89   ? 80.764  -11.937 72.111  1.00 55.30  ? 89   THR C CB    1 
ATOM   4212  O  OG1   . THR C  2  89   ? 80.012  -10.948 71.398  1.00 60.51  ? 89   THR C OG1   1 
ATOM   4213  C  CG2   . THR C  2  89   ? 79.928  -13.200 72.250  1.00 51.35  ? 89   THR C CG2   1 
ATOM   4214  N  N     . TYR C  2  90   ? 81.502  -13.246 75.031  1.00 54.51  ? 90   TYR C N     1 
ATOM   4215  C  CA    . TYR C  2  90   ? 82.294  -14.293 75.655  1.00 50.01  ? 90   TYR C CA    1 
ATOM   4216  C  C     . TYR C  2  90   ? 82.185  -15.474 74.714  1.00 49.75  ? 90   TYR C C     1 
ATOM   4217  O  O     . TYR C  2  90   ? 81.085  -15.956 74.447  1.00 44.25  ? 90   TYR C O     1 
ATOM   4218  C  CB    . TYR C  2  90   ? 81.723  -14.647 77.027  1.00 46.63  ? 90   TYR C CB    1 
ATOM   4219  C  CG    . TYR C  2  90   ? 82.473  -15.742 77.750  1.00 51.24  ? 90   TYR C CG    1 
ATOM   4220  C  CD1   . TYR C  2  90   ? 83.837  -15.640 77.984  1.00 61.03  ? 90   TYR C CD1   1 
ATOM   4221  C  CD2   . TYR C  2  90   ? 81.815  -16.877 78.203  1.00 49.72  ? 90   TYR C CD2   1 
ATOM   4222  C  CE1   . TYR C  2  90   ? 84.525  -16.638 78.646  1.00 60.87  ? 90   TYR C CE1   1 
ATOM   4223  C  CE2   . TYR C  2  90   ? 82.494  -17.881 78.866  1.00 46.57  ? 90   TYR C CE2   1 
ATOM   4224  C  CZ    . TYR C  2  90   ? 83.849  -17.756 79.085  1.00 51.10  ? 90   TYR C CZ    1 
ATOM   4225  O  OH    . TYR C  2  90   ? 84.529  -18.754 79.745  1.00 50.65  ? 90   TYR C OH    1 
ATOM   4226  N  N     . GLN C  2  91   ? 83.315  -15.935 74.189  1.00 53.78  ? 91   GLN C N     1 
ATOM   4227  C  CA    . GLN C  2  91   ? 83.249  -16.911 73.116  1.00 48.59  ? 91   GLN C CA    1 
ATOM   4228  C  C     . GLN C  2  91   ? 84.512  -17.760 73.043  1.00 50.07  ? 91   GLN C C     1 
ATOM   4229  O  O     . GLN C  2  91   ? 85.537  -17.413 73.623  1.00 53.58  ? 91   GLN C O     1 
ATOM   4230  C  CB    . GLN C  2  91   ? 83.048  -16.176 71.798  1.00 51.97  ? 91   GLN C CB    1 
ATOM   4231  C  CG    . GLN C  2  91   ? 83.972  -14.977 71.642  1.00 55.72  ? 91   GLN C CG    1 
ATOM   4232  C  CD    . GLN C  2  91   ? 83.645  -14.136 70.427  1.00 57.44  ? 91   GLN C CD    1 
ATOM   4233  O  OE1   . GLN C  2  91   ? 82.558  -14.243 69.857  1.00 55.43  ? 91   GLN C OE1   1 
ATOM   4234  N  NE2   . GLN C  2  91   ? 84.589  -13.296 70.019  1.00 59.32  ? 91   GLN C NE2   1 
ATOM   4235  N  N     . ALA C  2  92   ? 84.429  -18.875 72.320  1.00 53.08  ? 92   ALA C N     1 
ATOM   4236  C  CA    . ALA C  2  92   ? 85.573  -19.760 72.113  1.00 49.47  ? 92   ALA C CA    1 
ATOM   4237  C  C     . ALA C  2  92   ? 85.890  -19.877 70.628  1.00 48.38  ? 92   ALA C C     1 
ATOM   4238  O  O     . ALA C  2  92   ? 84.980  -19.967 69.810  1.00 46.21  ? 92   ALA C O     1 
ATOM   4239  C  CB    . ALA C  2  92   ? 85.287  -21.133 72.694  1.00 49.09  ? 92   ALA C CB    1 
ATOM   4240  N  N     . PRO C  2  93   ? 87.186  -19.883 70.273  1.00 53.59  ? 93   PRO C N     1 
ATOM   4241  C  CA    . PRO C  2  93   ? 87.588  -19.996 68.867  1.00 51.75  ? 93   PRO C CA    1 
ATOM   4242  C  C     . PRO C  2  93   ? 87.240  -21.357 68.278  1.00 47.51  ? 93   PRO C C     1 
ATOM   4243  O  O     . PRO C  2  93   ? 87.547  -22.387 68.873  1.00 49.62  ? 93   PRO C O     1 
ATOM   4244  C  CB    . PRO C  2  93   ? 89.105  -19.817 68.926  1.00 49.96  ? 93   PRO C CB    1 
ATOM   4245  C  CG    . PRO C  2  93   ? 89.479  -20.249 70.289  1.00 49.75  ? 93   PRO C CG    1 
ATOM   4246  C  CD    . PRO C  2  93   ? 88.351  -19.809 71.169  1.00 49.93  ? 93   PRO C CD    1 
ATOM   4247  N  N     . LEU C  2  94   ? 86.598  -21.353 67.117  1.00 49.33  ? 94   LEU C N     1 
ATOM   4248  C  CA    . LEU C  2  94   ? 86.226  -22.589 66.445  1.00 53.95  ? 94   LEU C CA    1 
ATOM   4249  C  C     . LEU C  2  94   ? 87.158  -22.858 65.279  1.00 53.67  ? 94   LEU C C     1 
ATOM   4250  O  O     . LEU C  2  94   ? 87.283  -22.036 64.374  1.00 51.17  ? 94   LEU C O     1 
ATOM   4251  C  CB    . LEU C  2  94   ? 84.789  -22.510 65.933  1.00 49.22  ? 94   LEU C CB    1 
ATOM   4252  C  CG    . LEU C  2  94   ? 84.301  -23.698 65.103  1.00 46.75  ? 94   LEU C CG    1 
ATOM   4253  C  CD1   . LEU C  2  94   ? 84.287  -24.971 65.934  1.00 49.72  ? 94   LEU C CD1   1 
ATOM   4254  C  CD2   . LEU C  2  94   ? 82.923  -23.417 64.547  1.00 48.50  ? 94   LEU C CD2   1 
ATOM   4255  N  N     . TYR C  2  95   ? 87.816  -24.010 65.305  1.00 52.69  ? 95   TYR C N     1 
ATOM   4256  C  CA    . TYR C  2  95   ? 88.654  -24.426 64.195  1.00 53.40  ? 95   TYR C CA    1 
ATOM   4257  C  C     . TYR C  2  95   ? 88.038  -25.657 63.545  1.00 53.25  ? 95   TYR C C     1 
ATOM   4258  O  O     . TYR C  2  95   ? 87.371  -26.450 64.206  1.00 52.44  ? 95   TYR C O     1 
ATOM   4259  C  CB    . TYR C  2  95   ? 90.070  -24.737 64.678  1.00 56.46  ? 95   TYR C CB    1 
ATOM   4260  C  CG    . TYR C  2  95   ? 90.758  -23.591 65.394  1.00 54.29  ? 95   TYR C CG    1 
ATOM   4261  C  CD1   . TYR C  2  95   ? 90.682  -23.460 66.772  1.00 47.13  ? 95   TYR C CD1   1 
ATOM   4262  C  CD2   . TYR C  2  95   ? 91.489  -22.645 64.690  1.00 53.83  ? 95   TYR C CD2   1 
ATOM   4263  C  CE1   . TYR C  2  95   ? 91.314  -22.420 67.425  1.00 49.17  ? 95   TYR C CE1   1 
ATOM   4264  C  CE2   . TYR C  2  95   ? 92.120  -21.600 65.335  1.00 49.33  ? 95   TYR C CE2   1 
ATOM   4265  C  CZ    . TYR C  2  95   ? 92.031  -21.491 66.702  1.00 52.58  ? 95   TYR C CZ    1 
ATOM   4266  O  OH    . TYR C  2  95   ? 92.665  -20.446 67.341  1.00 59.21  ? 95   TYR C OH    1 
ATOM   4267  N  N     . ALA C  2  96   ? 88.256  -25.808 62.247  1.00 53.12  ? 96   ALA C N     1 
ATOM   4268  C  CA    . ALA C  2  96   ? 87.782  -26.979 61.525  1.00 52.57  ? 96   ALA C CA    1 
ATOM   4269  C  C     . ALA C  2  96   ? 88.898  -27.566 60.674  1.00 58.47  ? 96   ALA C C     1 
ATOM   4270  O  O     . ALA C  2  96   ? 89.485  -26.879 59.839  1.00 62.41  ? 96   ALA C O     1 
ATOM   4271  C  CB    . ALA C  2  96   ? 86.584  -26.630 60.661  1.00 51.44  ? 96   ALA C CB    1 
ATOM   4272  N  N     . ARG C  2  97   ? 89.192  -28.839 60.899  1.00 60.11  ? 97   ARG C N     1 
ATOM   4273  C  CA    . ARG C  2  97   ? 90.160  -29.550 60.084  1.00 62.73  ? 97   ARG C CA    1 
ATOM   4274  C  C     . ARG C  2  97   ? 89.487  -30.055 58.813  1.00 57.50  ? 97   ARG C C     1 
ATOM   4275  O  O     . ARG C  2  97   ? 88.601  -30.910 58.854  1.00 53.05  ? 97   ARG C O     1 
ATOM   4276  C  CB    . ARG C  2  97   ? 90.784  -30.711 60.862  1.00 66.85  ? 97   ARG C CB    1 
ATOM   4277  C  CG    . ARG C  2  97   ? 92.124  -31.149 60.302  1.00 78.54  ? 97   ARG C CG    1 
ATOM   4278  C  CD    . ARG C  2  97   ? 92.449  -32.591 60.634  1.00 82.07  ? 97   ARG C CD    1 
ATOM   4279  N  NE    . ARG C  2  97   ? 92.902  -32.768 62.009  1.00 92.03  ? 97   ARG C NE    1 
ATOM   4280  C  CZ    . ARG C  2  97   ? 93.430  -33.896 62.474  1.00 94.59  ? 97   ARG C CZ    1 
ATOM   4281  N  NH1   . ARG C  2  97   ? 93.575  -34.943 61.668  1.00 89.28  ? 97   ARG C NH1   1 
ATOM   4282  N  NH2   . ARG C  2  97   ? 93.818  -33.979 63.742  1.00 87.91  ? 97   ARG C NH2   1 
ATOM   4283  N  N     . LEU C  2  98   ? 89.922  -29.509 57.684  1.00 61.68  ? 98   LEU C N     1 
ATOM   4284  C  CA    . LEU C  2  98   ? 89.366  -29.850 56.385  1.00 65.10  ? 98   LEU C CA    1 
ATOM   4285  C  C     . LEU C  2  98   ? 90.445  -30.400 55.455  1.00 70.80  ? 98   LEU C C     1 
ATOM   4286  O  O     . LEU C  2  98   ? 91.597  -29.970 55.511  1.00 74.76  ? 98   LEU C O     1 
ATOM   4287  C  CB    . LEU C  2  98   ? 88.737  -28.611 55.752  1.00 61.26  ? 98   LEU C CB    1 
ATOM   4288  C  CG    . LEU C  2  98   ? 87.626  -27.906 56.523  1.00 54.42  ? 98   LEU C CG    1 
ATOM   4289  C  CD1   . LEU C  2  98   ? 87.299  -26.584 55.857  1.00 42.65  ? 98   LEU C CD1   1 
ATOM   4290  C  CD2   . LEU C  2  98   ? 86.392  -28.795 56.619  1.00 59.07  ? 98   LEU C CD2   1 
ATOM   4291  N  N     . GLN C  2  99   ? 90.070  -31.348 54.599  1.00 75.17  ? 99   GLN C N     1 
ATOM   4292  C  CA    . GLN C  2  99   ? 90.987  -31.865 53.586  1.00 80.98  ? 99   GLN C CA    1 
ATOM   4293  C  C     . GLN C  2  99   ? 90.430  -31.674 52.177  1.00 80.46  ? 99   GLN C C     1 
ATOM   4294  O  O     . GLN C  2  99   ? 89.349  -32.161 51.850  1.00 73.43  ? 99   GLN C O     1 
ATOM   4295  C  CB    . GLN C  2  99   ? 91.325  -33.339 53.841  1.00 80.57  ? 99   GLN C CB    1 
ATOM   4296  C  CG    . GLN C  2  99   ? 90.175  -34.307 53.613  1.00 79.33  ? 99   GLN C CG    1 
ATOM   4297  C  CD    . GLN C  2  99   ? 90.542  -35.739 53.962  1.00 86.71  ? 99   GLN C CD    1 
ATOM   4298  O  OE1   . GLN C  2  99   ? 91.582  -35.995 54.571  1.00 79.59  ? 99   GLN C OE1   1 
ATOM   4299  N  NE2   . GLN C  2  99   ? 89.688  -36.682 53.574  1.00 93.85  ? 99   GLN C NE2   1 
ATOM   4300  N  N     . LEU C  2  100  ? 91.178  -30.950 51.351  1.00 87.12  ? 100  LEU C N     1 
ATOM   4301  C  CA    . LEU C  2  100  ? 90.821  -30.761 49.949  1.00 91.10  ? 100  LEU C CA    1 
ATOM   4302  C  C     . LEU C  2  100  ? 91.326  -31.923 49.104  1.00 91.00  ? 100  LEU C C     1 
ATOM   4303  O  O     . LEU C  2  100  ? 92.505  -32.263 49.151  1.00 96.33  ? 100  LEU C O     1 
ATOM   4304  C  CB    . LEU C  2  100  ? 91.400  -29.451 49.417  1.00 89.98  ? 100  LEU C CB    1 
ATOM   4305  C  CG    . LEU C  2  100  ? 91.079  -29.171 47.950  1.00 83.59  ? 100  LEU C CG    1 
ATOM   4306  C  CD1   . LEU C  2  100  ? 89.592  -29.351 47.698  1.00 84.90  ? 100  LEU C CD1   1 
ATOM   4307  C  CD2   . LEU C  2  100  ? 91.530  -27.773 47.564  1.00 86.43  ? 100  LEU C CD2   1 
ATOM   4308  N  N     . ILE C  2  101  ? 90.415  -32.569 48.391  1.00 89.41  ? 101  ILE C N     1 
ATOM   4309  C  CA    . ILE C  2  101  ? 90.761  -33.765 47.644  1.00 92.22  ? 101  ILE C CA    1 
ATOM   4310  C  C     . ILE C  2  101  ? 90.495  -33.586 46.162  1.00 102.03 ? 101  ILE C C     1 
ATOM   4311  O  O     . ILE C  2  101  ? 89.419  -33.141 45.763  1.00 102.23 ? 101  ILE C O     1 
ATOM   4312  C  CB    . ILE C  2  101  ? 89.975  -34.990 48.148  1.00 94.41  ? 101  ILE C CB    1 
ATOM   4313  C  CG1   . ILE C  2  101  ? 90.317  -35.279 49.610  1.00 103.59 ? 101  ILE C CG1   1 
ATOM   4314  C  CG2   . ILE C  2  101  ? 90.264  -36.202 47.277  1.00 91.38  ? 101  ILE C CG2   1 
ATOM   4315  C  CD1   . ILE C  2  101  ? 89.367  -36.248 50.279  1.00 96.80  ? 101  ILE C CD1   1 
ATOM   4316  N  N     . HIS C  2  102  ? 91.476  -33.950 45.348  1.00 118.27 ? 102  HIS C N     1 
ATOM   4317  C  CA    . HIS C  2  102  ? 91.288  -33.944 43.921  1.00 116.73 ? 102  HIS C CA    1 
ATOM   4318  C  C     . HIS C  2  102  ? 91.056  -35.359 43.509  1.00 122.41 ? 102  HIS C C     1 
ATOM   4319  O  O     . HIS C  2  102  ? 91.920  -36.239 43.713  1.00 123.47 ? 102  HIS C O     1 
ATOM   4320  C  CB    . HIS C  2  102  ? 92.514  -33.380 43.218  1.00 119.28 ? 102  HIS C CB    1 
ATOM   4321  C  CG    . HIS C  2  102  ? 92.197  -32.627 41.949  1.00 128.73 ? 102  HIS C CG    1 
ATOM   4322  N  ND1   . HIS C  2  102  ? 91.328  -33.088 41.032  1.00 128.45 ? 102  HIS C ND1   1 
ATOM   4323  C  CD2   . HIS C  2  102  ? 92.668  -31.407 41.466  1.00 132.30 ? 102  HIS C CD2   1 
ATOM   4324  C  CE1   . HIS C  2  102  ? 91.244  -32.212 40.013  1.00 129.89 ? 102  HIS C CE1   1 
ATOM   4325  N  NE2   . HIS C  2  102  ? 92.065  -31.184 40.280  1.00 131.63 ? 102  HIS C NE2   1 
ATOM   4326  N  N     . LYS C  2  103  ? 89.888  -35.608 42.924  1.00 123.76 ? 103  LYS C N     1 
ATOM   4327  C  CA    . LYS C  2  103  ? 89.510  -36.956 42.527  1.00 125.42 ? 103  LYS C CA    1 
ATOM   4328  C  C     . LYS C  2  103  ? 90.069  -37.295 41.153  1.00 134.94 ? 103  LYS C C     1 
ATOM   4329  O  O     . LYS C  2  103  ? 89.817  -36.600 40.169  1.00 136.29 ? 103  LYS C O     1 
ATOM   4330  C  CB    . LYS C  2  103  ? 87.988  -37.107 42.528  1.00 122.89 ? 103  LYS C CB    1 
ATOM   4331  C  CG    . LYS C  2  103  ? 87.244  -35.890 43.053  1.00 113.89 ? 103  LYS C CG    1 
ATOM   4332  C  CD    . LYS C  2  103  ? 86.311  -35.316 41.999  1.00 112.18 ? 103  LYS C CD    1 
ATOM   4333  C  CE    . LYS C  2  103  ? 87.011  -34.262 41.157  1.00 111.89 ? 103  LYS C CE    1 
ATOM   4334  N  NZ    . LYS C  2  103  ? 86.867  -32.899 41.739  1.00 107.40 ? 103  LYS C NZ    1 
ATOM   4335  N  N     . ASP C  2  104  ? 90.835  -38.377 41.108  1.00 136.94 ? 104  ASP C N     1 
ATOM   4336  C  CA    . ASP C  2  104  ? 91.475  -38.846 39.889  1.00 143.61 ? 104  ASP C CA    1 
ATOM   4337  C  C     . ASP C  2  104  ? 92.812  -38.139 39.727  1.00 140.19 ? 104  ASP C C     1 
ATOM   4338  O  O     . ASP C  2  104  ? 93.620  -38.500 38.871  1.00 143.08 ? 104  ASP C O     1 
ATOM   4339  C  CB    . ASP C  2  104  ? 90.582  -38.582 38.676  1.00 148.69 ? 104  ASP C CB    1 
ATOM   4340  C  CG    . ASP C  2  104  ? 89.659  -39.744 38.367  1.00 147.63 ? 104  ASP C CG    1 
ATOM   4341  O  OD1   . ASP C  2  104  ? 90.163  -40.872 38.181  1.00 140.41 ? 104  ASP C OD1   1 
ATOM   4342  O  OD2   . ASP C  2  104  ? 88.430  -39.531 38.312  1.00 148.57 ? 104  ASP C OD2   1 
ATOM   4343  N  N     . THR C  2  105  ? 92.993  -37.080 40.513  1.00 132.61 ? 105  THR C N     1 
ATOM   4344  C  CA    . THR C  2  105  ? 94.268  -36.384 40.617  1.00 129.59 ? 105  THR C CA    1 
ATOM   4345  C  C     . THR C  2  105  ? 95.063  -36.905 41.810  1.00 131.04 ? 105  THR C C     1 
ATOM   4346  O  O     . THR C  2  105  ? 96.210  -36.514 42.023  1.00 127.59 ? 105  THR C O     1 
ATOM   4347  C  CB    . THR C  2  105  ? 94.074  -34.864 40.763  1.00 130.26 ? 105  THR C CB    1 
ATOM   4348  O  OG1   . THR C  2  105  ? 94.576  -34.201 39.596  1.00 118.40 ? 105  THR C OG1   1 
ATOM   4349  C  CG2   . THR C  2  105  ? 94.813  -34.349 41.989  1.00 125.08 ? 105  THR C CG2   1 
ATOM   4350  N  N     . GLY C  2  106  ? 94.446  -37.794 42.585  1.00 134.60 ? 106  GLY C N     1 
ATOM   4351  C  CA    . GLY C  2  106  ? 95.107  -38.401 43.726  1.00 135.26 ? 106  GLY C CA    1 
ATOM   4352  C  C     . GLY C  2  106  ? 95.277  -37.524 44.956  1.00 132.22 ? 106  GLY C C     1 
ATOM   4353  O  O     . GLY C  2  106  ? 94.911  -37.915 46.064  1.00 122.58 ? 106  GLY C O     1 
ATOM   4354  N  N     . LEU C  2  107  ? 95.853  -36.342 44.760  1.00 131.26 ? 107  LEU C N     1 
ATOM   4355  C  CA    . LEU C  2  107  ? 96.339  -35.505 45.856  1.00 128.19 ? 107  LEU C CA    1 
ATOM   4356  C  C     . LEU C  2  107  ? 95.307  -34.977 46.862  1.00 120.69 ? 107  LEU C C     1 
ATOM   4357  O  O     . LEU C  2  107  ? 94.195  -34.588 46.506  1.00 112.68 ? 107  LEU C O     1 
ATOM   4358  C  CB    . LEU C  2  107  ? 97.151  -34.331 45.297  1.00 120.88 ? 107  LEU C CB    1 
ATOM   4359  C  CG    . LEU C  2  107  ? 96.643  -32.931 45.645  1.00 121.88 ? 107  LEU C CG    1 
ATOM   4360  C  CD1   . LEU C  2  107  ? 97.445  -32.338 46.793  1.00 123.61 ? 107  LEU C CD1   1 
ATOM   4361  C  CD2   . LEU C  2  107  ? 96.692  -32.023 44.426  1.00 119.44 ? 107  LEU C CD2   1 
ATOM   4362  N  N     . ILE C  2  108  ? 95.726  -34.971 48.125  1.00 114.38 ? 108  ILE C N     1 
ATOM   4363  C  CA    . ILE C  2  108  ? 95.023  -34.354 49.242  1.00 108.43 ? 108  ILE C CA    1 
ATOM   4364  C  C     . ILE C  2  108  ? 95.855  -33.258 49.900  1.00 105.85 ? 108  ILE C C     1 
ATOM   4365  O  O     . ILE C  2  108  ? 97.030  -33.458 50.207  1.00 110.06 ? 108  ILE C O     1 
ATOM   4366  C  CB    . ILE C  2  108  ? 94.634  -35.397 50.306  1.00 111.61 ? 108  ILE C CB    1 
ATOM   4367  C  CG1   . ILE C  2  108  ? 95.833  -35.718 51.201  1.00 115.03 ? 108  ILE C CG1   1 
ATOM   4368  C  CG2   . ILE C  2  108  ? 94.105  -36.660 49.646  1.00 109.25 ? 108  ILE C CG2   1 
ATOM   4369  C  CD1   . ILE C  2  108  ? 96.269  -34.562 52.075  1.00 109.46 ? 108  ILE C CD1   1 
ATOM   4370  N  N     . LYS C  2  109  ? 95.235  -32.105 50.121  1.00 103.91 ? 109  LYS C N     1 
ATOM   4371  C  CA    . LYS C  2  109  ? 95.872  -31.013 50.852  1.00 102.46 ? 109  LYS C CA    1 
ATOM   4372  C  C     . LYS C  2  109  ? 95.020  -30.671 52.078  1.00 94.43  ? 109  LYS C C     1 
ATOM   4373  O  O     . LYS C  2  109  ? 93.896  -30.189 51.955  1.00 93.30  ? 109  LYS C O     1 
ATOM   4374  C  CB    . LYS C  2  109  ? 96.072  -29.789 49.952  1.00 96.79  ? 109  LYS C CB    1 
ATOM   4375  C  CG    . LYS C  2  109  ? 96.570  -28.545 50.682  1.00 97.44  ? 109  LYS C CG    1 
ATOM   4376  C  CD    . LYS C  2  109  ? 97.912  -28.785 51.361  1.00 105.64 ? 109  LYS C CD    1 
ATOM   4377  C  CE    . LYS C  2  109  ? 98.386  -27.549 52.123  1.00 101.35 ? 109  LYS C CE    1 
ATOM   4378  N  NZ    . LYS C  2  109  ? 97.500  -27.202 53.272  1.00 91.57  ? 109  LYS C NZ    1 
ATOM   4379  N  N     . GLU C  2  110  ? 95.563  -30.930 53.262  1.00 89.67  ? 110  GLU C N     1 
ATOM   4380  C  CA    . GLU C  2  110  ? 94.794  -30.842 54.495  1.00 79.20  ? 110  GLU C CA    1 
ATOM   4381  C  C     . GLU C  2  110  ? 95.254  -29.694 55.386  1.00 77.80  ? 110  GLU C C     1 
ATOM   4382  O  O     . GLU C  2  110  ? 96.448  -29.440 55.523  1.00 83.23  ? 110  GLU C O     1 
ATOM   4383  C  CB    . GLU C  2  110  ? 94.886  -32.171 55.240  1.00 83.06  ? 110  GLU C CB    1 
ATOM   4384  C  CG    . GLU C  2  110  ? 94.339  -32.162 56.650  1.00 87.72  ? 110  GLU C CG    1 
ATOM   4385  C  CD    . GLU C  2  110  ? 94.312  -33.554 57.251  1.00 92.94  ? 110  GLU C CD    1 
ATOM   4386  O  OE1   . GLU C  2  110  ? 94.361  -33.673 58.495  1.00 88.00  ? 110  GLU C OE1   1 
ATOM   4387  O  OE2   . GLU C  2  110  ? 94.240  -34.529 56.472  1.00 96.51  ? 110  GLU C OE2   1 
ATOM   4388  N  N     . ASP C  2  111  ? 94.298  -29.002 55.993  1.00 78.37  ? 111  ASP C N     1 
ATOM   4389  C  CA    . ASP C  2  111  ? 94.609  -27.840 56.819  1.00 81.06  ? 111  ASP C CA    1 
ATOM   4390  C  C     . ASP C  2  111  ? 93.518  -27.583 57.867  1.00 72.64  ? 111  ASP C C     1 
ATOM   4391  O  O     . ASP C  2  111  ? 92.365  -27.961 57.678  1.00 70.12  ? 111  ASP C O     1 
ATOM   4392  C  CB    . ASP C  2  111  ? 94.811  -26.610 55.924  1.00 79.46  ? 111  ASP C CB    1 
ATOM   4393  C  CG    . ASP C  2  111  ? 95.325  -25.402 56.687  1.00 89.23  ? 111  ASP C CG    1 
ATOM   4394  O  OD1   . ASP C  2  111  ? 95.277  -24.283 56.130  1.00 88.84  ? 111  ASP C OD1   1 
ATOM   4395  O  OD2   . ASP C  2  111  ? 95.776  -25.567 57.842  1.00 92.22  ? 111  ASP C OD2   1 
ATOM   4396  N  N     . GLU C  2  112  ? 93.890  -26.953 58.977  1.00 69.71  ? 112  GLU C N     1 
ATOM   4397  C  CA    . GLU C  2  112  ? 92.918  -26.579 59.999  1.00 62.23  ? 112  GLU C CA    1 
ATOM   4398  C  C     . GLU C  2  112  ? 92.600  -25.100 59.877  1.00 64.29  ? 112  GLU C C     1 
ATOM   4399  O  O     . GLU C  2  112  ? 93.399  -24.245 60.272  1.00 64.00  ? 112  GLU C O     1 
ATOM   4400  C  CB    . GLU C  2  112  ? 93.447  -26.872 61.401  1.00 57.02  ? 112  GLU C CB    1 
ATOM   4401  C  CG    . GLU C  2  112  ? 92.366  -26.950 62.458  1.00 59.77  ? 112  GLU C CG    1 
ATOM   4402  C  CD    . GLU C  2  112  ? 92.904  -26.788 63.869  1.00 65.43  ? 112  GLU C CD    1 
ATOM   4403  O  OE1   . GLU C  2  112  ? 93.790  -25.926 64.069  1.00 59.77  ? 112  GLU C OE1   1 
ATOM   4404  O  OE2   . GLU C  2  112  ? 92.438  -27.520 64.775  1.00 59.28  ? 112  GLU C OE2   1 
ATOM   4405  N  N     . VAL C  2  113  ? 91.427  -24.803 59.331  1.00 60.57  ? 113  VAL C N     1 
ATOM   4406  C  CA    . VAL C  2  113  ? 91.019  -23.426 59.103  1.00 62.20  ? 113  VAL C CA    1 
ATOM   4407  C  C     . VAL C  2  113  ? 90.231  -22.839 60.269  1.00 58.01  ? 113  VAL C C     1 
ATOM   4408  O  O     . VAL C  2  113  ? 89.479  -23.531 60.947  1.00 55.64  ? 113  VAL C O     1 
ATOM   4409  C  CB    . VAL C  2  113  ? 90.202  -23.295 57.814  1.00 62.56  ? 113  VAL C CB    1 
ATOM   4410  C  CG1   . VAL C  2  113  ? 91.124  -23.239 56.615  1.00 68.82  ? 113  VAL C CG1   1 
ATOM   4411  C  CG2   . VAL C  2  113  ? 89.240  -24.451 57.694  1.00 63.95  ? 113  VAL C CG2   1 
ATOM   4412  N  N     . PHE C  2  114  ? 90.426  -21.549 60.493  1.00 61.07  ? 114  PHE C N     1 
ATOM   4413  C  CA    . PHE C  2  114  ? 89.780  -20.842 61.583  1.00 56.06  ? 114  PHE C CA    1 
ATOM   4414  C  C     . PHE C  2  114  ? 88.446  -20.287 61.113  1.00 56.83  ? 114  PHE C C     1 
ATOM   4415  O  O     . PHE C  2  114  ? 88.393  -19.525 60.153  1.00 59.12  ? 114  PHE C O     1 
ATOM   4416  C  CB    . PHE C  2  114  ? 90.689  -19.713 62.054  1.00 57.29  ? 114  PHE C CB    1 
ATOM   4417  C  CG    . PHE C  2  114  ? 90.123  -18.906 63.169  1.00 51.99  ? 114  PHE C CG    1 
ATOM   4418  C  CD1   . PHE C  2  114  ? 89.772  -19.504 64.359  1.00 51.38  ? 114  PHE C CD1   1 
ATOM   4419  C  CD2   . PHE C  2  114  ? 89.963  -17.540 63.034  1.00 60.69  ? 114  PHE C CD2   1 
ATOM   4420  C  CE1   . PHE C  2  114  ? 89.254  -18.758 65.393  1.00 60.33  ? 114  PHE C CE1   1 
ATOM   4421  C  CE2   . PHE C  2  114  ? 89.446  -16.785 64.065  1.00 61.02  ? 114  PHE C CE2   1 
ATOM   4422  C  CZ    . PHE C  2  114  ? 89.092  -17.394 65.247  1.00 60.01  ? 114  PHE C CZ    1 
ATOM   4423  N  N     . LEU C  2  115  ? 87.371  -20.676 61.793  1.00 60.20  ? 115  LEU C N     1 
ATOM   4424  C  CA    . LEU C  2  115  ? 86.018  -20.293 61.396  1.00 54.02  ? 115  LEU C CA    1 
ATOM   4425  C  C     . LEU C  2  115  ? 85.442  -19.155 62.234  1.00 56.37  ? 115  LEU C C     1 
ATOM   4426  O  O     . LEU C  2  115  ? 84.260  -18.845 62.127  1.00 64.64  ? 115  LEU C O     1 
ATOM   4427  C  CB    . LEU C  2  115  ? 85.077  -21.494 61.476  1.00 51.23  ? 115  LEU C CB    1 
ATOM   4428  C  CG    . LEU C  2  115  ? 85.490  -22.715 60.667  1.00 50.28  ? 115  LEU C CG    1 
ATOM   4429  C  CD1   . LEU C  2  115  ? 84.471  -23.829 60.813  1.00 47.92  ? 115  LEU C CD1   1 
ATOM   4430  C  CD2   . LEU C  2  115  ? 85.652  -22.330 59.214  1.00 58.58  ? 115  LEU C CD2   1 
ATOM   4431  N  N     . GLY C  2  116  ? 86.271  -18.541 63.069  1.00 54.28  ? 116  GLY C N     1 
ATOM   4432  C  CA    . GLY C  2  116  ? 85.811  -17.475 63.941  1.00 58.44  ? 116  GLY C CA    1 
ATOM   4433  C  C     . GLY C  2  116  ? 85.441  -17.990 65.319  1.00 56.57  ? 116  GLY C C     1 
ATOM   4434  O  O     . GLY C  2  116  ? 85.726  -19.142 65.644  1.00 55.59  ? 116  GLY C O     1 
ATOM   4435  N  N     . HIS C  2  117  ? 84.805  -17.140 66.126  1.00 55.34  ? 117  HIS C N     1 
ATOM   4436  C  CA    . HIS C  2  117  ? 84.429  -17.503 67.496  1.00 54.08  ? 117  HIS C CA    1 
ATOM   4437  C  C     . HIS C  2  117  ? 82.946  -17.844 67.659  1.00 48.07  ? 117  HIS C C     1 
ATOM   4438  O  O     . HIS C  2  117  ? 82.088  -17.282 66.979  1.00 52.51  ? 117  HIS C O     1 
ATOM   4439  C  CB    . HIS C  2  117  ? 84.795  -16.384 68.470  1.00 51.91  ? 117  HIS C CB    1 
ATOM   4440  C  CG    . HIS C  2  117  ? 86.261  -16.116 68.568  1.00 56.93  ? 117  HIS C CG    1 
ATOM   4441  N  ND1   . HIS C  2  117  ? 87.065  -16.712 69.519  1.00 56.88  ? 117  HIS C ND1   1 
ATOM   4442  C  CD2   . HIS C  2  117  ? 87.072  -15.306 67.849  1.00 60.32  ? 117  HIS C CD2   1 
ATOM   4443  C  CE1   . HIS C  2  117  ? 88.307  -16.286 69.373  1.00 57.48  ? 117  HIS C CE1   1 
ATOM   4444  N  NE2   . HIS C  2  117  ? 88.337  -15.431 68.367  1.00 61.51  ? 117  HIS C NE2   1 
ATOM   4445  N  N     . ILE C  2  118  ? 82.662  -18.770 68.572  1.00 48.29  ? 118  ILE C N     1 
ATOM   4446  C  CA    . ILE C  2  118  ? 81.293  -19.152 68.926  1.00 48.68  ? 118  ILE C CA    1 
ATOM   4447  C  C     . ILE C  2  118  ? 81.001  -18.810 70.386  1.00 46.65  ? 118  ILE C C     1 
ATOM   4448  O  O     . ILE C  2  118  ? 81.722  -19.243 71.284  1.00 47.40  ? 118  ILE C O     1 
ATOM   4449  C  CB    . ILE C  2  118  ? 81.047  -20.655 68.720  1.00 44.02  ? 118  ILE C CB    1 
ATOM   4450  C  CG1   . ILE C  2  118  ? 80.810  -20.959 67.246  1.00 48.78  ? 118  ILE C CG1   1 
ATOM   4451  C  CG2   . ILE C  2  118  ? 79.845  -21.109 69.512  1.00 43.97  ? 118  ILE C CG2   1 
ATOM   4452  C  CD1   . ILE C  2  118  ? 80.283  -22.355 67.010  1.00 61.67  ? 118  ILE C CD1   1 
ATOM   4453  N  N     . PRO C  2  119  ? 79.941  -18.024 70.628  1.00 45.21  ? 119  PRO C N     1 
ATOM   4454  C  CA    . PRO C  2  119  ? 79.601  -17.577 71.980  1.00 48.11  ? 119  PRO C CA    1 
ATOM   4455  C  C     . PRO C  2  119  ? 79.428  -18.733 72.962  1.00 48.80  ? 119  PRO C C     1 
ATOM   4456  O  O     . PRO C  2  119  ? 78.836  -19.754 72.619  1.00 46.21  ? 119  PRO C O     1 
ATOM   4457  C  CB    . PRO C  2  119  ? 78.277  -16.844 71.773  1.00 40.84  ? 119  PRO C CB    1 
ATOM   4458  C  CG    . PRO C  2  119  ? 78.356  -16.342 70.395  1.00 45.06  ? 119  PRO C CG    1 
ATOM   4459  C  CD    . PRO C  2  119  ? 79.050  -17.426 69.622  1.00 49.90  ? 119  PRO C CD    1 
ATOM   4460  N  N     . LEU C  2  120  ? 79.952  -18.560 74.173  1.00 47.63  ? 120  LEU C N     1 
ATOM   4461  C  CA    . LEU C  2  120  ? 79.873  -19.577 75.217  1.00 47.15  ? 120  LEU C CA    1 
ATOM   4462  C  C     . LEU C  2  120  ? 78.806  -19.247 76.252  1.00 46.52  ? 120  LEU C C     1 
ATOM   4463  O  O     . LEU C  2  120  ? 78.607  -18.085 76.614  1.00 48.56  ? 120  LEU C O     1 
ATOM   4464  C  CB    . LEU C  2  120  ? 81.221  -19.730 75.925  1.00 48.70  ? 120  LEU C CB    1 
ATOM   4465  C  CG    . LEU C  2  120  ? 82.404  -20.233 75.098  1.00 48.76  ? 120  LEU C CG    1 
ATOM   4466  C  CD1   . LEU C  2  120  ? 83.675  -20.165 75.909  1.00 40.82  ? 120  LEU C CD1   1 
ATOM   4467  C  CD2   . LEU C  2  120  ? 82.150  -21.647 74.610  1.00 44.38  ? 120  LEU C CD2   1 
ATOM   4468  N  N     . MET C  2  121  ? 78.126  -20.283 76.724  1.00 47.36  ? 121  MET C N     1 
ATOM   4469  C  CA    . MET C  2  121  ? 77.154  -20.140 77.795  1.00 48.64  ? 121  MET C CA    1 
ATOM   4470  C  C     . MET C  2  121  ? 77.891  -20.192 79.127  1.00 51.00  ? 121  MET C C     1 
ATOM   4471  O  O     . MET C  2  121  ? 78.841  -20.957 79.287  1.00 51.41  ? 121  MET C O     1 
ATOM   4472  C  CB    . MET C  2  121  ? 76.101  -21.246 77.710  1.00 41.34  ? 121  MET C CB    1 
ATOM   4473  C  CG    . MET C  2  121  ? 75.171  -21.331 78.902  1.00 42.23  ? 121  MET C CG    1 
ATOM   4474  S  SD    . MET C  2  121  ? 73.926  -22.625 78.734  1.00 41.52  ? 121  MET C SD    1 
ATOM   4475  C  CE    . MET C  2  121  ? 72.952  -21.991 77.379  1.00 41.81  ? 121  MET C CE    1 
ATOM   4476  N  N     . THR C  2  122  ? 77.462  -19.363 80.073  1.00 48.33  ? 122  THR C N     1 
ATOM   4477  C  CA    . THR C  2  122  ? 78.110  -19.282 81.377  1.00 48.92  ? 122  THR C CA    1 
ATOM   4478  C  C     . THR C  2  122  ? 77.616  -20.377 82.323  1.00 54.89  ? 122  THR C C     1 
ATOM   4479  O  O     . THR C  2  122  ? 76.795  -21.214 81.942  1.00 57.35  ? 122  THR C O     1 
ATOM   4480  C  CB    . THR C  2  122  ? 77.904  -17.901 82.025  1.00 49.79  ? 122  THR C CB    1 
ATOM   4481  O  OG1   . THR C  2  122  ? 76.511  -17.685 82.259  1.00 56.48  ? 122  THR C OG1   1 
ATOM   4482  C  CG2   . THR C  2  122  ? 78.424  -16.804 81.115  1.00 43.52  ? 122  THR C CG2   1 
ATOM   4483  N  N     . GLU C  2  123  ? 78.118  -20.376 83.553  1.00 51.20  ? 123  GLU C N     1 
ATOM   4484  C  CA    . GLU C  2  123  ? 77.802  -21.453 84.479  1.00 60.42  ? 123  GLU C CA    1 
ATOM   4485  C  C     . GLU C  2  123  ? 76.308  -21.547 84.749  1.00 62.03  ? 123  GLU C C     1 
ATOM   4486  O  O     . GLU C  2  123  ? 75.762  -22.639 84.918  1.00 60.50  ? 123  GLU C O     1 
ATOM   4487  C  CB    . GLU C  2  123  ? 78.548  -21.268 85.798  1.00 76.25  ? 123  GLU C CB    1 
ATOM   4488  C  CG    . GLU C  2  123  ? 80.057  -21.395 85.693  1.00 87.76  ? 123  GLU C CG    1 
ATOM   4489  C  CD    . GLU C  2  123  ? 80.715  -21.561 87.051  1.00 95.42  ? 123  GLU C CD    1 
ATOM   4490  O  OE1   . GLU C  2  123  ? 80.012  -21.946 88.011  1.00 80.66  ? 123  GLU C OE1   1 
ATOM   4491  O  OE2   . GLU C  2  123  ? 81.934  -21.304 87.156  1.00 108.81 ? 123  GLU C OE2   1 
ATOM   4492  N  N     . ASP C  2  124  ? 75.654  -20.391 84.781  1.00 59.13  ? 124  ASP C N     1 
ATOM   4493  C  CA    . ASP C  2  124  ? 74.260  -20.300 85.190  1.00 53.66  ? 124  ASP C CA    1 
ATOM   4494  C  C     . ASP C  2  124  ? 73.271  -20.368 84.027  1.00 57.25  ? 124  ASP C C     1 
ATOM   4495  O  O     . ASP C  2  124  ? 72.060  -20.345 84.238  1.00 65.99  ? 124  ASP C O     1 
ATOM   4496  C  CB    . ASP C  2  124  ? 74.035  -19.011 85.975  1.00 54.68  ? 124  ASP C CB    1 
ATOM   4497  C  CG    . ASP C  2  124  ? 74.242  -17.773 85.129  1.00 58.48  ? 124  ASP C CG    1 
ATOM   4498  O  OD1   . ASP C  2  124  ? 75.162  -17.780 84.288  1.00 64.88  ? 124  ASP C OD1   1 
ATOM   4499  O  OD2   . ASP C  2  124  ? 73.484  -16.795 85.300  1.00 56.79  ? 124  ASP C OD2   1 
ATOM   4500  N  N     . GLY C  2  125  ? 73.777  -20.443 82.804  1.00 50.95  ? 125  GLY C N     1 
ATOM   4501  C  CA    . GLY C  2  125  ? 72.911  -20.648 81.660  1.00 49.42  ? 125  GLY C CA    1 
ATOM   4502  C  C     . GLY C  2  125  ? 72.677  -19.425 80.797  1.00 51.40  ? 125  GLY C C     1 
ATOM   4503  O  O     . GLY C  2  125  ? 71.822  -19.438 79.905  1.00 46.15  ? 125  GLY C O     1 
ATOM   4504  N  N     . SER C  2  126  ? 73.441  -18.366 81.039  1.00 50.03  ? 126  SER C N     1 
ATOM   4505  C  CA    . SER C  2  126  ? 73.296  -17.162 80.232  1.00 45.22  ? 126  SER C CA    1 
ATOM   4506  C  C     . SER C  2  126  ? 74.465  -16.950 79.284  1.00 42.26  ? 126  SER C C     1 
ATOM   4507  O  O     . SER C  2  126  ? 75.388  -17.751 79.229  1.00 45.86  ? 126  SER C O     1 
ATOM   4508  C  CB    . SER C  2  126  ? 73.088  -15.928 81.113  1.00 49.74  ? 126  SER C CB    1 
ATOM   4509  O  OG    . SER C  2  126  ? 74.222  -15.659 81.904  1.00 48.08  ? 126  SER C OG    1 
ATOM   4510  N  N     . PHE C  2  127  ? 74.397  -15.865 78.525  1.00 44.92  ? 127  PHE C N     1 
ATOM   4511  C  CA    . PHE C  2  127  ? 75.444  -15.497 77.593  1.00 43.98  ? 127  PHE C CA    1 
ATOM   4512  C  C     . PHE C  2  127  ? 75.909  -14.082 77.877  1.00 47.31  ? 127  PHE C C     1 
ATOM   4513  O  O     . PHE C  2  127  ? 75.285  -13.361 78.643  1.00 55.60  ? 127  PHE C O     1 
ATOM   4514  C  CB    . PHE C  2  127  ? 74.940  -15.594 76.153  1.00 41.34  ? 127  PHE C CB    1 
ATOM   4515  C  CG    . PHE C  2  127  ? 74.748  -17.003 75.674  1.00 46.09  ? 127  PHE C CG    1 
ATOM   4516  C  CD1   . PHE C  2  127  ? 73.565  -17.671 75.906  1.00 39.07  ? 127  PHE C CD1   1 
ATOM   4517  C  CD2   . PHE C  2  127  ? 75.755  -17.663 74.992  1.00 47.16  ? 127  PHE C CD2   1 
ATOM   4518  C  CE1   . PHE C  2  127  ? 73.388  -18.969 75.467  1.00 40.56  ? 127  PHE C CE1   1 
ATOM   4519  C  CE2   . PHE C  2  127  ? 75.580  -18.962 74.558  1.00 40.50  ? 127  PHE C CE2   1 
ATOM   4520  C  CZ    . PHE C  2  127  ? 74.394  -19.614 74.801  1.00 37.75  ? 127  PHE C CZ    1 
ATOM   4521  N  N     . ILE C  2  128  ? 77.085  -13.768 77.360  1.00 47.99  ? 128  ILE C N     1 
ATOM   4522  C  CA    . ILE C  2  128  ? 77.565  -12.414 77.346  1.00 43.71  ? 128  ILE C CA    1 
ATOM   4523  C  C     . ILE C  2  128  ? 77.719  -12.108 75.878  1.00 47.62  ? 128  ILE C C     1 
ATOM   4524  O  O     . ILE C  2  128  ? 78.507  -12.741 75.175  1.00 50.05  ? 128  ILE C O     1 
ATOM   4525  C  CB    . ILE C  2  128  ? 78.926  -12.283 78.050  1.00 49.27  ? 128  ILE C CB    1 
ATOM   4526  C  CG1   . ILE C  2  128  ? 78.860  -12.894 79.451  1.00 44.59  ? 128  ILE C CG1   1 
ATOM   4527  C  CG2   . ILE C  2  128  ? 79.350  -10.825 78.120  1.00 54.79  ? 128  ILE C CG2   1 
ATOM   4528  C  CD1   . ILE C  2  128  ? 80.208  -13.021 80.126  1.00 46.20  ? 128  ILE C CD1   1 
ATOM   4529  N  N     . ILE C  2  129  ? 76.964  -11.126 75.417  1.00 48.38  ? 129  ILE C N     1 
ATOM   4530  C  CA    . ILE C  2  129  ? 77.067  -10.680 74.025  1.00 50.95  ? 129  ILE C CA    1 
ATOM   4531  C  C     . ILE C  2  129  ? 77.316  -9.179  73.976  1.00 56.33  ? 129  ILE C C     1 
ATOM   4532  O  O     . ILE C  2  129  ? 76.440  -8.392  74.332  1.00 64.61  ? 129  ILE C O     1 
ATOM   4533  C  CB    . ILE C  2  129  ? 75.778  -10.971 73.242  1.00 45.56  ? 129  ILE C CB    1 
ATOM   4534  C  CG1   . ILE C  2  129  ? 75.373  -12.441 73.389  1.00 39.98  ? 129  ILE C CG1   1 
ATOM   4535  C  CG2   . ILE C  2  129  ? 75.949  -10.593 71.796  1.00 49.66  ? 129  ILE C CG2   1 
ATOM   4536  C  CD1   . ILE C  2  129  ? 76.444  -13.425 72.987  1.00 49.68  ? 129  ILE C CD1   1 
ATOM   4537  N  N     . ASN C  2  130  ? 78.508  -8.788  73.535  1.00 59.04  ? 130  ASN C N     1 
ATOM   4538  C  CA    . ASN C  2  130  ? 78.924  -7.386  73.572  1.00 62.22  ? 130  ASN C CA    1 
ATOM   4539  C  C     . ASN C  2  130  ? 78.837  -6.737  74.955  1.00 61.79  ? 130  ASN C C     1 
ATOM   4540  O  O     . ASN C  2  130  ? 78.450  -5.575  75.079  1.00 63.08  ? 130  ASN C O     1 
ATOM   4541  C  CB    . ASN C  2  130  ? 78.151  -6.561  72.544  1.00 55.85  ? 130  ASN C CB    1 
ATOM   4542  C  CG    . ASN C  2  130  ? 78.431  -7.009  71.125  1.00 76.16  ? 130  ASN C CG    1 
ATOM   4543  O  OD1   . ASN C  2  130  ? 77.534  -7.471  70.424  1.00 85.04  ? 130  ASN C OD1   1 
ATOM   4544  N  ND2   . ASN C  2  130  ? 79.690  -6.892  70.700  1.00 77.54  ? 130  ASN C ND2   1 
ATOM   4545  N  N     . GLY C  2  131  ? 79.201  -7.491  75.987  1.00 54.78  ? 131  GLY C N     1 
ATOM   4546  C  CA    . GLY C  2  131  ? 79.274  -6.947  77.329  1.00 58.57  ? 131  GLY C CA    1 
ATOM   4547  C  C     . GLY C  2  131  ? 77.993  -7.000  78.139  1.00 67.98  ? 131  GLY C C     1 
ATOM   4548  O  O     . GLY C  2  131  ? 78.016  -6.724  79.338  1.00 80.59  ? 131  GLY C O     1 
ATOM   4549  N  N     . ALA C  2  132  ? 76.881  -7.356  77.501  1.00 50.40  ? 132  ALA C N     1 
ATOM   4550  C  CA    . ALA C  2  132  ? 75.600  -7.399  78.201  1.00 51.85  ? 132  ALA C CA    1 
ATOM   4551  C  C     . ALA C  2  132  ? 75.025  -8.810  78.248  1.00 52.23  ? 132  ALA C C     1 
ATOM   4552  O  O     . ALA C  2  132  ? 75.007  -9.502  77.238  1.00 52.37  ? 132  ALA C O     1 
ATOM   4553  C  CB    . ALA C  2  132  ? 74.620  -6.455  77.543  1.00 58.59  ? 132  ALA C CB    1 
ATOM   4554  N  N     . ASP C  2  133  ? 74.563  -9.232  79.421  1.00 49.70  ? 133  ASP C N     1 
ATOM   4555  C  CA    . ASP C  2  133  ? 74.048  -10.587 79.598  1.00 44.40  ? 133  ASP C CA    1 
ATOM   4556  C  C     . ASP C  2  133  ? 72.791  -10.847 78.771  1.00 47.60  ? 133  ASP C C     1 
ATOM   4557  O  O     . ASP C  2  133  ? 71.928  -9.979  78.645  1.00 45.97  ? 133  ASP C O     1 
ATOM   4558  C  CB    . ASP C  2  133  ? 73.772  -10.866 81.077  1.00 56.70  ? 133  ASP C CB    1 
ATOM   4559  C  CG    . ASP C  2  133  ? 75.033  -11.184 81.854  1.00 65.40  ? 133  ASP C CG    1 
ATOM   4560  O  OD1   . ASP C  2  133  ? 75.196  -12.348 82.276  1.00 66.25  ? 133  ASP C OD1   1 
ATOM   4561  O  OD2   . ASP C  2  133  ? 75.863  -10.270 82.043  1.00 65.38  ? 133  ASP C OD2   1 
ATOM   4562  N  N     . ARG C  2  134  ? 72.697  -12.050 78.211  1.00 50.11  ? 134  ARG C N     1 
ATOM   4563  C  CA    . ARG C  2  134  ? 71.552  -12.435 77.393  1.00 44.52  ? 134  ARG C CA    1 
ATOM   4564  C  C     . ARG C  2  134  ? 71.070  -13.849 77.711  1.00 44.94  ? 134  ARG C C     1 
ATOM   4565  O  O     . ARG C  2  134  ? 71.842  -14.690 78.169  1.00 45.63  ? 134  ARG C O     1 
ATOM   4566  C  CB    . ARG C  2  134  ? 71.895  -12.320 75.906  1.00 42.83  ? 134  ARG C CB    1 
ATOM   4567  C  CG    . ARG C  2  134  ? 72.281  -10.918 75.465  1.00 46.73  ? 134  ARG C CG    1 
ATOM   4568  C  CD    . ARG C  2  134  ? 71.817  -10.639 74.045  1.00 45.15  ? 134  ARG C CD    1 
ATOM   4569  N  NE    . ARG C  2  134  ? 71.195  -9.324  73.921  1.00 41.99  ? 134  ARG C NE    1 
ATOM   4570  C  CZ    . ARG C  2  134  ? 70.002  -9.111  73.377  1.00 46.33  ? 134  ARG C CZ    1 
ATOM   4571  N  NH1   . ARG C  2  134  ? 69.296  -10.128 72.902  1.00 45.24  ? 134  ARG C NH1   1 
ATOM   4572  N  NH2   . ARG C  2  134  ? 69.514  -7.881  73.306  1.00 59.33  ? 134  ARG C NH2   1 
ATOM   4573  N  N     . VAL C  2  135  ? 69.788  -14.101 77.463  1.00 47.73  ? 135  VAL C N     1 
ATOM   4574  C  CA    . VAL C  2  135  ? 69.203  -15.410 77.682  1.00 42.98  ? 135  VAL C CA    1 
ATOM   4575  C  C     . VAL C  2  135  ? 68.573  -15.804 76.362  1.00 43.79  ? 135  VAL C C     1 
ATOM   4576  O  O     . VAL C  2  135  ? 67.937  -14.983 75.704  1.00 47.93  ? 135  VAL C O     1 
ATOM   4577  C  CB    . VAL C  2  135  ? 68.115  -15.371 78.790  1.00 37.64  ? 135  VAL C CB    1 
ATOM   4578  C  CG1   . VAL C  2  135  ? 67.359  -16.676 78.846  1.00 40.89  ? 135  VAL C CG1   1 
ATOM   4579  C  CG2   . VAL C  2  135  ? 68.733  -15.066 80.141  1.00 43.47  ? 135  VAL C CG2   1 
ATOM   4580  N  N     . ILE C  2  136  ? 68.774  -17.043 75.944  1.00 39.32  ? 136  ILE C N     1 
ATOM   4581  C  CA    . ILE C  2  136  ? 68.090  -17.513 74.753  1.00 41.47  ? 136  ILE C CA    1 
ATOM   4582  C  C     . ILE C  2  136  ? 66.865  -18.295 75.207  1.00 42.35  ? 136  ILE C C     1 
ATOM   4583  O  O     . ILE C  2  136  ? 66.975  -19.393 75.748  1.00 43.39  ? 136  ILE C O     1 
ATOM   4584  C  CB    . ILE C  2  136  ? 68.999  -18.384 73.849  1.00 41.70  ? 136  ILE C CB    1 
ATOM   4585  C  CG1   . ILE C  2  136  ? 70.283  -17.637 73.485  1.00 38.09  ? 136  ILE C CG1   1 
ATOM   4586  C  CG2   . ILE C  2  136  ? 68.265  -18.799 72.592  1.00 35.81  ? 136  ILE C CG2   1 
ATOM   4587  C  CD1   . ILE C  2  136  ? 70.043  -16.301 72.834  1.00 35.62  ? 136  ILE C CD1   1 
ATOM   4588  N  N     . VAL C  2  137  ? 65.693  -17.709 75.010  1.00 41.67  ? 137  VAL C N     1 
ATOM   4589  C  CA    . VAL C  2  137  ? 64.460  -18.325 75.460  1.00 40.05  ? 137  VAL C CA    1 
ATOM   4590  C  C     . VAL C  2  137  ? 64.094  -19.512 74.587  1.00 42.51  ? 137  VAL C C     1 
ATOM   4591  O  O     . VAL C  2  137  ? 64.084  -19.410 73.361  1.00 44.46  ? 137  VAL C O     1 
ATOM   4592  C  CB    . VAL C  2  137  ? 63.304  -17.324 75.426  1.00 42.20  ? 137  VAL C CB    1 
ATOM   4593  C  CG1   . VAL C  2  137  ? 62.027  -17.975 75.918  1.00 44.78  ? 137  VAL C CG1   1 
ATOM   4594  C  CG2   . VAL C  2  137  ? 63.642  -16.119 76.265  1.00 44.18  ? 137  VAL C CG2   1 
ATOM   4595  N  N     . SER C  2  138  ? 63.790  -20.634 75.230  1.00 43.91  ? 138  SER C N     1 
ATOM   4596  C  CA    . SER C  2  138  ? 63.325  -21.830 74.534  1.00 42.52  ? 138  SER C CA    1 
ATOM   4597  C  C     . SER C  2  138  ? 62.077  -21.513 73.732  1.00 40.90  ? 138  SER C C     1 
ATOM   4598  O  O     . SER C  2  138  ? 61.285  -20.659 74.119  1.00 48.06  ? 138  SER C O     1 
ATOM   4599  C  CB    . SER C  2  138  ? 63.022  -22.931 75.540  1.00 41.47  ? 138  SER C CB    1 
ATOM   4600  O  OG    . SER C  2  138  ? 63.989  -22.932 76.576  1.00 50.70  ? 138  SER C OG    1 
ATOM   4601  N  N     . GLN C  2  139  ? 61.894  -22.196 72.611  1.00 44.76  ? 139  GLN C N     1 
ATOM   4602  C  CA    . GLN C  2  139  ? 60.739  -21.906 71.769  1.00 49.31  ? 139  GLN C CA    1 
ATOM   4603  C  C     . GLN C  2  139  ? 59.841  -23.118 71.568  1.00 47.49  ? 139  GLN C C     1 
ATOM   4604  O  O     . GLN C  2  139  ? 60.294  -24.156 71.113  1.00 48.56  ? 139  GLN C O     1 
ATOM   4605  C  CB    . GLN C  2  139  ? 61.185  -21.353 70.414  1.00 45.98  ? 139  GLN C CB    1 
ATOM   4606  C  CG    . GLN C  2  139  ? 60.134  -21.496 69.338  1.00 46.45  ? 139  GLN C CG    1 
ATOM   4607  C  CD    . GLN C  2  139  ? 60.485  -20.745 68.088  1.00 63.33  ? 139  GLN C CD    1 
ATOM   4608  O  OE1   . GLN C  2  139  ? 61.185  -21.261 67.212  1.00 66.22  ? 139  GLN C OE1   1 
ATOM   4609  N  NE2   . GLN C  2  139  ? 60.001  -19.510 67.988  1.00 72.87  ? 139  GLN C NE2   1 
ATOM   4610  N  N     . ILE C  2  140  ? 58.561  -22.986 71.896  1.00 44.75  ? 140  ILE C N     1 
ATOM   4611  C  CA    . ILE C  2  140  ? 57.628  -24.087 71.676  1.00 43.86  ? 140  ILE C CA    1 
ATOM   4612  C  C     . ILE C  2  140  ? 57.096  -24.039 70.250  1.00 41.78  ? 140  ILE C C     1 
ATOM   4613  O  O     . ILE C  2  140  ? 56.933  -22.962 69.678  1.00 46.68  ? 140  ILE C O     1 
ATOM   4614  C  CB    . ILE C  2  140  ? 56.469  -24.084 72.711  1.00 43.30  ? 140  ILE C CB    1 
ATOM   4615  C  CG1   . ILE C  2  140  ? 55.597  -25.334 72.567  1.00 40.69  ? 140  ILE C CG1   1 
ATOM   4616  C  CG2   . ILE C  2  140  ? 55.639  -22.823 72.594  1.00 42.33  ? 140  ILE C CG2   1 
ATOM   4617  C  CD1   . ILE C  2  140  ? 54.841  -25.699 73.836  1.00 35.95  ? 140  ILE C CD1   1 
ATOM   4618  N  N     . HIS C  2  141  ? 56.862  -25.205 69.660  1.00 39.03  ? 141  HIS C N     1 
ATOM   4619  C  CA    . HIS C  2  141  ? 56.293  -25.249 68.317  1.00 46.07  ? 141  HIS C CA    1 
ATOM   4620  C  C     . HIS C  2  141  ? 55.634  -26.586 68.020  1.00 49.52  ? 141  HIS C C     1 
ATOM   4621  O  O     . HIS C  2  141  ? 55.725  -27.521 68.810  1.00 47.13  ? 141  HIS C O     1 
ATOM   4622  C  CB    . HIS C  2  141  ? 57.344  -24.926 67.256  1.00 47.22  ? 141  HIS C CB    1 
ATOM   4623  C  CG    . HIS C  2  141  ? 58.363  -26.005 67.057  1.00 51.47  ? 141  HIS C CG    1 
ATOM   4624  N  ND1   . HIS C  2  141  ? 58.917  -26.285 65.826  1.00 52.51  ? 141  HIS C ND1   1 
ATOM   4625  C  CD2   . HIS C  2  141  ? 58.937  -26.867 67.930  1.00 53.28  ? 141  HIS C CD2   1 
ATOM   4626  C  CE1   . HIS C  2  141  ? 59.780  -27.278 65.948  1.00 51.57  ? 141  HIS C CE1   1 
ATOM   4627  N  NE2   . HIS C  2  141  ? 59.812  -27.647 67.214  1.00 52.05  ? 141  HIS C NE2   1 
ATOM   4628  N  N     . ARG C  2  142  ? 54.944  -26.662 66.889  1.00 53.56  ? 142  ARG C N     1 
ATOM   4629  C  CA    . ARG C  2  142  ? 54.361  -27.921 66.460  1.00 56.65  ? 142  ARG C CA    1 
ATOM   4630  C  C     . ARG C  2  142  ? 55.484  -28.870 66.094  1.00 55.87  ? 142  ARG C C     1 
ATOM   4631  O  O     . ARG C  2  142  ? 56.306  -28.564 65.226  1.00 59.21  ? 142  ARG C O     1 
ATOM   4632  C  CB    . ARG C  2  142  ? 53.445  -27.723 65.252  1.00 59.75  ? 142  ARG C CB    1 
ATOM   4633  C  CG    . ARG C  2  142  ? 52.175  -26.956 65.546  1.00 63.78  ? 142  ARG C CG    1 
ATOM   4634  C  CD    . ARG C  2  142  ? 51.246  -26.997 64.356  1.00 71.57  ? 142  ARG C CD    1 
ATOM   4635  N  NE    . ARG C  2  142  ? 50.946  -28.369 63.963  1.00 75.12  ? 142  ARG C NE    1 
ATOM   4636  C  CZ    . ARG C  2  142  ? 50.059  -28.702 63.031  1.00 78.56  ? 142  ARG C CZ    1 
ATOM   4637  N  NH1   . ARG C  2  142  ? 49.376  -27.761 62.391  1.00 75.08  ? 142  ARG C NH1   1 
ATOM   4638  N  NH2   . ARG C  2  142  ? 49.852  -29.979 62.741  1.00 76.91  ? 142  ARG C NH2   1 
ATOM   4639  N  N     . SER C  2  143  ? 55.528  -30.015 66.764  1.00 52.82  ? 143  SER C N     1 
ATOM   4640  C  CA    . SER C  2  143  ? 56.527  -31.021 66.452  1.00 55.84  ? 143  SER C CA    1 
ATOM   4641  C  C     . SER C  2  143  ? 56.351  -31.470 65.018  1.00 56.47  ? 143  SER C C     1 
ATOM   4642  O  O     . SER C  2  143  ? 55.224  -31.677 64.572  1.00 57.17  ? 143  SER C O     1 
ATOM   4643  C  CB    . SER C  2  143  ? 56.388  -32.228 67.374  1.00 55.37  ? 143  SER C CB    1 
ATOM   4644  O  OG    . SER C  2  143  ? 57.029  -33.360 66.812  1.00 54.21  ? 143  SER C OG    1 
ATOM   4645  N  N     . PRO C  2  144  ? 57.463  -31.600 64.281  1.00 53.25  ? 144  PRO C N     1 
ATOM   4646  C  CA    . PRO C  2  144  ? 57.388  -32.248 62.972  1.00 56.21  ? 144  PRO C CA    1 
ATOM   4647  C  C     . PRO C  2  144  ? 56.804  -33.649 63.124  1.00 59.99  ? 144  PRO C C     1 
ATOM   4648  O  O     . PRO C  2  144  ? 56.741  -34.185 64.234  1.00 53.01  ? 144  PRO C O     1 
ATOM   4649  C  CB    . PRO C  2  144  ? 58.852  -32.323 62.538  1.00 57.96  ? 144  PRO C CB    1 
ATOM   4650  C  CG    . PRO C  2  144  ? 59.503  -31.183 63.229  1.00 59.57  ? 144  PRO C CG    1 
ATOM   4651  C  CD    . PRO C  2  144  ? 58.804  -31.056 64.555  1.00 55.73  ? 144  PRO C CD    1 
ATOM   4652  N  N     . GLY C  2  145  ? 56.374  -34.228 62.012  1.00 60.42  ? 145  GLY C N     1 
ATOM   4653  C  CA    . GLY C  2  145  ? 55.727  -35.520 62.017  1.00 59.17  ? 145  GLY C CA    1 
ATOM   4654  C  C     . GLY C  2  145  ? 54.661  -35.553 60.948  1.00 58.75  ? 145  GLY C C     1 
ATOM   4655  O  O     . GLY C  2  145  ? 54.678  -34.746 60.020  1.00 57.62  ? 145  GLY C O     1 
ATOM   4656  N  N     . VAL C  2  146  ? 53.738  -36.497 61.085  1.00 62.59  ? 146  VAL C N     1 
ATOM   4657  C  CA    . VAL C  2  146  ? 52.611  -36.628 60.176  1.00 66.10  ? 146  VAL C CA    1 
ATOM   4658  C  C     . VAL C  2  146  ? 51.338  -36.655 60.996  1.00 68.02  ? 146  VAL C C     1 
ATOM   4659  O  O     . VAL C  2  146  ? 51.134  -37.566 61.801  1.00 70.07  ? 146  VAL C O     1 
ATOM   4660  C  CB    . VAL C  2  146  ? 52.696  -37.918 59.350  1.00 62.19  ? 146  VAL C CB    1 
ATOM   4661  C  CG1   . VAL C  2  146  ? 51.368  -38.195 58.670  1.00 63.11  ? 146  VAL C CG1   1 
ATOM   4662  C  CG2   . VAL C  2  146  ? 53.814  -37.819 58.334  1.00 57.31  ? 146  VAL C CG2   1 
ATOM   4663  N  N     . TYR C  2  147  ? 50.490  -35.652 60.798  1.00 65.01  ? 147  TYR C N     1 
ATOM   4664  C  CA    . TYR C  2  147  ? 49.281  -35.507 61.598  1.00 69.47  ? 147  TYR C CA    1 
ATOM   4665  C  C     . TYR C  2  147  ? 48.042  -35.656 60.730  1.00 66.24  ? 147  TYR C C     1 
ATOM   4666  O  O     . TYR C  2  147  ? 48.110  -35.503 59.519  1.00 66.13  ? 147  TYR C O     1 
ATOM   4667  C  CB    . TYR C  2  147  ? 49.274  -34.154 62.323  1.00 70.16  ? 147  TYR C CB    1 
ATOM   4668  C  CG    . TYR C  2  147  ? 50.498  -33.915 63.188  1.00 69.49  ? 147  TYR C CG    1 
ATOM   4669  C  CD1   . TYR C  2  147  ? 51.619  -33.265 62.679  1.00 64.20  ? 147  TYR C CD1   1 
ATOM   4670  C  CD2   . TYR C  2  147  ? 50.537  -34.350 64.506  1.00 65.08  ? 147  TYR C CD2   1 
ATOM   4671  C  CE1   . TYR C  2  147  ? 52.741  -33.050 63.461  1.00 62.11  ? 147  TYR C CE1   1 
ATOM   4672  C  CE2   . TYR C  2  147  ? 51.655  -34.143 65.297  1.00 67.16  ? 147  TYR C CE2   1 
ATOM   4673  C  CZ    . TYR C  2  147  ? 52.753  -33.491 64.771  1.00 67.07  ? 147  TYR C CZ    1 
ATOM   4674  O  OH    . TYR C  2  147  ? 53.865  -33.283 65.556  1.00 68.23  ? 147  TYR C OH    1 
ATOM   4675  N  N     . PHE C  2  148  ? 46.912  -35.967 61.354  1.00 73.00  ? 148  PHE C N     1 
ATOM   4676  C  CA    . PHE C  2  148  ? 45.649  -36.077 60.634  1.00 70.96  ? 148  PHE C CA    1 
ATOM   4677  C  C     . PHE C  2  148  ? 44.566  -35.275 61.339  1.00 73.92  ? 148  PHE C C     1 
ATOM   4678  O  O     . PHE C  2  148  ? 44.189  -35.581 62.468  1.00 81.03  ? 148  PHE C O     1 
ATOM   4679  C  CB    . PHE C  2  148  ? 45.232  -37.537 60.504  1.00 64.87  ? 148  PHE C CB    1 
ATOM   4680  C  CG    . PHE C  2  148  ? 46.246  -38.387 59.809  1.00 70.87  ? 148  PHE C CG    1 
ATOM   4681  C  CD1   . PHE C  2  148  ? 47.267  -38.990 60.522  1.00 72.85  ? 148  PHE C CD1   1 
ATOM   4682  C  CD2   . PHE C  2  148  ? 46.188  -38.573 58.441  1.00 73.17  ? 148  PHE C CD2   1 
ATOM   4683  C  CE1   . PHE C  2  148  ? 48.206  -39.767 59.884  1.00 73.28  ? 148  PHE C CE1   1 
ATOM   4684  C  CE2   . PHE C  2  148  ? 47.124  -39.351 57.797  1.00 69.55  ? 148  PHE C CE2   1 
ATOM   4685  C  CZ    . PHE C  2  148  ? 48.135  -39.948 58.518  1.00 71.08  ? 148  PHE C CZ    1 
ATOM   4686  N  N     . THR C  2  149  ? 44.076  -34.232 60.674  1.00 73.87  ? 149  THR C N     1 
ATOM   4687  C  CA    . THR C  2  149  ? 43.082  -33.331 61.259  1.00 80.43  ? 149  THR C CA    1 
ATOM   4688  C  C     . THR C  2  149  ? 41.826  -33.249 60.395  1.00 85.52  ? 149  THR C C     1 
ATOM   4689  O  O     . THR C  2  149  ? 41.914  -33.214 59.168  1.00 90.40  ? 149  THR C O     1 
ATOM   4690  C  CB    . THR C  2  149  ? 43.651  -31.914 61.452  1.00 83.83  ? 149  THR C CB    1 
ATOM   4691  O  OG1   . THR C  2  149  ? 44.655  -31.660 60.462  1.00 71.42  ? 149  THR C OG1   1 
ATOM   4692  C  CG2   . THR C  2  149  ? 44.262  -31.770 62.837  1.00 86.23  ? 149  THR C CG2   1 
ATOM   4693  N  N     . PRO C  2  150  ? 40.662  -33.284 61.030  1.00 85.44  ? 150  PRO C N     1 
ATOM   4694  C  CA    . PRO C  2  150  ? 39.415  -33.378 60.271  1.00 86.85  ? 150  PRO C CA    1 
ATOM   4695  C  C     . PRO C  2  150  ? 39.249  -32.157 59.389  1.00 92.88  ? 150  PRO C C     1 
ATOM   4696  O  O     . PRO C  2  150  ? 39.493  -31.038 59.841  1.00 89.91  ? 150  PRO C O     1 
ATOM   4697  C  CB    . PRO C  2  150  ? 38.344  -33.388 61.362  1.00 86.88  ? 150  PRO C CB    1 
ATOM   4698  C  CG    . PRO C  2  150  ? 39.031  -33.955 62.555  1.00 91.99  ? 150  PRO C CG    1 
ATOM   4699  C  CD    . PRO C  2  150  ? 40.447  -33.461 62.477  1.00 89.19  ? 150  PRO C CD    1 
ATOM   4700  N  N     . ASP C  2  151  ? 38.835  -32.365 58.146  1.00 100.43 ? 151  ASP C N     1 
ATOM   4701  C  CA    . ASP C  2  151  ? 38.603  -31.242 57.260  1.00 97.76  ? 151  ASP C CA    1 
ATOM   4702  C  C     . ASP C  2  151  ? 37.465  -30.450 57.869  1.00 107.09 ? 151  ASP C C     1 
ATOM   4703  O  O     . ASP C  2  151  ? 36.476  -31.024 58.323  1.00 111.74 ? 151  ASP C O     1 
ATOM   4704  C  CB    . ASP C  2  151  ? 38.226  -31.725 55.860  1.00 100.56 ? 151  ASP C CB    1 
ATOM   4705  C  CG    . ASP C  2  151  ? 37.873  -30.585 54.926  1.00 104.02 ? 151  ASP C CG    1 
ATOM   4706  O  OD1   . ASP C  2  151  ? 37.135  -29.673 55.353  1.00 110.63 ? 151  ASP C OD1   1 
ATOM   4707  O  OD2   . ASP C  2  151  ? 38.334  -30.601 53.766  1.00 99.30  ? 151  ASP C OD2   1 
ATOM   4708  N  N     . PRO C  2  152  ? 37.599  -29.131 57.885  1.00 106.24 ? 152  PRO C N     1 
ATOM   4709  C  CA    . PRO C  2  152  ? 36.558  -28.293 58.492  1.00 105.58 ? 152  PRO C CA    1 
ATOM   4710  C  C     . PRO C  2  152  ? 35.362  -28.102 57.564  1.00 109.01 ? 152  PRO C C     1 
ATOM   4711  O  O     . PRO C  2  152  ? 34.227  -28.010 58.035  1.00 113.54 ? 152  PRO C O     1 
ATOM   4712  C  CB    . PRO C  2  152  ? 37.276  -26.960 58.728  1.00 108.19 ? 152  PRO C CB    1 
ATOM   4713  C  CG    . PRO C  2  152  ? 38.416  -26.961 57.755  1.00 102.00 ? 152  PRO C CG    1 
ATOM   4714  C  CD    . PRO C  2  152  ? 38.854  -28.388 57.674  1.00 100.32 ? 152  PRO C CD    1 
ATOM   4715  N  N     . ALA C  2  153  ? 35.621  -28.062 56.260  1.00 109.54 ? 153  ALA C N     1 
ATOM   4716  C  CA    . ALA C  2  153  ? 34.568  -27.907 55.263  1.00 107.63 ? 153  ALA C CA    1 
ATOM   4717  C  C     . ALA C  2  153  ? 33.696  -29.157 55.157  1.00 109.76 ? 153  ALA C C     1 
ATOM   4718  O  O     . ALA C  2  153  ? 32.469  -29.069 55.149  1.00 117.09 ? 153  ALA C O     1 
ATOM   4719  C  CB    . ALA C  2  153  ? 35.169  -27.559 53.906  1.00 103.30 ? 153  ALA C CB    1 
ATOM   4720  N  N     . ARG C  2  154  ? 34.330  -30.322 55.091  1.00 109.18 ? 154  ARG C N     1 
ATOM   4721  C  CA    . ARG C  2  154  ? 33.587  -31.575 55.055  1.00 111.51 ? 154  ARG C CA    1 
ATOM   4722  C  C     . ARG C  2  154  ? 33.876  -32.420 56.292  1.00 116.56 ? 154  ARG C C     1 
ATOM   4723  O  O     . ARG C  2  154  ? 35.030  -32.715 56.599  1.00 119.54 ? 154  ARG C O     1 
ATOM   4724  C  CB    . ARG C  2  154  ? 33.927  -32.364 53.790  1.00 114.85 ? 154  ARG C CB    1 
ATOM   4725  C  CG    . ARG C  2  154  ? 33.633  -31.622 52.497  1.00 119.43 ? 154  ARG C CG    1 
ATOM   4726  C  CD    . ARG C  2  154  ? 34.915  -31.186 51.805  1.00 118.32 ? 154  ARG C CD    1 
ATOM   4727  N  NE    . ARG C  2  154  ? 35.441  -32.224 50.923  1.00 119.23 ? 154  ARG C NE    1 
ATOM   4728  C  CZ    . ARG C  2  154  ? 34.724  -33.237 50.450  1.00 117.49 ? 154  ARG C CZ    1 
ATOM   4729  N  NH1   . ARG C  2  154  ? 33.444  -33.354 50.774  1.00 119.00 ? 154  ARG C NH1   1 
ATOM   4730  N  NH2   . ARG C  2  154  ? 35.287  -34.135 49.653  1.00 109.82 ? 154  ARG C NH2   1 
ATOM   4731  N  N     . PRO C  2  155  ? 32.817  -32.809 56.996  1.00 117.19 ? 155  PRO C N     1 
ATOM   4732  C  CA    . PRO C  2  155  ? 32.946  -33.672 58.174  1.00 128.61 ? 155  PRO C CA    1 
ATOM   4733  C  C     . PRO C  2  155  ? 33.500  -35.040 57.797  1.00 128.35 ? 155  PRO C C     1 
ATOM   4734  O  O     . PRO C  2  155  ? 34.329  -35.602 58.512  1.00 130.12 ? 155  PRO C O     1 
ATOM   4735  C  CB    . PRO C  2  155  ? 31.504  -33.806 58.664  1.00 125.16 ? 155  PRO C CB    1 
ATOM   4736  C  CG    . PRO C  2  155  ? 30.841  -32.551 58.209  1.00 122.08 ? 155  PRO C CG    1 
ATOM   4737  C  CD    . PRO C  2  155  ? 31.476  -32.208 56.891  1.00 111.55 ? 155  PRO C CD    1 
ATOM   4738  N  N     . GLY C  2  156  ? 33.031  -35.562 56.670  1.00 122.15 ? 156  GLY C N     1 
ATOM   4739  C  CA    . GLY C  2  156  ? 33.440  -36.866 56.184  1.00 121.94 ? 156  GLY C CA    1 
ATOM   4740  C  C     . GLY C  2  156  ? 34.913  -36.964 55.845  1.00 114.68 ? 156  GLY C C     1 
ATOM   4741  O  O     . GLY C  2  156  ? 35.548  -37.988 56.098  1.00 110.03 ? 156  GLY C O     1 
ATOM   4742  N  N     . ARG C  2  157  ? 35.458  -35.903 55.260  1.00 115.29 ? 157  ARG C N     1 
ATOM   4743  C  CA    . ARG C  2  157  ? 36.825  -35.934 54.753  1.00 116.88 ? 157  ARG C CA    1 
ATOM   4744  C  C     . ARG C  2  157  ? 37.845  -35.287 55.687  1.00 113.61 ? 157  ARG C C     1 
ATOM   4745  O  O     . ARG C  2  157  ? 37.679  -34.150 56.130  1.00 113.32 ? 157  ARG C O     1 
ATOM   4746  C  CB    . ARG C  2  157  ? 36.893  -35.276 53.372  1.00 116.56 ? 157  ARG C CB    1 
ATOM   4747  C  CG    . ARG C  2  157  ? 36.274  -36.108 52.260  1.00 122.10 ? 157  ARG C CG    1 
ATOM   4748  C  CD    . ARG C  2  157  ? 35.832  -37.469 52.772  1.00 117.75 ? 157  ARG C CD    1 
ATOM   4749  N  NE    . ARG C  2  157  ? 34.865  -38.101 51.880  1.00 116.90 ? 157  ARG C NE    1 
ATOM   4750  C  CZ    . ARG C  2  157  ? 34.985  -38.141 50.557  1.00 119.70 ? 157  ARG C CZ    1 
ATOM   4751  N  NH1   . ARG C  2  157  ? 36.033  -37.583 49.967  1.00 115.11 ? 157  ARG C NH1   1 
ATOM   4752  N  NH2   . ARG C  2  157  ? 34.056  -38.738 49.823  1.00 125.04 ? 157  ARG C NH2   1 
ATOM   4753  N  N     . TYR C  2  158  ? 38.903  -36.038 55.972  1.00 103.59 ? 158  TYR C N     1 
ATOM   4754  C  CA    . TYR C  2  158  ? 40.022  -35.577 56.785  1.00 90.58  ? 158  TYR C CA    1 
ATOM   4755  C  C     . TYR C  2  158  ? 41.161  -35.044 55.922  1.00 90.41  ? 158  TYR C C     1 
ATOM   4756  O  O     . TYR C  2  158  ? 41.201  -35.271 54.713  1.00 99.17  ? 158  TYR C O     1 
ATOM   4757  C  CB    . TYR C  2  158  ? 40.544  -36.714 57.670  1.00 96.45  ? 158  TYR C CB    1 
ATOM   4758  C  CG    . TYR C  2  158  ? 39.509  -37.298 58.605  1.00 99.40  ? 158  TYR C CG    1 
ATOM   4759  C  CD1   . TYR C  2  158  ? 39.261  -36.724 59.843  1.00 98.31  ? 158  TYR C CD1   1 
ATOM   4760  C  CD2   . TYR C  2  158  ? 38.782  -38.427 58.251  1.00 95.93  ? 158  TYR C CD2   1 
ATOM   4761  C  CE1   . TYR C  2  158  ? 38.317  -37.254 60.699  1.00 101.46 ? 158  TYR C CE1   1 
ATOM   4762  C  CE2   . TYR C  2  158  ? 37.836  -38.964 59.101  1.00 93.00  ? 158  TYR C CE2   1 
ATOM   4763  C  CZ    . TYR C  2  158  ? 37.609  -38.374 60.323  1.00 101.31 ? 158  TYR C CZ    1 
ATOM   4764  O  OH    . TYR C  2  158  ? 36.669  -38.904 61.175  1.00 114.70 ? 158  TYR C OH    1 
ATOM   4765  N  N     . ILE C  2  159  ? 42.086  -34.335 56.558  1.00 85.46  ? 159  ILE C N     1 
ATOM   4766  C  CA    . ILE C  2  159  ? 43.286  -33.843 55.895  1.00 78.64  ? 159  ILE C CA    1 
ATOM   4767  C  C     . ILE C  2  159  ? 44.530  -34.417 56.558  1.00 79.09  ? 159  ILE C C     1 
ATOM   4768  O  O     . ILE C  2  159  ? 44.678  -34.371 57.786  1.00 78.45  ? 159  ILE C O     1 
ATOM   4769  C  CB    . ILE C  2  159  ? 43.388  -32.314 55.947  1.00 72.18  ? 159  ILE C CB    1 
ATOM   4770  C  CG1   . ILE C  2  159  ? 42.226  -31.671 55.200  1.00 86.92  ? 159  ILE C CG1   1 
ATOM   4771  C  CG2   . ILE C  2  159  ? 44.699  -31.856 55.350  1.00 75.84  ? 159  ILE C CG2   1 
ATOM   4772  C  CD1   . ILE C  2  159  ? 42.316  -30.163 55.138  1.00 96.31  ? 159  ILE C CD1   1 
ATOM   4773  N  N     . ALA C  2  160  ? 45.426  -34.957 55.740  1.00 76.73  ? 160  ALA C N     1 
ATOM   4774  C  CA    . ALA C  2  160  ? 46.673  -35.498 56.251  1.00 67.84  ? 160  ALA C CA    1 
ATOM   4775  C  C     . ALA C  2  160  ? 47.798  -34.507 55.998  1.00 76.58  ? 160  ALA C C     1 
ATOM   4776  O  O     . ALA C  2  160  ? 48.092  -34.176 54.856  1.00 76.48  ? 160  ALA C O     1 
ATOM   4777  C  CB    . ALA C  2  160  ? 46.975  -36.823 55.597  1.00 67.57  ? 160  ALA C CB    1 
ATOM   4778  N  N     . SER C  2  161  ? 48.421  -34.026 57.067  1.00 76.84  ? 161  SER C N     1 
ATOM   4779  C  CA    . SER C  2  161  ? 49.506  -33.064 56.938  1.00 68.80  ? 161  SER C CA    1 
ATOM   4780  C  C     . SER C  2  161  ? 50.857  -33.695 57.250  1.00 65.84  ? 161  SER C C     1 
ATOM   4781  O  O     . SER C  2  161  ? 51.005  -34.427 58.228  1.00 64.34  ? 161  SER C O     1 
ATOM   4782  C  CB    . SER C  2  161  ? 49.264  -31.856 57.842  1.00 70.00  ? 161  SER C CB    1 
ATOM   4783  O  OG    . SER C  2  161  ? 48.009  -31.263 57.568  1.00 73.83  ? 161  SER C OG    1 
ATOM   4784  N  N     . ILE C  2  162  ? 51.835  -33.408 56.398  1.00 71.05  ? 162  ILE C N     1 
ATOM   4785  C  CA    . ILE C  2  162  ? 53.206  -33.849 56.599  1.00 65.76  ? 162  ILE C CA    1 
ATOM   4786  C  C     . ILE C  2  162  ? 54.078  -32.634 56.883  1.00 66.83  ? 162  ILE C C     1 
ATOM   4787  O  O     . ILE C  2  162  ? 54.326  -31.818 55.997  1.00 67.48  ? 162  ILE C O     1 
ATOM   4788  C  CB    . ILE C  2  162  ? 53.740  -34.593 55.364  1.00 62.57  ? 162  ILE C CB    1 
ATOM   4789  C  CG1   . ILE C  2  162  ? 53.080  -35.969 55.256  1.00 60.86  ? 162  ILE C CG1   1 
ATOM   4790  C  CG2   . ILE C  2  162  ? 55.252  -34.725 55.436  1.00 62.56  ? 162  ILE C CG2   1 
ATOM   4791  C  CD1   . ILE C  2  162  ? 53.320  -36.665 53.936  1.00 58.55  ? 162  ILE C CD1   1 
ATOM   4792  N  N     . ILE C  2  163  ? 54.537  -32.520 58.126  1.00 66.63  ? 163  ILE C N     1 
ATOM   4793  C  CA    . ILE C  2  163  ? 55.273  -31.343 58.569  1.00 68.76  ? 163  ILE C CA    1 
ATOM   4794  C  C     . ILE C  2  163  ? 56.701  -31.689 58.956  1.00 62.37  ? 163  ILE C C     1 
ATOM   4795  O  O     . ILE C  2  163  ? 56.916  -32.544 59.802  1.00 58.58  ? 163  ILE C O     1 
ATOM   4796  C  CB    . ILE C  2  163  ? 54.592  -30.695 59.783  1.00 74.54  ? 163  ILE C CB    1 
ATOM   4797  C  CG1   . ILE C  2  163  ? 53.114  -30.443 59.489  1.00 70.11  ? 163  ILE C CG1   1 
ATOM   4798  C  CG2   . ILE C  2  163  ? 55.301  -29.405 60.169  1.00 76.52  ? 163  ILE C CG2   1 
ATOM   4799  C  CD1   . ILE C  2  163  ? 52.322  -30.033 60.702  1.00 67.34  ? 163  ILE C CD1   1 
ATOM   4800  N  N     . PRO C  2  164  ? 57.683  -31.017 58.335  1.00 63.04  ? 164  PRO C N     1 
ATOM   4801  C  CA    . PRO C  2  164  ? 59.107  -31.198 58.623  1.00 63.26  ? 164  PRO C CA    1 
ATOM   4802  C  C     . PRO C  2  164  ? 59.586  -30.151 59.618  1.00 64.77  ? 164  PRO C C     1 
ATOM   4803  O  O     . PRO C  2  164  ? 58.782  -29.349 60.093  1.00 69.31  ? 164  PRO C O     1 
ATOM   4804  C  CB    . PRO C  2  164  ? 59.742  -30.918 57.271  1.00 65.95  ? 164  PRO C CB    1 
ATOM   4805  C  CG    . PRO C  2  164  ? 58.890  -29.813 56.724  1.00 67.44  ? 164  PRO C CG    1 
ATOM   4806  C  CD    . PRO C  2  164  ? 57.480  -30.107 57.194  1.00 71.49  ? 164  PRO C CD    1 
ATOM   4807  N  N     . LEU C  2  165  ? 60.881  -30.155 59.917  1.00 65.32  ? 165  LEU C N     1 
ATOM   4808  C  CA    . LEU C  2  165  ? 61.474  -29.116 60.746  1.00 67.91  ? 165  LEU C CA    1 
ATOM   4809  C  C     . LEU C  2  165  ? 61.400  -27.797 59.989  1.00 74.50  ? 165  LEU C C     1 
ATOM   4810  O  O     . LEU C  2  165  ? 61.538  -27.772 58.767  1.00 73.98  ? 165  LEU C O     1 
ATOM   4811  C  CB    . LEU C  2  165  ? 62.928  -29.455 61.074  1.00 67.22  ? 165  LEU C CB    1 
ATOM   4812  C  CG    . LEU C  2  165  ? 63.153  -30.480 62.187  1.00 62.09  ? 165  LEU C CG    1 
ATOM   4813  C  CD1   . LEU C  2  165  ? 64.628  -30.835 62.297  1.00 62.04  ? 165  LEU C CD1   1 
ATOM   4814  C  CD2   . LEU C  2  165  ? 62.622  -29.959 63.513  1.00 63.36  ? 165  LEU C CD2   1 
ATOM   4815  N  N     . PRO C  2  166  ? 61.176  -26.702 60.708  1.00 77.12  ? 166  PRO C N     1 
ATOM   4816  C  CA    . PRO C  2  166  ? 61.022  -25.400 60.053  1.00 84.52  ? 166  PRO C CA    1 
ATOM   4817  C  C     . PRO C  2  166  ? 62.292  -24.991 59.317  1.00 81.14  ? 166  PRO C C     1 
ATOM   4818  O  O     . PRO C  2  166  ? 63.393  -25.143 59.846  1.00 81.39  ? 166  PRO C O     1 
ATOM   4819  C  CB    . PRO C  2  166  ? 60.764  -24.452 61.225  1.00 78.23  ? 166  PRO C CB    1 
ATOM   4820  C  CG    . PRO C  2  166  ? 61.448  -25.098 62.380  1.00 69.54  ? 166  PRO C CG    1 
ATOM   4821  C  CD    . PRO C  2  166  ? 61.293  -26.578 62.171  1.00 69.33  ? 166  PRO C CD    1 
ATOM   4822  N  N     . LYS C  2  167  ? 62.129  -24.475 58.104  1.00 82.35  ? 167  LYS C N     1 
ATOM   4823  C  CA    . LYS C  2  167  ? 63.257  -24.046 57.288  1.00 88.37  ? 167  LYS C CA    1 
ATOM   4824  C  C     . LYS C  2  167  ? 63.905  -25.239 56.593  1.00 85.31  ? 167  LYS C C     1 
ATOM   4825  O  O     . LYS C  2  167  ? 64.918  -25.098 55.910  1.00 85.20  ? 167  LYS C O     1 
ATOM   4826  C  CB    . LYS C  2  167  ? 64.289  -23.310 58.143  1.00 94.48  ? 167  LYS C CB    1 
ATOM   4827  C  CG    . LYS C  2  167  ? 63.816  -21.963 58.665  1.00 94.46  ? 167  LYS C CG    1 
ATOM   4828  C  CD    . LYS C  2  167  ? 64.486  -20.817 57.925  1.00 99.54  ? 167  LYS C CD    1 
ATOM   4829  C  CE    . LYS C  2  167  ? 65.803  -20.433 58.579  1.00 98.50  ? 167  LYS C CE    1 
ATOM   4830  N  NZ    . LYS C  2  167  ? 66.504  -19.356 57.826  1.00 85.24  ? 167  LYS C NZ    1 
ATOM   4831  N  N     . ARG C  2  168  ? 63.286  -26.406 56.749  1.00 84.57  ? 168  ARG C N     1 
ATOM   4832  C  CA    . ARG C  2  168  ? 63.776  -27.629 56.126  1.00 83.61  ? 168  ARG C CA    1 
ATOM   4833  C  C     . ARG C  2  168  ? 62.659  -28.347 55.373  1.00 77.68  ? 168  ARG C C     1 
ATOM   4834  O  O     . ARG C  2  168  ? 62.164  -29.385 55.811  1.00 70.86  ? 168  ARG C O     1 
ATOM   4835  C  CB    . ARG C  2  168  ? 64.383  -28.560 57.178  1.00 76.69  ? 168  ARG C CB    1 
ATOM   4836  C  CG    . ARG C  2  168  ? 64.891  -27.846 58.420  1.00 84.35  ? 168  ARG C CG    1 
ATOM   4837  C  CD    . ARG C  2  168  ? 66.409  -27.782 58.438  1.00 89.89  ? 168  ARG C CD    1 
ATOM   4838  N  NE    . ARG C  2  168  ? 66.983  -28.028 57.118  1.00 85.77  ? 168  ARG C NE    1 
ATOM   4839  C  CZ    . ARG C  2  168  ? 68.098  -28.718 56.905  1.00 85.33  ? 168  ARG C CZ    1 
ATOM   4840  N  NH1   . ARG C  2  168  ? 68.767  -29.233 57.928  1.00 86.10  ? 168  ARG C NH1   1 
ATOM   4841  N  NH2   . ARG C  2  168  ? 68.547  -28.893 55.670  1.00 84.46  ? 168  ARG C NH2   1 
ATOM   4842  N  N     . GLY C  2  169  ? 62.276  -27.780 54.234  1.00 85.85  ? 169  GLY C N     1 
ATOM   4843  C  CA    . GLY C  2  169  ? 61.266  -28.362 53.368  1.00 91.08  ? 169  GLY C CA    1 
ATOM   4844  C  C     . GLY C  2  169  ? 59.858  -27.851 53.606  1.00 81.24  ? 169  GLY C C     1 
ATOM   4845  O  O     . GLY C  2  169  ? 59.520  -27.393 54.697  1.00 84.64  ? 169  GLY C O     1 
ATOM   4846  N  N     . PRO C  2  170  ? 59.023  -27.945 52.577  1.00 78.37  ? 170  PRO C N     1 
ATOM   4847  C  CA    . PRO C  2  170  ? 57.645  -27.449 52.657  1.00 88.36  ? 170  PRO C CA    1 
ATOM   4848  C  C     . PRO C  2  170  ? 56.661  -28.491 53.183  1.00 84.43  ? 170  PRO C C     1 
ATOM   4849  O  O     . PRO C  2  170  ? 56.829  -29.685 52.941  1.00 82.76  ? 170  PRO C O     1 
ATOM   4850  C  CB    . PRO C  2  170  ? 57.319  -27.116 51.201  1.00 90.39  ? 170  PRO C CB    1 
ATOM   4851  C  CG    . PRO C  2  170  ? 58.144  -28.076 50.415  1.00 90.88  ? 170  PRO C CG    1 
ATOM   4852  C  CD    . PRO C  2  170  ? 59.414  -28.277 51.196  1.00 83.27  ? 170  PRO C CD    1 
ATOM   4853  N  N     . TRP C  2  171  ? 55.641  -28.024 53.896  1.00 80.46  ? 171  TRP C N     1 
ATOM   4854  C  CA    . TRP C  2  171  ? 54.583  -28.881 54.400  1.00 78.76  ? 171  TRP C CA    1 
ATOM   4855  C  C     . TRP C  2  171  ? 53.808  -29.431 53.238  1.00 76.53  ? 171  TRP C C     1 
ATOM   4856  O  O     . TRP C  2  171  ? 53.733  -28.787 52.169  1.00 76.74  ? 171  TRP C O     1 
ATOM   4857  C  CB    . TRP C  2  171  ? 53.663  -28.103 55.331  1.00 86.51  ? 171  TRP C CB    1 
ATOM   4858  C  CG    . TRP C  2  171  ? 54.329  -27.660 56.612  1.00 92.33  ? 171  TRP C CG    1 
ATOM   4859  C  CD1   . TRP C  2  171  ? 55.621  -27.947 57.042  1.00 94.58  ? 171  TRP C CD1   1 
ATOM   4860  C  CD2   . TRP C  2  171  ? 53.751  -26.826 57.677  1.00 94.77  ? 171  TRP C CD2   1 
ATOM   4861  N  NE1   . TRP C  2  171  ? 55.872  -27.368 58.260  1.00 96.86  ? 171  TRP C NE1   1 
ATOM   4862  C  CE2   . TRP C  2  171  ? 54.794  -26.683 58.696  1.00 95.89  ? 171  TRP C CE2   1 
ATOM   4863  C  CE3   . TRP C  2  171  ? 52.525  -26.211 57.879  1.00 98.62  ? 171  TRP C CE3   1 
ATOM   4864  C  CZ2   . TRP C  2  171  ? 54.591  -25.952 59.852  1.00 100.51 ? 171  TRP C CZ2   1 
ATOM   4865  C  CZ3   . TRP C  2  171  ? 52.335  -25.478 59.051  1.00 111.06 ? 171  TRP C CZ3   1 
ATOM   4866  C  CH2   . TRP C  2  171  ? 53.344  -25.352 60.013  1.00 105.74 ? 171  TRP C CH2   1 
ATOM   4867  N  N     . ILE C  2  172  ? 53.222  -30.611 53.395  1.00 73.64  ? 172  ILE C N     1 
ATOM   4868  C  CA    . ILE C  2  172  ? 52.453  -31.212 52.310  1.00 75.49  ? 172  ILE C CA    1 
ATOM   4869  C  C     . ILE C  2  172  ? 51.078  -31.647 52.795  1.00 76.26  ? 172  ILE C C     1 
ATOM   4870  O  O     . ILE C  2  172  ? 50.957  -32.238 53.868  1.00 75.45  ? 172  ILE C O     1 
ATOM   4871  C  CB    . ILE C  2  172  ? 53.181  -32.429 51.710  1.00 72.79  ? 172  ILE C CB    1 
ATOM   4872  C  CG1   . ILE C  2  172  ? 54.481  -31.992 51.032  1.00 75.15  ? 172  ILE C CG1   1 
ATOM   4873  C  CG2   . ILE C  2  172  ? 52.279  -33.156 50.724  1.00 79.00  ? 172  ILE C CG2   1 
ATOM   4874  C  CD1   . ILE C  2  172  ? 55.486  -33.110 50.862  1.00 75.13  ? 172  ILE C CD1   1 
ATOM   4875  N  N     . ASP C  2  173  ? 50.039  -31.360 52.015  1.00 74.27  ? 173  ASP C N     1 
ATOM   4876  C  CA    . ASP C  2  173  ? 48.697  -31.757 52.435  1.00 75.38  ? 173  ASP C CA    1 
ATOM   4877  C  C     . ASP C  2  173  ? 48.022  -32.759 51.503  1.00 81.72  ? 173  ASP C C     1 
ATOM   4878  O  O     . ASP C  2  173  ? 47.937  -32.551 50.297  1.00 79.92  ? 173  ASP C O     1 
ATOM   4879  C  CB    . ASP C  2  173  ? 47.804  -30.534 52.655  1.00 81.79  ? 173  ASP C CB    1 
ATOM   4880  C  CG    . ASP C  2  173  ? 47.942  -29.955 54.052  1.00 84.05  ? 173  ASP C CG    1 
ATOM   4881  O  OD1   . ASP C  2  173  ? 48.992  -30.184 54.691  1.00 79.74  ? 173  ASP C OD1   1 
ATOM   4882  O  OD2   . ASP C  2  173  ? 46.999  -29.271 54.510  1.00 85.06  ? 173  ASP C OD2   1 
ATOM   4883  N  N     . LEU C  2  174  ? 47.499  -33.835 52.081  1.00 80.06  ? 174  LEU C N     1 
ATOM   4884  C  CA    . LEU C  2  174  ? 46.791  -34.846 51.302  1.00 78.99  ? 174  LEU C CA    1 
ATOM   4885  C  C     . LEU C  2  174  ? 45.298  -34.835 51.620  1.00 86.36  ? 174  LEU C C     1 
ATOM   4886  O  O     . LEU C  2  174  ? 44.900  -34.905 52.782  1.00 89.66  ? 174  LEU C O     1 
ATOM   4887  C  CB    . LEU C  2  174  ? 47.376  -36.234 51.569  1.00 72.93  ? 174  LEU C CB    1 
ATOM   4888  C  CG    . LEU C  2  174  ? 48.675  -36.573 50.837  1.00 68.64  ? 174  LEU C CG    1 
ATOM   4889  C  CD1   . LEU C  2  174  ? 49.575  -35.350 50.746  1.00 73.20  ? 174  LEU C CD1   1 
ATOM   4890  C  CD2   . LEU C  2  174  ? 49.394  -37.723 51.524  1.00 66.64  ? 174  LEU C CD2   1 
ATOM   4891  N  N     . GLU C  2  175  ? 44.479  -34.746 50.576  1.00 89.54  ? 175  GLU C N     1 
ATOM   4892  C  CA    . GLU C  2  175  ? 43.029  -34.701 50.733  1.00 95.81  ? 175  GLU C CA    1 
ATOM   4893  C  C     . GLU C  2  175  ? 42.338  -35.647 49.755  1.00 100.64 ? 175  GLU C C     1 
ATOM   4894  O  O     . GLU C  2  175  ? 42.862  -35.924 48.676  1.00 97.86  ? 175  GLU C O     1 
ATOM   4895  C  CB    . GLU C  2  175  ? 42.515  -33.273 50.534  1.00 99.77  ? 175  GLU C CB    1 
ATOM   4896  C  CG    . GLU C  2  175  ? 41.023  -33.110 50.772  1.00 116.11 ? 175  GLU C CG    1 
ATOM   4897  C  CD    . GLU C  2  175  ? 40.570  -31.668 50.653  1.00 119.95 ? 175  GLU C CD    1 
ATOM   4898  O  OE1   . GLU C  2  175  ? 41.434  -30.786 50.464  1.00 113.46 ? 175  GLU C OE1   1 
ATOM   4899  O  OE2   . GLU C  2  175  ? 39.351  -31.417 50.749  1.00 120.10 ? 175  GLU C OE2   1 
ATOM   4900  N  N     . VAL C  2  176  ? 41.202  -36.207 50.164  1.00 106.75 ? 176  VAL C N     1 
ATOM   4901  C  CA    . VAL C  2  176  ? 40.420  -37.083 49.290  1.00 100.78 ? 176  VAL C CA    1 
ATOM   4902  C  C     . VAL C  2  176  ? 39.812  -36.382 48.070  1.00 109.52 ? 176  VAL C C     1 
ATOM   4903  O  O     . VAL C  2  176  ? 39.853  -36.906 46.957  1.00 119.39 ? 176  VAL C O     1 
ATOM   4904  C  CB    . VAL C  2  176  ? 39.293  -37.789 50.068  1.00 112.24 ? 176  VAL C CB    1 
ATOM   4905  C  CG1   . VAL C  2  176  ? 38.037  -37.880 49.215  1.00 119.80 ? 176  VAL C CG1   1 
ATOM   4906  C  CG2   . VAL C  2  176  ? 39.744  -39.172 50.514  1.00 105.13 ? 176  VAL C CG2   1 
ATOM   4907  N  N     . GLU C  2  177  ? 39.250  -35.197 48.292  1.00 106.14 ? 177  GLU C N     1 
ATOM   4908  C  CA    . GLU C  2  177  ? 38.613  -34.413 47.233  1.00 110.11 ? 177  GLU C CA    1 
ATOM   4909  C  C     . GLU C  2  177  ? 37.123  -34.743 47.098  1.00 115.80 ? 177  GLU C C     1 
ATOM   4910  O  O     . GLU C  2  177  ? 36.694  -35.847 47.434  1.00 123.59 ? 177  GLU C O     1 
ATOM   4911  C  CB    . GLU C  2  177  ? 39.326  -34.636 45.898  1.00 108.56 ? 177  GLU C CB    1 
ATOM   4912  C  CG    . GLU C  2  177  ? 39.735  -33.354 45.191  1.00 112.14 ? 177  GLU C CG    1 
ATOM   4913  C  CD    . GLU C  2  177  ? 40.604  -32.463 46.056  1.00 110.20 ? 177  GLU C CD    1 
ATOM   4914  O  OE1   . GLU C  2  177  ? 40.080  -31.474 46.610  1.00 103.02 ? 177  GLU C OE1   1 
ATOM   4915  O  OE2   . GLU C  2  177  ? 41.813  -32.751 46.182  1.00 107.73 ? 177  GLU C OE2   1 
ATOM   4916  N  N     . PRO C  2  178  ? 36.340  -33.787 46.600  1.00 111.41 ? 178  PRO C N     1 
ATOM   4917  C  CA    . PRO C  2  178  ? 34.908  -34.003 46.347  1.00 114.16 ? 178  PRO C CA    1 
ATOM   4918  C  C     . PRO C  2  178  ? 34.640  -35.040 45.254  1.00 112.33 ? 178  PRO C C     1 
ATOM   4919  O  O     . PRO C  2  178  ? 33.752  -35.882 45.387  1.00 110.49 ? 178  PRO C O     1 
ATOM   4920  C  CB    . PRO C  2  178  ? 34.427  -32.624 45.890  1.00 115.34 ? 178  PRO C CB    1 
ATOM   4921  C  CG    . PRO C  2  178  ? 35.636  -31.990 45.289  1.00 109.14 ? 178  PRO C CG    1 
ATOM   4922  C  CD    . PRO C  2  178  ? 36.801  -32.480 46.102  1.00 106.26 ? 178  PRO C CD    1 
ATOM   4923  N  N     . ASN C  2  179  ? 35.422  -34.961 44.183  1.00 109.01 ? 179  ASN C N     1 
ATOM   4924  C  CA    . ASN C  2  179  ? 35.352  -35.887 43.056  1.00 109.03 ? 179  ASN C CA    1 
ATOM   4925  C  C     . ASN C  2  179  ? 35.761  -37.312 43.425  1.00 114.86 ? 179  ASN C C     1 
ATOM   4926  O  O     . ASN C  2  179  ? 35.284  -38.278 42.827  1.00 122.82 ? 179  ASN C O     1 
ATOM   4927  C  CB    . ASN C  2  179  ? 36.152  -35.369 41.843  1.00 104.26 ? 179  ASN C CB    1 
ATOM   4928  C  CG    . ASN C  2  179  ? 37.668  -35.431 42.044  1.00 110.21 ? 179  ASN C CG    1 
ATOM   4929  O  OD1   . ASN C  2  179  ? 38.198  -36.384 42.605  1.00 114.72 ? 179  ASN C OD1   1 
ATOM   4930  N  ND2   . ASN C  2  179  ? 38.369  -34.408 41.562  1.00 104.01 ? 179  ASN C ND2   1 
ATOM   4931  N  N     . GLY C  2  180  ? 36.643  -37.432 44.415  1.00 112.91 ? 180  GLY C N     1 
ATOM   4932  C  CA    . GLY C  2  180  ? 37.207  -38.714 44.792  1.00 113.34 ? 180  GLY C CA    1 
ATOM   4933  C  C     . GLY C  2  180  ? 38.676  -38.919 44.449  1.00 114.42 ? 180  GLY C C     1 
ATOM   4934  O  O     . GLY C  2  180  ? 39.252  -39.936 44.836  1.00 117.10 ? 180  GLY C O     1 
ATOM   4935  N  N     . VAL C  2  181  ? 39.284  -37.986 43.715  1.00 113.05 ? 181  VAL C N     1 
ATOM   4936  C  CA    . VAL C  2  181  ? 40.721  -38.081 43.419  1.00 115.19 ? 181  VAL C CA    1 
ATOM   4937  C  C     . VAL C  2  181  ? 41.533  -37.461 44.556  1.00 110.89 ? 181  VAL C C     1 
ATOM   4938  O  O     . VAL C  2  181  ? 41.205  -36.383 45.060  1.00 107.16 ? 181  VAL C O     1 
ATOM   4939  C  CB    . VAL C  2  181  ? 41.125  -37.485 42.021  1.00 113.70 ? 181  VAL C CB    1 
ATOM   4940  C  CG1   . VAL C  2  181  ? 41.368  -35.981 42.092  1.00 105.70 ? 181  VAL C CG1   1 
ATOM   4941  C  CG2   . VAL C  2  181  ? 42.369  -38.183 41.476  1.00 111.12 ? 181  VAL C CG2   1 
ATOM   4942  N  N     . VAL C  2  182  ? 42.594  -38.152 44.962  1.00 108.38 ? 182  VAL C N     1 
ATOM   4943  C  CA    . VAL C  2  182  ? 43.495  -37.640 45.990  1.00 101.71 ? 182  VAL C CA    1 
ATOM   4944  C  C     . VAL C  2  182  ? 44.281  -36.434 45.481  1.00 101.99 ? 182  VAL C C     1 
ATOM   4945  O  O     . VAL C  2  182  ? 44.711  -36.406 44.329  1.00 105.19 ? 182  VAL C O     1 
ATOM   4946  C  CB    . VAL C  2  182  ? 44.484  -38.721 46.463  1.00 102.71 ? 182  VAL C CB    1 
ATOM   4947  C  CG1   . VAL C  2  182  ? 43.850  -40.100 46.361  1.00 108.58 ? 182  VAL C CG1   1 
ATOM   4948  C  CG2   . VAL C  2  182  ? 45.769  -38.655 45.652  1.00 97.99  ? 182  VAL C CG2   1 
ATOM   4949  N  N     . SER C  2  183  ? 44.467  -35.442 46.346  1.00 99.21  ? 183  SER C N     1 
ATOM   4950  C  CA    . SER C  2  183  ? 45.206  -34.236 45.982  1.00 93.30  ? 183  SER C CA    1 
ATOM   4951  C  C     . SER C  2  183  ? 46.350  -33.942 46.950  1.00 91.92  ? 183  SER C C     1 
ATOM   4952  O  O     . SER C  2  183  ? 46.170  -33.991 48.167  1.00 97.87  ? 183  SER C O     1 
ATOM   4953  C  CB    . SER C  2  183  ? 44.262  -33.034 45.910  1.00 94.40  ? 183  SER C CB    1 
ATOM   4954  O  OG    . SER C  2  183  ? 44.139  -32.406 47.174  1.00 96.87  ? 183  SER C OG    1 
ATOM   4955  N  N     . MET C  2  184  ? 47.524  -33.630 46.408  1.00 84.87  ? 184  MET C N     1 
ATOM   4956  C  CA    . MET C  2  184  ? 48.654  -33.245 47.228  1.00 82.01  ? 184  MET C CA    1 
ATOM   4957  C  C     . MET C  2  184  ? 48.917  -31.759 47.029  1.00 89.74  ? 184  MET C C     1 
ATOM   4958  O  O     . MET C  2  184  ? 48.944  -31.271 45.894  1.00 93.10  ? 184  MET C O     1 
ATOM   4959  C  CB    . MET C  2  184  ? 49.890  -34.047 46.834  1.00 76.38  ? 184  MET C CB    1 
ATOM   4960  C  CG    . MET C  2  184  ? 50.911  -34.178 47.943  1.00 81.94  ? 184  MET C CG    1 
ATOM   4961  S  SD    . MET C  2  184  ? 52.527  -34.706 47.355  1.00 74.23  ? 184  MET C SD    1 
ATOM   4962  C  CE    . MET C  2  184  ? 53.139  -33.176 46.664  1.00 86.58  ? 184  MET C CE    1 
ATOM   4963  N  N     . LYS C  2  185  ? 49.100  -31.046 48.137  1.00 89.98  ? 185  LYS C N     1 
ATOM   4964  C  CA    . LYS C  2  185  ? 49.369  -29.617 48.115  1.00 84.34  ? 185  LYS C CA    1 
ATOM   4965  C  C     . LYS C  2  185  ? 50.775  -29.349 48.628  1.00 82.66  ? 185  LYS C C     1 
ATOM   4966  O  O     . LYS C  2  185  ? 51.109  -29.697 49.770  1.00 85.26  ? 185  LYS C O     1 
ATOM   4967  C  CB    . LYS C  2  185  ? 48.350  -28.869 48.973  1.00 86.06  ? 185  LYS C CB    1 
ATOM   4968  C  CG    . LYS C  2  185  ? 48.542  -27.363 49.006  1.00 92.13  ? 185  LYS C CG    1 
ATOM   4969  C  CD    . LYS C  2  185  ? 47.566  -26.715 49.973  1.00 86.58  ? 185  LYS C CD    1 
ATOM   4970  C  CE    . LYS C  2  185  ? 46.137  -27.118 49.656  1.00 88.11  ? 185  LYS C CE    1 
ATOM   4971  N  NZ    . LYS C  2  185  ? 45.167  -26.550 50.629  1.00 101.55 ? 185  LYS C NZ    1 
ATOM   4972  N  N     . VAL C  2  186  ? 51.585  -28.740 47.764  1.00 82.85  ? 186  VAL C N     1 
ATOM   4973  C  CA    . VAL C  2  186  ? 52.967  -28.382 48.063  1.00 86.20  ? 186  VAL C CA    1 
ATOM   4974  C  C     . VAL C  2  186  ? 53.317  -27.033 47.447  1.00 94.29  ? 186  VAL C C     1 
ATOM   4975  O  O     . VAL C  2  186  ? 53.195  -26.846 46.238  1.00 99.36  ? 186  VAL C O     1 
ATOM   4976  C  CB    . VAL C  2  186  ? 53.945  -29.427 47.513  1.00 80.31  ? 186  VAL C CB    1 
ATOM   4977  C  CG1   . VAL C  2  186  ? 55.320  -28.818 47.341  1.00 87.25  ? 186  VAL C CG1   1 
ATOM   4978  C  CG2   . VAL C  2  186  ? 54.018  -30.606 48.445  1.00 85.44  ? 186  VAL C CG2   1 
ATOM   4979  N  N     . ASN C  2  187  ? 53.745  -26.089 48.277  1.00 95.73  ? 187  ASN C N     1 
ATOM   4980  C  CA    . ASN C  2  187  ? 54.059  -24.748 47.799  1.00 94.87  ? 187  ASN C CA    1 
ATOM   4981  C  C     . ASN C  2  187  ? 52.847  -24.077 47.154  1.00 99.77  ? 187  ASN C C     1 
ATOM   4982  O  O     . ASN C  2  187  ? 52.976  -23.324 46.189  1.00 93.12  ? 187  ASN C O     1 
ATOM   4983  C  CB    . ASN C  2  187  ? 55.226  -24.789 46.812  1.00 93.36  ? 187  ASN C CB    1 
ATOM   4984  C  CG    . ASN C  2  187  ? 56.515  -25.264 47.454  1.00 92.76  ? 187  ASN C CG    1 
ATOM   4985  O  OD1   . ASN C  2  187  ? 57.278  -26.022 46.855  1.00 95.63  ? 187  ASN C OD1   1 
ATOM   4986  N  ND2   . ASN C  2  187  ? 56.763  -24.820 48.680  1.00 92.13  ? 187  ASN C ND2   1 
ATOM   4987  N  N     . LYS C  2  188  ? 51.672  -24.360 47.706  1.00 105.62 ? 188  LYS C N     1 
ATOM   4988  C  CA    . LYS C  2  188  ? 50.417  -23.746 47.268  1.00 109.54 ? 188  LYS C CA    1 
ATOM   4989  C  C     . LYS C  2  188  ? 49.875  -24.276 45.938  1.00 103.82 ? 188  LYS C C     1 
ATOM   4990  O  O     . LYS C  2  188  ? 48.900  -23.743 45.412  1.00 104.30 ? 188  LYS C O     1 
ATOM   4991  C  CB    . LYS C  2  188  ? 50.542  -22.219 47.232  1.00 115.06 ? 188  LYS C CB    1 
ATOM   4992  C  CG    . LYS C  2  188  ? 51.029  -21.601 48.538  1.00 118.09 ? 188  LYS C CG    1 
ATOM   4993  C  CD    . LYS C  2  188  ? 51.040  -20.074 48.454  1.00 118.77 ? 188  LYS C CD    1 
ATOM   4994  C  CE    . LYS C  2  188  ? 51.864  -19.469 49.583  1.00 117.03 ? 188  LYS C CE    1 
ATOM   4995  N  NZ    . LYS C  2  188  ? 53.313  -19.807 49.461  1.00 128.25 ? 188  LYS C NZ    1 
ATOM   4996  N  N     . ARG C  2  189  ? 50.499  -25.322 45.404  1.00 100.75 ? 189  ARG C N     1 
ATOM   4997  C  CA    . ARG C  2  189  ? 50.010  -25.949 44.180  1.00 97.97  ? 189  ARG C CA    1 
ATOM   4998  C  C     . ARG C  2  189  ? 49.500  -27.362 44.439  1.00 94.71  ? 189  ARG C C     1 
ATOM   4999  O  O     . ARG C  2  189  ? 50.203  -28.183 45.020  1.00 91.63  ? 189  ARG C O     1 
ATOM   5000  C  CB    . ARG C  2  189  ? 51.094  -25.968 43.099  1.00 96.66  ? 189  ARG C CB    1 
ATOM   5001  C  CG    . ARG C  2  189  ? 51.543  -24.591 42.642  1.00 106.40 ? 189  ARG C CG    1 
ATOM   5002  C  CD    . ARG C  2  189  ? 52.325  -24.660 41.338  1.00 110.98 ? 189  ARG C CD    1 
ATOM   5003  N  NE    . ARG C  2  189  ? 52.876  -23.358 40.967  1.00 120.68 ? 189  ARG C NE    1 
ATOM   5004  C  CZ    . ARG C  2  189  ? 53.442  -23.087 39.795  1.00 127.88 ? 189  ARG C CZ    1 
ATOM   5005  N  NH1   . ARG C  2  189  ? 53.529  -24.027 38.865  1.00 133.90 ? 189  ARG C NH1   1 
ATOM   5006  N  NH2   . ARG C  2  189  ? 53.919  -21.873 39.549  1.00 127.91 ? 189  ARG C NH2   1 
ATOM   5007  N  N     . LYS C  2  190  ? 48.271  -27.638 44.013  1.00 102.13 ? 190  LYS C N     1 
ATOM   5008  C  CA    . LYS C  2  190  ? 47.685  -28.964 44.179  1.00 96.89  ? 190  LYS C CA    1 
ATOM   5009  C  C     . LYS C  2  190  ? 47.841  -29.784 42.906  1.00 90.81  ? 190  LYS C C     1 
ATOM   5010  O  O     . LYS C  2  190  ? 47.666  -29.269 41.805  1.00 88.54  ? 190  LYS C O     1 
ATOM   5011  C  CB    . LYS C  2  190  ? 46.198  -28.866 44.538  1.00 86.08  ? 190  LYS C CB    1 
ATOM   5012  C  CG    . LYS C  2  190  ? 45.899  -28.138 45.830  1.00 87.75  ? 190  LYS C CG    1 
ATOM   5013  C  CD    . LYS C  2  190  ? 44.410  -28.179 46.154  1.00 97.23  ? 190  LYS C CD    1 
ATOM   5014  C  CE    . LYS C  2  190  ? 43.919  -29.607 46.354  1.00 102.98 ? 190  LYS C CE    1 
ATOM   5015  N  NZ    . LYS C  2  190  ? 42.481  -29.674 46.758  1.00 108.20 ? 190  LYS C NZ    1 
ATOM   5016  N  N     . PHE C  2  191  ? 48.173  -31.061 43.058  1.00 88.48  ? 191  PHE C N     1 
ATOM   5017  C  CA    . PHE C  2  191  ? 48.143  -31.980 41.925  1.00 87.77  ? 191  PHE C CA    1 
ATOM   5018  C  C     . PHE C  2  191  ? 47.710  -33.365 42.389  1.00 94.01  ? 191  PHE C C     1 
ATOM   5019  O  O     . PHE C  2  191  ? 47.713  -33.640 43.577  1.00 98.50  ? 191  PHE C O     1 
ATOM   5020  C  CB    . PHE C  2  191  ? 49.498  -32.032 41.223  1.00 89.97  ? 191  PHE C CB    1 
ATOM   5021  C  CG    . PHE C  2  191  ? 50.594  -32.627 42.053  1.00 93.51  ? 191  PHE C CG    1 
ATOM   5022  C  CD1   . PHE C  2  191  ? 50.726  -33.999 42.168  1.00 93.39  ? 191  PHE C CD1   1 
ATOM   5023  C  CD2   . PHE C  2  191  ? 51.508  -31.815 42.698  1.00 94.47  ? 191  PHE C CD2   1 
ATOM   5024  C  CE1   . PHE C  2  191  ? 51.739  -34.551 42.922  1.00 92.09  ? 191  PHE C CE1   1 
ATOM   5025  C  CE2   . PHE C  2  191  ? 52.524  -32.361 43.451  1.00 94.35  ? 191  PHE C CE2   1 
ATOM   5026  C  CZ    . PHE C  2  191  ? 52.639  -33.732 43.563  1.00 91.22  ? 191  PHE C CZ    1 
ATOM   5027  N  N     . PRO C  2  192  ? 47.319  -34.242 41.456  1.00 96.56  ? 192  PRO C N     1 
ATOM   5028  C  CA    . PRO C  2  192  ? 46.890  -35.576 41.890  1.00 99.99  ? 192  PRO C CA    1 
ATOM   5029  C  C     . PRO C  2  192  ? 48.049  -36.368 42.488  1.00 93.83  ? 192  PRO C C     1 
ATOM   5030  O  O     . PRO C  2  192  ? 49.130  -36.405 41.909  1.00 91.46  ? 192  PRO C O     1 
ATOM   5031  C  CB    . PRO C  2  192  ? 46.409  -36.225 40.593  1.00 96.78  ? 192  PRO C CB    1 
ATOM   5032  C  CG    . PRO C  2  192  ? 47.148  -35.506 39.521  1.00 94.16  ? 192  PRO C CG    1 
ATOM   5033  C  CD    . PRO C  2  192  ? 47.268  -34.092 39.994  1.00 87.89  ? 192  PRO C CD    1 
ATOM   5034  N  N     . LEU C  2  193  ? 47.816  -36.990 43.639  1.00 90.13  ? 193  LEU C N     1 
ATOM   5035  C  CA    . LEU C  2  193  ? 48.860  -37.713 44.355  1.00 84.79  ? 193  LEU C CA    1 
ATOM   5036  C  C     . LEU C  2  193  ? 49.373  -38.897 43.544  1.00 87.36  ? 193  LEU C C     1 
ATOM   5037  O  O     . LEU C  2  193  ? 50.519  -39.326 43.699  1.00 87.89  ? 193  LEU C O     1 
ATOM   5038  C  CB    . LEU C  2  193  ? 48.322  -38.191 45.706  1.00 87.80  ? 193  LEU C CB    1 
ATOM   5039  C  CG    . LEU C  2  193  ? 49.247  -38.951 46.657  1.00 73.35  ? 193  LEU C CG    1 
ATOM   5040  C  CD1   . LEU C  2  193  ? 50.368  -38.065 47.151  1.00 69.81  ? 193  LEU C CD1   1 
ATOM   5041  C  CD2   . LEU C  2  193  ? 48.442  -39.489 47.824  1.00 76.76  ? 193  LEU C CD2   1 
ATOM   5042  N  N     . VAL C  2  194  ? 48.515  -39.416 42.672  1.00 94.29  ? 194  VAL C N     1 
ATOM   5043  C  CA    . VAL C  2  194  ? 48.831  -40.602 41.886  1.00 90.34  ? 194  VAL C CA    1 
ATOM   5044  C  C     . VAL C  2  194  ? 50.049  -40.395 41.001  1.00 91.22  ? 194  VAL C C     1 
ATOM   5045  O  O     . VAL C  2  194  ? 50.802  -41.330 40.751  1.00 94.12  ? 194  VAL C O     1 
ATOM   5046  C  CB    . VAL C  2  194  ? 47.655  -41.001 40.995  1.00 90.37  ? 194  VAL C CB    1 
ATOM   5047  C  CG1   . VAL C  2  194  ? 47.672  -42.500 40.753  1.00 95.05  ? 194  VAL C CG1   1 
ATOM   5048  C  CG2   . VAL C  2  194  ? 46.347  -40.568 41.640  1.00 101.15 ? 194  VAL C CG2   1 
ATOM   5049  N  N     . LEU C  2  195  ? 50.233  -39.169 40.523  1.00 89.42  ? 195  LEU C N     1 
ATOM   5050  C  CA    . LEU C  2  195  ? 51.378  -38.836 39.683  1.00 89.76  ? 195  LEU C CA    1 
ATOM   5051  C  C     . LEU C  2  195  ? 52.687  -39.064 40.434  1.00 92.38  ? 195  LEU C C     1 
ATOM   5052  O  O     . LEU C  2  195  ? 53.589  -39.761 39.951  1.00 89.26  ? 195  LEU C O     1 
ATOM   5053  C  CB    . LEU C  2  195  ? 51.280  -37.384 39.220  1.00 88.18  ? 195  LEU C CB    1 
ATOM   5054  C  CG    . LEU C  2  195  ? 52.338  -36.898 38.232  1.00 97.71  ? 195  LEU C CG    1 
ATOM   5055  C  CD1   . LEU C  2  195  ? 52.378  -37.795 37.009  1.00 103.75 ? 195  LEU C CD1   1 
ATOM   5056  C  CD2   . LEU C  2  195  ? 52.061  -35.462 37.834  1.00 101.35 ? 195  LEU C CD2   1 
ATOM   5057  N  N     . LEU C  2  196  ? 52.780  -38.476 41.623  1.00 94.39  ? 196  LEU C N     1 
ATOM   5058  C  CA    . LEU C  2  196  ? 53.939  -38.664 42.487  1.00 92.94  ? 196  LEU C CA    1 
ATOM   5059  C  C     . LEU C  2  196  ? 54.104  -40.142 42.811  1.00 91.34  ? 196  LEU C C     1 
ATOM   5060  O  O     . LEU C  2  196  ? 55.202  -40.685 42.719  1.00 92.30  ? 196  LEU C O     1 
ATOM   5061  C  CB    . LEU C  2  196  ? 53.786  -37.864 43.781  1.00 88.72  ? 196  LEU C CB    1 
ATOM   5062  C  CG    . LEU C  2  196  ? 55.069  -37.364 44.451  1.00 84.31  ? 196  LEU C CG    1 
ATOM   5063  C  CD1   . LEU C  2  196  ? 54.748  -36.763 45.807  1.00 79.82  ? 196  LEU C CD1   1 
ATOM   5064  C  CD2   . LEU C  2  196  ? 56.096  -38.468 44.595  1.00 77.64  ? 196  LEU C CD2   1 
ATOM   5065  N  N     . LEU C  2  197  ? 53.010  -40.789 43.195  1.00 90.33  ? 197  LEU C N     1 
ATOM   5066  C  CA    . LEU C  2  197  ? 53.043  -42.222 43.458  1.00 90.85  ? 197  LEU C CA    1 
ATOM   5067  C  C     . LEU C  2  197  ? 53.727  -42.970 42.317  1.00 93.70  ? 197  LEU C C     1 
ATOM   5068  O  O     . LEU C  2  197  ? 54.569  -43.838 42.545  1.00 91.62  ? 197  LEU C O     1 
ATOM   5069  C  CB    . LEU C  2  197  ? 51.630  -42.757 43.673  1.00 88.85  ? 197  LEU C CB    1 
ATOM   5070  C  CG    . LEU C  2  197  ? 50.964  -42.273 44.958  1.00 87.24  ? 197  LEU C CG    1 
ATOM   5071  C  CD1   . LEU C  2  197  ? 49.493  -42.654 44.980  1.00 94.59  ? 197  LEU C CD1   1 
ATOM   5072  C  CD2   . LEU C  2  197  ? 51.692  -42.836 46.167  1.00 81.49  ? 197  LEU C CD2   1 
ATOM   5073  N  N     . ARG C  2  198  ? 53.364  -42.623 41.087  1.00 94.10  ? 198  ARG C N     1 
ATOM   5074  C  CA    . ARG C  2  198  ? 53.968  -43.238 39.915  1.00 93.75  ? 198  ARG C CA    1 
ATOM   5075  C  C     . ARG C  2  198  ? 55.463  -42.948 39.881  1.00 96.39  ? 198  ARG C C     1 
ATOM   5076  O  O     . ARG C  2  198  ? 56.274  -43.858 39.710  1.00 99.79  ? 198  ARG C O     1 
ATOM   5077  C  CB    . ARG C  2  198  ? 53.301  -42.734 38.636  1.00 97.35  ? 198  ARG C CB    1 
ATOM   5078  C  CG    . ARG C  2  198  ? 53.822  -43.392 37.368  1.00 112.90 ? 198  ARG C CG    1 
ATOM   5079  C  CD    . ARG C  2  198  ? 53.541  -44.889 37.356  1.00 119.70 ? 198  ARG C CD    1 
ATOM   5080  N  NE    . ARG C  2  198  ? 54.111  -45.544 36.181  1.00 127.56 ? 198  ARG C NE    1 
ATOM   5081  C  CZ    . ARG C  2  198  ? 54.042  -46.851 35.947  1.00 130.04 ? 198  ARG C CZ    1 
ATOM   5082  N  NH1   . ARG C  2  198  ? 54.591  -47.361 34.852  1.00 136.97 ? 198  ARG C NH1   1 
ATOM   5083  N  NH2   . ARG C  2  198  ? 53.425  -47.648 36.808  1.00 127.91 ? 198  ARG C NH2   1 
ATOM   5084  N  N     . VAL C  2  199  ? 55.828  -41.681 40.055  1.00 93.68  ? 199  VAL C N     1 
ATOM   5085  C  CA    . VAL C  2  199  ? 57.237  -41.299 40.058  1.00 86.07  ? 199  VAL C CA    1 
ATOM   5086  C  C     . VAL C  2  199  ? 58.057  -42.157 41.021  1.00 86.65  ? 199  VAL C C     1 
ATOM   5087  O  O     . VAL C  2  199  ? 59.234  -42.413 40.789  1.00 90.36  ? 199  VAL C O     1 
ATOM   5088  C  CB    . VAL C  2  199  ? 57.419  -39.817 40.428  1.00 82.01  ? 199  VAL C CB    1 
ATOM   5089  C  CG1   . VAL C  2  199  ? 58.895  -39.453 40.456  1.00 80.37  ? 199  VAL C CG1   1 
ATOM   5090  C  CG2   . VAL C  2  199  ? 56.663  -38.933 39.456  1.00 89.71  ? 199  VAL C CG2   1 
ATOM   5091  N  N     . LEU C  2  200  ? 57.421  -42.607 42.097  1.00 92.92  ? 200  LEU C N     1 
ATOM   5092  C  CA    . LEU C  2  200  ? 58.106  -43.367 43.139  1.00 92.45  ? 200  LEU C CA    1 
ATOM   5093  C  C     . LEU C  2  200  ? 58.237  -44.839 42.770  1.00 93.95  ? 200  LEU C C     1 
ATOM   5094  O  O     . LEU C  2  200  ? 58.817  -45.629 43.517  1.00 99.34  ? 200  LEU C O     1 
ATOM   5095  C  CB    . LEU C  2  200  ? 57.368  -43.228 44.472  1.00 90.52  ? 200  LEU C CB    1 
ATOM   5096  C  CG    . LEU C  2  200  ? 57.190  -41.805 45.004  1.00 85.73  ? 200  LEU C CG    1 
ATOM   5097  C  CD1   . LEU C  2  200  ? 56.244  -41.788 46.187  1.00 84.52  ? 200  LEU C CD1   1 
ATOM   5098  C  CD2   . LEU C  2  200  ? 58.529  -41.196 45.378  1.00 87.77  ? 200  LEU C CD2   1 
ATOM   5099  N  N     . GLY C  2  201  ? 57.687  -45.202 41.616  1.00 94.91  ? 201  GLY C N     1 
ATOM   5100  C  CA    . GLY C  2  201  ? 57.787  -46.562 41.122  1.00 97.06  ? 201  GLY C CA    1 
ATOM   5101  C  C     . GLY C  2  201  ? 56.614  -47.437 41.515  1.00 97.38  ? 201  GLY C C     1 
ATOM   5102  O  O     . GLY C  2  201  ? 56.708  -48.663 41.479  1.00 96.13  ? 201  GLY C O     1 
ATOM   5103  N  N     . TYR C  2  202  ? 55.506  -46.812 41.895  1.00 100.11 ? 202  TYR C N     1 
ATOM   5104  C  CA    . TYR C  2  202  ? 54.311  -47.561 42.258  1.00 104.09 ? 202  TYR C CA    1 
ATOM   5105  C  C     . TYR C  2  202  ? 53.516  -47.947 41.021  1.00 109.30 ? 202  TYR C C     1 
ATOM   5106  O  O     . TYR C  2  202  ? 53.379  -47.160 40.086  1.00 105.96 ? 202  TYR C O     1 
ATOM   5107  C  CB    . TYR C  2  202  ? 53.429  -46.764 43.221  1.00 99.96  ? 202  TYR C CB    1 
ATOM   5108  C  CG    . TYR C  2  202  ? 53.883  -46.807 44.662  1.00 94.12  ? 202  TYR C CG    1 
ATOM   5109  C  CD1   . TYR C  2  202  ? 53.605  -47.903 45.466  1.00 97.76  ? 202  TYR C CD1   1 
ATOM   5110  C  CD2   . TYR C  2  202  ? 54.579  -45.747 45.221  1.00 93.43  ? 202  TYR C CD2   1 
ATOM   5111  C  CE1   . TYR C  2  202  ? 54.015  -47.944 46.786  1.00 92.20  ? 202  TYR C CE1   1 
ATOM   5112  C  CE2   . TYR C  2  202  ? 54.992  -45.779 46.539  1.00 91.69  ? 202  TYR C CE2   1 
ATOM   5113  C  CZ    . TYR C  2  202  ? 54.708  -46.878 47.317  1.00 87.35  ? 202  TYR C CZ    1 
ATOM   5114  O  OH    . TYR C  2  202  ? 55.121  -46.905 48.628  1.00 83.81  ? 202  TYR C OH    1 
ATOM   5115  N  N     . ASP C  2  203  ? 52.995  -49.168 41.024  1.00 119.71 ? 203  ASP C N     1 
ATOM   5116  C  CA    . ASP C  2  203  ? 52.174  -49.650 39.925  1.00 126.56 ? 203  ASP C CA    1 
ATOM   5117  C  C     . ASP C  2  203  ? 50.749  -49.885 40.408  1.00 129.61 ? 203  ASP C C     1 
ATOM   5118  O  O     . ASP C  2  203  ? 50.529  -50.218 41.571  1.00 130.69 ? 203  ASP C O     1 
ATOM   5119  C  CB    . ASP C  2  203  ? 52.760  -50.939 39.349  1.00 133.35 ? 203  ASP C CB    1 
ATOM   5120  C  CG    . ASP C  2  203  ? 52.146  -51.312 38.016  1.00 141.51 ? 203  ASP C CG    1 
ATOM   5121  O  OD1   . ASP C  2  203  ? 52.207  -52.504 37.646  1.00 153.41 ? 203  ASP C OD1   1 
ATOM   5122  O  OD2   . ASP C  2  203  ? 51.602  -50.414 37.337  1.00 138.90 ? 203  ASP C OD2   1 
ATOM   5123  N  N     . GLN C  2  204  ? 49.785  -49.707 39.510  1.00 130.21 ? 204  GLN C N     1 
ATOM   5124  C  CA    . GLN C  2  204  ? 48.375  -49.864 39.849  1.00 131.83 ? 204  GLN C CA    1 
ATOM   5125  C  C     . GLN C  2  204  ? 48.112  -51.134 40.659  1.00 133.30 ? 204  GLN C C     1 
ATOM   5126  O  O     . GLN C  2  204  ? 47.337  -51.124 41.617  1.00 135.48 ? 204  GLN C O     1 
ATOM   5127  C  CB    . GLN C  2  204  ? 47.529  -49.859 38.578  1.00 134.82 ? 204  GLN C CB    1 
ATOM   5128  C  CG    . GLN C  2  204  ? 46.038  -49.928 38.831  1.00 137.76 ? 204  GLN C CG    1 
ATOM   5129  C  CD    . GLN C  2  204  ? 45.235  -49.818 37.554  1.00 141.08 ? 204  GLN C CD    1 
ATOM   5130  O  OE1   . GLN C  2  204  ? 45.759  -49.426 36.511  1.00 146.94 ? 204  GLN C OE1   1 
ATOM   5131  N  NE2   . GLN C  2  204  ? 43.956  -50.167 37.627  1.00 139.22 ? 204  GLN C NE2   1 
ATOM   5132  N  N     . GLU C  2  205  ? 48.762  -52.225 40.270  1.00 138.04 ? 205  GLU C N     1 
ATOM   5133  C  CA    . GLU C  2  205  ? 48.669  -53.483 41.002  1.00 141.95 ? 205  GLU C CA    1 
ATOM   5134  C  C     . GLU C  2  205  ? 49.172  -53.294 42.429  1.00 139.59 ? 205  GLU C C     1 
ATOM   5135  O  O     . GLU C  2  205  ? 48.456  -53.560 43.402  1.00 135.87 ? 205  GLU C O     1 
ATOM   5136  C  CB    . GLU C  2  205  ? 49.507  -54.555 40.302  1.00 149.26 ? 205  GLU C CB    1 
ATOM   5137  C  CG    . GLU C  2  205  ? 49.429  -55.936 40.931  1.00 155.76 ? 205  GLU C CG    1 
ATOM   5138  C  CD    . GLU C  2  205  ? 48.253  -56.746 40.421  1.00 170.85 ? 205  GLU C CD    1 
ATOM   5139  O  OE1   . GLU C  2  205  ? 47.497  -56.232 39.570  1.00 172.75 ? 205  GLU C OE1   1 
ATOM   5140  O  OE2   . GLU C  2  205  ? 48.088  -57.902 40.866  1.00 182.72 ? 205  GLU C OE2   1 
ATOM   5141  N  N     . THR C  2  206  ? 50.412  -52.823 42.535  1.00 137.42 ? 206  THR C N     1 
ATOM   5142  C  CA    . THR C  2  206  ? 51.070  -52.602 43.819  1.00 129.61 ? 206  THR C CA    1 
ATOM   5143  C  C     . THR C  2  206  ? 50.185  -51.814 44.781  1.00 127.49 ? 206  THR C C     1 
ATOM   5144  O  O     . THR C  2  206  ? 50.121  -52.125 45.968  1.00 127.85 ? 206  THR C O     1 
ATOM   5145  C  CB    . THR C  2  206  ? 52.408  -51.854 43.639  1.00 124.65 ? 206  THR C CB    1 
ATOM   5146  O  OG1   . THR C  2  206  ? 53.148  -52.439 42.561  1.00 131.81 ? 206  THR C OG1   1 
ATOM   5147  C  CG2   . THR C  2  206  ? 53.235  -51.921 44.911  1.00 115.33 ? 206  THR C CG2   1 
ATOM   5148  N  N     . LEU C  2  207  ? 49.553  -50.764 44.264  1.00 127.28 ? 207  LEU C N     1 
ATOM   5149  C  CA    . LEU C  2  207  ? 48.533  -50.014 44.993  1.00 125.37 ? 207  LEU C CA    1 
ATOM   5150  C  C     . LEU C  2  207  ? 47.238  -50.787 45.279  1.00 124.14 ? 207  LEU C C     1 
ATOM   5151  O  O     . LEU C  2  207  ? 46.678  -50.687 46.370  1.00 121.12 ? 207  LEU C O     1 
ATOM   5152  C  CB    . LEU C  2  207  ? 48.206  -48.712 44.256  1.00 122.77 ? 207  LEU C CB    1 
ATOM   5153  C  CG    . LEU C  2  207  ? 49.389  -47.788 43.957  1.00 117.22 ? 207  LEU C CG    1 
ATOM   5154  C  CD1   . LEU C  2  207  ? 48.935  -46.575 43.160  1.00 118.17 ? 207  LEU C CD1   1 
ATOM   5155  C  CD2   . LEU C  2  207  ? 50.075  -47.360 45.245  1.00 108.65 ? 207  LEU C CD2   1 
ATOM   5156  N  N     . ALA C  2  208  ? 46.762  -51.543 44.290  1.00 134.29 ? 208  ALA C N     1 
ATOM   5157  C  CA    . ALA C  2  208  ? 45.442  -52.179 44.366  1.00 132.80 ? 208  ALA C CA    1 
ATOM   5158  C  C     . ALA C  2  208  ? 45.318  -53.201 45.492  1.00 127.32 ? 208  ALA C C     1 
ATOM   5159  O  O     . ALA C  2  208  ? 44.317  -53.235 46.208  1.00 121.19 ? 208  ALA C O     1 
ATOM   5160  C  CB    . ALA C  2  208  ? 45.088  -52.817 43.030  1.00 139.23 ? 208  ALA C CB    1 
ATOM   5161  N  N     . ARG C  2  209  ? 46.349  -54.020 45.649  1.00 127.11 ? 209  ARG C N     1 
ATOM   5162  C  CA    . ARG C  2  209  ? 46.464  -54.931 46.781  1.00 126.85 ? 209  ARG C CA    1 
ATOM   5163  C  C     . ARG C  2  209  ? 46.648  -54.172 48.093  1.00 130.91 ? 209  ARG C C     1 
ATOM   5164  O  O     . ARG C  2  209  ? 46.137  -54.588 49.132  1.00 130.48 ? 209  ARG C O     1 
ATOM   5165  C  CB    . ARG C  2  209  ? 47.590  -55.951 46.572  1.00 127.87 ? 209  ARG C CB    1 
ATOM   5166  C  CG    . ARG C  2  209  ? 48.897  -55.366 46.071  1.00 135.09 ? 209  ARG C CG    1 
ATOM   5167  C  CD    . ARG C  2  209  ? 49.995  -56.416 46.023  1.00 135.38 ? 209  ARG C CD    1 
ATOM   5168  N  NE    . ARG C  2  209  ? 50.385  -56.851 47.361  1.00 140.52 ? 209  ARG C NE    1 
ATOM   5169  C  CZ    . ARG C  2  209  ? 51.318  -56.257 48.097  1.00 139.90 ? 209  ARG C CZ    1 
ATOM   5170  N  NH1   . ARG C  2  209  ? 51.963  -55.199 47.624  1.00 130.51 ? 209  ARG C NH1   1 
ATOM   5171  N  NH2   . ARG C  2  209  ? 51.610  -56.718 49.306  1.00 137.01 ? 209  ARG C NH2   1 
ATOM   5172  N  N     . GLU C  2  210  ? 47.369  -53.054 48.041  1.00 132.37 ? 210  GLU C N     1 
ATOM   5173  C  CA    . GLU C  2  210  ? 47.671  -52.295 49.250  1.00 128.43 ? 210  GLU C CA    1 
ATOM   5174  C  C     . GLU C  2  210  ? 46.470  -51.546 49.827  1.00 121.98 ? 210  GLU C C     1 
ATOM   5175  O  O     . GLU C  2  210  ? 46.121  -51.723 50.994  1.00 116.09 ? 210  GLU C O     1 
ATOM   5176  C  CB    . GLU C  2  210  ? 48.809  -51.311 48.986  1.00 120.96 ? 210  GLU C CB    1 
ATOM   5177  C  CG    . GLU C  2  210  ? 49.809  -51.224 50.116  1.00 122.44 ? 210  GLU C CG    1 
ATOM   5178  C  CD    . GLU C  2  210  ? 50.525  -52.539 50.349  1.00 131.61 ? 210  GLU C CD    1 
ATOM   5179  O  OE1   . GLU C  2  210  ? 51.020  -53.131 49.365  1.00 130.52 ? 210  GLU C OE1   1 
ATOM   5180  O  OE2   . GLU C  2  210  ? 50.586  -52.984 51.514  1.00 136.55 ? 210  GLU C OE2   1 
ATOM   5181  N  N     . LEU C  2  211  ? 45.847  -50.706 49.008  1.00 121.58 ? 211  LEU C N     1 
ATOM   5182  C  CA    . LEU C  2  211  ? 44.761  -49.850 49.476  1.00 114.79 ? 211  LEU C CA    1 
ATOM   5183  C  C     . LEU C  2  211  ? 43.356  -50.370 49.174  1.00 118.48 ? 211  LEU C C     1 
ATOM   5184  O  O     . LEU C  2  211  ? 42.368  -49.731 49.534  1.00 114.02 ? 211  LEU C O     1 
ATOM   5185  C  CB    . LEU C  2  211  ? 44.923  -48.426 48.937  1.00 109.41 ? 211  LEU C CB    1 
ATOM   5186  C  CG    . LEU C  2  211  ? 46.256  -47.755 49.273  1.00 106.86 ? 211  LEU C CG    1 
ATOM   5187  C  CD1   . LEU C  2  211  ? 47.245  -47.931 48.140  1.00 121.08 ? 211  LEU C CD1   1 
ATOM   5188  C  CD2   . LEU C  2  211  ? 46.053  -46.292 49.575  1.00 97.44  ? 211  LEU C CD2   1 
ATOM   5189  N  N     . GLY C  2  212  ? 43.270  -51.522 48.516  1.00 124.83 ? 212  GLY C N     1 
ATOM   5190  C  CA    . GLY C  2  212  ? 41.991  -52.065 48.088  1.00 127.35 ? 212  GLY C CA    1 
ATOM   5191  C  C     . GLY C  2  212  ? 40.995  -52.349 49.200  1.00 123.80 ? 212  GLY C C     1 
ATOM   5192  O  O     . GLY C  2  212  ? 39.782  -52.242 49.000  1.00 120.08 ? 212  GLY C O     1 
ATOM   5193  N  N     . ALA C  2  213  ? 41.511  -52.705 50.373  1.00 118.90 ? 213  ALA C N     1 
ATOM   5194  C  CA    . ALA C  2  213  ? 40.672  -53.081 51.511  1.00 124.16 ? 213  ALA C CA    1 
ATOM   5195  C  C     . ALA C  2  213  ? 39.619  -52.027 51.862  1.00 122.34 ? 213  ALA C C     1 
ATOM   5196  O  O     . ALA C  2  213  ? 38.526  -52.358 52.324  1.00 125.02 ? 213  ALA C O     1 
ATOM   5197  C  CB    . ALA C  2  213  ? 41.542  -53.401 52.726  1.00 116.11 ? 213  ALA C CB    1 
ATOM   5198  N  N     . TYR C  2  214  ? 39.952  -50.760 51.634  1.00 122.38 ? 214  TYR C N     1 
ATOM   5199  C  CA    . TYR C  2  214  ? 39.031  -49.660 51.884  1.00 121.79 ? 214  TYR C CA    1 
ATOM   5200  C  C     . TYR C  2  214  ? 38.329  -49.352 50.576  1.00 127.26 ? 214  TYR C C     1 
ATOM   5201  O  O     . TYR C  2  214  ? 38.937  -48.846 49.630  1.00 128.10 ? 214  TYR C O     1 
ATOM   5202  C  CB    . TYR C  2  214  ? 39.803  -48.445 52.400  1.00 109.22 ? 214  TYR C CB    1 
ATOM   5203  C  CG    . TYR C  2  214  ? 40.970  -48.855 53.267  1.00 107.95 ? 214  TYR C CG    1 
ATOM   5204  C  CD1   . TYR C  2  214  ? 40.797  -49.122 54.618  1.00 104.63 ? 214  TYR C CD1   1 
ATOM   5205  C  CD2   . TYR C  2  214  ? 42.242  -49.012 52.728  1.00 108.31 ? 214  TYR C CD2   1 
ATOM   5206  C  CE1   . TYR C  2  214  ? 41.859  -49.519 55.411  1.00 100.90 ? 214  TYR C CE1   1 
ATOM   5207  C  CE2   . TYR C  2  214  ? 43.310  -49.408 53.514  1.00 101.24 ? 214  TYR C CE2   1 
ATOM   5208  C  CZ    . TYR C  2  214  ? 43.114  -49.659 54.854  1.00 96.19  ? 214  TYR C CZ    1 
ATOM   5209  O  OH    . TYR C  2  214  ? 44.177  -50.052 55.637  1.00 90.85  ? 214  TYR C OH    1 
ATOM   5210  N  N     . GLY C  2  215  ? 37.043  -49.668 50.526  1.00 130.54 ? 215  GLY C N     1 
ATOM   5211  C  CA    . GLY C  2  215  ? 36.320  -49.624 49.278  1.00 134.58 ? 215  GLY C CA    1 
ATOM   5212  C  C     . GLY C  2  215  ? 36.114  -48.210 48.796  1.00 132.28 ? 215  GLY C C     1 
ATOM   5213  O  O     . GLY C  2  215  ? 36.098  -47.264 49.590  1.00 128.77 ? 215  GLY C O     1 
ATOM   5214  N  N     . GLU C  2  216  ? 35.996  -48.087 47.478  1.00 132.56 ? 216  GLU C N     1 
ATOM   5215  C  CA    . GLU C  2  216  ? 35.576  -46.877 46.757  1.00 137.02 ? 216  GLU C CA    1 
ATOM   5216  C  C     . GLU C  2  216  ? 36.611  -45.749 46.702  1.00 133.94 ? 216  GLU C C     1 
ATOM   5217  O  O     . GLU C  2  216  ? 36.509  -44.854 45.864  1.00 134.08 ? 216  GLU C O     1 
ATOM   5218  C  CB    . GLU C  2  216  ? 34.228  -46.332 47.270  1.00 137.80 ? 216  GLU C CB    1 
ATOM   5219  C  CG    . GLU C  2  216  ? 33.227  -47.375 47.773  1.00 138.71 ? 216  GLU C CG    1 
ATOM   5220  C  CD    . GLU C  2  216  ? 32.968  -48.487 46.776  1.00 142.22 ? 216  GLU C CD    1 
ATOM   5221  O  OE1   . GLU C  2  216  ? 31.988  -48.376 46.012  1.00 140.66 ? 216  GLU C OE1   1 
ATOM   5222  O  OE2   . GLU C  2  216  ? 33.730  -49.479 46.769  1.00 137.70 ? 216  GLU C OE2   1 
ATOM   5223  N  N     . LEU C  2  217  ? 37.608  -45.793 47.576  1.00 131.12 ? 217  LEU C N     1 
ATOM   5224  C  CA    . LEU C  2  217  ? 38.614  -44.737 47.613  1.00 123.52 ? 217  LEU C CA    1 
ATOM   5225  C  C     . LEU C  2  217  ? 39.694  -44.994 46.570  1.00 120.61 ? 217  LEU C C     1 
ATOM   5226  O  O     . LEU C  2  217  ? 40.115  -44.086 45.835  1.00 121.99 ? 217  LEU C O     1 
ATOM   5227  C  CB    . LEU C  2  217  ? 39.209  -44.620 49.020  1.00 119.53 ? 217  LEU C CB    1 
ATOM   5228  C  CG    . LEU C  2  217  ? 38.218  -44.212 50.122  1.00 118.65 ? 217  LEU C CG    1 
ATOM   5229  C  CD1   . LEU C  2  217  ? 38.740  -44.561 51.511  1.00 109.23 ? 217  LEU C CD1   1 
ATOM   5230  C  CD2   . LEU C  2  217  ? 37.857  -42.730 50.035  1.00 115.91 ? 217  LEU C CD2   1 
ATOM   5231  N  N     . VAL C  2  218  ? 40.108  -46.254 46.496  1.00 119.13 ? 218  VAL C N     1 
ATOM   5232  C  CA    . VAL C  2  218  ? 41.159  -46.685 45.589  1.00 119.94 ? 218  VAL C CA    1 
ATOM   5233  C  C     . VAL C  2  218  ? 40.814  -46.371 44.139  1.00 126.81 ? 218  VAL C C     1 
ATOM   5234  O  O     . VAL C  2  218  ? 41.680  -45.970 43.368  1.00 126.07 ? 218  VAL C O     1 
ATOM   5235  C  CB    . VAL C  2  218  ? 41.420  -48.188 45.720  1.00 122.75 ? 218  VAL C CB    1 
ATOM   5236  C  CG1   . VAL C  2  218  ? 42.908  -48.466 45.663  1.00 118.82 ? 218  VAL C CG1   1 
ATOM   5237  C  CG2   . VAL C  2  218  ? 40.829  -48.714 47.018  1.00 127.29 ? 218  VAL C CG2   1 
ATOM   5238  N  N     . GLN C  2  219  ? 39.548  -46.555 43.773  1.00 133.71 ? 219  GLN C N     1 
ATOM   5239  C  CA    . GLN C  2  219  ? 39.099  -46.247 42.417  1.00 135.64 ? 219  GLN C CA    1 
ATOM   5240  C  C     . GLN C  2  219  ? 39.174  -44.751 42.145  1.00 131.61 ? 219  GLN C C     1 
ATOM   5241  O  O     . GLN C  2  219  ? 39.402  -44.327 41.010  1.00 129.37 ? 219  GLN C O     1 
ATOM   5242  C  CB    . GLN C  2  219  ? 37.681  -46.764 42.169  1.00 137.99 ? 219  GLN C CB    1 
ATOM   5243  C  CG    . GLN C  2  219  ? 37.622  -48.181 41.616  1.00 141.22 ? 219  GLN C CG    1 
ATOM   5244  C  CD    . GLN C  2  219  ? 37.943  -49.236 42.657  1.00 143.75 ? 219  GLN C CD    1 
ATOM   5245  O  OE1   . GLN C  2  219  ? 37.593  -49.093 43.830  1.00 144.20 ? 219  GLN C OE1   1 
ATOM   5246  N  NE2   . GLN C  2  219  ? 38.612  -50.304 42.234  1.00 135.23 ? 219  GLN C NE2   1 
ATOM   5247  N  N     . GLY C  2  220  ? 38.979  -43.956 43.192  1.00 129.85 ? 220  GLY C N     1 
ATOM   5248  C  CA    . GLY C  2  220  ? 39.170  -42.523 43.103  1.00 127.34 ? 220  GLY C CA    1 
ATOM   5249  C  C     . GLY C  2  220  ? 40.641  -42.206 42.905  1.00 121.68 ? 220  GLY C C     1 
ATOM   5250  O  O     . GLY C  2  220  ? 40.991  -41.183 42.320  1.00 117.73 ? 220  GLY C O     1 
ATOM   5251  N  N     . LEU C  2  221  ? 41.495  -43.094 43.387  1.00 122.77 ? 221  LEU C N     1 
ATOM   5252  C  CA    . LEU C  2  221  ? 42.927  -43.070 43.112  1.00 120.15 ? 221  LEU C CA    1 
ATOM   5253  C  C     . LEU C  2  221  ? 43.354  -43.367 41.684  1.00 119.21 ? 221  LEU C C     1 
ATOM   5254  O  O     . LEU C  2  221  ? 44.291  -42.779 41.189  1.00 118.13 ? 221  LEU C O     1 
ATOM   5255  C  CB    . LEU C  2  221  ? 43.644  -44.040 44.040  1.00 124.66 ? 221  LEU C CB    1 
ATOM   5256  C  CG    . LEU C  2  221  ? 44.953  -43.586 44.665  1.00 103.97 ? 221  LEU C CG    1 
ATOM   5257  C  CD1   . LEU C  2  221  ? 45.177  -44.369 45.939  1.00 100.85 ? 221  LEU C CD1   1 
ATOM   5258  C  CD2   . LEU C  2  221  ? 46.088  -43.849 43.707  1.00 109.70 ? 221  LEU C CD2   1 
ATOM   5259  N  N     . MET C  2  222  ? 42.704  -44.321 41.036  1.00 128.06 ? 222  MET C N     1 
ATOM   5260  C  CA    . MET C  2  222  ? 43.233  -44.870 39.796  1.00 129.87 ? 222  MET C CA    1 
ATOM   5261  C  C     . MET C  2  222  ? 43.033  -43.989 38.574  1.00 134.91 ? 222  MET C C     1 
ATOM   5262  O  O     . MET C  2  222  ? 41.917  -43.628 38.217  1.00 133.80 ? 222  MET C O     1 
ATOM   5263  C  CB    . MET C  2  222  ? 42.605  -46.230 39.531  1.00 129.50 ? 222  MET C CB    1 
ATOM   5264  C  CG    . MET C  2  222  ? 42.647  -47.163 40.721  1.00 132.35 ? 222  MET C CG    1 
ATOM   5265  S  SD    . MET C  2  222  ? 43.984  -48.356 40.602  1.00 136.30 ? 222  MET C SD    1 
ATOM   5266  C  CE    . MET C  2  222  ? 44.505  -48.445 42.300  1.00 133.13 ? 222  MET C CE    1 
ATOM   5267  N  N     . ASP C  2  223  ? 44.136  -43.666 37.918  1.00 135.73 ? 223  ASP C N     1 
ATOM   5268  C  CA    . ASP C  2  223  ? 44.085  -42.895 36.698  1.00 142.49 ? 223  ASP C CA    1 
ATOM   5269  C  C     . ASP C  2  223  ? 44.876  -43.602 35.621  1.00 147.40 ? 223  ASP C C     1 
ATOM   5270  O  O     . ASP C  2  223  ? 46.046  -43.916 35.788  1.00 143.72 ? 223  ASP C O     1 
ATOM   5271  C  CB    . ASP C  2  223  ? 44.624  -41.496 36.932  1.00 138.15 ? 223  ASP C CB    1 
ATOM   5272  C  CG    . ASP C  2  223  ? 45.017  -40.821 35.661  1.00 141.84 ? 223  ASP C CG    1 
ATOM   5273  O  OD1   . ASP C  2  223  ? 46.038  -41.227 35.076  1.00 148.77 ? 223  ASP C OD1   1 
ATOM   5274  O  OD2   . ASP C  2  223  ? 44.302  -39.892 35.241  1.00 136.99 ? 223  ASP C OD2   1 
ATOM   5275  N  N     . GLU C  2  224  ? 44.220  -43.839 34.503  1.00 152.87 ? 224  GLU C N     1 
ATOM   5276  C  CA    . GLU C  2  224  ? 44.773  -44.661 33.454  1.00 149.54 ? 224  GLU C CA    1 
ATOM   5277  C  C     . GLU C  2  224  ? 46.031  -44.089 32.843  1.00 147.73 ? 224  GLU C C     1 
ATOM   5278  O  O     . GLU C  2  224  ? 47.036  -44.779 32.676  1.00 145.37 ? 224  GLU C O     1 
ATOM   5279  C  CB    . GLU C  2  224  ? 43.725  -44.728 32.363  1.00 154.05 ? 224  GLU C CB    1 
ATOM   5280  C  CG    . GLU C  2  224  ? 42.915  -43.444 32.283  1.00 153.86 ? 224  GLU C CG    1 
ATOM   5281  C  CD    . GLU C  2  224  ? 41.921  -43.296 33.422  1.00 154.56 ? 224  GLU C CD    1 
ATOM   5282  O  OE1   . GLU C  2  224  ? 40.795  -43.818 33.312  1.00 153.06 ? 224  GLU C OE1   1 
ATOM   5283  O  OE2   . GLU C  2  224  ? 42.256  -42.649 34.427  1.00 155.54 ? 224  GLU C OE2   1 
ATOM   5284  N  N     . SER C  2  225  ? 45.978  -42.800 32.547  1.00 146.13 ? 225  SER C N     1 
ATOM   5285  C  CA    . SER C  2  225  ? 47.016  -42.162 31.772  1.00 142.78 ? 225  SER C CA    1 
ATOM   5286  C  C     . SER C  2  225  ? 48.303  -42.209 32.527  1.00 143.53 ? 225  SER C C     1 
ATOM   5287  O  O     . SER C  2  225  ? 49.349  -42.495 31.970  1.00 143.59 ? 225  SER C O     1 
ATOM   5288  C  CB    . SER C  2  225  ? 46.647  -40.716 31.562  1.00 139.08 ? 225  SER C CB    1 
ATOM   5289  O  OG    . SER C  2  225  ? 46.009  -40.237 32.723  1.00 145.92 ? 225  SER C OG    1 
ATOM   5290  N  N     . VAL C  2  226  ? 48.221  -41.924 33.814  1.00 144.80 ? 226  VAL C N     1 
ATOM   5291  C  CA    . VAL C  2  226  ? 49.409  -41.901 34.633  1.00 142.75 ? 226  VAL C CA    1 
ATOM   5292  C  C     . VAL C  2  226  ? 50.063  -43.262 34.693  1.00 142.54 ? 226  VAL C C     1 
ATOM   5293  O  O     . VAL C  2  226  ? 51.275  -43.380 34.633  1.00 141.69 ? 226  VAL C O     1 
ATOM   5294  C  CB    . VAL C  2  226  ? 49.089  -41.486 36.061  1.00 134.56 ? 226  VAL C CB    1 
ATOM   5295  C  CG1   . VAL C  2  226  ? 50.177  -41.992 36.987  1.00 125.85 ? 226  VAL C CG1   1 
ATOM   5296  C  CG2   . VAL C  2  226  ? 48.962  -39.981 36.145  1.00 125.41 ? 226  VAL C CG2   1 
ATOM   5297  N  N     . PHE C  2  227  ? 49.250  -44.295 34.815  1.00 142.86 ? 227  PHE C N     1 
ATOM   5298  C  CA    . PHE C  2  227  ? 49.781  -45.645 34.904  1.00 144.18 ? 227  PHE C CA    1 
ATOM   5299  C  C     . PHE C  2  227  ? 50.504  -46.050 33.630  1.00 144.60 ? 227  PHE C C     1 
ATOM   5300  O  O     . PHE C  2  227  ? 51.451  -46.825 33.658  1.00 141.00 ? 227  PHE C O     1 
ATOM   5301  C  CB    . PHE C  2  227  ? 48.705  -46.630 35.330  1.00 147.25 ? 227  PHE C CB    1 
ATOM   5302  C  CG    . PHE C  2  227  ? 48.372  -46.540 36.788  1.00 142.02 ? 227  PHE C CG    1 
ATOM   5303  C  CD1   . PHE C  2  227  ? 49.245  -47.027 37.735  1.00 136.88 ? 227  PHE C CD1   1 
ATOM   5304  C  CD2   . PHE C  2  227  ? 47.209  -45.941 37.208  1.00 140.88 ? 227  PHE C CD2   1 
ATOM   5305  C  CE1   . PHE C  2  227  ? 48.954  -46.940 39.073  1.00 133.90 ? 227  PHE C CE1   1 
ATOM   5306  C  CE2   . PHE C  2  227  ? 46.910  -45.846 38.548  1.00 138.54 ? 227  PHE C CE2   1 
ATOM   5307  C  CZ    . PHE C  2  227  ? 47.784  -46.347 39.481  1.00 136.34 ? 227  PHE C CZ    1 
ATOM   5308  N  N     . ALA C  2  228  ? 50.037  -45.528 32.508  1.00 146.22 ? 228  ALA C N     1 
ATOM   5309  C  CA    . ALA C  2  228  ? 50.700  -45.758 31.243  1.00 144.45 ? 228  ALA C CA    1 
ATOM   5310  C  C     . ALA C  2  228  ? 52.122  -45.208 31.253  1.00 143.09 ? 228  ALA C C     1 
ATOM   5311  O  O     . ALA C  2  228  ? 53.040  -45.849 30.750  1.00 141.08 ? 228  ALA C O     1 
ATOM   5312  C  CB    . ALA C  2  228  ? 49.909  -45.116 30.129  1.00 140.56 ? 228  ALA C CB    1 
ATOM   5313  N  N     . MET C  2  229  ? 52.276  -43.996 31.780  1.00 143.79 ? 229  MET C N     1 
ATOM   5314  C  CA    . MET C  2  229  ? 53.501  -43.208 31.631  1.00 138.36 ? 229  MET C CA    1 
ATOM   5315  C  C     . MET C  2  229  ? 54.781  -43.776 32.246  1.00 133.23 ? 229  MET C C     1 
ATOM   5316  O  O     . MET C  2  229  ? 55.848  -43.703 31.636  1.00 135.31 ? 229  MET C O     1 
ATOM   5317  C  CB    . MET C  2  229  ? 53.276  -41.784 32.152  1.00 136.23 ? 229  MET C CB    1 
ATOM   5318  C  CG    . MET C  2  229  ? 51.822  -41.341 32.146  1.00 144.15 ? 229  MET C CG    1 
ATOM   5319  S  SD    . MET C  2  229  ? 51.635  -39.583 32.496  1.00 128.88 ? 229  MET C SD    1 
ATOM   5320  C  CE    . MET C  2  229  ? 53.339  -39.112 32.784  1.00 122.35 ? 229  MET C CE    1 
ATOM   5321  N  N     . ARG C  2  230  ? 54.682  -44.305 33.459  1.00 131.11 ? 230  ARG C N     1 
ATOM   5322  C  CA    . ARG C  2  230  ? 55.860  -44.781 34.169  1.00 132.19 ? 230  ARG C CA    1 
ATOM   5323  C  C     . ARG C  2  230  ? 56.532  -43.596 34.851  1.00 131.96 ? 230  ARG C C     1 
ATOM   5324  O  O     . ARG C  2  230  ? 56.068  -42.462 34.731  1.00 135.92 ? 230  ARG C O     1 
ATOM   5325  C  CB    . ARG C  2  230  ? 56.833  -45.460 33.205  1.00 133.16 ? 230  ARG C CB    1 
ATOM   5326  C  CG    . ARG C  2  230  ? 57.411  -44.530 32.151  1.00 134.65 ? 230  ARG C CG    1 
ATOM   5327  C  CD    . ARG C  2  230  ? 57.746  -45.282 30.874  1.00 135.59 ? 230  ARG C CD    1 
ATOM   5328  N  NE    . ARG C  2  230  ? 59.154  -45.664 30.816  1.00 139.45 ? 230  ARG C NE    1 
ATOM   5329  C  CZ    . ARG C  2  230  ? 59.977  -45.337 29.825  1.00 135.55 ? 230  ARG C CZ    1 
ATOM   5330  N  NH1   . ARG C  2  230  ? 59.534  -44.620 28.801  1.00 128.09 ? 230  ARG C NH1   1 
ATOM   5331  N  NH2   . ARG C  2  230  ? 61.244  -45.728 29.856  1.00 124.32 ? 230  ARG C NH2   1 
ATOM   5332  N  N     . PRO C  2  231  ? 57.620  -43.855 35.567  1.00 123.78 ? 231  PRO C N     1 
ATOM   5333  C  CA    . PRO C  2  231  ? 58.305  -42.789 36.306  1.00 121.26 ? 231  PRO C CA    1 
ATOM   5334  C  C     . PRO C  2  231  ? 58.901  -41.687 35.428  1.00 124.60 ? 231  PRO C C     1 
ATOM   5335  O  O     . PRO C  2  231  ? 58.761  -40.511 35.763  1.00 122.82 ? 231  PRO C O     1 
ATOM   5336  C  CB    . PRO C  2  231  ? 59.424  -43.540 37.030  1.00 120.49 ? 231  PRO C CB    1 
ATOM   5337  C  CG    . PRO C  2  231  ? 59.720  -44.700 36.142  1.00 125.44 ? 231  PRO C CG    1 
ATOM   5338  C  CD    . PRO C  2  231  ? 58.406  -45.101 35.534  1.00 121.89 ? 231  PRO C CD    1 
ATOM   5339  N  N     . GLU C  2  232  ? 59.559  -42.055 34.332  1.00 124.97 ? 232  GLU C N     1 
ATOM   5340  C  CA    . GLU C  2  232  ? 60.221  -41.061 33.489  1.00 122.75 ? 232  GLU C CA    1 
ATOM   5341  C  C     . GLU C  2  232  ? 59.259  -40.076 32.827  1.00 119.73 ? 232  GLU C C     1 
ATOM   5342  O  O     . GLU C  2  232  ? 59.499  -38.869 32.821  1.00 121.51 ? 232  GLU C O     1 
ATOM   5343  C  CB    . GLU C  2  232  ? 61.074  -41.752 32.422  1.00 129.89 ? 232  GLU C CB    1 
ATOM   5344  C  CG    . GLU C  2  232  ? 62.312  -42.444 32.970  1.00 129.12 ? 232  GLU C CG    1 
ATOM   5345  C  CD    . GLU C  2  232  ? 61.982  -43.477 34.029  1.00 134.67 ? 232  GLU C CD    1 
ATOM   5346  O  OE1   . GLU C  2  232  ? 62.239  -44.676 33.792  1.00 134.27 ? 232  GLU C OE1   1 
ATOM   5347  O  OE2   . GLU C  2  232  ? 61.464  -43.090 35.097  1.00 134.25 ? 232  GLU C OE2   1 
ATOM   5348  N  N     . GLU C  2  233  ? 58.169  -40.600 32.277  1.00 120.94 ? 233  GLU C N     1 
ATOM   5349  C  CA    . GLU C  2  233  ? 57.133  -39.773 31.668  1.00 125.66 ? 233  GLU C CA    1 
ATOM   5350  C  C     . GLU C  2  233  ? 56.436  -38.909 32.709  1.00 124.41 ? 233  GLU C C     1 
ATOM   5351  O  O     . GLU C  2  233  ? 56.111  -37.746 32.469  1.00 120.13 ? 233  GLU C O     1 
ATOM   5352  C  CB    . GLU C  2  233  ? 56.110  -40.647 30.940  1.00 132.28 ? 233  GLU C CB    1 
ATOM   5353  C  CG    . GLU C  2  233  ? 56.335  -40.747 29.440  1.00 135.52 ? 233  GLU C CG    1 
ATOM   5354  C  CD    . GLU C  2  233  ? 56.979  -42.057 29.034  1.00 139.15 ? 233  GLU C CD    1 
ATOM   5355  O  OE1   . GLU C  2  233  ? 56.362  -43.120 29.262  1.00 142.32 ? 233  GLU C OE1   1 
ATOM   5356  O  OE2   . GLU C  2  233  ? 58.101  -42.026 28.487  1.00 133.32 ? 233  GLU C OE2   1 
ATOM   5357  N  N     . ALA C  2  234  ? 56.206  -39.514 33.867  1.00 126.66 ? 234  ALA C N     1 
ATOM   5358  C  CA    . ALA C  2  234  ? 55.382  -38.947 34.926  1.00 116.95 ? 234  ALA C CA    1 
ATOM   5359  C  C     . ALA C  2  234  ? 56.175  -37.934 35.743  1.00 114.29 ? 234  ALA C C     1 
ATOM   5360  O  O     . ALA C  2  234  ? 55.621  -36.954 36.233  1.00 113.12 ? 234  ALA C O     1 
ATOM   5361  C  CB    . ALA C  2  234  ? 54.845  -40.046 35.822  1.00 113.27 ? 234  ALA C CB    1 
ATOM   5362  N  N     . LEU C  2  235  ? 57.474  -38.179 35.889  1.00 114.17 ? 235  LEU C N     1 
ATOM   5363  C  CA    . LEU C  2  235  ? 58.353  -37.249 36.591  1.00 111.33 ? 235  LEU C CA    1 
ATOM   5364  C  C     . LEU C  2  235  ? 58.398  -35.907 35.868  1.00 113.40 ? 235  LEU C C     1 
ATOM   5365  O  O     . LEU C  2  235  ? 58.350  -34.847 36.493  1.00 116.36 ? 235  LEU C O     1 
ATOM   5366  C  CB    . LEU C  2  235  ? 59.765  -37.827 36.713  1.00 105.18 ? 235  LEU C CB    1 
ATOM   5367  C  CG    . LEU C  2  235  ? 60.804  -36.964 37.436  1.00 102.88 ? 235  LEU C CG    1 
ATOM   5368  C  CD1   . LEU C  2  235  ? 60.384  -36.695 38.869  1.00 105.05 ? 235  LEU C CD1   1 
ATOM   5369  C  CD2   . LEU C  2  235  ? 62.175  -37.621 37.404  1.00 101.27 ? 235  LEU C CD2   1 
ATOM   5370  N  N     . ILE C  2  236  ? 58.487  -35.964 34.544  1.00 109.75 ? 236  ILE C N     1 
ATOM   5371  C  CA    . ILE C  2  236  ? 58.530  -34.761 33.722  1.00 108.24 ? 236  ILE C CA    1 
ATOM   5372  C  C     . ILE C  2  236  ? 57.173  -34.058 33.700  1.00 108.62 ? 236  ILE C C     1 
ATOM   5373  O  O     . ILE C  2  236  ? 57.096  -32.829 33.755  1.00 109.58 ? 236  ILE C O     1 
ATOM   5374  C  CB    . ILE C  2  236  ? 58.991  -35.088 32.289  1.00 109.84 ? 236  ILE C CB    1 
ATOM   5375  C  CG1   . ILE C  2  236  ? 60.455  -35.532 32.296  1.00 107.93 ? 236  ILE C CG1   1 
ATOM   5376  C  CG2   . ILE C  2  236  ? 58.804  -33.889 31.382  1.00 115.61 ? 236  ILE C CG2   1 
ATOM   5377  C  CD1   . ILE C  2  236  ? 61.001  -35.870 30.931  1.00 114.02 ? 236  ILE C CD1   1 
ATOM   5378  N  N     . ARG C  2  237  ? 56.108  -34.849 33.623  1.00 108.65 ? 237  ARG C N     1 
ATOM   5379  C  CA    . ARG C  2  237  ? 54.748  -34.333 33.728  1.00 111.75 ? 237  ARG C CA    1 
ATOM   5380  C  C     . ARG C  2  237  ? 54.604  -33.521 35.012  1.00 113.16 ? 237  ARG C C     1 
ATOM   5381  O  O     . ARG C  2  237  ? 54.168  -32.360 34.996  1.00 113.56 ? 237  ARG C O     1 
ATOM   5382  C  CB    . ARG C  2  237  ? 53.756  -35.498 33.716  1.00 110.72 ? 237  ARG C CB    1 
ATOM   5383  C  CG    . ARG C  2  237  ? 52.416  -35.217 34.370  1.00 111.47 ? 237  ARG C CG    1 
ATOM   5384  C  CD    . ARG C  2  237  ? 51.500  -34.391 33.486  1.00 113.91 ? 237  ARG C CD    1 
ATOM   5385  N  NE    . ARG C  2  237  ? 50.133  -34.389 34.003  1.00 121.86 ? 237  ARG C NE    1 
ATOM   5386  C  CZ    . ARG C  2  237  ? 49.114  -33.758 33.431  1.00 123.08 ? 237  ARG C CZ    1 
ATOM   5387  N  NH1   . ARG C  2  237  ? 47.907  -33.818 33.977  1.00 121.65 ? 237  ARG C NH1   1 
ATOM   5388  N  NH2   . ARG C  2  237  ? 49.300  -33.068 32.314  1.00 129.35 ? 237  ARG C NH2   1 
ATOM   5389  N  N     . LEU C  2  238  ? 54.991  -34.142 36.122  1.00 110.87 ? 238  LEU C N     1 
ATOM   5390  C  CA    . LEU C  2  238  ? 54.951  -33.494 37.424  1.00 108.46 ? 238  LEU C CA    1 
ATOM   5391  C  C     . LEU C  2  238  ? 55.768  -32.213 37.404  1.00 106.12 ? 238  LEU C C     1 
ATOM   5392  O  O     . LEU C  2  238  ? 55.288  -31.159 37.809  1.00 106.32 ? 238  LEU C O     1 
ATOM   5393  C  CB    . LEU C  2  238  ? 55.480  -34.432 38.512  1.00 106.74 ? 238  LEU C CB    1 
ATOM   5394  C  CG    . LEU C  2  238  ? 55.429  -33.880 39.938  1.00 102.27 ? 238  LEU C CG    1 
ATOM   5395  C  CD1   . LEU C  2  238  ? 54.003  -33.499 40.320  1.00 96.24  ? 238  LEU C CD1   1 
ATOM   5396  C  CD2   . LEU C  2  238  ? 56.005  -34.881 40.926  1.00 86.94  ? 238  LEU C CD2   1 
ATOM   5397  N  N     . PHE C  2  239  ? 57.004  -32.309 36.926  1.00 104.92 ? 239  PHE C N     1 
ATOM   5398  C  CA    . PHE C  2  239  ? 57.889  -31.154 36.879  1.00 100.48 ? 239  PHE C CA    1 
ATOM   5399  C  C     . PHE C  2  239  ? 57.248  -29.987 36.138  1.00 103.68 ? 239  PHE C C     1 
ATOM   5400  O  O     . PHE C  2  239  ? 57.417  -28.832 36.523  1.00 102.95 ? 239  PHE C O     1 
ATOM   5401  C  CB    . PHE C  2  239  ? 59.220  -31.520 36.230  1.00 95.34  ? 239  PHE C CB    1 
ATOM   5402  C  CG    . PHE C  2  239  ? 60.189  -30.379 36.164  1.00 98.01  ? 239  PHE C CG    1 
ATOM   5403  C  CD1   . PHE C  2  239  ? 60.167  -29.494 35.101  1.00 106.60 ? 239  PHE C CD1   1 
ATOM   5404  C  CD2   . PHE C  2  239  ? 61.121  -30.191 37.164  1.00 93.84  ? 239  PHE C CD2   1 
ATOM   5405  C  CE1   . PHE C  2  239  ? 61.058  -28.443 35.040  1.00 105.45 ? 239  PHE C CE1   1 
ATOM   5406  C  CE2   . PHE C  2  239  ? 62.016  -29.142 37.106  1.00 95.82  ? 239  PHE C CE2   1 
ATOM   5407  C  CZ    . PHE C  2  239  ? 61.984  -28.268 36.044  1.00 98.36  ? 239  PHE C CZ    1 
ATOM   5408  N  N     . THR C  2  240  ? 56.512  -30.294 35.074  1.00 107.90 ? 240  THR C N     1 
ATOM   5409  C  CA    . THR C  2  240  ? 55.818  -29.264 34.308  1.00 109.99 ? 240  THR C CA    1 
ATOM   5410  C  C     . THR C  2  240  ? 54.608  -28.723 35.065  1.00 111.60 ? 240  THR C C     1 
ATOM   5411  O  O     . THR C  2  240  ? 54.210  -27.574 34.872  1.00 110.97 ? 240  THR C O     1 
ATOM   5412  C  CB    . THR C  2  240  ? 55.370  -29.781 32.933  1.00 113.13 ? 240  THR C CB    1 
ATOM   5413  O  OG1   . THR C  2  240  ? 54.427  -30.847 33.103  1.00 112.07 ? 240  THR C OG1   1 
ATOM   5414  C  CG2   . THR C  2  240  ? 56.569  -30.278 32.134  1.00 108.80 ? 240  THR C CG2   1 
ATOM   5415  N  N     . LEU C  2  241  ? 54.020  -29.552 35.922  1.00 111.61 ? 241  LEU C N     1 
ATOM   5416  C  CA    . LEU C  2  241  ? 52.946  -29.079 36.790  1.00 109.00 ? 241  LEU C CA    1 
ATOM   5417  C  C     . LEU C  2  241  ? 53.477  -28.117 37.846  1.00 113.01 ? 241  LEU C C     1 
ATOM   5418  O  O     . LEU C  2  241  ? 52.812  -27.146 38.207  1.00 120.29 ? 241  LEU C O     1 
ATOM   5419  C  CB    . LEU C  2  241  ? 52.236  -30.248 37.472  1.00 107.76 ? 241  LEU C CB    1 
ATOM   5420  C  CG    . LEU C  2  241  ? 51.481  -31.214 36.563  1.00 110.26 ? 241  LEU C CG    1 
ATOM   5421  C  CD1   . LEU C  2  241  ? 50.740  -32.235 37.400  1.00 110.67 ? 241  LEU C CD1   1 
ATOM   5422  C  CD2   . LEU C  2  241  ? 50.520  -30.458 35.662  1.00 111.45 ? 241  LEU C CD2   1 
ATOM   5423  N  N     . LEU C  2  242  ? 54.681  -28.397 38.337  1.00 112.92 ? 242  LEU C N     1 
ATOM   5424  C  CA    . LEU C  2  242  ? 55.281  -27.626 39.421  1.00 114.43 ? 242  LEU C CA    1 
ATOM   5425  C  C     . LEU C  2  242  ? 55.763  -26.254 38.970  1.00 116.42 ? 242  LEU C C     1 
ATOM   5426  O  O     . LEU C  2  242  ? 55.608  -25.273 39.691  1.00 125.25 ? 242  LEU C O     1 
ATOM   5427  C  CB    . LEU C  2  242  ? 56.429  -28.408 40.064  1.00 112.24 ? 242  LEU C CB    1 
ATOM   5428  C  CG    . LEU C  2  242  ? 56.113  -29.150 41.368  1.00 110.20 ? 242  LEU C CG    1 
ATOM   5429  C  CD1   . LEU C  2  242  ? 55.995  -28.167 42.525  1.00 115.62 ? 242  LEU C CD1   1 
ATOM   5430  C  CD2   . LEU C  2  242  ? 54.840  -29.977 41.238  1.00 104.04 ? 242  LEU C CD2   1 
ATOM   5431  N  N     . ARG C  2  243  ? 56.353  -26.186 37.783  1.00 113.62 ? 243  ARG C N     1 
ATOM   5432  C  CA    . ARG C  2  243  ? 56.762  -24.902 37.225  1.00 117.68 ? 243  ARG C CA    1 
ATOM   5433  C  C     . ARG C  2  243  ? 56.560  -24.824 35.714  1.00 119.91 ? 243  ARG C C     1 
ATOM   5434  O  O     . ARG C  2  243  ? 56.964  -25.724 34.975  1.00 118.04 ? 243  ARG C O     1 
ATOM   5435  C  CB    . ARG C  2  243  ? 58.212  -24.577 37.595  1.00 116.81 ? 243  ARG C CB    1 
ATOM   5436  C  CG    . ARG C  2  243  ? 59.205  -25.669 37.256  1.00 116.50 ? 243  ARG C CG    1 
ATOM   5437  C  CD    . ARG C  2  243  ? 60.624  -25.249 37.614  1.00 119.88 ? 243  ARG C CD    1 
ATOM   5438  N  NE    . ARG C  2  243  ? 60.757  -24.896 39.025  1.00 113.68 ? 243  ARG C NE    1 
ATOM   5439  C  CZ    . ARG C  2  243  ? 61.301  -23.766 39.467  1.00 106.13 ? 243  ARG C CZ    1 
ATOM   5440  N  NH1   . ARG C  2  243  ? 61.378  -23.533 40.770  1.00 101.80 ? 243  ARG C NH1   1 
ATOM   5441  N  NH2   . ARG C  2  243  ? 61.767  -22.870 38.607  1.00 94.25  ? 243  ARG C NH2   1 
ATOM   5442  N  N     . PRO C  2  244  ? 55.917  -23.742 35.257  1.00 126.99 ? 244  PRO C N     1 
ATOM   5443  C  CA    . PRO C  2  244  ? 55.686  -23.456 33.839  1.00 125.97 ? 244  PRO C CA    1 
ATOM   5444  C  C     . PRO C  2  244  ? 56.920  -22.861 33.169  1.00 124.74 ? 244  PRO C C     1 
ATOM   5445  O  O     . PRO C  2  244  ? 57.821  -22.377 33.853  1.00 121.02 ? 244  PRO C O     1 
ATOM   5446  C  CB    . PRO C  2  244  ? 54.568  -22.402 33.871  1.00 130.37 ? 244  PRO C CB    1 
ATOM   5447  C  CG    . PRO C  2  244  ? 54.035  -22.412 35.281  1.00 132.56 ? 244  PRO C CG    1 
ATOM   5448  C  CD    . PRO C  2  244  ? 55.200  -22.796 36.126  1.00 131.72 ? 244  PRO C CD    1 
ATOM   5449  N  N     . GLY C  2  245  ? 56.962  -22.909 31.844  1.00 129.35 ? 245  GLY C N     1 
ATOM   5450  C  CA    . GLY C  2  245  ? 57.873  -22.092 31.068  1.00 129.08 ? 245  GLY C CA    1 
ATOM   5451  C  C     . GLY C  2  245  ? 59.322  -22.428 31.332  1.00 122.53 ? 245  GLY C C     1 
ATOM   5452  O  O     . GLY C  2  245  ? 60.220  -21.635 31.047  1.00 118.03 ? 245  GLY C O     1 
ATOM   5453  N  N     . ASP C  2  246  ? 59.550  -23.615 31.874  1.00 120.67 ? 246  ASP C N     1 
ATOM   5454  C  CA    . ASP C  2  246  ? 60.896  -24.093 32.124  1.00 118.60 ? 246  ASP C CA    1 
ATOM   5455  C  C     . ASP C  2  246  ? 61.037  -25.419 31.413  1.00 123.21 ? 246  ASP C C     1 
ATOM   5456  O  O     . ASP C  2  246  ? 60.186  -26.297 31.559  1.00 119.33 ? 246  ASP C O     1 
ATOM   5457  C  CB    . ASP C  2  246  ? 61.139  -24.265 33.623  1.00 112.74 ? 246  ASP C CB    1 
ATOM   5458  C  CG    . ASP C  2  246  ? 62.492  -24.876 33.927  1.00 116.90 ? 246  ASP C CG    1 
ATOM   5459  O  OD1   . ASP C  2  246  ? 63.301  -25.029 32.988  1.00 118.71 ? 246  ASP C OD1   1 
ATOM   5460  O  OD2   . ASP C  2  246  ? 62.748  -25.202 35.105  1.00 109.27 ? 246  ASP C OD2   1 
ATOM   5461  N  N     . PRO C  2  247  ? 62.102  -25.578 30.641  1.00 120.50 ? 247  PRO C N     1 
ATOM   5462  C  CA    . PRO C  2  247  ? 62.273  -26.833 29.915  1.00 120.15 ? 247  PRO C CA    1 
ATOM   5463  C  C     . PRO C  2  247  ? 62.415  -27.965 30.916  1.00 120.94 ? 247  PRO C C     1 
ATOM   5464  O  O     . PRO C  2  247  ? 63.170  -27.848 31.882  1.00 120.27 ? 247  PRO C O     1 
ATOM   5465  C  CB    . PRO C  2  247  ? 63.587  -26.623 29.164  1.00 116.40 ? 247  PRO C CB    1 
ATOM   5466  C  CG    . PRO C  2  247  ? 63.659  -25.150 28.954  1.00 102.96 ? 247  PRO C CG    1 
ATOM   5467  C  CD    . PRO C  2  247  ? 63.028  -24.533 30.170  1.00 106.07 ? 247  PRO C CD    1 
ATOM   5468  N  N     . PRO C  2  248  ? 61.699  -29.055 30.678  1.00 118.28 ? 248  PRO C N     1 
ATOM   5469  C  CA    . PRO C  2  248  ? 61.822  -30.249 31.518  1.00 119.11 ? 248  PRO C CA    1 
ATOM   5470  C  C     . PRO C  2  248  ? 62.968  -31.153 31.087  1.00 115.31 ? 248  PRO C C     1 
ATOM   5471  O  O     . PRO C  2  248  ? 62.745  -32.347 30.884  1.00 117.08 ? 248  PRO C O     1 
ATOM   5472  C  CB    . PRO C  2  248  ? 60.491  -30.977 31.288  1.00 121.60 ? 248  PRO C CB    1 
ATOM   5473  C  CG    . PRO C  2  248  ? 59.623  -30.023 30.507  1.00 121.16 ? 248  PRO C CG    1 
ATOM   5474  C  CD    . PRO C  2  248  ? 60.563  -29.159 29.752  1.00 117.62 ? 248  PRO C CD    1 
ATOM   5475  N  N     . LYS C  2  249  ? 64.164  -30.592 30.945  1.00 113.85 ? 249  LYS C N     1 
ATOM   5476  C  CA    . LYS C  2  249  ? 65.354  -31.395 30.740  1.00 119.07 ? 249  LYS C CA    1 
ATOM   5477  C  C     . LYS C  2  249  ? 65.386  -32.348 31.923  1.00 120.05 ? 249  LYS C C     1 
ATOM   5478  O  O     . LYS C  2  249  ? 65.365  -31.904 33.066  1.00 122.05 ? 249  LYS C O     1 
ATOM   5479  C  CB    . LYS C  2  249  ? 66.586  -30.485 30.736  1.00 117.56 ? 249  LYS C CB    1 
ATOM   5480  C  CG    . LYS C  2  249  ? 67.870  -31.129 30.243  1.00 121.25 ? 249  LYS C CG    1 
ATOM   5481  C  CD    . LYS C  2  249  ? 68.976  -30.087 30.107  1.00 122.10 ? 249  LYS C CD    1 
ATOM   5482  C  CE    . LYS C  2  249  ? 70.333  -30.734 29.857  1.00 122.16 ? 249  LYS C CE    1 
ATOM   5483  N  NZ    . LYS C  2  249  ? 70.376  -31.534 28.600  1.00 117.62 ? 249  LYS C NZ    1 
ATOM   5484  N  N     . ARG C  2  250  ? 65.429  -33.652 31.648  1.00 122.21 ? 250  ARG C N     1 
ATOM   5485  C  CA    . ARG C  2  250  ? 65.171  -34.666 32.677  1.00 118.79 ? 250  ARG C CA    1 
ATOM   5486  C  C     . ARG C  2  250  ? 66.040  -34.542 33.929  1.00 119.43 ? 250  ARG C C     1 
ATOM   5487  O  O     . ARG C  2  250  ? 65.566  -34.776 35.043  1.00 122.93 ? 250  ARG C O     1 
ATOM   5488  C  CB    . ARG C  2  250  ? 65.260  -36.085 32.109  1.00 125.54 ? 250  ARG C CB    1 
ATOM   5489  C  CG    . ARG C  2  250  ? 65.124  -37.162 33.177  1.00 123.80 ? 250  ARG C CG    1 
ATOM   5490  C  CD    . ARG C  2  250  ? 65.090  -38.567 32.608  1.00 126.86 ? 250  ARG C CD    1 
ATOM   5491  N  NE    . ARG C  2  250  ? 65.120  -39.561 33.677  1.00 130.98 ? 250  ARG C NE    1 
ATOM   5492  C  CZ    . ARG C  2  250  ? 66.233  -39.984 34.270  1.00 128.63 ? 250  ARG C CZ    1 
ATOM   5493  N  NH1   . ARG C  2  250  ? 67.410  -39.500 33.896  1.00 115.48 ? 250  ARG C NH1   1 
ATOM   5494  N  NH2   . ARG C  2  250  ? 66.169  -40.890 35.239  1.00 123.52 ? 250  ARG C NH2   1 
ATOM   5495  N  N     . ASP C  2  251  ? 67.302  -34.169 33.751  1.00 121.05 ? 251  ASP C N     1 
ATOM   5496  C  CA    . ASP C  2  251  ? 68.193  -33.956 34.889  1.00 120.12 ? 251  ASP C CA    1 
ATOM   5497  C  C     . ASP C  2  251  ? 67.698  -32.843 35.821  1.00 114.84 ? 251  ASP C C     1 
ATOM   5498  O  O     . ASP C  2  251  ? 67.886  -32.921 37.034  1.00 106.36 ? 251  ASP C O     1 
ATOM   5499  C  CB    . ASP C  2  251  ? 69.632  -33.690 34.430  1.00 119.82 ? 251  ASP C CB    1 
ATOM   5500  C  CG    . ASP C  2  251  ? 69.700  -32.937 33.112  1.00 122.49 ? 251  ASP C CG    1 
ATOM   5501  O  OD1   . ASP C  2  251  ? 69.127  -33.428 32.116  1.00 121.74 ? 251  ASP C OD1   1 
ATOM   5502  O  OD2   . ASP C  2  251  ? 70.330  -31.858 33.073  1.00 119.51 ? 251  ASP C OD2   1 
ATOM   5503  N  N     . LYS C  2  252  ? 67.063  -31.817 35.255  1.00 116.86 ? 252  LYS C N     1 
ATOM   5504  C  CA    . LYS C  2  252  ? 66.441  -30.768 36.061  1.00 105.61 ? 252  LYS C CA    1 
ATOM   5505  C  C     . LYS C  2  252  ? 65.261  -31.317 36.856  1.00 105.13 ? 252  LYS C C     1 
ATOM   5506  O  O     . LYS C  2  252  ? 65.065  -30.952 38.012  1.00 107.26 ? 252  LYS C O     1 
ATOM   5507  C  CB    . LYS C  2  252  ? 65.984  -29.591 35.194  1.00 103.63 ? 252  LYS C CB    1 
ATOM   5508  C  CG    . LYS C  2  252  ? 66.989  -28.456 35.100  1.00 109.66 ? 252  LYS C CG    1 
ATOM   5509  C  CD    . LYS C  2  252  ? 66.303  -27.138 34.764  1.00 118.19 ? 252  LYS C CD    1 
ATOM   5510  C  CE    . LYS C  2  252  ? 67.289  -25.975 34.820  1.00 116.22 ? 252  LYS C CE    1 
ATOM   5511  N  NZ    . LYS C  2  252  ? 66.617  -24.645 34.736  1.00 112.10 ? 252  LYS C NZ    1 
ATOM   5512  N  N     . ALA C  2  253  ? 64.463  -32.173 36.226  1.00 106.59 ? 253  ALA C N     1 
ATOM   5513  C  CA    . ALA C  2  253  ? 63.311  -32.754 36.902  1.00 102.55 ? 253  ALA C CA    1 
ATOM   5514  C  C     . ALA C  2  253  ? 63.753  -33.608 38.084  1.00 102.00 ? 253  ALA C C     1 
ATOM   5515  O  O     . ALA C  2  253  ? 63.158  -33.551 39.160  1.00 102.71 ? 253  ALA C O     1 
ATOM   5516  C  CB    . ALA C  2  253  ? 62.485  -33.580 35.928  1.00 107.02 ? 253  ALA C CB    1 
ATOM   5517  N  N     . VAL C  2  254  ? 64.804  -34.395 37.879  1.00 105.92 ? 254  VAL C N     1 
ATOM   5518  C  CA    . VAL C  2  254  ? 65.369  -35.209 38.948  1.00 109.33 ? 254  VAL C CA    1 
ATOM   5519  C  C     . VAL C  2  254  ? 65.936  -34.333 40.058  1.00 105.05 ? 254  VAL C C     1 
ATOM   5520  O  O     . VAL C  2  254  ? 65.768  -34.621 41.242  1.00 99.41  ? 254  VAL C O     1 
ATOM   5521  C  CB    . VAL C  2  254  ? 66.479  -36.139 38.424  1.00 109.53 ? 254  VAL C CB    1 
ATOM   5522  C  CG1   . VAL C  2  254  ? 67.179  -36.834 39.581  1.00 99.99  ? 254  VAL C CG1   1 
ATOM   5523  C  CG2   . VAL C  2  254  ? 65.903  -37.156 37.451  1.00 114.82 ? 254  VAL C CG2   1 
ATOM   5524  N  N     . ALA C  2  255  ? 66.611  -33.259 39.659  1.00 109.06 ? 255  ALA C N     1 
ATOM   5525  C  CA    . ALA C  2  255  ? 67.225  -32.337 40.606  1.00 106.75 ? 255  ALA C CA    1 
ATOM   5526  C  C     . ALA C  2  255  ? 66.187  -31.647 41.482  1.00 103.64 ? 255  ALA C C     1 
ATOM   5527  O  O     . ALA C  2  255  ? 66.393  -31.470 42.683  1.00 96.55  ? 255  ALA C O     1 
ATOM   5528  C  CB    . ALA C  2  255  ? 68.069  -31.307 39.870  1.00 107.52 ? 255  ALA C CB    1 
ATOM   5529  N  N     . TYR C  2  256  ? 65.071  -31.257 40.875  1.00 103.20 ? 256  TYR C N     1 
ATOM   5530  C  CA    . TYR C  2  256  ? 64.024  -30.544 41.597  1.00 94.43  ? 256  TYR C CA    1 
ATOM   5531  C  C     . TYR C  2  256  ? 63.221  -31.442 42.528  1.00 100.10 ? 256  TYR C C     1 
ATOM   5532  O  O     . TYR C  2  256  ? 63.079  -31.132 43.708  1.00 103.29 ? 256  TYR C O     1 
ATOM   5533  C  CB    . TYR C  2  256  ? 63.082  -29.833 40.628  1.00 95.61  ? 256  TYR C CB    1 
ATOM   5534  C  CG    . TYR C  2  256  ? 62.015  -29.013 41.316  1.00 103.69 ? 256  TYR C CG    1 
ATOM   5535  C  CD1   . TYR C  2  256  ? 62.248  -27.689 41.663  1.00 105.64 ? 256  TYR C CD1   1 
ATOM   5536  C  CD2   . TYR C  2  256  ? 60.774  -29.561 41.618  1.00 98.75  ? 256  TYR C CD2   1 
ATOM   5537  C  CE1   . TYR C  2  256  ? 61.277  -26.934 42.291  1.00 105.32 ? 256  TYR C CE1   1 
ATOM   5538  C  CE2   . TYR C  2  256  ? 59.798  -28.814 42.246  1.00 95.08  ? 256  TYR C CE2   1 
ATOM   5539  C  CZ    . TYR C  2  256  ? 60.055  -27.500 42.580  1.00 105.88 ? 256  TYR C CZ    1 
ATOM   5540  O  OH    . TYR C  2  256  ? 59.089  -26.747 43.208  1.00 112.78 ? 256  TYR C OH    1 
ATOM   5541  N  N     . VAL C  2  257  ? 62.684  -32.543 42.007  1.00 101.47 ? 257  VAL C N     1 
ATOM   5542  C  CA    . VAL C  2  257  ? 61.892  -33.444 42.847  1.00 98.74  ? 257  VAL C CA    1 
ATOM   5543  C  C     . VAL C  2  257  ? 62.738  -34.042 43.970  1.00 97.74  ? 257  VAL C C     1 
ATOM   5544  O  O     . VAL C  2  257  ? 62.243  -34.278 45.071  1.00 94.10  ? 257  VAL C O     1 
ATOM   5545  C  CB    . VAL C  2  257  ? 61.215  -34.569 42.040  1.00 89.94  ? 257  VAL C CB    1 
ATOM   5546  C  CG1   . VAL C  2  257  ? 60.526  -35.549 42.976  1.00 84.39  ? 257  VAL C CG1   1 
ATOM   5547  C  CG2   . VAL C  2  257  ? 60.215  -33.985 41.064  1.00 92.77  ? 257  VAL C CG2   1 
ATOM   5548  N  N     . TYR C  2  258  ? 64.015  -34.276 43.689  1.00 102.52 ? 258  TYR C N     1 
ATOM   5549  C  CA    . TYR C  2  258  ? 64.943  -34.746 44.711  1.00 98.38  ? 258  TYR C CA    1 
ATOM   5550  C  C     . TYR C  2  258  ? 65.093  -33.689 45.797  1.00 95.80  ? 258  TYR C C     1 
ATOM   5551  O  O     . TYR C  2  258  ? 64.918  -33.971 46.983  1.00 90.63  ? 258  TYR C O     1 
ATOM   5552  C  CB    . TYR C  2  258  ? 66.301  -35.070 44.087  1.00 95.81  ? 258  TYR C CB    1 
ATOM   5553  C  CG    . TYR C  2  258  ? 67.373  -35.479 45.073  1.00 92.92  ? 258  TYR C CG    1 
ATOM   5554  C  CD1   . TYR C  2  258  ? 68.424  -34.623 45.378  1.00 91.30  ? 258  TYR C CD1   1 
ATOM   5555  C  CD2   . TYR C  2  258  ? 67.344  -36.722 45.688  1.00 93.18  ? 258  TYR C CD2   1 
ATOM   5556  C  CE1   . TYR C  2  258  ? 69.413  -34.994 46.272  1.00 87.75  ? 258  TYR C CE1   1 
ATOM   5557  C  CE2   . TYR C  2  258  ? 68.329  -37.101 46.585  1.00 88.78  ? 258  TYR C CE2   1 
ATOM   5558  C  CZ    . TYR C  2  258  ? 69.361  -36.234 46.872  1.00 85.66  ? 258  TYR C CZ    1 
ATOM   5559  O  OH    . TYR C  2  258  ? 70.345  -36.606 47.762  1.00 75.30  ? 258  TYR C OH    1 
ATOM   5560  N  N     . GLY C  2  259  ? 65.407  -32.466 45.381  1.00 99.42  ? 259  GLY C N     1 
ATOM   5561  C  CA    . GLY C  2  259  ? 65.572  -31.362 46.309  1.00 101.96 ? 259  GLY C CA    1 
ATOM   5562  C  C     . GLY C  2  259  ? 64.315  -31.082 47.106  1.00 98.46  ? 259  GLY C C     1 
ATOM   5563  O  O     . GLY C  2  259  ? 64.368  -30.485 48.180  1.00 95.71  ? 259  GLY C O     1 
ATOM   5564  N  N     . LEU C  2  260  ? 63.178  -31.517 46.577  1.00 96.76  ? 260  LEU C N     1 
ATOM   5565  C  CA    . LEU C  2  260  ? 61.899  -31.275 47.225  1.00 90.78  ? 260  LEU C CA    1 
ATOM   5566  C  C     . LEU C  2  260  ? 61.598  -32.329 48.281  1.00 84.41  ? 260  LEU C C     1 
ATOM   5567  O  O     . LEU C  2  260  ? 61.125  -32.007 49.366  1.00 83.50  ? 260  LEU C O     1 
ATOM   5568  C  CB    . LEU C  2  260  ? 60.777  -31.233 46.190  1.00 90.88  ? 260  LEU C CB    1 
ATOM   5569  C  CG    . LEU C  2  260  ? 59.467  -30.588 46.640  1.00 86.89  ? 260  LEU C CG    1 
ATOM   5570  C  CD1   . LEU C  2  260  ? 59.701  -29.138 47.035  1.00 91.51  ? 260  LEU C CD1   1 
ATOM   5571  C  CD2   . LEU C  2  260  ? 58.416  -30.684 45.548  1.00 88.98  ? 260  LEU C CD2   1 
ATOM   5572  N  N     . ILE C  2  261  ? 61.880  -33.588 47.965  1.00 87.81  ? 261  ILE C N     1 
ATOM   5573  C  CA    . ILE C  2  261  ? 61.542  -34.687 48.867  1.00 85.36  ? 261  ILE C CA    1 
ATOM   5574  C  C     . ILE C  2  261  ? 62.750  -35.451 49.407  1.00 86.71  ? 261  ILE C C     1 
ATOM   5575  O  O     . ILE C  2  261  ? 62.938  -35.542 50.616  1.00 91.00  ? 261  ILE C O     1 
ATOM   5576  C  CB    . ILE C  2  261  ? 60.580  -35.697 48.210  1.00 78.80  ? 261  ILE C CB    1 
ATOM   5577  C  CG1   . ILE C  2  261  ? 59.140  -35.200 48.288  1.00 77.60  ? 261  ILE C CG1   1 
ATOM   5578  C  CG2   . ILE C  2  261  ? 60.674  -37.039 48.900  1.00 80.05  ? 261  ILE C CG2   1 
ATOM   5579  C  CD1   . ILE C  2  261  ? 58.878  -33.971 47.471  1.00 90.04  ? 261  ILE C CD1   1 
ATOM   5580  N  N     . ALA C  2  262  ? 63.560  -36.004 48.511  1.00 83.91  ? 262  ALA C N     1 
ATOM   5581  C  CA    . ALA C  2  262  ? 64.589  -36.963 48.905  1.00 81.45  ? 262  ALA C CA    1 
ATOM   5582  C  C     . ALA C  2  262  ? 65.863  -36.339 49.472  1.00 83.56  ? 262  ALA C C     1 
ATOM   5583  O  O     . ALA C  2  262  ? 66.643  -37.016 50.143  1.00 78.65  ? 262  ALA C O     1 
ATOM   5584  C  CB    . ALA C  2  262  ? 64.922  -37.896 47.746  1.00 92.39  ? 262  ALA C CB    1 
ATOM   5585  N  N     . ASP C  2  263  ? 66.075  -35.055 49.207  1.00 85.08  ? 263  ASP C N     1 
ATOM   5586  C  CA    . ASP C  2  263  ? 67.312  -34.397 49.618  1.00 85.64  ? 263  ASP C CA    1 
ATOM   5587  C  C     . ASP C  2  263  ? 67.352  -34.163 51.124  1.00 83.76  ? 263  ASP C C     1 
ATOM   5588  O  O     . ASP C  2  263  ? 66.587  -33.356 51.651  1.00 84.76  ? 263  ASP C O     1 
ATOM   5589  C  CB    . ASP C  2  263  ? 67.492  -33.072 48.872  1.00 89.59  ? 263  ASP C CB    1 
ATOM   5590  C  CG    . ASP C  2  263  ? 68.921  -32.558 48.929  1.00 87.40  ? 263  ASP C CG    1 
ATOM   5591  O  OD1   . ASP C  2  263  ? 69.714  -33.094 49.732  1.00 82.63  ? 263  ASP C OD1   1 
ATOM   5592  O  OD2   . ASP C  2  263  ? 69.248  -31.617 48.173  1.00 84.07  ? 263  ASP C OD2   1 
ATOM   5593  N  N     . PRO C  2  264  ? 68.252  -34.869 51.824  1.00 81.83  ? 264  PRO C N     1 
ATOM   5594  C  CA    . PRO C  2  264  ? 68.399  -34.727 53.276  1.00 85.49  ? 264  PRO C CA    1 
ATOM   5595  C  C     . PRO C  2  264  ? 68.996  -33.379 53.669  1.00 83.83  ? 264  PRO C C     1 
ATOM   5596  O  O     . PRO C  2  264  ? 68.931  -33.001 54.840  1.00 84.45  ? 264  PRO C O     1 
ATOM   5597  C  CB    . PRO C  2  264  ? 69.358  -35.862 53.643  1.00 75.15  ? 264  PRO C CB    1 
ATOM   5598  C  CG    . PRO C  2  264  ? 70.120  -36.122 52.409  1.00 80.42  ? 264  PRO C CG    1 
ATOM   5599  C  CD    . PRO C  2  264  ? 69.167  -35.882 51.277  1.00 82.26  ? 264  PRO C CD    1 
ATOM   5600  N  N     . ARG C  2  265  ? 69.562  -32.668 52.699  1.00 75.98  ? 265  ARG C N     1 
ATOM   5601  C  CA    . ARG C  2  265  ? 70.140  -31.353 52.948  1.00 79.41  ? 265  ARG C CA    1 
ATOM   5602  C  C     . ARG C  2  265  ? 69.079  -30.254 52.895  1.00 85.12  ? 265  ARG C C     1 
ATOM   5603  O  O     . ARG C  2  265  ? 69.062  -29.367 53.746  1.00 94.75  ? 265  ARG C O     1 
ATOM   5604  C  CB    . ARG C  2  265  ? 71.259  -31.061 51.944  1.00 94.57  ? 265  ARG C CB    1 
ATOM   5605  C  CG    . ARG C  2  265  ? 72.360  -32.121 51.911  1.00 97.33  ? 265  ARG C CG    1 
ATOM   5606  C  CD    . ARG C  2  265  ? 73.194  -32.034 50.636  1.00 97.25  ? 265  ARG C CD    1 
ATOM   5607  N  NE    . ARG C  2  265  ? 74.155  -30.933 50.659  1.00 101.53 ? 265  ARG C NE    1 
ATOM   5608  C  CZ    . ARG C  2  265  ? 75.426  -31.057 51.031  1.00 98.01  ? 265  ARG C CZ    1 
ATOM   5609  N  NH1   . ARG C  2  265  ? 75.898  -32.237 51.417  1.00 88.79  ? 265  ARG C NH1   1 
ATOM   5610  N  NH2   . ARG C  2  265  ? 76.229  -30.000 51.019  1.00 91.27  ? 265  ARG C NH2   1 
ATOM   5611  N  N     . ARG C  2  266  ? 68.195  -30.316 51.900  1.00 83.95  ? 266  ARG C N     1 
ATOM   5612  C  CA    . ARG C  2  266  ? 67.147  -29.307 51.742  1.00 83.99  ? 266  ARG C CA    1 
ATOM   5613  C  C     . ARG C  2  266  ? 65.888  -29.656 52.534  1.00 84.93  ? 266  ARG C C     1 
ATOM   5614  O  O     . ARG C  2  266  ? 65.197  -28.771 53.038  1.00 82.43  ? 266  ARG C O     1 
ATOM   5615  C  CB    . ARG C  2  266  ? 66.788  -29.107 50.265  1.00 89.54  ? 266  ARG C CB    1 
ATOM   5616  C  CG    . ARG C  2  266  ? 67.962  -28.727 49.371  1.00 103.52 ? 266  ARG C CG    1 
ATOM   5617  C  CD    . ARG C  2  266  ? 67.510  -28.330 47.966  1.00 111.16 ? 266  ARG C CD    1 
ATOM   5618  N  NE    . ARG C  2  266  ? 66.967  -26.974 47.921  1.00 114.04 ? 266  ARG C NE    1 
ATOM   5619  C  CZ    . ARG C  2  266  ? 65.677  -26.682 47.785  1.00 112.03 ? 266  ARG C CZ    1 
ATOM   5620  N  NH1   . ARG C  2  266  ? 65.283  -25.415 47.757  1.00 109.71 ? 266  ARG C NH1   1 
ATOM   5621  N  NH2   . ARG C  2  266  ? 64.780  -27.653 47.671  1.00 106.50 ? 266  ARG C NH2   1 
ATOM   5622  N  N     . TYR C  2  267  ? 65.589  -30.946 52.630  1.00 80.64  ? 267  TYR C N     1 
ATOM   5623  C  CA    . TYR C  2  267  ? 64.417  -31.404 53.367  1.00 79.92  ? 267  TYR C CA    1 
ATOM   5624  C  C     . TYR C  2  267  ? 64.822  -32.267 54.555  1.00 81.29  ? 267  TYR C C     1 
ATOM   5625  O  O     . TYR C  2  267  ? 65.254  -33.408 54.396  1.00 77.14  ? 267  TYR C O     1 
ATOM   5626  C  CB    . TYR C  2  267  ? 63.473  -32.182 52.451  1.00 77.62  ? 267  TYR C CB    1 
ATOM   5627  C  CG    . TYR C  2  267  ? 62.196  -32.641 53.120  1.00 74.43  ? 267  TYR C CG    1 
ATOM   5628  C  CD1   . TYR C  2  267  ? 61.024  -31.910 52.993  1.00 76.11  ? 267  TYR C CD1   1 
ATOM   5629  C  CD2   . TYR C  2  267  ? 62.161  -33.804 53.872  1.00 67.72  ? 267  TYR C CD2   1 
ATOM   5630  C  CE1   . TYR C  2  267  ? 59.858  -32.321 53.598  1.00 71.33  ? 267  TYR C CE1   1 
ATOM   5631  C  CE2   . TYR C  2  267  ? 60.998  -34.222 54.481  1.00 68.44  ? 267  TYR C CE2   1 
ATOM   5632  C  CZ    . TYR C  2  267  ? 59.848  -33.477 54.342  1.00 67.25  ? 267  TYR C CZ    1 
ATOM   5633  O  OH    . TYR C  2  267  ? 58.678  -33.886 54.944  1.00 67.73  ? 267  TYR C OH    1 
ATOM   5634  N  N     . ASP C  2  268  ? 64.669  -31.712 55.750  1.00 82.30  ? 268  ASP C N     1 
ATOM   5635  C  CA    . ASP C  2  268  ? 65.046  -32.404 56.972  1.00 76.10  ? 268  ASP C CA    1 
ATOM   5636  C  C     . ASP C  2  268  ? 63.825  -32.538 57.862  1.00 74.34  ? 268  ASP C C     1 
ATOM   5637  O  O     . ASP C  2  268  ? 63.351  -31.554 58.424  1.00 74.41  ? 268  ASP C O     1 
ATOM   5638  C  CB    . ASP C  2  268  ? 66.134  -31.616 57.710  1.00 82.14  ? 268  ASP C CB    1 
ATOM   5639  C  CG    . ASP C  2  268  ? 66.812  -32.424 58.803  1.00 78.13  ? 268  ASP C CG    1 
ATOM   5640  O  OD1   . ASP C  2  268  ? 66.281  -33.484 59.193  1.00 66.01  ? 268  ASP C OD1   1 
ATOM   5641  O  OD2   . ASP C  2  268  ? 67.884  -31.988 59.275  1.00 81.11  ? 268  ASP C OD2   1 
ATOM   5642  N  N     . LEU C  2  269  ? 63.306  -33.756 57.969  1.00 77.96  ? 269  LEU C N     1 
ATOM   5643  C  CA    . LEU C  2  269  ? 62.256  -34.051 58.930  1.00 67.87  ? 269  LEU C CA    1 
ATOM   5644  C  C     . LEU C  2  269  ? 62.916  -33.997 60.289  1.00 65.78  ? 269  LEU C C     1 
ATOM   5645  O  O     . LEU C  2  269  ? 64.136  -34.010 60.386  1.00 78.15  ? 269  LEU C O     1 
ATOM   5646  C  CB    . LEU C  2  269  ? 61.699  -35.454 58.690  1.00 68.08  ? 269  LEU C CB    1 
ATOM   5647  C  CG    . LEU C  2  269  ? 60.282  -35.770 59.160  1.00 58.58  ? 269  LEU C CG    1 
ATOM   5648  C  CD1   . LEU C  2  269  ? 59.314  -34.833 58.485  1.00 63.77  ? 269  LEU C CD1   1 
ATOM   5649  C  CD2   . LEU C  2  269  ? 59.923  -37.206 58.842  1.00 49.94  ? 269  LEU C CD2   1 
ATOM   5650  N  N     . GLY C  2  270  ? 62.130  -33.934 61.348  1.00 63.28  ? 270  GLY C N     1 
ATOM   5651  C  CA    . GLY C  2  270  ? 62.728  -33.956 62.665  1.00 75.93  ? 270  GLY C CA    1 
ATOM   5652  C  C     . GLY C  2  270  ? 63.257  -35.347 62.951  1.00 74.11  ? 270  GLY C C     1 
ATOM   5653  O  O     . GLY C  2  270  ? 62.754  -36.324 62.402  1.00 77.43  ? 270  GLY C O     1 
ATOM   5654  N  N     . GLU C  2  271  ? 64.282  -35.448 63.789  1.00 66.89  ? 271  GLU C N     1 
ATOM   5655  C  CA    . GLU C  2  271  ? 64.607  -36.735 64.384  1.00 70.38  ? 271  GLU C CA    1 
ATOM   5656  C  C     . GLU C  2  271  ? 63.391  -37.088 65.227  1.00 71.16  ? 271  GLU C C     1 
ATOM   5657  O  O     . GLU C  2  271  ? 62.939  -38.239 65.268  1.00 66.33  ? 271  GLU C O     1 
ATOM   5658  C  CB    . GLU C  2  271  ? 65.851  -36.634 65.265  1.00 74.84  ? 271  GLU C CB    1 
ATOM   5659  C  CG    . GLU C  2  271  ? 66.367  -37.976 65.779  1.00 70.87  ? 271  GLU C CG    1 
ATOM   5660  C  CD    . GLU C  2  271  ? 67.034  -38.813 64.693  1.00 84.99  ? 271  GLU C CD    1 
ATOM   5661  O  OE1   . GLU C  2  271  ? 67.902  -38.279 63.966  1.00 87.81  ? 271  GLU C OE1   1 
ATOM   5662  O  OE2   . GLU C  2  271  ? 66.692  -40.007 64.565  1.00 86.50  ? 271  GLU C OE2   1 
ATOM   5663  N  N     . ALA C  2  272  ? 62.858  -36.062 65.884  1.00 69.09  ? 272  ALA C N     1 
ATOM   5664  C  CA    . ALA C  2  272  ? 61.591  -36.159 66.591  1.00 71.49  ? 272  ALA C CA    1 
ATOM   5665  C  C     . ALA C  2  272  ? 60.450  -36.358 65.602  1.00 65.38  ? 272  ALA C C     1 
ATOM   5666  O  O     . ALA C  2  272  ? 59.534  -37.135 65.854  1.00 58.87  ? 272  ALA C O     1 
ATOM   5667  C  CB    . ALA C  2  272  ? 61.356  -34.912 67.416  1.00 70.89  ? 272  ALA C CB    1 
ATOM   5668  N  N     . GLY C  2  273  ? 60.508  -35.639 64.484  1.00 63.42  ? 273  GLY C N     1 
ATOM   5669  C  CA    . GLY C  2  273  ? 59.554  -35.823 63.406  1.00 63.22  ? 273  GLY C CA    1 
ATOM   5670  C  C     . GLY C  2  273  ? 59.594  -37.245 62.878  1.00 69.35  ? 273  GLY C C     1 
ATOM   5671  O  O     . GLY C  2  273  ? 58.562  -37.896 62.723  1.00 63.86  ? 273  GLY C O     1 
ATOM   5672  N  N     . ARG C  2  274  ? 60.801  -37.725 62.600  1.00 74.05  ? 274  ARG C N     1 
ATOM   5673  C  CA    . ARG C  2  274  ? 61.017  -39.108 62.195  1.00 69.81  ? 274  ARG C CA    1 
ATOM   5674  C  C     . ARG C  2  274  ? 60.353  -40.066 63.177  1.00 72.50  ? 274  ARG C C     1 
ATOM   5675  O  O     . ARG C  2  274  ? 59.580  -40.940 62.783  1.00 73.61  ? 274  ARG C O     1 
ATOM   5676  C  CB    . ARG C  2  274  ? 62.515  -39.394 62.118  1.00 74.32  ? 274  ARG C CB    1 
ATOM   5677  C  CG    . ARG C  2  274  ? 62.881  -40.859 61.983  1.00 79.79  ? 274  ARG C CG    1 
ATOM   5678  C  CD    . ARG C  2  274  ? 64.286  -41.100 62.511  1.00 84.93  ? 274  ARG C CD    1 
ATOM   5679  N  NE    . ARG C  2  274  ? 64.629  -42.515 62.528  1.00 92.36  ? 274  ARG C NE    1 
ATOM   5680  C  CZ    . ARG C  2  274  ? 65.383  -43.109 61.612  1.00 103.24 ? 274  ARG C CZ    1 
ATOM   5681  N  NH1   . ARG C  2  274  ? 65.884  -42.405 60.604  1.00 101.74 ? 274  ARG C NH1   1 
ATOM   5682  N  NH2   . ARG C  2  274  ? 65.641  -44.407 61.705  1.00 106.63 ? 274  ARG C NH2   1 
ATOM   5683  N  N     . TYR C  2  275  ? 60.655  -39.898 64.460  1.00 77.77  ? 275  TYR C N     1 
ATOM   5684  C  CA    . TYR C  2  275  ? 60.060  -40.750 65.487  1.00 84.50  ? 275  TYR C CA    1 
ATOM   5685  C  C     . TYR C  2  275  ? 58.527  -40.702 65.487  1.00 79.37  ? 275  TYR C C     1 
ATOM   5686  O  O     . TYR C  2  275  ? 57.870  -41.734 65.615  1.00 73.86  ? 275  TYR C O     1 
ATOM   5687  C  CB    . TYR C  2  275  ? 60.601  -40.395 66.876  1.00 90.34  ? 275  TYR C CB    1 
ATOM   5688  C  CG    . TYR C  2  275  ? 59.966  -41.208 67.981  1.00 99.52  ? 275  TYR C CG    1 
ATOM   5689  C  CD1   . TYR C  2  275  ? 60.416  -42.490 68.271  1.00 107.11 ? 275  TYR C CD1   1 
ATOM   5690  C  CD2   . TYR C  2  275  ? 58.907  -40.701 68.723  1.00 99.96  ? 275  TYR C CD2   1 
ATOM   5691  C  CE1   . TYR C  2  275  ? 59.832  -43.243 69.276  1.00 111.55 ? 275  TYR C CE1   1 
ATOM   5692  C  CE2   . TYR C  2  275  ? 58.316  -41.447 69.730  1.00 106.52 ? 275  TYR C CE2   1 
ATOM   5693  C  CZ    . TYR C  2  275  ? 58.783  -42.717 70.001  1.00 107.10 ? 275  TYR C CZ    1 
ATOM   5694  O  OH    . TYR C  2  275  ? 58.201  -43.463 71.000  1.00 105.71 ? 275  TYR C OH    1 
ATOM   5695  N  N     . LYS C  2  276  ? 57.964  -39.503 65.354  1.00 80.19  ? 276  LYS C N     1 
ATOM   5696  C  CA    . LYS C  2  276  ? 56.513  -39.330 65.327  1.00 75.66  ? 276  LYS C CA    1 
ATOM   5697  C  C     . LYS C  2  276  ? 55.905  -40.072 64.145  1.00 75.27  ? 276  LYS C C     1 
ATOM   5698  O  O     . LYS C  2  276  ? 54.881  -40.732 64.278  1.00 72.79  ? 276  LYS C O     1 
ATOM   5699  C  CB    . LYS C  2  276  ? 56.139  -37.845 65.250  1.00 76.56  ? 276  LYS C CB    1 
ATOM   5700  C  CG    . LYS C  2  276  ? 56.473  -37.033 66.495  1.00 75.33  ? 276  LYS C CG    1 
ATOM   5701  C  CD    . LYS C  2  276  ? 55.449  -37.225 67.605  1.00 65.61  ? 276  LYS C CD    1 
ATOM   5702  C  CE    . LYS C  2  276  ? 54.233  -36.325 67.419  1.00 59.40  ? 276  LYS C CE    1 
ATOM   5703  N  NZ    . LYS C  2  276  ? 53.222  -36.894 66.488  1.00 59.79  ? 276  LYS C NZ    1 
ATOM   5704  N  N     . ALA C  2  277  ? 56.539  -39.949 62.984  1.00 81.43  ? 277  ALA C N     1 
ATOM   5705  C  CA    . ALA C  2  277  ? 56.086  -40.654 61.794  1.00 75.97  ? 277  ALA C CA    1 
ATOM   5706  C  C     . ALA C  2  277  ? 56.100  -42.157 62.041  1.00 75.58  ? 277  ALA C C     1 
ATOM   5707  O  O     . ALA C  2  277  ? 55.085  -42.827 61.877  1.00 72.76  ? 277  ALA C O     1 
ATOM   5708  C  CB    . ALA C  2  277  ? 56.956  -40.300 60.603  1.00 63.47  ? 277  ALA C CB    1 
ATOM   5709  N  N     . GLU C  2  278  ? 57.252  -42.681 62.449  1.00 78.48  ? 278  GLU C N     1 
ATOM   5710  C  CA    . GLU C  2  278  ? 57.378  -44.108 62.719  1.00 80.17  ? 278  GLU C CA    1 
ATOM   5711  C  C     . GLU C  2  278  ? 56.298  -44.604 63.678  1.00 82.61  ? 278  GLU C C     1 
ATOM   5712  O  O     . GLU C  2  278  ? 55.617  -45.589 63.401  1.00 85.55  ? 278  GLU C O     1 
ATOM   5713  C  CB    . GLU C  2  278  ? 58.764  -44.435 63.278  1.00 83.62  ? 278  GLU C CB    1 
ATOM   5714  C  CG    . GLU C  2  278  ? 59.894  -44.277 62.279  1.00 89.01  ? 278  GLU C CG    1 
ATOM   5715  C  CD    . GLU C  2  278  ? 61.228  -44.730 62.836  1.00 95.45  ? 278  GLU C CD    1 
ATOM   5716  O  OE1   . GLU C  2  278  ? 61.332  -44.892 64.072  1.00 95.29  ? 278  GLU C OE1   1 
ATOM   5717  O  OE2   . GLU C  2  278  ? 62.169  -44.927 62.037  1.00 96.11  ? 278  GLU C OE2   1 
ATOM   5718  N  N     . GLU C  2  279  ? 56.143  -43.915 64.803  1.00 82.45  ? 279  GLU C N     1 
ATOM   5719  C  CA    . GLU C  2  279  ? 55.221  -44.351 65.846  1.00 80.98  ? 279  GLU C CA    1 
ATOM   5720  C  C     . GLU C  2  279  ? 53.765  -44.258 65.397  1.00 79.53  ? 279  GLU C C     1 
ATOM   5721  O  O     . GLU C  2  279  ? 52.937  -45.092 65.757  1.00 78.68  ? 279  GLU C O     1 
ATOM   5722  C  CB    . GLU C  2  279  ? 55.438  -43.527 67.116  1.00 84.93  ? 279  GLU C CB    1 
ATOM   5723  C  CG    . GLU C  2  279  ? 54.755  -44.099 68.344  1.00 101.79 ? 279  GLU C CG    1 
ATOM   5724  C  CD    . GLU C  2  279  ? 55.231  -45.503 68.668  1.00 111.44 ? 279  GLU C CD    1 
ATOM   5725  O  OE1   . GLU C  2  279  ? 54.469  -46.256 69.314  1.00 110.32 ? 279  GLU C OE1   1 
ATOM   5726  O  OE2   . GLU C  2  279  ? 56.368  -45.851 68.277  1.00 104.75 ? 279  GLU C OE2   1 
ATOM   5727  N  N     . LYS C  2  280  ? 53.465  -43.237 64.604  1.00 81.97  ? 280  LYS C N     1 
ATOM   5728  C  CA    . LYS C  2  280  ? 52.104  -42.975 64.145  1.00 79.77  ? 280  LYS C CA    1 
ATOM   5729  C  C     . LYS C  2  280  ? 51.657  -43.955 63.068  1.00 80.54  ? 280  LYS C C     1 
ATOM   5730  O  O     . LYS C  2  280  ? 50.580  -44.541 63.155  1.00 78.22  ? 280  LYS C O     1 
ATOM   5731  C  CB    . LYS C  2  280  ? 52.009  -41.550 63.599  1.00 79.21  ? 280  LYS C CB    1 
ATOM   5732  C  CG    . LYS C  2  280  ? 50.655  -41.183 63.019  1.00 76.60  ? 280  LYS C CG    1 
ATOM   5733  C  CD    . LYS C  2  280  ? 49.585  -41.189 64.084  1.00 72.11  ? 280  LYS C CD    1 
ATOM   5734  C  CE    . LYS C  2  280  ? 48.290  -40.595 63.572  1.00 71.51  ? 280  LYS C CE    1 
ATOM   5735  N  NZ    . LYS C  2  280  ? 47.220  -40.667 64.604  1.00 85.37  ? 280  LYS C NZ    1 
ATOM   5736  N  N     . LEU C  2  281  ? 52.496  -44.123 62.052  1.00 84.55  ? 281  LEU C N     1 
ATOM   5737  C  CA    . LEU C  2  281  ? 52.158  -44.929 60.884  1.00 84.59  ? 281  LEU C CA    1 
ATOM   5738  C  C     . LEU C  2  281  ? 52.659  -46.367 61.013  1.00 88.09  ? 281  LEU C C     1 
ATOM   5739  O  O     . LEU C  2  281  ? 52.426  -47.194 60.132  1.00 91.14  ? 281  LEU C O     1 
ATOM   5740  C  CB    . LEU C  2  281  ? 52.746  -44.287 59.627  1.00 79.99  ? 281  LEU C CB    1 
ATOM   5741  C  CG    . LEU C  2  281  ? 52.477  -42.790 59.445  1.00 73.73  ? 281  LEU C CG    1 
ATOM   5742  C  CD1   . LEU C  2  281  ? 53.483  -42.162 58.491  1.00 68.16  ? 281  LEU C CD1   1 
ATOM   5743  C  CD2   . LEU C  2  281  ? 51.053  -42.543 58.977  1.00 66.43  ? 281  LEU C CD2   1 
ATOM   5744  N  N     . GLY C  2  282  ? 53.350  -46.657 62.112  1.00 86.33  ? 282  GLY C N     1 
ATOM   5745  C  CA    . GLY C  2  282  ? 53.902  -47.979 62.341  1.00 86.52  ? 282  GLY C CA    1 
ATOM   5746  C  C     . GLY C  2  282  ? 54.871  -48.401 61.253  1.00 87.77  ? 282  GLY C C     1 
ATOM   5747  O  O     . GLY C  2  282  ? 54.674  -49.425 60.599  1.00 85.24  ? 282  GLY C O     1 
ATOM   5748  N  N     . ILE C  2  283  ? 55.918  -47.608 61.052  1.00 80.63  ? 283  ILE C N     1 
ATOM   5749  C  CA    . ILE C  2  283  ? 56.906  -47.908 60.026  1.00 82.29  ? 283  ILE C CA    1 
ATOM   5750  C  C     . ILE C  2  283  ? 58.318  -47.589 60.499  1.00 91.78  ? 283  ILE C C     1 
ATOM   5751  O  O     . ILE C  2  283  ? 58.522  -47.111 61.616  1.00 89.23  ? 283  ILE C O     1 
ATOM   5752  C  CB    . ILE C  2  283  ? 56.635  -47.124 58.727  1.00 86.43  ? 283  ILE C CB    1 
ATOM   5753  C  CG1   . ILE C  2  283  ? 57.089  -45.669 58.874  1.00 85.46  ? 283  ILE C CG1   1 
ATOM   5754  C  CG2   . ILE C  2  283  ? 55.162  -47.215 58.339  1.00 80.89  ? 283  ILE C CG2   1 
ATOM   5755  C  CD1   . ILE C  2  283  ? 56.921  -44.843 57.623  1.00 67.99  ? 283  ILE C CD1   1 
ATOM   5756  N  N     . ARG C  2  284  ? 59.286  -47.859 59.629  1.00 91.94  ? 284  ARG C N     1 
ATOM   5757  C  CA    . ARG C  2  284  ? 60.690  -47.613 59.915  1.00 95.57  ? 284  ARG C CA    1 
ATOM   5758  C  C     . ARG C  2  284  ? 61.306  -46.774 58.805  1.00 97.35  ? 284  ARG C C     1 
ATOM   5759  O  O     . ARG C  2  284  ? 61.335  -47.189 57.646  1.00 94.54  ? 284  ARG C O     1 
ATOM   5760  C  CB    . ARG C  2  284  ? 61.442  -48.938 60.028  1.00 101.49 ? 284  ARG C CB    1 
ATOM   5761  C  CG    . ARG C  2  284  ? 61.403  -49.575 61.401  1.00 102.63 ? 284  ARG C CG    1 
ATOM   5762  C  CD    . ARG C  2  284  ? 62.663  -49.245 62.186  1.00 114.91 ? 284  ARG C CD    1 
ATOM   5763  N  NE    . ARG C  2  284  ? 63.876  -49.519 61.417  1.00 123.39 ? 284  ARG C NE    1 
ATOM   5764  C  CZ    . ARG C  2  284  ? 64.724  -48.585 60.996  1.00 121.97 ? 284  ARG C CZ    1 
ATOM   5765  N  NH1   . ARG C  2  284  ? 65.803  -48.926 60.299  1.00 123.11 ? 284  ARG C NH1   1 
ATOM   5766  N  NH2   . ARG C  2  284  ? 64.500  -47.308 61.277  1.00 115.41 ? 284  ARG C NH2   1 
ATOM   5767  N  N     . LEU C  2  285  ? 61.800  -45.593 59.158  1.00 100.52 ? 285  LEU C N     1 
ATOM   5768  C  CA    . LEU C  2  285  ? 62.449  -44.733 58.178  1.00 103.29 ? 285  LEU C CA    1 
ATOM   5769  C  C     . LEU C  2  285  ? 63.955  -44.978 58.117  1.00 99.84  ? 285  LEU C C     1 
ATOM   5770  O  O     . LEU C  2  285  ? 64.628  -45.047 59.144  1.00 100.25 ? 285  LEU C O     1 
ATOM   5771  C  CB    . LEU C  2  285  ? 62.174  -43.258 58.479  1.00 102.57 ? 285  LEU C CB    1 
ATOM   5772  C  CG    . LEU C  2  285  ? 60.762  -42.711 58.275  1.00 86.96  ? 285  LEU C CG    1 
ATOM   5773  C  CD1   . LEU C  2  285  ? 60.842  -41.226 57.967  1.00 89.20  ? 285  LEU C CD1   1 
ATOM   5774  C  CD2   . LEU C  2  285  ? 60.062  -43.435 57.151  1.00 89.50  ? 285  LEU C CD2   1 
ATOM   5775  N  N     . SER C  2  286  ? 64.480  -45.107 56.905  1.00 99.11  ? 286  SER C N     1 
ATOM   5776  C  CA    . SER C  2  286  ? 65.914  -45.255 56.718  1.00 102.28 ? 286  SER C CA    1 
ATOM   5777  C  C     . SER C  2  286  ? 66.615  -43.919 56.949  1.00 102.51 ? 286  SER C C     1 
ATOM   5778  O  O     . SER C  2  286  ? 67.841  -43.831 56.900  1.00 104.60 ? 286  SER C O     1 
ATOM   5779  C  CB    . SER C  2  286  ? 66.219  -45.786 55.316  1.00 107.31 ? 286  SER C CB    1 
ATOM   5780  O  OG    . SER C  2  286  ? 65.709  -44.920 54.319  1.00 104.32 ? 286  SER C OG    1 
ATOM   5781  N  N     . GLY C  2  287  ? 65.829  -42.879 57.204  1.00 98.83  ? 287  GLY C N     1 
ATOM   5782  C  CA    . GLY C  2  287  ? 66.373  -41.557 57.450  1.00 92.91  ? 287  GLY C CA    1 
ATOM   5783  C  C     . GLY C  2  287  ? 65.287  -40.539 57.732  1.00 89.62  ? 287  GLY C C     1 
ATOM   5784  O  O     . GLY C  2  287  ? 64.132  -40.894 57.962  1.00 91.66  ? 287  GLY C O     1 
ATOM   5785  N  N     . ARG C  2  288  ? 65.655  -39.265 57.711  1.00 82.33  ? 288  ARG C N     1 
ATOM   5786  C  CA    . ARG C  2  288  ? 64.701  -38.202 57.983  1.00 80.18  ? 288  ARG C CA    1 
ATOM   5787  C  C     . ARG C  2  288  ? 64.099  -37.641 56.698  1.00 80.65  ? 288  ARG C C     1 
ATOM   5788  O  O     . ARG C  2  288  ? 63.558  -36.537 56.680  1.00 74.29  ? 288  ARG C O     1 
ATOM   5789  C  CB    . ARG C  2  288  ? 65.371  -37.086 58.779  1.00 84.24  ? 288  ARG C CB    1 
ATOM   5790  C  CG    . ARG C  2  288  ? 65.833  -37.513 60.161  1.00 74.05  ? 288  ARG C CG    1 
ATOM   5791  C  CD    . ARG C  2  288  ? 66.253  -36.304 60.973  1.00 78.72  ? 288  ARG C CD    1 
ATOM   5792  N  NE    . ARG C  2  288  ? 67.395  -35.620 60.378  1.00 76.94  ? 288  ARG C NE    1 
ATOM   5793  C  CZ    . ARG C  2  288  ? 68.657  -35.893 60.682  1.00 81.70  ? 288  ARG C CZ    1 
ATOM   5794  N  NH1   . ARG C  2  288  ? 68.927  -36.833 61.578  1.00 78.60  ? 288  ARG C NH1   1 
ATOM   5795  N  NH2   . ARG C  2  288  ? 69.646  -35.228 60.096  1.00 91.22  ? 288  ARG C NH2   1 
ATOM   5796  N  N     . THR C  2  289  ? 64.206  -38.406 55.618  1.00 89.49  ? 289  THR C N     1 
ATOM   5797  C  CA    . THR C  2  289  ? 63.700  -37.968 54.322  1.00 84.70  ? 289  THR C CA    1 
ATOM   5798  C  C     . THR C  2  289  ? 62.371  -38.647 53.992  1.00 80.04  ? 289  THR C C     1 
ATOM   5799  O  O     . THR C  2  289  ? 62.091  -39.746 54.473  1.00 80.46  ? 289  THR C O     1 
ATOM   5800  C  CB    . THR C  2  289  ? 64.710  -38.267 53.209  1.00 81.32  ? 289  THR C CB    1 
ATOM   5801  O  OG1   . THR C  2  289  ? 65.952  -37.614 53.498  1.00 85.06  ? 289  THR C OG1   1 
ATOM   5802  C  CG2   . THR C  2  289  ? 64.193  -37.764 51.901  1.00 85.87  ? 289  THR C CG2   1 
ATOM   5803  N  N     . LEU C  2  290  ? 61.553  -37.987 53.177  1.00 73.81  ? 290  LEU C N     1 
ATOM   5804  C  CA    . LEU C  2  290  ? 60.265  -38.542 52.768  1.00 77.43  ? 290  LEU C CA    1 
ATOM   5805  C  C     . LEU C  2  290  ? 60.424  -39.693 51.779  1.00 84.55  ? 290  LEU C C     1 
ATOM   5806  O  O     . LEU C  2  290  ? 59.642  -40.642 51.792  1.00 81.98  ? 290  LEU C O     1 
ATOM   5807  C  CB    . LEU C  2  290  ? 59.372  -37.461 52.158  1.00 75.30  ? 290  LEU C CB    1 
ATOM   5808  C  CG    . LEU C  2  290  ? 58.770  -36.425 53.106  1.00 63.80  ? 290  LEU C CG    1 
ATOM   5809  C  CD1   . LEU C  2  290  ? 57.918  -35.443 52.330  1.00 61.50  ? 290  LEU C CD1   1 
ATOM   5810  C  CD2   . LEU C  2  290  ? 57.953  -37.097 54.179  1.00 60.50  ? 290  LEU C CD2   1 
ATOM   5811  N  N     . ALA C  2  291  ? 61.433  -39.597 50.917  1.00 86.80  ? 291  ALA C N     1 
ATOM   5812  C  CA    . ALA C  2  291  ? 61.721  -40.651 49.950  1.00 84.93  ? 291  ALA C CA    1 
ATOM   5813  C  C     . ALA C  2  291  ? 63.224  -40.770 49.695  1.00 95.14  ? 291  ALA C C     1 
ATOM   5814  O  O     . ALA C  2  291  ? 64.008  -39.965 50.190  1.00 91.40  ? 291  ALA C O     1 
ATOM   5815  C  CB    . ALA C  2  291  ? 60.972  -40.399 48.653  1.00 81.88  ? 291  ALA C CB    1 
ATOM   5816  N  N     . ARG C  2  292  ? 63.637  -41.802 48.970  1.00 107.08 ? 292  ARG C N     1 
ATOM   5817  C  CA    . ARG C  2  292  ? 65.064  -42.056 48.792  1.00 103.52 ? 292  ARG C CA    1 
ATOM   5818  C  C     . ARG C  2  292  ? 65.445  -42.270 47.334  1.00 106.25 ? 292  ARG C C     1 
ATOM   5819  O  O     . ARG C  2  292  ? 64.657  -42.797 46.549  1.00 106.48 ? 292  ARG C O     1 
ATOM   5820  C  CB    . ARG C  2  292  ? 65.503  -43.259 49.630  1.00 98.93  ? 292  ARG C CB    1 
ATOM   5821  C  CG    . ARG C  2  292  ? 64.460  -44.360 49.733  1.00 105.38 ? 292  ARG C CG    1 
ATOM   5822  C  CD    . ARG C  2  292  ? 65.016  -45.579 50.450  1.00 111.47 ? 292  ARG C CD    1 
ATOM   5823  N  NE    . ARG C  2  292  ? 64.243  -46.783 50.160  1.00 120.53 ? 292  ARG C NE    1 
ATOM   5824  C  CZ    . ARG C  2  292  ? 64.378  -47.933 50.813  1.00 120.91 ? 292  ARG C CZ    1 
ATOM   5825  N  NH1   . ARG C  2  292  ? 65.258  -48.039 51.799  1.00 118.88 ? 292  ARG C NH1   1 
ATOM   5826  N  NH2   . ARG C  2  292  ? 63.632  -48.978 50.481  1.00 114.12 ? 292  ARG C NH2   1 
ATOM   5827  N  N     . PHE C  2  293  ? 66.655  -41.853 46.983  1.00 112.84 ? 293  PHE C N     1 
ATOM   5828  C  CA    . PHE C  2  293  ? 67.197  -42.174 45.680  1.00 119.11 ? 293  PHE C CA    1 
ATOM   5829  C  C     . PHE C  2  293  ? 68.221  -43.273 45.899  1.00 124.09 ? 293  PHE C C     1 
ATOM   5830  O  O     . PHE C  2  293  ? 69.269  -43.052 46.506  1.00 122.13 ? 293  PHE C O     1 
ATOM   5831  C  CB    . PHE C  2  293  ? 67.861  -40.946 45.058  1.00 117.39 ? 293  PHE C CB    1 
ATOM   5832  C  CG    . PHE C  2  293  ? 68.012  -41.030 43.566  1.00 123.18 ? 293  PHE C CG    1 
ATOM   5833  C  CD1   . PHE C  2  293  ? 67.067  -40.462 42.728  1.00 119.04 ? 293  PHE C CD1   1 
ATOM   5834  C  CD2   . PHE C  2  293  ? 69.100  -41.674 43.002  1.00 130.37 ? 293  PHE C CD2   1 
ATOM   5835  C  CE1   . PHE C  2  293  ? 67.204  -40.536 41.355  1.00 117.18 ? 293  PHE C CE1   1 
ATOM   5836  C  CE2   . PHE C  2  293  ? 69.243  -41.752 41.630  1.00 129.82 ? 293  PHE C CE2   1 
ATOM   5837  C  CZ    . PHE C  2  293  ? 68.293  -41.183 40.805  1.00 122.56 ? 293  PHE C CZ    1 
ATOM   5838  N  N     . GLU C  2  294  ? 67.909  -44.459 45.396  1.00 128.61 ? 294  GLU C N     1 
ATOM   5839  C  CA    . GLU C  2  294  ? 68.806  -45.595 45.502  1.00 132.21 ? 294  GLU C CA    1 
ATOM   5840  C  C     . GLU C  2  294  ? 69.058  -46.109 44.101  1.00 136.96 ? 294  GLU C C     1 
ATOM   5841  O  O     . GLU C  2  294  ? 68.118  -46.321 43.336  1.00 136.56 ? 294  GLU C O     1 
ATOM   5842  C  CB    . GLU C  2  294  ? 68.185  -46.693 46.365  1.00 127.37 ? 294  GLU C CB    1 
ATOM   5843  C  CG    . GLU C  2  294  ? 68.875  -46.896 47.704  1.00 125.08 ? 294  GLU C CG    1 
ATOM   5844  C  CD    . GLU C  2  294  ? 68.407  -48.150 48.415  1.00 122.18 ? 294  GLU C CD    1 
ATOM   5845  O  OE1   . GLU C  2  294  ? 67.417  -48.760 47.959  1.00 116.92 ? 294  GLU C OE1   1 
ATOM   5846  O  OE2   . GLU C  2  294  ? 69.029  -48.527 49.430  1.00 123.01 ? 294  GLU C OE2   1 
ATOM   5847  N  N     . ASP C  2  295  ? 70.323  -46.318 43.764  1.00 138.34 ? 295  ASP C N     1 
ATOM   5848  C  CA    . ASP C  2  295  ? 70.629  -46.798 42.437  1.00 135.06 ? 295  ASP C CA    1 
ATOM   5849  C  C     . ASP C  2  295  ? 70.038  -45.788 41.474  1.00 130.76 ? 295  ASP C C     1 
ATOM   5850  O  O     . ASP C  2  295  ? 70.299  -44.589 41.575  1.00 128.41 ? 295  ASP C O     1 
ATOM   5851  C  CB    . ASP C  2  295  ? 70.013  -48.177 42.205  1.00 132.50 ? 295  ASP C CB    1 
ATOM   5852  C  CG    . ASP C  2  295  ? 70.178  -49.096 43.398  1.00 136.04 ? 295  ASP C CG    1 
ATOM   5853  O  OD1   . ASP C  2  295  ? 69.231  -49.851 43.705  1.00 134.09 ? 295  ASP C OD1   1 
ATOM   5854  O  OD2   . ASP C  2  295  ? 71.255  -49.065 44.030  1.00 134.50 ? 295  ASP C OD2   1 
ATOM   5855  N  N     . GLY C  2  296  ? 69.244  -46.279 40.534  1.00 127.80 ? 296  GLY C N     1 
ATOM   5856  C  CA    . GLY C  2  296  ? 68.670  -45.427 39.516  1.00 131.50 ? 296  GLY C CA    1 
ATOM   5857  C  C     . GLY C  2  296  ? 67.304  -44.791 39.713  1.00 125.09 ? 296  GLY C C     1 
ATOM   5858  O  O     . GLY C  2  296  ? 66.872  -44.062 38.820  1.00 124.42 ? 296  GLY C O     1 
ATOM   5859  N  N     . GLU C  2  297  ? 66.589  -45.134 40.777  1.00 127.18 ? 297  GLU C N     1 
ATOM   5860  C  CA    . GLU C  2  297  ? 65.190  -44.735 40.871  1.00 128.98 ? 297  GLU C CA    1 
ATOM   5861  C  C     . GLU C  2  297  ? 64.760  -44.233 42.241  1.00 126.00 ? 297  GLU C C     1 
ATOM   5862  O  O     . GLU C  2  297  ? 65.329  -44.608 43.266  1.00 118.73 ? 297  GLU C O     1 
ATOM   5863  C  CB    . GLU C  2  297  ? 64.281  -45.888 40.435  1.00 128.71 ? 297  GLU C CB    1 
ATOM   5864  C  CG    . GLU C  2  297  ? 64.642  -47.230 41.051  1.00 128.67 ? 297  GLU C CG    1 
ATOM   5865  C  CD    . GLU C  2  297  ? 63.451  -48.162 41.154  1.00 125.14 ? 297  GLU C CD    1 
ATOM   5866  O  OE1   . GLU C  2  297  ? 63.395  -48.953 42.119  1.00 128.15 ? 297  GLU C OE1   1 
ATOM   5867  O  OE2   . GLU C  2  297  ? 62.570  -48.103 40.270  1.00 118.31 ? 297  GLU C OE2   1 
ATOM   5868  N  N     . PHE C  2  298  ? 63.740  -43.382 42.241  1.00 121.55 ? 298  PHE C N     1 
ATOM   5869  C  CA    . PHE C  2  298  ? 63.152  -42.893 43.475  1.00 112.70 ? 298  PHE C CA    1 
ATOM   5870  C  C     . PHE C  2  298  ? 62.487  -44.036 44.231  1.00 104.40 ? 298  PHE C C     1 
ATOM   5871  O  O     . PHE C  2  298  ? 61.857  -44.910 43.637  1.00 106.71 ? 298  PHE C O     1 
ATOM   5872  C  CB    . PHE C  2  298  ? 62.134  -41.788 43.185  1.00 106.56 ? 298  PHE C CB    1 
ATOM   5873  C  CG    . PHE C  2  298  ? 62.752  -40.435 42.977  1.00 106.65 ? 298  PHE C CG    1 
ATOM   5874  C  CD1   . PHE C  2  298  ? 62.338  -39.623 41.935  1.00 107.04 ? 298  PHE C CD1   1 
ATOM   5875  C  CD2   . PHE C  2  298  ? 63.746  -39.975 43.825  1.00 110.79 ? 298  PHE C CD2   1 
ATOM   5876  C  CE1   . PHE C  2  298  ? 62.904  -38.377 41.741  1.00 108.33 ? 298  PHE C CE1   1 
ATOM   5877  C  CE2   . PHE C  2  298  ? 64.316  -38.731 43.637  1.00 107.35 ? 298  PHE C CE2   1 
ATOM   5878  C  CZ    . PHE C  2  298  ? 63.895  -37.930 42.593  1.00 105.15 ? 298  PHE C CZ    1 
ATOM   5879  N  N     . LYS C  2  299  ? 62.635  -44.014 45.549  1.00 102.74 ? 299  LYS C N     1 
ATOM   5880  C  CA    . LYS C  2  299  ? 62.051  -45.012 46.424  1.00 104.98 ? 299  LYS C CA    1 
ATOM   5881  C  C     . LYS C  2  299  ? 61.240  -44.295 47.482  1.00 101.55 ? 299  LYS C C     1 
ATOM   5882  O  O     . LYS C  2  299  ? 61.740  -43.397 48.160  1.00 101.90 ? 299  LYS C O     1 
ATOM   5883  C  CB    . LYS C  2  299  ? 63.143  -45.861 47.077  1.00 111.40 ? 299  LYS C CB    1 
ATOM   5884  C  CG    . LYS C  2  299  ? 63.545  -47.083 46.268  1.00 115.34 ? 299  LYS C CG    1 
ATOM   5885  C  CD    . LYS C  2  299  ? 64.261  -48.107 47.133  1.00 120.54 ? 299  LYS C CD    1 
ATOM   5886  C  CE    . LYS C  2  299  ? 63.567  -49.458 47.079  1.00 127.44 ? 299  LYS C CE    1 
ATOM   5887  N  NZ    . LYS C  2  299  ? 63.763  -50.132 45.766  1.00 114.54 ? 299  LYS C NZ    1 
ATOM   5888  N  N     . ASP C  2  300  ? 59.984  -44.692 47.620  1.00 97.43  ? 300  ASP C N     1 
ATOM   5889  C  CA    . ASP C  2  300  ? 59.098  -44.049 48.593  1.00 94.23  ? 300  ASP C CA    1 
ATOM   5890  C  C     . ASP C  2  300  ? 59.303  -44.571 50.015  1.00 92.97  ? 300  ASP C C     1 
ATOM   5891  O  O     . ASP C  2  300  ? 59.729  -45.709 50.215  1.00 90.76  ? 300  ASP C O     1 
ATOM   5892  C  CB    . ASP C  2  300  ? 57.630  -44.211 48.187  1.00 88.70  ? 300  ASP C CB    1 
ATOM   5893  C  CG    . ASP C  2  300  ? 56.668  -43.611 49.206  1.00 85.01  ? 300  ASP C CG    1 
ATOM   5894  O  OD1   . ASP C  2  300  ? 57.002  -42.569 49.809  1.00 85.50  ? 300  ASP C OD1   1 
ATOM   5895  O  OD2   . ASP C  2  300  ? 55.576  -44.183 49.408  1.00 81.61  ? 300  ASP C OD2   1 
ATOM   5896  N  N     . GLU C  2  301  ? 59.002  -43.727 50.999  1.00 92.29  ? 301  GLU C N     1 
ATOM   5897  C  CA    . GLU C  2  301  ? 59.035  -44.135 52.401  1.00 88.39  ? 301  GLU C CA    1 
ATOM   5898  C  C     . GLU C  2  301  ? 57.801  -43.674 53.175  1.00 84.32  ? 301  GLU C C     1 
ATOM   5899  O  O     . GLU C  2  301  ? 57.117  -44.481 53.798  1.00 79.87  ? 301  GLU C O     1 
ATOM   5900  C  CB    . GLU C  2  301  ? 60.298  -43.622 53.099  1.00 87.15  ? 301  GLU C CB    1 
ATOM   5901  C  CG    . GLU C  2  301  ? 61.561  -44.385 52.755  1.00 96.64  ? 301  GLU C CG    1 
ATOM   5902  C  CD    . GLU C  2  301  ? 62.709  -44.053 53.686  1.00 104.83 ? 301  GLU C CD    1 
ATOM   5903  O  OE1   . GLU C  2  301  ? 62.510  -43.254 54.625  1.00 104.60 ? 301  GLU C OE1   1 
ATOM   5904  O  OE2   . GLU C  2  301  ? 63.813  -44.595 53.480  1.00 110.68 ? 301  GLU C OE2   1 
ATOM   5905  N  N     . VAL C  2  302  ? 57.520  -42.375 53.131  1.00 85.01  ? 302  VAL C N     1 
ATOM   5906  C  CA    . VAL C  2  302  ? 56.472  -41.793 53.968  1.00 78.15  ? 302  VAL C CA    1 
ATOM   5907  C  C     . VAL C  2  302  ? 55.087  -41.775 53.317  1.00 77.03  ? 302  VAL C C     1 
ATOM   5908  O  O     . VAL C  2  302  ? 54.084  -42.018 53.985  1.00 73.51  ? 302  VAL C O     1 
ATOM   5909  C  CB    . VAL C  2  302  ? 56.842  -40.361 54.413  1.00 74.81  ? 302  VAL C CB    1 
ATOM   5910  C  CG1   . VAL C  2  302  ? 55.729  -39.753 55.235  1.00 71.26  ? 302  VAL C CG1   1 
ATOM   5911  C  CG2   . VAL C  2  302  ? 58.133  -40.372 55.208  1.00 78.04  ? 302  VAL C CG2   1 
ATOM   5912  N  N     . PHE C  2  303  ? 55.039  -41.495 52.017  1.00 76.10  ? 303  PHE C N     1 
ATOM   5913  C  CA    . PHE C  2  303  ? 53.775  -41.235 51.319  1.00 74.83  ? 303  PHE C CA    1 
ATOM   5914  C  C     . PHE C  2  303  ? 52.727  -42.348 51.378  1.00 77.16  ? 303  PHE C C     1 
ATOM   5915  O  O     . PHE C  2  303  ? 51.576  -42.106 51.754  1.00 75.80  ? 303  PHE C O     1 
ATOM   5916  C  CB    . PHE C  2  303  ? 54.041  -40.852 49.864  1.00 66.21  ? 303  PHE C CB    1 
ATOM   5917  C  CG    . PHE C  2  303  ? 54.705  -39.523 49.707  1.00 60.32  ? 303  PHE C CG    1 
ATOM   5918  C  CD1   . PHE C  2  303  ? 56.084  -39.426 49.681  1.00 65.73  ? 303  PHE C CD1   1 
ATOM   5919  C  CD2   . PHE C  2  303  ? 53.952  -38.369 49.595  1.00 58.13  ? 303  PHE C CD2   1 
ATOM   5920  C  CE1   . PHE C  2  303  ? 56.701  -38.201 49.540  1.00 68.05  ? 303  PHE C CE1   1 
ATOM   5921  C  CE2   . PHE C  2  303  ? 54.561  -37.140 49.451  1.00 62.83  ? 303  PHE C CE2   1 
ATOM   5922  C  CZ    . PHE C  2  303  ? 55.938  -37.055 49.424  1.00 70.27  ? 303  PHE C CZ    1 
ATOM   5923  N  N     . LEU C  2  304  ? 53.110  -43.558 50.987  1.00 79.22  ? 304  LEU C N     1 
ATOM   5924  C  CA    . LEU C  2  304  ? 52.160  -44.670 50.974  1.00 84.73  ? 304  LEU C CA    1 
ATOM   5925  C  C     . LEU C  2  304  ? 51.553  -44.965 52.348  1.00 79.56  ? 304  LEU C C     1 
ATOM   5926  O  O     . LEU C  2  304  ? 50.361  -45.235 52.446  1.00 76.87  ? 304  LEU C O     1 
ATOM   5927  C  CB    . LEU C  2  304  ? 52.791  -45.938 50.394  1.00 90.57  ? 304  LEU C CB    1 
ATOM   5928  C  CG    . LEU C  2  304  ? 51.838  -47.132 50.279  1.00 87.27  ? 304  LEU C CG    1 
ATOM   5929  C  CD1   . LEU C  2  304  ? 50.758  -46.865 49.237  1.00 83.44  ? 304  LEU C CD1   1 
ATOM   5930  C  CD2   . LEU C  2  304  ? 52.605  -48.405 49.954  1.00 92.44  ? 304  LEU C CD2   1 
ATOM   5931  N  N     . PRO C  2  305  ? 52.373  -44.934 53.413  1.00 79.29  ? 305  PRO C N     1 
ATOM   5932  C  CA    . PRO C  2  305  ? 51.843  -45.170 54.760  1.00 79.16  ? 305  PRO C CA    1 
ATOM   5933  C  C     . PRO C  2  305  ? 50.897  -44.072 55.243  1.00 73.86  ? 305  PRO C C     1 
ATOM   5934  O  O     . PRO C  2  305  ? 49.920  -44.385 55.921  1.00 73.02  ? 305  PRO C O     1 
ATOM   5935  C  CB    . PRO C  2  305  ? 53.104  -45.196 55.631  1.00 78.90  ? 305  PRO C CB    1 
ATOM   5936  C  CG    . PRO C  2  305  ? 54.202  -45.544 54.704  1.00 71.28  ? 305  PRO C CG    1 
ATOM   5937  C  CD    . PRO C  2  305  ? 53.845  -44.888 53.409  1.00 76.99  ? 305  PRO C CD    1 
ATOM   5938  N  N     . THR C  2  306  ? 51.184  -42.814 54.915  1.00 74.20  ? 306  THR C N     1 
ATOM   5939  C  CA    . THR C  2  306  ? 50.332  -41.713 55.356  1.00 74.65  ? 306  THR C CA    1 
ATOM   5940  C  C     . THR C  2  306  ? 49.040  -41.696 54.555  1.00 74.70  ? 306  THR C C     1 
ATOM   5941  O  O     . THR C  2  306  ? 47.998  -41.277 55.053  1.00 77.97  ? 306  THR C O     1 
ATOM   5942  C  CB    . THR C  2  306  ? 51.021  -40.331 55.249  1.00 69.02  ? 306  THR C CB    1 
ATOM   5943  O  OG1   . THR C  2  306  ? 50.977  -39.869 53.898  1.00 74.00  ? 306  THR C OG1   1 
ATOM   5944  C  CG2   . THR C  2  306  ? 52.461  -40.402 55.712  1.00 65.25  ? 306  THR C CG2   1 
ATOM   5945  N  N     . LEU C  2  307  ? 49.114  -42.159 53.312  1.00 78.92  ? 307  LEU C N     1 
ATOM   5946  C  CA    . LEU C  2  307  ? 47.928  -42.293 52.471  1.00 81.43  ? 307  LEU C CA    1 
ATOM   5947  C  C     . LEU C  2  307  ? 47.063  -43.445 52.974  1.00 77.69  ? 307  LEU C C     1 
ATOM   5948  O  O     . LEU C  2  307  ? 45.837  -43.353 53.016  1.00 80.41  ? 307  LEU C O     1 
ATOM   5949  C  CB    . LEU C  2  307  ? 48.335  -42.527 51.014  1.00 84.95  ? 307  LEU C CB    1 
ATOM   5950  C  CG    . LEU C  2  307  ? 47.218  -42.743 49.988  1.00 85.16  ? 307  LEU C CG    1 
ATOM   5951  C  CD1   . LEU C  2  307  ? 46.253  -41.572 49.970  1.00 83.09  ? 307  LEU C CD1   1 
ATOM   5952  C  CD2   . LEU C  2  307  ? 47.805  -42.972 48.605  1.00 84.10  ? 307  LEU C CD2   1 
ATOM   5953  N  N     . ARG C  2  308  ? 47.724  -44.530 53.358  1.00 80.28  ? 308  ARG C N     1 
ATOM   5954  C  CA    . ARG C  2  308  ? 47.060  -45.685 53.937  1.00 80.86  ? 308  ARG C CA    1 
ATOM   5955  C  C     . ARG C  2  308  ? 46.325  -45.265 55.204  1.00 78.21  ? 308  ARG C C     1 
ATOM   5956  O  O     . ARG C  2  308  ? 45.160  -45.603 55.388  1.00 78.81  ? 308  ARG C O     1 
ATOM   5957  C  CB    . ARG C  2  308  ? 48.088  -46.783 54.236  1.00 78.53  ? 308  ARG C CB    1 
ATOM   5958  C  CG    . ARG C  2  308  ? 47.512  -48.134 54.645  1.00 80.78  ? 308  ARG C CG    1 
ATOM   5959  C  CD    . ARG C  2  308  ? 47.177  -48.191 56.131  1.00 86.13  ? 308  ARG C CD    1 
ATOM   5960  N  NE    . ARG C  2  308  ? 48.220  -47.575 56.947  1.00 96.33  ? 308  ARG C NE    1 
ATOM   5961  C  CZ    . ARG C  2  308  ? 48.410  -47.825 58.239  1.00 98.07  ? 308  ARG C CZ    1 
ATOM   5962  N  NH1   . ARG C  2  308  ? 47.631  -48.696 58.868  1.00 100.00 ? 308  ARG C NH1   1 
ATOM   5963  N  NH2   . ARG C  2  308  ? 49.387  -47.212 58.898  1.00 94.38  ? 308  ARG C NH2   1 
ATOM   5964  N  N     . TYR C  2  309  ? 47.008  -44.516 56.068  1.00 77.57  ? 309  TYR C N     1 
ATOM   5965  C  CA    . TYR C  2  309  ? 46.421  -44.052 57.323  1.00 78.41  ? 309  TYR C CA    1 
ATOM   5966  C  C     . TYR C  2  309  ? 45.259  -43.106 57.052  1.00 81.17  ? 309  TYR C C     1 
ATOM   5967  O  O     . TYR C  2  309  ? 44.221  -43.179 57.707  1.00 81.84  ? 309  TYR C O     1 
ATOM   5968  C  CB    . TYR C  2  309  ? 47.474  -43.351 58.182  1.00 76.54  ? 309  TYR C CB    1 
ATOM   5969  C  CG    . TYR C  2  309  ? 47.137  -43.260 59.658  1.00 76.17  ? 309  TYR C CG    1 
ATOM   5970  C  CD1   . TYR C  2  309  ? 47.798  -44.050 60.588  1.00 81.80  ? 309  TYR C CD1   1 
ATOM   5971  C  CD2   . TYR C  2  309  ? 46.172  -42.378 60.123  1.00 77.54  ? 309  TYR C CD2   1 
ATOM   5972  C  CE1   . TYR C  2  309  ? 47.507  -43.970 61.936  1.00 83.59  ? 309  TYR C CE1   1 
ATOM   5973  C  CE2   . TYR C  2  309  ? 45.872  -42.291 61.474  1.00 78.82  ? 309  TYR C CE2   1 
ATOM   5974  C  CZ    . TYR C  2  309  ? 46.542  -43.091 62.373  1.00 83.19  ? 309  TYR C CZ    1 
ATOM   5975  O  OH    . TYR C  2  309  ? 46.253  -43.015 63.717  1.00 86.94  ? 309  TYR C OH    1 
ATOM   5976  N  N     . LEU C  2  310  ? 45.445  -42.216 56.084  1.00 79.94  ? 310  LEU C N     1 
ATOM   5977  C  CA    . LEU C  2  310  ? 44.403  -41.276 55.688  1.00 78.97  ? 310  LEU C CA    1 
ATOM   5978  C  C     . LEU C  2  310  ? 43.128  -42.001 55.270  1.00 83.80  ? 310  LEU C C     1 
ATOM   5979  O  O     . LEU C  2  310  ? 42.040  -41.688 55.755  1.00 85.74  ? 310  LEU C O     1 
ATOM   5980  C  CB    . LEU C  2  310  ? 44.900  -40.381 54.551  1.00 77.81  ? 310  LEU C CB    1 
ATOM   5981  C  CG    . LEU C  2  310  ? 43.881  -39.488 53.840  1.00 78.77  ? 310  LEU C CG    1 
ATOM   5982  C  CD1   . LEU C  2  310  ? 43.019  -38.721 54.835  1.00 77.62  ? 310  LEU C CD1   1 
ATOM   5983  C  CD2   . LEU C  2  310  ? 44.587  -38.540 52.879  1.00 76.31  ? 310  LEU C CD2   1 
ATOM   5984  N  N     . PHE C  2  311  ? 43.268  -42.967 54.365  1.00 83.79  ? 311  PHE C N     1 
ATOM   5985  C  CA    . PHE C  2  311  ? 42.124  -43.748 53.904  1.00 85.62  ? 311  PHE C CA    1 
ATOM   5986  C  C     . PHE C  2  311  ? 41.490  -44.532 55.048  1.00 91.48  ? 311  PHE C C     1 
ATOM   5987  O  O     . PHE C  2  311  ? 40.281  -44.463 55.268  1.00 93.90  ? 311  PHE C O     1 
ATOM   5988  C  CB    . PHE C  2  311  ? 42.533  -44.702 52.777  1.00 93.42  ? 311  PHE C CB    1 
ATOM   5989  C  CG    . PHE C  2  311  ? 42.652  -44.040 51.431  1.00 97.97  ? 311  PHE C CG    1 
ATOM   5990  C  CD1   . PHE C  2  311  ? 41.988  -42.855 51.163  1.00 101.03 ? 311  PHE C CD1   1 
ATOM   5991  C  CD2   . PHE C  2  311  ? 43.422  -44.606 50.432  1.00 95.48  ? 311  PHE C CD2   1 
ATOM   5992  C  CE1   . PHE C  2  311  ? 42.097  -42.246 49.928  1.00 99.74  ? 311  PHE C CE1   1 
ATOM   5993  C  CE2   . PHE C  2  311  ? 43.531  -44.000 49.197  1.00 98.69  ? 311  PHE C CE2   1 
ATOM   5994  C  CZ    . PHE C  2  311  ? 42.868  -42.820 48.946  1.00 97.19  ? 311  PHE C CZ    1 
ATOM   5995  N  N     . ALA C  2  312  ? 42.317  -45.278 55.774  1.00 95.30  ? 312  ALA C N     1 
ATOM   5996  C  CA    . ALA C  2  312  ? 41.849  -46.084 56.896  1.00 92.13  ? 312  ALA C CA    1 
ATOM   5997  C  C     . ALA C  2  312  ? 41.107  -45.220 57.903  1.00 88.59  ? 312  ALA C C     1 
ATOM   5998  O  O     . ALA C  2  312  ? 40.270  -45.705 58.655  1.00 91.31  ? 312  ALA C O     1 
ATOM   5999  C  CB    . ALA C  2  312  ? 43.019  -46.792 57.563  1.00 94.01  ? 312  ALA C CB    1 
ATOM   6000  N  N     . LEU C  2  313  ? 41.425  -43.933 57.916  1.00 89.71  ? 313  LEU C N     1 
ATOM   6001  C  CA    . LEU C  2  313  ? 40.763  -43.005 58.815  1.00 92.11  ? 313  LEU C CA    1 
ATOM   6002  C  C     . LEU C  2  313  ? 39.427  -42.563 58.234  1.00 89.50  ? 313  LEU C C     1 
ATOM   6003  O  O     . LEU C  2  313  ? 38.408  -42.589 58.922  1.00 90.81  ? 313  LEU C O     1 
ATOM   6004  C  CB    . LEU C  2  313  ? 41.654  -41.792 59.086  1.00 91.78  ? 313  LEU C CB    1 
ATOM   6005  C  CG    . LEU C  2  313  ? 41.186  -40.820 60.168  1.00 84.23  ? 313  LEU C CG    1 
ATOM   6006  C  CD1   . LEU C  2  313  ? 41.040  -41.532 61.503  1.00 90.69  ? 313  LEU C CD1   1 
ATOM   6007  C  CD2   . LEU C  2  313  ? 42.150  -39.655 60.281  1.00 85.87  ? 313  LEU C CD2   1 
ATOM   6008  N  N     . THR C  2  314  ? 39.436  -42.168 56.962  1.00 90.84  ? 314  THR C N     1 
ATOM   6009  C  CA    . THR C  2  314  ? 38.232  -41.662 56.305  1.00 94.38  ? 314  THR C CA    1 
ATOM   6010  C  C     . THR C  2  314  ? 37.063  -42.633 56.449  1.00 97.91  ? 314  THR C C     1 
ATOM   6011  O  O     . THR C  2  314  ? 36.003  -42.276 56.967  1.00 95.93  ? 314  THR C O     1 
ATOM   6012  C  CB    . THR C  2  314  ? 38.478  -41.352 54.820  1.00 87.18  ? 314  THR C CB    1 
ATOM   6013  O  OG1   . THR C  2  314  ? 39.525  -40.382 54.705  1.00 85.78  ? 314  THR C OG1   1 
ATOM   6014  C  CG2   . THR C  2  314  ? 37.218  -40.799 54.184  1.00 97.27  ? 314  THR C CG2   1 
ATOM   6015  N  N     . ALA C  2  315  ? 37.253  -43.859 55.980  1.00 94.86  ? 315  ALA C N     1 
ATOM   6016  C  CA    . ALA C  2  315  ? 36.340  -44.935 56.320  1.00 96.42  ? 315  ALA C CA    1 
ATOM   6017  C  C     . ALA C  2  315  ? 36.730  -45.409 57.713  1.00 97.80  ? 315  ALA C C     1 
ATOM   6018  O  O     . ALA C  2  315  ? 37.809  -45.964 57.897  1.00 102.42 ? 315  ALA C O     1 
ATOM   6019  C  CB    . ALA C  2  315  ? 36.458  -46.067 55.320  1.00 96.67  ? 315  ALA C CB    1 
ATOM   6020  N  N     . GLY C  2  316  ? 35.862  -45.181 58.691  1.00 96.14  ? 316  GLY C N     1 
ATOM   6021  C  CA    . GLY C  2  316  ? 36.179  -45.487 60.074  1.00 98.23  ? 316  GLY C CA    1 
ATOM   6022  C  C     . GLY C  2  316  ? 36.806  -46.848 60.295  1.00 96.48  ? 316  GLY C C     1 
ATOM   6023  O  O     . GLY C  2  316  ? 36.152  -47.871 60.131  1.00 105.33 ? 316  GLY C O     1 
ATOM   6024  N  N     . VAL C  2  317  ? 38.080  -46.858 60.669  1.00 96.61  ? 317  VAL C N     1 
ATOM   6025  C  CA    . VAL C  2  317  ? 38.769  -48.097 61.011  1.00 99.34  ? 317  VAL C CA    1 
ATOM   6026  C  C     . VAL C  2  317  ? 39.315  -48.047 62.426  1.00 101.80 ? 317  VAL C C     1 
ATOM   6027  O  O     . VAL C  2  317  ? 40.045  -47.123 62.786  1.00 99.89  ? 317  VAL C O     1 
ATOM   6028  C  CB    . VAL C  2  317  ? 39.938  -48.396 60.056  1.00 94.57  ? 317  VAL C CB    1 
ATOM   6029  C  CG1   . VAL C  2  317  ? 40.843  -49.458 60.644  1.00 98.00  ? 317  VAL C CG1   1 
ATOM   6030  C  CG2   . VAL C  2  317  ? 39.419  -48.848 58.705  1.00 93.06  ? 317  VAL C CG2   1 
ATOM   6031  N  N     . PRO C  2  318  ? 38.952  -49.045 63.238  1.00 104.07 ? 318  PRO C N     1 
ATOM   6032  C  CA    . PRO C  2  318  ? 39.458  -49.128 64.607  1.00 109.37 ? 318  PRO C CA    1 
ATOM   6033  C  C     . PRO C  2  318  ? 40.984  -49.069 64.643  1.00 104.23 ? 318  PRO C C     1 
ATOM   6034  O  O     . PRO C  2  318  ? 41.646  -49.805 63.909  1.00 98.23  ? 318  PRO C O     1 
ATOM   6035  C  CB    . PRO C  2  318  ? 38.963  -50.499 65.069  1.00 109.56 ? 318  PRO C CB    1 
ATOM   6036  C  CG    . PRO C  2  318  ? 37.738  -50.742 64.263  1.00 102.66 ? 318  PRO C CG    1 
ATOM   6037  C  CD    . PRO C  2  318  ? 38.018  -50.139 62.923  1.00 99.69  ? 318  PRO C CD    1 
ATOM   6038  N  N     . GLY C  2  319  ? 41.528  -48.194 65.485  1.00 104.00 ? 319  GLY C N     1 
ATOM   6039  C  CA    . GLY C  2  319  ? 42.966  -48.074 65.639  1.00 108.26 ? 319  GLY C CA    1 
ATOM   6040  C  C     . GLY C  2  319  ? 43.547  -46.826 64.998  1.00 103.40 ? 319  GLY C C     1 
ATOM   6041  O  O     . GLY C  2  319  ? 44.756  -46.594 65.055  1.00 100.50 ? 319  GLY C O     1 
ATOM   6042  N  N     . HIS C  2  320  ? 42.686  -46.016 64.390  1.00 98.47  ? 320  HIS C N     1 
ATOM   6043  C  CA    . HIS C  2  320  ? 43.134  -44.796 63.728  1.00 94.63  ? 320  HIS C CA    1 
ATOM   6044  C  C     . HIS C  2  320  ? 42.564  -43.539 64.379  1.00 97.09  ? 320  HIS C C     1 
ATOM   6045  O  O     . HIS C  2  320  ? 41.352  -43.389 64.516  1.00 94.14  ? 320  HIS C O     1 
ATOM   6046  C  CB    . HIS C  2  320  ? 42.805  -44.847 62.239  1.00 91.28  ? 320  HIS C CB    1 
ATOM   6047  C  CG    . HIS C  2  320  ? 43.545  -45.919 61.501  1.00 92.93  ? 320  HIS C CG    1 
ATOM   6048  N  ND1   . HIS C  2  320  ? 43.508  -47.243 61.880  1.00 92.81  ? 320  HIS C ND1   1 
ATOM   6049  C  CD2   . HIS C  2  320  ? 44.352  -45.861 60.415  1.00 94.92  ? 320  HIS C CD2   1 
ATOM   6050  C  CE1   . HIS C  2  320  ? 44.255  -47.956 61.055  1.00 92.15  ? 320  HIS C CE1   1 
ATOM   6051  N  NE2   . HIS C  2  320  ? 44.778  -47.142 60.157  1.00 90.87  ? 320  HIS C NE2   1 
ATOM   6052  N  N     . GLU C  2  321  ? 43.460  -42.638 64.768  1.00 104.70 ? 321  GLU C N     1 
ATOM   6053  C  CA    . GLU C  2  321  ? 43.106  -41.483 65.585  1.00 103.20 ? 321  GLU C CA    1 
ATOM   6054  C  C     . GLU C  2  321  ? 43.258  -40.167 64.836  1.00 91.82  ? 321  GLU C C     1 
ATOM   6055  O  O     . GLU C  2  321  ? 44.042  -40.054 63.897  1.00 81.50  ? 321  GLU C O     1 
ATOM   6056  C  CB    . GLU C  2  321  ? 43.991  -41.437 66.839  1.00 103.47 ? 321  GLU C CB    1 
ATOM   6057  C  CG    . GLU C  2  321  ? 43.838  -42.620 67.782  1.00 98.87  ? 321  GLU C CG    1 
ATOM   6058  C  CD    . GLU C  2  321  ? 42.733  -42.412 68.794  1.00 110.95 ? 321  GLU C CD    1 
ATOM   6059  O  OE1   . GLU C  2  321  ? 42.115  -41.327 68.779  1.00 115.61 ? 321  GLU C OE1   1 
ATOM   6060  O  OE2   . GLU C  2  321  ? 42.485  -43.328 69.606  1.00 120.64 ? 321  GLU C OE2   1 
ATOM   6061  N  N     . VAL C  2  322  ? 42.500  -39.168 65.267  1.00 91.30  ? 322  VAL C N     1 
ATOM   6062  C  CA    . VAL C  2  322  ? 42.730  -37.804 64.834  1.00 80.57  ? 322  VAL C CA    1 
ATOM   6063  C  C     . VAL C  2  322  ? 43.723  -37.195 65.816  1.00 81.52  ? 322  VAL C C     1 
ATOM   6064  O  O     . VAL C  2  322  ? 43.729  -37.554 66.995  1.00 79.98  ? 322  VAL C O     1 
ATOM   6065  C  CB    . VAL C  2  322  ? 41.433  -36.994 64.843  1.00 80.04  ? 322  VAL C CB    1 
ATOM   6066  C  CG1   . VAL C  2  322  ? 41.633  -35.677 64.134  1.00 71.78  ? 322  VAL C CG1   1 
ATOM   6067  C  CG2   . VAL C  2  322  ? 40.305  -37.790 64.206  1.00 85.33  ? 322  VAL C CG2   1 
ATOM   6068  N  N     . ASP C  2  323  ? 44.563  -36.283 65.337  1.00 73.93  ? 323  ASP C N     1 
ATOM   6069  C  CA    . ASP C  2  323  ? 45.638  -35.740 66.163  1.00 68.63  ? 323  ASP C CA    1 
ATOM   6070  C  C     . ASP C  2  323  ? 45.291  -34.419 66.845  1.00 67.37  ? 323  ASP C C     1 
ATOM   6071  O  O     . ASP C  2  323  ? 44.748  -33.511 66.217  1.00 67.95  ? 323  ASP C O     1 
ATOM   6072  C  CB    . ASP C  2  323  ? 46.912  -35.615 65.338  1.00 70.24  ? 323  ASP C CB    1 
ATOM   6073  C  CG    . ASP C  2  323  ? 47.517  -36.964 65.010  1.00 77.19  ? 323  ASP C CG    1 
ATOM   6074  O  OD1   . ASP C  2  323  ? 47.459  -37.860 65.878  1.00 79.71  ? 323  ASP C OD1   1 
ATOM   6075  O  OD2   . ASP C  2  323  ? 48.042  -37.133 63.889  1.00 75.52  ? 323  ASP C OD2   1 
ATOM   6076  N  N     . ASP C  2  324  ? 45.572  -34.340 68.150  1.00 61.34  ? 324  ASP C N     1 
ATOM   6077  C  CA    . ASP C  2  324  ? 45.241  -33.167 68.976  1.00 58.04  ? 324  ASP C CA    1 
ATOM   6078  C  C     . ASP C  2  324  ? 45.952  -31.852 68.625  1.00 67.55  ? 324  ASP C C     1 
ATOM   6079  O  O     . ASP C  2  324  ? 45.312  -30.804 68.547  1.00 75.62  ? 324  ASP C O     1 
ATOM   6080  C  CB    . ASP C  2  324  ? 45.458  -33.488 70.458  1.00 62.28  ? 324  ASP C CB    1 
ATOM   6081  C  CG    . ASP C  2  324  ? 44.678  -32.567 71.374  1.00 59.20  ? 324  ASP C CG    1 
ATOM   6082  O  OD1   . ASP C  2  324  ? 44.521  -31.377 71.029  1.00 60.58  ? 324  ASP C OD1   1 
ATOM   6083  O  OD2   . ASP C  2  324  ? 44.221  -33.032 72.439  1.00 59.44  ? 324  ASP C OD2   1 
ATOM   6084  N  N     . ILE C  2  325  ? 47.261  -31.909 68.392  1.00 61.56  ? 325  ILE C N     1 
ATOM   6085  C  CA    . ILE C  2  325  ? 47.976  -30.795 67.768  1.00 63.01  ? 325  ILE C CA    1 
ATOM   6086  C  C     . ILE C  2  325  ? 48.172  -29.614 68.716  1.00 57.86  ? 325  ILE C C     1 
ATOM   6087  O  O     . ILE C  2  325  ? 48.835  -28.634 68.378  1.00 65.90  ? 325  ILE C O     1 
ATOM   6088  C  CB    . ILE C  2  325  ? 47.255  -30.304 66.499  1.00 66.52  ? 325  ILE C CB    1 
ATOM   6089  C  CG1   . ILE C  2  325  ? 46.735  -28.880 66.698  1.00 63.87  ? 325  ILE C CG1   1 
ATOM   6090  C  CG2   . ILE C  2  325  ? 46.118  -31.246 66.134  1.00 74.93  ? 325  ILE C CG2   1 
ATOM   6091  C  CD1   . ILE C  2  325  ? 47.433  -27.849 65.838  1.00 56.31  ? 325  ILE C CD1   1 
ATOM   6092  N  N     . ASP C  2  326  ? 47.607  -29.732 69.911  1.00 58.57  ? 326  ASP C N     1 
ATOM   6093  C  CA    . ASP C  2  326  ? 47.962  -28.898 71.048  1.00 60.66  ? 326  ASP C CA    1 
ATOM   6094  C  C     . ASP C  2  326  ? 48.338  -29.794 72.212  1.00 57.36  ? 326  ASP C C     1 
ATOM   6095  O  O     . ASP C  2  326  ? 48.697  -29.324 73.290  1.00 55.75  ? 326  ASP C O     1 
ATOM   6096  C  CB    . ASP C  2  326  ? 46.810  -27.974 71.422  1.00 68.20  ? 326  ASP C CB    1 
ATOM   6097  C  CG    . ASP C  2  326  ? 46.707  -26.783 70.499  1.00 71.52  ? 326  ASP C CG    1 
ATOM   6098  O  OD1   . ASP C  2  326  ? 47.766  -26.178 70.196  1.00 63.88  ? 326  ASP C OD1   1 
ATOM   6099  O  OD2   . ASP C  2  326  ? 45.575  -26.470 70.066  1.00 74.14  ? 326  ASP C OD2   1 
ATOM   6100  N  N     . HIS C  2  327  ? 48.255  -31.098 71.978  1.00 56.39  ? 327  HIS C N     1 
ATOM   6101  C  CA    . HIS C  2  327  ? 48.717  -32.059 72.945  1.00 52.01  ? 327  HIS C CA    1 
ATOM   6102  C  C     . HIS C  2  327  ? 50.190  -31.848 73.075  1.00 48.38  ? 327  HIS C C     1 
ATOM   6103  O  O     . HIS C  2  327  ? 50.897  -31.652 72.064  1.00 48.58  ? 327  HIS C O     1 
ATOM   6104  C  CB    . HIS C  2  327  ? 48.429  -33.474 72.461  1.00 50.77  ? 327  HIS C CB    1 
ATOM   6105  C  CG    . HIS C  2  327  ? 48.450  -34.511 73.558  1.00 48.94  ? 327  HIS C CG    1 
ATOM   6106  N  ND1   . HIS C  2  327  ? 49.555  -35.212 73.869  1.00 55.01  ? 327  HIS C ND1   1 
ATOM   6107  C  CD2   . HIS C  2  327  ? 47.448  -34.955 74.417  1.00 51.68  ? 327  HIS C CD2   1 
ATOM   6108  C  CE1   . HIS C  2  327  ? 49.278  -36.060 74.877  1.00 55.93  ? 327  HIS C CE1   1 
ATOM   6109  N  NE2   . HIS C  2  327  ? 47.988  -35.901 75.211  1.00 59.61  ? 327  HIS C NE2   1 
ATOM   6110  N  N     . LEU C  2  328  ? 50.685  -31.878 74.304  1.00 47.22  ? 328  LEU C N     1 
ATOM   6111  C  CA    . LEU C  2  328  ? 52.102  -31.649 74.548  1.00 51.26  ? 328  LEU C CA    1 
ATOM   6112  C  C     . LEU C  2  328  ? 52.979  -32.793 74.039  1.00 52.62  ? 328  LEU C C     1 
ATOM   6113  O  O     . LEU C  2  328  ? 54.200  -32.782 74.209  1.00 52.18  ? 328  LEU C O     1 
ATOM   6114  C  CB    . LEU C  2  328  ? 52.367  -31.359 76.021  1.00 45.70  ? 328  LEU C CB    1 
ATOM   6115  C  CG    . LEU C  2  328  ? 52.165  -29.882 76.321  1.00 44.57  ? 328  LEU C CG    1 
ATOM   6116  C  CD1   . LEU C  2  328  ? 52.645  -29.564 77.715  1.00 44.35  ? 328  LEU C CD1   1 
ATOM   6117  C  CD2   . LEU C  2  328  ? 52.915  -29.056 75.291  1.00 46.60  ? 328  LEU C CD2   1 
ATOM   6118  N  N     . GLY C  2  329  ? 52.341  -33.782 73.420  1.00 49.61  ? 329  GLY C N     1 
ATOM   6119  C  CA    . GLY C  2  329  ? 53.049  -34.828 72.716  1.00 50.31  ? 329  GLY C CA    1 
ATOM   6120  C  C     . GLY C  2  329  ? 53.359  -34.366 71.303  1.00 58.85  ? 329  GLY C C     1 
ATOM   6121  O  O     . GLY C  2  329  ? 54.357  -34.778 70.710  1.00 62.47  ? 329  GLY C O     1 
ATOM   6122  N  N     . ASN C  2  330  ? 52.499  -33.506 70.762  1.00 54.21  ? 330  ASN C N     1 
ATOM   6123  C  CA    . ASN C  2  330  ? 52.648  -33.018 69.392  1.00 51.70  ? 330  ASN C CA    1 
ATOM   6124  C  C     . ASN C  2  330  ? 53.248  -31.619 69.312  1.00 49.96  ? 330  ASN C C     1 
ATOM   6125  O  O     . ASN C  2  330  ? 53.440  -31.087 68.223  1.00 52.32  ? 330  ASN C O     1 
ATOM   6126  C  CB    . ASN C  2  330  ? 51.304  -33.057 68.657  1.00 55.45  ? 330  ASN C CB    1 
ATOM   6127  C  CG    . ASN C  2  330  ? 50.625  -34.407 68.746  1.00 56.64  ? 330  ASN C CG    1 
ATOM   6128  O  OD1   . ASN C  2  330  ? 51.287  -35.441 68.771  1.00 60.34  ? 330  ASN C OD1   1 
ATOM   6129  N  ND2   . ASN C  2  330  ? 49.292  -34.404 68.784  1.00 56.80  ? 330  ASN C ND2   1 
ATOM   6130  N  N     . ARG C  2  331  ? 53.560  -31.048 70.472  1.00 51.80  ? 331  ARG C N     1 
ATOM   6131  C  CA    . ARG C  2  331  ? 54.254  -29.767 70.562  1.00 49.39  ? 331  ARG C CA    1 
ATOM   6132  C  C     . ARG C  2  331  ? 55.573  -29.959 71.308  1.00 44.15  ? 331  ARG C C     1 
ATOM   6133  O  O     . ARG C  2  331  ? 55.602  -30.586 72.366  1.00 47.98  ? 331  ARG C O     1 
ATOM   6134  C  CB    . ARG C  2  331  ? 53.387  -28.733 71.281  1.00 53.31  ? 331  ARG C CB    1 
ATOM   6135  C  CG    . ARG C  2  331  ? 52.084  -28.410 70.569  1.00 56.44  ? 331  ARG C CG    1 
ATOM   6136  C  CD    . ARG C  2  331  ? 51.905  -26.910 70.403  1.00 57.14  ? 331  ARG C CD    1 
ATOM   6137  N  NE    . ARG C  2  331  ? 51.567  -26.256 71.663  1.00 49.77  ? 331  ARG C NE    1 
ATOM   6138  C  CZ    . ARG C  2  331  ? 51.777  -24.969 71.917  1.00 52.47  ? 331  ARG C CZ    1 
ATOM   6139  N  NH1   . ARG C  2  331  ? 51.437  -24.458 73.093  1.00 46.43  ? 331  ARG C NH1   1 
ATOM   6140  N  NH2   . ARG C  2  331  ? 52.327  -24.190 70.996  1.00 54.97  ? 331  ARG C NH2   1 
ATOM   6141  N  N     . ARG C  2  332  ? 56.662  -29.429 70.758  1.00 42.10  ? 332  ARG C N     1 
ATOM   6142  C  CA    . ARG C  2  332  ? 57.980  -29.651 71.343  1.00 47.75  ? 332  ARG C CA    1 
ATOM   6143  C  C     . ARG C  2  332  ? 58.710  -28.345 71.588  1.00 47.38  ? 332  ARG C C     1 
ATOM   6144  O  O     . ARG C  2  332  ? 58.314  -27.292 71.077  1.00 47.82  ? 332  ARG C O     1 
ATOM   6145  C  CB    . ARG C  2  332  ? 58.825  -30.559 70.447  1.00 48.22  ? 332  ARG C CB    1 
ATOM   6146  C  CG    . ARG C  2  332  ? 59.150  -29.962 69.090  1.00 51.02  ? 332  ARG C CG    1 
ATOM   6147  C  CD    . ARG C  2  332  ? 59.951  -30.931 68.226  1.00 48.42  ? 332  ARG C CD    1 
ATOM   6148  N  NE    . ARG C  2  332  ? 61.268  -31.213 68.790  1.00 42.68  ? 332  ARG C NE    1 
ATOM   6149  C  CZ    . ARG C  2  332  ? 62.370  -30.531 68.498  1.00 44.62  ? 332  ARG C CZ    1 
ATOM   6150  N  NH1   . ARG C  2  332  ? 62.326  -29.519 67.640  1.00 42.88  ? 332  ARG C NH1   1 
ATOM   6151  N  NH2   . ARG C  2  332  ? 63.521  -30.860 69.066  1.00 52.50  ? 332  ARG C NH2   1 
ATOM   6152  N  N     . ILE C  2  333  ? 59.777  -28.430 72.376  1.00 47.67  ? 333  ILE C N     1 
ATOM   6153  C  CA    . ILE C  2  333  ? 60.605  -27.274 72.697  1.00 52.04  ? 333  ILE C CA    1 
ATOM   6154  C  C     . ILE C  2  333  ? 61.947  -27.285 71.953  1.00 51.79  ? 333  ILE C C     1 
ATOM   6155  O  O     . ILE C  2  333  ? 62.719  -28.242 72.036  1.00 53.01  ? 333  ILE C O     1 
ATOM   6156  C  CB    . ILE C  2  333  ? 60.880  -27.182 74.214  1.00 45.26  ? 333  ILE C CB    1 
ATOM   6157  C  CG1   . ILE C  2  333  ? 59.587  -27.373 75.008  1.00 43.56  ? 333  ILE C CG1   1 
ATOM   6158  C  CG2   . ILE C  2  333  ? 61.539  -25.855 74.554  1.00 46.51  ? 333  ILE C CG2   1 
ATOM   6159  C  CD1   . ILE C  2  333  ? 58.557  -26.300 74.770  1.00 41.74  ? 333  ILE C CD1   1 
ATOM   6160  N  N     . ARG C  2  334  ? 62.213  -26.213 71.221  1.00 45.02  ? 334  ARG C N     1 
ATOM   6161  C  CA    . ARG C  2  334  ? 63.514  -25.990 70.624  1.00 44.87  ? 334  ARG C CA    1 
ATOM   6162  C  C     . ARG C  2  334  ? 64.340  -25.140 71.584  1.00 46.48  ? 334  ARG C C     1 
ATOM   6163  O  O     . ARG C  2  334  ? 64.119  -23.932 71.708  1.00 45.35  ? 334  ARG C O     1 
ATOM   6164  C  CB    . ARG C  2  334  ? 63.359  -25.290 69.279  1.00 46.45  ? 334  ARG C CB    1 
ATOM   6165  C  CG    . ARG C  2  334  ? 62.359  -25.962 68.367  1.00 51.37  ? 334  ARG C CG    1 
ATOM   6166  C  CD    . ARG C  2  334  ? 62.103  -25.133 67.135  1.00 54.00  ? 334  ARG C CD    1 
ATOM   6167  N  NE    . ARG C  2  334  ? 63.220  -25.177 66.199  1.00 61.35  ? 334  ARG C NE    1 
ATOM   6168  C  CZ    . ARG C  2  334  ? 63.540  -24.184 65.377  1.00 67.02  ? 334  ARG C CZ    1 
ATOM   6169  N  NH1   . ARG C  2  334  ? 62.837  -23.056 65.384  1.00 65.11  ? 334  ARG C NH1   1 
ATOM   6170  N  NH2   . ARG C  2  334  ? 64.568  -24.317 64.553  1.00 68.73  ? 334  ARG C NH2   1 
ATOM   6171  N  N     . THR C  2  335  ? 65.280  -25.793 72.266  1.00 49.37  ? 335  THR C N     1 
ATOM   6172  C  CA    . THR C  2  335  ? 66.128  -25.164 73.275  1.00 47.50  ? 335  THR C CA    1 
ATOM   6173  C  C     . THR C  2  335  ? 67.257  -24.362 72.629  1.00 41.02  ? 335  THR C C     1 
ATOM   6174  O  O     . THR C  2  335  ? 67.379  -24.354 71.416  1.00 43.19  ? 335  THR C O     1 
ATOM   6175  C  CB    . THR C  2  335  ? 66.711  -26.223 74.232  1.00 50.23  ? 335  THR C CB    1 
ATOM   6176  O  OG1   . THR C  2  335  ? 67.304  -27.284 73.474  1.00 52.37  ? 335  THR C OG1   1 
ATOM   6177  C  CG2   . THR C  2  335  ? 65.617  -26.808 75.096  1.00 43.01  ? 335  THR C CG2   1 
ATOM   6178  N  N     . VAL C  2  336  ? 68.075  -23.691 73.435  1.00 41.15  ? 336  VAL C N     1 
ATOM   6179  C  CA    . VAL C  2  336  ? 69.139  -22.826 72.907  1.00 44.45  ? 336  VAL C CA    1 
ATOM   6180  C  C     . VAL C  2  336  ? 70.078  -23.575 71.972  1.00 46.37  ? 336  VAL C C     1 
ATOM   6181  O  O     . VAL C  2  336  ? 70.513  -23.040 70.950  1.00 42.19  ? 336  VAL C O     1 
ATOM   6182  C  CB    . VAL C  2  336  ? 69.969  -22.168 74.031  1.00 44.26  ? 336  VAL C CB    1 
ATOM   6183  C  CG1   . VAL C  2  336  ? 69.052  -21.511 75.030  1.00 58.26  ? 336  VAL C CG1   1 
ATOM   6184  C  CG2   . VAL C  2  336  ? 70.824  -23.194 74.739  1.00 39.59  ? 336  VAL C CG2   1 
ATOM   6185  N  N     . GLY C  2  337  ? 70.389  -24.816 72.328  1.00 48.04  ? 337  GLY C N     1 
ATOM   6186  C  CA    . GLY C  2  337  ? 71.215  -25.661 71.492  1.00 45.00  ? 337  GLY C CA    1 
ATOM   6187  C  C     . GLY C  2  337  ? 70.631  -25.788 70.100  1.00 46.30  ? 337  GLY C C     1 
ATOM   6188  O  O     . GLY C  2  337  ? 71.298  -25.496 69.120  1.00 48.69  ? 337  GLY C O     1 
ATOM   6189  N  N     . GLU C  2  338  ? 69.374  -26.209 70.014  1.00 45.44  ? 338  GLU C N     1 
ATOM   6190  C  CA    . GLU C  2  338  ? 68.729  -26.413 68.724  1.00 43.81  ? 338  GLU C CA    1 
ATOM   6191  C  C     . GLU C  2  338  ? 68.678  -25.148 67.868  1.00 49.44  ? 338  GLU C C     1 
ATOM   6192  O  O     . GLU C  2  338  ? 68.940  -25.197 66.664  1.00 58.87  ? 338  GLU C O     1 
ATOM   6193  C  CB    . GLU C  2  338  ? 67.323  -26.979 68.911  1.00 44.94  ? 338  GLU C CB    1 
ATOM   6194  C  CG    . GLU C  2  338  ? 66.555  -27.154 67.612  1.00 49.02  ? 338  GLU C CG    1 
ATOM   6195  C  CD    . GLU C  2  338  ? 65.395  -28.118 67.747  1.00 53.77  ? 338  GLU C CD    1 
ATOM   6196  O  OE1   . GLU C  2  338  ? 65.346  -28.857 68.755  1.00 52.16  ? 338  GLU C OE1   1 
ATOM   6197  O  OE2   . GLU C  2  338  ? 64.535  -28.135 66.841  1.00 59.67  ? 338  GLU C OE2   1 
ATOM   6198  N  N     . LEU C  2  339  ? 68.344  -24.022 68.490  1.00 43.98  ? 339  LEU C N     1 
ATOM   6199  C  CA    . LEU C  2  339  ? 68.212  -22.748 67.792  1.00 43.00  ? 339  LEU C CA    1 
ATOM   6200  C  C     . LEU C  2  339  ? 69.562  -22.259 67.276  1.00 48.38  ? 339  LEU C C     1 
ATOM   6201  O  O     . LEU C  2  339  ? 69.761  -22.053 66.061  1.00 57.39  ? 339  LEU C O     1 
ATOM   6202  C  CB    . LEU C  2  339  ? 67.598  -21.710 68.734  1.00 48.59  ? 339  LEU C CB    1 
ATOM   6203  C  CG    . LEU C  2  339  ? 66.298  -22.143 69.422  1.00 44.04  ? 339  LEU C CG    1 
ATOM   6204  C  CD1   . LEU C  2  339  ? 65.905  -21.180 70.525  1.00 36.32  ? 339  LEU C CD1   1 
ATOM   6205  C  CD2   . LEU C  2  339  ? 65.174  -22.308 68.411  1.00 41.16  ? 339  LEU C CD2   1 
ATOM   6206  N  N     . MET C  2  340  ? 70.491  -22.079 68.208  1.00 48.14  ? 340  MET C N     1 
ATOM   6207  C  CA    . MET C  2  340  ? 71.844  -21.685 67.860  1.00 52.67  ? 340  MET C CA    1 
ATOM   6208  C  C     . MET C  2  340  ? 72.388  -22.578 66.745  1.00 53.77  ? 340  MET C C     1 
ATOM   6209  O  O     . MET C  2  340  ? 72.904  -22.092 65.738  1.00 56.15  ? 340  MET C O     1 
ATOM   6210  C  CB    . MET C  2  340  ? 72.746  -21.751 69.092  1.00 50.67  ? 340  MET C CB    1 
ATOM   6211  C  CG    . MET C  2  340  ? 74.204  -21.448 68.813  1.00 53.67  ? 340  MET C CG    1 
ATOM   6212  S  SD    . MET C  2  340  ? 75.076  -22.814 68.018  1.00 56.44  ? 340  MET C SD    1 
ATOM   6213  C  CE    . MET C  2  340  ? 76.535  -21.957 67.428  1.00 59.00  ? 340  MET C CE    1 
ATOM   6214  N  N     . THR C  2  341  ? 72.263  -23.887 66.931  1.00 49.64  ? 341  THR C N     1 
ATOM   6215  C  CA    . THR C  2  341  ? 72.728  -24.857 65.947  1.00 50.54  ? 341  THR C CA    1 
ATOM   6216  C  C     . THR C  2  341  ? 72.075  -24.632 64.596  1.00 57.50  ? 341  THR C C     1 
ATOM   6217  O  O     . THR C  2  341  ? 72.728  -24.752 63.563  1.00 60.71  ? 341  THR C O     1 
ATOM   6218  C  CB    . THR C  2  341  ? 72.458  -26.301 66.405  1.00 51.55  ? 341  THR C CB    1 
ATOM   6219  O  OG1   . THR C  2  341  ? 73.351  -26.635 67.473  1.00 49.60  ? 341  THR C OG1   1 
ATOM   6220  C  CG2   . THR C  2  341  ? 72.657  -27.281 65.262  1.00 49.10  ? 341  THR C CG2   1 
ATOM   6221  N  N     . ASP C  2  342  ? 70.786  -24.309 64.599  1.00 51.82  ? 342  ASP C N     1 
ATOM   6222  C  CA    . ASP C  2  342  ? 70.091  -24.006 63.356  1.00 53.28  ? 342  ASP C CA    1 
ATOM   6223  C  C     . ASP C  2  342  ? 70.802  -22.870 62.615  1.00 50.70  ? 342  ASP C C     1 
ATOM   6224  O  O     . ASP C  2  342  ? 71.117  -22.972 61.421  1.00 56.05  ? 342  ASP C O     1 
ATOM   6225  C  CB    . ASP C  2  342  ? 68.641  -23.624 63.642  1.00 60.65  ? 342  ASP C CB    1 
ATOM   6226  C  CG    . ASP C  2  342  ? 67.684  -24.141 62.591  1.00 77.63  ? 342  ASP C CG    1 
ATOM   6227  O  OD1   . ASP C  2  342  ? 67.709  -25.360 62.316  1.00 86.94  ? 342  ASP C OD1   1 
ATOM   6228  O  OD2   . ASP C  2  342  ? 66.911  -23.331 62.035  1.00 83.34  ? 342  ASP C OD2   1 
ATOM   6229  N  N     . GLN C  2  343  ? 71.072  -21.785 63.329  1.00 46.56  ? 343  GLN C N     1 
ATOM   6230  C  CA    . GLN C  2  343  ? 71.739  -20.656 62.690  1.00 50.44  ? 343  GLN C CA    1 
ATOM   6231  C  C     . GLN C  2  343  ? 73.141  -21.013 62.215  1.00 57.81  ? 343  GLN C C     1 
ATOM   6232  O  O     . GLN C  2  343  ? 73.612  -20.522 61.176  1.00 58.61  ? 343  GLN C O     1 
ATOM   6233  C  CB    . GLN C  2  343  ? 71.770  -19.449 63.619  1.00 53.11  ? 343  GLN C CB    1 
ATOM   6234  C  CG    . GLN C  2  343  ? 70.413  -18.808 63.745  1.00 55.06  ? 343  GLN C CG    1 
ATOM   6235  C  CD    . GLN C  2  343  ? 69.768  -18.618 62.392  1.00 57.72  ? 343  GLN C CD    1 
ATOM   6236  O  OE1   . GLN C  2  343  ? 70.192  -17.765 61.606  1.00 61.84  ? 343  GLN C OE1   1 
ATOM   6237  N  NE2   . GLN C  2  343  ? 68.751  -19.428 62.100  1.00 51.20  ? 343  GLN C NE2   1 
ATOM   6238  N  N     . PHE C  2  344  ? 73.801  -21.874 62.982  1.00 56.93  ? 344  PHE C N     1 
ATOM   6239  C  CA    . PHE C  2  344  ? 75.106  -22.396 62.606  1.00 56.29  ? 344  PHE C CA    1 
ATOM   6240  C  C     . PHE C  2  344  ? 74.987  -23.078 61.250  1.00 55.61  ? 344  PHE C C     1 
ATOM   6241  O  O     . PHE C  2  344  ? 75.753  -22.792 60.333  1.00 61.49  ? 344  PHE C O     1 
ATOM   6242  C  CB    . PHE C  2  344  ? 75.615  -23.380 63.663  1.00 56.26  ? 344  PHE C CB    1 
ATOM   6243  C  CG    . PHE C  2  344  ? 77.071  -23.740 63.517  1.00 58.74  ? 344  PHE C CG    1 
ATOM   6244  C  CD1   . PHE C  2  344  ? 77.453  -24.901 62.866  1.00 59.68  ? 344  PHE C CD1   1 
ATOM   6245  C  CD2   . PHE C  2  344  ? 78.056  -22.921 64.040  1.00 54.37  ? 344  PHE C CD2   1 
ATOM   6246  C  CE1   . PHE C  2  344  ? 78.786  -25.231 62.736  1.00 56.55  ? 344  PHE C CE1   1 
ATOM   6247  C  CE2   . PHE C  2  344  ? 79.390  -23.248 63.913  1.00 51.45  ? 344  PHE C CE2   1 
ATOM   6248  C  CZ    . PHE C  2  344  ? 79.754  -24.402 63.261  1.00 52.69  ? 344  PHE C CZ    1 
ATOM   6249  N  N     . ARG C  2  345  ? 74.008  -23.966 61.121  1.00 50.99  ? 345  ARG C N     1 
ATOM   6250  C  CA    . ARG C  2  345  ? 73.781  -24.673 59.868  1.00 56.28  ? 345  ARG C CA    1 
ATOM   6251  C  C     . ARG C  2  345  ? 73.549  -23.714 58.713  1.00 53.91  ? 345  ARG C C     1 
ATOM   6252  O  O     . ARG C  2  345  ? 74.032  -23.944 57.608  1.00 61.19  ? 345  ARG C O     1 
ATOM   6253  C  CB    . ARG C  2  345  ? 72.607  -25.638 59.987  1.00 56.24  ? 345  ARG C CB    1 
ATOM   6254  C  CG    . ARG C  2  345  ? 72.177  -26.245 58.665  1.00 61.32  ? 345  ARG C CG    1 
ATOM   6255  C  CD    . ARG C  2  345  ? 71.097  -27.292 58.872  1.00 84.94  ? 345  ARG C CD    1 
ATOM   6256  N  NE    . ARG C  2  345  ? 71.578  -28.436 59.647  1.00 95.59  ? 345  ARG C NE    1 
ATOM   6257  C  CZ    . ARG C  2  345  ? 71.450  -28.561 60.967  1.00 93.96  ? 345  ARG C CZ    1 
ATOM   6258  N  NH1   . ARG C  2  345  ? 70.853  -27.610 61.674  1.00 85.63  ? 345  ARG C NH1   1 
ATOM   6259  N  NH2   . ARG C  2  345  ? 71.918  -29.640 61.585  1.00 82.42  ? 345  ARG C NH2   1 
ATOM   6260  N  N     . VAL C  2  346  ? 72.814  -22.636 58.958  1.00 50.94  ? 346  VAL C N     1 
ATOM   6261  C  CA    . VAL C  2  346  ? 72.587  -21.660 57.893  1.00 54.39  ? 346  VAL C CA    1 
ATOM   6262  C  C     . VAL C  2  346  ? 73.876  -20.960 57.432  1.00 57.00  ? 346  VAL C C     1 
ATOM   6263  O  O     . VAL C  2  346  ? 74.242  -21.022 56.245  1.00 59.69  ? 346  VAL C O     1 
ATOM   6264  C  CB    . VAL C  2  346  ? 71.515  -20.629 58.282  1.00 49.98  ? 346  VAL C CB    1 
ATOM   6265  C  CG1   . VAL C  2  346  ? 71.563  -19.431 57.359  1.00 58.37  ? 346  VAL C CG1   1 
ATOM   6266  C  CG2   . VAL C  2  346  ? 70.156  -21.272 58.234  1.00 50.01  ? 346  VAL C CG2   1 
ATOM   6267  N  N     . GLY C  2  347  ? 74.564  -20.303 58.363  1.00 56.53  ? 347  GLY C N     1 
ATOM   6268  C  CA    . GLY C  2  347  ? 75.809  -19.629 58.028  1.00 56.26  ? 347  GLY C CA    1 
ATOM   6269  C  C     . GLY C  2  347  ? 76.793  -20.577 57.368  1.00 59.58  ? 347  GLY C C     1 
ATOM   6270  O  O     . GLY C  2  347  ? 77.601  -20.182 56.519  1.00 62.21  ? 347  GLY C O     1 
ATOM   6271  N  N     . LEU C  2  348  ? 76.708  -21.845 57.756  1.00 56.92  ? 348  LEU C N     1 
ATOM   6272  C  CA    . LEU C  2  348  ? 77.575  -22.887 57.220  1.00 58.69  ? 348  LEU C CA    1 
ATOM   6273  C  C     . LEU C  2  348  ? 77.233  -23.189 55.764  1.00 61.00  ? 348  LEU C C     1 
ATOM   6274  O  O     . LEU C  2  348  ? 78.110  -23.232 54.905  1.00 58.26  ? 348  LEU C O     1 
ATOM   6275  C  CB    . LEU C  2  348  ? 77.446  -24.157 58.060  1.00 57.98  ? 348  LEU C CB    1 
ATOM   6276  C  CG    . LEU C  2  348  ? 78.667  -25.068 58.173  1.00 58.55  ? 348  LEU C CG    1 
ATOM   6277  C  CD1   . LEU C  2  348  ? 79.876  -24.284 58.662  1.00 51.89  ? 348  LEU C CD1   1 
ATOM   6278  C  CD2   . LEU C  2  348  ? 78.366  -26.234 59.099  1.00 54.85  ? 348  LEU C CD2   1 
ATOM   6279  N  N     . ALA C  2  349  ? 75.951  -23.407 55.490  1.00 63.31  ? 349  ALA C N     1 
ATOM   6280  C  CA    . ALA C  2  349  ? 75.504  -23.635 54.123  1.00 61.60  ? 349  ALA C CA    1 
ATOM   6281  C  C     . ALA C  2  349  ? 75.932  -22.484 53.214  1.00 64.35  ? 349  ALA C C     1 
ATOM   6282  O  O     . ALA C  2  349  ? 76.324  -22.706 52.066  1.00 69.66  ? 349  ALA C O     1 
ATOM   6283  C  CB    . ALA C  2  349  ? 74.004  -23.824 54.079  1.00 53.99  ? 349  ALA C CB    1 
ATOM   6284  N  N     . ARG C  2  350  ? 75.866  -21.257 53.727  1.00 57.98  ? 350  ARG C N     1 
ATOM   6285  C  CA    . ARG C  2  350  ? 76.334  -20.105 52.955  1.00 58.82  ? 350  ARG C CA    1 
ATOM   6286  C  C     . ARG C  2  350  ? 77.842  -20.165 52.697  1.00 71.89  ? 350  ARG C C     1 
ATOM   6287  O  O     . ARG C  2  350  ? 78.304  -19.974 51.562  1.00 76.41  ? 350  ARG C O     1 
ATOM   6288  C  CB    . ARG C  2  350  ? 75.967  -18.804 53.655  1.00 59.58  ? 350  ARG C CB    1 
ATOM   6289  C  CG    . ARG C  2  350  ? 74.471  -18.591 53.772  1.00 61.08  ? 350  ARG C CG    1 
ATOM   6290  C  CD    . ARG C  2  350  ? 74.147  -17.458 54.720  1.00 62.25  ? 350  ARG C CD    1 
ATOM   6291  N  NE    . ARG C  2  350  ? 72.710  -17.263 54.850  1.00 64.53  ? 350  ARG C NE    1 
ATOM   6292  C  CZ    . ARG C  2  350  ? 72.146  -16.471 55.754  1.00 73.02  ? 350  ARG C CZ    1 
ATOM   6293  N  NH1   . ARG C  2  350  ? 72.901  -15.802 56.617  1.00 59.96  ? 350  ARG C NH1   1 
ATOM   6294  N  NH2   . ARG C  2  350  ? 70.825  -16.354 55.801  1.00 81.59  ? 350  ARG C NH2   1 
ATOM   6295  N  N     . LEU C  2  351  ? 78.607  -20.431 53.750  1.00 68.97  ? 351  LEU C N     1 
ATOM   6296  C  CA    . LEU C  2  351  ? 80.048  -20.620 53.609  1.00 68.25  ? 351  LEU C CA    1 
ATOM   6297  C  C     . LEU C  2  351  ? 80.388  -21.660 52.533  1.00 67.14  ? 351  LEU C C     1 
ATOM   6298  O  O     . LEU C  2  351  ? 81.308  -21.464 51.731  1.00 72.61  ? 351  LEU C O     1 
ATOM   6299  C  CB    . LEU C  2  351  ? 80.653  -21.013 54.958  1.00 70.37  ? 351  LEU C CB    1 
ATOM   6300  C  CG    . LEU C  2  351  ? 82.096  -21.507 55.028  1.00 65.87  ? 351  LEU C CG    1 
ATOM   6301  C  CD1   . LEU C  2  351  ? 82.716  -21.093 56.351  1.00 72.43  ? 351  LEU C CD1   1 
ATOM   6302  C  CD2   . LEU C  2  351  ? 82.158  -23.016 54.851  1.00 60.54  ? 351  LEU C CD2   1 
ATOM   6303  N  N     . ALA C  2  352  ? 79.638  -22.759 52.521  1.00 65.46  ? 352  ALA C N     1 
ATOM   6304  C  CA    . ALA C  2  352  ? 79.824  -23.824 51.538  1.00 69.48  ? 352  ALA C CA    1 
ATOM   6305  C  C     . ALA C  2  352  ? 79.497  -23.335 50.134  1.00 75.11  ? 352  ALA C C     1 
ATOM   6306  O  O     . ALA C  2  352  ? 80.214  -23.637 49.179  1.00 84.17  ? 352  ALA C O     1 
ATOM   6307  C  CB    . ALA C  2  352  ? 78.968  -25.030 51.888  1.00 66.89  ? 352  ALA C CB    1 
ATOM   6308  N  N     . ARG C  2  353  ? 78.420  -22.564 50.017  1.00 73.90  ? 353  ARG C N     1 
ATOM   6309  C  CA    . ARG C  2  353  ? 78.049  -21.962 48.745  1.00 77.74  ? 353  ARG C CA    1 
ATOM   6310  C  C     . ARG C  2  353  ? 79.229  -21.171 48.197  1.00 81.63  ? 353  ARG C C     1 
ATOM   6311  O  O     . ARG C  2  353  ? 79.553  -21.257 47.013  1.00 88.88  ? 353  ARG C O     1 
ATOM   6312  C  CB    . ARG C  2  353  ? 76.835  -21.048 48.915  1.00 82.08  ? 353  ARG C CB    1 
ATOM   6313  C  CG    . ARG C  2  353  ? 76.327  -20.442 47.617  1.00 96.75  ? 353  ARG C CG    1 
ATOM   6314  C  CD    . ARG C  2  353  ? 76.159  -18.936 47.739  1.00 105.54 ? 353  ARG C CD    1 
ATOM   6315  N  NE    . ARG C  2  353  ? 76.529  -18.243 46.508  1.00 123.82 ? 353  ARG C NE    1 
ATOM   6316  C  CZ    . ARG C  2  353  ? 76.393  -16.934 46.318  1.00 124.25 ? 353  ARG C CZ    1 
ATOM   6317  N  NH1   . ARG C  2  353  ? 76.757  -16.389 45.164  1.00 106.44 ? 353  ARG C NH1   1 
ATOM   6318  N  NH2   . ARG C  2  353  ? 75.895  -16.170 47.279  1.00 116.36 ? 353  ARG C NH2   1 
ATOM   6319  N  N     . GLY C  2  354  ? 79.873  -20.405 49.072  1.00 78.32  ? 354  GLY C N     1 
ATOM   6320  C  CA    . GLY C  2  354  ? 81.069  -19.658 48.703  1.00 78.50  ? 354  GLY C CA    1 
ATOM   6321  C  C     . GLY C  2  354  ? 82.236  -20.537 48.275  1.00 80.15  ? 354  GLY C C     1 
ATOM   6322  O  O     . GLY C  2  354  ? 82.943  -20.234 47.307  1.00 84.94  ? 354  GLY C O     1 
ATOM   6323  N  N     . VAL C  2  355  ? 82.449  -21.630 49.002  1.00 79.66  ? 355  VAL C N     1 
ATOM   6324  C  CA    . VAL C  2  355  ? 83.451  -22.616 48.608  1.00 74.68  ? 355  VAL C CA    1 
ATOM   6325  C  C     . VAL C  2  355  ? 83.220  -23.095 47.178  1.00 81.82  ? 355  VAL C C     1 
ATOM   6326  O  O     . VAL C  2  355  ? 84.081  -22.920 46.313  1.00 91.40  ? 355  VAL C O     1 
ATOM   6327  C  CB    . VAL C  2  355  ? 83.460  -23.827 49.557  1.00 70.17  ? 355  VAL C CB    1 
ATOM   6328  C  CG1   . VAL C  2  355  ? 84.122  -25.020 48.896  1.00 69.37  ? 355  VAL C CG1   1 
ATOM   6329  C  CG2   . VAL C  2  355  ? 84.159  -23.470 50.855  1.00 68.46  ? 355  VAL C CG2   1 
ATOM   6330  N  N     . ARG C  2  356  ? 82.056  -23.691 46.927  1.00 80.22  ? 356  ARG C N     1 
ATOM   6331  C  CA    . ARG C  2  356  ? 81.707  -24.141 45.581  1.00 79.94  ? 356  ARG C CA    1 
ATOM   6332  C  C     . ARG C  2  356  ? 81.933  -23.044 44.551  1.00 82.45  ? 356  ARG C C     1 
ATOM   6333  O  O     . ARG C  2  356  ? 82.475  -23.297 43.477  1.00 86.51  ? 356  ARG C O     1 
ATOM   6334  C  CB    . ARG C  2  356  ? 80.260  -24.642 45.514  1.00 74.36  ? 356  ARG C CB    1 
ATOM   6335  C  CG    . ARG C  2  356  ? 80.100  -26.106 45.893  1.00 80.29  ? 356  ARG C CG    1 
ATOM   6336  C  CD    . ARG C  2  356  ? 78.679  -26.608 45.684  1.00 80.88  ? 356  ARG C CD    1 
ATOM   6337  N  NE    . ARG C  2  356  ? 78.531  -28.008 46.087  1.00 90.23  ? 356  ARG C NE    1 
ATOM   6338  C  CZ    . ARG C  2  356  ? 78.124  -28.409 47.292  1.00 84.48  ? 356  ARG C CZ    1 
ATOM   6339  N  NH1   . ARG C  2  356  ? 77.813  -27.516 48.224  1.00 77.71  ? 356  ARG C NH1   1 
ATOM   6340  N  NH2   . ARG C  2  356  ? 78.022  -29.705 47.563  1.00 77.30  ? 356  ARG C NH2   1 
ATOM   6341  N  N     . GLU C  2  357  ? 81.525  -21.823 44.880  1.00 84.73  ? 357  GLU C N     1 
ATOM   6342  C  CA    . GLU C  2  357  ? 81.728  -20.711 43.960  1.00 92.66  ? 357  GLU C CA    1 
ATOM   6343  C  C     . GLU C  2  357  ? 83.204  -20.496 43.633  1.00 100.66 ? 357  GLU C C     1 
ATOM   6344  O  O     . GLU C  2  357  ? 83.545  -20.143 42.504  1.00 109.04 ? 357  GLU C O     1 
ATOM   6345  C  CB    . GLU C  2  357  ? 81.131  -19.414 44.507  1.00 102.95 ? 357  GLU C CB    1 
ATOM   6346  C  CG    . GLU C  2  357  ? 81.276  -18.243 43.545  1.00 116.61 ? 357  GLU C CG    1 
ATOM   6347  C  CD    . GLU C  2  357  ? 81.180  -16.898 44.236  1.00 128.64 ? 357  GLU C CD    1 
ATOM   6348  O  OE1   . GLU C  2  357  ? 80.646  -16.840 45.365  1.00 121.80 ? 357  GLU C OE1   1 
ATOM   6349  O  OE2   . GLU C  2  357  ? 81.649  -15.898 43.647  1.00 135.95 ? 357  GLU C OE2   1 
ATOM   6350  N  N     . ARG C  2  358  ? 84.080  -20.699 44.615  1.00 98.80  ? 358  ARG C N     1 
ATOM   6351  C  CA    . ARG C  2  358  ? 85.512  -20.496 44.383  1.00 96.59  ? 358  ARG C CA    1 
ATOM   6352  C  C     . ARG C  2  358  ? 86.241  -21.736 43.870  1.00 95.11  ? 358  ARG C C     1 
ATOM   6353  O  O     . ARG C  2  358  ? 87.429  -21.676 43.565  1.00 97.89  ? 358  ARG C O     1 
ATOM   6354  C  CB    . ARG C  2  358  ? 86.200  -19.956 45.635  1.00 90.78  ? 358  ARG C CB    1 
ATOM   6355  C  CG    . ARG C  2  358  ? 86.675  -18.520 45.494  1.00 100.94 ? 358  ARG C CG    1 
ATOM   6356  C  CD    . ARG C  2  358  ? 86.791  -17.871 46.852  1.00 96.97  ? 358  ARG C CD    1 
ATOM   6357  N  NE    . ARG C  2  358  ? 85.576  -18.098 47.627  1.00 98.39  ? 358  ARG C NE    1 
ATOM   6358  C  CZ    . ARG C  2  358  ? 85.412  -17.722 48.889  1.00 94.68  ? 358  ARG C CZ    1 
ATOM   6359  N  NH1   . ARG C  2  358  ? 86.392  -17.095 49.528  1.00 94.51  ? 358  ARG C NH1   1 
ATOM   6360  N  NH2   . ARG C  2  358  ? 84.268  -17.978 49.512  1.00 84.46  ? 358  ARG C NH2   1 
ATOM   6361  N  N     . MET C  2  359  ? 85.534  -22.855 43.768  1.00 91.68  ? 359  MET C N     1 
ATOM   6362  C  CA    . MET C  2  359  ? 86.134  -24.069 43.228  1.00 93.91  ? 359  MET C CA    1 
ATOM   6363  C  C     . MET C  2  359  ? 86.325  -23.972 41.716  1.00 106.80 ? 359  MET C C     1 
ATOM   6364  O  O     . MET C  2  359  ? 86.879  -24.877 41.090  1.00 115.44 ? 359  MET C O     1 
ATOM   6365  C  CB    . MET C  2  359  ? 85.283  -25.290 43.572  1.00 92.80  ? 359  MET C CB    1 
ATOM   6366  C  CG    . MET C  2  359  ? 84.997  -25.432 45.049  1.00 84.06  ? 359  MET C CG    1 
ATOM   6367  S  SD    . MET C  2  359  ? 85.433  -27.044 45.714  1.00 90.06  ? 359  MET C SD    1 
ATOM   6368  C  CE    . MET C  2  359  ? 84.218  -28.091 44.923  1.00 95.53  ? 359  MET C CE    1 
ATOM   6369  N  N     . LEU C  2  360  ? 85.862  -22.871 41.133  1.00 108.62 ? 360  LEU C N     1 
ATOM   6370  C  CA    . LEU C  2  360  ? 85.954  -22.667 39.688  1.00 111.11 ? 360  LEU C CA    1 
ATOM   6371  C  C     . LEU C  2  360  ? 86.958  -21.572 39.340  1.00 115.54 ? 360  LEU C C     1 
ATOM   6372  O  O     . LEU C  2  360  ? 88.085  -21.857 38.937  1.00 120.31 ? 360  LEU C O     1 
ATOM   6373  C  CB    . LEU C  2  360  ? 84.580  -22.329 39.104  1.00 109.32 ? 360  LEU C CB    1 
ATOM   6374  C  CG    . LEU C  2  360  ? 83.532  -23.447 39.011  1.00 109.63 ? 360  LEU C CG    1 
ATOM   6375  C  CD1   . LEU C  2  360  ? 83.240  -24.093 40.364  1.00 100.61 ? 360  LEU C CD1   1 
ATOM   6376  C  CD2   . LEU C  2  360  ? 82.248  -22.910 38.394  1.00 109.04 ? 360  LEU C CD2   1 
ATOM   6377  N  N     . MET C  2  361  ? 86.544  -20.320 39.509  1.00 118.68 ? 361  MET C N     1 
ATOM   6378  C  CA    . MET C  2  361  ? 87.397  -19.174 39.205  1.00 127.64 ? 361  MET C CA    1 
ATOM   6379  C  C     . MET C  2  361  ? 88.669  -19.160 40.054  1.00 134.26 ? 361  MET C C     1 
ATOM   6380  O  O     . MET C  2  361  ? 88.743  -19.817 41.093  1.00 133.85 ? 361  MET C O     1 
ATOM   6381  C  CB    . MET C  2  361  ? 86.622  -17.870 39.397  1.00 128.02 ? 361  MET C CB    1 
ATOM   6382  C  CG    . MET C  2  361  ? 85.153  -18.068 39.721  1.00 132.41 ? 361  MET C CG    1 
ATOM   6383  S  SD    . MET C  2  361  ? 84.296  -16.513 40.035  1.00 166.12 ? 361  MET C SD    1 
ATOM   6384  C  CE    . MET C  2  361  ? 85.308  -15.817 41.339  1.00 146.06 ? 361  MET C CE    1 
ATOM   6385  N  N     . GLY C  2  362  ? 89.665  -18.400 39.608  1.00 141.45 ? 362  GLY C N     1 
ATOM   6386  C  CA    . GLY C  2  362  ? 90.957  -18.365 40.270  1.00 144.12 ? 362  GLY C CA    1 
ATOM   6387  C  C     . GLY C  2  362  ? 91.773  -19.592 39.911  1.00 153.96 ? 362  GLY C C     1 
ATOM   6388  O  O     . GLY C  2  362  ? 91.346  -20.399 39.087  1.00 156.79 ? 362  GLY C O     1 
ATOM   6389  N  N     . SER C  2  363  ? 92.947  -19.735 40.521  1.00 155.11 ? 363  SER C N     1 
ATOM   6390  C  CA    . SER C  2  363  ? 93.782  -20.909 40.282  1.00 155.09 ? 363  SER C CA    1 
ATOM   6391  C  C     . SER C  2  363  ? 92.978  -22.180 40.530  1.00 156.81 ? 363  SER C C     1 
ATOM   6392  O  O     . SER C  2  363  ? 92.433  -22.374 41.615  1.00 153.37 ? 363  SER C O     1 
ATOM   6393  C  CB    . SER C  2  363  ? 95.021  -20.892 41.182  1.00 146.06 ? 363  SER C CB    1 
ATOM   6394  O  OG    . SER C  2  363  ? 95.883  -19.818 40.854  1.00 145.40 ? 363  SER C OG    1 
ATOM   6395  N  N     . GLU C  2  364  ? 92.899  -23.037 39.518  1.00 162.89 ? 364  GLU C N     1 
ATOM   6396  C  CA    . GLU C  2  364  ? 92.178  -24.299 39.645  1.00 164.73 ? 364  GLU C CA    1 
ATOM   6397  C  C     . GLU C  2  364  ? 93.062  -25.355 40.298  1.00 159.34 ? 364  GLU C C     1 
ATOM   6398  O  O     . GLU C  2  364  ? 92.581  -26.246 41.001  1.00 150.39 ? 364  GLU C O     1 
ATOM   6399  C  CB    . GLU C  2  364  ? 91.716  -24.792 38.272  1.00 172.79 ? 364  GLU C CB    1 
ATOM   6400  C  CG    . GLU C  2  364  ? 92.857  -25.066 37.302  1.00 173.94 ? 364  GLU C CG    1 
ATOM   6401  C  CD    . GLU C  2  364  ? 92.382  -25.658 35.992  1.00 174.90 ? 364  GLU C CD    1 
ATOM   6402  O  OE1   . GLU C  2  364  ? 91.154  -25.782 35.806  1.00 174.10 ? 364  GLU C OE1   1 
ATOM   6403  O  OE2   . GLU C  2  364  ? 93.237  -26.001 35.150  1.00 178.59 ? 364  GLU C OE2   1 
ATOM   6404  N  N     . ASP C  2  365  ? 94.362  -25.243 40.059  1.00 159.11 ? 365  ASP C N     1 
ATOM   6405  C  CA    . ASP C  2  365  ? 95.320  -26.233 40.528  1.00 156.09 ? 365  ASP C CA    1 
ATOM   6406  C  C     . ASP C  2  365  ? 95.769  -25.999 41.968  1.00 152.85 ? 365  ASP C C     1 
ATOM   6407  O  O     . ASP C  2  365  ? 95.809  -26.933 42.767  1.00 151.74 ? 365  ASP C O     1 
ATOM   6408  C  CB    . ASP C  2  365  ? 96.531  -26.261 39.601  1.00 154.32 ? 365  ASP C CB    1 
ATOM   6409  C  CG    . ASP C  2  365  ? 97.650  -27.105 40.144  1.00 148.91 ? 365  ASP C CG    1 
ATOM   6410  O  OD1   . ASP C  2  365  ? 97.399  -28.280 40.487  1.00 139.55 ? 365  ASP C OD1   1 
ATOM   6411  O  OD2   . ASP C  2  365  ? 98.776  -26.579 40.245  1.00 150.26 ? 365  ASP C OD2   1 
ATOM   6412  N  N     . SER C  2  366  ? 96.111  -24.754 42.294  1.00 151.28 ? 366  SER C N     1 
ATOM   6413  C  CA    . SER C  2  366  ? 96.572  -24.414 43.641  1.00 141.39 ? 366  SER C CA    1 
ATOM   6414  C  C     . SER C  2  366  ? 95.463  -23.839 44.509  1.00 136.91 ? 366  SER C C     1 
ATOM   6415  O  O     . SER C  2  366  ? 95.172  -22.643 44.457  1.00 138.40 ? 366  SER C O     1 
ATOM   6416  C  CB    . SER C  2  366  ? 97.753  -23.442 43.590  1.00 140.49 ? 366  SER C CB    1 
ATOM   6417  O  OG    . SER C  2  366  ? 98.940  -24.115 43.205  1.00 149.94 ? 366  SER C OG    1 
ATOM   6418  N  N     . LEU C  2  367  ? 94.803  -24.730 45.235  1.00 128.55 ? 367  LEU C N     1 
ATOM   6419  C  CA    . LEU C  2  367  ? 93.885  -24.338 46.279  1.00 109.05 ? 367  LEU C CA    1 
ATOM   6420  C  C     . LEU C  2  367  ? 94.214  -25.087 47.560  1.00 104.88 ? 367  LEU C C     1 
ATOM   6421  O  O     . LEU C  2  367  ? 94.227  -26.318 47.590  1.00 99.90  ? 367  LEU C O     1 
ATOM   6422  C  CB    . LEU C  2  367  ? 92.442  -24.623 45.858  1.00 101.58 ? 367  LEU C CB    1 
ATOM   6423  C  CG    . LEU C  2  367  ? 92.028  -24.111 44.477  1.00 112.78 ? 367  LEU C CG    1 
ATOM   6424  C  CD1   . LEU C  2  367  ? 90.647  -24.627 44.104  1.00 102.88 ? 367  LEU C CD1   1 
ATOM   6425  C  CD2   . LEU C  2  367  ? 92.066  -22.591 44.434  1.00 109.90 ? 367  LEU C CD2   1 
ATOM   6426  N  N     . THR C  2  368  ? 94.457  -24.333 48.621  1.00 104.18 ? 368  THR C N     1 
ATOM   6427  C  CA    . THR C  2  368  ? 94.434  -24.863 49.974  1.00 99.57  ? 368  THR C CA    1 
ATOM   6428  C  C     . THR C  2  368  ? 93.009  -24.730 50.516  1.00 93.72  ? 368  THR C C     1 
ATOM   6429  O  O     . THR C  2  368  ? 92.221  -23.950 49.977  1.00 88.43  ? 368  THR C O     1 
ATOM   6430  C  CB    . THR C  2  368  ? 95.482  -24.166 50.874  1.00 99.98  ? 368  THR C CB    1 
ATOM   6431  O  OG1   . THR C  2  368  ? 95.210  -22.762 50.951  1.00 94.29  ? 368  THR C OG1   1 
ATOM   6432  C  CG2   . THR C  2  368  ? 96.877  -24.369 50.304  1.00 98.51  ? 368  THR C CG2   1 
ATOM   6433  N  N     . PRO C  2  369  ? 92.656  -25.515 51.550  1.00 88.90  ? 369  PRO C N     1 
ATOM   6434  C  CA    . PRO C  2  369  ? 91.350  -25.314 52.188  1.00 78.47  ? 369  PRO C CA    1 
ATOM   6435  C  C     . PRO C  2  369  ? 91.208  -23.896 52.724  1.00 75.97  ? 369  PRO C C     1 
ATOM   6436  O  O     . PRO C  2  369  ? 90.114  -23.350 52.683  1.00 77.05  ? 369  PRO C O     1 
ATOM   6437  C  CB    . PRO C  2  369  ? 91.370  -26.314 53.341  1.00 73.81  ? 369  PRO C CB    1 
ATOM   6438  C  CG    . PRO C  2  369  ? 92.267  -27.395 52.870  1.00 81.37  ? 369  PRO C CG    1 
ATOM   6439  C  CD    . PRO C  2  369  ? 93.348  -26.699 52.087  1.00 88.50  ? 369  PRO C CD    1 
ATOM   6440  N  N     . ALA C  2  370  ? 92.305  -23.311 53.196  1.00 78.15  ? 370  ALA C N     1 
ATOM   6441  C  CA    . ALA C  2  370  ? 92.312  -21.921 53.646  1.00 82.13  ? 370  ALA C CA    1 
ATOM   6442  C  C     . ALA C  2  370  ? 91.890  -20.944 52.541  1.00 81.43  ? 370  ALA C C     1 
ATOM   6443  O  O     . ALA C  2  370  ? 91.256  -19.925 52.810  1.00 80.27  ? 370  ALA C O     1 
ATOM   6444  C  CB    . ALA C  2  370  ? 93.690  -21.552 54.173  1.00 84.89  ? 370  ALA C CB    1 
ATOM   6445  N  N     . LYS C  2  371  ? 92.255  -21.261 51.303  1.00 87.05  ? 371  LYS C N     1 
ATOM   6446  C  CA    . LYS C  2  371  ? 91.958  -20.404 50.159  1.00 88.35  ? 371  LYS C CA    1 
ATOM   6447  C  C     . LYS C  2  371  ? 90.494  -20.514 49.786  1.00 82.23  ? 371  LYS C C     1 
ATOM   6448  O  O     . LYS C  2  371  ? 89.893  -19.558 49.305  1.00 83.07  ? 371  LYS C O     1 
ATOM   6449  C  CB    . LYS C  2  371  ? 92.796  -20.816 48.944  1.00 98.08  ? 371  LYS C CB    1 
ATOM   6450  C  CG    . LYS C  2  371  ? 94.273  -20.482 49.012  1.00 99.92  ? 371  LYS C CG    1 
ATOM   6451  C  CD    . LYS C  2  371  ? 95.015  -21.101 47.828  1.00 109.87 ? 371  LYS C CD    1 
ATOM   6452  C  CE    . LYS C  2  371  ? 96.481  -20.695 47.822  1.00 118.82 ? 371  LYS C CE    1 
ATOM   6453  N  NZ    . LYS C  2  371  ? 96.677  -19.395 48.527  1.00 124.81 ? 371  LYS C NZ    1 
ATOM   6454  N  N     . LEU C  2  372  ? 89.939  -21.702 49.997  1.00 82.17  ? 372  LEU C N     1 
ATOM   6455  C  CA    . LEU C  2  372  ? 88.592  -22.046 49.559  1.00 78.39  ? 372  LEU C CA    1 
ATOM   6456  C  C     . LEU C  2  372  ? 87.494  -21.537 50.495  1.00 81.60  ? 372  LEU C C     1 
ATOM   6457  O  O     . LEU C  2  372  ? 86.337  -21.414 50.090  1.00 81.57  ? 372  LEU C O     1 
ATOM   6458  C  CB    . LEU C  2  372  ? 88.487  -23.567 49.419  1.00 69.91  ? 372  LEU C CB    1 
ATOM   6459  C  CG    . LEU C  2  372  ? 88.048  -24.153 48.078  1.00 66.61  ? 372  LEU C CG    1 
ATOM   6460  C  CD1   . LEU C  2  372  ? 88.468  -23.250 46.933  1.00 80.26  ? 372  LEU C CD1   1 
ATOM   6461  C  CD2   . LEU C  2  372  ? 88.627  -25.552 47.901  1.00 65.12  ? 372  LEU C CD2   1 
ATOM   6462  N  N     . VAL C  2  373  ? 87.847  -21.267 51.748  1.00 77.14  ? 373  VAL C N     1 
ATOM   6463  C  CA    . VAL C  2  373  ? 86.844  -21.028 52.782  1.00 66.25  ? 373  VAL C CA    1 
ATOM   6464  C  C     . VAL C  2  373  ? 86.794  -19.605 53.334  1.00 71.76  ? 373  VAL C C     1 
ATOM   6465  O  O     . VAL C  2  373  ? 87.816  -19.027 53.699  1.00 77.24  ? 373  VAL C O     1 
ATOM   6466  C  CB    . VAL C  2  373  ? 87.021  -22.003 53.963  1.00 64.34  ? 373  VAL C CB    1 
ATOM   6467  C  CG1   . VAL C  2  373  ? 86.404  -21.423 55.226  1.00 68.08  ? 373  VAL C CG1   1 
ATOM   6468  C  CG2   . VAL C  2  373  ? 86.406  -23.354 53.633  1.00 63.93  ? 373  VAL C CG2   1 
ATOM   6469  N  N     . ASN C  2  374  ? 85.583  -19.058 53.393  1.00 77.91  ? 374  ASN C N     1 
ATOM   6470  C  CA    . ASN C  2  374  ? 85.336  -17.754 53.995  1.00 74.27  ? 374  ASN C CA    1 
ATOM   6471  C  C     . ASN C  2  374  ? 84.395  -17.884 55.191  1.00 70.90  ? 374  ASN C C     1 
ATOM   6472  O  O     . ASN C  2  374  ? 83.346  -18.521 55.098  1.00 73.41  ? 374  ASN C O     1 
ATOM   6473  C  CB    . ASN C  2  374  ? 84.752  -16.787 52.965  1.00 65.10  ? 374  ASN C CB    1 
ATOM   6474  C  CG    . ASN C  2  374  ? 84.791  -15.346 53.433  1.00 68.47  ? 374  ASN C CG    1 
ATOM   6475  O  OD1   . ASN C  2  374  ? 85.075  -15.066 54.597  1.00 73.78  ? 374  ASN C OD1   1 
ATOM   6476  N  ND2   . ASN C  2  374  ? 84.504  -14.421 52.525  1.00 69.52  ? 374  ASN C ND2   1 
ATOM   6477  N  N     . SER C  2  375  ? 84.778  -17.283 56.313  1.00 69.59  ? 375  SER C N     1 
ATOM   6478  C  CA    . SER C  2  375  ? 84.009  -17.397 57.554  1.00 67.26  ? 375  SER C CA    1 
ATOM   6479  C  C     . SER C  2  375  ? 82.831  -16.429 57.651  1.00 69.52  ? 375  SER C C     1 
ATOM   6480  O  O     . SER C  2  375  ? 81.789  -16.765 58.214  1.00 75.34  ? 375  SER C O     1 
ATOM   6481  C  CB    . SER C  2  375  ? 84.921  -17.179 58.760  1.00 66.13  ? 375  SER C CB    1 
ATOM   6482  O  OG    . SER C  2  375  ? 85.773  -18.286 58.963  1.00 73.95  ? 375  SER C OG    1 
ATOM   6483  N  N     . ARG C  2  376  ? 83.007  -15.231 57.103  1.00 65.44  ? 376  ARG C N     1 
ATOM   6484  C  CA    . ARG C  2  376  ? 82.048  -14.143 57.271  1.00 68.20  ? 376  ARG C CA    1 
ATOM   6485  C  C     . ARG C  2  376  ? 80.574  -14.563 57.297  1.00 64.78  ? 376  ARG C C     1 
ATOM   6486  O  O     . ARG C  2  376  ? 79.835  -14.119 58.164  1.00 63.54  ? 376  ARG C O     1 
ATOM   6487  C  CB    . ARG C  2  376  ? 82.288  -13.045 56.232  1.00 74.20  ? 376  ARG C CB    1 
ATOM   6488  C  CG    . ARG C  2  376  ? 83.723  -12.532 56.203  1.00 76.51  ? 376  ARG C CG    1 
ATOM   6489  C  CD    . ARG C  2  376  ? 84.249  -12.263 57.608  1.00 74.27  ? 376  ARG C CD    1 
ATOM   6490  N  NE    . ARG C  2  376  ? 85.555  -11.608 57.587  1.00 78.90  ? 376  ARG C NE    1 
ATOM   6491  C  CZ    . ARG C  2  376  ? 86.242  -11.271 58.674  1.00 79.68  ? 376  ARG C CZ    1 
ATOM   6492  N  NH1   . ARG C  2  376  ? 85.752  -11.529 59.878  1.00 77.37  ? 376  ARG C NH1   1 
ATOM   6493  N  NH2   . ARG C  2  376  ? 87.422  -10.675 58.559  1.00 82.93  ? 376  ARG C NH2   1 
ATOM   6494  N  N     . PRO C  2  377  ? 80.141  -15.409 56.347  1.00 62.05  ? 377  PRO C N     1 
ATOM   6495  C  CA    . PRO C  2  377  ? 78.764  -15.917 56.394  1.00 63.08  ? 377  PRO C CA    1 
ATOM   6496  C  C     . PRO C  2  377  ? 78.426  -16.594 57.725  1.00 62.56  ? 377  PRO C C     1 
ATOM   6497  O  O     . PRO C  2  377  ? 77.349  -16.373 58.285  1.00 69.67  ? 377  PRO C O     1 
ATOM   6498  C  CB    . PRO C  2  377  ? 78.738  -16.950 55.263  1.00 63.42  ? 377  PRO C CB    1 
ATOM   6499  C  CG    . PRO C  2  377  ? 79.747  -16.469 54.303  1.00 61.20  ? 377  PRO C CG    1 
ATOM   6500  C  CD    . PRO C  2  377  ? 80.841  -15.841 55.126  1.00 64.14  ? 377  PRO C CD    1 
ATOM   6501  N  N     . LEU C  2  378  ? 79.345  -17.412 58.222  1.00 61.07  ? 378  LEU C N     1 
ATOM   6502  C  CA    . LEU C  2  378  ? 79.134  -18.149 59.458  1.00 60.04  ? 378  LEU C CA    1 
ATOM   6503  C  C     . LEU C  2  378  ? 79.173  -17.216 60.659  1.00 57.75  ? 378  LEU C C     1 
ATOM   6504  O  O     . LEU C  2  378  ? 78.257  -17.196 61.489  1.00 57.89  ? 378  LEU C O     1 
ATOM   6505  C  CB    . LEU C  2  378  ? 80.205  -19.226 59.602  1.00 58.26  ? 378  LEU C CB    1 
ATOM   6506  C  CG    . LEU C  2  378  ? 79.991  -20.248 60.715  1.00 63.56  ? 378  LEU C CG    1 
ATOM   6507  C  CD1   . LEU C  2  378  ? 78.671  -20.973 60.521  1.00 60.32  ? 378  LEU C CD1   1 
ATOM   6508  C  CD2   . LEU C  2  378  ? 81.147  -21.228 60.741  1.00 61.97  ? 378  LEU C CD2   1 
ATOM   6509  N  N     . GLU C  2  379  ? 80.248  -16.443 60.743  1.00 57.79  ? 379  GLU C N     1 
ATOM   6510  C  CA    . GLU C  2  379  ? 80.431  -15.491 61.824  1.00 64.05  ? 379  GLU C CA    1 
ATOM   6511  C  C     . GLU C  2  379  ? 79.208  -14.596 61.944  1.00 65.44  ? 379  GLU C C     1 
ATOM   6512  O  O     . GLU C  2  379  ? 78.733  -14.305 63.045  1.00 68.42  ? 379  GLU C O     1 
ATOM   6513  C  CB    . GLU C  2  379  ? 81.674  -14.636 61.570  1.00 67.29  ? 379  GLU C CB    1 
ATOM   6514  C  CG    . GLU C  2  379  ? 82.954  -15.433 61.349  1.00 70.70  ? 379  GLU C CG    1 
ATOM   6515  C  CD    . GLU C  2  379  ? 84.177  -14.543 61.171  1.00 79.66  ? 379  GLU C CD    1 
ATOM   6516  O  OE1   . GLU C  2  379  ? 84.792  -14.581 60.082  1.00 76.11  ? 379  GLU C OE1   1 
ATOM   6517  O  OE2   . GLU C  2  379  ? 84.525  -13.807 62.121  1.00 80.12  ? 379  GLU C OE2   1 
ATOM   6518  N  N     . ALA C  2  380  ? 78.695  -14.172 60.797  1.00 64.65  ? 380  ALA C N     1 
ATOM   6519  C  CA    . ALA C  2  380  ? 77.554  -13.267 60.749  1.00 63.52  ? 380  ALA C CA    1 
ATOM   6520  C  C     . ALA C  2  380  ? 76.228  -13.962 61.057  1.00 63.87  ? 380  ALA C C     1 
ATOM   6521  O  O     . ALA C  2  380  ? 75.328  -13.345 61.610  1.00 65.74  ? 380  ALA C O     1 
ATOM   6522  C  CB    . ALA C  2  380  ? 77.490  -12.560 59.405  1.00 52.81  ? 380  ALA C CB    1 
ATOM   6523  N  N     . ALA C  2  381  ? 76.098  -15.235 60.693  1.00 60.63  ? 381  ALA C N     1 
ATOM   6524  C  CA    . ALA C  2  381  ? 74.887  -15.984 61.027  1.00 58.29  ? 381  ALA C CA    1 
ATOM   6525  C  C     . ALA C  2  381  ? 74.763  -16.162 62.537  1.00 57.68  ? 381  ALA C C     1 
ATOM   6526  O  O     . ALA C  2  381  ? 73.680  -15.992 63.116  1.00 59.79  ? 381  ALA C O     1 
ATOM   6527  C  CB    . ALA C  2  381  ? 74.887  -17.333 60.336  1.00 57.45  ? 381  ALA C CB    1 
ATOM   6528  N  N     . ILE C  2  382  ? 75.881  -16.501 63.171  1.00 57.84  ? 382  ILE C N     1 
ATOM   6529  C  CA    . ILE C  2  382  ? 75.897  -16.678 64.617  1.00 52.48  ? 382  ILE C CA    1 
ATOM   6530  C  C     . ILE C  2  382  ? 75.734  -15.337 65.332  1.00 52.65  ? 382  ILE C C     1 
ATOM   6531  O  O     . ILE C  2  382  ? 74.923  -15.205 66.259  1.00 50.66  ? 382  ILE C O     1 
ATOM   6532  C  CB    . ILE C  2  382  ? 77.185  -17.381 65.083  1.00 47.52  ? 382  ILE C CB    1 
ATOM   6533  C  CG1   . ILE C  2  382  ? 77.305  -18.754 64.427  1.00 54.05  ? 382  ILE C CG1   1 
ATOM   6534  C  CG2   . ILE C  2  382  ? 77.190  -17.551 66.582  1.00 52.36  ? 382  ILE C CG2   1 
ATOM   6535  C  CD1   . ILE C  2  382  ? 78.700  -19.340 64.505  1.00 64.71  ? 382  ILE C CD1   1 
ATOM   6536  N  N     . ARG C  2  383  ? 76.493  -14.338 64.892  1.00 55.28  ? 383  ARG C N     1 
ATOM   6537  C  CA    . ARG C  2  383  ? 76.402  -13.007 65.488  1.00 65.57  ? 383  ARG C CA    1 
ATOM   6538  C  C     . ARG C  2  383  ? 74.980  -12.475 65.374  1.00 63.52  ? 383  ARG C C     1 
ATOM   6539  O  O     . ARG C  2  383  ? 74.467  -11.824 66.283  1.00 53.75  ? 383  ARG C O     1 
ATOM   6540  C  CB    . ARG C  2  383  ? 77.374  -12.036 64.817  1.00 60.83  ? 383  ARG C CB    1 
ATOM   6541  C  CG    . ARG C  2  383  ? 77.369  -10.652 65.450  1.00 68.75  ? 383  ARG C CG    1 
ATOM   6542  C  CD    . ARG C  2  383  ? 78.296  -9.686  64.732  1.00 76.03  ? 383  ARG C CD    1 
ATOM   6543  N  NE    . ARG C  2  383  ? 77.857  -9.415  63.364  1.00 90.96  ? 383  ARG C NE    1 
ATOM   6544  C  CZ    . ARG C  2  383  ? 78.434  -9.914  62.273  1.00 89.40  ? 383  ARG C CZ    1 
ATOM   6545  N  NH1   . ARG C  2  383  ? 79.492  -10.713 62.375  1.00 81.20  ? 383  ARG C NH1   1 
ATOM   6546  N  NH2   . ARG C  2  383  ? 77.956  -9.607  61.073  1.00 80.47  ? 383  ARG C NH2   1 
ATOM   6547  N  N     . GLU C  2  384  ? 74.356  -12.766 64.239  1.00 66.28  ? 384  GLU C N     1 
ATOM   6548  C  CA    . GLU C  2  384  ? 72.980  -12.381 63.972  1.00 63.98  ? 384  GLU C CA    1 
ATOM   6549  C  C     . GLU C  2  384  ? 72.036  -13.033 64.969  1.00 59.97  ? 384  GLU C C     1 
ATOM   6550  O  O     . GLU C  2  384  ? 71.233  -12.355 65.607  1.00 65.21  ? 384  GLU C O     1 
ATOM   6551  C  CB    . GLU C  2  384  ? 72.583  -12.795 62.554  1.00 70.11  ? 384  GLU C CB    1 
ATOM   6552  C  CG    . GLU C  2  384  ? 71.274  -12.200 62.075  1.00 77.71  ? 384  GLU C CG    1 
ATOM   6553  C  CD    . GLU C  2  384  ? 71.393  -10.719 61.782  1.00 87.28  ? 384  GLU C CD    1 
ATOM   6554  O  OE1   . GLU C  2  384  ? 72.526  -10.192 61.847  1.00 89.26  ? 384  GLU C OE1   1 
ATOM   6555  O  OE2   . GLU C  2  384  ? 70.358  -10.084 61.486  1.00 88.19  ? 384  GLU C OE2   1 
ATOM   6556  N  N     . PHE C  2  385  ? 72.125  -14.353 65.097  1.00 55.79  ? 385  PHE C N     1 
ATOM   6557  C  CA    . PHE C  2  385  ? 71.264  -15.062 66.039  1.00 48.92  ? 385  PHE C CA    1 
ATOM   6558  C  C     . PHE C  2  385  ? 71.387  -14.536 67.462  1.00 48.85  ? 385  PHE C C     1 
ATOM   6559  O  O     . PHE C  2  385  ? 70.389  -14.235 68.108  1.00 47.09  ? 385  PHE C O     1 
ATOM   6560  C  CB    . PHE C  2  385  ? 71.572  -16.550 66.033  1.00 47.32  ? 385  PHE C CB    1 
ATOM   6561  C  CG    . PHE C  2  385  ? 70.897  -17.308 67.134  1.00 46.93  ? 385  PHE C CG    1 
ATOM   6562  C  CD1   . PHE C  2  385  ? 69.666  -17.899 66.930  1.00 47.36  ? 385  PHE C CD1   1 
ATOM   6563  C  CD2   . PHE C  2  385  ? 71.502  -17.441 68.370  1.00 48.02  ? 385  PHE C CD2   1 
ATOM   6564  C  CE1   . PHE C  2  385  ? 69.048  -18.606 67.937  1.00 47.27  ? 385  PHE C CE1   1 
ATOM   6565  C  CE2   . PHE C  2  385  ? 70.892  -18.149 69.379  1.00 43.26  ? 385  PHE C CE2   1 
ATOM   6566  C  CZ    . PHE C  2  385  ? 69.661  -18.733 69.161  1.00 44.35  ? 385  PHE C CZ    1 
ATOM   6567  N  N     . PHE C  2  386  ? 72.613  -14.434 67.959  1.00 50.30  ? 386  PHE C N     1 
ATOM   6568  C  CA    . PHE C  2  386  ? 72.800  -14.012 69.340  1.00 43.65  ? 386  PHE C CA    1 
ATOM   6569  C  C     . PHE C  2  386  ? 72.485  -12.541 69.567  1.00 52.21  ? 386  PHE C C     1 
ATOM   6570  O  O     . PHE C  2  386  ? 72.132  -12.139 70.677  1.00 56.50  ? 386  PHE C O     1 
ATOM   6571  C  CB    . PHE C  2  386  ? 74.208  -14.341 69.831  1.00 40.18  ? 386  PHE C CB    1 
ATOM   6572  C  CG    . PHE C  2  386  ? 74.355  -15.745 70.317  1.00 42.31  ? 386  PHE C CG    1 
ATOM   6573  C  CD1   . PHE C  2  386  ? 74.813  -16.742 69.471  1.00 42.02  ? 386  PHE C CD1   1 
ATOM   6574  C  CD2   . PHE C  2  386  ? 74.018  -16.075 71.615  1.00 41.26  ? 386  PHE C CD2   1 
ATOM   6575  C  CE1   . PHE C  2  386  ? 74.940  -18.039 69.913  1.00 44.53  ? 386  PHE C CE1   1 
ATOM   6576  C  CE2   . PHE C  2  386  ? 74.139  -17.367 72.064  1.00 42.40  ? 386  PHE C CE2   1 
ATOM   6577  C  CZ    . PHE C  2  386  ? 74.602  -18.355 71.212  1.00 46.69  ? 386  PHE C CZ    1 
ATOM   6578  N  N     . SER C  2  387  ? 72.664  -11.728 68.524  1.00 60.33  ? 387  SER C N     1 
ATOM   6579  C  CA    . SER C  2  387  ? 72.557  -10.268 68.648  1.00 60.07  ? 387  SER C CA    1 
ATOM   6580  C  C     . SER C  2  387  ? 71.222  -9.600  68.273  1.00 66.34  ? 387  SER C C     1 
ATOM   6581  O  O     . SER C  2  387  ? 70.735  -8.744  69.012  1.00 65.80  ? 387  SER C O     1 
ATOM   6582  C  CB    . SER C  2  387  ? 73.696  -9.595  67.874  1.00 64.31  ? 387  SER C CB    1 
ATOM   6583  O  OG    . SER C  2  387  ? 74.887  -9.565  68.642  1.00 63.12  ? 387  SER C OG    1 
ATOM   6584  N  N     . ARG C  2  388  ? 70.634  -9.977  67.139  1.00 66.86  ? 388  ARG C N     1 
ATOM   6585  C  CA    . ARG C  2  388  ? 69.404  -9.344  66.689  1.00 65.74  ? 388  ARG C CA    1 
ATOM   6586  C  C     . ARG C  2  388  ? 68.190  -10.272 66.671  1.00 66.26  ? 388  ARG C C     1 
ATOM   6587  O  O     . ARG C  2  388  ? 67.130  -9.890  66.178  1.00 68.43  ? 388  ARG C O     1 
ATOM   6588  C  CB    . ARG C  2  388  ? 69.615  -8.698  65.317  1.00 75.53  ? 388  ARG C CB    1 
ATOM   6589  C  CG    . ARG C  2  388  ? 70.536  -7.478  65.357  1.00 81.20  ? 388  ARG C CG    1 
ATOM   6590  C  CD    . ARG C  2  388  ? 71.083  -7.117  63.975  1.00 92.29  ? 388  ARG C CD    1 
ATOM   6591  N  NE    . ARG C  2  388  ? 72.087  -8.071  63.498  1.00 96.20  ? 388  ARG C NE    1 
ATOM   6592  C  CZ    . ARG C  2  388  ? 73.383  -8.016  63.801  1.00 94.07  ? 388  ARG C CZ    1 
ATOM   6593  N  NH1   . ARG C  2  388  ? 73.843  -7.052  64.588  1.00 93.14  ? 388  ARG C NH1   1 
ATOM   6594  N  NH2   . ARG C  2  388  ? 74.222  -8.927  63.321  1.00 87.63  ? 388  ARG C NH2   1 
ATOM   6595  N  N     . SER C  2  389  ? 68.331  -11.478 67.216  1.00 65.15  ? 389  SER C N     1 
ATOM   6596  C  CA    . SER C  2  389  ? 67.199  -12.409 67.272  1.00 56.91  ? 389  SER C CA    1 
ATOM   6597  C  C     . SER C  2  389  ? 66.171  -12.022 68.336  1.00 57.63  ? 389  SER C C     1 
ATOM   6598  O  O     . SER C  2  389  ? 66.472  -11.285 69.278  1.00 62.83  ? 389  SER C O     1 
ATOM   6599  C  CB    . SER C  2  389  ? 67.666  -13.848 67.494  1.00 54.26  ? 389  SER C CB    1 
ATOM   6600  O  OG    . SER C  2  389  ? 66.559  -14.733 67.572  1.00 52.80  ? 389  SER C OG    1 
ATOM   6601  N  N     . GLN C  2  390  ? 64.953  -12.527 68.175  1.00 54.96  ? 390  GLN C N     1 
ATOM   6602  C  CA    . GLN C  2  390  ? 63.871  -12.219 69.094  1.00 57.59  ? 390  GLN C CA    1 
ATOM   6603  C  C     . GLN C  2  390  ? 63.963  -13.085 70.339  1.00 56.92  ? 390  GLN C C     1 
ATOM   6604  O  O     . GLN C  2  390  ? 63.673  -12.628 71.441  1.00 57.68  ? 390  GLN C O     1 
ATOM   6605  C  CB    . GLN C  2  390  ? 62.514  -12.422 68.415  1.00 62.05  ? 390  GLN C CB    1 
ATOM   6606  C  CG    . GLN C  2  390  ? 61.322  -12.197 69.335  1.00 78.25  ? 390  GLN C CG    1 
ATOM   6607  C  CD    . GLN C  2  390  ? 59.991  -12.356 68.624  1.00 80.96  ? 390  GLN C CD    1 
ATOM   6608  O  OE1   . GLN C  2  390  ? 59.942  -12.725 67.450  1.00 79.52  ? 390  GLN C OE1   1 
ATOM   6609  N  NE2   . GLN C  2  390  ? 58.901  -12.073 69.335  1.00 75.88  ? 390  GLN C NE2   1 
ATOM   6610  N  N     . LEU C  2  391  ? 64.366  -14.338 70.156  1.00 53.64  ? 391  LEU C N     1 
ATOM   6611  C  CA    . LEU C  2  391  ? 64.484  -15.274 71.265  1.00 48.40  ? 391  LEU C CA    1 
ATOM   6612  C  C     . LEU C  2  391  ? 65.727  -14.991 72.097  1.00 49.16  ? 391  LEU C C     1 
ATOM   6613  O  O     . LEU C  2  391  ? 65.869  -15.509 73.205  1.00 48.86  ? 391  LEU C O     1 
ATOM   6614  C  CB    . LEU C  2  391  ? 64.488  -16.717 70.756  1.00 48.23  ? 391  LEU C CB    1 
ATOM   6615  C  CG    . LEU C  2  391  ? 63.169  -17.175 70.126  1.00 56.52  ? 391  LEU C CG    1 
ATOM   6616  C  CD1   . LEU C  2  391  ? 63.237  -18.604 69.589  1.00 46.04  ? 391  LEU C CD1   1 
ATOM   6617  C  CD2   . LEU C  2  391  ? 62.059  -17.047 71.147  1.00 59.08  ? 391  LEU C CD2   1 
ATOM   6618  N  N     . SER C  2  392  ? 66.625  -14.170 71.556  1.00 44.34  ? 392  SER C N     1 
ATOM   6619  C  CA    . SER C  2  392  ? 67.800  -13.723 72.293  1.00 45.30  ? 392  SER C CA    1 
ATOM   6620  C  C     . SER C  2  392  ? 67.465  -12.437 73.009  1.00 42.85  ? 392  SER C C     1 
ATOM   6621  O  O     . SER C  2  392  ? 67.374  -11.382 72.383  1.00 46.36  ? 392  SER C O     1 
ATOM   6622  C  CB    . SER C  2  392  ? 68.984  -13.486 71.357  1.00 49.65  ? 392  SER C CB    1 
ATOM   6623  O  OG    . SER C  2  392  ? 70.086  -12.929 72.065  1.00 47.86  ? 392  SER C OG    1 
ATOM   6624  N  N     . GLN C  2  393  ? 67.295  -12.518 74.322  1.00 44.67  ? 393  GLN C N     1 
ATOM   6625  C  CA    . GLN C  2  393  ? 66.792  -11.381 75.085  1.00 50.17  ? 393  GLN C CA    1 
ATOM   6626  C  C     . GLN C  2  393  ? 67.789  -10.837 76.096  1.00 50.67  ? 393  GLN C C     1 
ATOM   6627  O  O     . GLN C  2  393  ? 68.560  -11.595 76.689  1.00 47.55  ? 393  GLN C O     1 
ATOM   6628  C  CB    . GLN C  2  393  ? 65.500  -11.766 75.798  1.00 44.94  ? 393  GLN C CB    1 
ATOM   6629  C  CG    . GLN C  2  393  ? 64.441  -12.325 74.869  1.00 43.79  ? 393  GLN C CG    1 
ATOM   6630  C  CD    . GLN C  2  393  ? 63.269  -12.891 75.618  1.00 53.55  ? 393  GLN C CD    1 
ATOM   6631  O  OE1   . GLN C  2  393  ? 63.295  -12.998 76.847  1.00 56.72  ? 393  GLN C OE1   1 
ATOM   6632  N  NE2   . GLN C  2  393  ? 62.224  -13.257 74.890  1.00 54.10  ? 393  GLN C NE2   1 
ATOM   6633  N  N     . PHE C  2  394  ? 67.771  -9.516  76.269  1.00 49.13  ? 394  PHE C N     1 
ATOM   6634  C  CA    . PHE C  2  394  ? 68.496  -8.867  77.353  1.00 45.96  ? 394  PHE C CA    1 
ATOM   6635  C  C     . PHE C  2  394  ? 68.147  -9.645  78.615  1.00 44.72  ? 394  PHE C C     1 
ATOM   6636  O  O     . PHE C  2  394  ? 66.974  -9.824  78.935  1.00 41.26  ? 394  PHE C O     1 
ATOM   6637  C  CB    . PHE C  2  394  ? 68.033  -7.416  77.481  1.00 36.52  ? 394  PHE C CB    1 
ATOM   6638  C  CG    . PHE C  2  394  ? 69.035  -6.504  78.118  1.00 40.12  ? 394  PHE C CG    1 
ATOM   6639  C  CD1   . PHE C  2  394  ? 70.327  -6.427  77.629  1.00 51.85  ? 394  PHE C CD1   1 
ATOM   6640  C  CD2   . PHE C  2  394  ? 68.679  -5.697  79.188  1.00 40.94  ? 394  PHE C CD2   1 
ATOM   6641  C  CE1   . PHE C  2  394  ? 71.254  -5.577  78.211  1.00 52.71  ? 394  PHE C CE1   1 
ATOM   6642  C  CE2   . PHE C  2  394  ? 69.594  -4.846  79.772  1.00 41.72  ? 394  PHE C CE2   1 
ATOM   6643  C  CZ    . PHE C  2  394  ? 70.885  -4.785  79.285  1.00 55.37  ? 394  PHE C CZ    1 
ATOM   6644  N  N     . LYS C  2  395  ? 69.152  -10.140 79.323  1.00 47.09  ? 395  LYS C N     1 
ATOM   6645  C  CA    . LYS C  2  395  ? 68.870  -10.970 80.486  1.00 46.00  ? 395  LYS C CA    1 
ATOM   6646  C  C     . LYS C  2  395  ? 68.146  -10.170 81.559  1.00 46.51  ? 395  LYS C C     1 
ATOM   6647  O  O     . LYS C  2  395  ? 68.563  -9.072  81.927  1.00 45.68  ? 395  LYS C O     1 
ATOM   6648  C  CB    . LYS C  2  395  ? 70.155  -11.555 81.063  1.00 51.80  ? 395  LYS C CB    1 
ATOM   6649  C  CG    . LYS C  2  395  ? 69.941  -12.548 82.194  1.00 44.75  ? 395  LYS C CG    1 
ATOM   6650  C  CD    . LYS C  2  395  ? 71.241  -12.767 82.938  1.00 48.80  ? 395  LYS C CD    1 
ATOM   6651  C  CE    . LYS C  2  395  ? 71.214  -14.039 83.742  1.00 52.08  ? 395  LYS C CE    1 
ATOM   6652  N  NZ    . LYS C  2  395  ? 72.480  -14.213 84.493  1.00 56.98  ? 395  LYS C NZ    1 
ATOM   6653  N  N     . ASP C  2  396  ? 67.054  -10.728 82.059  1.00 46.89  ? 396  ASP C N     1 
ATOM   6654  C  CA    . ASP C  2  396  ? 66.339  -10.111 83.160  1.00 47.47  ? 396  ASP C CA    1 
ATOM   6655  C  C     . ASP C  2  396  ? 66.900  -10.581 84.489  1.00 47.72  ? 396  ASP C C     1 
ATOM   6656  O  O     . ASP C  2  396  ? 66.502  -11.610 85.014  1.00 46.31  ? 396  ASP C O     1 
ATOM   6657  C  CB    . ASP C  2  396  ? 64.846  -10.414 83.089  1.00 45.67  ? 396  ASP C CB    1 
ATOM   6658  C  CG    . ASP C  2  396  ? 64.094  -9.937  84.324  1.00 51.90  ? 396  ASP C CG    1 
ATOM   6659  O  OD1   . ASP C  2  396  ? 64.618  -9.066  85.056  1.00 45.66  ? 396  ASP C OD1   1 
ATOM   6660  O  OD2   . ASP C  2  396  ? 62.975  -10.446 84.562  1.00 57.69  ? 396  ASP C OD2   1 
ATOM   6661  N  N     . GLU C  2  397  ? 67.833  -9.813  85.027  1.00 46.24  ? 397  GLU C N     1 
ATOM   6662  C  CA    . GLU C  2  397  ? 68.370  -10.082 86.340  1.00 44.99  ? 397  GLU C CA    1 
ATOM   6663  C  C     . GLU C  2  397  ? 68.118  -8.873  87.236  1.00 50.72  ? 397  GLU C C     1 
ATOM   6664  O  O     . GLU C  2  397  ? 69.024  -8.082  87.484  1.00 58.35  ? 397  GLU C O     1 
ATOM   6665  C  CB    . GLU C  2  397  ? 69.868  -10.389 86.251  1.00 52.36  ? 397  GLU C CB    1 
ATOM   6666  C  CG    . GLU C  2  397  ? 70.678  -9.354  85.470  1.00 53.56  ? 397  GLU C CG    1 
ATOM   6667  C  CD    . GLU C  2  397  ? 72.162  -9.673  85.431  1.00 61.89  ? 397  GLU C CD    1 
ATOM   6668  O  OE1   . GLU C  2  397  ? 72.554  -10.749 85.929  1.00 71.09  ? 397  GLU C OE1   1 
ATOM   6669  O  OE2   . GLU C  2  397  ? 72.937  -8.845  84.903  1.00 53.69  ? 397  GLU C OE2   1 
ATOM   6670  N  N     . THR C  2  398  ? 66.885  -8.724  87.712  1.00 45.14  ? 398  THR C N     1 
ATOM   6671  C  CA    . THR C  2  398  ? 66.585  -7.692  88.693  1.00 41.08  ? 398  THR C CA    1 
ATOM   6672  C  C     . THR C  2  398  ? 67.001  -8.253  90.035  1.00 42.56  ? 398  THR C C     1 
ATOM   6673  O  O     . THR C  2  398  ? 67.513  -7.546  90.904  1.00 45.57  ? 398  THR C O     1 
ATOM   6674  C  CB    . THR C  2  398  ? 65.096  -7.375  88.735  1.00 40.27  ? 398  THR C CB    1 
ATOM   6675  O  OG1   . THR C  2  398  ? 64.641  -7.037  87.427  1.00 36.73  ? 398  THR C OG1   1 
ATOM   6676  C  CG2   . THR C  2  398  ? 64.833  -6.213  89.655  1.00 51.37  ? 398  THR C CG2   1 
ATOM   6677  N  N     . ASN C  2  399  ? 66.750  -9.548  90.183  1.00 42.87  ? 399  ASN C N     1 
ATOM   6678  C  CA    . ASN C  2  399  ? 67.159  -10.325 91.338  1.00 44.76  ? 399  ASN C CA    1 
ATOM   6679  C  C     . ASN C  2  399  ? 67.342  -11.756 90.851  1.00 45.32  ? 399  ASN C C     1 
ATOM   6680  O  O     . ASN C  2  399  ? 66.870  -12.094 89.772  1.00 44.70  ? 399  ASN C O     1 
ATOM   6681  C  CB    . ASN C  2  399  ? 66.101  -10.254 92.436  1.00 36.55  ? 399  ASN C CB    1 
ATOM   6682  C  CG    . ASN C  2  399  ? 64.838  -11.002 92.075  1.00 39.24  ? 399  ASN C CG    1 
ATOM   6683  O  OD1   . ASN C  2  399  ? 64.834  -12.230 91.979  1.00 38.15  ? 399  ASN C OD1   1 
ATOM   6684  N  ND2   . ASN C  2  399  ? 63.752  -10.266 91.874  1.00 40.62  ? 399  ASN C ND2   1 
ATOM   6685  N  N     . PRO C  2  400  ? 68.022  -12.603 91.637  1.00 46.25  ? 400  PRO C N     1 
ATOM   6686  C  CA    . PRO C  2  400  ? 68.352  -13.972 91.216  1.00 44.01  ? 400  PRO C CA    1 
ATOM   6687  C  C     . PRO C  2  400  ? 67.185  -14.731 90.576  1.00 42.69  ? 400  PRO C C     1 
ATOM   6688  O  O     . PRO C  2  400  ? 67.359  -15.382 89.534  1.00 41.92  ? 400  PRO C O     1 
ATOM   6689  C  CB    . PRO C  2  400  ? 68.751  -14.642 92.529  1.00 46.47  ? 400  PRO C CB    1 
ATOM   6690  C  CG    . PRO C  2  400  ? 69.291  -13.532 93.362  1.00 42.46  ? 400  PRO C CG    1 
ATOM   6691  C  CD    . PRO C  2  400  ? 68.487  -12.318 93.007  1.00 39.23  ? 400  PRO C CD    1 
ATOM   6692  N  N     . LEU C  2  401  ? 66.009  -14.647 91.196  1.00 41.53  ? 401  LEU C N     1 
ATOM   6693  C  CA    . LEU C  2  401  ? 64.834  -15.336 90.687  1.00 36.67  ? 401  LEU C CA    1 
ATOM   6694  C  C     . LEU C  2  401  ? 64.425  -14.823 89.314  1.00 42.84  ? 401  LEU C C     1 
ATOM   6695  O  O     . LEU C  2  401  ? 63.973  -15.602 88.477  1.00 44.60  ? 401  LEU C O     1 
ATOM   6696  C  CB    . LEU C  2  401  ? 63.666  -15.209 91.651  1.00 38.13  ? 401  LEU C CB    1 
ATOM   6697  C  CG    . LEU C  2  401  ? 62.402  -15.950 91.208  1.00 43.64  ? 401  LEU C CG    1 
ATOM   6698  C  CD1   . LEU C  2  401  ? 62.697  -17.419 90.924  1.00 42.75  ? 401  LEU C CD1   1 
ATOM   6699  C  CD2   . LEU C  2  401  ? 61.298  -15.805 92.245  1.00 42.99  ? 401  LEU C CD2   1 
ATOM   6700  N  N     . SER C  2  402  ? 64.584  -13.521 89.083  1.00 42.08  ? 402  SER C N     1 
ATOM   6701  C  CA    . SER C  2  402  ? 64.286  -12.927 87.779  1.00 38.87  ? 402  SER C CA    1 
ATOM   6702  C  C     . SER C  2  402  ? 64.934  -13.717 86.644  1.00 43.92  ? 402  SER C C     1 
ATOM   6703  O  O     . SER C  2  402  ? 64.269  -14.122 85.686  1.00 45.55  ? 402  SER C O     1 
ATOM   6704  C  CB    . SER C  2  402  ? 64.780  -11.485 87.717  1.00 38.98  ? 402  SER C CB    1 
ATOM   6705  O  OG    . SER C  2  402  ? 64.688  -10.861 88.977  1.00 42.63  ? 402  SER C OG    1 
ATOM   6706  N  N     . SER C  2  403  ? 66.242  -13.924 86.760  1.00 40.61  ? 403  SER C N     1 
ATOM   6707  C  CA    . SER C  2  403  ? 67.007  -14.621 85.740  1.00 43.90  ? 403  SER C CA    1 
ATOM   6708  C  C     . SER C  2  403  ? 66.728  -16.119 85.748  1.00 46.55  ? 403  SER C C     1 
ATOM   6709  O  O     . SER C  2  403  ? 66.503  -16.725 84.691  1.00 49.88  ? 403  SER C O     1 
ATOM   6710  C  CB    . SER C  2  403  ? 68.499  -14.342 85.907  1.00 45.18  ? 403  SER C CB    1 
ATOM   6711  O  OG    . SER C  2  403  ? 68.934  -14.685 87.205  1.00 55.86  ? 403  SER C OG    1 
ATOM   6712  N  N     . LEU C  2  404  ? 66.724  -16.722 86.934  1.00 47.20  ? 404  LEU C N     1 
ATOM   6713  C  CA    . LEU C  2  404  ? 66.409  -18.143 87.003  1.00 47.59  ? 404  LEU C CA    1 
ATOM   6714  C  C     . LEU C  2  404  ? 65.109  -18.445 86.267  1.00 47.97  ? 404  LEU C C     1 
ATOM   6715  O  O     . LEU C  2  404  ? 64.953  -19.510 85.674  1.00 50.34  ? 404  LEU C O     1 
ATOM   6716  C  CB    . LEU C  2  404  ? 66.292  -18.633 88.440  1.00 47.09  ? 404  LEU C CB    1 
ATOM   6717  C  CG    . LEU C  2  404  ? 65.917  -20.114 88.477  1.00 44.26  ? 404  LEU C CG    1 
ATOM   6718  C  CD1   . LEU C  2  404  ? 67.168  -20.976 88.535  1.00 47.88  ? 404  LEU C CD1   1 
ATOM   6719  C  CD2   . LEU C  2  404  ? 65.004  -20.414 89.641  1.00 48.61  ? 404  LEU C CD2   1 
ATOM   6720  N  N     . ARG C  2  405  ? 64.169  -17.510 86.311  1.00 47.18  ? 405  ARG C N     1 
ATOM   6721  C  CA    . ARG C  2  405  ? 62.895  -17.716 85.638  1.00 48.02  ? 405  ARG C CA    1 
ATOM   6722  C  C     . ARG C  2  405  ? 63.006  -17.385 84.167  1.00 50.17  ? 405  ARG C C     1 
ATOM   6723  O  O     . ARG C  2  405  ? 62.399  -18.048 83.324  1.00 50.79  ? 405  ARG C O     1 
ATOM   6724  C  CB    . ARG C  2  405  ? 61.799  -16.851 86.240  1.00 45.02  ? 405  ARG C CB    1 
ATOM   6725  C  CG    . ARG C  2  405  ? 60.481  -17.074 85.545  1.00 51.93  ? 405  ARG C CG    1 
ATOM   6726  C  CD    . ARG C  2  405  ? 59.575  -15.883 85.664  1.00 55.48  ? 405  ARG C CD    1 
ATOM   6727  N  NE    . ARG C  2  405  ? 59.997  -14.783 84.813  1.00 55.23  ? 405  ARG C NE    1 
ATOM   6728  C  CZ    . ARG C  2  405  ? 59.182  -13.820 84.403  1.00 56.45  ? 405  ARG C CZ    1 
ATOM   6729  N  NH1   . ARG C  2  405  ? 57.904  -13.838 84.762  1.00 47.45  ? 405  ARG C NH1   1 
ATOM   6730  N  NH2   . ARG C  2  405  ? 59.645  -12.843 83.634  1.00 67.87  ? 405  ARG C NH2   1 
ATOM   6731  N  N     . HIS C  2  406  ? 63.765  -16.335 83.867  1.00 46.44  ? 406  HIS C N     1 
ATOM   6732  C  CA    . HIS C  2  406  ? 63.956  -15.917 82.493  1.00 42.33  ? 406  HIS C CA    1 
ATOM   6733  C  C     . HIS C  2  406  ? 64.430  -17.100 81.673  1.00 40.79  ? 406  HIS C C     1 
ATOM   6734  O  O     . HIS C  2  406  ? 64.036  -17.272 80.525  1.00 40.04  ? 406  HIS C O     1 
ATOM   6735  C  CB    . HIS C  2  406  ? 64.980  -14.793 82.414  1.00 38.72  ? 406  HIS C CB    1 
ATOM   6736  C  CG    . HIS C  2  406  ? 64.963  -14.064 81.111  1.00 36.78  ? 406  HIS C CG    1 
ATOM   6737  N  ND1   . HIS C  2  406  ? 65.677  -12.906 80.896  1.00 43.12  ? 406  HIS C ND1   1 
ATOM   6738  C  CD2   . HIS C  2  406  ? 64.308  -14.323 79.956  1.00 30.93  ? 406  HIS C CD2   1 
ATOM   6739  C  CE1   . HIS C  2  406  ? 65.467  -12.486 79.662  1.00 45.70  ? 406  HIS C CE1   1 
ATOM   6740  N  NE2   . HIS C  2  406  ? 64.635  -13.326 79.071  1.00 37.46  ? 406  HIS C NE2   1 
ATOM   6741  N  N     . LYS C  2  407  ? 65.270  -17.926 82.281  1.00 38.52  ? 407  LYS C N     1 
ATOM   6742  C  CA    . LYS C  2  407  ? 65.844  -19.067 81.580  1.00 41.48  ? 407  LYS C CA    1 
ATOM   6743  C  C     . LYS C  2  407  ? 64.847  -20.200 81.331  1.00 44.72  ? 407  LYS C C     1 
ATOM   6744  O  O     . LYS C  2  407  ? 64.934  -20.901 80.320  1.00 44.89  ? 407  LYS C O     1 
ATOM   6745  C  CB    . LYS C  2  407  ? 67.073  -19.577 82.331  1.00 44.86  ? 407  LYS C CB    1 
ATOM   6746  C  CG    . LYS C  2  407  ? 68.232  -18.591 82.308  1.00 46.58  ? 407  LYS C CG    1 
ATOM   6747  C  CD    . LYS C  2  407  ? 69.111  -18.729 83.529  1.00 46.07  ? 407  LYS C CD    1 
ATOM   6748  C  CE    . LYS C  2  407  ? 70.130  -17.610 83.596  1.00 51.92  ? 407  LYS C CE    1 
ATOM   6749  N  NZ    . LYS C  2  407  ? 70.799  -17.575 84.927  1.00 61.92  ? 407  LYS C NZ    1 
ATOM   6750  N  N     . ARG C  2  408  ? 63.898  -20.375 82.244  1.00 45.08  ? 408  ARG C N     1 
ATOM   6751  C  CA    . ARG C  2  408  ? 62.899  -21.433 82.102  1.00 40.46  ? 408  ARG C CA    1 
ATOM   6752  C  C     . ARG C  2  408  ? 61.671  -20.936 81.341  1.00 41.99  ? 408  ARG C C     1 
ATOM   6753  O  O     . ARG C  2  408  ? 60.635  -21.593 81.320  1.00 41.13  ? 408  ARG C O     1 
ATOM   6754  C  CB    . ARG C  2  408  ? 62.503  -21.987 83.470  1.00 42.65  ? 408  ARG C CB    1 
ATOM   6755  C  CG    . ARG C  2  408  ? 63.651  -21.991 84.460  1.00 42.49  ? 408  ARG C CG    1 
ATOM   6756  C  CD    . ARG C  2  408  ? 63.283  -22.641 85.772  1.00 41.75  ? 408  ARG C CD    1 
ATOM   6757  N  NE    . ARG C  2  408  ? 63.306  -24.097 85.690  1.00 42.35  ? 408  ARG C NE    1 
ATOM   6758  C  CZ    . ARG C  2  408  ? 62.255  -24.872 85.930  1.00 46.69  ? 408  ARG C CZ    1 
ATOM   6759  N  NH1   . ARG C  2  408  ? 61.098  -24.322 86.267  1.00 46.66  ? 408  ARG C NH1   1 
ATOM   6760  N  NH2   . ARG C  2  408  ? 62.360  -26.193 85.840  1.00 45.05  ? 408  ARG C NH2   1 
ATOM   6761  N  N     . ARG C  2  409  ? 61.804  -19.771 80.713  1.00 44.07  ? 409  ARG C N     1 
ATOM   6762  C  CA    . ARG C  2  409  ? 60.735  -19.189 79.906  1.00 45.62  ? 409  ARG C CA    1 
ATOM   6763  C  C     . ARG C  2  409  ? 60.516  -19.993 78.622  1.00 43.53  ? 409  ARG C C     1 
ATOM   6764  O  O     . ARG C  2  409  ? 61.469  -20.434 77.990  1.00 42.50  ? 409  ARG C O     1 
ATOM   6765  C  CB    . ARG C  2  409  ? 61.070  -17.733 79.560  1.00 46.73  ? 409  ARG C CB    1 
ATOM   6766  C  CG    . ARG C  2  409  ? 59.875  -16.785 79.562  1.00 52.56  ? 409  ARG C CG    1 
ATOM   6767  C  CD    . ARG C  2  409  ? 59.081  -16.925 80.854  1.00 57.31  ? 409  ARG C CD    1 
ATOM   6768  N  NE    . ARG C  2  409  ? 58.071  -15.883 81.019  1.00 69.61  ? 409  ARG C NE    1 
ATOM   6769  C  CZ    . ARG C  2  409  ? 57.015  -15.992 81.824  1.00 73.81  ? 409  ARG C CZ    1 
ATOM   6770  N  NH1   . ARG C  2  409  ? 56.137  -14.995 81.923  1.00 71.90  ? 409  ARG C NH1   1 
ATOM   6771  N  NH2   . ARG C  2  409  ? 56.832  -17.104 82.528  1.00 65.02  ? 409  ARG C NH2   1 
ATOM   6772  N  N     . ILE C  2  410  ? 59.251  -20.148 78.239  1.00 45.62  ? 410  ILE C N     1 
ATOM   6773  C  CA    . ILE C  2  410  ? 58.882  -20.787 76.977  1.00 41.39  ? 410  ILE C CA    1 
ATOM   6774  C  C     . ILE C  2  410  ? 58.068  -19.829 76.106  1.00 45.35  ? 410  ILE C C     1 
ATOM   6775  O  O     . ILE C  2  410  ? 57.114  -19.212 76.578  1.00 50.94  ? 410  ILE C O     1 
ATOM   6776  C  CB    . ILE C  2  410  ? 58.068  -22.072 77.210  1.00 43.66  ? 410  ILE C CB    1 
ATOM   6777  C  CG1   . ILE C  2  410  ? 58.895  -23.092 77.995  1.00 47.68  ? 410  ILE C CG1   1 
ATOM   6778  C  CG2   . ILE C  2  410  ? 57.609  -22.659 75.885  1.00 43.30  ? 410  ILE C CG2   1 
ATOM   6779  C  CD1   . ILE C  2  410  ? 58.075  -24.223 78.575  1.00 55.65  ? 410  ILE C CD1   1 
ATOM   6780  N  N     . SER C  2  411  ? 58.447  -19.705 74.836  1.00 40.16  ? 411  SER C N     1 
ATOM   6781  C  CA    . SER C  2  411  ? 57.784  -18.777 73.920  1.00 41.32  ? 411  SER C CA    1 
ATOM   6782  C  C     . SER C  2  411  ? 57.212  -19.456 72.674  1.00 45.82  ? 411  SER C C     1 
ATOM   6783  O  O     . SER C  2  411  ? 57.882  -20.272 72.042  1.00 43.49  ? 411  SER C O     1 
ATOM   6784  C  CB    . SER C  2  411  ? 58.743  -17.657 73.510  1.00 38.60  ? 411  SER C CB    1 
ATOM   6785  O  OG    . SER C  2  411  ? 58.112  -16.740 72.633  1.00 39.60  ? 411  SER C OG    1 
ATOM   6786  N  N     . ALA C  2  412  ? 55.941  -19.186 72.397  1.00 49.97  ? 412  ALA C N     1 
ATOM   6787  C  CA    . ALA C  2  412  ? 55.328  -19.494 71.114  1.00 48.40  ? 412  ALA C CA    1 
ATOM   6788  C  C     . ALA C  2  412  ? 55.966  -18.626 70.034  1.00 59.41  ? 412  ALA C C     1 
ATOM   6789  O  O     . ALA C  2  412  ? 56.208  -19.069 68.912  1.00 62.34  ? 412  ALA C O     1 
ATOM   6790  C  CB    . ALA C  2  412  ? 53.828  -19.261 71.170  1.00 51.21  ? 412  ALA C CB    1 
ATOM   6791  N  N     . LEU C  2  413  ? 56.221  -17.375 70.404  1.00 57.47  ? 413  LEU C N     1 
ATOM   6792  C  CA    . LEU C  2  413  ? 56.717  -16.347 69.496  1.00 59.92  ? 413  LEU C CA    1 
ATOM   6793  C  C     . LEU C  2  413  ? 58.172  -16.539 69.080  1.00 62.63  ? 413  LEU C C     1 
ATOM   6794  O  O     . LEU C  2  413  ? 58.946  -17.210 69.762  1.00 64.06  ? 413  LEU C O     1 
ATOM   6795  C  CB    . LEU C  2  413  ? 56.535  -14.959 70.116  1.00 60.27  ? 413  LEU C CB    1 
ATOM   6796  C  CG    . LEU C  2  413  ? 55.195  -14.698 70.805  1.00 56.18  ? 413  LEU C CG    1 
ATOM   6797  C  CD1   . LEU C  2  413  ? 55.267  -13.441 71.657  1.00 62.47  ? 413  LEU C CD1   1 
ATOM   6798  C  CD2   . LEU C  2  413  ? 54.078  -14.593 69.779  1.00 62.95  ? 413  LEU C CD2   1 
ATOM   6799  N  N     . GLY C  2  414  ? 58.527  -15.941 67.948  1.00 62.17  ? 414  GLY C N     1 
ATOM   6800  C  CA    . GLY C  2  414  ? 59.870  -16.029 67.407  1.00 66.46  ? 414  GLY C CA    1 
ATOM   6801  C  C     . GLY C  2  414  ? 59.880  -16.661 66.031  1.00 76.16  ? 414  GLY C C     1 
ATOM   6802  O  O     . GLY C  2  414  ? 58.868  -17.195 65.577  1.00 79.34  ? 414  GLY C O     1 
ATOM   6803  N  N     . PRO C  2  415  ? 61.025  -16.596 65.361  1.00 69.56  ? 415  PRO C N     1 
ATOM   6804  C  CA    . PRO C  2  415  ? 61.137  -17.114 63.989  1.00 67.17  ? 415  PRO C CA    1 
ATOM   6805  C  C     . PRO C  2  415  ? 60.718  -18.585 63.891  1.00 74.83  ? 415  PRO C C     1 
ATOM   6806  O  O     . PRO C  2  415  ? 61.137  -19.404 64.707  1.00 78.38  ? 415  PRO C O     1 
ATOM   6807  C  CB    . PRO C  2  415  ? 62.630  -16.954 63.680  1.00 69.49  ? 415  PRO C CB    1 
ATOM   6808  C  CG    . PRO C  2  415  ? 63.108  -15.887 64.622  1.00 74.86  ? 415  PRO C CG    1 
ATOM   6809  C  CD    . PRO C  2  415  ? 62.317  -16.113 65.874  1.00 70.86  ? 415  PRO C CD    1 
ATOM   6810  N  N     . GLY C  2  416  ? 59.901  -18.913 62.896  1.00 72.42  ? 416  GLY C N     1 
ATOM   6811  C  CA    . GLY C  2  416  ? 59.300  -20.232 62.813  1.00 74.52  ? 416  GLY C CA    1 
ATOM   6812  C  C     . GLY C  2  416  ? 58.209  -20.385 63.858  1.00 84.96  ? 416  GLY C C     1 
ATOM   6813  O  O     . GLY C  2  416  ? 57.985  -21.477 64.387  1.00 87.22  ? 416  GLY C O     1 
ATOM   6814  N  N     . GLY C  2  417  ? 57.566  -19.262 64.174  1.00 76.86  ? 417  GLY C N     1 
ATOM   6815  C  CA    . GLY C  2  417  ? 56.682  -19.135 65.320  1.00 77.86  ? 417  GLY C CA    1 
ATOM   6816  C  C     . GLY C  2  417  ? 55.451  -18.275 65.084  1.00 81.59  ? 417  GLY C C     1 
ATOM   6817  O  O     . GLY C  2  417  ? 55.374  -17.539 64.100  1.00 86.54  ? 417  GLY C O     1 
ATOM   6818  N  N     . LEU C  2  418  ? 54.485  -18.375 65.993  1.00 84.82  ? 418  LEU C N     1 
ATOM   6819  C  CA    . LEU C  2  418  ? 53.217  -17.654 65.881  1.00 84.20  ? 418  LEU C CA    1 
ATOM   6820  C  C     . LEU C  2  418  ? 53.399  -16.135 65.902  1.00 88.75  ? 418  LEU C C     1 
ATOM   6821  O  O     . LEU C  2  418  ? 54.281  -15.608 66.580  1.00 88.05  ? 418  LEU C O     1 
ATOM   6822  C  CB    . LEU C  2  418  ? 52.260  -18.083 66.994  1.00 77.89  ? 418  LEU C CB    1 
ATOM   6823  C  CG    . LEU C  2  418  ? 51.966  -19.581 67.089  1.00 69.99  ? 418  LEU C CG    1 
ATOM   6824  C  CD1   . LEU C  2  418  ? 51.180  -19.895 68.353  1.00 75.14  ? 418  LEU C CD1   1 
ATOM   6825  C  CD2   . LEU C  2  418  ? 51.218  -20.061 65.855  1.00 69.91  ? 418  LEU C CD2   1 
ATOM   6826  N  N     . THR C  2  419  ? 52.558  -15.448 65.134  1.00 93.82  ? 419  THR C N     1 
ATOM   6827  C  CA    . THR C  2  419  ? 52.710  -14.019 64.845  1.00 96.36  ? 419  THR C CA    1 
ATOM   6828  C  C     . THR C  2  419  ? 51.827  -13.158 65.782  1.00 96.27  ? 419  THR C C     1 
ATOM   6829  O  O     . THR C  2  419  ? 52.064  -11.951 65.946  1.00 104.59 ? 419  THR C O     1 
ATOM   6830  C  CB    . THR C  2  419  ? 52.452  -13.647 63.341  1.00 101.72 ? 419  THR C CB    1 
ATOM   6831  O  OG1   . THR C  2  419  ? 53.360  -14.357 62.485  1.00 91.11  ? 419  THR C OG1   1 
ATOM   6832  C  CG2   . THR C  2  419  ? 52.619  -12.156 63.084  1.00 105.92 ? 419  THR C CG2   1 
ATOM   6833  N  N     . ARG C  2  420  ? 50.896  -13.834 66.463  1.00 85.93  ? 420  ARG C N     1 
ATOM   6834  C  CA    . ARG C  2  420  ? 49.706  -13.300 67.189  1.00 87.37  ? 420  ARG C CA    1 
ATOM   6835  C  C     . ARG C  2  420  ? 48.406  -13.021 66.433  1.00 91.50  ? 420  ARG C C     1 
ATOM   6836  O  O     . ARG C  2  420  ? 47.342  -12.988 67.054  1.00 88.86  ? 420  ARG C O     1 
ATOM   6837  C  CB    . ARG C  2  420  ? 49.983  -11.979 67.889  1.00 79.44  ? 420  ARG C CB    1 
ATOM   6838  C  CG    . ARG C  2  420  ? 50.987  -11.987 68.969  1.00 85.51  ? 420  ARG C CG    1 
ATOM   6839  C  CD    . ARG C  2  420  ? 50.527  -11.022 70.035  1.00 86.89  ? 420  ARG C CD    1 
ATOM   6840  N  NE    . ARG C  2  420  ? 51.586  -10.779 70.998  1.00 84.12  ? 420  ARG C NE    1 
ATOM   6841  C  CZ    . ARG C  2  420  ? 52.436  -9.765  70.920  1.00 85.29  ? 420  ARG C CZ    1 
ATOM   6842  N  NH1   . ARG C  2  420  ? 52.337  -8.884  69.935  1.00 86.21  ? 420  ARG C NH1   1 
ATOM   6843  N  NH2   . ARG C  2  420  ? 53.383  -9.630  71.835  1.00 84.49  ? 420  ARG C NH2   1 
ATOM   6844  N  N     . GLU C  2  421  ? 48.454  -12.853 65.119  1.00 92.67  ? 421  GLU C N     1 
ATOM   6845  C  CA    . GLU C  2  421  ? 47.216  -12.890 64.369  1.00 90.74  ? 421  GLU C CA    1 
ATOM   6846  C  C     . GLU C  2  421  ? 47.007  -14.375 64.215  1.00 96.53  ? 421  GLU C C     1 
ATOM   6847  O  O     . GLU C  2  421  ? 45.880  -14.870 64.233  1.00 96.97  ? 421  GLU C O     1 
ATOM   6848  C  CB    . GLU C  2  421  ? 47.325  -12.191 63.014  1.00 94.29  ? 421  GLU C CB    1 
ATOM   6849  C  CG    . GLU C  2  421  ? 48.720  -12.143 62.430  1.00 100.36 ? 421  GLU C CG    1 
ATOM   6850  C  CD    . GLU C  2  421  ? 49.462  -10.887 62.836  1.00 103.69 ? 421  GLU C CD    1 
ATOM   6851  O  OE1   . GLU C  2  421  ? 50.089  -10.265 61.951  1.00 98.25  ? 421  GLU C OE1   1 
ATOM   6852  O  OE2   . GLU C  2  421  ? 49.418  -10.527 64.036  1.00 103.00 ? 421  GLU C OE2   1 
ATOM   6853  N  N     . ARG C  2  422  ? 48.113  -15.096 64.114  1.00 98.22  ? 422  ARG C N     1 
ATOM   6854  C  CA    . ARG C  2  422  ? 48.069  -16.542 64.087  1.00 100.20 ? 422  ARG C CA    1 
ATOM   6855  C  C     . ARG C  2  422  ? 47.489  -17.045 65.401  1.00 97.62  ? 422  ARG C C     1 
ATOM   6856  O  O     . ARG C  2  422  ? 46.750  -18.029 65.424  1.00 93.42  ? 422  ARG C O     1 
ATOM   6857  C  CB    . ARG C  2  422  ? 49.469  -17.119 63.872  1.00 96.91  ? 422  ARG C CB    1 
ATOM   6858  C  CG    . ARG C  2  422  ? 50.474  -16.120 63.322  1.00 103.16 ? 422  ARG C CG    1 
ATOM   6859  C  CD    . ARG C  2  422  ? 50.332  -15.966 61.816  1.00 104.41 ? 422  ARG C CD    1 
ATOM   6860  N  NE    . ARG C  2  422  ? 50.420  -17.249 61.124  1.00 111.21 ? 422  ARG C NE    1 
ATOM   6861  C  CZ    . ARG C  2  422  ? 50.390  -17.388 59.803  1.00 114.40 ? 422  ARG C CZ    1 
ATOM   6862  N  NH1   . ARG C  2  422  ? 50.275  -16.321 59.024  1.00 114.60 ? 422  ARG C NH1   1 
ATOM   6863  N  NH2   . ARG C  2  422  ? 50.477  -18.594 59.259  1.00 115.49 ? 422  ARG C NH2   1 
ATOM   6864  N  N     . ALA C  2  423  ? 47.840  -16.381 66.501  1.00 89.56  ? 423  ALA C N     1 
ATOM   6865  C  CA    . ALA C  2  423  ? 47.536  -16.924 67.818  1.00 81.12  ? 423  ALA C CA    1 
ATOM   6866  C  C     . ALA C  2  423  ? 46.116  -16.601 68.285  1.00 84.81  ? 423  ALA C C     1 
ATOM   6867  O  O     . ALA C  2  423  ? 45.807  -15.463 68.654  1.00 84.47  ? 423  ALA C O     1 
ATOM   6868  C  CB    . ALA C  2  423  ? 48.562  -16.444 68.849  1.00 74.94  ? 423  ALA C CB    1 
ATOM   6869  N  N     . GLY C  2  424  ? 45.270  -17.630 68.287  1.00 79.44  ? 424  GLY C N     1 
ATOM   6870  C  CA    . GLY C  2  424  ? 43.923  -17.539 68.819  1.00 81.51  ? 424  GLY C CA    1 
ATOM   6871  C  C     . GLY C  2  424  ? 43.807  -18.300 70.127  1.00 81.52  ? 424  GLY C C     1 
ATOM   6872  O  O     . GLY C  2  424  ? 44.806  -18.549 70.792  1.00 81.30  ? 424  GLY C O     1 
ATOM   6873  N  N     . PHE C  2  425  ? 42.593  -18.695 70.487  1.00 83.90  ? 425  PHE C N     1 
ATOM   6874  C  CA    . PHE C  2  425  ? 42.352  -19.336 71.775  1.00 83.45  ? 425  PHE C CA    1 
ATOM   6875  C  C     . PHE C  2  425  ? 43.039  -20.693 71.931  1.00 78.77  ? 425  PHE C C     1 
ATOM   6876  O  O     . PHE C  2  425  ? 43.484  -21.040 73.025  1.00 78.89  ? 425  PHE C O     1 
ATOM   6877  C  CB    . PHE C  2  425  ? 40.846  -19.485 72.023  1.00 83.09  ? 425  PHE C CB    1 
ATOM   6878  C  CG    . PHE C  2  425  ? 40.130  -18.178 72.182  1.00 83.75  ? 425  PHE C CG    1 
ATOM   6879  C  CD1   . PHE C  2  425  ? 39.673  -17.778 73.423  1.00 83.88  ? 425  PHE C CD1   1 
ATOM   6880  C  CD2   . PHE C  2  425  ? 39.929  -17.341 71.094  1.00 83.70  ? 425  PHE C CD2   1 
ATOM   6881  C  CE1   . PHE C  2  425  ? 39.021  -16.580 73.581  1.00 83.08  ? 425  PHE C CE1   1 
ATOM   6882  C  CE2   . PHE C  2  425  ? 39.280  -16.136 71.243  1.00 78.59  ? 425  PHE C CE2   1 
ATOM   6883  C  CZ    . PHE C  2  425  ? 38.822  -15.755 72.488  1.00 83.44  ? 425  PHE C CZ    1 
ATOM   6884  N  N     . ASP C  2  426  ? 43.119  -21.453 70.843  1.00 75.90  ? 426  ASP C N     1 
ATOM   6885  C  CA    . ASP C  2  426  ? 43.619  -22.824 70.905  1.00 75.25  ? 426  ASP C CA    1 
ATOM   6886  C  C     . ASP C  2  426  ? 45.040  -22.920 71.449  1.00 69.05  ? 426  ASP C C     1 
ATOM   6887  O  O     . ASP C  2  426  ? 45.354  -23.803 72.248  1.00 64.33  ? 426  ASP C O     1 
ATOM   6888  C  CB    . ASP C  2  426  ? 43.538  -23.475 69.526  1.00 82.03  ? 426  ASP C CB    1 
ATOM   6889  C  CG    . ASP C  2  426  ? 42.120  -23.856 69.146  1.00 87.46  ? 426  ASP C CG    1 
ATOM   6890  O  OD1   . ASP C  2  426  ? 41.395  -24.359 70.027  1.00 85.44  ? 426  ASP C OD1   1 
ATOM   6891  O  OD2   . ASP C  2  426  ? 41.733  -23.653 67.971  1.00 87.05  ? 426  ASP C OD2   1 
ATOM   6892  N  N     . VAL C  2  427  ? 45.932  -22.100 70.899  1.00 69.87  ? 427  VAL C N     1 
ATOM   6893  C  CA    . VAL C  2  427  ? 47.332  -22.086 71.323  1.00 66.27  ? 427  VAL C CA    1 
ATOM   6894  C  C     . VAL C  2  427  ? 47.544  -21.591 72.752  1.00 63.69  ? 427  VAL C C     1 
ATOM   6895  O  O     . VAL C  2  427  ? 48.320  -22.168 73.513  1.00 55.89  ? 427  VAL C O     1 
ATOM   6896  C  CB    . VAL C  2  427  ? 48.195  -21.235 70.372  1.00 59.90  ? 427  VAL C CB    1 
ATOM   6897  C  CG1   . VAL C  2  427  ? 49.455  -21.990 69.981  1.00 62.29  ? 427  VAL C CG1   1 
ATOM   6898  C  CG2   . VAL C  2  427  ? 47.395  -20.842 69.140  1.00 76.67  ? 427  VAL C CG2   1 
ATOM   6899  N  N     . ARG C  2  428  ? 46.849  -20.514 73.101  1.00 66.32  ? 428  ARG C N     1 
ATOM   6900  C  CA    . ARG C  2  428  ? 46.981  -19.890 74.414  1.00 60.73  ? 428  ARG C CA    1 
ATOM   6901  C  C     . ARG C  2  428  ? 46.511  -20.801 75.541  1.00 55.73  ? 428  ARG C C     1 
ATOM   6902  O  O     . ARG C  2  428  ? 47.117  -20.858 76.610  1.00 52.30  ? 428  ARG C O     1 
ATOM   6903  C  CB    . ARG C  2  428  ? 46.217  -18.565 74.453  1.00 53.51  ? 428  ARG C CB    1 
ATOM   6904  C  CG    . ARG C  2  428  ? 46.406  -17.708 73.211  1.00 55.95  ? 428  ARG C CG    1 
ATOM   6905  C  CD    . ARG C  2  428  ? 45.739  -16.352 73.365  1.00 64.26  ? 428  ARG C CD    1 
ATOM   6906  N  NE    . ARG C  2  428  ? 46.713  -15.277 73.527  1.00 61.91  ? 428  ARG C NE    1 
ATOM   6907  C  CZ    . ARG C  2  428  ? 47.041  -14.415 72.570  1.00 52.09  ? 428  ARG C CZ    1 
ATOM   6908  N  NH1   . ARG C  2  428  ? 46.472  -14.500 71.375  1.00 52.53  ? 428  ARG C NH1   1 
ATOM   6909  N  NH2   . ARG C  2  428  ? 47.938  -13.468 72.807  1.00 53.09  ? 428  ARG C NH2   1 
ATOM   6910  N  N     . ASP C  2  429  ? 45.415  -21.502 75.284  1.00 55.81  ? 429  ASP C N     1 
ATOM   6911  C  CA    . ASP C  2  429  ? 44.751  -22.328 76.290  1.00 59.18  ? 429  ASP C CA    1 
ATOM   6912  C  C     . ASP C  2  429  ? 45.721  -23.133 77.143  1.00 58.42  ? 429  ASP C C     1 
ATOM   6913  O  O     . ASP C  2  429  ? 46.854  -23.394 76.748  1.00 59.45  ? 429  ASP C O     1 
ATOM   6914  C  CB    . ASP C  2  429  ? 43.761  -23.288 75.631  1.00 62.18  ? 429  ASP C CB    1 
ATOM   6915  C  CG    . ASP C  2  429  ? 42.378  -22.698 75.501  1.00 74.25  ? 429  ASP C CG    1 
ATOM   6916  O  OD1   . ASP C  2  429  ? 42.059  -21.767 76.269  1.00 75.60  ? 429  ASP C OD1   1 
ATOM   6917  O  OD2   . ASP C  2  429  ? 41.610  -23.170 74.636  1.00 76.59  ? 429  ASP C OD2   1 
ATOM   6918  N  N     . VAL C  2  430  ? 45.261  -23.519 78.327  1.00 61.47  ? 430  VAL C N     1 
ATOM   6919  C  CA    . VAL C  2  430  ? 45.999  -24.451 79.166  1.00 59.31  ? 430  VAL C CA    1 
ATOM   6920  C  C     . VAL C  2  430  ? 45.516  -25.846 78.824  1.00 59.71  ? 430  VAL C C     1 
ATOM   6921  O  O     . VAL C  2  430  ? 44.388  -26.213 79.151  1.00 64.77  ? 430  VAL C O     1 
ATOM   6922  C  CB    . VAL C  2  430  ? 45.762  -24.173 80.663  1.00 55.23  ? 430  VAL C CB    1 
ATOM   6923  C  CG1   . VAL C  2  430  ? 46.108  -25.391 81.505  1.00 48.55  ? 430  VAL C CG1   1 
ATOM   6924  C  CG2   . VAL C  2  430  ? 46.581  -22.973 81.101  1.00 59.23  ? 430  VAL C CG2   1 
ATOM   6925  N  N     . HIS C  2  431  ? 46.357  -26.615 78.141  1.00 53.55  ? 431  HIS C N     1 
ATOM   6926  C  CA    . HIS C  2  431  ? 45.978  -27.958 77.732  1.00 51.97  ? 431  HIS C CA    1 
ATOM   6927  C  C     . HIS C  2  431  ? 46.088  -28.929 78.906  1.00 60.29  ? 431  HIS C C     1 
ATOM   6928  O  O     . HIS C  2  431  ? 46.952  -28.771 79.772  1.00 57.92  ? 431  HIS C O     1 
ATOM   6929  C  CB    . HIS C  2  431  ? 46.848  -28.433 76.570  1.00 52.27  ? 431  HIS C CB    1 
ATOM   6930  C  CG    . HIS C  2  431  ? 46.232  -29.543 75.771  1.00 53.27  ? 431  HIS C CG    1 
ATOM   6931  N  ND1   . HIS C  2  431  ? 46.213  -30.849 76.201  1.00 48.95  ? 431  HIS C ND1   1 
ATOM   6932  C  CD2   . HIS C  2  431  ? 45.609  -29.531 74.568  1.00 52.91  ? 431  HIS C CD2   1 
ATOM   6933  C  CE1   . HIS C  2  431  ? 45.605  -31.599 75.300  1.00 48.11  ? 431  HIS C CE1   1 
ATOM   6934  N  NE2   . HIS C  2  431  ? 45.230  -30.824 74.300  1.00 51.02  ? 431  HIS C NE2   1 
ATOM   6935  N  N     . ARG C  2  432  ? 45.209  -29.929 78.934  1.00 56.32  ? 432  ARG C N     1 
ATOM   6936  C  CA    . ARG C  2  432  ? 45.234  -30.923 80.000  1.00 49.36  ? 432  ARG C CA    1 
ATOM   6937  C  C     . ARG C  2  432  ? 46.622  -31.536 80.152  1.00 55.78  ? 432  ARG C C     1 
ATOM   6938  O  O     . ARG C  2  432  ? 46.982  -32.003 81.231  1.00 60.83  ? 432  ARG C O     1 
ATOM   6939  C  CB    . ARG C  2  432  ? 44.198  -32.020 79.752  1.00 46.31  ? 432  ARG C CB    1 
ATOM   6940  C  CG    . ARG C  2  432  ? 44.477  -32.870 78.540  1.00 52.25  ? 432  ARG C CG    1 
ATOM   6941  C  CD    . ARG C  2  432  ? 43.546  -34.062 78.472  1.00 53.35  ? 432  ARG C CD    1 
ATOM   6942  N  NE    . ARG C  2  432  ? 43.707  -34.815 77.231  1.00 52.37  ? 432  ARG C NE    1 
ATOM   6943  C  CZ    . ARG C  2  432  ? 44.545  -35.833 77.084  1.00 56.45  ? 432  ARG C CZ    1 
ATOM   6944  N  NH1   . ARG C  2  432  ? 45.304  -36.218 78.101  1.00 57.67  ? 432  ARG C NH1   1 
ATOM   6945  N  NH2   . ARG C  2  432  ? 44.627  -36.465 75.922  1.00 58.90  ? 432  ARG C NH2   1 
ATOM   6946  N  N     . THR C  2  433  ? 47.402  -31.528 79.073  1.00 53.20  ? 433  THR C N     1 
ATOM   6947  C  CA    . THR C  2  433  ? 48.732  -32.122 79.098  1.00 47.17  ? 433  THR C CA    1 
ATOM   6948  C  C     . THR C  2  433  ? 49.812  -31.165 79.607  1.00 49.11  ? 433  THR C C     1 
ATOM   6949  O  O     . THR C  2  433  ? 50.982  -31.528 79.658  1.00 51.39  ? 433  THR C O     1 
ATOM   6950  C  CB    . THR C  2  433  ? 49.143  -32.691 77.721  1.00 53.39  ? 433  THR C CB    1 
ATOM   6951  O  OG1   . THR C  2  433  ? 49.139  -31.645 76.744  1.00 56.43  ? 433  THR C OG1   1 
ATOM   6952  C  CG2   . THR C  2  433  ? 48.196  -33.794 77.279  1.00 47.08  ? 433  THR C CG2   1 
ATOM   6953  N  N     . HIS C  2  434  ? 49.428  -29.948 79.982  1.00 50.86  ? 434  HIS C N     1 
ATOM   6954  C  CA    . HIS C  2  434  ? 50.376  -29.024 80.596  1.00 47.39  ? 434  HIS C CA    1 
ATOM   6955  C  C     . HIS C  2  434  ? 50.671  -29.493 82.008  1.00 51.75  ? 434  HIS C C     1 
ATOM   6956  O  O     . HIS C  2  434  ? 51.590  -29.005 82.661  1.00 59.35  ? 434  HIS C O     1 
ATOM   6957  C  CB    . HIS C  2  434  ? 49.822  -27.600 80.641  1.00 47.34  ? 434  HIS C CB    1 
ATOM   6958  C  CG    . HIS C  2  434  ? 49.801  -26.911 79.318  1.00 46.94  ? 434  HIS C CG    1 
ATOM   6959  N  ND1   . HIS C  2  434  ? 49.998  -27.578 78.125  1.00 47.62  ? 434  HIS C ND1   1 
ATOM   6960  C  CD2   . HIS C  2  434  ? 49.609  -25.613 78.991  1.00 46.76  ? 434  HIS C CD2   1 
ATOM   6961  C  CE1   . HIS C  2  434  ? 49.931  -26.720 77.127  1.00 46.85  ? 434  HIS C CE1   1 
ATOM   6962  N  NE2   . HIS C  2  434  ? 49.694  -25.518 77.625  1.00 49.23  ? 434  HIS C NE2   1 
ATOM   6963  N  N     . TYR C  2  435  ? 49.872  -30.439 82.481  1.00 52.98  ? 435  TYR C N     1 
ATOM   6964  C  CA    . TYR C  2  435  ? 50.026  -30.967 83.827  1.00 51.55  ? 435  TYR C CA    1 
ATOM   6965  C  C     . TYR C  2  435  ? 51.459  -31.420 84.071  1.00 52.20  ? 435  TYR C C     1 
ATOM   6966  O  O     . TYR C  2  435  ? 51.968  -32.309 83.390  1.00 54.02  ? 435  TYR C O     1 
ATOM   6967  C  CB    . TYR C  2  435  ? 49.073  -32.143 84.042  1.00 50.77  ? 435  TYR C CB    1 
ATOM   6968  C  CG    . TYR C  2  435  ? 48.856  -32.500 85.493  1.00 52.19  ? 435  TYR C CG    1 
ATOM   6969  C  CD1   . TYR C  2  435  ? 47.803  -31.952 86.206  1.00 53.28  ? 435  TYR C CD1   1 
ATOM   6970  C  CD2   . TYR C  2  435  ? 49.703  -33.383 86.149  1.00 52.52  ? 435  TYR C CD2   1 
ATOM   6971  C  CE1   . TYR C  2  435  ? 47.596  -32.270 87.530  1.00 52.39  ? 435  TYR C CE1   1 
ATOM   6972  C  CE2   . TYR C  2  435  ? 49.506  -33.705 87.472  1.00 50.83  ? 435  TYR C CE2   1 
ATOM   6973  C  CZ    . TYR C  2  435  ? 48.449  -33.146 88.159  1.00 54.21  ? 435  TYR C CZ    1 
ATOM   6974  O  OH    . TYR C  2  435  ? 48.237  -33.462 89.481  1.00 56.95  ? 435  TYR C OH    1 
ATOM   6975  N  N     . GLY C  2  436  ? 52.109  -30.803 85.048  1.00 51.65  ? 436  GLY C N     1 
ATOM   6976  C  CA    . GLY C  2  436  ? 53.444  -31.212 85.440  1.00 52.04  ? 436  GLY C CA    1 
ATOM   6977  C  C     . GLY C  2  436  ? 54.512  -30.896 84.417  1.00 47.90  ? 436  GLY C C     1 
ATOM   6978  O  O     . GLY C  2  436  ? 55.663  -31.297 84.579  1.00 46.91  ? 436  GLY C O     1 
ATOM   6979  N  N     . ARG C  2  437  ? 54.128  -30.169 83.371  1.00 50.41  ? 437  ARG C N     1 
ATOM   6980  C  CA    . ARG C  2  437  ? 55.040  -29.819 82.292  1.00 44.84  ? 437  ARG C CA    1 
ATOM   6981  C  C     . ARG C  2  437  ? 55.168  -28.312 82.116  1.00 51.13  ? 437  ARG C C     1 
ATOM   6982  O  O     . ARG C  2  437  ? 56.261  -27.757 82.217  1.00 57.59  ? 437  ARG C O     1 
ATOM   6983  C  CB    . ARG C  2  437  ? 54.578  -30.468 80.995  1.00 42.24  ? 437  ARG C CB    1 
ATOM   6984  C  CG    . ARG C  2  437  ? 54.617  -31.966 81.059  1.00 43.72  ? 437  ARG C CG    1 
ATOM   6985  C  CD    . ARG C  2  437  ? 54.132  -32.603 79.790  1.00 45.84  ? 437  ARG C CD    1 
ATOM   6986  N  NE    . ARG C  2  437  ? 54.168  -34.054 79.912  1.00 47.23  ? 437  ARG C NE    1 
ATOM   6987  C  CZ    . ARG C  2  437  ? 53.251  -34.767 80.552  1.00 47.31  ? 437  ARG C CZ    1 
ATOM   6988  N  NH1   . ARG C  2  437  ? 52.226  -34.160 81.123  1.00 56.77  ? 437  ARG C NH1   1 
ATOM   6989  N  NH2   . ARG C  2  437  ? 53.357  -36.084 80.623  1.00 49.08  ? 437  ARG C NH2   1 
ATOM   6990  N  N     . ILE C  2  438  ? 54.050  -27.651 81.836  1.00 49.70  ? 438  ILE C N     1 
ATOM   6991  C  CA    . ILE C  2  438  ? 54.030  -26.198 81.762  1.00 47.66  ? 438  ILE C CA    1 
ATOM   6992  C  C     . ILE C  2  438  ? 53.107  -25.650 82.843  1.00 46.38  ? 438  ILE C C     1 
ATOM   6993  O  O     . ILE C  2  438  ? 52.055  -26.217 83.105  1.00 48.20  ? 438  ILE C O     1 
ATOM   6994  C  CB    . ILE C  2  438  ? 53.565  -25.716 80.389  1.00 44.34  ? 438  ILE C CB    1 
ATOM   6995  C  CG1   . ILE C  2  438  ? 54.410  -26.363 79.298  1.00 46.91  ? 438  ILE C CG1   1 
ATOM   6996  C  CG2   . ILE C  2  438  ? 53.671  -24.206 80.295  1.00 51.62  ? 438  ILE C CG2   1 
ATOM   6997  C  CD1   . ILE C  2  438  ? 54.038  -25.919 77.901  1.00 48.85  ? 438  ILE C CD1   1 
ATOM   6998  N  N     . CYS C  2  439  ? 53.507  -24.551 83.472  1.00 44.78  ? 439  CYS C N     1 
ATOM   6999  C  CA    . CYS C  2  439  ? 52.729  -23.965 84.560  1.00 42.37  ? 439  CYS C CA    1 
ATOM   7000  C  C     . CYS C  2  439  ? 51.430  -23.327 84.075  1.00 43.66  ? 439  CYS C C     1 
ATOM   7001  O  O     . CYS C  2  439  ? 51.443  -22.543 83.132  1.00 54.18  ? 439  CYS C O     1 
ATOM   7002  C  CB    . CYS C  2  439  ? 53.563  -22.926 85.300  1.00 46.06  ? 439  CYS C CB    1 
ATOM   7003  S  SG    . CYS C  2  439  ? 52.681  -22.125 86.640  1.00 50.92  ? 439  CYS C SG    1 
ATOM   7004  N  N     . PRO C  2  440  ? 50.306  -23.659 84.730  1.00 46.78  ? 440  PRO C N     1 
ATOM   7005  C  CA    . PRO C  2  440  ? 48.981  -23.138 84.376  1.00 44.15  ? 440  PRO C CA    1 
ATOM   7006  C  C     . PRO C  2  440  ? 48.841  -21.692 84.820  1.00 46.02  ? 440  PRO C C     1 
ATOM   7007  O  O     . PRO C  2  440  ? 48.144  -20.905 84.186  1.00 51.61  ? 440  PRO C O     1 
ATOM   7008  C  CB    . PRO C  2  440  ? 48.016  -24.007 85.200  1.00 47.62  ? 440  PRO C CB    1 
ATOM   7009  C  CG    . PRO C  2  440  ? 48.849  -25.088 85.834  1.00 51.56  ? 440  PRO C CG    1 
ATOM   7010  C  CD    . PRO C  2  440  ? 50.249  -24.563 85.891  1.00 54.20  ? 440  PRO C CD    1 
ATOM   7011  N  N     . VAL C  2  441  ? 49.501  -21.351 85.918  1.00 49.63  ? 441  VAL C N     1 
ATOM   7012  C  CA    . VAL C  2  441  ? 49.379  -20.024 86.499  1.00 47.81  ? 441  VAL C CA    1 
ATOM   7013  C  C     . VAL C  2  441  ? 50.234  -18.982 85.783  1.00 44.93  ? 441  VAL C C     1 
ATOM   7014  O  O     . VAL C  2  441  ? 49.733  -17.950 85.355  1.00 43.54  ? 441  VAL C O     1 
ATOM   7015  C  CB    . VAL C  2  441  ? 49.759  -20.036 87.995  1.00 42.27  ? 441  VAL C CB    1 
ATOM   7016  C  CG1   . VAL C  2  441  ? 49.918  -18.618 88.514  1.00 40.51  ? 441  VAL C CG1   1 
ATOM   7017  C  CG2   . VAL C  2  441  ? 48.709  -20.787 88.797  1.00 46.23  ? 441  VAL C CG2   1 
ATOM   7018  N  N     . GLU C  2  442  ? 51.523  -19.263 85.642  1.00 45.31  ? 442  GLU C N     1 
ATOM   7019  C  CA    . GLU C  2  442  ? 52.473  -18.231 85.248  1.00 44.32  ? 442  GLU C CA    1 
ATOM   7020  C  C     . GLU C  2  442  ? 52.504  -17.959 83.755  1.00 50.28  ? 442  GLU C C     1 
ATOM   7021  O  O     . GLU C  2  442  ? 53.102  -18.711 82.985  1.00 56.55  ? 442  GLU C O     1 
ATOM   7022  C  CB    . GLU C  2  442  ? 53.882  -18.553 85.743  1.00 47.92  ? 442  GLU C CB    1 
ATOM   7023  C  CG    . GLU C  2  442  ? 54.832  -17.386 85.553  1.00 57.35  ? 442  GLU C CG    1 
ATOM   7024  C  CD    . GLU C  2  442  ? 56.271  -17.708 85.894  1.00 61.28  ? 442  GLU C CD    1 
ATOM   7025  O  OE1   . GLU C  2  442  ? 56.568  -18.853 86.300  1.00 60.60  ? 442  GLU C OE1   1 
ATOM   7026  O  OE2   . GLU C  2  442  ? 57.111  -16.800 85.752  1.00 57.81  ? 442  GLU C OE2   1 
ATOM   7027  N  N     . THR C  2  443  ? 51.872  -16.861 83.365  1.00 49.08  ? 443  THR C N     1 
ATOM   7028  C  CA    . THR C  2  443  ? 51.843  -16.426 81.979  1.00 48.01  ? 443  THR C CA    1 
ATOM   7029  C  C     . THR C  2  443  ? 51.708  -14.915 82.007  1.00 49.26  ? 443  THR C C     1 
ATOM   7030  O  O     . THR C  2  443  ? 51.238  -14.363 82.994  1.00 46.95  ? 443  THR C O     1 
ATOM   7031  C  CB    . THR C  2  443  ? 50.666  -17.067 81.208  1.00 43.82  ? 443  THR C CB    1 
ATOM   7032  O  OG1   . THR C  2  443  ? 50.685  -16.640 79.844  1.00 46.75  ? 443  THR C OG1   1 
ATOM   7033  C  CG2   . THR C  2  443  ? 49.342  -16.677 81.826  1.00 51.04  ? 443  THR C CG2   1 
ATOM   7034  N  N     . PRO C  2  444  ? 52.147  -14.233 80.939  1.00 52.27  ? 444  PRO C N     1 
ATOM   7035  C  CA    . PRO C  2  444  ? 52.023  -12.775 80.919  1.00 47.45  ? 444  PRO C CA    1 
ATOM   7036  C  C     . PRO C  2  444  ? 50.574  -12.361 81.011  1.00 50.85  ? 444  PRO C C     1 
ATOM   7037  O  O     . PRO C  2  444  ? 49.672  -13.114 80.647  1.00 53.68  ? 444  PRO C O     1 
ATOM   7038  C  CB    . PRO C  2  444  ? 52.568  -12.393 79.546  1.00 46.90  ? 444  PRO C CB    1 
ATOM   7039  C  CG    . PRO C  2  444  ? 53.474  -13.496 79.183  1.00 51.06  ? 444  PRO C CG    1 
ATOM   7040  C  CD    . PRO C  2  444  ? 52.862  -14.737 79.757  1.00 51.91  ? 444  PRO C CD    1 
ATOM   7041  N  N     . GLU C  2  445  ? 50.362  -11.154 81.508  1.00 58.46  ? 445  GLU C N     1 
ATOM   7042  C  CA    . GLU C  2  445  ? 49.037  -10.582 81.618  1.00 55.21  ? 445  GLU C CA    1 
ATOM   7043  C  C     . GLU C  2  445  ? 48.860  -9.703  80.385  1.00 58.62  ? 445  GLU C C     1 
ATOM   7044  O  O     . GLU C  2  445  ? 49.727  -8.880  80.065  1.00 60.06  ? 445  GLU C O     1 
ATOM   7045  C  CB    . GLU C  2  445  ? 48.976  -9.757  82.901  1.00 52.86  ? 445  GLU C CB    1 
ATOM   7046  C  CG    . GLU C  2  445  ? 47.624  -9.234  83.307  1.00 64.58  ? 445  GLU C CG    1 
ATOM   7047  C  CD    . GLU C  2  445  ? 47.701  -8.476  84.619  1.00 74.09  ? 445  GLU C CD    1 
ATOM   7048  O  OE1   . GLU C  2  445  ? 46.744  -7.749  84.955  1.00 74.57  ? 445  GLU C OE1   1 
ATOM   7049  O  OE2   . GLU C  2  445  ? 48.732  -8.608  85.314  1.00 70.44  ? 445  GLU C OE2   1 
ATOM   7050  N  N     . GLY C  2  446  ? 47.764  -9.891  79.664  1.00 51.21  ? 446  GLY C N     1 
ATOM   7051  C  CA    . GLY C  2  446  ? 47.521  -9.068  78.496  1.00 49.70  ? 446  GLY C CA    1 
ATOM   7052  C  C     . GLY C  2  446  ? 47.797  -9.764  77.182  1.00 51.18  ? 446  GLY C C     1 
ATOM   7053  O  O     . GLY C  2  446  ? 47.606  -10.973 77.053  1.00 52.37  ? 446  GLY C O     1 
ATOM   7054  N  N     . ALA C  2  447  ? 48.246  -8.992  76.200  1.00 50.52  ? 447  ALA C N     1 
ATOM   7055  C  CA    . ALA C  2  447  ? 48.317  -9.459  74.820  1.00 45.88  ? 447  ALA C CA    1 
ATOM   7056  C  C     . ALA C  2  447  ? 49.066  -10.781 74.598  1.00 51.98  ? 447  ALA C C     1 
ATOM   7057  O  O     . ALA C  2  447  ? 48.760  -11.518 73.663  1.00 49.80  ? 447  ALA C O     1 
ATOM   7058  C  CB    . ALA C  2  447  ? 48.888  -8.371  73.939  1.00 50.74  ? 447  ALA C CB    1 
ATOM   7059  N  N     . ASN C  2  448  ? 50.048  -11.078 75.442  1.00 54.47  ? 448  ASN C N     1 
ATOM   7060  C  CA    . ASN C  2  448  ? 50.846  -12.286 75.256  1.00 52.55  ? 448  ASN C CA    1 
ATOM   7061  C  C     . ASN C  2  448  ? 50.324  -13.484 76.035  1.00 54.14  ? 448  ASN C C     1 
ATOM   7062  O  O     . ASN C  2  448  ? 50.931  -14.553 76.027  1.00 55.54  ? 448  ASN C O     1 
ATOM   7063  C  CB    . ASN C  2  448  ? 52.307  -12.031 75.626  1.00 56.39  ? 448  ASN C CB    1 
ATOM   7064  C  CG    . ASN C  2  448  ? 53.024  -11.163 74.611  1.00 62.50  ? 448  ASN C CG    1 
ATOM   7065  O  OD1   . ASN C  2  448  ? 52.747  -11.228 73.409  1.00 65.28  ? 448  ASN C OD1   1 
ATOM   7066  N  ND2   . ASN C  2  448  ? 53.952  -10.342 75.091  1.00 64.22  ? 448  ASN C ND2   1 
ATOM   7067  N  N     . ILE C  2  449  ? 49.200  -13.307 76.713  1.00 51.86  ? 449  ILE C N     1 
ATOM   7068  C  CA    . ILE C  2  449  ? 48.665  -14.367 77.545  1.00 48.78  ? 449  ILE C CA    1 
ATOM   7069  C  C     . ILE C  2  449  ? 48.548  -15.668 76.754  1.00 52.76  ? 449  ILE C C     1 
ATOM   7070  O  O     . ILE C  2  449  ? 47.945  -15.708 75.676  1.00 54.04  ? 449  ILE C O     1 
ATOM   7071  C  CB    . ILE C  2  449  ? 47.304  -13.976 78.163  1.00 50.02  ? 449  ILE C CB    1 
ATOM   7072  C  CG1   . ILE C  2  449  ? 46.837  -15.055 79.145  1.00 45.17  ? 449  ILE C CG1   1 
ATOM   7073  C  CG2   . ILE C  2  449  ? 46.271  -13.722 77.069  1.00 46.58  ? 449  ILE C CG2   1 
ATOM   7074  C  CD1   . ILE C  2  449  ? 46.057  -14.520 80.314  1.00 40.22  ? 449  ILE C CD1   1 
ATOM   7075  N  N     . GLY C  2  450  ? 49.154  -16.725 77.288  1.00 51.93  ? 450  GLY C N     1 
ATOM   7076  C  CA    . GLY C  2  450  ? 49.079  -18.038 76.679  1.00 54.94  ? 450  GLY C CA    1 
ATOM   7077  C  C     . GLY C  2  450  ? 50.237  -18.354 75.752  1.00 54.36  ? 450  GLY C C     1 
ATOM   7078  O  O     . GLY C  2  450  ? 50.467  -19.516 75.417  1.00 57.67  ? 450  GLY C O     1 
ATOM   7079  N  N     . LEU C  2  451  ? 50.966  -17.324 75.332  1.00 53.67  ? 451  LEU C N     1 
ATOM   7080  C  CA    . LEU C  2  451  ? 52.103  -17.511 74.425  1.00 55.92  ? 451  LEU C CA    1 
ATOM   7081  C  C     . LEU C  2  451  ? 53.408  -17.747 75.191  1.00 54.37  ? 451  LEU C C     1 
ATOM   7082  O  O     . LEU C  2  451  ? 54.019  -18.810 75.070  1.00 52.82  ? 451  LEU C O     1 
ATOM   7083  C  CB    . LEU C  2  451  ? 52.243  -16.319 73.479  1.00 52.94  ? 451  LEU C CB    1 
ATOM   7084  C  CG    . LEU C  2  451  ? 50.958  -15.870 72.781  1.00 52.55  ? 451  LEU C CG    1 
ATOM   7085  C  CD1   . LEU C  2  451  ? 51.237  -14.645 71.930  1.00 52.42  ? 451  LEU C CD1   1 
ATOM   7086  C  CD2   . LEU C  2  451  ? 50.346  -16.992 71.942  1.00 47.99  ? 451  LEU C CD2   1 
ATOM   7087  N  N     . ILE C  2  452  ? 53.833  -16.756 75.970  1.00 49.34  ? 452  ILE C N     1 
ATOM   7088  C  CA    . ILE C  2  452  ? 54.941  -16.938 76.900  1.00 48.09  ? 452  ILE C CA    1 
ATOM   7089  C  C     . ILE C  2  452  ? 54.469  -17.778 78.075  1.00 47.39  ? 452  ILE C C     1 
ATOM   7090  O  O     . ILE C  2  452  ? 53.373  -17.573 78.584  1.00 51.72  ? 452  ILE C O     1 
ATOM   7091  C  CB    . ILE C  2  452  ? 55.433  -15.606 77.469  1.00 51.47  ? 452  ILE C CB    1 
ATOM   7092  C  CG1   . ILE C  2  452  ? 55.507  -14.541 76.374  1.00 50.81  ? 452  ILE C CG1   1 
ATOM   7093  C  CG2   . ILE C  2  452  ? 56.765  -15.793 78.170  1.00 47.98  ? 452  ILE C CG2   1 
ATOM   7094  C  CD1   . ILE C  2  452  ? 56.420  -14.894 75.265  1.00 39.49  ? 452  ILE C CD1   1 
ATOM   7095  N  N     . THR C  2  453  ? 55.291  -18.726 78.502  1.00 48.00  ? 453  THR C N     1 
ATOM   7096  C  CA    . THR C  2  453  ? 54.952  -19.572 79.642  1.00 51.54  ? 453  THR C CA    1 
ATOM   7097  C  C     . THR C  2  453  ? 56.212  -20.079 80.320  1.00 50.31  ? 453  THR C C     1 
ATOM   7098  O  O     . THR C  2  453  ? 57.306  -19.917 79.801  1.00 49.02  ? 453  THR C O     1 
ATOM   7099  C  CB    . THR C  2  453  ? 54.043  -20.768 79.254  1.00 52.56  ? 453  THR C CB    1 
ATOM   7100  O  OG1   . THR C  2  453  ? 54.470  -21.326 78.004  1.00 52.08  ? 453  THR C OG1   1 
ATOM   7101  C  CG2   . THR C  2  453  ? 52.587  -20.330 79.135  1.00 54.98  ? 453  THR C CG2   1 
ATOM   7102  N  N     . SER C  2  454  ? 56.055  -20.679 81.492  1.00 52.67  ? 454  SER C N     1 
ATOM   7103  C  CA    . SER C  2  454  ? 57.200  -21.174 82.239  1.00 48.39  ? 454  SER C CA    1 
ATOM   7104  C  C     . SER C  2  454  ? 57.146  -22.688 82.413  1.00 47.47  ? 454  SER C C     1 
ATOM   7105  O  O     . SER C  2  454  ? 56.072  -23.283 82.492  1.00 49.20  ? 454  SER C O     1 
ATOM   7106  C  CB    . SER C  2  454  ? 57.312  -20.473 83.597  1.00 55.28  ? 454  SER C CB    1 
ATOM   7107  O  OG    . SER C  2  454  ? 58.459  -19.637 83.646  1.00 55.09  ? 454  SER C OG    1 
ATOM   7108  N  N     . LEU C  2  455  ? 58.324  -23.299 82.454  1.00 46.95  ? 455  LEU C N     1 
ATOM   7109  C  CA    . LEU C  2  455  ? 58.465  -24.732 82.656  1.00 44.35  ? 455  LEU C CA    1 
ATOM   7110  C  C     . LEU C  2  455  ? 58.127  -25.106 84.095  1.00 45.04  ? 455  LEU C C     1 
ATOM   7111  O  O     . LEU C  2  455  ? 58.520  -24.413 85.033  1.00 47.96  ? 455  LEU C O     1 
ATOM   7112  C  CB    . LEU C  2  455  ? 59.902  -25.139 82.349  1.00 47.50  ? 455  LEU C CB    1 
ATOM   7113  C  CG    . LEU C  2  455  ? 60.268  -26.618 82.400  1.00 49.66  ? 455  LEU C CG    1 
ATOM   7114  C  CD1   . LEU C  2  455  ? 59.623  -27.363 81.248  1.00 45.48  ? 455  LEU C CD1   1 
ATOM   7115  C  CD2   . LEU C  2  455  ? 61.774  -26.769 82.369  1.00 40.08  ? 455  LEU C CD2   1 
ATOM   7116  N  N     . ALA C  2  456  ? 57.396  -26.200 84.270  1.00 41.45  ? 456  ALA C N     1 
ATOM   7117  C  CA    . ALA C  2  456  ? 57.075  -26.676 85.607  1.00 43.33  ? 456  ALA C CA    1 
ATOM   7118  C  C     . ALA C  2  456  ? 58.359  -27.011 86.356  1.00 51.12  ? 456  ALA C C     1 
ATOM   7119  O  O     . ALA C  2  456  ? 59.413  -27.203 85.744  1.00 54.70  ? 456  ALA C O     1 
ATOM   7120  C  CB    . ALA C  2  456  ? 56.168  -27.884 85.536  1.00 47.53  ? 456  ALA C CB    1 
ATOM   7121  N  N     . ALA C  2  457  ? 58.268  -27.084 87.680  1.00 46.79  ? 457  ALA C N     1 
ATOM   7122  C  CA    . ALA C  2  457  ? 59.445  -27.282 88.520  1.00 47.85  ? 457  ALA C CA    1 
ATOM   7123  C  C     . ALA C  2  457  ? 60.154  -28.612 88.265  1.00 51.68  ? 457  ALA C C     1 
ATOM   7124  O  O     . ALA C  2  457  ? 61.358  -28.645 88.019  1.00 58.17  ? 457  ALA C O     1 
ATOM   7125  C  CB    . ALA C  2  457  ? 59.073  -27.145 89.983  1.00 50.87  ? 457  ALA C CB    1 
ATOM   7126  N  N     . TYR C  2  458  ? 59.401  -29.705 88.321  1.00 53.35  ? 458  TYR C N     1 
ATOM   7127  C  CA    . TYR C  2  458  ? 59.977  -31.038 88.165  1.00 52.99  ? 458  TYR C CA    1 
ATOM   7128  C  C     . TYR C  2  458  ? 60.108  -31.478 86.710  1.00 55.95  ? 458  TYR C C     1 
ATOM   7129  O  O     . TYR C  2  458  ? 60.507  -32.610 86.444  1.00 56.85  ? 458  TYR C O     1 
ATOM   7130  C  CB    . TYR C  2  458  ? 59.138  -32.075 88.912  1.00 57.10  ? 458  TYR C CB    1 
ATOM   7131  C  CG    . TYR C  2  458  ? 59.499  -32.266 90.367  1.00 55.55  ? 458  TYR C CG    1 
ATOM   7132  C  CD1   . TYR C  2  458  ? 58.727  -31.707 91.378  1.00 53.57  ? 458  TYR C CD1   1 
ATOM   7133  C  CD2   . TYR C  2  458  ? 60.603  -33.021 90.730  1.00 57.36  ? 458  TYR C CD2   1 
ATOM   7134  C  CE1   . TYR C  2  458  ? 59.049  -31.889 92.703  1.00 53.30  ? 458  TYR C CE1   1 
ATOM   7135  C  CE2   . TYR C  2  458  ? 60.936  -33.207 92.055  1.00 55.75  ? 458  TYR C CE2   1 
ATOM   7136  C  CZ    . TYR C  2  458  ? 60.156  -32.640 93.039  1.00 57.12  ? 458  TYR C CZ    1 
ATOM   7137  O  OH    . TYR C  2  458  ? 60.486  -32.822 94.364  1.00 61.07  ? 458  TYR C OH    1 
ATOM   7138  N  N     . ALA C  2  459  ? 59.775  -30.595 85.772  1.00 54.45  ? 459  ALA C N     1 
ATOM   7139  C  CA    . ALA C  2  459  ? 59.748  -30.967 84.358  1.00 51.05  ? 459  ALA C CA    1 
ATOM   7140  C  C     . ALA C  2  459  ? 61.119  -30.927 83.682  1.00 52.09  ? 459  ALA C C     1 
ATOM   7141  O  O     . ALA C  2  459  ? 61.967  -30.094 84.016  1.00 55.06  ? 459  ALA C O     1 
ATOM   7142  C  CB    . ALA C  2  459  ? 58.760  -30.099 83.603  1.00 50.72  ? 459  ALA C CB    1 
ATOM   7143  N  N     . ARG C  2  460  ? 61.321  -31.842 82.733  1.00 51.87  ? 460  ARG C N     1 
ATOM   7144  C  CA    . ARG C  2  460  ? 62.541  -31.896 81.934  1.00 54.27  ? 460  ARG C CA    1 
ATOM   7145  C  C     . ARG C  2  460  ? 62.207  -31.982 80.450  1.00 54.02  ? 460  ARG C C     1 
ATOM   7146  O  O     . ARG C  2  460  ? 61.280  -32.689 80.052  1.00 50.55  ? 460  ARG C O     1 
ATOM   7147  C  CB    . ARG C  2  460  ? 63.388  -33.114 82.295  1.00 55.24  ? 460  ARG C CB    1 
ATOM   7148  C  CG    . ARG C  2  460  ? 63.480  -33.434 83.768  1.00 63.43  ? 460  ARG C CG    1 
ATOM   7149  C  CD    . ARG C  2  460  ? 64.285  -34.712 83.974  1.00 74.53  ? 460  ARG C CD    1 
ATOM   7150  N  NE    . ARG C  2  460  ? 65.710  -34.500 83.746  1.00 75.71  ? 460  ARG C NE    1 
ATOM   7151  C  CZ    . ARG C  2  460  ? 66.592  -34.283 84.717  1.00 79.65  ? 460  ARG C CZ    1 
ATOM   7152  N  NH1   . ARG C  2  460  ? 66.196  -34.262 85.983  1.00 67.86  ? 460  ARG C NH1   1 
ATOM   7153  N  NH2   . ARG C  2  460  ? 67.871  -34.092 84.424  1.00 84.94  ? 460  ARG C NH2   1 
ATOM   7154  N  N     . VAL C  2  461  ? 62.973  -31.265 79.634  1.00 51.44  ? 461  VAL C N     1 
ATOM   7155  C  CA    . VAL C  2  461  ? 62.861  -31.385 78.191  1.00 51.71  ? 461  VAL C CA    1 
ATOM   7156  C  C     . VAL C  2  461  ? 63.799  -32.491 77.733  1.00 54.55  ? 461  VAL C C     1 
ATOM   7157  O  O     . VAL C  2  461  ? 64.998  -32.427 77.988  1.00 59.73  ? 461  VAL C O     1 
ATOM   7158  C  CB    . VAL C  2  461  ? 63.263  -30.078 77.495  1.00 54.14  ? 461  VAL C CB    1 
ATOM   7159  C  CG1   . VAL C  2  461  ? 63.164  -30.225 75.985  1.00 52.47  ? 461  VAL C CG1   1 
ATOM   7160  C  CG2   . VAL C  2  461  ? 62.400  -28.928 77.983  1.00 50.79  ? 461  VAL C CG2   1 
ATOM   7161  N  N     . ASP C  2  462  ? 63.260  -33.506 77.063  1.00 52.59  ? 462  ASP C N     1 
ATOM   7162  C  CA    . ASP C  2  462  ? 64.075  -34.642 76.636  1.00 58.40  ? 462  ASP C CA    1 
ATOM   7163  C  C     . ASP C  2  462  ? 64.834  -34.407 75.319  1.00 61.00  ? 462  ASP C C     1 
ATOM   7164  O  O     . ASP C  2  462  ? 64.834  -33.301 74.777  1.00 55.04  ? 462  ASP C O     1 
ATOM   7165  C  CB    . ASP C  2  462  ? 63.234  -35.922 76.570  1.00 57.59  ? 462  ASP C CB    1 
ATOM   7166  C  CG    . ASP C  2  462  ? 62.253  -35.923 75.417  1.00 62.26  ? 462  ASP C CG    1 
ATOM   7167  O  OD1   . ASP C  2  462  ? 62.537  -35.268 74.393  1.00 64.19  ? 462  ASP C OD1   1 
ATOM   7168  O  OD2   . ASP C  2  462  ? 61.203  -36.594 75.527  1.00 61.16  ? 462  ASP C OD2   1 
ATOM   7169  N  N     . GLU C  2  463  ? 65.478  -35.460 74.819  1.00 64.64  ? 463  GLU C N     1 
ATOM   7170  C  CA    . GLU C  2  463  ? 66.320  -35.370 73.628  1.00 67.16  ? 463  GLU C CA    1 
ATOM   7171  C  C     . GLU C  2  463  ? 65.539  -34.922 72.398  1.00 67.59  ? 463  GLU C C     1 
ATOM   7172  O  O     . GLU C  2  463  ? 66.055  -34.176 71.557  1.00 64.31  ? 463  GLU C O     1 
ATOM   7173  C  CB    . GLU C  2  463  ? 66.997  -36.713 73.340  1.00 68.37  ? 463  GLU C CB    1 
ATOM   7174  C  CG    . GLU C  2  463  ? 67.916  -37.213 74.445  1.00 83.69  ? 463  GLU C CG    1 
ATOM   7175  C  CD    . GLU C  2  463  ? 67.166  -37.910 75.566  1.00 97.19  ? 463  GLU C CD    1 
ATOM   7176  O  OE1   . GLU C  2  463  ? 65.913  -37.914 75.542  1.00 87.97  ? 463  GLU C OE1   1 
ATOM   7177  O  OE2   . GLU C  2  463  ? 67.834  -38.460 76.470  1.00 98.68  ? 463  GLU C OE2   1 
ATOM   7178  N  N     . LEU C  2  464  ? 64.296  -35.385 72.301  1.00 60.46  ? 464  LEU C N     1 
ATOM   7179  C  CA    . LEU C  2  464  ? 63.441  -35.064 71.164  1.00 58.29  ? 464  LEU C CA    1 
ATOM   7180  C  C     . LEU C  2  464  ? 62.788  -33.696 71.310  1.00 56.75  ? 464  LEU C C     1 
ATOM   7181  O  O     . LEU C  2  464  ? 62.208  -33.171 70.362  1.00 53.40  ? 464  LEU C O     1 
ATOM   7182  C  CB    . LEU C  2  464  ? 62.370  -36.139 70.970  1.00 60.48  ? 464  LEU C CB    1 
ATOM   7183  C  CG    . LEU C  2  464  ? 62.841  -37.511 70.480  1.00 58.80  ? 464  LEU C CG    1 
ATOM   7184  C  CD1   . LEU C  2  464  ? 63.731  -37.373 69.250  1.00 53.76  ? 464  LEU C CD1   1 
ATOM   7185  C  CD2   . LEU C  2  464  ? 63.555  -38.272 71.591  1.00 74.86  ? 464  LEU C CD2   1 
ATOM   7186  N  N     . GLY C  2  465  ? 62.885  -33.123 72.503  1.00 59.87  ? 465  GLY C N     1 
ATOM   7187  C  CA    . GLY C  2  465  ? 62.335  -31.804 72.757  1.00 58.84  ? 465  GLY C CA    1 
ATOM   7188  C  C     . GLY C  2  465  ? 60.932  -31.825 73.329  1.00 48.76  ? 465  GLY C C     1 
ATOM   7189  O  O     . GLY C  2  465  ? 60.256  -30.800 73.370  1.00 48.38  ? 465  GLY C O     1 
ATOM   7190  N  N     . PHE C  2  466  ? 60.492  -33.001 73.760  1.00 51.74  ? 466  PHE C N     1 
ATOM   7191  C  CA    . PHE C  2  466  ? 59.206  -33.147 74.430  1.00 51.91  ? 466  PHE C CA    1 
ATOM   7192  C  C     . PHE C  2  466  ? 59.382  -32.962 75.930  1.00 51.99  ? 466  PHE C C     1 
ATOM   7193  O  O     . PHE C  2  466  ? 60.366  -33.422 76.507  1.00 57.32  ? 466  PHE C O     1 
ATOM   7194  C  CB    . PHE C  2  466  ? 58.608  -34.521 74.141  1.00 52.40  ? 466  PHE C CB    1 
ATOM   7195  C  CG    . PHE C  2  466  ? 58.287  -34.751 72.695  1.00 58.74  ? 466  PHE C CG    1 
ATOM   7196  C  CD1   . PHE C  2  466  ? 58.291  -36.028 72.167  1.00 65.55  ? 466  PHE C CD1   1 
ATOM   7197  C  CD2   . PHE C  2  466  ? 57.976  -33.692 71.864  1.00 61.06  ? 466  PHE C CD2   1 
ATOM   7198  C  CE1   . PHE C  2  466  ? 57.994  -36.243 70.838  1.00 63.38  ? 466  PHE C CE1   1 
ATOM   7199  C  CE2   . PHE C  2  466  ? 57.677  -33.901 70.535  1.00 59.15  ? 466  PHE C CE2   1 
ATOM   7200  C  CZ    . PHE C  2  466  ? 57.688  -35.179 70.021  1.00 59.54  ? 466  PHE C CZ    1 
ATOM   7201  N  N     . ILE C  2  467  ? 58.435  -32.284 76.565  1.00 52.22  ? 467  ILE C N     1 
ATOM   7202  C  CA    . ILE C  2  467  ? 58.545  -32.013 77.994  1.00 52.08  ? 467  ILE C CA    1 
ATOM   7203  C  C     . ILE C  2  467  ? 58.019  -33.188 78.807  1.00 49.30  ? 467  ILE C C     1 
ATOM   7204  O  O     . ILE C  2  467  ? 56.873  -33.606 78.640  1.00 48.67  ? 467  ILE C O     1 
ATOM   7205  C  CB    . ILE C  2  467  ? 57.806  -30.721 78.393  1.00 47.16  ? 467  ILE C CB    1 
ATOM   7206  C  CG1   . ILE C  2  467  ? 58.262  -29.558 77.516  1.00 43.54  ? 467  ILE C CG1   1 
ATOM   7207  C  CG2   . ILE C  2  467  ? 58.070  -30.386 79.839  1.00 53.08  ? 467  ILE C CG2   1 
ATOM   7208  C  CD1   . ILE C  2  467  ? 57.618  -28.262 77.880  1.00 41.46  ? 467  ILE C CD1   1 
ATOM   7209  N  N     . ARG C  2  468  ? 58.866  -33.722 79.679  1.00 49.81  ? 468  ARG C N     1 
ATOM   7210  C  CA    . ARG C  2  468  ? 58.507  -34.889 80.467  1.00 46.91  ? 468  ARG C CA    1 
ATOM   7211  C  C     . ARG C  2  468  ? 58.334  -34.517 81.932  1.00 49.11  ? 468  ARG C C     1 
ATOM   7212  O  O     . ARG C  2  468  ? 58.991  -33.606 82.433  1.00 47.14  ? 468  ARG C O     1 
ATOM   7213  C  CB    . ARG C  2  468  ? 59.562  -35.980 80.316  1.00 46.15  ? 468  ARG C CB    1 
ATOM   7214  C  CG    . ARG C  2  468  ? 60.002  -36.207 78.883  1.00 59.65  ? 468  ARG C CG    1 
ATOM   7215  C  CD    . ARG C  2  468  ? 61.052  -37.305 78.789  1.00 66.86  ? 468  ARG C CD    1 
ATOM   7216  N  NE    . ARG C  2  468  ? 60.457  -38.629 78.903  1.00 63.71  ? 468  ARG C NE    1 
ATOM   7217  C  CZ    . ARG C  2  468  ? 60.490  -39.547 77.944  1.00 71.18  ? 468  ARG C CZ    1 
ATOM   7218  N  NH1   . ARG C  2  468  ? 61.107  -39.293 76.797  1.00 59.62  ? 468  ARG C NH1   1 
ATOM   7219  N  NH2   . ARG C  2  468  ? 59.909  -40.725 78.136  1.00 82.58  ? 468  ARG C NH2   1 
ATOM   7220  N  N     . THR C  2  469  ? 57.438  -35.230 82.610  1.00 48.12  ? 469  THR C N     1 
ATOM   7221  C  CA    . THR C  2  469  ? 57.160  -35.010 84.023  1.00 48.00  ? 469  THR C CA    1 
ATOM   7222  C  C     . THR C  2  469  ? 57.298  -36.332 84.760  1.00 51.12  ? 469  THR C C     1 
ATOM   7223  O  O     . THR C  2  469  ? 56.942  -37.376 84.220  1.00 49.91  ? 469  THR C O     1 
ATOM   7224  C  CB    . THR C  2  469  ? 55.731  -34.454 84.233  1.00 52.14  ? 469  THR C CB    1 
ATOM   7225  O  OG1   . THR C  2  469  ? 55.470  -34.284 85.630  1.00 51.13  ? 469  THR C OG1   1 
ATOM   7226  C  CG2   . THR C  2  469  ? 54.697  -35.397 83.648  1.00 55.08  ? 469  THR C CG2   1 
ATOM   7227  N  N     . PRO C  2  470  ? 57.826  -36.293 85.994  1.00 51.73  ? 470  PRO C N     1 
ATOM   7228  C  CA    . PRO C  2  470  ? 58.035  -37.490 86.814  1.00 48.84  ? 470  PRO C CA    1 
ATOM   7229  C  C     . PRO C  2  470  ? 56.748  -38.064 87.388  1.00 53.10  ? 470  PRO C C     1 
ATOM   7230  O  O     . PRO C  2  470  ? 55.812  -37.325 87.668  1.00 58.02  ? 470  PRO C O     1 
ATOM   7231  C  CB    . PRO C  2  470  ? 58.903  -36.971 87.961  1.00 51.27  ? 470  PRO C CB    1 
ATOM   7232  C  CG    . PRO C  2  470  ? 58.543  -35.544 88.074  1.00 53.31  ? 470  PRO C CG    1 
ATOM   7233  C  CD    . PRO C  2  470  ? 58.337  -35.085 86.660  1.00 56.76  ? 470  PRO C CD    1 
ATOM   7234  N  N     . TYR C  2  471  ? 56.712  -39.383 87.545  1.00 57.56  ? 471  TYR C N     1 
ATOM   7235  C  CA    . TYR C  2  471  ? 55.676  -40.054 88.324  1.00 55.22  ? 471  TYR C CA    1 
ATOM   7236  C  C     . TYR C  2  471  ? 56.316  -41.228 89.045  1.00 62.06  ? 471  TYR C C     1 
ATOM   7237  O  O     . TYR C  2  471  ? 57.426  -41.628 88.718  1.00 58.99  ? 471  TYR C O     1 
ATOM   7238  C  CB    . TYR C  2  471  ? 54.543  -40.562 87.440  1.00 53.53  ? 471  TYR C CB    1 
ATOM   7239  C  CG    . TYR C  2  471  ? 53.758  -39.478 86.755  1.00 56.50  ? 471  TYR C CG    1 
ATOM   7240  C  CD1   . TYR C  2  471  ? 53.981  -39.172 85.421  1.00 59.64  ? 471  TYR C CD1   1 
ATOM   7241  C  CD2   . TYR C  2  471  ? 52.788  -38.760 87.438  1.00 59.42  ? 471  TYR C CD2   1 
ATOM   7242  C  CE1   . TYR C  2  471  ? 53.258  -38.177 84.787  1.00 65.19  ? 471  TYR C CE1   1 
ATOM   7243  C  CE2   . TYR C  2  471  ? 52.061  -37.762 86.813  1.00 55.33  ? 471  TYR C CE2   1 
ATOM   7244  C  CZ    . TYR C  2  471  ? 52.301  -37.475 85.490  1.00 59.26  ? 471  TYR C CZ    1 
ATOM   7245  O  OH    . TYR C  2  471  ? 51.579  -36.486 84.869  1.00 59.87  ? 471  TYR C OH    1 
ATOM   7246  N  N     . ARG C  2  472  ? 55.616  -41.773 90.031  1.00 67.41  ? 472  ARG C N     1 
ATOM   7247  C  CA    . ARG C  2  472  ? 56.110  -42.912 90.786  1.00 61.47  ? 472  ARG C CA    1 
ATOM   7248  C  C     . ARG C  2  472  ? 55.355  -44.149 90.360  1.00 64.17  ? 472  ARG C C     1 
ATOM   7249  O  O     . ARG C  2  472  ? 54.141  -44.106 90.193  1.00 66.40  ? 472  ARG C O     1 
ATOM   7250  C  CB    . ARG C  2  472  ? 55.912  -42.687 92.280  1.00 60.66  ? 472  ARG C CB    1 
ATOM   7251  C  CG    . ARG C  2  472  ? 56.787  -41.606 92.866  1.00 68.23  ? 472  ARG C CG    1 
ATOM   7252  C  CD    . ARG C  2  472  ? 57.182  -41.963 94.286  1.00 80.48  ? 472  ARG C CD    1 
ATOM   7253  N  NE    . ARG C  2  472  ? 56.246  -41.450 95.281  1.00 78.90  ? 472  ARG C NE    1 
ATOM   7254  C  CZ    . ARG C  2  472  ? 56.182  -41.892 96.532  1.00 83.88  ? 472  ARG C CZ    1 
ATOM   7255  N  NH1   . ARG C  2  472  ? 56.985  -42.868 96.935  1.00 86.06  ? 472  ARG C NH1   1 
ATOM   7256  N  NH2   . ARG C  2  472  ? 55.308  -41.366 97.377  1.00 90.15  ? 472  ARG C NH2   1 
ATOM   7257  N  N     . ARG C  2  473  ? 56.065  -45.255 90.180  1.00 68.22  ? 473  ARG C N     1 
ATOM   7258  C  CA    . ARG C  2  473  ? 55.402  -46.495 89.809  1.00 70.03  ? 473  ARG C CA    1 
ATOM   7259  C  C     . ARG C  2  473  ? 54.645  -47.069 90.998  1.00 70.48  ? 473  ARG C C     1 
ATOM   7260  O  O     . ARG C  2  473  ? 55.118  -47.028 92.135  1.00 65.70  ? 473  ARG C O     1 
ATOM   7261  C  CB    . ARG C  2  473  ? 56.392  -47.523 89.255  1.00 72.76  ? 473  ARG C CB    1 
ATOM   7262  C  CG    . ARG C  2  473  ? 55.740  -48.832 88.811  1.00 73.90  ? 473  ARG C CG    1 
ATOM   7263  C  CD    . ARG C  2  473  ? 56.124  -49.192 87.387  1.00 73.11  ? 473  ARG C CD    1 
ATOM   7264  N  NE    . ARG C  2  473  ? 57.569  -49.139 87.201  1.00 75.65  ? 473  ARG C NE    1 
ATOM   7265  C  CZ    . ARG C  2  473  ? 58.167  -48.951 86.028  1.00 86.69  ? 473  ARG C CZ    1 
ATOM   7266  N  NH1   . ARG C  2  473  ? 57.440  -48.795 84.928  1.00 82.23  ? 473  ARG C NH1   1 
ATOM   7267  N  NH2   . ARG C  2  473  ? 59.494  -48.912 85.956  1.00 86.15  ? 473  ARG C NH2   1 
ATOM   7268  N  N     . VAL C  2  474  ? 53.455  -47.587 90.724  1.00 71.54  ? 474  VAL C N     1 
ATOM   7269  C  CA    . VAL C  2  474  ? 52.650  -48.248 91.736  1.00 74.47  ? 474  VAL C CA    1 
ATOM   7270  C  C     . VAL C  2  474  ? 52.254  -49.626 91.235  1.00 80.65  ? 474  VAL C C     1 
ATOM   7271  O  O     . VAL C  2  474  ? 51.458  -49.749 90.306  1.00 79.41  ? 474  VAL C O     1 
ATOM   7272  C  CB    . VAL C  2  474  ? 51.378  -47.444 92.052  1.00 67.52  ? 474  VAL C CB    1 
ATOM   7273  C  CG1   . VAL C  2  474  ? 50.471  -48.229 92.972  1.00 70.29  ? 474  VAL C CG1   1 
ATOM   7274  C  CG2   . VAL C  2  474  ? 51.743  -46.110 92.671  1.00 71.72  ? 474  VAL C CG2   1 
ATOM   7275  N  N     . VAL C  2  475  ? 52.826  -50.663 91.835  1.00 88.21  ? 475  VAL C N     1 
ATOM   7276  C  CA    . VAL C  2  475  ? 52.465  -52.028 91.476  1.00 91.03  ? 475  VAL C CA    1 
ATOM   7277  C  C     . VAL C  2  475  ? 51.809  -52.709 92.667  1.00 86.50  ? 475  VAL C C     1 
ATOM   7278  O  O     . VAL C  2  475  ? 52.346  -52.701 93.776  1.00 79.87  ? 475  VAL C O     1 
ATOM   7279  C  CB    . VAL C  2  475  ? 53.674  -52.844 90.986  1.00 97.32  ? 475  VAL C CB    1 
ATOM   7280  C  CG1   . VAL C  2  475  ? 53.221  -54.217 90.516  1.00 106.80 ? 475  VAL C CG1   1 
ATOM   7281  C  CG2   . VAL C  2  475  ? 54.384  -52.110 89.858  1.00 91.08  ? 475  VAL C CG2   1 
ATOM   7282  N  N     . GLY C  2  476  ? 50.641  -53.294 92.428  1.00 89.54  ? 476  GLY C N     1 
ATOM   7283  C  CA    . GLY C  2  476  ? 49.799  -53.758 93.510  1.00 94.71  ? 476  GLY C CA    1 
ATOM   7284  C  C     . GLY C  2  476  ? 49.235  -52.532 94.191  1.00 89.01  ? 476  GLY C C     1 
ATOM   7285  O  O     . GLY C  2  476  ? 48.670  -51.658 93.535  1.00 90.91  ? 476  GLY C O     1 
ATOM   7286  N  N     . GLY C  2  477  ? 49.396  -52.457 95.504  1.00 85.72  ? 477  GLY C N     1 
ATOM   7287  C  CA    . GLY C  2  477  ? 48.996  -51.274 96.236  1.00 82.34  ? 477  GLY C CA    1 
ATOM   7288  C  C     . GLY C  2  477  ? 50.213  -50.470 96.640  1.00 84.61  ? 477  GLY C C     1 
ATOM   7289  O  O     . GLY C  2  477  ? 50.094  -49.346 97.118  1.00 88.09  ? 477  GLY C O     1 
ATOM   7290  N  N     . VAL C  2  478  ? 51.392  -51.049 96.436  1.00 89.25  ? 478  VAL C N     1 
ATOM   7291  C  CA    . VAL C  2  478  ? 52.636  -50.451 96.914  1.00 85.95  ? 478  VAL C CA    1 
ATOM   7292  C  C     . VAL C  2  478  ? 53.183  -49.371 95.984  1.00 83.08  ? 478  VAL C C     1 
ATOM   7293  O  O     . VAL C  2  478  ? 53.253  -49.552 94.767  1.00 76.91  ? 478  VAL C O     1 
ATOM   7294  C  CB    . VAL C  2  478  ? 53.719  -51.522 97.148  1.00 84.55  ? 478  VAL C CB    1 
ATOM   7295  C  CG1   . VAL C  2  478  ? 55.040  -50.869 97.510  1.00 86.77  ? 478  VAL C CG1   1 
ATOM   7296  C  CG2   . VAL C  2  478  ? 53.282  -52.485 98.240  1.00 91.00  ? 478  VAL C CG2   1 
ATOM   7297  N  N     . VAL C  2  479  ? 53.572  -48.246 96.577  1.00 81.09  ? 479  VAL C N     1 
ATOM   7298  C  CA    . VAL C  2  479  ? 54.163  -47.142 95.837  1.00 76.33  ? 479  VAL C CA    1 
ATOM   7299  C  C     . VAL C  2  479  ? 55.686  -47.200 95.878  1.00 76.53  ? 479  VAL C C     1 
ATOM   7300  O  O     . VAL C  2  479  ? 56.299  -46.954 96.915  1.00 72.50  ? 479  VAL C O     1 
ATOM   7301  C  CB    . VAL C  2  479  ? 53.716  -45.794 96.407  1.00 72.92  ? 479  VAL C CB    1 
ATOM   7302  C  CG1   . VAL C  2  479  ? 54.392  -44.660 95.656  1.00 76.49  ? 479  VAL C CG1   1 
ATOM   7303  C  CG2   . VAL C  2  479  ? 52.212  -45.671 96.331  1.00 70.54  ? 479  VAL C CG2   1 
ATOM   7304  N  N     . THR C  2  480  ? 56.293  -47.521 94.743  1.00 77.34  ? 480  THR C N     1 
ATOM   7305  C  CA    . THR C  2  480  ? 57.744  -47.598 94.653  1.00 81.42  ? 480  THR C CA    1 
ATOM   7306  C  C     . THR C  2  480  ? 58.357  -46.209 94.786  1.00 83.00  ? 480  THR C C     1 
ATOM   7307  O  O     . THR C  2  480  ? 57.665  -45.202 94.636  1.00 80.90  ? 480  THR C O     1 
ATOM   7308  C  CB    . THR C  2  480  ? 58.190  -48.207 93.311  1.00 84.75  ? 480  THR C CB    1 
ATOM   7309  O  OG1   . THR C  2  480  ? 57.400  -49.368 93.022  1.00 86.72  ? 480  THR C OG1   1 
ATOM   7310  C  CG2   . THR C  2  480  ? 59.662  -48.592 93.357  1.00 89.91  ? 480  THR C CG2   1 
ATOM   7311  N  N     . ASP C  2  481  ? 59.651  -46.158 95.083  1.00 83.28  ? 481  ASP C N     1 
ATOM   7312  C  CA    . ASP C  2  481  ? 60.371  -44.894 95.091  1.00 81.62  ? 481  ASP C CA    1 
ATOM   7313  C  C     . ASP C  2  481  ? 61.028  -44.676 93.735  1.00 81.45  ? 481  ASP C C     1 
ATOM   7314  O  O     . ASP C  2  481  ? 61.778  -43.718 93.546  1.00 80.40  ? 481  ASP C O     1 
ATOM   7315  C  CB    . ASP C  2  481  ? 61.423  -44.855 96.205  1.00 88.84  ? 481  ASP C CB    1 
ATOM   7316  C  CG    . ASP C  2  481  ? 60.819  -44.603 97.580  1.00 92.29  ? 481  ASP C CG    1 
ATOM   7317  O  OD1   . ASP C  2  481  ? 59.607  -44.310 97.661  1.00 91.44  ? 481  ASP C OD1   1 
ATOM   7318  O  OD2   . ASP C  2  481  ? 61.562  -44.684 98.582  1.00 95.38  ? 481  ASP C OD2   1 
ATOM   7319  N  N     . GLU C  2  482  ? 60.745  -45.572 92.792  1.00 80.77  ? 482  GLU C N     1 
ATOM   7320  C  CA    . GLU C  2  482  ? 61.272  -45.440 91.437  1.00 81.90  ? 482  GLU C CA    1 
ATOM   7321  C  C     . GLU C  2  482  ? 60.424  -44.475 90.614  1.00 76.77  ? 482  GLU C C     1 
ATOM   7322  O  O     . GLU C  2  482  ? 59.203  -44.624 90.523  1.00 72.08  ? 482  GLU C O     1 
ATOM   7323  C  CB    . GLU C  2  482  ? 61.353  -46.797 90.733  1.00 81.64  ? 482  GLU C CB    1 
ATOM   7324  C  CG    . GLU C  2  482  ? 60.036  -47.285 90.147  1.00 82.34  ? 482  GLU C CG    1 
ATOM   7325  C  CD    . GLU C  2  482  ? 60.224  -48.177 88.924  1.00 87.61  ? 482  GLU C CD    1 
ATOM   7326  O  OE1   . GLU C  2  482  ? 60.964  -47.789 87.988  1.00 74.11  ? 482  GLU C OE1   1 
ATOM   7327  O  OE2   . GLU C  2  482  ? 59.624  -49.272 88.896  1.00 92.81  ? 482  GLU C OE2   1 
ATOM   7328  N  N     . VAL C  2  483  ? 61.081  -43.485 90.017  1.00 73.44  ? 483  VAL C N     1 
ATOM   7329  C  CA    . VAL C  2  483  ? 60.387  -42.459 89.249  1.00 69.08  ? 483  VAL C CA    1 
ATOM   7330  C  C     . VAL C  2  483  ? 60.578  -42.613 87.741  1.00 63.52  ? 483  VAL C C     1 
ATOM   7331  O  O     . VAL C  2  483  ? 61.699  -42.657 87.239  1.00 61.49  ? 483  VAL C O     1 
ATOM   7332  C  CB    . VAL C  2  483  ? 60.820  -41.044 89.676  1.00 63.71  ? 483  VAL C CB    1 
ATOM   7333  C  CG1   . VAL C  2  483  ? 60.401  -40.780 91.108  1.00 65.39  ? 483  VAL C CG1   1 
ATOM   7334  C  CG2   . VAL C  2  483  ? 62.323  -40.878 89.525  1.00 75.99  ? 483  VAL C CG2   1 
ATOM   7335  N  N     . VAL C  2  484  ? 59.463  -42.705 87.028  1.00 59.87  ? 484  VAL C N     1 
ATOM   7336  C  CA    . VAL C  2  484  ? 59.475  -42.710 85.578  1.00 61.95  ? 484  VAL C CA    1 
ATOM   7337  C  C     . VAL C  2  484  ? 59.131  -41.325 85.047  1.00 61.39  ? 484  VAL C C     1 
ATOM   7338  O  O     . VAL C  2  484  ? 58.064  -40.788 85.355  1.00 58.28  ? 484  VAL C O     1 
ATOM   7339  C  CB    . VAL C  2  484  ? 58.449  -43.699 85.024  1.00 61.46  ? 484  VAL C CB    1 
ATOM   7340  C  CG1   . VAL C  2  484  ? 58.343  -43.561 83.512  1.00 60.14  ? 484  VAL C CG1   1 
ATOM   7341  C  CG2   . VAL C  2  484  ? 58.815  -45.113 85.422  1.00 65.06  ? 484  VAL C CG2   1 
ATOM   7342  N  N     . TYR C  2  485  ? 60.039  -40.744 84.265  1.00 56.73  ? 485  TYR C N     1 
ATOM   7343  C  CA    . TYR C  2  485  ? 59.766  -39.486 83.585  1.00 49.13  ? 485  TYR C CA    1 
ATOM   7344  C  C     . TYR C  2  485  ? 59.010  -39.780 82.304  1.00 52.36  ? 485  TYR C C     1 
ATOM   7345  O  O     . TYR C  2  485  ? 59.504  -40.501 81.442  1.00 61.40  ? 485  TYR C O     1 
ATOM   7346  C  CB    . TYR C  2  485  ? 61.061  -38.752 83.269  1.00 45.39  ? 485  TYR C CB    1 
ATOM   7347  C  CG    . TYR C  2  485  ? 61.482  -37.763 84.322  1.00 52.70  ? 485  TYR C CG    1 
ATOM   7348  C  CD1   . TYR C  2  485  ? 62.397  -38.109 85.301  1.00 63.45  ? 485  TYR C CD1   1 
ATOM   7349  C  CD2   . TYR C  2  485  ? 60.971  -36.477 84.331  1.00 54.85  ? 485  TYR C CD2   1 
ATOM   7350  C  CE1   . TYR C  2  485  ? 62.789  -37.196 86.265  1.00 66.17  ? 485  TYR C CE1   1 
ATOM   7351  C  CE2   . TYR C  2  485  ? 61.352  -35.560 85.289  1.00 55.05  ? 485  TYR C CE2   1 
ATOM   7352  C  CZ    . TYR C  2  485  ? 62.260  -35.921 86.253  1.00 60.35  ? 485  TYR C CZ    1 
ATOM   7353  O  OH    . TYR C  2  485  ? 62.638  -35.000 87.203  1.00 61.19  ? 485  TYR C OH    1 
ATOM   7354  N  N     . MET C  2  486  ? 57.809  -39.231 82.176  1.00 50.68  ? 486  MET C N     1 
ATOM   7355  C  CA    . MET C  2  486  ? 56.970  -39.548 81.026  1.00 54.87  ? 486  MET C CA    1 
ATOM   7356  C  C     . MET C  2  486  ? 56.724  -38.379 80.092  1.00 58.30  ? 486  MET C C     1 
ATOM   7357  O  O     . MET C  2  486  ? 56.587  -37.235 80.521  1.00 57.36  ? 486  MET C O     1 
ATOM   7358  C  CB    . MET C  2  486  ? 55.628  -40.129 81.466  1.00 53.90  ? 486  MET C CB    1 
ATOM   7359  C  CG    . MET C  2  486  ? 55.741  -41.478 82.126  1.00 62.32  ? 486  MET C CG    1 
ATOM   7360  S  SD    . MET C  2  486  ? 54.145  -42.153 82.587  1.00 62.52  ? 486  MET C SD    1 
ATOM   7361  C  CE    . MET C  2  486  ? 54.597  -42.902 84.138  1.00 60.97  ? 486  MET C CE    1 
ATOM   7362  N  N     . THR C  2  487  ? 56.677  -38.689 78.803  1.00 62.92  ? 487  THR C N     1 
ATOM   7363  C  CA    . THR C  2  487  ? 56.234  -37.738 77.806  1.00 59.32  ? 487  THR C CA    1 
ATOM   7364  C  C     . THR C  2  487  ? 54.723  -37.618 77.932  1.00 55.03  ? 487  THR C C     1 
ATOM   7365  O  O     . THR C  2  487  ? 54.070  -38.493 78.492  1.00 54.59  ? 487  THR C O     1 
ATOM   7366  C  CB    . THR C  2  487  ? 56.613  -38.202 76.393  1.00 51.14  ? 487  THR C CB    1 
ATOM   7367  O  OG1   . THR C  2  487  ? 55.945  -37.386 75.429  1.00 58.60  ? 487  THR C OG1   1 
ATOM   7368  C  CG2   . THR C  2  487  ? 56.203  -39.643 76.182  1.00 54.07  ? 487  THR C CG2   1 
ATOM   7369  N  N     . ALA C  2  488  ? 54.166  -36.530 77.421  1.00 54.98  ? 488  ALA C N     1 
ATOM   7370  C  CA    . ALA C  2  488  ? 52.729  -36.308 77.517  1.00 56.18  ? 488  ALA C CA    1 
ATOM   7371  C  C     . ALA C  2  488  ? 51.924  -37.418 76.846  1.00 55.55  ? 488  ALA C C     1 
ATOM   7372  O  O     . ALA C  2  488  ? 50.801  -37.709 77.246  1.00 56.35  ? 488  ALA C O     1 
ATOM   7373  C  CB    . ALA C  2  488  ? 52.368  -34.959 76.923  1.00 59.72  ? 488  ALA C CB    1 
ATOM   7374  N  N     . THR C  2  489  ? 52.502  -38.028 75.817  1.00 61.34  ? 489  THR C N     1 
ATOM   7375  C  CA    . THR C  2  489  ? 51.814  -39.073 75.066  1.00 61.04  ? 489  THR C CA    1 
ATOM   7376  C  C     . THR C  2  489  ? 51.790  -40.373 75.843  1.00 62.11  ? 489  THR C C     1 
ATOM   7377  O  O     . THR C  2  489  ? 50.752  -41.021 75.943  1.00 63.31  ? 489  THR C O     1 
ATOM   7378  C  CB    . THR C  2  489  ? 52.470  -39.341 73.701  1.00 59.13  ? 489  THR C CB    1 
ATOM   7379  O  OG1   . THR C  2  489  ? 52.361  -38.176 72.872  1.00 65.80  ? 489  THR C OG1   1 
ATOM   7380  C  CG2   . THR C  2  489  ? 51.780  -40.501 73.014  1.00 55.09  ? 489  THR C CG2   1 
ATOM   7381  N  N     . GLU C  2  490  ? 52.931  -40.743 76.411  1.00 62.45  ? 490  GLU C N     1 
ATOM   7382  C  CA    . GLU C  2  490  ? 53.022  -41.959 77.203  1.00 64.00  ? 490  GLU C CA    1 
ATOM   7383  C  C     . GLU C  2  490  ? 52.105  -41.858 78.415  1.00 66.56  ? 490  GLU C C     1 
ATOM   7384  O  O     . GLU C  2  490  ? 51.454  -42.830 78.797  1.00 69.48  ? 490  GLU C O     1 
ATOM   7385  C  CB    . GLU C  2  490  ? 54.464  -42.202 77.652  1.00 60.51  ? 490  GLU C CB    1 
ATOM   7386  C  CG    . GLU C  2  490  ? 54.588  -43.065 78.896  1.00 69.73  ? 490  GLU C CG    1 
ATOM   7387  C  CD    . GLU C  2  490  ? 54.989  -44.492 78.578  1.00 73.26  ? 490  GLU C CD    1 
ATOM   7388  O  OE1   . GLU C  2  490  ? 54.939  -44.874 77.390  1.00 68.38  ? 490  GLU C OE1   1 
ATOM   7389  O  OE2   . GLU C  2  490  ? 55.354  -45.232 79.515  1.00 76.84  ? 490  GLU C OE2   1 
ATOM   7390  N  N     . GLU C  2  491  ? 52.061  -40.674 79.016  1.00 62.36  ? 491  GLU C N     1 
ATOM   7391  C  CA    . GLU C  2  491  ? 51.253  -40.451 80.208  1.00 61.26  ? 491  GLU C CA    1 
ATOM   7392  C  C     . GLU C  2  491  ? 49.801  -40.890 80.026  1.00 61.15  ? 491  GLU C C     1 
ATOM   7393  O  O     . GLU C  2  491  ? 49.181  -41.379 80.966  1.00 58.44  ? 491  GLU C O     1 
ATOM   7394  C  CB    . GLU C  2  491  ? 51.310  -38.978 80.619  1.00 63.26  ? 491  GLU C CB    1 
ATOM   7395  C  CG    . GLU C  2  491  ? 50.378  -38.611 81.760  1.00 61.98  ? 491  GLU C CG    1 
ATOM   7396  C  CD    . GLU C  2  491  ? 50.312  -37.113 81.997  1.00 65.62  ? 491  GLU C CD    1 
ATOM   7397  O  OE1   . GLU C  2  491  ? 49.189  -36.569 82.078  1.00 62.89  ? 491  GLU C OE1   1 
ATOM   7398  O  OE2   . GLU C  2  491  ? 51.385  -36.481 82.102  1.00 65.91  ? 491  GLU C OE2   1 
ATOM   7399  N  N     . ASP C  2  492  ? 49.268  -40.722 78.817  1.00 61.65  ? 492  ASP C N     1 
ATOM   7400  C  CA    . ASP C  2  492  ? 47.855  -41.004 78.550  1.00 61.42  ? 492  ASP C CA    1 
ATOM   7401  C  C     . ASP C  2  492  ? 47.497  -42.476 78.698  1.00 62.91  ? 492  ASP C C     1 
ATOM   7402  O  O     . ASP C  2  492  ? 46.327  -42.847 78.641  1.00 66.54  ? 492  ASP C O     1 
ATOM   7403  C  CB    . ASP C  2  492  ? 47.444  -40.520 77.157  1.00 56.42  ? 492  ASP C CB    1 
ATOM   7404  C  CG    . ASP C  2  492  ? 47.278  -39.020 77.087  1.00 59.77  ? 492  ASP C CG    1 
ATOM   7405  O  OD1   . ASP C  2  492  ? 47.289  -38.477 75.964  1.00 61.51  ? 492  ASP C OD1   1 
ATOM   7406  O  OD2   . ASP C  2  492  ? 47.144  -38.382 78.152  1.00 56.11  ? 492  ASP C OD2   1 
ATOM   7407  N  N     . ARG C  2  493  ? 48.504  -43.315 78.890  1.00 64.45  ? 493  ARG C N     1 
ATOM   7408  C  CA    . ARG C  2  493  ? 48.279  -44.750 78.971  1.00 69.17  ? 493  ARG C CA    1 
ATOM   7409  C  C     . ARG C  2  493  ? 47.870  -45.196 80.375  1.00 65.58  ? 493  ARG C C     1 
ATOM   7410  O  O     . ARG C  2  493  ? 47.171  -46.194 80.541  1.00 63.03  ? 493  ARG C O     1 
ATOM   7411  C  CB    . ARG C  2  493  ? 49.536  -45.506 78.534  1.00 70.20  ? 493  ARG C CB    1 
ATOM   7412  C  CG    . ARG C  2  493  ? 50.082  -45.095 77.172  1.00 78.60  ? 493  ARG C CG    1 
ATOM   7413  C  CD    . ARG C  2  493  ? 51.291  -45.938 76.797  1.00 84.00  ? 493  ARG C CD    1 
ATOM   7414  N  NE    . ARG C  2  493  ? 50.927  -47.337 76.601  1.00 80.95  ? 493  ARG C NE    1 
ATOM   7415  C  CZ    . ARG C  2  493  ? 51.799  -48.335 76.561  1.00 84.80  ? 493  ARG C CZ    1 
ATOM   7416  N  NH1   . ARG C  2  493  ? 53.097  -48.094 76.706  1.00 96.07  ? 493  ARG C NH1   1 
ATOM   7417  N  NH2   . ARG C  2  493  ? 51.370  -49.575 76.376  1.00 78.05  ? 493  ARG C NH2   1 
ATOM   7418  N  N     . TYR C  2  494  ? 48.300  -44.447 81.383  1.00 63.74  ? 494  TYR C N     1 
ATOM   7419  C  CA    . TYR C  2  494  ? 48.180  -44.902 82.763  1.00 65.07  ? 494  TYR C CA    1 
ATOM   7420  C  C     . TYR C  2  494  ? 47.153  -44.139 83.604  1.00 68.39  ? 494  TYR C C     1 
ATOM   7421  O  O     . TYR C  2  494  ? 46.786  -43.004 83.297  1.00 67.07  ? 494  TYR C O     1 
ATOM   7422  C  CB    . TYR C  2  494  ? 49.549  -44.868 83.449  1.00 64.66  ? 494  TYR C CB    1 
ATOM   7423  C  CG    . TYR C  2  494  ? 50.666  -45.392 82.578  1.00 69.68  ? 494  TYR C CG    1 
ATOM   7424  C  CD1   . TYR C  2  494  ? 50.766  -46.745 82.286  1.00 72.60  ? 494  TYR C CD1   1 
ATOM   7425  C  CD2   . TYR C  2  494  ? 51.617  -44.535 82.043  1.00 70.12  ? 494  TYR C CD2   1 
ATOM   7426  C  CE1   . TYR C  2  494  ? 51.782  -47.235 81.485  1.00 74.34  ? 494  TYR C CE1   1 
ATOM   7427  C  CE2   . TYR C  2  494  ? 52.636  -45.014 81.242  1.00 75.01  ? 494  TYR C CE2   1 
ATOM   7428  C  CZ    . TYR C  2  494  ? 52.713  -46.366 80.966  1.00 76.50  ? 494  TYR C CZ    1 
ATOM   7429  O  OH    . TYR C  2  494  ? 53.725  -46.851 80.168  1.00 82.31  ? 494  TYR C OH    1 
ATOM   7430  N  N     . THR C  2  495  ? 46.691  -44.796 84.664  1.00 65.25  ? 495  THR C N     1 
ATOM   7431  C  CA    . THR C  2  495  ? 45.826  -44.187 85.660  1.00 62.52  ? 495  THR C CA    1 
ATOM   7432  C  C     . THR C  2  495  ? 46.691  -43.664 86.799  1.00 64.20  ? 495  THR C C     1 
ATOM   7433  O  O     . THR C  2  495  ? 47.285  -44.440 87.548  1.00 58.19  ? 495  THR C O     1 
ATOM   7434  C  CB    . THR C  2  495  ? 44.840  -45.209 86.211  1.00 58.05  ? 495  THR C CB    1 
ATOM   7435  O  OG1   . THR C  2  495  ? 44.072  -45.744 85.129  1.00 65.36  ? 495  THR C OG1   1 
ATOM   7436  C  CG2   . THR C  2  495  ? 43.914  -44.564 87.217  1.00 61.50  ? 495  THR C CG2   1 
ATOM   7437  N  N     . ILE C  2  496  ? 46.767  -42.344 86.929  1.00 64.18  ? 496  ILE C N     1 
ATOM   7438  C  CA    . ILE C  2  496  ? 47.755  -41.745 87.820  1.00 60.74  ? 496  ILE C CA    1 
ATOM   7439  C  C     . ILE C  2  496  ? 47.144  -41.126 89.071  1.00 62.01  ? 496  ILE C C     1 
ATOM   7440  O  O     . ILE C  2  496  ? 46.333  -40.210 88.988  1.00 64.76  ? 496  ILE C O     1 
ATOM   7441  C  CB    . ILE C  2  496  ? 48.592  -40.693 87.072  1.00 62.02  ? 496  ILE C CB    1 
ATOM   7442  C  CG1   . ILE C  2  496  ? 49.162  -41.301 85.787  1.00 55.65  ? 496  ILE C CG1   1 
ATOM   7443  C  CG2   . ILE C  2  496  ? 49.692  -40.151 87.969  1.00 56.49  ? 496  ILE C CG2   1 
ATOM   7444  C  CD1   . ILE C  2  496  ? 49.935  -40.334 84.937  1.00 56.69  ? 496  ILE C CD1   1 
ATOM   7445  N  N     . ALA C  2  497  ? 47.518  -41.666 90.227  1.00 63.03  ? 497  ALA C N     1 
ATOM   7446  C  CA    . ALA C  2  497  ? 47.008  -41.203 91.517  1.00 62.05  ? 497  ALA C CA    1 
ATOM   7447  C  C     . ALA C  2  497  ? 47.548  -39.837 91.937  1.00 59.19  ? 497  ALA C C     1 
ATOM   7448  O  O     . ALA C  2  497  ? 48.685  -39.484 91.627  1.00 61.31  ? 497  ALA C O     1 
ATOM   7449  C  CB    . ALA C  2  497  ? 47.290  -42.238 92.596  1.00 66.97  ? 497  ALA C CB    1 
ATOM   7450  N  N     . GLN C  2  498  ? 46.722  -39.078 92.652  1.00 61.62  ? 498  GLN C N     1 
ATOM   7451  C  CA    . GLN C  2  498  ? 47.131  -37.794 93.212  1.00 59.28  ? 498  GLN C CA    1 
ATOM   7452  C  C     . GLN C  2  498  ? 48.154  -37.993 94.328  1.00 65.75  ? 498  GLN C C     1 
ATOM   7453  O  O     . GLN C  2  498  ? 48.107  -38.989 95.049  1.00 69.55  ? 498  GLN C O     1 
ATOM   7454  C  CB    . GLN C  2  498  ? 45.918  -37.026 93.738  1.00 58.50  ? 498  GLN C CB    1 
ATOM   7455  C  CG    . GLN C  2  498  ? 45.140  -36.284 92.663  1.00 63.35  ? 498  GLN C CG    1 
ATOM   7456  C  CD    . GLN C  2  498  ? 46.006  -35.314 91.883  1.00 63.38  ? 498  GLN C CD    1 
ATOM   7457  O  OE1   . GLN C  2  498  ? 46.636  -34.427 92.457  1.00 64.27  ? 498  GLN C OE1   1 
ATOM   7458  N  NE2   . GLN C  2  498  ? 46.040  -35.479 90.566  1.00 59.25  ? 498  GLN C NE2   1 
ATOM   7459  N  N     . ALA C  2  499  ? 49.078  -37.048 94.465  1.00 62.46  ? 499  ALA C N     1 
ATOM   7460  C  CA    . ALA C  2  499  ? 50.142  -37.162 95.450  1.00 65.09  ? 499  ALA C CA    1 
ATOM   7461  C  C     . ALA C  2  499  ? 49.604  -37.253 96.874  1.00 74.49  ? 499  ALA C C     1 
ATOM   7462  O  O     . ALA C  2  499  ? 50.136  -37.999 97.697  1.00 73.06  ? 499  ALA C O     1 
ATOM   7463  C  CB    . ALA C  2  499  ? 51.109  -35.995 95.322  1.00 62.07  ? 499  ALA C CB    1 
ATOM   7464  N  N     . ASN C  2  500  ? 48.560  -36.485 97.171  1.00 74.29  ? 500  ASN C N     1 
ATOM   7465  C  CA    . ASN C  2  500  ? 48.084  -36.373 98.544  1.00 73.61  ? 500  ASN C CA    1 
ATOM   7466  C  C     . ASN C  2  500  ? 47.311  -37.596 99.022  1.00 81.00  ? 500  ASN C C     1 
ATOM   7467  O  O     . ASN C  2  500  ? 46.873  -37.631 100.168 1.00 93.05  ? 500  ASN C O     1 
ATOM   7468  C  CB    . ASN C  2  500  ? 47.215  -35.125 98.717  1.00 79.55  ? 500  ASN C CB    1 
ATOM   7469  C  CG    . ASN C  2  500  ? 45.832  -35.283 98.099  1.00 87.49  ? 500  ASN C CG    1 
ATOM   7470  O  OD1   . ASN C  2  500  ? 45.628  -36.090 97.190  1.00 84.61  ? 500  ASN C OD1   1 
ATOM   7471  N  ND2   . ASN C  2  500  ? 44.873  -34.507 98.591  1.00 91.75  ? 500  ASN C ND2   1 
ATOM   7472  N  N     . THR C  2  501  ? 47.127  -38.583 98.147  1.00 73.73  ? 501  THR C N     1 
ATOM   7473  C  CA    . THR C  2  501  ? 46.398  -39.795 98.516  1.00 77.26  ? 501  THR C CA    1 
ATOM   7474  C  C     . THR C  2  501  ? 47.060  -40.480 99.710  1.00 84.99  ? 501  THR C C     1 
ATOM   7475  O  O     . THR C  2  501  ? 48.277  -40.676 99.720  1.00 81.52  ? 501  THR C O     1 
ATOM   7476  C  CB    . THR C  2  501  ? 46.263  -40.784 97.337  1.00 75.20  ? 501  THR C CB    1 
ATOM   7477  O  OG1   . THR C  2  501  ? 47.506  -40.864 96.634  1.00 71.58  ? 501  THR C OG1   1 
ATOM   7478  C  CG2   . THR C  2  501  ? 45.166  -40.328 96.374  1.00 77.88  ? 501  THR C CG2   1 
ATOM   7479  N  N     . PRO C  2  502  ? 46.264  -40.784 100.732 1.00 88.34  ? 502  PRO C N     1 
ATOM   7480  C  CA    . PRO C  2  502  ? 46.798  -41.219 102.028 1.00 88.01  ? 502  PRO C CA    1 
ATOM   7481  C  C     . PRO C  2  502  ? 47.556  -42.537 101.963 1.00 89.78  ? 502  PRO C C     1 
ATOM   7482  O  O     . PRO C  2  502  ? 47.107  -43.484 101.319 1.00 86.85  ? 502  PRO C O     1 
ATOM   7483  C  CB    . PRO C  2  502  ? 45.538  -41.385 102.882 1.00 92.93  ? 502  PRO C CB    1 
ATOM   7484  C  CG    . PRO C  2  502  ? 44.552  -40.444 102.279 1.00 95.19  ? 502  PRO C CG    1 
ATOM   7485  C  CD    . PRO C  2  502  ? 44.829  -40.459 100.803 1.00 87.79  ? 502  PRO C CD    1 
ATOM   7486  N  N     . LEU C  2  503  ? 48.702  -42.586 102.636 1.00 95.45  ? 503  LEU C N     1 
ATOM   7487  C  CA    . LEU C  2  503  ? 49.503  -43.801 102.688 1.00 96.05  ? 503  LEU C CA    1 
ATOM   7488  C  C     . LEU C  2  503  ? 50.000  -44.144 104.091 1.00 102.36 ? 503  LEU C C     1 
ATOM   7489  O  O     . LEU C  2  503  ? 50.464  -43.275 104.830 1.00 110.13 ? 503  LEU C O     1 
ATOM   7490  C  CB    . LEU C  2  503  ? 50.691  -43.696 101.729 1.00 90.56  ? 503  LEU C CB    1 
ATOM   7491  C  CG    . LEU C  2  503  ? 50.359  -43.392 100.267 1.00 84.37  ? 503  LEU C CG    1 
ATOM   7492  C  CD1   . LEU C  2  503  ? 51.583  -43.588 99.386  1.00 75.60  ? 503  LEU C CD1   1 
ATOM   7493  C  CD2   . LEU C  2  503  ? 49.205  -44.259 99.788  1.00 94.09  ? 503  LEU C CD2   1 
ATOM   7494  N  N     . GLU C  2  504  ? 49.914  -45.423 104.436 1.00 101.39 ? 504  GLU C N     1 
ATOM   7495  C  CA    . GLU C  2  504  ? 50.604  -45.985 105.589 1.00 103.81 ? 504  GLU C CA    1 
ATOM   7496  C  C     . GLU C  2  504  ? 51.754  -46.828 105.051 1.00 104.06 ? 504  GLU C C     1 
ATOM   7497  O  O     . GLU C  2  504  ? 51.540  -47.904 104.493 1.00 105.99 ? 504  GLU C O     1 
ATOM   7498  C  CB    . GLU C  2  504  ? 49.661  -46.816 106.463 1.00 106.08 ? 504  GLU C CB    1 
ATOM   7499  C  CG    . GLU C  2  504  ? 48.876  -47.884 105.725 1.00 114.18 ? 504  GLU C CG    1 
ATOM   7500  C  CD    . GLU C  2  504  ? 47.969  -48.676 106.646 1.00 120.84 ? 504  GLU C CD    1 
ATOM   7501  O  OE1   . GLU C  2  504  ? 48.185  -48.631 107.875 1.00 126.32 ? 504  GLU C OE1   1 
ATOM   7502  O  OE2   . GLU C  2  504  ? 47.037  -49.340 106.143 1.00 122.50 ? 504  GLU C OE2   1 
ATOM   7503  N  N     . GLY C  2  505  ? 52.973  -46.322 105.201 1.00 98.25  ? 505  GLY C N     1 
ATOM   7504  C  CA    . GLY C  2  505  ? 54.129  -46.929 104.569 1.00 92.77  ? 505  GLY C CA    1 
ATOM   7505  C  C     . GLY C  2  505  ? 54.113  -46.639 103.080 1.00 94.58  ? 505  GLY C C     1 
ATOM   7506  O  O     . GLY C  2  505  ? 53.827  -45.518 102.666 1.00 98.53  ? 505  GLY C O     1 
ATOM   7507  N  N     . ASN C  2  506  ? 54.419  -47.648 102.273 1.00 92.70  ? 506  ASN C N     1 
ATOM   7508  C  CA    . ASN C  2  506  ? 54.321  -47.519 100.825 1.00 87.74  ? 506  ASN C CA    1 
ATOM   7509  C  C     . ASN C  2  506  ? 52.975  -48.020 100.311 1.00 89.27  ? 506  ASN C C     1 
ATOM   7510  O  O     . ASN C  2  506  ? 52.718  -48.027 99.109  1.00 84.13  ? 506  ASN C O     1 
ATOM   7511  C  CB    . ASN C  2  506  ? 55.463  -48.271 100.144 1.00 90.07  ? 506  ASN C CB    1 
ATOM   7512  C  CG    . ASN C  2  506  ? 56.788  -47.539 100.252 1.00 103.37 ? 506  ASN C CG    1 
ATOM   7513  O  OD1   . ASN C  2  506  ? 56.912  -46.564 100.996 1.00 106.45 ? 506  ASN C OD1   1 
ATOM   7514  N  ND2   . ASN C  2  506  ? 57.788  -48.004 99.506  1.00 95.56  ? 506  ASN C ND2   1 
ATOM   7515  N  N     . ARG C  2  507  ? 52.119  -48.431 101.241 1.00 94.65  ? 507  ARG C N     1 
ATOM   7516  C  CA    . ARG C  2  507  ? 50.810  -48.982 100.913 1.00 96.51  ? 507  ARG C CA    1 
ATOM   7517  C  C     . ARG C  2  507  ? 49.777  -47.871 100.776 1.00 91.47  ? 507  ARG C C     1 
ATOM   7518  O  O     . ARG C  2  507  ? 49.772  -46.925 101.563 1.00 93.55  ? 507  ARG C O     1 
ATOM   7519  C  CB    . ARG C  2  507  ? 50.373  -49.965 102.007 1.00 107.85 ? 507  ARG C CB    1 
ATOM   7520  C  CG    . ARG C  2  507  ? 49.061  -50.698 101.737 1.00 108.92 ? 507  ARG C CG    1 
ATOM   7521  C  CD    . ARG C  2  507  ? 49.244  -51.824 100.729 1.00 114.93 ? 507  ARG C CD    1 
ATOM   7522  N  NE    . ARG C  2  507  ? 50.215  -52.818 101.185 1.00 127.48 ? 507  ARG C NE    1 
ATOM   7523  C  CZ    . ARG C  2  507  ? 50.596  -53.876 100.474 1.00 120.81 ? 507  ARG C CZ    1 
ATOM   7524  N  NH1   . ARG C  2  507  ? 50.087  -54.084 99.266  1.00 111.10 ? 507  ARG C NH1   1 
ATOM   7525  N  NH2   . ARG C  2  507  ? 51.486  -54.725 100.969 1.00 113.30 ? 507  ARG C NH2   1 
ATOM   7526  N  N     . ILE C  2  508  ? 48.908  -47.985 99.774  1.00 85.16  ? 508  ILE C N     1 
ATOM   7527  C  CA    . ILE C  2  508  ? 47.809  -47.039 99.606  1.00 89.06  ? 508  ILE C CA    1 
ATOM   7528  C  C     . ILE C  2  508  ? 46.789  -47.230 100.723 1.00 96.72  ? 508  ILE C C     1 
ATOM   7529  O  O     . ILE C  2  508  ? 46.199  -48.301 100.861 1.00 97.31  ? 508  ILE C O     1 
ATOM   7530  C  CB    . ILE C  2  508  ? 47.100  -47.210 98.249  1.00 85.07  ? 508  ILE C CB    1 
ATOM   7531  C  CG1   . ILE C  2  508  ? 48.074  -46.966 97.098  1.00 85.10  ? 508  ILE C CG1   1 
ATOM   7532  C  CG2   . ILE C  2  508  ? 45.922  -46.256 98.142  1.00 81.75  ? 508  ILE C CG2   1 
ATOM   7533  C  CD1   . ILE C  2  508  ? 48.465  -45.520 96.929  1.00 81.93  ? 508  ILE C CD1   1 
ATOM   7534  N  N     . ALA C  2  509  ? 46.578  -46.181 101.511 1.00 96.59  ? 509  ALA C N     1 
ATOM   7535  C  CA    . ALA C  2  509  ? 45.762  -46.278 102.717 1.00 95.24  ? 509  ALA C CA    1 
ATOM   7536  C  C     . ALA C  2  509  ? 44.279  -45.975 102.498 1.00 92.27  ? 509  ALA C C     1 
ATOM   7537  O  O     . ALA C  2  509  ? 43.474  -46.123 103.414 1.00 102.91 ? 509  ALA C O     1 
ATOM   7538  C  CB    . ALA C  2  509  ? 46.331  -45.377 103.807 1.00 100.59 ? 509  ALA C CB    1 
ATOM   7539  N  N     . ALA C  2  510  ? 43.916  -45.549 101.295 1.00 92.38  ? 510  ALA C N     1 
ATOM   7540  C  CA    . ALA C  2  510  ? 42.528  -45.196 101.018 1.00 93.53  ? 510  ALA C CA    1 
ATOM   7541  C  C     . ALA C  2  510  ? 41.813  -46.279 100.218 1.00 96.12  ? 510  ALA C C     1 
ATOM   7542  O  O     . ALA C  2  510  ? 42.424  -46.962 99.397  1.00 95.19  ? 510  ALA C O     1 
ATOM   7543  C  CB    . ALA C  2  510  ? 42.452  -43.859 100.298 1.00 93.42  ? 510  ALA C CB    1 
ATOM   7544  N  N     . GLU C  2  511  ? 40.517  -46.434 100.470 1.00 99.49  ? 511  GLU C N     1 
ATOM   7545  C  CA    . GLU C  2  511  ? 39.692  -47.382 99.730  1.00 103.02 ? 511  GLU C CA    1 
ATOM   7546  C  C     . GLU C  2  511  ? 39.408  -46.848 98.330  1.00 99.60  ? 511  GLU C C     1 
ATOM   7547  O  O     . GLU C  2  511  ? 39.246  -47.611 97.377  1.00 94.54  ? 511  GLU C O     1 
ATOM   7548  C  CB    . GLU C  2  511  ? 38.375  -47.622 100.467 1.00 114.27 ? 511  GLU C CB    1 
ATOM   7549  C  CG    . GLU C  2  511  ? 37.556  -46.354 100.671 1.00 124.05 ? 511  GLU C CG    1 
ATOM   7550  C  CD    . GLU C  2  511  ? 36.232  -46.610 101.364 1.00 128.16 ? 511  GLU C CD    1 
ATOM   7551  O  OE1   . GLU C  2  511  ? 36.078  -47.682 101.987 1.00 132.26 ? 511  GLU C OE1   1 
ATOM   7552  O  OE2   . GLU C  2  511  ? 35.343  -45.735 101.283 1.00 127.10 ? 511  GLU C OE2   1 
ATOM   7553  N  N     . ARG C  2  512  ? 39.345  -45.526 98.222  1.00 100.66 ? 512  ARG C N     1 
ATOM   7554  C  CA    . ARG C  2  512  ? 39.113  -44.856 96.952  1.00 96.23  ? 512  ARG C CA    1 
ATOM   7555  C  C     . ARG C  2  512  ? 40.090  -43.693 96.792  1.00 91.49  ? 512  ARG C C     1 
ATOM   7556  O  O     . ARG C  2  512  ? 40.187  -42.828 97.664  1.00 90.92  ? 512  ARG C O     1 
ATOM   7557  C  CB    . ARG C  2  512  ? 37.670  -44.355 96.870  1.00 100.62 ? 512  ARG C CB    1 
ATOM   7558  C  CG    . ARG C  2  512  ? 37.192  -43.638 98.128  1.00 110.40 ? 512  ARG C CG    1 
ATOM   7559  C  CD    . ARG C  2  512  ? 35.925  -42.843 97.865  1.00 113.21 ? 512  ARG C CD    1 
ATOM   7560  N  NE    . ARG C  2  512  ? 34.876  -43.666 97.273  1.00 114.83 ? 512  ARG C NE    1 
ATOM   7561  C  CZ    . ARG C  2  512  ? 33.947  -43.206 96.442  1.00 119.68 ? 512  ARG C CZ    1 
ATOM   7562  N  NH1   . ARG C  2  512  ? 33.937  -41.923 96.097  1.00 112.52 ? 512  ARG C NH1   1 
ATOM   7563  N  NH2   . ARG C  2  512  ? 33.028  -44.027 95.950  1.00 122.21 ? 512  ARG C NH2   1 
ATOM   7564  N  N     . VAL C  2  513  ? 40.820  -43.681 95.681  1.00 82.49  ? 513  VAL C N     1 
ATOM   7565  C  CA    . VAL C  2  513  ? 41.810  -42.640 95.429  1.00 80.35  ? 513  VAL C CA    1 
ATOM   7566  C  C     . VAL C  2  513  ? 41.451  -41.803 94.208  1.00 77.41  ? 513  VAL C C     1 
ATOM   7567  O  O     . VAL C  2  513  ? 40.790  -42.279 93.281  1.00 72.18  ? 513  VAL C O     1 
ATOM   7568  C  CB    . VAL C  2  513  ? 43.220  -43.231 95.230  1.00 80.62  ? 513  VAL C CB    1 
ATOM   7569  C  CG1   . VAL C  2  513  ? 43.586  -44.134 96.394  1.00 90.88  ? 513  VAL C CG1   1 
ATOM   7570  C  CG2   . VAL C  2  513  ? 43.300  -43.988 93.918  1.00 74.52  ? 513  VAL C CG2   1 
ATOM   7571  N  N     . VAL C  2  514  ? 41.892  -40.549 94.219  1.00 76.39  ? 514  VAL C N     1 
ATOM   7572  C  CA    . VAL C  2  514  ? 41.662  -39.651 93.099  1.00 71.34  ? 514  VAL C CA    1 
ATOM   7573  C  C     . VAL C  2  514  ? 42.755  -39.835 92.063  1.00 67.25  ? 514  VAL C C     1 
ATOM   7574  O  O     . VAL C  2  514  ? 43.937  -39.721 92.375  1.00 67.85  ? 514  VAL C O     1 
ATOM   7575  C  CB    . VAL C  2  514  ? 41.673  -38.189 93.543  1.00 70.86  ? 514  VAL C CB    1 
ATOM   7576  C  CG1   . VAL C  2  514  ? 41.303  -37.291 92.377  1.00 67.09  ? 514  VAL C CG1   1 
ATOM   7577  C  CG2   . VAL C  2  514  ? 40.722  -37.987 94.705  1.00 69.17  ? 514  VAL C CG2   1 
ATOM   7578  N  N     . ALA C  2  515  ? 42.358  -40.117 90.829  1.00 66.42  ? 515  ALA C N     1 
ATOM   7579  C  CA    . ALA C  2  515  ? 43.329  -40.365 89.773  1.00 66.06  ? 515  ALA C CA    1 
ATOM   7580  C  C     . ALA C  2  515  ? 42.960  -39.667 88.473  1.00 65.71  ? 515  ALA C C     1 
ATOM   7581  O  O     . ALA C  2  515  ? 41.860  -39.142 88.324  1.00 64.12  ? 515  ALA C O     1 
ATOM   7582  C  CB    . ALA C  2  515  ? 43.488  -41.862 89.542  1.00 67.03  ? 515  ALA C CB    1 
ATOM   7583  N  N     . ARG C  2  516  ? 43.896  -39.664 87.534  1.00 65.62  ? 516  ARG C N     1 
ATOM   7584  C  CA    . ARG C  2  516  ? 43.638  -39.138 86.207  1.00 65.28  ? 516  ARG C CA    1 
ATOM   7585  C  C     . ARG C  2  516  ? 43.847  -40.219 85.157  1.00 69.30  ? 516  ARG C C     1 
ATOM   7586  O  O     . ARG C  2  516  ? 44.849  -40.940 85.179  1.00 72.14  ? 516  ARG C O     1 
ATOM   7587  C  CB    . ARG C  2  516  ? 44.546  -37.945 85.907  1.00 65.80  ? 516  ARG C CB    1 
ATOM   7588  C  CG    . ARG C  2  516  ? 44.240  -36.709 86.715  1.00 61.02  ? 516  ARG C CG    1 
ATOM   7589  C  CD    . ARG C  2  516  ? 45.270  -35.627 86.456  1.00 56.36  ? 516  ARG C CD    1 
ATOM   7590  N  NE    . ARG C  2  516  ? 46.621  -36.051 86.818  1.00 60.73  ? 516  ARG C NE    1 
ATOM   7591  C  CZ    . ARG C  2  516  ? 47.642  -36.106 85.968  1.00 58.12  ? 516  ARG C CZ    1 
ATOM   7592  N  NH1   . ARG C  2  516  ? 47.472  -35.762 84.700  1.00 60.81  ? 516  ARG C NH1   1 
ATOM   7593  N  NH2   . ARG C  2  516  ? 48.837  -36.499 86.386  1.00 57.96  ? 516  ARG C NH2   1 
ATOM   7594  N  N     . ARG C  2  517  ? 42.872  -40.338 84.262  1.00 68.30  ? 517  ARG C N     1 
ATOM   7595  C  CA    . ARG C  2  517  ? 43.005  -41.125 83.047  1.00 66.99  ? 517  ARG C CA    1 
ATOM   7596  C  C     . ARG C  2  517  ? 42.881  -40.172 81.870  1.00 68.97  ? 517  ARG C C     1 
ATOM   7597  O  O     . ARG C  2  517  ? 41.800  -39.645 81.595  1.00 72.41  ? 517  ARG C O     1 
ATOM   7598  C  CB    . ARG C  2  517  ? 41.927  -42.206 82.972  1.00 69.66  ? 517  ARG C CB    1 
ATOM   7599  C  CG    . ARG C  2  517  ? 42.231  -43.433 83.810  1.00 75.63  ? 517  ARG C CG    1 
ATOM   7600  C  CD    . ARG C  2  517  ? 40.996  -44.298 84.022  1.00 79.47  ? 517  ARG C CD    1 
ATOM   7601  N  NE    . ARG C  2  517  ? 41.286  -45.433 84.895  1.00 81.58  ? 517  ARG C NE    1 
ATOM   7602  C  CZ    . ARG C  2  517  ? 40.364  -46.195 85.474  1.00 84.22  ? 517  ARG C CZ    1 
ATOM   7603  N  NH1   . ARG C  2  517  ? 39.073  -45.947 85.284  1.00 84.79  ? 517  ARG C NH1   1 
ATOM   7604  N  NH2   . ARG C  2  517  ? 40.735  -47.204 86.251  1.00 83.16  ? 517  ARG C NH2   1 
ATOM   7605  N  N     . LYS C  2  518  ? 43.998  -39.948 81.186  1.00 67.36  ? 518  LYS C N     1 
ATOM   7606  C  CA    . LYS C  2  518  ? 44.055  -38.982 80.095  1.00 63.09  ? 518  LYS C CA    1 
ATOM   7607  C  C     . LYS C  2  518  ? 43.559  -37.612 80.537  1.00 65.31  ? 518  LYS C C     1 
ATOM   7608  O  O     . LYS C  2  518  ? 42.718  -37.002 79.881  1.00 67.52  ? 518  LYS C O     1 
ATOM   7609  C  CB    . LYS C  2  518  ? 43.285  -39.482 78.871  1.00 55.59  ? 518  LYS C CB    1 
ATOM   7610  C  CG    . LYS C  2  518  ? 43.968  -40.647 78.181  1.00 62.75  ? 518  LYS C CG    1 
ATOM   7611  C  CD    . LYS C  2  518  ? 43.128  -41.237 77.068  1.00 60.48  ? 518  LYS C CD    1 
ATOM   7612  C  CE    . LYS C  2  518  ? 43.786  -42.494 76.521  1.00 71.90  ? 518  LYS C CE    1 
ATOM   7613  N  NZ    . LYS C  2  518  ? 42.981  -43.143 75.453  1.00 83.62  ? 518  LYS C NZ    1 
ATOM   7614  N  N     . GLY C  2  519  ? 44.086  -37.143 81.664  1.00 66.96  ? 519  GLY C N     1 
ATOM   7615  C  CA    . GLY C  2  519  ? 43.826  -35.796 82.132  1.00 67.86  ? 519  GLY C CA    1 
ATOM   7616  C  C     . GLY C  2  519  ? 42.530  -35.623 82.895  1.00 68.59  ? 519  GLY C C     1 
ATOM   7617  O  O     . GLY C  2  519  ? 42.409  -34.715 83.719  1.00 70.73  ? 519  GLY C O     1 
ATOM   7618  N  N     . GLU C  2  520  ? 41.561  -36.491 82.633  1.00 65.62  ? 520  GLU C N     1 
ATOM   7619  C  CA    . GLU C  2  520  ? 40.258  -36.355 83.270  1.00 73.52  ? 520  GLU C CA    1 
ATOM   7620  C  C     . GLU C  2  520  ? 40.167  -37.112 84.592  1.00 67.87  ? 520  GLU C C     1 
ATOM   7621  O  O     . GLU C  2  520  ? 40.498  -38.291 84.658  1.00 66.40  ? 520  GLU C O     1 
ATOM   7622  C  CB    . GLU C  2  520  ? 39.141  -36.776 82.322  1.00 75.41  ? 520  GLU C CB    1 
ATOM   7623  C  CG    . GLU C  2  520  ? 37.920  -35.888 82.444  1.00 85.25  ? 520  GLU C CG    1 
ATOM   7624  C  CD    . GLU C  2  520  ? 36.837  -36.239 81.455  1.00 99.81  ? 520  GLU C CD    1 
ATOM   7625  O  OE1   . GLU C  2  520  ? 35.677  -36.395 81.891  1.00 109.39 ? 520  GLU C OE1   1 
ATOM   7626  O  OE2   . GLU C  2  520  ? 37.144  -36.351 80.247  1.00 100.29 ? 520  GLU C OE2   1 
ATOM   7627  N  N     . PRO C  2  521  ? 39.711  -36.422 85.649  1.00 67.12  ? 521  PRO C N     1 
ATOM   7628  C  CA    . PRO C  2  521  ? 39.670  -36.943 87.021  1.00 64.58  ? 521  PRO C CA    1 
ATOM   7629  C  C     . PRO C  2  521  ? 38.618  -38.034 87.246  1.00 60.15  ? 521  PRO C C     1 
ATOM   7630  O  O     . PRO C  2  521  ? 37.497  -37.957 86.742  1.00 60.59  ? 521  PRO C O     1 
ATOM   7631  C  CB    . PRO C  2  521  ? 39.351  -35.699 87.854  1.00 61.08  ? 521  PRO C CB    1 
ATOM   7632  C  CG    . PRO C  2  521  ? 38.635  -34.795 86.923  1.00 61.76  ? 521  PRO C CG    1 
ATOM   7633  C  CD    . PRO C  2  521  ? 39.226  -35.032 85.572  1.00 65.18  ? 521  PRO C CD    1 
ATOM   7634  N  N     . VAL C  2  522  ? 38.999  -39.049 88.011  1.00 55.88  ? 522  VAL C N     1 
ATOM   7635  C  CA    . VAL C  2  522  ? 38.130  -40.184 88.273  1.00 69.00  ? 522  VAL C CA    1 
ATOM   7636  C  C     . VAL C  2  522  ? 38.486  -40.848 89.607  1.00 73.63  ? 522  VAL C C     1 
ATOM   7637  O  O     . VAL C  2  522  ? 39.647  -40.836 90.025  1.00 74.56  ? 522  VAL C O     1 
ATOM   7638  C  CB    . VAL C  2  522  ? 38.232  -41.216 87.142  1.00 67.12  ? 522  VAL C CB    1 
ATOM   7639  C  CG1   . VAL C  2  522  ? 39.652  -41.743 87.044  1.00 61.64  ? 522  VAL C CG1   1 
ATOM   7640  C  CG2   . VAL C  2  522  ? 37.240  -42.348 87.362  1.00 83.00  ? 522  VAL C CG2   1 
ATOM   7641  N  N     . ILE C  2  523  ? 37.483  -41.412 90.277  1.00 68.43  ? 523  ILE C N     1 
ATOM   7642  C  CA    . ILE C  2  523  ? 37.702  -42.126 91.528  1.00 72.82  ? 523  ILE C CA    1 
ATOM   7643  C  C     . ILE C  2  523  ? 37.981  -43.597 91.245  1.00 73.43  ? 523  ILE C C     1 
ATOM   7644  O  O     . ILE C  2  523  ? 37.228  -44.260 90.534  1.00 73.27  ? 523  ILE C O     1 
ATOM   7645  C  CB    . ILE C  2  523  ? 36.502  -41.999 92.476  1.00 80.53  ? 523  ILE C CB    1 
ATOM   7646  C  CG1   . ILE C  2  523  ? 36.210  -40.526 92.757  1.00 79.07  ? 523  ILE C CG1   1 
ATOM   7647  C  CG2   . ILE C  2  523  ? 36.766  -42.748 93.770  1.00 82.87  ? 523  ILE C CG2   1 
ATOM   7648  C  CD1   . ILE C  2  523  ? 37.428  -39.743 93.184  1.00 79.26  ? 523  ILE C CD1   1 
ATOM   7649  N  N     . VAL C  2  524  ? 39.068  -44.104 91.811  1.00 73.99  ? 524  VAL C N     1 
ATOM   7650  C  CA    . VAL C  2  524  ? 39.592  -45.401 91.410  1.00 75.12  ? 524  VAL C CA    1 
ATOM   7651  C  C     . VAL C  2  524  ? 40.020  -46.232 92.614  1.00 80.27  ? 524  VAL C C     1 
ATOM   7652  O  O     . VAL C  2  524  ? 40.251  -45.692 93.692  1.00 86.44  ? 524  VAL C O     1 
ATOM   7653  C  CB    . VAL C  2  524  ? 40.801  -45.212 90.473  1.00 69.72  ? 524  VAL C CB    1 
ATOM   7654  C  CG1   . VAL C  2  524  ? 41.354  -46.540 90.044  1.00 75.28  ? 524  VAL C CG1   1 
ATOM   7655  C  CG2   . VAL C  2  524  ? 40.406  -44.390 89.257  1.00 72.63  ? 524  VAL C CG2   1 
ATOM   7656  N  N     . SER C  2  525  ? 40.119  -47.546 92.431  1.00 77.02  ? 525  SER C N     1 
ATOM   7657  C  CA    . SER C  2  525  ? 40.615  -48.434 93.479  1.00 79.96  ? 525  SER C CA    1 
ATOM   7658  C  C     . SER C  2  525  ? 42.133  -48.543 93.421  1.00 81.22  ? 525  SER C C     1 
ATOM   7659  O  O     . SER C  2  525  ? 42.723  -48.457 92.346  1.00 86.44  ? 525  SER C O     1 
ATOM   7660  C  CB    . SER C  2  525  ? 39.995  -49.824 93.341  1.00 86.57  ? 525  SER C CB    1 
ATOM   7661  O  OG    . SER C  2  525  ? 38.590  -49.774 93.502  1.00 104.10 ? 525  SER C OG    1 
ATOM   7662  N  N     . PRO C  2  526  ? 42.773  -48.742 94.580  1.00 74.62  ? 526  PRO C N     1 
ATOM   7663  C  CA    . PRO C  2  526  ? 44.233  -48.869 94.663  1.00 83.17  ? 526  PRO C CA    1 
ATOM   7664  C  C     . PRO C  2  526  ? 44.790  -49.934 93.720  1.00 82.27  ? 526  PRO C C     1 
ATOM   7665  O  O     . PRO C  2  526  ? 45.982  -49.922 93.418  1.00 79.77  ? 526  PRO C O     1 
ATOM   7666  C  CB    . PRO C  2  526  ? 44.458  -49.281 96.118  1.00 79.22  ? 526  PRO C CB    1 
ATOM   7667  C  CG    . PRO C  2  526  ? 43.306  -48.685 96.841  1.00 77.59  ? 526  PRO C CG    1 
ATOM   7668  C  CD    . PRO C  2  526  ? 42.140  -48.801 95.905  1.00 73.02  ? 526  PRO C CD    1 
ATOM   7669  N  N     . GLU C  2  527  ? 43.935  -50.844 93.268  1.00 85.47  ? 527  GLU C N     1 
ATOM   7670  C  CA    . GLU C  2  527  ? 44.345  -51.882 92.331  1.00 81.00  ? 527  GLU C CA    1 
ATOM   7671  C  C     . GLU C  2  527  ? 44.636  -51.294 90.964  1.00 79.57  ? 527  GLU C C     1 
ATOM   7672  O  O     . GLU C  2  527  ? 45.571  -51.715 90.287  1.00 89.30  ? 527  GLU C O     1 
ATOM   7673  C  CB    . GLU C  2  527  ? 43.259  -52.948 92.201  1.00 85.42  ? 527  GLU C CB    1 
ATOM   7674  C  CG    . GLU C  2  527  ? 43.590  -54.261 92.891  1.00 95.78  ? 527  GLU C CG    1 
ATOM   7675  C  CD    . GLU C  2  527  ? 42.617  -54.597 94.009  1.00 102.22 ? 527  GLU C CD    1 
ATOM   7676  O  OE1   . GLU C  2  527  ? 41.673  -53.810 94.230  1.00 98.21  ? 527  GLU C OE1   1 
ATOM   7677  O  OE2   . GLU C  2  527  ? 42.795  -55.646 94.667  1.00 98.44  ? 527  GLU C OE2   1 
ATOM   7678  N  N     . GLU C  2  528  ? 43.833  -50.315 90.562  1.00 72.47  ? 528  GLU C N     1 
ATOM   7679  C  CA    . GLU C  2  528  ? 43.929  -49.758 89.221  1.00 75.82  ? 528  GLU C CA    1 
ATOM   7680  C  C     . GLU C  2  528  ? 44.959  -48.639 89.118  1.00 69.35  ? 528  GLU C C     1 
ATOM   7681  O  O     . GLU C  2  528  ? 45.108  -48.027 88.064  1.00 69.68  ? 528  GLU C O     1 
ATOM   7682  C  CB    . GLU C  2  528  ? 42.566  -49.241 88.763  1.00 78.73  ? 528  GLU C CB    1 
ATOM   7683  C  CG    . GLU C  2  528  ? 41.384  -49.962 89.385  1.00 77.22  ? 528  GLU C CG    1 
ATOM   7684  C  CD    . GLU C  2  528  ? 40.052  -49.386 88.939  1.00 77.93  ? 528  GLU C CD    1 
ATOM   7685  O  OE1   . GLU C  2  528  ? 39.193  -49.128 89.807  1.00 83.17  ? 528  GLU C OE1   1 
ATOM   7686  O  OE2   . GLU C  2  528  ? 39.861  -49.195 87.719  1.00 69.93  ? 528  GLU C OE2   1 
ATOM   7687  N  N     . VAL C  2  529  ? 45.667  -48.371 90.209  1.00 65.71  ? 529  VAL C N     1 
ATOM   7688  C  CA    . VAL C  2  529  ? 46.647  -47.293 90.221  1.00 65.32  ? 529  VAL C CA    1 
ATOM   7689  C  C     . VAL C  2  529  ? 48.003  -47.756 89.699  1.00 66.27  ? 529  VAL C C     1 
ATOM   7690  O  O     . VAL C  2  529  ? 48.659  -48.595 90.317  1.00 73.75  ? 529  VAL C O     1 
ATOM   7691  C  CB    . VAL C  2  529  ? 46.815  -46.697 91.626  1.00 62.33  ? 529  VAL C CB    1 
ATOM   7692  C  CG1   . VAL C  2  529  ? 47.977  -45.724 91.645  1.00 65.13  ? 529  VAL C CG1   1 
ATOM   7693  C  CG2   . VAL C  2  529  ? 45.539  -46.014 92.054  1.00 60.69  ? 529  VAL C CG2   1 
ATOM   7694  N  N     . GLU C  2  530  ? 48.408  -47.200 88.558  1.00 57.76  ? 530  GLU C N     1 
ATOM   7695  C  CA    . GLU C  2  530  ? 49.644  -47.589 87.898  1.00 62.17  ? 530  GLU C CA    1 
ATOM   7696  C  C     . GLU C  2  530  ? 50.801  -46.677 88.314  1.00 65.73  ? 530  GLU C C     1 
ATOM   7697  O  O     . GLU C  2  530  ? 51.909  -47.143 88.591  1.00 67.12  ? 530  GLU C O     1 
ATOM   7698  C  CB    . GLU C  2  530  ? 49.453  -47.581 86.378  1.00 64.11  ? 530  GLU C CB    1 
ATOM   7699  C  CG    . GLU C  2  530  ? 48.194  -48.312 85.929  1.00 65.76  ? 530  GLU C CG    1 
ATOM   7700  C  CD    . GLU C  2  530  ? 48.019  -48.349 84.418  1.00 80.25  ? 530  GLU C CD    1 
ATOM   7701  O  OE1   . GLU C  2  530  ? 46.887  -48.087 83.944  1.00 72.93  ? 530  GLU C OE1   1 
ATOM   7702  O  OE2   . GLU C  2  530  ? 49.005  -48.648 83.708  1.00 89.93  ? 530  GLU C OE2   1 
ATOM   7703  N  N     . PHE C  2  531  ? 50.539  -45.376 88.357  1.00 61.77  ? 531  PHE C N     1 
ATOM   7704  C  CA    . PHE C  2  531  ? 51.530  -44.415 88.822  1.00 58.67  ? 531  PHE C CA    1 
ATOM   7705  C  C     . PHE C  2  531  ? 50.909  -43.445 89.818  1.00 63.11  ? 531  PHE C C     1 
ATOM   7706  O  O     . PHE C  2  531  ? 49.727  -43.542 90.134  1.00 64.46  ? 531  PHE C O     1 
ATOM   7707  C  CB    . PHE C  2  531  ? 52.131  -43.645 87.649  1.00 58.97  ? 531  PHE C CB    1 
ATOM   7708  C  CG    . PHE C  2  531  ? 52.971  -44.488 86.734  1.00 65.12  ? 531  PHE C CG    1 
ATOM   7709  C  CD1   . PHE C  2  531  ? 52.403  -45.120 85.640  1.00 61.61  ? 531  PHE C CD1   1 
ATOM   7710  C  CD2   . PHE C  2  531  ? 54.332  -44.639 86.961  1.00 61.69  ? 531  PHE C CD2   1 
ATOM   7711  C  CE1   . PHE C  2  531  ? 53.173  -45.892 84.794  1.00 59.38  ? 531  PHE C CE1   1 
ATOM   7712  C  CE2   . PHE C  2  531  ? 55.107  -45.410 86.117  1.00 60.64  ? 531  PHE C CE2   1 
ATOM   7713  C  CZ    . PHE C  2  531  ? 54.527  -46.038 85.033  1.00 63.91  ? 531  PHE C CZ    1 
ATOM   7714  N  N     . MET C  2  532  ? 51.714  -42.507 90.307  1.00 60.54  ? 532  MET C N     1 
ATOM   7715  C  CA    . MET C  2  532  ? 51.239  -41.492 91.242  1.00 57.61  ? 532  MET C CA    1 
ATOM   7716  C  C     . MET C  2  532  ? 52.114  -40.242 91.179  1.00 58.93  ? 532  MET C C     1 
ATOM   7717  O  O     . MET C  2  532  ? 53.311  -40.331 90.938  1.00 60.32  ? 532  MET C O     1 
ATOM   7718  C  CB    . MET C  2  532  ? 51.204  -42.054 92.659  1.00 58.87  ? 532  MET C CB    1 
ATOM   7719  C  CG    . MET C  2  532  ? 51.164  -41.012 93.757  1.00 64.71  ? 532  MET C CG    1 
ATOM   7720  S  SD    . MET C  2  532  ? 50.966  -41.761 95.390  1.00 67.34  ? 532  MET C SD    1 
ATOM   7721  C  CE    . MET C  2  532  ? 51.531  -40.436 96.456  1.00 73.93  ? 532  MET C CE    1 
ATOM   7722  N  N     . ASP C  2  533  ? 51.514  -39.076 91.379  1.00 58.53  ? 533  ASP C N     1 
ATOM   7723  C  CA    . ASP C  2  533  ? 52.257  -37.825 91.298  1.00 58.54  ? 533  ASP C CA    1 
ATOM   7724  C  C     . ASP C  2  533  ? 53.428  -37.822 92.268  1.00 60.37  ? 533  ASP C C     1 
ATOM   7725  O  O     . ASP C  2  533  ? 53.351  -38.410 93.346  1.00 59.97  ? 533  ASP C O     1 
ATOM   7726  C  CB    . ASP C  2  533  ? 51.345  -36.634 91.588  1.00 61.06  ? 533  ASP C CB    1 
ATOM   7727  C  CG    . ASP C  2  533  ? 50.401  -36.324 90.446  1.00 65.40  ? 533  ASP C CG    1 
ATOM   7728  O  OD1   . ASP C  2  533  ? 49.811  -37.264 89.868  1.00 65.07  ? 533  ASP C OD1   1 
ATOM   7729  O  OD2   . ASP C  2  533  ? 50.250  -35.127 90.128  1.00 68.52  ? 533  ASP C OD2   1 
ATOM   7730  N  N     . VAL C  2  534  ? 54.513  -37.158 91.879  1.00 60.73  ? 534  VAL C N     1 
ATOM   7731  C  CA    . VAL C  2  534  ? 55.679  -37.022 92.745  1.00 60.29  ? 534  VAL C CA    1 
ATOM   7732  C  C     . VAL C  2  534  ? 55.416  -36.005 93.844  1.00 59.84  ? 534  VAL C C     1 
ATOM   7733  O  O     . VAL C  2  534  ? 55.784  -36.215 95.000  1.00 63.64  ? 534  VAL C O     1 
ATOM   7734  C  CB    . VAL C  2  534  ? 56.923  -36.588 91.959  1.00 54.59  ? 534  VAL C CB    1 
ATOM   7735  C  CG1   . VAL C  2  534  ? 57.961  -36.001 92.898  1.00 52.20  ? 534  VAL C CG1   1 
ATOM   7736  C  CG2   . VAL C  2  534  ? 57.490  -37.758 91.176  1.00 57.71  ? 534  VAL C CG2   1 
ATOM   7737  N  N     . SER C  2  535  ? 54.770  -34.905 93.472  1.00 60.26  ? 535  SER C N     1 
ATOM   7738  C  CA    . SER C  2  535  ? 54.468  -33.821 94.399  1.00 56.40  ? 535  SER C CA    1 
ATOM   7739  C  C     . SER C  2  535  ? 53.535  -32.823 93.737  1.00 53.61  ? 535  SER C C     1 
ATOM   7740  O  O     . SER C  2  535  ? 53.417  -32.802 92.518  1.00 57.35  ? 535  SER C O     1 
ATOM   7741  C  CB    . SER C  2  535  ? 55.750  -33.109 94.831  1.00 58.02  ? 535  SER C CB    1 
ATOM   7742  O  OG    . SER C  2  535  ? 55.459  -31.840 95.391  1.00 55.50  ? 535  SER C OG    1 
ATOM   7743  N  N     . PRO C  2  536  ? 52.856  -31.996 94.541  1.00 51.43  ? 536  PRO C N     1 
ATOM   7744  C  CA    . PRO C  2  536  ? 52.064  -30.912 93.957  1.00 49.71  ? 536  PRO C CA    1 
ATOM   7745  C  C     . PRO C  2  536  ? 52.965  -29.880 93.279  1.00 50.09  ? 536  PRO C C     1 
ATOM   7746  O  O     . PRO C  2  536  ? 52.578  -29.306 92.260  1.00 50.05  ? 536  PRO C O     1 
ATOM   7747  C  CB    . PRO C  2  536  ? 51.366  -30.294 95.173  1.00 50.89  ? 536  PRO C CB    1 
ATOM   7748  C  CG    . PRO C  2  536  ? 51.358  -31.374 96.203  1.00 54.54  ? 536  PRO C CG    1 
ATOM   7749  C  CD    . PRO C  2  536  ? 52.644  -32.117 95.993  1.00 57.53  ? 536  PRO C CD    1 
ATOM   7750  N  N     . LYS C  2  537  ? 54.155  -29.662 93.833  1.00 46.18  ? 537  LYS C N     1 
ATOM   7751  C  CA    . LYS C  2  537  ? 55.104  -28.712 93.266  1.00 44.83  ? 537  LYS C CA    1 
ATOM   7752  C  C     . LYS C  2  537  ? 55.286  -28.915 91.767  1.00 48.76  ? 537  LYS C C     1 
ATOM   7753  O  O     . LYS C  2  537  ? 55.564  -27.966 91.039  1.00 51.65  ? 537  LYS C O     1 
ATOM   7754  C  CB    . LYS C  2  537  ? 56.467  -28.840 93.945  1.00 46.54  ? 537  LYS C CB    1 
ATOM   7755  C  CG    . LYS C  2  537  ? 56.413  -28.972 95.443  1.00 47.87  ? 537  LYS C CG    1 
ATOM   7756  C  CD    . LYS C  2  537  ? 57.810  -28.960 96.057  1.00 52.71  ? 537  LYS C CD    1 
ATOM   7757  C  CE    . LYS C  2  537  ? 57.726  -29.057 97.581  1.00 67.75  ? 537  LYS C CE    1 
ATOM   7758  N  NZ    . LYS C  2  537  ? 59.047  -28.924 98.257  1.00 74.49  ? 537  LYS C NZ    1 
ATOM   7759  N  N     . GLN C  2  538  ? 55.135  -30.156 91.314  1.00 48.97  ? 538  GLN C N     1 
ATOM   7760  C  CA    . GLN C  2  538  ? 55.439  -30.510 89.929  1.00 56.58  ? 538  GLN C CA    1 
ATOM   7761  C  C     . GLN C  2  538  ? 54.473  -29.879 88.941  1.00 54.24  ? 538  GLN C C     1 
ATOM   7762  O  O     . GLN C  2  538  ? 54.788  -29.746 87.758  1.00 56.68  ? 538  GLN C O     1 
ATOM   7763  C  CB    . GLN C  2  538  ? 55.457  -32.030 89.735  1.00 55.53  ? 538  GLN C CB    1 
ATOM   7764  C  CG    . GLN C  2  538  ? 54.086  -32.667 89.594  1.00 50.30  ? 538  GLN C CG    1 
ATOM   7765  C  CD    . GLN C  2  538  ? 54.169  -34.158 89.339  1.00 54.06  ? 538  GLN C CD    1 
ATOM   7766  O  OE1   . GLN C  2  538  ? 54.822  -34.892 90.073  1.00 52.85  ? 538  GLN C OE1   1 
ATOM   7767  N  NE2   . GLN C  2  538  ? 53.509  -34.612 88.288  1.00 60.85  ? 538  GLN C NE2   1 
ATOM   7768  N  N     . VAL C  2  539  ? 53.305  -29.485 89.431  1.00 49.19  ? 539  VAL C N     1 
ATOM   7769  C  CA    . VAL C  2  539  ? 52.267  -28.926 88.575  1.00 48.52  ? 539  VAL C CA    1 
ATOM   7770  C  C     . VAL C  2  539  ? 52.505  -27.448 88.253  1.00 49.23  ? 539  VAL C C     1 
ATOM   7771  O  O     . VAL C  2  539  ? 51.946  -26.922 87.286  1.00 44.91  ? 539  VAL C O     1 
ATOM   7772  C  CB    . VAL C  2  539  ? 50.870  -29.127 89.205  1.00 47.60  ? 539  VAL C CB    1 
ATOM   7773  C  CG1   . VAL C  2  539  ? 49.806  -28.360 88.439  1.00 43.86  ? 539  VAL C CG1   1 
ATOM   7774  C  CG2   . VAL C  2  539  ? 50.529  -30.609 89.257  1.00 52.26  ? 539  VAL C CG2   1 
ATOM   7775  N  N     . PHE C  2  540  ? 53.358  -26.794 89.043  1.00 48.60  ? 540  PHE C N     1 
ATOM   7776  C  CA    . PHE C  2  540  ? 53.531  -25.344 88.946  1.00 48.83  ? 540  PHE C CA    1 
ATOM   7777  C  C     . PHE C  2  540  ? 54.955  -24.895 88.677  1.00 44.28  ? 540  PHE C C     1 
ATOM   7778  O  O     . PHE C  2  540  ? 55.903  -25.632 88.913  1.00 48.19  ? 540  PHE C O     1 
ATOM   7779  C  CB    . PHE C  2  540  ? 53.011  -24.666 90.217  1.00 46.34  ? 540  PHE C CB    1 
ATOM   7780  C  CG    . PHE C  2  540  ? 51.578  -24.966 90.502  1.00 44.63  ? 540  PHE C CG    1 
ATOM   7781  C  CD1   . PHE C  2  540  ? 51.232  -25.991 91.365  1.00 48.21  ? 540  PHE C CD1   1 
ATOM   7782  C  CD2   . PHE C  2  540  ? 50.572  -24.248 89.878  1.00 45.61  ? 540  PHE C CD2   1 
ATOM   7783  C  CE1   . PHE C  2  540  ? 49.904  -26.284 91.619  1.00 51.07  ? 540  PHE C CE1   1 
ATOM   7784  C  CE2   . PHE C  2  540  ? 49.241  -24.536 90.122  1.00 45.18  ? 540  PHE C CE2   1 
ATOM   7785  C  CZ    . PHE C  2  540  ? 48.905  -25.556 90.994  1.00 48.14  ? 540  PHE C CZ    1 
ATOM   7786  N  N     . SER C  2  541  ? 55.086  -23.664 88.194  1.00 43.73  ? 541  SER C N     1 
ATOM   7787  C  CA    . SER C  2  541  ? 56.388  -23.075 87.913  1.00 49.72  ? 541  SER C CA    1 
ATOM   7788  C  C     . SER C  2  541  ? 57.153  -22.811 89.195  1.00 49.64  ? 541  SER C C     1 
ATOM   7789  O  O     . SER C  2  541  ? 56.605  -22.938 90.284  1.00 52.62  ? 541  SER C O     1 
ATOM   7790  C  CB    . SER C  2  541  ? 56.220  -21.761 87.163  1.00 52.23  ? 541  SER C CB    1 
ATOM   7791  O  OG    . SER C  2  541  ? 55.645  -20.781 88.005  1.00 51.24  ? 541  SER C OG    1 
ATOM   7792  N  N     . VAL C  2  542  ? 58.419  -22.438 89.063  1.00 47.31  ? 542  VAL C N     1 
ATOM   7793  C  CA    . VAL C  2  542  ? 59.235  -22.124 90.226  1.00 45.31  ? 542  VAL C CA    1 
ATOM   7794  C  C     . VAL C  2  542  ? 58.677  -20.911 90.966  1.00 48.87  ? 542  VAL C C     1 
ATOM   7795  O  O     . VAL C  2  542  ? 58.609  -20.905 92.194  1.00 45.71  ? 542  VAL C O     1 
ATOM   7796  C  CB    . VAL C  2  542  ? 60.709  -21.883 89.845  1.00 39.74  ? 542  VAL C CB    1 
ATOM   7797  C  CG1   . VAL C  2  542  ? 61.439  -21.157 90.957  1.00 35.94  ? 542  VAL C CG1   1 
ATOM   7798  C  CG2   . VAL C  2  542  ? 61.393  -23.197 89.521  1.00 41.29  ? 542  VAL C CG2   1 
ATOM   7799  N  N     . ASN C  2  543  ? 58.267  -19.887 90.223  1.00 51.61  ? 543  ASN C N     1 
ATOM   7800  C  CA    . ASN C  2  543  ? 57.678  -18.705 90.848  1.00 47.82  ? 543  ASN C CA    1 
ATOM   7801  C  C     . ASN C  2  543  ? 56.392  -19.038 91.588  1.00 42.85  ? 543  ASN C C     1 
ATOM   7802  O  O     . ASN C  2  543  ? 56.219  -18.666 92.743  1.00 41.58  ? 543  ASN C O     1 
ATOM   7803  C  CB    . ASN C  2  543  ? 57.432  -17.607 89.816  1.00 45.27  ? 543  ASN C CB    1 
ATOM   7804  C  CG    . ASN C  2  543  ? 58.707  -17.119 89.195  1.00 46.51  ? 543  ASN C CG    1 
ATOM   7805  O  OD1   . ASN C  2  543  ? 59.363  -17.853 88.459  1.00 50.64  ? 543  ASN C OD1   1 
ATOM   7806  N  ND2   . ASN C  2  543  ? 59.078  -15.881 89.492  1.00 45.88  ? 543  ASN C ND2   1 
ATOM   7807  N  N     . THR C  2  544  ? 55.493  -19.743 90.917  1.00 39.50  ? 544  THR C N     1 
ATOM   7808  C  CA    . THR C  2  544  ? 54.244  -20.149 91.535  1.00 38.88  ? 544  THR C CA    1 
ATOM   7809  C  C     . THR C  2  544  ? 54.485  -20.976 92.801  1.00 46.49  ? 544  THR C C     1 
ATOM   7810  O  O     . THR C  2  544  ? 53.722  -20.883 93.761  1.00 46.95  ? 544  THR C O     1 
ATOM   7811  C  CB    . THR C  2  544  ? 53.373  -20.934 90.547  1.00 42.25  ? 544  THR C CB    1 
ATOM   7812  O  OG1   . THR C  2  544  ? 53.135  -20.130 89.390  1.00 42.18  ? 544  THR C OG1   1 
ATOM   7813  C  CG2   . THR C  2  544  ? 52.040  -21.299 91.176  1.00 44.24  ? 544  THR C CG2   1 
ATOM   7814  N  N     . ASN C  2  545  ? 55.553  -21.770 92.806  1.00 45.97  ? 545  ASN C N     1 
ATOM   7815  C  CA    . ASN C  2  545  ? 55.891  -22.616 93.951  1.00 43.09  ? 545  ASN C CA    1 
ATOM   7816  C  C     . ASN C  2  545  ? 56.370  -21.849 95.181  1.00 47.75  ? 545  ASN C C     1 
ATOM   7817  O  O     . ASN C  2  545  ? 56.566  -22.432 96.246  1.00 49.07  ? 545  ASN C O     1 
ATOM   7818  C  CB    . ASN C  2  545  ? 56.950  -23.645 93.561  1.00 43.29  ? 545  ASN C CB    1 
ATOM   7819  C  CG    . ASN C  2  545  ? 56.358  -24.874 92.923  1.00 49.07  ? 545  ASN C CG    1 
ATOM   7820  O  OD1   . ASN C  2  545  ? 55.869  -25.765 93.610  1.00 49.69  ? 545  ASN C OD1   1 
ATOM   7821  N  ND2   . ASN C  2  545  ? 56.407  -24.937 91.601  1.00 52.02  ? 545  ASN C ND2   1 
ATOM   7822  N  N     . LEU C  2  546  ? 56.572  -20.547 95.025  1.00 44.99  ? 546  LEU C N     1 
ATOM   7823  C  CA    . LEU C  2  546  ? 57.036  -19.711 96.121  1.00 47.74  ? 546  LEU C CA    1 
ATOM   7824  C  C     . LEU C  2  546  ? 55.868  -19.032 96.840  1.00 48.17  ? 546  LEU C C     1 
ATOM   7825  O  O     . LEU C  2  546  ? 56.057  -18.319 97.828  1.00 46.50  ? 546  LEU C O     1 
ATOM   7826  C  CB    . LEU C  2  546  ? 58.030  -18.674 95.600  1.00 45.57  ? 546  LEU C CB    1 
ATOM   7827  C  CG    . LEU C  2  546  ? 59.363  -19.251 95.144  1.00 41.64  ? 546  LEU C CG    1 
ATOM   7828  C  CD1   . LEU C  2  546  ? 60.218  -18.181 94.499  1.00 41.48  ? 546  LEU C CD1   1 
ATOM   7829  C  CD2   . LEU C  2  546  ? 60.082  -19.876 96.327  1.00 43.42  ? 546  LEU C CD2   1 
ATOM   7830  N  N     . ILE C  2  547  ? 54.661  -19.264 96.336  1.00 44.70  ? 547  ILE C N     1 
ATOM   7831  C  CA    . ILE C  2  547  ? 53.455  -18.711 96.931  1.00 48.73  ? 547  ILE C CA    1 
ATOM   7832  C  C     . ILE C  2  547  ? 52.845  -19.654 97.971  1.00 48.41  ? 547  ILE C C     1 
ATOM   7833  O  O     . ILE C  2  547  ? 52.249  -20.675 97.622  1.00 49.24  ? 547  ILE C O     1 
ATOM   7834  C  CB    . ILE C  2  547  ? 52.381  -18.439 95.865  1.00 45.96  ? 547  ILE C CB    1 
ATOM   7835  C  CG1   . ILE C  2  547  ? 52.955  -17.659 94.688  1.00 38.98  ? 547  ILE C CG1   1 
ATOM   7836  C  CG2   . ILE C  2  547  ? 51.206  -17.697 96.482  1.00 46.30  ? 547  ILE C CG2   1 
ATOM   7837  C  CD1   . ILE C  2  547  ? 51.958  -17.486 93.568  1.00 36.09  ? 547  ILE C CD1   1 
ATOM   7838  N  N     . PRO C  2  548  ? 52.977  -19.310 99.256  1.00 42.80  ? 548  PRO C N     1 
ATOM   7839  C  CA    . PRO C  2  548  ? 52.365  -20.147 100.289 1.00 43.64  ? 548  PRO C CA    1 
ATOM   7840  C  C     . PRO C  2  548  ? 50.858  -19.965 100.286 1.00 47.14  ? 548  PRO C C     1 
ATOM   7841  O  O     . PRO C  2  548  ? 50.380  -18.897 99.924  1.00 47.76  ? 548  PRO C O     1 
ATOM   7842  C  CB    . PRO C  2  548  ? 52.960  -19.590 101.577 1.00 47.23  ? 548  PRO C CB    1 
ATOM   7843  C  CG    . PRO C  2  548  ? 53.260  -18.170 101.260 1.00 46.69  ? 548  PRO C CG    1 
ATOM   7844  C  CD    . PRO C  2  548  ? 53.636  -18.120 99.816  1.00 41.49  ? 548  PRO C CD    1 
ATOM   7845  N  N     . PHE C  2  549  ? 50.122  -20.999 100.674 1.00 52.88  ? 549  PHE C N     1 
ATOM   7846  C  CA    . PHE C  2  549  ? 48.665  -20.928 100.738 1.00 51.49  ? 549  PHE C CA    1 
ATOM   7847  C  C     . PHE C  2  549  ? 48.051  -20.750 99.357  1.00 51.28  ? 549  PHE C C     1 
ATOM   7848  O  O     . PHE C  2  549  ? 46.886  -20.364 99.217  1.00 53.71  ? 549  PHE C O     1 
ATOM   7849  C  CB    . PHE C  2  549  ? 48.235  -19.792 101.652 1.00 47.39  ? 549  PHE C CB    1 
ATOM   7850  C  CG    . PHE C  2  549  ? 48.692  -19.966 103.067 1.00 51.44  ? 549  PHE C CG    1 
ATOM   7851  C  CD1   . PHE C  2  549  ? 48.199  -21.008 103.831 1.00 48.74  ? 549  PHE C CD1   1 
ATOM   7852  C  CD2   . PHE C  2  549  ? 49.619  -19.102 103.632 1.00 49.73  ? 549  PHE C CD2   1 
ATOM   7853  C  CE1   . PHE C  2  549  ? 48.612  -21.183 105.130 1.00 50.85  ? 549  PHE C CE1   1 
ATOM   7854  C  CE2   . PHE C  2  549  ? 50.034  -19.269 104.931 1.00 45.53  ? 549  PHE C CE2   1 
ATOM   7855  C  CZ    . PHE C  2  549  ? 49.531  -20.312 105.684 1.00 47.18  ? 549  PHE C CZ    1 
ATOM   7856  N  N     . LEU C  2  550  ? 48.849  -21.042 98.337  1.00 47.52  ? 550  LEU C N     1 
ATOM   7857  C  CA    . LEU C  2  550  ? 48.408  -20.976 96.955  1.00 43.56  ? 550  LEU C CA    1 
ATOM   7858  C  C     . LEU C  2  550  ? 47.041  -21.615 96.758  1.00 48.45  ? 550  LEU C C     1 
ATOM   7859  O  O     . LEU C  2  550  ? 46.239  -21.126 95.968  1.00 52.99  ? 550  LEU C O     1 
ATOM   7860  C  CB    . LEU C  2  550  ? 49.433  -21.664 96.063  1.00 46.38  ? 550  LEU C CB    1 
ATOM   7861  C  CG    . LEU C  2  550  ? 49.048  -21.759 94.595  1.00 48.22  ? 550  LEU C CG    1 
ATOM   7862  C  CD1   . LEU C  2  550  ? 48.953  -20.364 94.006  1.00 48.02  ? 550  LEU C CD1   1 
ATOM   7863  C  CD2   . LEU C  2  550  ? 50.062  -22.603 93.850  1.00 46.88  ? 550  LEU C CD2   1 
ATOM   7864  N  N     . GLU C  2  551  ? 46.778  -22.711 97.466  1.00 50.81  ? 551  GLU C N     1 
ATOM   7865  C  CA    . GLU C  2  551  ? 45.494  -23.402 97.344  1.00 50.63  ? 551  GLU C CA    1 
ATOM   7866  C  C     . GLU C  2  551  ? 44.342  -22.498 97.770  1.00 53.64  ? 551  GLU C C     1 
ATOM   7867  O  O     . GLU C  2  551  ? 43.176  -22.775 97.478  1.00 51.21  ? 551  GLU C O     1 
ATOM   7868  C  CB    . GLU C  2  551  ? 45.477  -24.684 98.173  1.00 47.20  ? 551  GLU C CB    1 
ATOM   7869  C  CG    . GLU C  2  551  ? 45.661  -24.469 99.661  1.00 44.95  ? 551  GLU C CG    1 
ATOM   7870  C  CD    . GLU C  2  551  ? 47.118  -24.454 100.067 1.00 51.32  ? 551  GLU C CD    1 
ATOM   7871  O  OE1   . GLU C  2  551  ? 47.411  -24.626 101.268 1.00 56.23  ? 551  GLU C OE1   1 
ATOM   7872  O  OE2   . GLU C  2  551  ? 47.974  -24.273 99.182  1.00 54.14  ? 551  GLU C OE2   1 
ATOM   7873  N  N     . HIS C  2  552  ? 44.672  -21.411 98.458  1.00 53.29  ? 552  HIS C N     1 
ATOM   7874  C  CA    . HIS C  2  552  ? 43.657  -20.493 98.946  1.00 50.55  ? 552  HIS C CA    1 
ATOM   7875  C  C     . HIS C  2  552  ? 43.547  -19.247 98.073  1.00 53.94  ? 552  HIS C C     1 
ATOM   7876  O  O     . HIS C  2  552  ? 42.701  -18.391 98.319  1.00 58.28  ? 552  HIS C O     1 
ATOM   7877  C  CB    . HIS C  2  552  ? 43.944  -20.106 100.397 1.00 50.95  ? 552  HIS C CB    1 
ATOM   7878  C  CG    . HIS C  2  552  ? 43.973  -21.269 101.342 1.00 52.89  ? 552  HIS C CG    1 
ATOM   7879  N  ND1   . HIS C  2  552  ? 42.846  -21.991 101.674 1.00 45.97  ? 552  HIS C ND1   1 
ATOM   7880  C  CD2   . HIS C  2  552  ? 44.991  -21.829 102.037 1.00 54.94  ? 552  HIS C CD2   1 
ATOM   7881  C  CE1   . HIS C  2  552  ? 43.170  -22.947 102.524 1.00 47.87  ? 552  HIS C CE1   1 
ATOM   7882  N  NE2   . HIS C  2  552  ? 44.467  -22.870 102.764 1.00 53.05  ? 552  HIS C NE2   1 
ATOM   7883  N  N     . ASP C  2  553  ? 44.394  -19.154 97.050  1.00 52.12  ? 553  ASP C N     1 
ATOM   7884  C  CA    . ASP C  2  553  ? 44.394  -17.998 96.148  1.00 45.91  ? 553  ASP C CA    1 
ATOM   7885  C  C     . ASP C  2  553  ? 43.771  -18.279 94.782  1.00 47.08  ? 553  ASP C C     1 
ATOM   7886  O  O     . ASP C  2  553  ? 44.165  -19.216 94.090  1.00 51.78  ? 553  ASP C O     1 
ATOM   7887  C  CB    . ASP C  2  553  ? 45.817  -17.475 95.946  1.00 41.04  ? 553  ASP C CB    1 
ATOM   7888  C  CG    . ASP C  2  553  ? 46.368  -16.800 97.176  1.00 46.33  ? 553  ASP C CG    1 
ATOM   7889  O  OD1   . ASP C  2  553  ? 47.608  -16.710 97.315  1.00 41.26  ? 553  ASP C OD1   1 
ATOM   7890  O  OD2   . ASP C  2  553  ? 45.556  -16.356 98.011  1.00 55.70  ? 553  ASP C OD2   1 
ATOM   7891  N  N     . ASP C  2  554  ? 42.810  -17.454 94.387  1.00 45.74  ? 554  ASP C N     1 
ATOM   7892  C  CA    . ASP C  2  554  ? 42.267  -17.527 93.039  1.00 46.68  ? 554  ASP C CA    1 
ATOM   7893  C  C     . ASP C  2  554  ? 43.389  -17.398 92.004  1.00 49.33  ? 554  ASP C C     1 
ATOM   7894  O  O     . ASP C  2  554  ? 44.266  -16.535 92.116  1.00 43.95  ? 554  ASP C O     1 
ATOM   7895  C  CB    . ASP C  2  554  ? 41.197  -16.449 92.838  1.00 50.69  ? 554  ASP C CB    1 
ATOM   7896  C  CG    . ASP C  2  554  ? 40.822  -16.248 91.371  1.00 56.23  ? 554  ASP C CG    1 
ATOM   7897  O  OD1   . ASP C  2  554  ? 40.123  -17.117 90.795  1.00 55.57  ? 554  ASP C OD1   1 
ATOM   7898  O  OD2   . ASP C  2  554  ? 41.210  -15.200 90.804  1.00 56.75  ? 554  ASP C OD2   1 
ATOM   7899  N  N     . ALA C  2  555  ? 43.351  -18.268 90.999  1.00 53.98  ? 555  ALA C N     1 
ATOM   7900  C  CA    . ALA C  2  555  ? 44.400  -18.347 89.984  1.00 48.34  ? 555  ALA C CA    1 
ATOM   7901  C  C     . ALA C  2  555  ? 44.798  -16.999 89.382  1.00 46.23  ? 555  ALA C C     1 
ATOM   7902  O  O     . ALA C  2  555  ? 45.988  -16.699 89.257  1.00 46.47  ? 555  ALA C O     1 
ATOM   7903  C  CB    . ALA C  2  555  ? 43.988  -19.313 88.892  1.00 47.87  ? 555  ALA C CB    1 
ATOM   7904  N  N     . ASN C  2  556  ? 43.805  -16.193 89.015  1.00 46.56  ? 556  ASN C N     1 
ATOM   7905  C  CA    . ASN C  2  556  ? 44.058  -14.893 88.391  1.00 48.04  ? 556  ASN C CA    1 
ATOM   7906  C  C     . ASN C  2  556  ? 44.990  -13.979 89.182  1.00 42.23  ? 556  ASN C C     1 
ATOM   7907  O  O     . ASN C  2  556  ? 45.686  -13.152 88.601  1.00 44.60  ? 556  ASN C O     1 
ATOM   7908  C  CB    . ASN C  2  556  ? 42.750  -14.150 88.118  1.00 42.87  ? 556  ASN C CB    1 
ATOM   7909  C  CG    . ASN C  2  556  ? 41.952  -14.763 86.989  1.00 54.10  ? 556  ASN C CG    1 
ATOM   7910  O  OD1   . ASN C  2  556  ? 42.134  -14.410 85.825  1.00 55.09  ? 556  ASN C OD1   1 
ATOM   7911  N  ND2   . ASN C  2  556  ? 41.054  -15.687 87.328  1.00 65.23  ? 556  ASN C ND2   1 
ATOM   7912  N  N     . ARG C  2  557  ? 44.993  -14.111 90.504  1.00 34.88  ? 557  ARG C N     1 
ATOM   7913  C  CA    . ARG C  2  557  ? 45.824  -13.254 91.334  1.00 35.80  ? 557  ARG C CA    1 
ATOM   7914  C  C     . ARG C  2  557  ? 47.163  -13.930 91.614  1.00 42.58  ? 557  ARG C C     1 
ATOM   7915  O  O     . ARG C  2  557  ? 48.212  -13.271 91.660  1.00 44.37  ? 557  ARG C O     1 
ATOM   7916  C  CB    . ARG C  2  557  ? 45.110  -12.922 92.641  1.00 50.73  ? 557  ARG C CB    1 
ATOM   7917  C  CG    . ARG C  2  557  ? 45.253  -11.471 93.067  1.00 47.92  ? 557  ARG C CG    1 
ATOM   7918  C  CD    . ARG C  2  557  ? 44.482  -10.554 92.138  1.00 45.42  ? 557  ARG C CD    1 
ATOM   7919  N  NE    . ARG C  2  557  ? 44.950  -9.171  92.204  1.00 40.59  ? 557  ARG C NE    1 
ATOM   7920  C  CZ    . ARG C  2  557  ? 44.344  -8.153  91.600  1.00 39.56  ? 557  ARG C CZ    1 
ATOM   7921  N  NH1   . ARG C  2  557  ? 43.237  -8.365  90.895  1.00 41.37  ? 557  ARG C NH1   1 
ATOM   7922  N  NH2   . ARG C  2  557  ? 44.837  -6.927  91.702  1.00 35.11  ? 557  ARG C NH2   1 
ATOM   7923  N  N     . ALA C  2  558  ? 47.123  -15.249 91.800  1.00 43.66  ? 558  ALA C N     1 
ATOM   7924  C  CA    . ALA C  2  558  ? 48.339  -16.048 91.910  1.00 41.09  ? 558  ALA C CA    1 
ATOM   7925  C  C     . ALA C  2  558  ? 49.270  -15.691 90.758  1.00 41.69  ? 558  ALA C C     1 
ATOM   7926  O  O     . ALA C  2  558  ? 50.463  -15.447 90.959  1.00 40.69  ? 558  ALA C O     1 
ATOM   7927  C  CB    . ALA C  2  558  ? 48.005  -17.529 91.880  1.00 39.05  ? 558  ALA C CB    1 
ATOM   7928  N  N     . LEU C  2  559  ? 48.709  -15.657 89.551  1.00 37.46  ? 559  LEU C N     1 
ATOM   7929  C  CA    . LEU C  2  559  ? 49.440  -15.225 88.362  1.00 41.62  ? 559  LEU C CA    1 
ATOM   7930  C  C     . LEU C  2  559  ? 50.269  -13.958 88.613  1.00 41.63  ? 559  LEU C C     1 
ATOM   7931  O  O     . LEU C  2  559  ? 51.470  -13.913 88.330  1.00 44.82  ? 559  LEU C O     1 
ATOM   7932  C  CB    . LEU C  2  559  ? 48.463  -15.004 87.210  1.00 39.06  ? 559  LEU C CB    1 
ATOM   7933  C  CG    . LEU C  2  559  ? 49.037  -14.539 85.871  1.00 35.94  ? 559  LEU C CG    1 
ATOM   7934  C  CD1   . LEU C  2  559  ? 48.128  -14.954 84.729  1.00 35.21  ? 559  LEU C CD1   1 
ATOM   7935  C  CD2   . LEU C  2  559  ? 49.248  -13.037 85.864  1.00 42.73  ? 559  LEU C CD2   1 
ATOM   7936  N  N     . MET C  2  560  ? 49.620  -12.930 89.140  1.00 34.99  ? 560  MET C N     1 
ATOM   7937  C  CA    . MET C  2  560  ? 50.299  -11.688 89.461  1.00 38.51  ? 560  MET C CA    1 
ATOM   7938  C  C     . MET C  2  560  ? 51.376  -11.876 90.524  1.00 41.40  ? 560  MET C C     1 
ATOM   7939  O  O     . MET C  2  560  ? 52.412  -11.214 90.484  1.00 38.46  ? 560  MET C O     1 
ATOM   7940  C  CB    . MET C  2  560  ? 49.291  -10.656 89.942  1.00 41.02  ? 560  MET C CB    1 
ATOM   7941  C  CG    . MET C  2  560  ? 48.527  -9.982  88.838  1.00 46.57  ? 560  MET C CG    1 
ATOM   7942  S  SD    . MET C  2  560  ? 46.882  -9.527  89.396  1.00 43.34  ? 560  MET C SD    1 
ATOM   7943  C  CE    . MET C  2  560  ? 46.381  -8.391  88.113  1.00 47.53  ? 560  MET C CE    1 
ATOM   7944  N  N     . GLY C  2  561  ? 51.126  -12.762 91.484  1.00 41.85  ? 561  GLY C N     1 
ATOM   7945  C  CA    . GLY C  2  561  ? 52.115  -13.035 92.517  1.00 39.90  ? 561  GLY C CA    1 
ATOM   7946  C  C     . GLY C  2  561  ? 53.397  -13.572 91.912  1.00 41.94  ? 561  GLY C C     1 
ATOM   7947  O  O     . GLY C  2  561  ? 54.498  -13.025 92.119  1.00 44.02  ? 561  GLY C O     1 
ATOM   7948  N  N     . SER C  2  562  ? 53.240  -14.650 91.149  1.00 40.93  ? 562  SER C N     1 
ATOM   7949  C  CA    . SER C  2  562  ? 54.340  -15.236 90.408  1.00 42.67  ? 562  SER C CA    1 
ATOM   7950  C  C     . SER C  2  562  ? 55.059  -14.143 89.640  1.00 43.42  ? 562  SER C C     1 
ATOM   7951  O  O     . SER C  2  562  ? 56.203  -13.808 89.940  1.00 45.03  ? 562  SER C O     1 
ATOM   7952  C  CB    . SER C  2  562  ? 53.823  -16.291 89.431  1.00 43.13  ? 562  SER C CB    1 
ATOM   7953  O  OG    . SER C  2  562  ? 53.198  -17.359 90.114  1.00 42.72  ? 562  SER C OG    1 
ATOM   7954  N  N     . ASN C  2  563  ? 54.372  -13.570 88.661  1.00 38.65  ? 563  ASN C N     1 
ATOM   7955  C  CA    . ASN C  2  563  ? 54.994  -12.578 87.805  1.00 39.32  ? 563  ASN C CA    1 
ATOM   7956  C  C     . ASN C  2  563  ? 55.744  -11.494 88.571  1.00 38.01  ? 563  ASN C C     1 
ATOM   7957  O  O     . ASN C  2  563  ? 56.789  -11.031 88.139  1.00 50.12  ? 563  ASN C O     1 
ATOM   7958  C  CB    . ASN C  2  563  ? 53.961  -11.955 86.866  1.00 44.53  ? 563  ASN C CB    1 
ATOM   7959  C  CG    . ASN C  2  563  ? 53.603  -12.864 85.701  1.00 51.66  ? 563  ASN C CG    1 
ATOM   7960  O  OD1   . ASN C  2  563  ? 54.418  -13.669 85.243  1.00 52.84  ? 563  ASN C OD1   1 
ATOM   7961  N  ND2   . ASN C  2  563  ? 52.378  -12.731 85.210  1.00 51.55  ? 563  ASN C ND2   1 
ATOM   7962  N  N     . MET C  2  564  ? 55.222  -11.086 89.710  1.00 37.50  ? 564  MET C N     1 
ATOM   7963  C  CA    . MET C  2  564  ? 55.812  -9.949  90.392  1.00 40.14  ? 564  MET C CA    1 
ATOM   7964  C  C     . MET C  2  564  ? 57.022  -10.295 91.234  1.00 46.32  ? 564  MET C C     1 
ATOM   7965  O  O     . MET C  2  564  ? 57.887  -9.447  91.434  1.00 47.32  ? 564  MET C O     1 
ATOM   7966  C  CB    . MET C  2  564  ? 54.770  -9.209  91.219  1.00 40.00  ? 564  MET C CB    1 
ATOM   7967  C  CG    . MET C  2  564  ? 53.689  -8.608  90.357  1.00 46.70  ? 564  MET C CG    1 
ATOM   7968  S  SD    . MET C  2  564  ? 52.646  -7.468  91.244  1.00 42.35  ? 564  MET C SD    1 
ATOM   7969  C  CE    . MET C  2  564  ? 51.939  -8.558  92.488  1.00 42.63  ? 564  MET C CE    1 
ATOM   7970  N  N     . GLN C  2  565  ? 57.101  -11.523 91.739  1.00 49.03  ? 565  GLN C N     1 
ATOM   7971  C  CA    . GLN C  2  565  ? 58.324  -11.905 92.447  1.00 44.95  ? 565  GLN C CA    1 
ATOM   7972  C  C     . GLN C  2  565  ? 59.533  -11.634 91.539  1.00 46.04  ? 565  GLN C C     1 
ATOM   7973  O  O     . GLN C  2  565  ? 60.639  -11.333 91.995  1.00 48.39  ? 565  GLN C O     1 
ATOM   7974  C  CB    . GLN C  2  565  ? 58.284  -13.370 92.874  1.00 43.87  ? 565  GLN C CB    1 
ATOM   7975  C  CG    . GLN C  2  565  ? 57.059  -13.738 93.650  1.00 39.98  ? 565  GLN C CG    1 
ATOM   7976  C  CD    . GLN C  2  565  ? 57.243  -15.008 94.431  1.00 44.78  ? 565  GLN C CD    1 
ATOM   7977  O  OE1   . GLN C  2  565  ? 56.523  -15.983 94.230  1.00 49.57  ? 565  GLN C OE1   1 
ATOM   7978  N  NE2   . GLN C  2  565  ? 58.207  -15.004 95.341  1.00 43.19  ? 565  GLN C NE2   1 
ATOM   7979  N  N     . THR C  2  566  ? 59.300  -11.734 90.240  1.00 43.25  ? 566  THR C N     1 
ATOM   7980  C  CA    . THR C  2  566  ? 60.325  -11.465 89.247  1.00 44.57  ? 566  THR C CA    1 
ATOM   7981  C  C     . THR C  2  566  ? 60.757  -10.003 89.265  1.00 44.28  ? 566  THR C C     1 
ATOM   7982  O  O     . THR C  2  566  ? 61.817  -9.652  88.753  1.00 49.92  ? 566  THR C O     1 
ATOM   7983  C  CB    . THR C  2  566  ? 59.804  -11.822 87.853  1.00 40.12  ? 566  THR C CB    1 
ATOM   7984  O  OG1   . THR C  2  566  ? 59.688  -13.248 87.750  1.00 43.34  ? 566  THR C OG1   1 
ATOM   7985  C  CG2   . THR C  2  566  ? 60.732  -11.296 86.777  1.00 45.81  ? 566  THR C CG2   1 
ATOM   7986  N  N     . GLN C  2  567  ? 59.934  -9.153  89.864  1.00 40.63  ? 567  GLN C N     1 
ATOM   7987  C  CA    . GLN C  2  567  ? 60.155  -7.719  89.790  1.00 37.09  ? 567  GLN C CA    1 
ATOM   7988  C  C     . GLN C  2  567  ? 60.705  -7.179  91.088  1.00 36.06  ? 567  GLN C C     1 
ATOM   7989  O  O     . GLN C  2  567  ? 60.972  -5.984  91.203  1.00 37.18  ? 567  GLN C O     1 
ATOM   7990  C  CB    . GLN C  2  567  ? 58.859  -6.995  89.434  1.00 37.09  ? 567  GLN C CB    1 
ATOM   7991  C  CG    . GLN C  2  567  ? 58.196  -7.524  88.179  1.00 40.01  ? 567  GLN C CG    1 
ATOM   7992  C  CD    . GLN C  2  567  ? 56.880  -6.846  87.887  1.00 44.91  ? 567  GLN C CD    1 
ATOM   7993  O  OE1   . GLN C  2  567  ? 56.731  -5.642  88.088  1.00 42.67  ? 567  GLN C OE1   1 
ATOM   7994  N  NE2   . GLN C  2  567  ? 55.906  -7.620  87.417  1.00 57.63  ? 567  GLN C NE2   1 
ATOM   7995  N  N     . ALA C  2  568  ? 60.880  -8.068  92.059  1.00 39.77  ? 568  ALA C N     1 
ATOM   7996  C  CA    . ALA C  2  568  ? 61.309  -7.667  93.397  1.00 34.08  ? 568  ALA C CA    1 
ATOM   7997  C  C     . ALA C  2  568  ? 62.736  -7.156  93.389  1.00 34.74  ? 568  ALA C C     1 
ATOM   7998  O  O     . ALA C  2  568  ? 63.645  -7.809  92.883  1.00 45.78  ? 568  ALA C O     1 
ATOM   7999  C  CB    . ALA C  2  568  ? 61.156  -8.811  94.383  1.00 37.62  ? 568  ALA C CB    1 
ATOM   8000  N  N     . VAL C  2  569  ? 62.916  -5.972  93.952  1.00 36.05  ? 569  VAL C N     1 
ATOM   8001  C  CA    . VAL C  2  569  ? 64.223  -5.353  94.070  1.00 38.65  ? 569  VAL C CA    1 
ATOM   8002  C  C     . VAL C  2  569  ? 64.954  -5.869  95.309  1.00 45.75  ? 569  VAL C C     1 
ATOM   8003  O  O     . VAL C  2  569  ? 64.358  -5.981  96.383  1.00 51.62  ? 569  VAL C O     1 
ATOM   8004  C  CB    . VAL C  2  569  ? 64.070  -3.832  94.159  1.00 34.14  ? 569  VAL C CB    1 
ATOM   8005  C  CG1   . VAL C  2  569  ? 65.180  -3.225  94.982  1.00 36.44  ? 569  VAL C CG1   1 
ATOM   8006  C  CG2   . VAL C  2  569  ? 64.019  -3.237  92.772  1.00 41.92  ? 569  VAL C CG2   1 
ATOM   8007  N  N     . PRO C  2  570  ? 66.243  -6.216  95.156  1.00 44.03  ? 570  PRO C N     1 
ATOM   8008  C  CA    . PRO C  2  570  ? 67.118  -6.637  96.258  1.00 45.59  ? 570  PRO C CA    1 
ATOM   8009  C  C     . PRO C  2  570  ? 67.397  -5.507  97.244  1.00 50.60  ? 570  PRO C C     1 
ATOM   8010  O  O     . PRO C  2  570  ? 67.921  -4.462  96.843  1.00 47.94  ? 570  PRO C O     1 
ATOM   8011  C  CB    . PRO C  2  570  ? 68.412  -7.027  95.546  1.00 39.95  ? 570  PRO C CB    1 
ATOM   8012  C  CG    . PRO C  2  570  ? 67.985  -7.369  94.162  1.00 44.63  ? 570  PRO C CG    1 
ATOM   8013  C  CD    . PRO C  2  570  ? 66.883  -6.415  93.846  1.00 45.82  ? 570  PRO C CD    1 
ATOM   8014  N  N     . LEU C  2  571  ? 67.076  -5.740  98.518  1.00 53.73  ? 571  LEU C N     1 
ATOM   8015  C  CA    . LEU C  2  571  ? 67.154  -4.718  99.565  1.00 46.88  ? 571  LEU C CA    1 
ATOM   8016  C  C     . LEU C  2  571  ? 68.373  -4.879  100.476 1.00 46.68  ? 571  LEU C C     1 
ATOM   8017  O  O     . LEU C  2  571  ? 68.786  -5.998  100.766 1.00 51.74  ? 571  LEU C O     1 
ATOM   8018  C  CB    . LEU C  2  571  ? 65.885  -4.770  100.403 1.00 45.06  ? 571  LEU C CB    1 
ATOM   8019  C  CG    . LEU C  2  571  ? 64.602  -4.631  99.593  1.00 42.35  ? 571  LEU C CG    1 
ATOM   8020  C  CD1   . LEU C  2  571  ? 63.391  -5.088  100.394 1.00 41.15  ? 571  LEU C CD1   1 
ATOM   8021  C  CD2   . LEU C  2  571  ? 64.462  -3.198  99.136  1.00 44.41  ? 571  LEU C CD2   1 
ATOM   8022  N  N     . ILE C  2  572  ? 68.933  -3.759  100.935 1.00 42.88  ? 572  ILE C N     1 
ATOM   8023  C  CA    . ILE C  2  572  ? 70.123  -3.793  101.788 1.00 46.87  ? 572  ILE C CA    1 
ATOM   8024  C  C     . ILE C  2  572  ? 69.914  -4.628  103.051 1.00 47.65  ? 572  ILE C C     1 
ATOM   8025  O  O     . ILE C  2  572  ? 70.846  -5.272  103.532 1.00 47.01  ? 572  ILE C O     1 
ATOM   8026  C  CB    . ILE C  2  572  ? 70.654  -2.378  102.147 1.00 41.73  ? 572  ILE C CB    1 
ATOM   8027  C  CG1   . ILE C  2  572  ? 69.693  -1.635  103.070 1.00 43.61  ? 572  ILE C CG1   1 
ATOM   8028  C  CG2   . ILE C  2  572  ? 70.904  -1.566  100.892 1.00 40.91  ? 572  ILE C CG2   1 
ATOM   8029  C  CD1   . ILE C  2  572  ? 70.147  -0.232  103.402 1.00 38.78  ? 572  ILE C CD1   1 
ATOM   8030  N  N     . ARG C  2  573  ? 68.692  -4.615  103.578 1.00 45.08  ? 573  ARG C N     1 
ATOM   8031  C  CA    . ARG C  2  573  ? 68.320  -5.496  104.675 1.00 47.26  ? 573  ARG C CA    1 
ATOM   8032  C  C     . ARG C  2  573  ? 67.191  -6.404  104.217 1.00 53.10  ? 573  ARG C C     1 
ATOM   8033  O  O     . ARG C  2  573  ? 66.021  -6.105  104.435 1.00 67.25  ? 573  ARG C O     1 
ATOM   8034  C  CB    . ARG C  2  573  ? 67.865  -4.693  105.895 1.00 46.50  ? 573  ARG C CB    1 
ATOM   8035  C  CG    . ARG C  2  573  ? 68.719  -3.483  106.212 1.00 45.69  ? 573  ARG C CG    1 
ATOM   8036  C  CD    . ARG C  2  573  ? 68.316  -2.883  107.540 1.00 58.06  ? 573  ARG C CD    1 
ATOM   8037  N  NE    . ARG C  2  573  ? 68.421  -3.857  108.623 1.00 58.95  ? 573  ARG C NE    1 
ATOM   8038  C  CZ    . ARG C  2  573  ? 68.010  -3.636  109.866 1.00 56.85  ? 573  ARG C CZ    1 
ATOM   8039  N  NH1   . ARG C  2  573  ? 67.460  -2.473  110.191 1.00 51.70  ? 573  ARG C NH1   1 
ATOM   8040  N  NH2   . ARG C  2  573  ? 68.142  -4.580  110.786 1.00 71.28  ? 573  ARG C NH2   1 
ATOM   8041  N  N     . ALA C  2  574  ? 67.537  -7.521  103.594 1.00 45.78  ? 574  ALA C N     1 
ATOM   8042  C  CA    . ALA C  2  574  ? 66.520  -8.391  103.024 1.00 45.48  ? 574  ALA C CA    1 
ATOM   8043  C  C     . ALA C  2  574  ? 66.246  -9.599  103.900 1.00 51.20  ? 574  ALA C C     1 
ATOM   8044  O  O     . ALA C  2  574  ? 67.155  -10.115 104.552 1.00 60.61  ? 574  ALA C O     1 
ATOM   8045  C  CB    . ALA C  2  574  ? 66.922  -8.828  101.630 1.00 41.07  ? 574  ALA C CB    1 
ATOM   8046  N  N     . GLN C  2  575  ? 64.997  -10.060 103.906 1.00 42.75  ? 575  GLN C N     1 
ATOM   8047  C  CA    . GLN C  2  575  ? 64.634  -11.209 104.727 1.00 49.59  ? 575  GLN C CA    1 
ATOM   8048  C  C     . GLN C  2  575  ? 63.846  -12.234 103.934 1.00 45.83  ? 575  GLN C C     1 
ATOM   8049  O  O     . GLN C  2  575  ? 63.099  -11.879 103.032 1.00 47.13  ? 575  GLN C O     1 
ATOM   8050  C  CB    . GLN C  2  575  ? 63.815  -10.762 105.936 1.00 48.67  ? 575  GLN C CB    1 
ATOM   8051  C  CG    . GLN C  2  575  ? 63.921  -9.283  106.243 1.00 46.31  ? 575  GLN C CG    1 
ATOM   8052  C  CD    . GLN C  2  575  ? 63.183  -8.905  107.503 1.00 50.20  ? 575  GLN C CD    1 
ATOM   8053  O  OE1   . GLN C  2  575  ? 62.439  -7.924  107.529 1.00 54.23  ? 575  GLN C OE1   1 
ATOM   8054  N  NE2   . GLN C  2  575  ? 63.386  -9.681  108.563 1.00 56.11  ? 575  GLN C NE2   1 
ATOM   8055  N  N     . ALA C  2  576  ? 64.024  -13.507 104.268 1.00 44.87  ? 576  ALA C N     1 
ATOM   8056  C  CA    . ALA C  2  576  ? 63.153  -14.546 103.751 1.00 46.25  ? 576  ALA C CA    1 
ATOM   8057  C  C     . ALA C  2  576  ? 61.813  -14.397 104.462 1.00 51.09  ? 576  ALA C C     1 
ATOM   8058  O  O     . ALA C  2  576  ? 61.761  -13.941 105.603 1.00 49.03  ? 576  ALA C O     1 
ATOM   8059  C  CB    . ALA C  2  576  ? 63.741  -15.911 104.008 1.00 45.48  ? 576  ALA C CB    1 
ATOM   8060  N  N     . PRO C  2  577  ? 60.719  -14.762 103.787 1.00 45.81  ? 577  PRO C N     1 
ATOM   8061  C  CA    . PRO C  2  577  ? 59.397  -14.628 104.400 1.00 50.30  ? 577  PRO C CA    1 
ATOM   8062  C  C     . PRO C  2  577  ? 59.271  -15.471 105.668 1.00 52.48  ? 577  PRO C C     1 
ATOM   8063  O  O     . PRO C  2  577  ? 59.902  -16.522 105.759 1.00 51.45  ? 577  PRO C O     1 
ATOM   8064  C  CB    . PRO C  2  577  ? 58.454  -15.143 103.305 1.00 49.38  ? 577  PRO C CB    1 
ATOM   8065  C  CG    . PRO C  2  577  ? 59.316  -15.930 102.381 1.00 43.59  ? 577  PRO C CG    1 
ATOM   8066  C  CD    . PRO C  2  577  ? 60.641  -15.266 102.409 1.00 43.26  ? 577  PRO C CD    1 
ATOM   8067  N  N     . VAL C  2  578  ? 58.477  -15.009 106.633 1.00 55.14  ? 578  VAL C N     1 
ATOM   8068  C  CA    . VAL C  2  578  ? 58.263  -15.768 107.862 1.00 51.69  ? 578  VAL C CA    1 
ATOM   8069  C  C     . VAL C  2  578  ? 57.511  -17.037 107.531 1.00 54.99  ? 578  VAL C C     1 
ATOM   8070  O  O     . VAL C  2  578  ? 57.666  -18.057 108.206 1.00 56.79  ? 578  VAL C O     1 
ATOM   8071  C  CB    . VAL C  2  578  ? 57.461  -14.983 108.911 1.00 46.74  ? 578  VAL C CB    1 
ATOM   8072  C  CG1   . VAL C  2  578  ? 58.274  -13.815 109.453 1.00 44.61  ? 578  VAL C CG1   1 
ATOM   8073  C  CG2   . VAL C  2  578  ? 56.142  -14.518 108.317 1.00 57.12  ? 578  VAL C CG2   1 
ATOM   8074  N  N     . VAL C  2  579  ? 56.684  -16.968 106.492 1.00 50.64  ? 579  VAL C N     1 
ATOM   8075  C  CA    . VAL C  2  579  ? 56.050  -18.167 105.962 1.00 52.04  ? 579  VAL C CA    1 
ATOM   8076  C  C     . VAL C  2  579  ? 56.654  -18.494 104.608 1.00 56.70  ? 579  VAL C C     1 
ATOM   8077  O  O     . VAL C  2  579  ? 56.588  -17.683 103.685 1.00 60.71  ? 579  VAL C O     1 
ATOM   8078  C  CB    . VAL C  2  579  ? 54.538  -17.999 105.807 1.00 44.37  ? 579  VAL C CB    1 
ATOM   8079  C  CG1   . VAL C  2  579  ? 53.936  -19.251 105.196 1.00 42.16  ? 579  VAL C CG1   1 
ATOM   8080  C  CG2   . VAL C  2  579  ? 53.911  -17.698 107.149 1.00 46.84  ? 579  VAL C CG2   1 
ATOM   8081  N  N     . MET C  2  580  ? 57.251  -19.675 104.495 1.00 52.23  ? 580  MET C N     1 
ATOM   8082  C  CA    . MET C  2  580  ? 57.879  -20.088 103.251 1.00 46.88  ? 580  MET C CA    1 
ATOM   8083  C  C     . MET C  2  580  ? 57.233  -21.362 102.721 1.00 50.76  ? 580  MET C C     1 
ATOM   8084  O  O     . MET C  2  580  ? 56.527  -22.060 103.448 1.00 49.31  ? 580  MET C O     1 
ATOM   8085  C  CB    . MET C  2  580  ? 59.377  -20.292 103.455 1.00 46.92  ? 580  MET C CB    1 
ATOM   8086  C  CG    . MET C  2  580  ? 60.116  -19.047 103.910 1.00 53.23  ? 580  MET C CG    1 
ATOM   8087  S  SD    . MET C  2  580  ? 61.875  -19.332 104.245 1.00 57.68  ? 580  MET C SD    1 
ATOM   8088  C  CE    . MET C  2  580  ? 61.790  -20.626 105.474 1.00 48.22  ? 580  MET C CE    1 
ATOM   8089  N  N     . THR C  2  581  ? 57.463  -21.653 101.446 1.00 52.07  ? 581  THR C N     1 
ATOM   8090  C  CA    . THR C  2  581  ? 56.917  -22.856 100.837 1.00 51.95  ? 581  THR C CA    1 
ATOM   8091  C  C     . THR C  2  581  ? 57.933  -23.993 100.895 1.00 56.30  ? 581  THR C C     1 
ATOM   8092  O  O     . THR C  2  581  ? 57.584  -25.161 100.706 1.00 57.40  ? 581  THR C O     1 
ATOM   8093  C  CB    . THR C  2  581  ? 56.499  -22.610 99.375  1.00 53.02  ? 581  THR C CB    1 
ATOM   8094  O  OG1   . THR C  2  581  ? 57.634  -22.184 98.616  1.00 50.98  ? 581  THR C OG1   1 
ATOM   8095  C  CG2   . THR C  2  581  ? 55.425  -21.541 99.297  1.00 49.10  ? 581  THR C CG2   1 
ATOM   8096  N  N     . GLY C  2  582  ? 59.189  -23.643 101.163 1.00 55.46  ? 582  GLY C N     1 
ATOM   8097  C  CA    . GLY C  2  582  ? 60.253  -24.625 101.259 1.00 57.04  ? 582  GLY C CA    1 
ATOM   8098  C  C     . GLY C  2  582  ? 61.120  -24.739 100.015 1.00 64.07  ? 582  GLY C C     1 
ATOM   8099  O  O     . GLY C  2  582  ? 61.980  -25.616 99.923  1.00 68.27  ? 582  GLY C O     1 
ATOM   8100  N  N     . LEU C  2  583  ? 60.892  -23.859 99.049  1.00 54.55  ? 583  LEU C N     1 
ATOM   8101  C  CA    . LEU C  2  583  ? 61.692  -23.847 97.836  1.00 52.86  ? 583  LEU C CA    1 
ATOM   8102  C  C     . LEU C  2  583  ? 62.715  -22.712 97.862  1.00 51.20  ? 583  LEU C C     1 
ATOM   8103  O  O     . LEU C  2  583  ? 63.593  -22.641 97.010  1.00 47.73  ? 583  LEU C O     1 
ATOM   8104  C  CB    . LEU C  2  583  ? 60.785  -23.683 96.618  1.00 53.11  ? 583  LEU C CB    1 
ATOM   8105  C  CG    . LEU C  2  583  ? 61.088  -24.548 95.400  1.00 47.83  ? 583  LEU C CG    1 
ATOM   8106  C  CD1   . LEU C  2  583  ? 60.877  -26.010 95.748  1.00 58.98  ? 583  LEU C CD1   1 
ATOM   8107  C  CD2   . LEU C  2  583  ? 60.206  -24.147 94.243  1.00 37.70  ? 583  LEU C CD2   1 
ATOM   8108  N  N     . GLU C  2  584  ? 62.602  -21.834 98.852  1.00 53.78  ? 584  GLU C N     1 
ATOM   8109  C  CA    . GLU C  2  584  ? 63.337  -20.573 98.841  1.00 50.31  ? 584  GLU C CA    1 
ATOM   8110  C  C     . GLU C  2  584  ? 64.856  -20.708 98.963  1.00 49.96  ? 584  GLU C C     1 
ATOM   8111  O  O     . GLU C  2  584  ? 65.583  -19.771 98.648  1.00 48.97  ? 584  GLU C O     1 
ATOM   8112  C  CB    . GLU C  2  584  ? 62.793  -19.618 99.912  1.00 45.58  ? 584  GLU C CB    1 
ATOM   8113  C  CG    . GLU C  2  584  ? 61.860  -20.276 100.906 1.00 52.21  ? 584  GLU C CG    1 
ATOM   8114  C  CD    . GLU C  2  584  ? 60.410  -20.282 100.452 1.00 60.10  ? 584  GLU C CD    1 
ATOM   8115  O  OE1   . GLU C  2  584  ? 59.951  -19.270 99.878  1.00 59.98  ? 584  GLU C OE1   1 
ATOM   8116  O  OE2   . GLU C  2  584  ? 59.722  -21.300 100.683 1.00 61.85  ? 584  GLU C OE2   1 
ATOM   8117  N  N     . GLU C  2  585  ? 65.333  -21.864 99.415  1.00 55.45  ? 585  GLU C N     1 
ATOM   8118  C  CA    . GLU C  2  585  ? 66.769  -22.089 99.598  1.00 55.87  ? 585  GLU C CA    1 
ATOM   8119  C  C     . GLU C  2  585  ? 67.380  -22.610 98.307  1.00 54.33  ? 585  GLU C C     1 
ATOM   8120  O  O     . GLU C  2  585  ? 68.403  -22.110 97.816  1.00 56.05  ? 585  GLU C O     1 
ATOM   8121  C  CB    . GLU C  2  585  ? 66.997  -23.114 100.710 1.00 55.20  ? 585  GLU C CB    1 
ATOM   8122  C  CG    . GLU C  2  585  ? 68.003  -22.699 101.767 1.00 61.45  ? 585  GLU C CG    1 
ATOM   8123  C  CD    . GLU C  2  585  ? 67.857  -23.509 103.048 1.00 76.67  ? 585  GLU C CD    1 
ATOM   8124  O  OE1   . GLU C  2  585  ? 66.881  -24.289 103.148 1.00 71.57  ? 585  GLU C OE1   1 
ATOM   8125  O  OE2   . GLU C  2  585  ? 68.712  -23.364 103.954 1.00 82.55  ? 585  GLU C OE2   1 
ATOM   8126  N  N     . ARG C  2  586  ? 66.728  -23.629 97.767  1.00 52.13  ? 586  ARG C N     1 
ATOM   8127  C  CA    . ARG C  2  586  ? 67.161  -24.289 96.551  1.00 49.06  ? 586  ARG C CA    1 
ATOM   8128  C  C     . ARG C  2  586  ? 67.184  -23.318 95.369  1.00 51.74  ? 586  ARG C C     1 
ATOM   8129  O  O     . ARG C  2  586  ? 67.924  -23.512 94.409  1.00 56.00  ? 586  ARG C O     1 
ATOM   8130  C  CB    . ARG C  2  586  ? 66.231  -25.469 96.278  1.00 46.58  ? 586  ARG C CB    1 
ATOM   8131  C  CG    . ARG C  2  586  ? 66.496  -26.205 95.000  1.00 55.45  ? 586  ARG C CG    1 
ATOM   8132  C  CD    . ARG C  2  586  ? 67.746  -27.045 95.058  1.00 41.93  ? 586  ARG C CD    1 
ATOM   8133  N  NE    . ARG C  2  586  ? 68.029  -27.568 93.726  1.00 47.76  ? 586  ARG C NE    1 
ATOM   8134  C  CZ    . ARG C  2  586  ? 67.363  -28.574 93.171  1.00 51.20  ? 586  ARG C CZ    1 
ATOM   8135  N  NH1   . ARG C  2  586  ? 66.389  -29.168 93.843  1.00 52.03  ? 586  ARG C NH1   1 
ATOM   8136  N  NH2   . ARG C  2  586  ? 67.670  -28.989 91.950  1.00 58.52  ? 586  ARG C NH2   1 
ATOM   8137  N  N     . VAL C  2  587  ? 66.375  -22.268 95.439  1.00 53.45  ? 587  VAL C N     1 
ATOM   8138  C  CA    . VAL C  2  587  ? 66.377  -21.251 94.397  1.00 50.28  ? 587  VAL C CA    1 
ATOM   8139  C  C     . VAL C  2  587  ? 67.652  -20.417 94.477  1.00 51.46  ? 587  VAL C C     1 
ATOM   8140  O  O     . VAL C  2  587  ? 68.324  -20.199 93.474  1.00 54.18  ? 587  VAL C O     1 
ATOM   8141  C  CB    . VAL C  2  587  ? 65.133  -20.343 94.480  1.00 47.86  ? 587  VAL C CB    1 
ATOM   8142  C  CG1   . VAL C  2  587  ? 65.277  -19.154 93.542  1.00 46.92  ? 587  VAL C CG1   1 
ATOM   8143  C  CG2   . VAL C  2  587  ? 63.878  -21.137 94.145  1.00 42.01  ? 587  VAL C CG2   1 
ATOM   8144  N  N     . VAL C  2  588  ? 67.988  -19.956 95.674  1.00 47.37  ? 588  VAL C N     1 
ATOM   8145  C  CA    . VAL C  2  588  ? 69.237  -19.239 95.869  1.00 48.76  ? 588  VAL C CA    1 
ATOM   8146  C  C     . VAL C  2  588  ? 70.381  -20.127 95.401  1.00 54.35  ? 588  VAL C C     1 
ATOM   8147  O  O     . VAL C  2  588  ? 71.389  -19.647 94.889  1.00 60.76  ? 588  VAL C O     1 
ATOM   8148  C  CB    . VAL C  2  588  ? 69.456  -18.870 97.347  1.00 44.05  ? 588  VAL C CB    1 
ATOM   8149  C  CG1   . VAL C  2  588  ? 70.667  -17.963 97.499  1.00 53.55  ? 588  VAL C CG1   1 
ATOM   8150  C  CG2   . VAL C  2  588  ? 68.230  -18.196 97.905  1.00 46.98  ? 588  VAL C CG2   1 
ATOM   8151  N  N     . ARG C  2  589  ? 70.213  -21.433 95.572  1.00 55.86  ? 589  ARG C N     1 
ATOM   8152  C  CA    . ARG C  2  589  ? 71.243  -22.392 95.186  1.00 56.28  ? 589  ARG C CA    1 
ATOM   8153  C  C     . ARG C  2  589  ? 71.406  -22.488 93.669  1.00 54.08  ? 589  ARG C C     1 
ATOM   8154  O  O     . ARG C  2  589  ? 72.451  -22.132 93.132  1.00 52.84  ? 589  ARG C O     1 
ATOM   8155  C  CB    . ARG C  2  589  ? 70.928  -23.769 95.787  1.00 58.62  ? 589  ARG C CB    1 
ATOM   8156  C  CG    . ARG C  2  589  ? 71.880  -24.895 95.405  1.00 52.35  ? 589  ARG C CG    1 
ATOM   8157  C  CD    . ARG C  2  589  ? 73.287  -24.662 95.931  1.00 69.75  ? 589  ARG C CD    1 
ATOM   8158  N  NE    . ARG C  2  589  ? 73.367  -24.639 97.391  1.00 81.34  ? 589  ARG C NE    1 
ATOM   8159  C  CZ    . ARG C  2  589  ? 73.335  -25.721 98.161  1.00 72.20  ? 589  ARG C CZ    1 
ATOM   8160  N  NH1   . ARG C  2  589  ? 73.198  -26.920 97.614  1.00 78.04  ? 589  ARG C NH1   1 
ATOM   8161  N  NH2   . ARG C  2  589  ? 73.426  -25.606 99.478  1.00 66.14  ? 589  ARG C NH2   1 
ATOM   8162  N  N     . ASP C  2  590  ? 70.369  -22.960 92.985  1.00 49.03  ? 590  ASP C N     1 
ATOM   8163  C  CA    . ASP C  2  590  ? 70.448  -23.245 91.555  1.00 49.75  ? 590  ASP C CA    1 
ATOM   8164  C  C     . ASP C  2  590  ? 70.766  -22.031 90.684  1.00 55.57  ? 590  ASP C C     1 
ATOM   8165  O  O     . ASP C  2  590  ? 71.375  -22.159 89.619  1.00 62.98  ? 590  ASP C O     1 
ATOM   8166  C  CB    . ASP C  2  590  ? 69.184  -23.950 91.079  1.00 49.81  ? 590  ASP C CB    1 
ATOM   8167  C  CG    . ASP C  2  590  ? 69.099  -25.374 91.584  1.00 56.57  ? 590  ASP C CG    1 
ATOM   8168  O  OD1   . ASP C  2  590  ? 69.767  -25.679 92.594  1.00 51.76  ? 590  ASP C OD1   1 
ATOM   8169  O  OD2   . ASP C  2  590  ? 68.377  -26.188 90.967  1.00 63.72  ? 590  ASP C OD2   1 
ATOM   8170  N  N     . SER C  2  591  ? 70.346  -20.856 91.132  1.00 55.13  ? 591  SER C N     1 
ATOM   8171  C  CA    . SER C  2  591  ? 70.837  -19.622 90.543  1.00 59.16  ? 591  SER C CA    1 
ATOM   8172  C  C     . SER C  2  591  ? 72.061  -19.216 91.321  1.00 58.75  ? 591  SER C C     1 
ATOM   8173  O  O     . SER C  2  591  ? 71.993  -18.998 92.525  1.00 68.26  ? 591  SER C O     1 
ATOM   8174  C  CB    . SER C  2  591  ? 69.811  -18.502 90.632  1.00 67.32  ? 591  SER C CB    1 
ATOM   8175  O  OG    . SER C  2  591  ? 70.448  -17.262 90.368  1.00 70.58  ? 591  SER C OG    1 
ATOM   8176  N  N     . LEU C  2  592  ? 73.186  -19.108 90.637  1.00 60.53  ? 592  LEU C N     1 
ATOM   8177  C  CA    . LEU C  2  592  ? 74.439  -18.850 91.327  1.00 67.81  ? 592  LEU C CA    1 
ATOM   8178  C  C     . LEU C  2  592  ? 74.499  -17.402 91.793  1.00 73.44  ? 592  LEU C C     1 
ATOM   8179  O  O     . LEU C  2  592  ? 74.860  -16.504 91.036  1.00 87.58  ? 592  LEU C O     1 
ATOM   8180  C  CB    . LEU C  2  592  ? 75.622  -19.195 90.424  1.00 66.17  ? 592  LEU C CB    1 
ATOM   8181  C  CG    . LEU C  2  592  ? 75.394  -20.442 89.551  1.00 65.36  ? 592  LEU C CG    1 
ATOM   8182  C  CD1   . LEU C  2  592  ? 76.682  -20.865 88.874  1.00 73.42  ? 592  LEU C CD1   1 
ATOM   8183  C  CD2   . LEU C  2  592  ? 74.818  -21.591 90.362  1.00 65.24  ? 592  LEU C CD2   1 
ATOM   8184  N  N     . ALA C  2  593  ? 74.125  -17.193 93.048  1.00 67.24  ? 593  ALA C N     1 
ATOM   8185  C  CA    . ALA C  2  593  ? 74.193  -15.886 93.678  1.00 76.69  ? 593  ALA C CA    1 
ATOM   8186  C  C     . ALA C  2  593  ? 74.975  -16.031 94.978  1.00 79.67  ? 593  ALA C C     1 
ATOM   8187  O  O     . ALA C  2  593  ? 75.987  -15.358 95.197  1.00 69.02  ? 593  ALA C O     1 
ATOM   8188  C  CB    . ALA C  2  593  ? 72.795  -15.357 93.952  1.00 79.77  ? 593  ALA C CB    1 
ATOM   8189  N  N     . ALA C  2  594  ? 74.484  -16.920 95.836  1.00 72.11  ? 594  ALA C N     1 
ATOM   8190  C  CA    . ALA C  2  594  ? 75.185  -17.303 97.053  1.00 63.12  ? 594  ALA C CA    1 
ATOM   8191  C  C     . ALA C  2  594  ? 76.432  -18.124 96.715  1.00 64.15  ? 594  ALA C C     1 
ATOM   8192  O  O     . ALA C  2  594  ? 76.467  -18.848 95.723  1.00 62.48  ? 594  ALA C O     1 
ATOM   8193  C  CB    . ALA C  2  594  ? 74.267  -18.091 97.963  1.00 60.58  ? 594  ALA C CB    1 
ATOM   8194  N  N     . LEU C  2  595  ? 77.457  -17.997 97.546  1.00 66.55  ? 595  LEU C N     1 
ATOM   8195  C  CA    . LEU C  2  595  ? 78.695  -18.733 97.363  1.00 60.67  ? 595  LEU C CA    1 
ATOM   8196  C  C     . LEU C  2  595  ? 78.742  -19.867 98.384  1.00 64.79  ? 595  LEU C C     1 
ATOM   8197  O  O     . LEU C  2  595  ? 78.389  -19.671 99.546  1.00 68.64  ? 595  LEU C O     1 
ATOM   8198  C  CB    . LEU C  2  595  ? 79.871  -17.785 97.568  1.00 62.04  ? 595  LEU C CB    1 
ATOM   8199  C  CG    . LEU C  2  595  ? 81.277  -18.246 97.198  1.00 69.78  ? 595  LEU C CG    1 
ATOM   8200  C  CD1   . LEU C  2  595  ? 81.380  -18.524 95.701  1.00 75.38  ? 595  LEU C CD1   1 
ATOM   8201  C  CD2   . LEU C  2  595  ? 82.278  -17.185 97.622  1.00 64.82  ? 595  LEU C CD2   1 
ATOM   8202  N  N     . TYR C  2  596  ? 79.168  -21.053 97.958  1.00 67.83  ? 596  TYR C N     1 
ATOM   8203  C  CA    . TYR C  2  596  ? 79.209  -22.211 98.851  1.00 65.68  ? 596  TYR C CA    1 
ATOM   8204  C  C     . TYR C  2  596  ? 80.593  -22.861 98.933  1.00 72.86  ? 596  TYR C C     1 
ATOM   8205  O  O     . TYR C  2  596  ? 81.462  -22.604 98.098  1.00 78.73  ? 596  TYR C O     1 
ATOM   8206  C  CB    . TYR C  2  596  ? 78.170  -23.247 98.424  1.00 63.94  ? 596  TYR C CB    1 
ATOM   8207  C  CG    . TYR C  2  596  ? 76.759  -22.714 98.386  1.00 68.37  ? 596  TYR C CG    1 
ATOM   8208  C  CD1   . TYR C  2  596  ? 76.321  -21.929 97.328  1.00 73.30  ? 596  TYR C CD1   1 
ATOM   8209  C  CD2   . TYR C  2  596  ? 75.857  -23.001 99.403  1.00 71.48  ? 596  TYR C CD2   1 
ATOM   8210  C  CE1   . TYR C  2  596  ? 75.023  -21.438 97.287  1.00 74.08  ? 596  TYR C CE1   1 
ATOM   8211  C  CE2   . TYR C  2  596  ? 74.558  -22.515 99.370  1.00 68.64  ? 596  TYR C CE2   1 
ATOM   8212  C  CZ    . TYR C  2  596  ? 74.147  -21.733 98.311  1.00 69.35  ? 596  TYR C CZ    1 
ATOM   8213  O  OH    . TYR C  2  596  ? 72.859  -21.250 98.276  1.00 64.25  ? 596  TYR C OH    1 
ATOM   8214  N  N     . ALA C  2  597  ? 80.785  -23.706 99.942  1.00 70.46  ? 597  ALA C N     1 
ATOM   8215  C  CA    . ALA C  2  597  ? 82.051  -24.407 100.146 1.00 78.95  ? 597  ALA C CA    1 
ATOM   8216  C  C     . ALA C  2  597  ? 82.126  -25.686 99.316  1.00 85.26  ? 597  ALA C C     1 
ATOM   8217  O  O     . ALA C  2  597  ? 81.195  -26.490 99.323  1.00 88.53  ? 597  ALA C O     1 
ATOM   8218  C  CB    . ALA C  2  597  ? 82.244  -24.724 101.619 1.00 78.12  ? 597  ALA C CB    1 
ATOM   8219  N  N     . GLU C  2  598  ? 83.240  -25.875 98.613  1.00 85.40  ? 598  GLU C N     1 
ATOM   8220  C  CA    . GLU C  2  598  ? 83.397  -27.013 97.709  1.00 88.18  ? 598  GLU C CA    1 
ATOM   8221  C  C     . GLU C  2  598  ? 83.503  -28.347 98.440  1.00 97.23  ? 598  GLU C C     1 
ATOM   8222  O  O     . GLU C  2  598  ? 82.799  -29.298 98.107  1.00 103.01 ? 598  GLU C O     1 
ATOM   8223  C  CB    . GLU C  2  598  ? 84.604  -26.815 96.786  1.00 97.18  ? 598  GLU C CB    1 
ATOM   8224  C  CG    . GLU C  2  598  ? 84.422  -25.691 95.772  1.00 105.59 ? 598  GLU C CG    1 
ATOM   8225  C  CD    . GLU C  2  598  ? 85.585  -25.573 94.802  1.00 114.08 ? 598  GLU C CD    1 
ATOM   8226  O  OE1   . GLU C  2  598  ? 86.588  -26.297 94.980  1.00 117.65 ? 598  GLU C OE1   1 
ATOM   8227  O  OE2   . GLU C  2  598  ? 85.493  -24.757 93.859  1.00 119.89 ? 598  GLU C OE2   1 
ATOM   8228  N  N     . GLU C  2  599  ? 84.386  -28.416 99.429  1.00 100.93 ? 599  GLU C N     1 
ATOM   8229  C  CA    . GLU C  2  599  ? 84.551  -29.626 100.224 1.00 99.74  ? 599  GLU C CA    1 
ATOM   8230  C  C     . GLU C  2  599  ? 84.605  -29.250 101.701 1.00 96.40  ? 599  GLU C C     1 
ATOM   8231  O  O     . GLU C  2  599  ? 84.734  -28.075 102.035 1.00 94.08  ? 599  GLU C O     1 
ATOM   8232  C  CB    . GLU C  2  599  ? 85.831  -30.359 99.813  1.00 104.67 ? 599  GLU C CB    1 
ATOM   8233  C  CG    . GLU C  2  599  ? 85.831  -31.844 100.139 1.00 114.02 ? 599  GLU C CG    1 
ATOM   8234  C  CD    . GLU C  2  599  ? 84.891  -32.636 99.245  1.00 115.42 ? 599  GLU C CD    1 
ATOM   8235  O  OE1   . GLU C  2  599  ? 84.841  -32.349 98.028  1.00 107.39 ? 599  GLU C OE1   1 
ATOM   8236  O  OE2   . GLU C  2  599  ? 84.200  -33.542 99.760  1.00 113.94 ? 599  GLU C OE2   1 
ATOM   8237  N  N     . ASP C  2  600  ? 84.494  -30.234 102.587 1.00 98.42  ? 600  ASP C N     1 
ATOM   8238  C  CA    . ASP C  2  600  ? 84.644  -29.968 104.011 1.00 93.25  ? 600  ASP C CA    1 
ATOM   8239  C  C     . ASP C  2  600  ? 85.957  -29.223 104.209 1.00 93.26  ? 600  ASP C C     1 
ATOM   8240  O  O     . ASP C  2  600  ? 86.950  -29.533 103.558 1.00 101.41 ? 600  ASP C O     1 
ATOM   8241  C  CB    . ASP C  2  600  ? 84.654  -31.272 104.809 1.00 100.54 ? 600  ASP C CB    1 
ATOM   8242  C  CG    . ASP C  2  600  ? 83.401  -32.101 104.596 1.00 102.99 ? 600  ASP C CG    1 
ATOM   8243  O  OD1   . ASP C  2  600  ? 82.511  -32.076 105.473 1.00 100.15 ? 600  ASP C OD1   1 
ATOM   8244  O  OD2   . ASP C  2  600  ? 83.308  -32.781 103.552 1.00 106.44 ? 600  ASP C OD2   1 
ATOM   8245  N  N     . GLY C  2  601  ? 85.965  -28.234 105.093 1.00 90.31  ? 601  GLY C N     1 
ATOM   8246  C  CA    . GLY C  2  601  ? 87.159  -27.433 105.298 1.00 88.02  ? 601  GLY C CA    1 
ATOM   8247  C  C     . GLY C  2  601  ? 87.073  -26.451 106.451 1.00 91.25  ? 601  GLY C C     1 
ATOM   8248  O  O     . GLY C  2  601  ? 86.170  -26.527 107.291 1.00 93.16  ? 601  GLY C O     1 
ATOM   8249  N  N     . GLU C  2  602  ? 88.027  -25.526 106.492 1.00 81.45  ? 602  GLU C N     1 
ATOM   8250  C  CA    . GLU C  2  602  ? 88.069  -24.509 107.534 1.00 82.27  ? 602  GLU C CA    1 
ATOM   8251  C  C     . GLU C  2  602  ? 88.363  -23.140 106.935 1.00 82.92  ? 602  GLU C C     1 
ATOM   8252  O  O     . GLU C  2  602  ? 89.236  -22.997 106.076 1.00 81.68  ? 602  GLU C O     1 
ATOM   8253  C  CB    . GLU C  2  602  ? 89.124  -24.850 108.584 1.00 88.42  ? 602  GLU C CB    1 
ATOM   8254  C  CG    . GLU C  2  602  ? 89.248  -23.807 109.684 1.00 92.15  ? 602  GLU C CG    1 
ATOM   8255  C  CD    . GLU C  2  602  ? 90.499  -23.979 110.522 1.00 102.51 ? 602  GLU C CD    1 
ATOM   8256  O  OE1   . GLU C  2  602  ? 90.367  -24.194 111.747 1.00 107.59 ? 602  GLU C OE1   1 
ATOM   8257  O  OE2   . GLU C  2  602  ? 91.612  -23.890 109.957 1.00 100.24 ? 602  GLU C OE2   1 
ATOM   8258  N  N     . VAL C  2  603  ? 87.632  -22.131 107.394 1.00 82.48  ? 603  VAL C N     1 
ATOM   8259  C  CA    . VAL C  2  603  ? 87.788  -20.787 106.863 1.00 80.70  ? 603  VAL C CA    1 
ATOM   8260  C  C     . VAL C  2  603  ? 89.110  -20.171 107.300 1.00 79.30  ? 603  VAL C C     1 
ATOM   8261  O  O     . VAL C  2  603  ? 89.402  -20.081 108.489 1.00 77.56  ? 603  VAL C O     1 
ATOM   8262  C  CB    . VAL C  2  603  ? 86.625  -19.879 107.282 1.00 75.12  ? 603  VAL C CB    1 
ATOM   8263  C  CG1   . VAL C  2  603  ? 86.883  -18.461 106.817 1.00 74.85  ? 603  VAL C CG1   1 
ATOM   8264  C  CG2   . VAL C  2  603  ? 85.318  -20.408 106.707 1.00 68.66  ? 603  VAL C CG2   1 
ATOM   8265  N  N     . ALA C  2  604  ? 89.905  -19.752 106.322 1.00 76.52  ? 604  ALA C N     1 
ATOM   8266  C  CA    . ALA C  2  604  ? 91.203  -19.146 106.578 1.00 68.74  ? 604  ALA C CA    1 
ATOM   8267  C  C     . ALA C  2  604  ? 91.090  -17.637 106.748 1.00 72.11  ? 604  ALA C C     1 
ATOM   8268  O  O     . ALA C  2  604  ? 91.441  -17.093 107.790 1.00 73.77  ? 604  ALA C O     1 
ATOM   8269  C  CB    . ALA C  2  604  ? 92.158  -19.473 105.451 1.00 78.01  ? 604  ALA C CB    1 
ATOM   8270  N  N     . LYS C  2  605  ? 90.607  -16.964 105.711 1.00 75.09  ? 605  LYS C N     1 
ATOM   8271  C  CA    . LYS C  2  605  ? 90.444  -15.517 105.751 1.00 74.85  ? 605  LYS C CA    1 
ATOM   8272  C  C     . LYS C  2  605  ? 89.005  -15.110 105.442 1.00 71.82  ? 605  LYS C C     1 
ATOM   8273  O  O     . LYS C  2  605  ? 88.313  -15.786 104.684 1.00 69.68  ? 605  LYS C O     1 
ATOM   8274  C  CB    . LYS C  2  605  ? 91.401  -14.849 104.765 1.00 75.89  ? 605  LYS C CB    1 
ATOM   8275  C  CG    . LYS C  2  605  ? 92.871  -15.031 105.099 1.00 75.48  ? 605  LYS C CG    1 
ATOM   8276  C  CD    . LYS C  2  605  ? 93.745  -14.339 104.060 1.00 86.52  ? 605  LYS C CD    1 
ATOM   8277  C  CE    . LYS C  2  605  ? 95.226  -14.484 104.377 1.00 96.51  ? 605  LYS C CE    1 
ATOM   8278  N  NZ    . LYS C  2  605  ? 96.079  -13.844 103.334 1.00 102.21 ? 605  LYS C NZ    1 
ATOM   8279  N  N     . VAL C  2  606  ? 88.559  -14.010 106.046 1.00 73.13  ? 606  VAL C N     1 
ATOM   8280  C  CA    . VAL C  2  606  ? 87.246  -13.441 105.747 1.00 69.25  ? 606  VAL C CA    1 
ATOM   8281  C  C     . VAL C  2  606  ? 87.299  -11.920 105.648 1.00 72.80  ? 606  VAL C C     1 
ATOM   8282  O  O     . VAL C  2  606  ? 87.626  -11.223 106.609 1.00 72.32  ? 606  VAL C O     1 
ATOM   8283  C  CB    . VAL C  2  606  ? 86.178  -13.853 106.768 1.00 73.11  ? 606  VAL C CB    1 
ATOM   8284  C  CG1   . VAL C  2  606  ? 84.952  -12.962 106.639 1.00 67.93  ? 606  VAL C CG1   1 
ATOM   8285  C  CG2   . VAL C  2  606  ? 85.801  -15.308 106.572 1.00 74.00  ? 606  VAL C CG2   1 
ATOM   8286  N  N     . ASP C  2  607  ? 86.961  -11.421 104.466 1.00 77.89  ? 607  ASP C N     1 
ATOM   8287  C  CA    . ASP C  2  607  ? 87.055  -10.008 104.148 1.00 70.74  ? 607  ASP C CA    1 
ATOM   8288  C  C     . ASP C  2  607  ? 85.762  -9.586  103.465 1.00 71.79  ? 607  ASP C C     1 
ATOM   8289  O  O     . ASP C  2  607  ? 84.953  -10.432 103.075 1.00 70.35  ? 607  ASP C O     1 
ATOM   8290  C  CB    . ASP C  2  607  ? 88.229  -9.790  103.193 1.00 70.43  ? 607  ASP C CB    1 
ATOM   8291  C  CG    . ASP C  2  607  ? 88.821  -8.410  103.304 1.00 77.61  ? 607  ASP C CG    1 
ATOM   8292  O  OD1   . ASP C  2  607  ? 88.657  -7.790  104.377 1.00 78.78  ? 607  ASP C OD1   1 
ATOM   8293  O  OD2   . ASP C  2  607  ? 89.459  -7.952  102.326 1.00 75.15  ? 607  ASP C OD2   1 
ATOM   8294  N  N     . GLY C  2  608  ? 85.560  -8.282  103.321 1.00 70.01  ? 608  GLY C N     1 
ATOM   8295  C  CA    . GLY C  2  608  ? 84.434  -7.790  102.554 1.00 67.10  ? 608  GLY C CA    1 
ATOM   8296  C  C     . GLY C  2  608  ? 84.629  -8.121  101.088 1.00 70.83  ? 608  GLY C C     1 
ATOM   8297  O  O     . GLY C  2  608  ? 83.662  -8.264  100.339 1.00 72.62  ? 608  GLY C O     1 
ATOM   8298  N  N     . ASN C  2  609  ? 85.890  -8.247  100.683 1.00 69.18  ? 609  ASN C N     1 
ATOM   8299  C  CA    . ASN C  2  609  ? 86.235  -8.476  99.286  1.00 58.65  ? 609  ASN C CA    1 
ATOM   8300  C  C     . ASN C  2  609  ? 86.409  -9.947  98.903  1.00 65.25  ? 609  ASN C C     1 
ATOM   8301  O  O     . ASN C  2  609  ? 86.138  -10.332 97.763  1.00 64.32  ? 609  ASN C O     1 
ATOM   8302  C  CB    . ASN C  2  609  ? 87.496  -7.700  98.932  1.00 55.65  ? 609  ASN C CB    1 
ATOM   8303  C  CG    . ASN C  2  609  ? 87.312  -6.216  99.068  1.00 58.14  ? 609  ASN C CG    1 
ATOM   8304  O  OD1   . ASN C  2  609  ? 86.263  -5.687  98.727  1.00 64.30  ? 609  ASN C OD1   1 
ATOM   8305  N  ND2   . ASN C  2  609  ? 88.328  -5.531  99.579  1.00 66.19  ? 609  ASN C ND2   1 
ATOM   8306  N  N     . ARG C  2  610  ? 86.862  -10.769 99.844  1.00 64.49  ? 610  ARG C N     1 
ATOM   8307  C  CA    . ARG C  2  610  ? 87.148  -12.164 99.525  1.00 60.95  ? 610  ARG C CA    1 
ATOM   8308  C  C     . ARG C  2  610  ? 87.107  -13.091 100.728 1.00 62.01  ? 610  ARG C C     1 
ATOM   8309  O  O     . ARG C  2  610  ? 87.206  -12.656 101.868 1.00 60.94  ? 610  ARG C O     1 
ATOM   8310  C  CB    . ARG C  2  610  ? 88.509  -12.279 98.842  1.00 66.59  ? 610  ARG C CB    1 
ATOM   8311  C  CG    . ARG C  2  610  ? 89.656  -11.650 99.624  1.00 72.41  ? 610  ARG C CG    1 
ATOM   8312  C  CD    . ARG C  2  610  ? 90.278  -12.611 100.635 1.00 70.05  ? 610  ARG C CD    1 
ATOM   8313  N  NE    . ARG C  2  610  ? 91.277  -11.939 101.463 1.00 74.19  ? 610  ARG C NE    1 
ATOM   8314  C  CZ    . ARG C  2  610  ? 91.143  -11.716 102.767 1.00 77.20  ? 610  ARG C CZ    1 
ATOM   8315  N  NH1   . ARG C  2  610  ? 90.060  -12.133 103.403 1.00 79.56  ? 610  ARG C NH1   1 
ATOM   8316  N  NH2   . ARG C  2  610  ? 92.097  -11.087 103.440 1.00 78.24  ? 610  ARG C NH2   1 
ATOM   8317  N  N     . ILE C  2  611  ? 86.969  -14.381 100.448 1.00 61.22  ? 611  ILE C N     1 
ATOM   8318  C  CA    . ILE C  2  611  ? 86.949  -15.411 101.477 1.00 63.42  ? 611  ILE C CA    1 
ATOM   8319  C  C     . ILE C  2  611  ? 87.937  -16.518 101.123 1.00 70.67  ? 611  ILE C C     1 
ATOM   8320  O  O     . ILE C  2  611  ? 87.814  -17.154 100.078 1.00 73.17  ? 611  ILE C O     1 
ATOM   8321  C  CB    . ILE C  2  611  ? 85.552  -16.047 101.611 1.00 59.58  ? 611  ILE C CB    1 
ATOM   8322  C  CG1   . ILE C  2  611  ? 84.524  -15.010 102.059 1.00 60.17  ? 611  ILE C CG1   1 
ATOM   8323  C  CG2   . ILE C  2  611  ? 85.590  -17.214 102.579 1.00 61.73  ? 611  ILE C CG2   1 
ATOM   8324  C  CD1   . ILE C  2  611  ? 83.094  -15.494 101.966 1.00 53.78  ? 611  ILE C CD1   1 
ATOM   8325  N  N     . VAL C  2  612  ? 88.915  -16.750 101.992 1.00 74.39  ? 612  VAL C N     1 
ATOM   8326  C  CA    . VAL C  2  612  ? 89.896  -17.805 101.758 1.00 71.15  ? 612  VAL C CA    1 
ATOM   8327  C  C     . VAL C  2  612  ? 89.619  -19.026 102.633 1.00 78.88  ? 612  VAL C C     1 
ATOM   8328  O  O     . VAL C  2  612  ? 89.510  -18.919 103.855 1.00 80.98  ? 612  VAL C O     1 
ATOM   8329  C  CB    . VAL C  2  612  ? 91.328  -17.309 102.004 1.00 71.18  ? 612  VAL C CB    1 
ATOM   8330  C  CG1   . VAL C  2  612  ? 92.302  -18.468 101.943 1.00 74.86  ? 612  VAL C CG1   1 
ATOM   8331  C  CG2   . VAL C  2  612  ? 91.697  -16.242 100.989 1.00 72.13  ? 612  VAL C CG2   1 
ATOM   8332  N  N     . VAL C  2  613  ? 89.510  -20.187 101.997 1.00 80.51  ? 613  VAL C N     1 
ATOM   8333  C  CA    . VAL C  2  613  ? 89.157  -21.419 102.690 1.00 82.24  ? 613  VAL C CA    1 
ATOM   8334  C  C     . VAL C  2  613  ? 90.200  -22.510 102.472 1.00 89.56  ? 613  VAL C C     1 
ATOM   8335  O  O     . VAL C  2  613  ? 90.613  -22.772 101.340 1.00 92.27  ? 613  VAL C O     1 
ATOM   8336  C  CB    . VAL C  2  613  ? 87.799  -21.950 102.208 1.00 76.11  ? 613  VAL C CB    1 
ATOM   8337  C  CG1   . VAL C  2  613  ? 87.446  -23.237 102.929 1.00 81.38  ? 613  VAL C CG1   1 
ATOM   8338  C  CG2   . VAL C  2  613  ? 86.723  -20.902 102.410 1.00 73.64  ? 613  VAL C CG2   1 
ATOM   8339  N  N     . ARG C  2  614  ? 90.620  -23.144 103.563 1.00 90.19  ? 614  ARG C N     1 
ATOM   8340  C  CA    . ARG C  2  614  ? 91.527  -24.283 103.488 1.00 93.99  ? 614  ARG C CA    1 
ATOM   8341  C  C     . ARG C  2  614  ? 90.735  -25.574 103.622 1.00 94.42  ? 614  ARG C C     1 
ATOM   8342  O  O     . ARG C  2  614  ? 90.103  -25.818 104.648 1.00 99.54  ? 614  ARG C O     1 
ATOM   8343  C  CB    . ARG C  2  614  ? 92.585  -24.206 104.590 1.00 103.82 ? 614  ARG C CB    1 
ATOM   8344  C  CG    . ARG C  2  614  ? 93.535  -25.396 104.620 1.00 111.88 ? 614  ARG C CG    1 
ATOM   8345  C  CD    . ARG C  2  614  ? 94.543  -25.293 105.757 1.00 116.84 ? 614  ARG C CD    1 
ATOM   8346  N  NE    . ARG C  2  614  ? 95.333  -24.067 105.691 1.00 120.56 ? 614  ARG C NE    1 
ATOM   8347  C  CZ    . ARG C  2  614  ? 96.350  -23.875 104.856 1.00 121.30 ? 614  ARG C CZ    1 
ATOM   8348  N  NH1   . ARG C  2  614  ? 97.011  -22.726 104.871 1.00 119.69 ? 614  ARG C NH1   1 
ATOM   8349  N  NH2   . ARG C  2  614  ? 96.702  -24.829 104.002 1.00 110.57 ? 614  ARG C NH2   1 
ATOM   8350  N  N     . TYR C  2  615  ? 90.767  -26.400 102.584 1.00 94.75  ? 615  TYR C N     1 
ATOM   8351  C  CA    . TYR C  2  615  ? 89.996  -27.637 102.584 1.00 104.22 ? 615  TYR C CA    1 
ATOM   8352  C  C     . TYR C  2  615  ? 90.768  -28.805 103.202 1.00 116.62 ? 615  TYR C C     1 
ATOM   8353  O  O     . TYR C  2  615  ? 91.907  -28.642 103.641 1.00 119.66 ? 615  TYR C O     1 
ATOM   8354  C  CB    . TYR C  2  615  ? 89.535  -27.978 101.164 1.00 103.33 ? 615  TYR C CB    1 
ATOM   8355  C  CG    . TYR C  2  615  ? 88.515  -27.005 100.612 1.00 101.48 ? 615  TYR C CG    1 
ATOM   8356  C  CD1   . TYR C  2  615  ? 88.838  -26.131 99.583  1.00 96.57  ? 615  TYR C CD1   1 
ATOM   8357  C  CD2   . TYR C  2  615  ? 87.229  -26.953 101.134 1.00 98.10  ? 615  TYR C CD2   1 
ATOM   8358  C  CE1   . TYR C  2  615  ? 87.902  -25.240 99.082  1.00 92.43  ? 615  TYR C CE1   1 
ATOM   8359  C  CE2   . TYR C  2  615  ? 86.290  -26.067 100.642 1.00 91.35  ? 615  TYR C CE2   1 
ATOM   8360  C  CZ    . TYR C  2  615  ? 86.628  -25.213 99.618  1.00 93.22  ? 615  TYR C CZ    1 
ATOM   8361  O  OH    . TYR C  2  615  ? 85.685  -24.332 99.134  1.00 85.42  ? 615  TYR C OH    1 
ATOM   8362  N  N     . GLU C  2  616  ? 90.133  -29.975 103.244 1.00 121.08 ? 616  GLU C N     1 
ATOM   8363  C  CA    . GLU C  2  616  ? 90.773  -31.187 103.749 1.00 123.96 ? 616  GLU C CA    1 
ATOM   8364  C  C     . GLU C  2  616  ? 92.015  -31.505 102.927 1.00 123.82 ? 616  GLU C C     1 
ATOM   8365  O  O     . GLU C  2  616  ? 93.054  -31.893 103.463 1.00 124.95 ? 616  GLU C O     1 
ATOM   8366  C  CB    . GLU C  2  616  ? 89.806  -32.373 103.686 1.00 122.59 ? 616  GLU C CB    1 
ATOM   8367  C  CG    . GLU C  2  616  ? 88.553  -32.221 104.531 1.00 119.78 ? 616  GLU C CG    1 
ATOM   8368  C  CD    . GLU C  2  616  ? 88.842  -32.230 106.021 1.00 129.92 ? 616  GLU C CD    1 
ATOM   8369  O  OE1   . GLU C  2  616  ? 90.032  -32.270 106.398 1.00 135.65 ? 616  GLU C OE1   1 
ATOM   8370  O  OE2   . GLU C  2  616  ? 87.876  -32.198 106.815 1.00 129.62 ? 616  GLU C OE2   1 
ATOM   8371  N  N     . ASP C  2  617  ? 91.890  -31.329 101.616 1.00 122.64 ? 617  ASP C N     1 
ATOM   8372  C  CA    . ASP C  2  617  ? 92.975  -31.581 100.679 1.00 120.04 ? 617  ASP C CA    1 
ATOM   8373  C  C     . ASP C  2  617  ? 94.239  -30.826 101.072 1.00 115.49 ? 617  ASP C C     1 
ATOM   8374  O  O     . ASP C  2  617  ? 95.337  -31.179 100.651 1.00 112.76 ? 617  ASP C O     1 
ATOM   8375  C  CB    . ASP C  2  617  ? 92.540  -31.168 99.273  1.00 118.48 ? 617  ASP C CB    1 
ATOM   8376  C  CG    . ASP C  2  617  ? 91.117  -31.597 98.955  1.00 123.76 ? 617  ASP C CG    1 
ATOM   8377  O  OD1   . ASP C  2  617  ? 90.354  -31.888 99.902  1.00 120.31 ? 617  ASP C OD1   1 
ATOM   8378  O  OD2   . ASP C  2  617  ? 90.760  -31.638 97.760  1.00 124.44 ? 617  ASP C OD2   1 
ATOM   8379  N  N     . GLY C  2  618  ? 94.075  -29.789 101.886 1.00 114.94 ? 618  GLY C N     1 
ATOM   8380  C  CA    . GLY C  2  618  ? 95.187  -28.952 102.294 1.00 115.66 ? 618  GLY C CA    1 
ATOM   8381  C  C     . GLY C  2  618  ? 95.336  -27.751 101.379 1.00 111.00 ? 618  GLY C C     1 
ATOM   8382  O  O     . GLY C  2  618  ? 95.951  -26.746 101.744 1.00 105.66 ? 618  GLY C O     1 
ATOM   8383  N  N     . ARG C  2  619  ? 94.763  -27.859 100.184 1.00 110.08 ? 619  ARG C N     1 
ATOM   8384  C  CA    . ARG C  2  619  ? 94.826  -26.788 99.199  1.00 108.31 ? 619  ARG C CA    1 
ATOM   8385  C  C     . ARG C  2  619  ? 94.037  -25.565 99.656  1.00 103.11 ? 619  ARG C C     1 
ATOM   8386  O  O     . ARG C  2  619  ? 92.938  -25.685 100.195 1.00 100.33 ? 619  ARG C O     1 
ATOM   8387  C  CB    . ARG C  2  619  ? 94.305  -27.276 97.849  1.00 107.37 ? 619  ARG C CB    1 
ATOM   8388  C  CG    . ARG C  2  619  ? 92.922  -27.882 97.917  1.00 110.20 ? 619  ARG C CG    1 
ATOM   8389  C  CD    . ARG C  2  619  ? 92.306  -27.983 96.540  1.00 112.05 ? 619  ARG C CD    1 
ATOM   8390  N  NE    . ARG C  2  619  ? 90.885  -28.304 96.611  1.00 116.62 ? 619  ARG C NE    1 
ATOM   8391  C  CZ    . ARG C  2  619  ? 90.028  -28.114 95.614  1.00 118.79 ? 619  ARG C CZ    1 
ATOM   8392  N  NH1   . ARG C  2  619  ? 88.750  -28.434 95.767  1.00 112.77 ? 619  ARG C NH1   1 
ATOM   8393  N  NH2   . ARG C  2  619  ? 90.447  -27.599 94.465  1.00 120.97 ? 619  ARG C NH2   1 
ATOM   8394  N  N     . LEU C  2  620  ? 94.609  -24.388 99.427  1.00 102.24 ? 620  LEU C N     1 
ATOM   8395  C  CA    . LEU C  2  620  ? 94.018  -23.133 99.876  1.00 92.25  ? 620  LEU C CA    1 
ATOM   8396  C  C     . LEU C  2  620  ? 93.293  -22.432 98.729  1.00 88.83  ? 620  LEU C C     1 
ATOM   8397  O  O     . LEU C  2  620  ? 93.927  -21.882 97.826  1.00 87.42  ? 620  LEU C O     1 
ATOM   8398  C  CB    . LEU C  2  620  ? 95.112  -22.221 100.440 1.00 94.72  ? 620  LEU C CB    1 
ATOM   8399  C  CG    . LEU C  2  620  ? 94.692  -21.052 101.330 1.00 94.81  ? 620  LEU C CG    1 
ATOM   8400  C  CD1   . LEU C  2  620  ? 94.149  -21.567 102.653 1.00 89.46  ? 620  LEU C CD1   1 
ATOM   8401  C  CD2   . LEU C  2  620  ? 95.866  -20.109 101.558 1.00 90.55  ? 620  LEU C CD2   1 
ATOM   8402  N  N     . VAL C  2  621  ? 91.964  -22.448 98.772  1.00 86.24  ? 621  VAL C N     1 
ATOM   8403  C  CA    . VAL C  2  621  ? 91.156  -21.844 97.714  1.00 80.06  ? 621  VAL C CA    1 
ATOM   8404  C  C     . VAL C  2  621  ? 90.704  -20.438 98.090  1.00 75.59  ? 621  VAL C C     1 
ATOM   8405  O  O     . VAL C  2  621  ? 90.279  -20.199 99.218  1.00 77.08  ? 621  VAL C O     1 
ATOM   8406  C  CB    . VAL C  2  621  ? 89.907  -22.687 97.412  1.00 77.82  ? 621  VAL C CB    1 
ATOM   8407  C  CG1   . VAL C  2  621  ? 89.103  -22.055 96.287  1.00 77.98  ? 621  VAL C CG1   1 
ATOM   8408  C  CG2   . VAL C  2  621  ? 90.299  -24.111 97.061  1.00 89.61  ? 621  VAL C CG2   1 
ATOM   8409  N  N     . GLU C  2  622  ? 90.799  -19.507 97.147  1.00 68.87  ? 622  GLU C N     1 
ATOM   8410  C  CA    . GLU C  2  622  ? 90.345  -18.145 97.397  1.00 68.86  ? 622  GLU C CA    1 
ATOM   8411  C  C     . GLU C  2  622  ? 89.132  -17.796 96.546  1.00 74.42  ? 622  GLU C C     1 
ATOM   8412  O  O     . GLU C  2  622  ? 89.140  -17.985 95.331  1.00 80.80  ? 622  GLU C O     1 
ATOM   8413  C  CB    . GLU C  2  622  ? 91.464  -17.129 97.167  1.00 65.86  ? 622  GLU C CB    1 
ATOM   8414  C  CG    . GLU C  2  622  ? 90.988  -15.685 97.220  1.00 70.31  ? 622  GLU C CG    1 
ATOM   8415  C  CD    . GLU C  2  622  ? 92.123  -14.689 97.357  1.00 80.91  ? 622  GLU C CD    1 
ATOM   8416  O  OE1   . GLU C  2  622  ? 93.207  -15.083 97.840  1.00 85.43  ? 622  GLU C OE1   1 
ATOM   8417  O  OE2   . GLU C  2  622  ? 91.929  -13.512 96.983  1.00 81.39  ? 622  GLU C OE2   1 
ATOM   8418  N  N     . TYR C  2  623  ? 88.091  -17.289 97.200  1.00 70.33  ? 623  TYR C N     1 
ATOM   8419  C  CA    . TYR C  2  623  ? 86.870  -16.895 96.520  1.00 61.49  ? 623  TYR C CA    1 
ATOM   8420  C  C     . TYR C  2  623  ? 86.706  -15.386 96.546  1.00 63.13  ? 623  TYR C C     1 
ATOM   8421  O  O     . TYR C  2  623  ? 86.483  -14.806 97.605  1.00 61.03  ? 623  TYR C O     1 
ATOM   8422  C  CB    . TYR C  2  623  ? 85.669  -17.532 97.198  1.00 57.41  ? 623  TYR C CB    1 
ATOM   8423  C  CG    . TYR C  2  623  ? 85.674  -19.039 97.194  1.00 64.86  ? 623  TYR C CG    1 
ATOM   8424  C  CD1   . TYR C  2  623  ? 85.524  -19.751 96.013  1.00 70.42  ? 623  TYR C CD1   1 
ATOM   8425  C  CD2   . TYR C  2  623  ? 85.798  -19.754 98.377  1.00 68.92  ? 623  TYR C CD2   1 
ATOM   8426  C  CE1   . TYR C  2  623  ? 85.515  -21.132 96.007  1.00 76.01  ? 623  TYR C CE1   1 
ATOM   8427  C  CE2   . TYR C  2  623  ? 85.788  -21.136 98.384  1.00 69.66  ? 623  TYR C CE2   1 
ATOM   8428  C  CZ    . TYR C  2  623  ? 85.645  -21.819 97.196  1.00 79.50  ? 623  TYR C CZ    1 
ATOM   8429  O  OH    . TYR C  2  623  ? 85.635  -23.192 97.197  1.00 90.03  ? 623  TYR C OH    1 
ATOM   8430  N  N     . PRO C  2  624  ? 86.826  -14.741 95.377  1.00 67.67  ? 624  PRO C N     1 
ATOM   8431  C  CA    . PRO C  2  624  ? 86.571  -13.302 95.286  1.00 66.55  ? 624  PRO C CA    1 
ATOM   8432  C  C     . PRO C  2  624  ? 85.072  -13.063 95.367  1.00 68.72  ? 624  PRO C C     1 
ATOM   8433  O  O     . PRO C  2  624  ? 84.304  -13.903 94.895  1.00 66.37  ? 624  PRO C O     1 
ATOM   8434  C  CB    . PRO C  2  624  ? 87.078  -12.938 93.885  1.00 62.70  ? 624  PRO C CB    1 
ATOM   8435  C  CG    . PRO C  2  624  ? 87.860  -14.126 93.412  1.00 71.04  ? 624  PRO C CG    1 
ATOM   8436  C  CD    . PRO C  2  624  ? 87.242  -15.303 94.085  1.00 69.48  ? 624  PRO C CD    1 
ATOM   8437  N  N     . LEU C  2  625  ? 84.660  -11.946 95.958  1.00 66.12  ? 625  LEU C N     1 
ATOM   8438  C  CA    . LEU C  2  625  ? 83.241  -11.636 96.063  1.00 58.45  ? 625  LEU C CA    1 
ATOM   8439  C  C     . LEU C  2  625  ? 82.866  -10.469 95.159  1.00 63.74  ? 625  LEU C C     1 
ATOM   8440  O  O     . LEU C  2  625  ? 83.593  -9.478  95.068  1.00 63.75  ? 625  LEU C O     1 
ATOM   8441  C  CB    . LEU C  2  625  ? 82.852  -11.333 97.511  1.00 61.64  ? 625  LEU C CB    1 
ATOM   8442  C  CG    . LEU C  2  625  ? 83.029  -12.459 98.531  1.00 58.68  ? 625  LEU C CG    1 
ATOM   8443  C  CD1   . LEU C  2  625  ? 82.664  -11.976 99.923  1.00 59.99  ? 625  LEU C CD1   1 
ATOM   8444  C  CD2   . LEU C  2  625  ? 82.205  -13.679 98.154  1.00 53.36  ? 625  LEU C CD2   1 
ATOM   8445  N  N     . ARG C  2  626  ? 81.734  -10.605 94.478  1.00 65.70  ? 626  ARG C N     1 
ATOM   8446  C  CA    . ARG C  2  626  ? 81.200  -9.538  93.648  1.00 64.80  ? 626  ARG C CA    1 
ATOM   8447  C  C     . ARG C  2  626  ? 80.612  -8.471  94.557  1.00 65.69  ? 626  ARG C C     1 
ATOM   8448  O  O     . ARG C  2  626  ? 79.710  -8.753  95.342  1.00 68.61  ? 626  ARG C O     1 
ATOM   8449  C  CB    . ARG C  2  626  ? 80.128  -10.100 92.717  1.00 68.24  ? 626  ARG C CB    1 
ATOM   8450  C  CG    . ARG C  2  626  ? 79.510  -9.083  91.784  1.00 74.74  ? 626  ARG C CG    1 
ATOM   8451  C  CD    . ARG C  2  626  ? 78.696  -9.747  90.676  1.00 78.86  ? 626  ARG C CD    1 
ATOM   8452  N  NE    . ARG C  2  626  ? 79.536  -10.510 89.757  1.00 82.95  ? 626  ARG C NE    1 
ATOM   8453  C  CZ    . ARG C  2  626  ? 79.725  -11.822 89.835  1.00 89.24  ? 626  ARG C CZ    1 
ATOM   8454  N  NH1   . ARG C  2  626  ? 80.511  -12.434 88.957  1.00 85.27  ? 626  ARG C NH1   1 
ATOM   8455  N  NH2   . ARG C  2  626  ? 79.126  -12.524 90.790  1.00 83.30  ? 626  ARG C NH2   1 
ATOM   8456  N  N     . ARG C  2  627  ? 81.126  -7.250  94.461  1.00 63.74  ? 627  ARG C N     1 
ATOM   8457  C  CA    . ARG C  2  627  ? 80.725  -6.184  95.379  1.00 63.86  ? 627  ARG C CA    1 
ATOM   8458  C  C     . ARG C  2  627  ? 80.204  -4.927  94.692  1.00 65.40  ? 627  ARG C C     1 
ATOM   8459  O  O     . ARG C  2  627  ? 80.949  -4.229  94.005  1.00 72.12  ? 627  ARG C O     1 
ATOM   8460  C  CB    . ARG C  2  627  ? 81.887  -5.819  96.303  1.00 70.25  ? 627  ARG C CB    1 
ATOM   8461  C  CG    . ARG C  2  627  ? 81.954  -6.657  97.555  1.00 63.78  ? 627  ARG C CG    1 
ATOM   8462  C  CD    . ARG C  2  627  ? 80.645  -6.565  98.297  1.00 64.84  ? 627  ARG C CD    1 
ATOM   8463  N  NE    . ARG C  2  627  ? 80.775  -7.002  99.679  1.00 66.39  ? 627  ARG C NE    1 
ATOM   8464  C  CZ    . ARG C  2  627  ? 79.813  -6.885  100.586 1.00 69.03  ? 627  ARG C CZ    1 
ATOM   8465  N  NH1   . ARG C  2  627  ? 78.649  -6.344  100.249 1.00 67.80  ? 627  ARG C NH1   1 
ATOM   8466  N  NH2   . ARG C  2  627  ? 80.015  -7.309  101.828 1.00 67.04  ? 627  ARG C NH2   1 
ATOM   8467  N  N     . PHE C  2  628  ? 78.925  -4.637  94.899  1.00 65.24  ? 628  PHE C N     1 
ATOM   8468  C  CA    . PHE C  2  628  ? 78.282  -3.461  94.322  1.00 64.49  ? 628  PHE C CA    1 
ATOM   8469  C  C     . PHE C  2  628  ? 78.366  -3.426  92.797  1.00 64.98  ? 628  PHE C C     1 
ATOM   8470  O  O     . PHE C  2  628  ? 78.535  -2.361  92.204  1.00 61.45  ? 628  PHE C O     1 
ATOM   8471  C  CB    . PHE C  2  628  ? 78.870  -2.182  94.917  1.00 62.68  ? 628  PHE C CB    1 
ATOM   8472  C  CG    . PHE C  2  628  ? 78.683  -2.070  96.400  1.00 65.50  ? 628  PHE C CG    1 
ATOM   8473  C  CD1   . PHE C  2  628  ? 77.515  -1.551  96.923  1.00 64.82  ? 628  PHE C CD1   1 
ATOM   8474  C  CD2   . PHE C  2  628  ? 79.672  -2.493  97.273  1.00 67.28  ? 628  PHE C CD2   1 
ATOM   8475  C  CE1   . PHE C  2  628  ? 77.337  -1.453  98.293  1.00 69.94  ? 628  PHE C CE1   1 
ATOM   8476  C  CE2   . PHE C  2  628  ? 79.500  -2.396  98.643  1.00 61.62  ? 628  PHE C CE2   1 
ATOM   8477  C  CZ    . PHE C  2  628  ? 78.333  -1.876  99.153  1.00 64.18  ? 628  PHE C CZ    1 
ATOM   8478  N  N     . TYR C  2  629  ? 78.246  -4.592  92.168  1.00 62.21  ? 629  TYR C N     1 
ATOM   8479  C  CA    . TYR C  2  629  ? 78.235  -4.677  90.712  1.00 63.56  ? 629  TYR C CA    1 
ATOM   8480  C  C     . TYR C  2  629  ? 76.829  -4.421  90.185  1.00 62.00  ? 629  TYR C C     1 
ATOM   8481  O  O     . TYR C  2  629  ? 75.853  -4.958  90.705  1.00 57.08  ? 629  TYR C O     1 
ATOM   8482  C  CB    . TYR C  2  629  ? 78.754  -6.035  90.215  1.00 71.15  ? 629  TYR C CB    1 
ATOM   8483  C  CG    . TYR C  2  629  ? 80.266  -6.217  90.303  1.00 85.28  ? 629  TYR C CG    1 
ATOM   8484  C  CD1   . TYR C  2  629  ? 80.913  -7.205  89.561  1.00 85.58  ? 629  TYR C CD1   1 
ATOM   8485  C  CD2   . TYR C  2  629  ? 81.043  -5.411  91.131  1.00 83.89  ? 629  TYR C CD2   1 
ATOM   8486  C  CE1   . TYR C  2  629  ? 82.288  -7.378  89.639  1.00 84.60  ? 629  TYR C CE1   1 
ATOM   8487  C  CE2   . TYR C  2  629  ? 82.419  -5.578  91.215  1.00 86.50  ? 629  TYR C CE2   1 
ATOM   8488  C  CZ    . TYR C  2  629  ? 83.035  -6.562  90.466  1.00 93.68  ? 629  TYR C CZ    1 
ATOM   8489  O  OH    . TYR C  2  629  ? 84.400  -6.730  90.547  1.00 103.18 ? 629  TYR C OH    1 
ATOM   8490  N  N     . ARG C  2  630  ? 76.736  -3.587  89.155  1.00 67.57  ? 630  ARG C N     1 
ATOM   8491  C  CA    . ARG C  2  630  ? 75.458  -3.218  88.557  1.00 58.13  ? 630  ARG C CA    1 
ATOM   8492  C  C     . ARG C  2  630  ? 74.922  -4.339  87.666  1.00 59.00  ? 630  ARG C C     1 
ATOM   8493  O  O     . ARG C  2  630  ? 75.693  -5.095  87.077  1.00 64.41  ? 630  ARG C O     1 
ATOM   8494  C  CB    . ARG C  2  630  ? 75.625  -1.934  87.747  1.00 50.65  ? 630  ARG C CB    1 
ATOM   8495  C  CG    . ARG C  2  630  ? 74.416  -1.532  86.941  1.00 47.63  ? 630  ARG C CG    1 
ATOM   8496  C  CD    . ARG C  2  630  ? 74.730  -0.329  86.081  1.00 50.51  ? 630  ARG C CD    1 
ATOM   8497  N  NE    . ARG C  2  630  ? 73.531  0.212   85.452  1.00 53.64  ? 630  ARG C NE    1 
ATOM   8498  C  CZ    . ARG C  2  630  ? 72.995  -0.271  84.339  1.00 54.18  ? 630  ARG C CZ    1 
ATOM   8499  N  NH1   . ARG C  2  630  ? 73.554  -1.311  83.735  1.00 52.98  ? 630  ARG C NH1   1 
ATOM   8500  N  NH2   . ARG C  2  630  ? 71.903  0.284   83.831  1.00 59.89  ? 630  ARG C NH2   1 
ATOM   8501  N  N     . SER C  2  631  ? 73.600  -4.449  87.578  1.00 50.50  ? 631  SER C N     1 
ATOM   8502  C  CA    . SER C  2  631  ? 72.968  -5.477  86.764  1.00 45.03  ? 631  SER C CA    1 
ATOM   8503  C  C     . SER C  2  631  ? 72.271  -4.823  85.594  1.00 45.14  ? 631  SER C C     1 
ATOM   8504  O  O     . SER C  2  631  ? 72.187  -3.600  85.529  1.00 46.43  ? 631  SER C O     1 
ATOM   8505  C  CB    . SER C  2  631  ? 71.932  -6.235  87.583  1.00 50.20  ? 631  SER C CB    1 
ATOM   8506  O  OG    . SER C  2  631  ? 70.738  -5.481  87.678  1.00 53.08  ? 631  SER C OG    1 
ATOM   8507  N  N     . ASN C  2  632  ? 71.753  -5.639  84.683  1.00 45.29  ? 632  ASN C N     1 
ATOM   8508  C  CA    . ASN C  2  632  ? 71.063  -5.123  83.504  1.00 49.67  ? 632  ASN C CA    1 
ATOM   8509  C  C     . ASN C  2  632  ? 69.984  -4.105  83.875  1.00 49.75  ? 632  ASN C C     1 
ATOM   8510  O  O     . ASN C  2  632  ? 69.755  -3.125  83.149  1.00 47.80  ? 632  ASN C O     1 
ATOM   8511  C  CB    . ASN C  2  632  ? 70.452  -6.266  82.683  1.00 50.83  ? 632  ASN C CB    1 
ATOM   8512  C  CG    . ASN C  2  632  ? 71.485  -7.023  81.864  1.00 48.83  ? 632  ASN C CG    1 
ATOM   8513  O  OD1   . ASN C  2  632  ? 72.674  -6.720  81.910  1.00 50.07  ? 632  ASN C OD1   1 
ATOM   8514  N  ND2   . ASN C  2  632  ? 71.030  -8.022  81.116  1.00 44.90  ? 632  ASN C ND2   1 
ATOM   8515  N  N     . GLN C  2  633  ? 69.333  -4.341  85.011  1.00 45.08  ? 633  GLN C N     1 
ATOM   8516  C  CA    . GLN C  2  633  ? 68.225  -3.502  85.441  1.00 44.40  ? 633  GLN C CA    1 
ATOM   8517  C  C     . GLN C  2  633  ? 68.682  -2.388  86.376  1.00 43.19  ? 633  GLN C C     1 
ATOM   8518  O  O     . GLN C  2  633  ? 67.883  -1.547  86.782  1.00 47.65  ? 633  GLN C O     1 
ATOM   8519  C  CB    . GLN C  2  633  ? 67.138  -4.344  86.104  1.00 45.52  ? 633  GLN C CB    1 
ATOM   8520  C  CG    . GLN C  2  633  ? 67.258  -5.834  85.842  1.00 44.85  ? 633  GLN C CG    1 
ATOM   8521  C  CD    . GLN C  2  633  ? 67.159  -6.196  84.380  1.00 43.13  ? 633  GLN C CD    1 
ATOM   8522  O  OE1   . GLN C  2  633  ? 67.588  -7.265  83.964  1.00 46.59  ? 633  GLN C OE1   1 
ATOM   8523  N  NE2   . GLN C  2  633  ? 66.585  -5.303  83.591  1.00 47.25  ? 633  GLN C NE2   1 
ATOM   8524  N  N     . GLY C  2  634  ? 69.966  -2.378  86.712  1.00 39.20  ? 634  GLY C N     1 
ATOM   8525  C  CA    . GLY C  2  634  ? 70.522  -1.309  87.519  1.00 41.00  ? 634  GLY C CA    1 
ATOM   8526  C  C     . GLY C  2  634  ? 70.481  -1.589  89.008  1.00 46.89  ? 634  GLY C C     1 
ATOM   8527  O  O     . GLY C  2  634  ? 70.929  -0.774  89.813  1.00 44.49  ? 634  GLY C O     1 
ATOM   8528  N  N     . THR C  2  635  ? 69.934  -2.742  89.379  1.00 45.21  ? 635  THR C N     1 
ATOM   8529  C  CA    . THR C  2  635  ? 69.937  -3.159  90.769  1.00 43.52  ? 635  THR C CA    1 
ATOM   8530  C  C     . THR C  2  635  ? 71.329  -3.647  91.125  1.00 50.43  ? 635  THR C C     1 
ATOM   8531  O  O     . THR C  2  635  ? 72.041  -4.177  90.274  1.00 54.06  ? 635  THR C O     1 
ATOM   8532  C  CB    . THR C  2  635  ? 68.901  -4.271  91.051  1.00 45.05  ? 635  THR C CB    1 
ATOM   8533  O  OG1   . THR C  2  635  ? 69.164  -5.405  90.221  1.00 45.43  ? 635  THR C OG1   1 
ATOM   8534  C  CG2   . THR C  2  635  ? 67.500  -3.777  90.769  1.00 46.48  ? 635  THR C CG2   1 
ATOM   8535  N  N     . ALA C  2  636  ? 71.720  -3.463  92.381  1.00 57.73  ? 636  ALA C N     1 
ATOM   8536  C  CA    . ALA C  2  636  ? 73.049  -3.864  92.820  1.00 55.13  ? 636  ALA C CA    1 
ATOM   8537  C  C     . ALA C  2  636  ? 73.143  -5.365  93.083  1.00 56.01  ? 636  ALA C C     1 
ATOM   8538  O  O     . ALA C  2  636  ? 72.357  -5.930  93.838  1.00 57.35  ? 636  ALA C O     1 
ATOM   8539  C  CB    . ALA C  2  636  ? 73.465  -3.079  94.051  1.00 46.89  ? 636  ALA C CB    1 
ATOM   8540  N  N     . LEU C  2  637  ? 74.107  -6.006  92.438  1.00 59.35  ? 637  LEU C N     1 
ATOM   8541  C  CA    . LEU C  2  637  ? 74.462  -7.373  92.765  1.00 63.60  ? 637  LEU C CA    1 
ATOM   8542  C  C     . LEU C  2  637  ? 75.718  -7.335  93.602  1.00 64.90  ? 637  LEU C C     1 
ATOM   8543  O  O     . LEU C  2  637  ? 76.779  -6.993  93.095  1.00 64.44  ? 637  LEU C O     1 
ATOM   8544  C  CB    . LEU C  2  637  ? 74.778  -8.165  91.501  1.00 63.50  ? 637  LEU C CB    1 
ATOM   8545  C  CG    . LEU C  2  637  ? 73.703  -8.334  90.436  1.00 66.90  ? 637  LEU C CG    1 
ATOM   8546  C  CD1   . LEU C  2  637  ? 74.356  -8.299  89.075  1.00 61.91  ? 637  LEU C CD1   1 
ATOM   8547  C  CD2   . LEU C  2  637  ? 72.936  -9.630  90.639  1.00 71.73  ? 637  LEU C CD2   1 
ATOM   8548  N  N     . ASP C  2  638  ? 75.615  -7.669  94.881  1.00 65.67  ? 638  ASP C N     1 
ATOM   8549  C  CA    . ASP C  2  638  ? 76.824  -7.955  95.641  1.00 66.10  ? 638  ASP C CA    1 
ATOM   8550  C  C     . ASP C  2  638  ? 76.643  -9.079  96.649  1.00 68.16  ? 638  ASP C C     1 
ATOM   8551  O  O     . ASP C  2  638  ? 75.545  -9.317  97.157  1.00 70.17  ? 638  ASP C O     1 
ATOM   8552  C  CB    . ASP C  2  638  ? 77.445  -6.698  96.272  1.00 64.69  ? 638  ASP C CB    1 
ATOM   8553  C  CG    . ASP C  2  638  ? 76.654  -6.163  97.435  1.00 68.78  ? 638  ASP C CG    1 
ATOM   8554  O  OD1   . ASP C  2  638  ? 75.733  -6.854  97.916  1.00 83.19  ? 638  ASP C OD1   1 
ATOM   8555  O  OD2   . ASP C  2  638  ? 76.974  -5.044  97.886  1.00 71.63  ? 638  ASP C OD2   1 
ATOM   8556  N  N     . GLN C  2  639  ? 77.736  -9.786  96.902  1.00 65.87  ? 639  GLN C N     1 
ATOM   8557  C  CA    . GLN C  2  639  ? 77.728  -10.899 97.826  1.00 66.92  ? 639  GLN C CA    1 
ATOM   8558  C  C     . GLN C  2  639  ? 78.386  -10.436 99.103  1.00 67.67  ? 639  GLN C C     1 
ATOM   8559  O  O     . GLN C  2  639  ? 79.262  -9.572  99.068  1.00 69.82  ? 639  GLN C O     1 
ATOM   8560  C  CB    . GLN C  2  639  ? 78.505  -12.068 97.236  1.00 65.43  ? 639  GLN C CB    1 
ATOM   8561  C  CG    . GLN C  2  639  ? 78.120  -12.387 95.812  1.00 62.98  ? 639  GLN C CG    1 
ATOM   8562  C  CD    . GLN C  2  639  ? 79.144  -13.258 95.118  1.00 67.12  ? 639  GLN C CD    1 
ATOM   8563  O  OE1   . GLN C  2  639  ? 80.077  -12.757 94.486  1.00 68.55  ? 639  GLN C OE1   1 
ATOM   8564  N  NE2   . GLN C  2  639  ? 78.973  -14.571 95.227  1.00 68.94  ? 639  GLN C NE2   1 
ATOM   8565  N  N     . ARG C  2  640  ? 77.959  -10.985 100.233 1.00 62.42  ? 640  ARG C N     1 
ATOM   8566  C  CA    . ARG C  2  640  ? 78.621  -10.642 101.480 1.00 62.73  ? 640  ARG C CA    1 
ATOM   8567  C  C     . ARG C  2  640  ? 78.964  -11.889 102.276 1.00 62.61  ? 640  ARG C C     1 
ATOM   8568  O  O     . ARG C  2  640  ? 78.207  -12.856 102.280 1.00 67.20  ? 640  ARG C O     1 
ATOM   8569  C  CB    . ARG C  2  640  ? 77.813  -9.636  102.312 1.00 67.21  ? 640  ARG C CB    1 
ATOM   8570  C  CG    . ARG C  2  640  ? 76.858  -8.763  101.528 1.00 69.60  ? 640  ARG C CG    1 
ATOM   8571  C  CD    . ARG C  2  640  ? 75.437  -9.472  101.598 1.00 72.35  ? 640  ARG C CD    1 
ATOM   8572  N  NE    . ARG C  2  640  ? 74.370  -8.665  101.081 1.00 80.63  ? 640  ARG C NE    1 
ATOM   8573  C  CZ    . ARG C  2  640  ? 73.118  -8.715  101.515 1.00 92.11  ? 640  ARG C CZ    1 
ATOM   8574  N  NH1   . ARG C  2  640  ? 72.766  -9.513  102.495 1.00 80.56  ? 640  ARG C NH1   1 
ATOM   8575  N  NH2   . ARG C  2  640  ? 72.197  -7.942  100.968 1.00 102.66 ? 640  ARG C NH2   1 
ATOM   8576  N  N     . PRO C  2  641  ? 80.128  -11.871 102.937 1.00 61.11  ? 641  PRO C N     1 
ATOM   8577  C  CA    . PRO C  2  641  ? 80.603  -13.046 103.669 1.00 56.60  ? 641  PRO C CA    1 
ATOM   8578  C  C     . PRO C  2  641  ? 79.620  -13.409 104.774 1.00 61.28  ? 641  PRO C C     1 
ATOM   8579  O  O     . PRO C  2  641  ? 79.199  -12.530 105.526 1.00 57.69  ? 641  PRO C O     1 
ATOM   8580  C  CB    . PRO C  2  641  ? 81.938  -12.577 104.254 1.00 61.60  ? 641  PRO C CB    1 
ATOM   8581  C  CG    . PRO C  2  641  ? 81.820  -11.084 104.325 1.00 63.41  ? 641  PRO C CG    1 
ATOM   8582  C  CD    . PRO C  2  641  ? 80.985  -10.690 103.151 1.00 64.85  ? 641  PRO C CD    1 
ATOM   8583  N  N     . ARG C  2  642  ? 79.241  -14.681 104.849 1.00 60.98  ? 642  ARG C N     1 
ATOM   8584  C  CA    . ARG C  2  642  ? 78.312  -15.142 105.874 1.00 56.87  ? 642  ARG C CA    1 
ATOM   8585  C  C     . ARG C  2  642  ? 78.999  -16.019 106.916 1.00 62.46  ? 642  ARG C C     1 
ATOM   8586  O  O     . ARG C  2  642  ? 78.341  -16.604 107.780 1.00 63.93  ? 642  ARG C O     1 
ATOM   8587  C  CB    . ARG C  2  642  ? 77.136  -15.888 105.243 1.00 58.82  ? 642  ARG C CB    1 
ATOM   8588  C  CG    . ARG C  2  642  ? 76.074  -14.972 104.668 1.00 59.89  ? 642  ARG C CG    1 
ATOM   8589  C  CD    . ARG C  2  642  ? 75.512  -14.069 105.741 1.00 54.50  ? 642  ARG C CD    1 
ATOM   8590  N  NE    . ARG C  2  642  ? 74.558  -13.097 105.215 1.00 65.92  ? 642  ARG C NE    1 
ATOM   8591  C  CZ    . ARG C  2  642  ? 74.794  -11.791 105.108 1.00 64.46  ? 642  ARG C CZ    1 
ATOM   8592  N  NH1   . ARG C  2  642  ? 75.959  -11.283 105.492 1.00 55.08  ? 642  ARG C NH1   1 
ATOM   8593  N  NH2   . ARG C  2  642  ? 73.857  -10.990 104.625 1.00 63.86  ? 642  ARG C NH2   1 
ATOM   8594  N  N     . VAL C  2  643  ? 80.324  -16.108 106.827 1.00 68.92  ? 643  VAL C N     1 
ATOM   8595  C  CA    . VAL C  2  643  ? 81.112  -16.924 107.750 1.00 64.64  ? 643  VAL C CA    1 
ATOM   8596  C  C     . VAL C  2  643  ? 82.224  -16.115 108.418 1.00 64.29  ? 643  VAL C C     1 
ATOM   8597  O  O     . VAL C  2  643  ? 82.551  -15.012 107.979 1.00 67.17  ? 643  VAL C O     1 
ATOM   8598  C  CB    . VAL C  2  643  ? 81.729  -18.140 107.035 1.00 63.40  ? 643  VAL C CB    1 
ATOM   8599  C  CG1   . VAL C  2  643  ? 80.635  -19.042 106.490 1.00 61.06  ? 643  VAL C CG1   1 
ATOM   8600  C  CG2   . VAL C  2  643  ? 82.660  -17.687 105.922 1.00 61.31  ? 643  VAL C CG2   1 
ATOM   8601  N  N     . VAL C  2  644  ? 82.804  -16.669 109.478 1.00 65.03  ? 644  VAL C N     1 
ATOM   8602  C  CA    . VAL C  2  644  ? 83.878  -15.995 110.200 1.00 68.97  ? 644  VAL C CA    1 
ATOM   8603  C  C     . VAL C  2  644  ? 85.179  -16.803 110.182 1.00 72.94  ? 644  VAL C C     1 
ATOM   8604  O  O     . VAL C  2  644  ? 85.162  -18.021 109.999 1.00 71.60  ? 644  VAL C O     1 
ATOM   8605  C  CB    . VAL C  2  644  ? 83.475  -15.717 111.657 1.00 66.59  ? 644  VAL C CB    1 
ATOM   8606  C  CG1   . VAL C  2  644  ? 83.315  -17.023 112.416 1.00 68.69  ? 644  VAL C CG1   1 
ATOM   8607  C  CG2   . VAL C  2  644  ? 84.500  -14.816 112.332 1.00 76.72  ? 644  VAL C CG2   1 
ATOM   8608  N  N     . VAL C  2  645  ? 86.302  -16.115 110.375 1.00 74.31  ? 645  VAL C N     1 
ATOM   8609  C  CA    . VAL C  2  645  ? 87.622  -16.744 110.341 1.00 74.53  ? 645  VAL C CA    1 
ATOM   8610  C  C     . VAL C  2  645  ? 87.732  -17.926 111.307 1.00 71.76  ? 645  VAL C C     1 
ATOM   8611  O  O     . VAL C  2  645  ? 87.306  -17.843 112.460 1.00 71.71  ? 645  VAL C O     1 
ATOM   8612  C  CB    . VAL C  2  645  ? 88.745  -15.728 110.663 1.00 74.59  ? 645  VAL C CB    1 
ATOM   8613  C  CG1   . VAL C  2  645  ? 90.103  -16.347 110.419 1.00 65.79  ? 645  VAL C CG1   1 
ATOM   8614  C  CG2   . VAL C  2  645  ? 88.589  -14.470 109.829 1.00 73.82  ? 645  VAL C CG2   1 
ATOM   8615  N  N     . GLY C  2  646  ? 88.304  -19.024 110.826 1.00 70.99  ? 646  GLY C N     1 
ATOM   8616  C  CA    . GLY C  2  646  ? 88.502  -20.206 111.647 1.00 79.11  ? 646  GLY C CA    1 
ATOM   8617  C  C     . GLY C  2  646  ? 87.261  -21.066 111.805 1.00 82.79  ? 646  GLY C C     1 
ATOM   8618  O  O     . GLY C  2  646  ? 87.258  -22.036 112.565 1.00 78.16  ? 646  GLY C O     1 
ATOM   8619  N  N     . GLN C  2  647  ? 86.203  -20.717 111.081 1.00 80.21  ? 647  GLN C N     1 
ATOM   8620  C  CA    . GLN C  2  647  ? 84.954  -21.460 111.156 1.00 76.59  ? 647  GLN C CA    1 
ATOM   8621  C  C     . GLN C  2  647  ? 85.020  -22.763 110.374 1.00 76.69  ? 647  GLN C C     1 
ATOM   8622  O  O     . GLN C  2  647  ? 85.566  -22.807 109.277 1.00 81.10  ? 647  GLN C O     1 
ATOM   8623  C  CB    . GLN C  2  647  ? 83.800  -20.605 110.640 1.00 73.90  ? 647  GLN C CB    1 
ATOM   8624  C  CG    . GLN C  2  647  ? 82.515  -21.373 110.445 1.00 72.46  ? 647  GLN C CG    1 
ATOM   8625  C  CD    . GLN C  2  647  ? 81.346  -20.470 110.140 1.00 67.25  ? 647  GLN C CD    1 
ATOM   8626  O  OE1   . GLN C  2  647  ? 81.443  -19.248 110.260 1.00 61.74  ? 647  GLN C OE1   1 
ATOM   8627  N  NE2   . GLN C  2  647  ? 80.228  -21.066 109.744 1.00 65.75  ? 647  GLN C NE2   1 
ATOM   8628  N  N     . ARG C  2  648  ? 84.454  -23.822 110.941 1.00 83.67  ? 648  ARG C N     1 
ATOM   8629  C  CA    . ARG C  2  648  ? 84.429  -25.122 110.277 1.00 92.68  ? 648  ARG C CA    1 
ATOM   8630  C  C     . ARG C  2  648  ? 83.221  -25.259 109.359 1.00 91.42  ? 648  ARG C C     1 
ATOM   8631  O  O     . ARG C  2  648  ? 82.077  -25.177 109.809 1.00 90.60  ? 648  ARG C O     1 
ATOM   8632  C  CB    . ARG C  2  648  ? 84.436  -26.254 111.307 1.00 103.55 ? 648  ARG C CB    1 
ATOM   8633  C  CG    . ARG C  2  648  ? 85.680  -26.283 112.173 1.00 110.61 ? 648  ARG C CG    1 
ATOM   8634  C  CD    . ARG C  2  648  ? 86.121  -27.705 112.462 1.00 121.45 ? 648  ARG C CD    1 
ATOM   8635  N  NE    . ARG C  2  648  ? 87.450  -27.740 113.064 1.00 133.32 ? 648  ARG C NE    1 
ATOM   8636  C  CZ    . ARG C  2  648  ? 88.583  -27.748 112.369 1.00 131.26 ? 648  ARG C CZ    1 
ATOM   8637  N  NH1   . ARG C  2  648  ? 88.549  -27.725 111.043 1.00 119.70 ? 648  ARG C NH1   1 
ATOM   8638  N  NH2   . ARG C  2  648  ? 89.750  -27.778 113.000 1.00 130.33 ? 648  ARG C NH2   1 
ATOM   8639  N  N     . VAL C  2  649  ? 83.478  -25.474 108.072 1.00 88.34  ? 649  VAL C N     1 
ATOM   8640  C  CA    . VAL C  2  649  ? 82.398  -25.586 107.097 1.00 90.58  ? 649  VAL C CA    1 
ATOM   8641  C  C     . VAL C  2  649  ? 82.435  -26.906 106.334 1.00 92.30  ? 649  VAL C C     1 
ATOM   8642  O  O     . VAL C  2  649  ? 83.497  -27.365 105.915 1.00 93.81  ? 649  VAL C O     1 
ATOM   8643  C  CB    . VAL C  2  649  ? 82.407  -24.411 106.090 1.00 87.34  ? 649  VAL C CB    1 
ATOM   8644  C  CG1   . VAL C  2  649  ? 82.147  -23.101 106.808 1.00 85.69  ? 649  VAL C CG1   1 
ATOM   8645  C  CG2   . VAL C  2  649  ? 83.723  -24.357 105.332 1.00 75.53  ? 649  VAL C CG2   1 
ATOM   8646  N  N     . ARG C  2  650  ? 81.265  -27.515 106.162 1.00 91.60  ? 650  ARG C N     1 
ATOM   8647  C  CA    . ARG C  2  650  ? 81.152  -28.757 105.409 1.00 95.98  ? 650  ARG C CA    1 
ATOM   8648  C  C     . ARG C  2  650  ? 80.943  -28.462 103.929 1.00 92.59  ? 650  ARG C C     1 
ATOM   8649  O  O     . ARG C  2  650  ? 80.637  -27.333 103.550 1.00 89.09  ? 650  ARG C O     1 
ATOM   8650  C  CB    . ARG C  2  650  ? 79.987  -29.593 105.933 1.00 103.53 ? 650  ARG C CB    1 
ATOM   8651  C  CG    . ARG C  2  650  ? 79.831  -29.545 107.442 1.00 115.81 ? 650  ARG C CG    1 
ATOM   8652  C  CD    . ARG C  2  650  ? 79.842  -30.938 108.049 1.00 131.45 ? 650  ARG C CD    1 
ATOM   8653  N  NE    . ARG C  2  650  ? 79.510  -30.907 109.470 1.00 149.75 ? 650  ARG C NE    1 
ATOM   8654  C  CZ    . ARG C  2  650  ? 78.307  -30.598 109.947 1.00 153.80 ? 650  ARG C CZ    1 
ATOM   8655  N  NH1   . ARG C  2  650  ? 77.321  -30.280 109.116 1.00 143.62 ? 650  ARG C NH1   1 
ATOM   8656  N  NH2   . ARG C  2  650  ? 78.090  -30.596 111.256 1.00 151.73 ? 650  ARG C NH2   1 
ATOM   8657  N  N     . LYS C  2  651  ? 81.118  -29.479 103.096 1.00 94.94  ? 651  LYS C N     1 
ATOM   8658  C  CA    . LYS C  2  651  ? 80.846  -29.350 101.672 1.00 96.36  ? 651  LYS C CA    1 
ATOM   8659  C  C     . LYS C  2  651  ? 79.401  -28.921 101.473 1.00 92.38  ? 651  LYS C C     1 
ATOM   8660  O  O     . LYS C  2  651  ? 78.483  -29.569 101.977 1.00 89.77  ? 651  LYS C O     1 
ATOM   8661  C  CB    . LYS C  2  651  ? 81.096  -30.683 100.967 1.00 97.98  ? 651  LYS C CB    1 
ATOM   8662  C  CG    . LYS C  2  651  ? 80.572  -30.759 99.546  1.00 89.58  ? 651  LYS C CG    1 
ATOM   8663  C  CD    . LYS C  2  651  ? 80.496  -32.206 99.089  1.00 95.45  ? 651  LYS C CD    1 
ATOM   8664  C  CE    . LYS C  2  651  ? 80.123  -32.320 97.620  1.00 106.66 ? 651  LYS C CE    1 
ATOM   8665  N  NZ    . LYS C  2  651  ? 81.206  -31.830 96.715  1.00 102.29 ? 651  LYS C NZ    1 
ATOM   8666  N  N     . GLY C  2  652  ? 79.204  -27.824 100.749 1.00 87.98  ? 652  GLY C N     1 
ATOM   8667  C  CA    . GLY C  2  652  ? 77.870  -27.338 100.450 1.00 85.26  ? 652  GLY C CA    1 
ATOM   8668  C  C     . GLY C  2  652  ? 77.362  -26.264 101.394 1.00 85.62  ? 652  GLY C C     1 
ATOM   8669  O  O     . GLY C  2  652  ? 76.266  -25.736 101.204 1.00 87.13  ? 652  GLY C O     1 
ATOM   8670  N  N     . ASP C  2  653  ? 78.152  -25.943 102.415 1.00 82.82  ? 653  ASP C N     1 
ATOM   8671  C  CA    . ASP C  2  653  ? 77.782  -24.904 103.374 1.00 74.51  ? 653  ASP C CA    1 
ATOM   8672  C  C     . ASP C  2  653  ? 77.868  -23.519 102.754 1.00 66.91  ? 653  ASP C C     1 
ATOM   8673  O  O     . ASP C  2  653  ? 78.656  -23.283 101.845 1.00 75.97  ? 653  ASP C O     1 
ATOM   8674  C  CB    . ASP C  2  653  ? 78.665  -24.969 104.624 1.00 84.59  ? 653  ASP C CB    1 
ATOM   8675  C  CG    . ASP C  2  653  ? 78.183  -25.996 105.628 1.00 88.39  ? 653  ASP C CG    1 
ATOM   8676  O  OD1   . ASP C  2  653  ? 78.597  -25.910 106.803 1.00 86.45  ? 653  ASP C OD1   1 
ATOM   8677  O  OD2   . ASP C  2  653  ? 77.387  -26.883 105.248 1.00 88.33  ? 653  ASP C OD2   1 
ATOM   8678  N  N     . LEU C  2  654  ? 77.056  -22.601 103.258 1.00 68.47  ? 654  LEU C N     1 
ATOM   8679  C  CA    . LEU C  2  654  ? 76.991  -21.253 102.713 1.00 68.00  ? 654  LEU C CA    1 
ATOM   8680  C  C     . LEU C  2  654  ? 78.182  -20.415 103.163 1.00 64.24  ? 654  LEU C C     1 
ATOM   8681  O  O     . LEU C  2  654  ? 78.434  -20.287 104.359 1.00 69.55  ? 654  LEU C O     1 
ATOM   8682  C  CB    . LEU C  2  654  ? 75.690  -20.580 103.147 1.00 54.50  ? 654  LEU C CB    1 
ATOM   8683  C  CG    . LEU C  2  654  ? 75.480  -19.162 102.627 1.00 51.46  ? 654  LEU C CG    1 
ATOM   8684  C  CD1   . LEU C  2  654  ? 75.029  -19.208 101.183 1.00 63.39  ? 654  LEU C CD1   1 
ATOM   8685  C  CD2   . LEU C  2  654  ? 74.469  -18.428 103.478 1.00 50.08  ? 654  LEU C CD2   1 
ATOM   8686  N  N     . LEU C  2  655  ? 78.910  -19.846 102.205 1.00 53.07  ? 655  LEU C N     1 
ATOM   8687  C  CA    . LEU C  2  655  ? 80.031  -18.974 102.529 1.00 55.75  ? 655  LEU C CA    1 
ATOM   8688  C  C     . LEU C  2  655  ? 79.669  -17.507 102.344 1.00 56.17  ? 655  LEU C C     1 
ATOM   8689  O  O     . LEU C  2  655  ? 80.253  -16.637 102.984 1.00 58.39  ? 655  LEU C O     1 
ATOM   8690  C  CB    . LEU C  2  655  ? 81.258  -19.318 101.684 1.00 65.51  ? 655  LEU C CB    1 
ATOM   8691  C  CG    . LEU C  2  655  ? 81.801  -20.744 101.785 1.00 65.02  ? 655  LEU C CG    1 
ATOM   8692  C  CD1   . LEU C  2  655  ? 83.053  -20.881 100.943 1.00 61.24  ? 655  LEU C CD1   1 
ATOM   8693  C  CD2   . LEU C  2  655  ? 82.084  -21.101 103.236 1.00 71.85  ? 655  LEU C CD2   1 
ATOM   8694  N  N     . ALA C  2  656  ? 78.692  -17.237 101.483 1.00 58.37  ? 656  ALA C N     1 
ATOM   8695  C  CA    . ALA C  2  656  ? 78.292  -15.862 101.190 1.00 61.58  ? 656  ALA C CA    1 
ATOM   8696  C  C     . ALA C  2  656  ? 76.857  -15.756 100.682 1.00 60.47  ? 656  ALA C C     1 
ATOM   8697  O  O     . ALA C  2  656  ? 76.338  -16.681 100.066 1.00 60.00  ? 656  ALA C O     1 
ATOM   8698  C  CB    . ALA C  2  656  ? 79.248  -15.240 100.186 1.00 57.88  ? 656  ALA C CB    1 
ATOM   8699  N  N     . ASP C  2  657  ? 76.229  -14.612 100.923 1.00 56.28  ? 657  ASP C N     1 
ATOM   8700  C  CA    . ASP C  2  657  ? 74.857  -14.402 100.488 1.00 59.78  ? 657  ASP C CA    1 
ATOM   8701  C  C     . ASP C  2  657  ? 74.793  -13.613 99.178  1.00 65.26  ? 657  ASP C C     1 
ATOM   8702  O  O     . ASP C  2  657  ? 75.545  -12.659 98.980  1.00 64.29  ? 657  ASP C O     1 
ATOM   8703  C  CB    . ASP C  2  657  ? 74.040  -13.697 101.578 1.00 59.91  ? 657  ASP C CB    1 
ATOM   8704  C  CG    . ASP C  2  657  ? 73.150  -14.654 102.360 1.00 56.33  ? 657  ASP C CG    1 
ATOM   8705  O  OD1   . ASP C  2  657  ? 72.921  -15.786 101.880 1.00 52.04  ? 657  ASP C OD1   1 
ATOM   8706  O  OD2   . ASP C  2  657  ? 72.668  -14.263 103.449 1.00 54.67  ? 657  ASP C OD2   1 
ATOM   8707  N  N     . GLY C  2  658  ? 73.893  -14.026 98.287  1.00 68.47  ? 658  GLY C N     1 
ATOM   8708  C  CA    . GLY C  2  658  ? 73.664  -13.328 97.037  1.00 63.35  ? 658  GLY C CA    1 
ATOM   8709  C  C     . GLY C  2  658  ? 73.001  -11.984 97.258  1.00 65.33  ? 658  GLY C C     1 
ATOM   8710  O  O     . GLY C  2  658  ? 72.837  -11.547 98.398  1.00 70.64  ? 658  GLY C O     1 
ATOM   8711  N  N     . PRO C  2  659  ? 72.578  -11.350 96.174  1.00 61.16  ? 659  PRO C N     1 
ATOM   8712  C  CA    . PRO C  2  659  ? 71.626  -10.249 96.288  1.00 64.84  ? 659  PRO C CA    1 
ATOM   8713  C  C     . PRO C  2  659  ? 70.281  -10.845 96.691  1.00 60.49  ? 659  PRO C C     1 
ATOM   8714  O  O     . PRO C  2  659  ? 69.879  -11.868 96.137  1.00 60.84  ? 659  PRO C O     1 
ATOM   8715  C  CB    . PRO C  2  659  ? 71.559  -9.697  94.865  1.00 61.02  ? 659  PRO C CB    1 
ATOM   8716  C  CG    . PRO C  2  659  ? 71.894  -10.862 93.999  1.00 60.63  ? 659  PRO C CG    1 
ATOM   8717  C  CD    . PRO C  2  659  ? 72.904  -11.660 94.771  1.00 63.19  ? 659  PRO C CD    1 
ATOM   8718  N  N     . ALA C  2  660  ? 69.595  -10.214 97.635  1.00 55.08  ? 660  ALA C N     1 
ATOM   8719  C  CA    . ALA C  2  660  ? 68.264  -10.653 98.046  1.00 57.90  ? 660  ALA C CA    1 
ATOM   8720  C  C     . ALA C  2  660  ? 68.150  -12.086 98.590  1.00 56.23  ? 660  ALA C C     1 
ATOM   8721  O  O     . ALA C  2  660  ? 67.146  -12.756 98.350  1.00 57.33  ? 660  ALA C O     1 
ATOM   8722  C  CB    . ALA C  2  660  ? 67.272  -10.446 96.908  1.00 48.11  ? 660  ALA C CB    1 
ATOM   8723  N  N     . SER C  2  661  ? 69.152  -12.550 99.334  1.00 51.44  ? 661  SER C N     1 
ATOM   8724  C  CA    . SER C  2  661  ? 68.999  -13.771 100.101 1.00 54.75  ? 661  SER C CA    1 
ATOM   8725  C  C     . SER C  2  661  ? 69.468  -13.582 101.546 1.00 56.27  ? 661  SER C C     1 
ATOM   8726  O  O     . SER C  2  661  ? 70.288  -12.709 101.850 1.00 54.69  ? 661  SER C O     1 
ATOM   8727  C  CB    . SER C  2  661  ? 69.729  -14.944 99.429  1.00 50.31  ? 661  SER C CB    1 
ATOM   8728  O  OG    . SER C  2  661  ? 71.135  -14.780 99.467  1.00 49.23  ? 661  SER C OG    1 
ATOM   8729  N  N     . GLU C  2  662  ? 68.923  -14.402 102.435 1.00 50.60  ? 662  GLU C N     1 
ATOM   8730  C  CA    . GLU C  2  662  ? 69.245  -14.318 103.841 1.00 54.39  ? 662  GLU C CA    1 
ATOM   8731  C  C     . GLU C  2  662  ? 69.672  -15.699 104.298 1.00 60.92  ? 662  GLU C C     1 
ATOM   8732  O  O     . GLU C  2  662  ? 68.852  -16.613 104.373 1.00 60.39  ? 662  GLU C O     1 
ATOM   8733  C  CB    . GLU C  2  662  ? 68.023  -13.851 104.630 1.00 52.88  ? 662  GLU C CB    1 
ATOM   8734  C  CG    . GLU C  2  662  ? 68.279  -13.631 106.105 1.00 54.89  ? 662  GLU C CG    1 
ATOM   8735  C  CD    . GLU C  2  662  ? 67.048  -13.166 106.837 1.00 55.79  ? 662  GLU C CD    1 
ATOM   8736  O  OE1   . GLU C  2  662  ? 65.961  -13.714 106.567 1.00 55.85  ? 662  GLU C OE1   1 
ATOM   8737  O  OE2   . GLU C  2  662  ? 67.167  -12.248 107.675 1.00 55.28  ? 662  GLU C OE2   1 
ATOM   8738  N  N     . ASN C  2  663  ? 70.959  -15.849 104.593 1.00 59.82  ? 663  ASN C N     1 
ATOM   8739  C  CA    . ASN C  2  663  ? 71.492  -17.130 105.030 1.00 56.93  ? 663  ASN C CA    1 
ATOM   8740  C  C     . ASN C  2  663  ? 71.101  -18.251 104.070 1.00 62.00  ? 663  ASN C C     1 
ATOM   8741  O  O     . ASN C  2  663  ? 70.816  -19.374 104.492 1.00 62.52  ? 663  ASN C O     1 
ATOM   8742  C  CB    . ASN C  2  663  ? 71.022  -17.456 106.450 1.00 60.45  ? 663  ASN C CB    1 
ATOM   8743  C  CG    . ASN C  2  663  ? 71.208  -16.289 107.414 1.00 70.29  ? 663  ASN C CG    1 
ATOM   8744  O  OD1   . ASN C  2  663  ? 72.145  -15.497 107.287 1.00 74.15  ? 663  ASN C OD1   1 
ATOM   8745  N  ND2   . ASN C  2  663  ? 70.305  -16.177 108.383 1.00 73.53  ? 663  ASN C ND2   1 
ATOM   8746  N  N     . GLY C  2  664  ? 71.076  -17.934 102.777 1.00 55.93  ? 664  GLY C N     1 
ATOM   8747  C  CA    . GLY C  2  664  ? 70.851  -18.940 101.758 1.00 53.37  ? 664  GLY C CA    1 
ATOM   8748  C  C     . GLY C  2  664  ? 69.402  -19.121 101.366 1.00 50.47  ? 664  GLY C C     1 
ATOM   8749  O  O     . GLY C  2  664  ? 69.089  -19.902 100.468 1.00 51.99  ? 664  GLY C O     1 
ATOM   8750  N  N     . PHE C  2  665  ? 68.517  -18.405 102.049 1.00 47.26  ? 665  PHE C N     1 
ATOM   8751  C  CA    . PHE C  2  665  ? 67.100  -18.399 101.710 1.00 51.30  ? 665  PHE C CA    1 
ATOM   8752  C  C     . PHE C  2  665  ? 66.789  -17.172 100.858 1.00 49.19  ? 665  PHE C C     1 
ATOM   8753  O  O     . PHE C  2  665  ? 67.270  -16.080 101.144 1.00 51.19  ? 665  PHE C O     1 
ATOM   8754  C  CB    . PHE C  2  665  ? 66.241  -18.351 102.978 1.00 56.77  ? 665  PHE C CB    1 
ATOM   8755  C  CG    . PHE C  2  665  ? 66.342  -19.576 103.844 1.00 55.24  ? 665  PHE C CG    1 
ATOM   8756  C  CD1   . PHE C  2  665  ? 65.424  -20.602 103.723 1.00 57.04  ? 665  PHE C CD1   1 
ATOM   8757  C  CD2   . PHE C  2  665  ? 67.334  -19.686 104.796 1.00 56.53  ? 665  PHE C CD2   1 
ATOM   8758  C  CE1   . PHE C  2  665  ? 65.505  -21.719 104.520 1.00 57.07  ? 665  PHE C CE1   1 
ATOM   8759  C  CE2   . PHE C  2  665  ? 67.418  -20.802 105.594 1.00 59.47  ? 665  PHE C CE2   1 
ATOM   8760  C  CZ    . PHE C  2  665  ? 66.502  -21.819 105.456 1.00 56.69  ? 665  PHE C CZ    1 
ATOM   8761  N  N     . LEU C  2  666  ? 65.968  -17.348 99.829  1.00 44.97  ? 666  LEU C N     1 
ATOM   8762  C  CA    . LEU C  2  666  ? 65.619  -16.257 98.926  1.00 43.27  ? 666  LEU C CA    1 
ATOM   8763  C  C     . LEU C  2  666  ? 64.901  -15.112 99.638  1.00 46.89  ? 666  LEU C C     1 
ATOM   8764  O  O     . LEU C  2  666  ? 63.817  -15.298 100.178 1.00 46.93  ? 666  LEU C O     1 
ATOM   8765  C  CB    . LEU C  2  666  ? 64.744  -16.790 97.791  1.00 40.72  ? 666  LEU C CB    1 
ATOM   8766  C  CG    . LEU C  2  666  ? 64.267  -15.766 96.763  1.00 41.01  ? 666  LEU C CG    1 
ATOM   8767  C  CD1   . LEU C  2  666  ? 65.446  -15.200 95.984  1.00 43.59  ? 666  LEU C CD1   1 
ATOM   8768  C  CD2   . LEU C  2  666  ? 63.237  -16.375 95.831  1.00 33.78  ? 666  LEU C CD2   1 
ATOM   8769  N  N     . ALA C  2  667  ? 65.490  -13.919 99.619  1.00 46.61  ? 667  ALA C N     1 
ATOM   8770  C  CA    . ALA C  2  667  ? 64.902  -12.775 100.321 1.00 44.38  ? 667  ALA C CA    1 
ATOM   8771  C  C     . ALA C  2  667  ? 64.495  -11.615 99.403  1.00 45.61  ? 667  ALA C C     1 
ATOM   8772  O  O     . ALA C  2  667  ? 65.269  -10.684 99.178  1.00 44.87  ? 667  ALA C O     1 
ATOM   8773  C  CB    . ALA C  2  667  ? 65.853  -12.277 101.397 1.00 42.19  ? 667  ALA C CB    1 
ATOM   8774  N  N     . LEU C  2  668  ? 63.261  -11.651 98.915  1.00 44.48  ? 668  LEU C N     1 
ATOM   8775  C  CA    . LEU C  2  668  ? 62.795  -10.660 97.956  1.00 44.41  ? 668  LEU C CA    1 
ATOM   8776  C  C     . LEU C  2  668  ? 62.263  -9.385  98.608  1.00 48.79  ? 668  LEU C C     1 
ATOM   8777  O  O     . LEU C  2  668  ? 62.455  -8.276  98.093  1.00 54.17  ? 668  LEU C O     1 
ATOM   8778  C  CB    . LEU C  2  668  ? 61.737  -11.273 97.040  1.00 42.12  ? 668  LEU C CB    1 
ATOM   8779  C  CG    . LEU C  2  668  ? 62.251  -12.453 96.220  1.00 43.32  ? 668  LEU C CG    1 
ATOM   8780  C  CD1   . LEU C  2  668  ? 61.159  -13.027 95.332  1.00 46.61  ? 668  LEU C CD1   1 
ATOM   8781  C  CD2   . LEU C  2  668  ? 63.438  -12.020 95.388  1.00 38.61  ? 668  LEU C CD2   1 
ATOM   8782  N  N     . GLY C  2  669  ? 61.588  -9.536  99.738  1.00 43.62  ? 669  GLY C N     1 
ATOM   8783  C  CA    . GLY C  2  669  ? 61.035  -8.381  100.412 1.00 48.71  ? 669  GLY C CA    1 
ATOM   8784  C  C     . GLY C  2  669  ? 61.451  -8.290  101.860 1.00 46.89  ? 669  GLY C C     1 
ATOM   8785  O  O     . GLY C  2  669  ? 62.569  -8.665  102.222 1.00 40.71  ? 669  GLY C O     1 
ATOM   8786  N  N     . GLN C  2  670  ? 60.546  -7.773  102.684 1.00 43.32  ? 670  GLN C N     1 
ATOM   8787  C  CA    . GLN C  2  670  ? 60.735  -7.755  104.123 1.00 45.32  ? 670  GLN C CA    1 
ATOM   8788  C  C     . GLN C  2  670  ? 59.493  -8.289  104.787 1.00 49.05  ? 670  GLN C C     1 
ATOM   8789  O  O     . GLN C  2  670  ? 58.416  -8.299  104.192 1.00 54.35  ? 670  GLN C O     1 
ATOM   8790  C  CB    . GLN C  2  670  ? 61.029  -6.344  104.621 1.00 44.27  ? 670  GLN C CB    1 
ATOM   8791  C  CG    . GLN C  2  670  ? 62.511  -6.077  104.829 1.00 47.42  ? 670  GLN C CG    1 
ATOM   8792  C  CD    . GLN C  2  670  ? 62.945  -4.805  104.165 1.00 48.45  ? 670  GLN C CD    1 
ATOM   8793  O  OE1   . GLN C  2  670  ? 62.190  -4.218  103.391 1.00 55.27  ? 670  GLN C OE1   1 
ATOM   8794  N  NE2   . GLN C  2  670  ? 64.159  -4.361  104.459 1.00 50.83  ? 670  GLN C NE2   1 
ATOM   8795  N  N     . ASN C  2  671  ? 59.644  -8.758  106.015 1.00 43.14  ? 671  ASN C N     1 
ATOM   8796  C  CA    . ASN C  2  671  ? 58.489  -9.117  106.813 1.00 48.00  ? 671  ASN C CA    1 
ATOM   8797  C  C     . ASN C  2  671  ? 58.063  -7.927  107.658 1.00 53.90  ? 671  ASN C C     1 
ATOM   8798  O  O     . ASN C  2  671  ? 58.812  -7.474  108.527 1.00 48.69  ? 671  ASN C O     1 
ATOM   8799  C  CB    . ASN C  2  671  ? 58.803  -10.313 107.696 1.00 47.22  ? 671  ASN C CB    1 
ATOM   8800  C  CG    . ASN C  2  671  ? 59.211  -11.521 106.898 1.00 50.69  ? 671  ASN C CG    1 
ATOM   8801  O  OD1   . ASN C  2  671  ? 58.392  -12.127 106.208 1.00 51.30  ? 671  ASN C OD1   1 
ATOM   8802  N  ND2   . ASN C  2  671  ? 60.483  -11.883 106.983 1.00 51.94  ? 671  ASN C ND2   1 
ATOM   8803  N  N     . VAL C  2  672  ? 56.871  -7.405  107.385 1.00 50.01  ? 672  VAL C N     1 
ATOM   8804  C  CA    . VAL C  2  672  ? 56.369  -6.262  108.128 1.00 42.99  ? 672  VAL C CA    1 
ATOM   8805  C  C     . VAL C  2  672  ? 55.107  -6.603  108.905 1.00 50.72  ? 672  VAL C C     1 
ATOM   8806  O  O     . VAL C  2  672  ? 54.370  -7.521  108.554 1.00 51.23  ? 672  VAL C O     1 
ATOM   8807  C  CB    . VAL C  2  672  ? 56.093  -5.062  107.221 1.00 34.65  ? 672  VAL C CB    1 
ATOM   8808  C  CG1   . VAL C  2  672  ? 57.389  -4.384  106.843 1.00 38.79  ? 672  VAL C CG1   1 
ATOM   8809  C  CG2   . VAL C  2  672  ? 55.320  -5.497  105.995 1.00 39.47  ? 672  VAL C CG2   1 
ATOM   8810  N  N     . LEU C  2  673  ? 54.881  -5.852  109.974 1.00 45.72  ? 673  LEU C N     1 
ATOM   8811  C  CA    . LEU C  2  673  ? 53.681  -5.986  110.766 1.00 39.55  ? 673  LEU C CA    1 
ATOM   8812  C  C     . LEU C  2  673  ? 52.603  -5.172  110.085 1.00 46.47  ? 673  LEU C C     1 
ATOM   8813  O  O     . LEU C  2  673  ? 52.732  -3.961  109.925 1.00 49.79  ? 673  LEU C O     1 
ATOM   8814  C  CB    . LEU C  2  673  ? 53.919  -5.450  112.169 1.00 44.48  ? 673  LEU C CB    1 
ATOM   8815  C  CG    . LEU C  2  673  ? 52.918  -5.957  113.197 1.00 55.35  ? 673  LEU C CG    1 
ATOM   8816  C  CD1   . LEU C  2  673  ? 53.098  -7.458  113.395 1.00 48.68  ? 673  LEU C CD1   1 
ATOM   8817  C  CD2   . LEU C  2  673  ? 53.088  -5.208  114.503 1.00 61.43  ? 673  LEU C CD2   1 
ATOM   8818  N  N     . VAL C  2  674  ? 51.541  -5.846  109.680 1.00 42.39  ? 674  VAL C N     1 
ATOM   8819  C  CA    . VAL C  2  674  ? 50.510  -5.238  108.874 1.00 42.11  ? 674  VAL C CA    1 
ATOM   8820  C  C     . VAL C  2  674  ? 49.161  -5.349  109.565 1.00 44.50  ? 674  VAL C C     1 
ATOM   8821  O  O     . VAL C  2  674  ? 48.864  -6.350  110.227 1.00 47.20  ? 674  VAL C O     1 
ATOM   8822  C  CB    . VAL C  2  674  ? 50.439  -5.902  107.482 1.00 42.69  ? 674  VAL C CB    1 
ATOM   8823  C  CG1   . VAL C  2  674  ? 49.878  -7.309  107.585 1.00 45.44  ? 674  VAL C CG1   1 
ATOM   8824  C  CG2   . VAL C  2  674  ? 49.584  -5.079  106.554 1.00 47.87  ? 674  VAL C CG2   1 
ATOM   8825  N  N     . ALA C  2  675  ? 48.358  -4.303  109.408 1.00 42.01  ? 675  ALA C N     1 
ATOM   8826  C  CA    . ALA C  2  675  ? 46.991  -4.276  109.903 1.00 40.06  ? 675  ALA C CA    1 
ATOM   8827  C  C     . ALA C  2  675  ? 46.045  -4.139  108.726 1.00 44.49  ? 675  ALA C C     1 
ATOM   8828  O  O     . ALA C  2  675  ? 46.232  -3.277  107.867 1.00 47.34  ? 675  ALA C O     1 
ATOM   8829  C  CB    . ALA C  2  675  ? 46.800  -3.119  110.858 1.00 41.33  ? 675  ALA C CB    1 
ATOM   8830  N  N     . ILE C  2  676  ? 45.029  -4.989  108.680 1.00 42.97  ? 676  ILE C N     1 
ATOM   8831  C  CA    . ILE C  2  676  ? 44.082  -4.948  107.580 1.00 39.93  ? 676  ILE C CA    1 
ATOM   8832  C  C     . ILE C  2  676  ? 42.837  -4.174  107.993 1.00 45.98  ? 676  ILE C C     1 
ATOM   8833  O  O     . ILE C  2  676  ? 41.933  -4.711  108.625 1.00 48.01  ? 676  ILE C O     1 
ATOM   8834  C  CB    . ILE C  2  676  ? 43.704  -6.362  107.091 1.00 38.45  ? 676  ILE C CB    1 
ATOM   8835  C  CG1   . ILE C  2  676  ? 44.966  -7.144  106.721 1.00 33.96  ? 676  ILE C CG1   1 
ATOM   8836  C  CG2   . ILE C  2  676  ? 42.776  -6.279  105.905 1.00 36.95  ? 676  ILE C CG2   1 
ATOM   8837  C  CD1   . ILE C  2  676  ? 44.699  -8.521  106.199 1.00 33.14  ? 676  ILE C CD1   1 
ATOM   8838  N  N     . MET C  2  677  ? 42.811  -2.901  107.622 1.00 46.02  ? 677  MET C N     1 
ATOM   8839  C  CA    . MET C  2  677  ? 41.725  -2.000  107.955 1.00 43.70  ? 677  MET C CA    1 
ATOM   8840  C  C     . MET C  2  677  ? 41.820  -0.817  107.017 1.00 46.09  ? 677  MET C C     1 
ATOM   8841  O  O     . MET C  2  677  ? 42.912  -0.477  106.558 1.00 44.71  ? 677  MET C O     1 
ATOM   8842  C  CB    . MET C  2  677  ? 41.882  -1.491  109.379 1.00 41.62  ? 677  MET C CB    1 
ATOM   8843  C  CG    . MET C  2  677  ? 43.209  -0.817  109.618 1.00 43.65  ? 677  MET C CG    1 
ATOM   8844  S  SD    . MET C  2  677  ? 43.379  -0.087  111.252 1.00 51.37  ? 677  MET C SD    1 
ATOM   8845  C  CE    . MET C  2  677  ? 42.092  1.156   111.180 1.00 48.29  ? 677  MET C CE    1 
ATOM   8846  N  N     . PRO C  2  678  ? 40.676  -0.181  106.719 1.00 44.43  ? 678  PRO C N     1 
ATOM   8847  C  CA    . PRO C  2  678  ? 40.748  1.058   105.944 1.00 43.89  ? 678  PRO C CA    1 
ATOM   8848  C  C     . PRO C  2  678  ? 41.453  2.098   106.783 1.00 43.08  ? 678  PRO C C     1 
ATOM   8849  O  O     . PRO C  2  678  ? 41.444  1.987   108.005 1.00 42.48  ? 678  PRO C O     1 
ATOM   8850  C  CB    . PRO C  2  678  ? 39.281  1.446   105.760 1.00 43.82  ? 678  PRO C CB    1 
ATOM   8851  C  CG    . PRO C  2  678  ? 38.522  0.187   105.985 1.00 45.79  ? 678  PRO C CG    1 
ATOM   8852  C  CD    . PRO C  2  678  ? 39.288  -0.560  107.020 1.00 42.98  ? 678  PRO C CD    1 
ATOM   8853  N  N     . PHE C  2  679  ? 42.081  3.077   106.148 1.00 39.16  ? 679  PHE C N     1 
ATOM   8854  C  CA    . PHE C  2  679  ? 42.668  4.163   106.904 1.00 35.70  ? 679  PHE C CA    1 
ATOM   8855  C  C     . PHE C  2  679  ? 42.501  5.516   106.224 1.00 35.21  ? 679  PHE C C     1 
ATOM   8856  O  O     . PHE C  2  679  ? 43.325  5.922   105.420 1.00 33.68  ? 679  PHE C O     1 
ATOM   8857  C  CB    . PHE C  2  679  ? 44.140  3.901   107.228 1.00 34.92  ? 679  PHE C CB    1 
ATOM   8858  C  CG    . PHE C  2  679  ? 44.708  4.887   108.195 1.00 39.02  ? 679  PHE C CG    1 
ATOM   8859  C  CD1   . PHE C  2  679  ? 44.729  4.610   109.550 1.00 44.44  ? 679  PHE C CD1   1 
ATOM   8860  C  CD2   . PHE C  2  679  ? 45.168  6.118   107.761 1.00 41.67  ? 679  PHE C CD2   1 
ATOM   8861  C  CE1   . PHE C  2  679  ? 45.225  5.530   110.449 1.00 50.57  ? 679  PHE C CE1   1 
ATOM   8862  C  CE2   . PHE C  2  679  ? 45.662  7.042   108.659 1.00 45.46  ? 679  PHE C CE2   1 
ATOM   8863  C  CZ    . PHE C  2  679  ? 45.692  6.746   110.004 1.00 46.38  ? 679  PHE C CZ    1 
ATOM   8864  N  N     . ASP C  2  680  ? 41.434  6.217   106.586 1.00 43.16  ? 680  ASP C N     1 
ATOM   8865  C  CA    . ASP C  2  680  ? 41.207  7.583   106.131 1.00 42.23  ? 680  ASP C CA    1 
ATOM   8866  C  C     . ASP C  2  680  ? 41.266  7.753   104.622 1.00 40.96  ? 680  ASP C C     1 
ATOM   8867  O  O     . ASP C  2  680  ? 41.571  8.836   104.133 1.00 44.82  ? 680  ASP C O     1 
ATOM   8868  C  CB    . ASP C  2  680  ? 42.193  8.533   106.804 1.00 43.44  ? 680  ASP C CB    1 
ATOM   8869  C  CG    . ASP C  2  680  ? 41.658  9.086   108.111 1.00 59.66  ? 680  ASP C CG    1 
ATOM   8870  O  OD1   . ASP C  2  680  ? 40.618  8.582   108.588 1.00 58.04  ? 680  ASP C OD1   1 
ATOM   8871  O  OD2   . ASP C  2  680  ? 42.270  10.023  108.667 1.00 68.80  ? 680  ASP C OD2   1 
ATOM   8872  N  N     . GLY C  2  681  ? 40.962  6.689   103.886 1.00 40.96  ? 681  GLY C N     1 
ATOM   8873  C  CA    . GLY C  2  681  ? 40.994  6.743   102.435 1.00 42.12  ? 681  GLY C CA    1 
ATOM   8874  C  C     . GLY C  2  681  ? 42.377  6.827   101.803 1.00 41.22  ? 681  GLY C C     1 
ATOM   8875  O  O     . GLY C  2  681  ? 42.494  6.978   100.592 1.00 43.26  ? 681  GLY C O     1 
ATOM   8876  N  N     . TYR C  2  682  ? 43.431  6.733   102.606 1.00 38.13  ? 682  TYR C N     1 
ATOM   8877  C  CA    . TYR C  2  682  ? 44.781  6.728   102.055 1.00 34.70  ? 682  TYR C CA    1 
ATOM   8878  C  C     . TYR C  2  682  ? 45.150  5.386   101.455 1.00 37.98  ? 682  TYR C C     1 
ATOM   8879  O  O     . TYR C  2  682  ? 46.066  5.298   100.642 1.00 45.45  ? 682  TYR C O     1 
ATOM   8880  C  CB    . TYR C  2  682  ? 45.814  7.149   103.095 1.00 34.24  ? 682  TYR C CB