data_4G7Z
# 
_entry.id   4G7Z 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4G7Z         
NDB   NA1932       
RCSB  RCSB073852   
WWPDB D_1000073852 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4G7H . unspecified 
PDB 4G7O . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4G7Z 
_pdbx_database_status.recvd_initial_deposition_date   2012-07-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, Y.'     1 
'Ebright, R.H.' 2 
# 
_citation.id                        primary 
_citation.title                     'Structural basis of transcription initiation.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            338 
_citation.page_first                1076 
_citation.page_last                 1080 
_citation.year                      2012 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23086998 
_citation.pdbx_database_id_DOI      10.1126/science.1227786 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhang, Y.'      1 
primary 'Feng, Y.'       2 
primary 'Chatterjee, S.' 3 
primary 'Tuske, S.'      4 
primary 'Ho, M.X.'       5 
primary 'Arnold, E.'     6 
primary 'Ebright, R.H.'  7 
# 
_cell.entry_id           4G7Z 
_cell.length_a           185.465 
_cell.length_b           103.590 
_cell.length_c           296.507 
_cell.angle_alpha        90.00 
_cell.angle_beta         98.53 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4G7Z 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'DNA-directed RNA polymerase subunit alpha'                                                 35056.164  4 2.7.7.6 
? ? ?                    
2 polymer     nat 'DNA-directed RNA polymerase subunit beta'                                                  125436.539 2 2.7.7.6 
? ? ?                    
3 polymer     nat 
;DNA-directed RNA polymerase subunit beta'
;
170997.391 2 2.7.7.6 ? ? ?                    
4 polymer     nat 'DNA-directed RNA polymerase subunit omega'                                                 11533.316  2 2.7.7.6 
? ? ?                    
5 polymer     man 'RNA polymerase sigma factor'                                                               50769.398  2 ?       
? ? ?                    
6 polymer     syn "5'-D(*TP*AP*TP*AP*AP*TP*GP*GP*GP*AP*GP*CP*TP*GP*TP*CP*AP*CP*GP*GP*AP*TP*GP*CP*AP*GP*G)-3'" 8421.432   2 ?       
? ? 'nontemplate strand' 
7 polymer     syn "5'-D(*CP*CP*TP*GP*CP*AP*TP*CP*CP*GP*TP*GP*AP*GP*(BRU)P*CP*GP*AP*GP*GP*G)-3'"               6545.042   2 ?       
? ? 'template strand'    
8 non-polymer syn 'ZINC ION'                                                                                  65.409     4 ?       
? ? ?                    
9 non-polymer syn 'MAGNESIUM ION'                                                                             24.305     2 ?       
? ? ?                    
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'RNAP subunit alpha, RNA polymerase subunit alpha, Transcriptase subunit alpha'                                    
2 'RNAP subunit beta, RNA polymerase subunit beta, Transcriptase subunit beta'                                       
3 
;RNA polymerase beta-prime subunit, RNAP subunit beta', RNA polymerase subunit beta', Transcriptase subunit beta'
;
4 'RNAP omega subunit, RNA polymerase omega subunit, Transcriptase subunit omega'                                    
5 'RNA polymerase principle sigma factor, sigma A'                                                                   
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
A,B,K,L ? 
2 'polypeptide(L)'        no no  
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
C,M     ? 
3 'polypeptide(L)'        no no  
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
D,N     ? 
4 'polypeptide(L)'        no no  
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
E,O     ? 
5 'polypeptide(L)'        no no  
;MGSSHHHHHHSSGLVPRGSHMKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEG
LDLEEEEEDLPIPKISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSAR
VRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGL
IRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWD
AKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGRE
HTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD
;
;MGSSHHHHHHSSGLVPRGSHMKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEG
LDLEEEEEDLPIPKISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSAR
VRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGL
IRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWD
AKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGRE
HTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD
;
F,P     ? 
6 polydeoxyribonucleotide no no  
;(DT)(DA)(DT)(DA)(DA)(DT)(DG)(DG)(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DA)(DC)(DG)(DG)
(DA)(DT)(DG)(DC)(DA)(DG)(DG)
;
TATAATGGGAGCTGTCACGGATGCAGG H,R     ? 
7 polydeoxyribonucleotide no yes 
;(DC)(DC)(DT)(DG)(DC)(DA)(DT)(DC)(DC)(DG)(DT)(DG)(DA)(DG)(BRU)(DC)(DG)(DA)(DG)
(DG)(DG)
;
CCTGCATCCGTGAGUCGAGGG G,Q     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    LEU n 
1 3    ASP n 
1 4    SER n 
1 5    LYS n 
1 6    LEU n 
1 7    LYS n 
1 8    ALA n 
1 9    PRO n 
1 10   VAL n 
1 11   PHE n 
1 12   THR n 
1 13   VAL n 
1 14   ARG n 
1 15   THR n 
1 16   GLN n 
1 17   GLY n 
1 18   ARG n 
1 19   GLU n 
1 20   TYR n 
1 21   GLY n 
1 22   GLU n 
1 23   PHE n 
1 24   VAL n 
1 25   LEU n 
1 26   GLU n 
1 27   PRO n 
1 28   LEU n 
1 29   GLU n 
1 30   ARG n 
1 31   GLY n 
1 32   PHE n 
1 33   GLY n 
1 34   VAL n 
1 35   THR n 
1 36   LEU n 
1 37   GLY n 
1 38   ASN n 
1 39   PRO n 
1 40   LEU n 
1 41   ARG n 
1 42   ARG n 
1 43   ILE n 
1 44   LEU n 
1 45   LEU n 
1 46   SER n 
1 47   SER n 
1 48   ILE n 
1 49   PRO n 
1 50   GLY n 
1 51   THR n 
1 52   ALA n 
1 53   VAL n 
1 54   THR n 
1 55   SER n 
1 56   VAL n 
1 57   TYR n 
1 58   ILE n 
1 59   GLU n 
1 60   ASP n 
1 61   VAL n 
1 62   LEU n 
1 63   HIS n 
1 64   GLU n 
1 65   PHE n 
1 66   SER n 
1 67   THR n 
1 68   ILE n 
1 69   PRO n 
1 70   GLY n 
1 71   VAL n 
1 72   LYS n 
1 73   GLU n 
1 74   ASP n 
1 75   VAL n 
1 76   VAL n 
1 77   GLU n 
1 78   ILE n 
1 79   ILE n 
1 80   LEU n 
1 81   ASN n 
1 82   LEU n 
1 83   LYS n 
1 84   GLU n 
1 85   LEU n 
1 86   VAL n 
1 87   VAL n 
1 88   ARG n 
1 89   PHE n 
1 90   LEU n 
1 91   ASN n 
1 92   PRO n 
1 93   SER n 
1 94   LEU n 
1 95   GLN n 
1 96   THR n 
1 97   VAL n 
1 98   THR n 
1 99   LEU n 
1 100  LEU n 
1 101  LEU n 
1 102  LYS n 
1 103  ALA n 
1 104  GLU n 
1 105  GLY n 
1 106  PRO n 
1 107  LYS n 
1 108  GLU n 
1 109  VAL n 
1 110  LYS n 
1 111  ALA n 
1 112  ARG n 
1 113  ASP n 
1 114  PHE n 
1 115  LEU n 
1 116  PRO n 
1 117  VAL n 
1 118  ALA n 
1 119  ASP n 
1 120  VAL n 
1 121  GLU n 
1 122  ILE n 
1 123  MET n 
1 124  ASN n 
1 125  PRO n 
1 126  ASP n 
1 127  LEU n 
1 128  HIS n 
1 129  ILE n 
1 130  ALA n 
1 131  THR n 
1 132  LEU n 
1 133  GLU n 
1 134  GLU n 
1 135  GLY n 
1 136  GLY n 
1 137  ARG n 
1 138  LEU n 
1 139  ASN n 
1 140  MET n 
1 141  GLU n 
1 142  VAL n 
1 143  ARG n 
1 144  VAL n 
1 145  ASP n 
1 146  ARG n 
1 147  GLY n 
1 148  VAL n 
1 149  GLY n 
1 150  TYR n 
1 151  VAL n 
1 152  PRO n 
1 153  ALA n 
1 154  GLU n 
1 155  LYS n 
1 156  HIS n 
1 157  GLY n 
1 158  ILE n 
1 159  LYS n 
1 160  ASP n 
1 161  ARG n 
1 162  ILE n 
1 163  ASN n 
1 164  ALA n 
1 165  ILE n 
1 166  PRO n 
1 167  VAL n 
1 168  ASP n 
1 169  ALA n 
1 170  VAL n 
1 171  PHE n 
1 172  SER n 
1 173  PRO n 
1 174  VAL n 
1 175  ARG n 
1 176  ARG n 
1 177  VAL n 
1 178  ALA n 
1 179  PHE n 
1 180  GLN n 
1 181  VAL n 
1 182  GLU n 
1 183  ASP n 
1 184  THR n 
1 185  ARG n 
1 186  LEU n 
1 187  GLY n 
1 188  GLN n 
1 189  ARG n 
1 190  THR n 
1 191  ASP n 
1 192  LEU n 
1 193  ASP n 
1 194  LYS n 
1 195  LEU n 
1 196  THR n 
1 197  LEU n 
1 198  ARG n 
1 199  ILE n 
1 200  TRP n 
1 201  THR n 
1 202  ASP n 
1 203  GLY n 
1 204  SER n 
1 205  VAL n 
1 206  THR n 
1 207  PRO n 
1 208  LEU n 
1 209  GLU n 
1 210  ALA n 
1 211  LEU n 
1 212  ASN n 
1 213  GLN n 
1 214  ALA n 
1 215  VAL n 
1 216  GLU n 
1 217  ILE n 
1 218  LEU n 
1 219  ARG n 
1 220  GLU n 
1 221  HIS n 
1 222  LEU n 
1 223  THR n 
1 224  TYR n 
1 225  PHE n 
1 226  SER n 
1 227  ASN n 
1 228  PRO n 
1 229  GLN n 
1 230  ALA n 
1 231  ALA n 
1 232  ALA n 
1 233  VAL n 
1 234  ALA n 
1 235  ALA n 
1 236  PRO n 
1 237  GLU n 
1 238  GLU n 
1 239  ALA n 
1 240  LYS n 
1 241  GLU n 
1 242  PRO n 
1 243  GLU n 
1 244  ALA n 
1 245  PRO n 
1 246  PRO n 
1 247  GLU n 
1 248  GLN n 
1 249  GLU n 
1 250  GLU n 
1 251  GLU n 
1 252  LEU n 
1 253  ASP n 
1 254  LEU n 
1 255  PRO n 
1 256  LEU n 
1 257  GLU n 
1 258  GLU n 
1 259  LEU n 
1 260  GLY n 
1 261  LEU n 
1 262  SER n 
1 263  THR n 
1 264  ARG n 
1 265  VAL n 
1 266  LEU n 
1 267  HIS n 
1 268  SER n 
1 269  LEU n 
1 270  LYS n 
1 271  GLU n 
1 272  GLU n 
1 273  GLY n 
1 274  ILE n 
1 275  GLU n 
1 276  SER n 
1 277  VAL n 
1 278  ARG n 
1 279  ALA n 
1 280  LEU n 
1 281  LEU n 
1 282  ALA n 
1 283  LEU n 
1 284  ASN n 
1 285  LEU n 
1 286  LYS n 
1 287  ASP n 
1 288  LEU n 
1 289  LYS n 
1 290  ASN n 
1 291  ILE n 
1 292  PRO n 
1 293  GLY n 
1 294  ILE n 
1 295  GLY n 
1 296  GLU n 
1 297  ARG n 
1 298  SER n 
1 299  LEU n 
1 300  GLU n 
1 301  GLU n 
1 302  ILE n 
1 303  LYS n 
1 304  GLU n 
1 305  ALA n 
1 306  LEU n 
1 307  GLU n 
1 308  LYS n 
1 309  LYS n 
1 310  GLY n 
1 311  PHE n 
1 312  THR n 
1 313  LEU n 
1 314  LYS n 
1 315  GLU n 
2 1    MET n 
2 2    GLU n 
2 3    ILE n 
2 4    LYS n 
2 5    ARG n 
2 6    PHE n 
2 7    GLY n 
2 8    ARG n 
2 9    ILE n 
2 10   ARG n 
2 11   GLU n 
2 12   VAL n 
2 13   ILE n 
2 14   PRO n 
2 15   LEU n 
2 16   PRO n 
2 17   PRO n 
2 18   LEU n 
2 19   THR n 
2 20   GLU n 
2 21   ILE n 
2 22   GLN n 
2 23   VAL n 
2 24   GLU n 
2 25   SER n 
2 26   TYR n 
2 27   ARG n 
2 28   ARG n 
2 29   ALA n 
2 30   LEU n 
2 31   GLN n 
2 32   ALA n 
2 33   ASP n 
2 34   VAL n 
2 35   PRO n 
2 36   PRO n 
2 37   GLU n 
2 38   LYS n 
2 39   ARG n 
2 40   GLU n 
2 41   ASN n 
2 42   VAL n 
2 43   GLY n 
2 44   ILE n 
2 45   GLN n 
2 46   ALA n 
2 47   ALA n 
2 48   PHE n 
2 49   ARG n 
2 50   GLU n 
2 51   THR n 
2 52   PHE n 
2 53   PRO n 
2 54   ILE n 
2 55   GLU n 
2 56   GLU n 
2 57   GLU n 
2 58   ASP n 
2 59   LYS n 
2 60   GLY n 
2 61   LYS n 
2 62   GLY n 
2 63   GLY n 
2 64   LEU n 
2 65   VAL n 
2 66   LEU n 
2 67   ASP n 
2 68   PHE n 
2 69   LEU n 
2 70   GLU n 
2 71   TYR n 
2 72   ARG n 
2 73   LEU n 
2 74   GLY n 
2 75   GLU n 
2 76   PRO n 
2 77   PRO n 
2 78   PHE n 
2 79   PRO n 
2 80   GLN n 
2 81   ASP n 
2 82   GLU n 
2 83   CYS n 
2 84   ARG n 
2 85   GLU n 
2 86   LYS n 
2 87   ASP n 
2 88   LEU n 
2 89   THR n 
2 90   TYR n 
2 91   GLN n 
2 92   ALA n 
2 93   PRO n 
2 94   LEU n 
2 95   TYR n 
2 96   ALA n 
2 97   ARG n 
2 98   LEU n 
2 99   GLN n 
2 100  LEU n 
2 101  ILE n 
2 102  HIS n 
2 103  LYS n 
2 104  ASP n 
2 105  THR n 
2 106  GLY n 
2 107  LEU n 
2 108  ILE n 
2 109  LYS n 
2 110  GLU n 
2 111  ASP n 
2 112  GLU n 
2 113  VAL n 
2 114  PHE n 
2 115  LEU n 
2 116  GLY n 
2 117  HIS n 
2 118  ILE n 
2 119  PRO n 
2 120  LEU n 
2 121  MET n 
2 122  THR n 
2 123  GLU n 
2 124  ASP n 
2 125  GLY n 
2 126  SER n 
2 127  PHE n 
2 128  ILE n 
2 129  ILE n 
2 130  ASN n 
2 131  GLY n 
2 132  ALA n 
2 133  ASP n 
2 134  ARG n 
2 135  VAL n 
2 136  ILE n 
2 137  VAL n 
2 138  SER n 
2 139  GLN n 
2 140  ILE n 
2 141  HIS n 
2 142  ARG n 
2 143  SER n 
2 144  PRO n 
2 145  GLY n 
2 146  VAL n 
2 147  TYR n 
2 148  PHE n 
2 149  THR n 
2 150  PRO n 
2 151  ASP n 
2 152  PRO n 
2 153  ALA n 
2 154  ARG n 
2 155  PRO n 
2 156  GLY n 
2 157  ARG n 
2 158  TYR n 
2 159  ILE n 
2 160  ALA n 
2 161  SER n 
2 162  ILE n 
2 163  ILE n 
2 164  PRO n 
2 165  LEU n 
2 166  PRO n 
2 167  LYS n 
2 168  ARG n 
2 169  GLY n 
2 170  PRO n 
2 171  TRP n 
2 172  ILE n 
2 173  ASP n 
2 174  LEU n 
2 175  GLU n 
2 176  VAL n 
2 177  GLU n 
2 178  PRO n 
2 179  ASN n 
2 180  GLY n 
2 181  VAL n 
2 182  VAL n 
2 183  SER n 
2 184  MET n 
2 185  LYS n 
2 186  VAL n 
2 187  ASN n 
2 188  LYS n 
2 189  ARG n 
2 190  LYS n 
2 191  PHE n 
2 192  PRO n 
2 193  LEU n 
2 194  VAL n 
2 195  LEU n 
2 196  LEU n 
2 197  LEU n 
2 198  ARG n 
2 199  VAL n 
2 200  LEU n 
2 201  GLY n 
2 202  TYR n 
2 203  ASP n 
2 204  GLN n 
2 205  GLU n 
2 206  THR n 
2 207  LEU n 
2 208  ALA n 
2 209  ARG n 
2 210  GLU n 
2 211  LEU n 
2 212  GLY n 
2 213  ALA n 
2 214  TYR n 
2 215  GLY n 
2 216  GLU n 
2 217  LEU n 
2 218  VAL n 
2 219  GLN n 
2 220  GLY n 
2 221  LEU n 
2 222  MET n 
2 223  ASP n 
2 224  GLU n 
2 225  SER n 
2 226  VAL n 
2 227  PHE n 
2 228  ALA n 
2 229  MET n 
2 230  ARG n 
2 231  PRO n 
2 232  GLU n 
2 233  GLU n 
2 234  ALA n 
2 235  LEU n 
2 236  ILE n 
2 237  ARG n 
2 238  LEU n 
2 239  PHE n 
2 240  THR n 
2 241  LEU n 
2 242  LEU n 
2 243  ARG n 
2 244  PRO n 
2 245  GLY n 
2 246  ASP n 
2 247  PRO n 
2 248  PRO n 
2 249  LYS n 
2 250  ARG n 
2 251  ASP n 
2 252  LYS n 
2 253  ALA n 
2 254  VAL n 
2 255  ALA n 
2 256  TYR n 
2 257  VAL n 
2 258  TYR n 
2 259  GLY n 
2 260  LEU n 
2 261  ILE n 
2 262  ALA n 
2 263  ASP n 
2 264  PRO n 
2 265  ARG n 
2 266  ARG n 
2 267  TYR n 
2 268  ASP n 
2 269  LEU n 
2 270  GLY n 
2 271  GLU n 
2 272  ALA n 
2 273  GLY n 
2 274  ARG n 
2 275  TYR n 
2 276  LYS n 
2 277  ALA n 
2 278  GLU n 
2 279  GLU n 
2 280  LYS n 
2 281  LEU n 
2 282  GLY n 
2 283  ILE n 
2 284  ARG n 
2 285  LEU n 
2 286  SER n 
2 287  GLY n 
2 288  ARG n 
2 289  THR n 
2 290  LEU n 
2 291  ALA n 
2 292  ARG n 
2 293  PHE n 
2 294  GLU n 
2 295  ASP n 
2 296  GLY n 
2 297  GLU n 
2 298  PHE n 
2 299  LYS n 
2 300  ASP n 
2 301  GLU n 
2 302  VAL n 
2 303  PHE n 
2 304  LEU n 
2 305  PRO n 
2 306  THR n 
2 307  LEU n 
2 308  ARG n 
2 309  TYR n 
2 310  LEU n 
2 311  PHE n 
2 312  ALA n 
2 313  LEU n 
2 314  THR n 
2 315  ALA n 
2 316  GLY n 
2 317  VAL n 
2 318  PRO n 
2 319  GLY n 
2 320  HIS n 
2 321  GLU n 
2 322  VAL n 
2 323  ASP n 
2 324  ASP n 
2 325  ILE n 
2 326  ASP n 
2 327  HIS n 
2 328  LEU n 
2 329  GLY n 
2 330  ASN n 
2 331  ARG n 
2 332  ARG n 
2 333  ILE n 
2 334  ARG n 
2 335  THR n 
2 336  VAL n 
2 337  GLY n 
2 338  GLU n 
2 339  LEU n 
2 340  MET n 
2 341  THR n 
2 342  ASP n 
2 343  GLN n 
2 344  PHE n 
2 345  ARG n 
2 346  VAL n 
2 347  GLY n 
2 348  LEU n 
2 349  ALA n 
2 350  ARG n 
2 351  LEU n 
2 352  ALA n 
2 353  ARG n 
2 354  GLY n 
2 355  VAL n 
2 356  ARG n 
2 357  GLU n 
2 358  ARG n 
2 359  MET n 
2 360  LEU n 
2 361  MET n 
2 362  GLY n 
2 363  SER n 
2 364  GLU n 
2 365  ASP n 
2 366  SER n 
2 367  LEU n 
2 368  THR n 
2 369  PRO n 
2 370  ALA n 
2 371  LYS n 
2 372  LEU n 
2 373  VAL n 
2 374  ASN n 
2 375  SER n 
2 376  ARG n 
2 377  PRO n 
2 378  LEU n 
2 379  GLU n 
2 380  ALA n 
2 381  ALA n 
2 382  ILE n 
2 383  ARG n 
2 384  GLU n 
2 385  PHE n 
2 386  PHE n 
2 387  SER n 
2 388  ARG n 
2 389  SER n 
2 390  GLN n 
2 391  LEU n 
2 392  SER n 
2 393  GLN n 
2 394  PHE n 
2 395  LYS n 
2 396  ASP n 
2 397  GLU n 
2 398  THR n 
2 399  ASN n 
2 400  PRO n 
2 401  LEU n 
2 402  SER n 
2 403  SER n 
2 404  LEU n 
2 405  ARG n 
2 406  HIS n 
2 407  LYS n 
2 408  ARG n 
2 409  ARG n 
2 410  ILE n 
2 411  SER n 
2 412  ALA n 
2 413  LEU n 
2 414  GLY n 
2 415  PRO n 
2 416  GLY n 
2 417  GLY n 
2 418  LEU n 
2 419  THR n 
2 420  ARG n 
2 421  GLU n 
2 422  ARG n 
2 423  ALA n 
2 424  GLY n 
2 425  PHE n 
2 426  ASP n 
2 427  VAL n 
2 428  ARG n 
2 429  ASP n 
2 430  VAL n 
2 431  HIS n 
2 432  ARG n 
2 433  THR n 
2 434  HIS n 
2 435  TYR n 
2 436  GLY n 
2 437  ARG n 
2 438  ILE n 
2 439  CYS n 
2 440  PRO n 
2 441  VAL n 
2 442  GLU n 
2 443  THR n 
2 444  PRO n 
2 445  GLU n 
2 446  GLY n 
2 447  ALA n 
2 448  ASN n 
2 449  ILE n 
2 450  GLY n 
2 451  LEU n 
2 452  ILE n 
2 453  THR n 
2 454  SER n 
2 455  LEU n 
2 456  ALA n 
2 457  ALA n 
2 458  TYR n 
2 459  ALA n 
2 460  ARG n 
2 461  VAL n 
2 462  ASP n 
2 463  GLU n 
2 464  LEU n 
2 465  GLY n 
2 466  PHE n 
2 467  ILE n 
2 468  ARG n 
2 469  THR n 
2 470  PRO n 
2 471  TYR n 
2 472  ARG n 
2 473  ARG n 
2 474  VAL n 
2 475  VAL n 
2 476  GLY n 
2 477  GLY n 
2 478  VAL n 
2 479  VAL n 
2 480  THR n 
2 481  ASP n 
2 482  GLU n 
2 483  VAL n 
2 484  VAL n 
2 485  TYR n 
2 486  MET n 
2 487  THR n 
2 488  ALA n 
2 489  THR n 
2 490  GLU n 
2 491  GLU n 
2 492  ASP n 
2 493  ARG n 
2 494  TYR n 
2 495  THR n 
2 496  ILE n 
2 497  ALA n 
2 498  GLN n 
2 499  ALA n 
2 500  ASN n 
2 501  THR n 
2 502  PRO n 
2 503  LEU n 
2 504  GLU n 
2 505  GLY n 
2 506  ASN n 
2 507  ARG n 
2 508  ILE n 
2 509  ALA n 
2 510  ALA n 
2 511  GLU n 
2 512  ARG n 
2 513  VAL n 
2 514  VAL n 
2 515  ALA n 
2 516  ARG n 
2 517  ARG n 
2 518  LYS n 
2 519  GLY n 
2 520  GLU n 
2 521  PRO n 
2 522  VAL n 
2 523  ILE n 
2 524  VAL n 
2 525  SER n 
2 526  PRO n 
2 527  GLU n 
2 528  GLU n 
2 529  VAL n 
2 530  GLU n 
2 531  PHE n 
2 532  MET n 
2 533  ASP n 
2 534  VAL n 
2 535  SER n 
2 536  PRO n 
2 537  LYS n 
2 538  GLN n 
2 539  VAL n 
2 540  PHE n 
2 541  SER n 
2 542  VAL n 
2 543  ASN n 
2 544  THR n 
2 545  ASN n 
2 546  LEU n 
2 547  ILE n 
2 548  PRO n 
2 549  PHE n 
2 550  LEU n 
2 551  GLU n 
2 552  HIS n 
2 553  ASP n 
2 554  ASP n 
2 555  ALA n 
2 556  ASN n 
2 557  ARG n 
2 558  ALA n 
2 559  LEU n 
2 560  MET n 
2 561  GLY n 
2 562  SER n 
2 563  ASN n 
2 564  MET n 
2 565  GLN n 
2 566  THR n 
2 567  GLN n 
2 568  ALA n 
2 569  VAL n 
2 570  PRO n 
2 571  LEU n 
2 572  ILE n 
2 573  ARG n 
2 574  ALA n 
2 575  GLN n 
2 576  ALA n 
2 577  PRO n 
2 578  VAL n 
2 579  VAL n 
2 580  MET n 
2 581  THR n 
2 582  GLY n 
2 583  LEU n 
2 584  GLU n 
2 585  GLU n 
2 586  ARG n 
2 587  VAL n 
2 588  VAL n 
2 589  ARG n 
2 590  ASP n 
2 591  SER n 
2 592  LEU n 
2 593  ALA n 
2 594  ALA n 
2 595  LEU n 
2 596  TYR n 
2 597  ALA n 
2 598  GLU n 
2 599  GLU n 
2 600  ASP n 
2 601  GLY n 
2 602  GLU n 
2 603  VAL n 
2 604  ALA n 
2 605  LYS n 
2 606  VAL n 
2 607  ASP n 
2 608  GLY n 
2 609  ASN n 
2 610  ARG n 
2 611  ILE n 
2 612  VAL n 
2 613  VAL n 
2 614  ARG n 
2 615  TYR n 
2 616  GLU n 
2 617  ASP n 
2 618  GLY n 
2 619  ARG n 
2 620  LEU n 
2 621  VAL n 
2 622  GLU n 
2 623  TYR n 
2 624  PRO n 
2 625  LEU n 
2 626  ARG n 
2 627  ARG n 
2 628  PHE n 
2 629  TYR n 
2 630  ARG n 
2 631  SER n 
2 632  ASN n 
2 633  GLN n 
2 634  GLY n 
2 635  THR n 
2 636  ALA n 
2 637  LEU n 
2 638  ASP n 
2 639  GLN n 
2 640  ARG n 
2 641  PRO n 
2 642  ARG n 
2 643  VAL n 
2 644  VAL n 
2 645  VAL n 
2 646  GLY n 
2 647  GLN n 
2 648  ARG n 
2 649  VAL n 
2 650  ARG n 
2 651  LYS n 
2 652  GLY n 
2 653  ASP n 
2 654  LEU n 
2 655  LEU n 
2 656  ALA n 
2 657  ASP n 
2 658  GLY n 
2 659  PRO n 
2 660  ALA n 
2 661  SER n 
2 662  GLU n 
2 663  ASN n 
2 664  GLY n 
2 665  PHE n 
2 666  LEU n 
2 667  ALA n 
2 668  LEU n 
2 669  GLY n 
2 670  GLN n 
2 671  ASN n 
2 672  VAL n 
2 673  LEU n 
2 674  VAL n 
2 675  ALA n 
2 676  ILE n 
2 677  MET n 
2 678  PRO n 
2 679  PHE n 
2 680  ASP n 
2 681  GLY n 
2 682  TYR n 
2 683  ASN n 
2 684  PHE n 
2 685  GLU n 
2 686  ASP n 
2 687  ALA n 
2 688  ILE n 
2 689  VAL n 
2 690  ILE n 
2 691  SER n 
2 692  GLU n 
2 693  GLU n 
2 694  LEU n 
2 695  LEU n 
2 696  LYS n 
2 697  ARG n 
2 698  ASP n 
2 699  PHE n 
2 700  TYR n 
2 701  THR n 
2 702  SER n 
2 703  ILE n 
2 704  HIS n 
2 705  ILE n 
2 706  GLU n 
2 707  ARG n 
2 708  TYR n 
2 709  GLU n 
2 710  ILE n 
2 711  GLU n 
2 712  ALA n 
2 713  ARG n 
2 714  ASP n 
2 715  THR n 
2 716  LYS n 
2 717  LEU n 
2 718  GLY n 
2 719  PRO n 
2 720  GLU n 
2 721  ARG n 
2 722  ILE n 
2 723  THR n 
2 724  ARG n 
2 725  ASP n 
2 726  ILE n 
2 727  PRO n 
2 728  HIS n 
2 729  LEU n 
2 730  SER n 
2 731  GLU n 
2 732  ALA n 
2 733  ALA n 
2 734  LEU n 
2 735  ARG n 
2 736  ASP n 
2 737  LEU n 
2 738  ASP n 
2 739  GLU n 
2 740  GLU n 
2 741  GLY n 
2 742  VAL n 
2 743  VAL n 
2 744  ARG n 
2 745  ILE n 
2 746  GLY n 
2 747  ALA n 
2 748  GLU n 
2 749  VAL n 
2 750  LYS n 
2 751  PRO n 
2 752  GLY n 
2 753  ASP n 
2 754  ILE n 
2 755  LEU n 
2 756  VAL n 
2 757  GLY n 
2 758  ARG n 
2 759  THR n 
2 760  SER n 
2 761  PHE n 
2 762  LYS n 
2 763  GLY n 
2 764  GLU n 
2 765  SER n 
2 766  GLU n 
2 767  PRO n 
2 768  THR n 
2 769  PRO n 
2 770  GLU n 
2 771  GLU n 
2 772  ARG n 
2 773  LEU n 
2 774  LEU n 
2 775  ARG n 
2 776  SER n 
2 777  ILE n 
2 778  PHE n 
2 779  GLY n 
2 780  GLU n 
2 781  LYS n 
2 782  ALA n 
2 783  ARG n 
2 784  ASP n 
2 785  VAL n 
2 786  LYS n 
2 787  ASP n 
2 788  THR n 
2 789  SER n 
2 790  LEU n 
2 791  ARG n 
2 792  VAL n 
2 793  PRO n 
2 794  PRO n 
2 795  GLY n 
2 796  GLU n 
2 797  GLY n 
2 798  GLY n 
2 799  ILE n 
2 800  VAL n 
2 801  VAL n 
2 802  ARG n 
2 803  THR n 
2 804  VAL n 
2 805  ARG n 
2 806  LEU n 
2 807  ARG n 
2 808  ARG n 
2 809  GLY n 
2 810  ASP n 
2 811  PRO n 
2 812  GLY n 
2 813  VAL n 
2 814  GLU n 
2 815  LEU n 
2 816  LYS n 
2 817  PRO n 
2 818  GLY n 
2 819  VAL n 
2 820  ARG n 
2 821  GLU n 
2 822  VAL n 
2 823  VAL n 
2 824  ARG n 
2 825  VAL n 
2 826  TYR n 
2 827  VAL n 
2 828  ALA n 
2 829  GLN n 
2 830  LYS n 
2 831  ARG n 
2 832  LYS n 
2 833  LEU n 
2 834  GLN n 
2 835  VAL n 
2 836  GLY n 
2 837  ASP n 
2 838  LYS n 
2 839  LEU n 
2 840  ALA n 
2 841  ASN n 
2 842  ARG n 
2 843  HIS n 
2 844  GLY n 
2 845  ASN n 
2 846  LYS n 
2 847  GLY n 
2 848  VAL n 
2 849  VAL n 
2 850  ALA n 
2 851  LYS n 
2 852  ILE n 
2 853  LEU n 
2 854  PRO n 
2 855  VAL n 
2 856  GLU n 
2 857  ASP n 
2 858  MET n 
2 859  PRO n 
2 860  HIS n 
2 861  LEU n 
2 862  PRO n 
2 863  ASP n 
2 864  GLY n 
2 865  THR n 
2 866  PRO n 
2 867  VAL n 
2 868  ASP n 
2 869  VAL n 
2 870  ILE n 
2 871  LEU n 
2 872  ASN n 
2 873  PRO n 
2 874  LEU n 
2 875  GLY n 
2 876  VAL n 
2 877  PRO n 
2 878  SER n 
2 879  ARG n 
2 880  MET n 
2 881  ASN n 
2 882  LEU n 
2 883  GLY n 
2 884  GLN n 
2 885  ILE n 
2 886  LEU n 
2 887  GLU n 
2 888  THR n 
2 889  HIS n 
2 890  LEU n 
2 891  GLY n 
2 892  LEU n 
2 893  ALA n 
2 894  GLY n 
2 895  TYR n 
2 896  PHE n 
2 897  LEU n 
2 898  GLY n 
2 899  GLN n 
2 900  ARG n 
2 901  TYR n 
2 902  ILE n 
2 903  SER n 
2 904  PRO n 
2 905  ILE n 
2 906  PHE n 
2 907  ASP n 
2 908  GLY n 
2 909  ALA n 
2 910  LYS n 
2 911  GLU n 
2 912  PRO n 
2 913  GLU n 
2 914  ILE n 
2 915  LYS n 
2 916  GLU n 
2 917  LEU n 
2 918  LEU n 
2 919  ALA n 
2 920  GLN n 
2 921  ALA n 
2 922  PHE n 
2 923  GLU n 
2 924  VAL n 
2 925  TYR n 
2 926  PHE n 
2 927  GLY n 
2 928  LYS n 
2 929  ARG n 
2 930  LYS n 
2 931  GLY n 
2 932  GLU n 
2 933  GLY n 
2 934  PHE n 
2 935  GLY n 
2 936  VAL n 
2 937  ASP n 
2 938  LYS n 
2 939  ARG n 
2 940  GLU n 
2 941  VAL n 
2 942  GLU n 
2 943  VAL n 
2 944  LEU n 
2 945  ARG n 
2 946  ARG n 
2 947  ALA n 
2 948  GLU n 
2 949  LYS n 
2 950  LEU n 
2 951  GLY n 
2 952  LEU n 
2 953  VAL n 
2 954  THR n 
2 955  PRO n 
2 956  GLY n 
2 957  LYS n 
2 958  THR n 
2 959  PRO n 
2 960  GLU n 
2 961  GLU n 
2 962  GLN n 
2 963  LEU n 
2 964  LYS n 
2 965  GLU n 
2 966  LEU n 
2 967  PHE n 
2 968  LEU n 
2 969  GLN n 
2 970  GLY n 
2 971  LYS n 
2 972  VAL n 
2 973  VAL n 
2 974  LEU n 
2 975  TYR n 
2 976  ASP n 
2 977  GLY n 
2 978  ARG n 
2 979  THR n 
2 980  GLY n 
2 981  GLU n 
2 982  PRO n 
2 983  ILE n 
2 984  GLU n 
2 985  GLY n 
2 986  PRO n 
2 987  ILE n 
2 988  VAL n 
2 989  VAL n 
2 990  GLY n 
2 991  GLN n 
2 992  MET n 
2 993  PHE n 
2 994  ILE n 
2 995  MET n 
2 996  LYS n 
2 997  LEU n 
2 998  TYR n 
2 999  HIS n 
2 1000 MET n 
2 1001 VAL n 
2 1002 GLU n 
2 1003 ASP n 
2 1004 LYS n 
2 1005 MET n 
2 1006 HIS n 
2 1007 ALA n 
2 1008 ARG n 
2 1009 SER n 
2 1010 THR n 
2 1011 GLY n 
2 1012 PRO n 
2 1013 TYR n 
2 1014 SER n 
2 1015 LEU n 
2 1016 ILE n 
2 1017 THR n 
2 1018 GLN n 
2 1019 GLN n 
2 1020 PRO n 
2 1021 LEU n 
2 1022 GLY n 
2 1023 GLY n 
2 1024 LYS n 
2 1025 ALA n 
2 1026 GLN n 
2 1027 PHE n 
2 1028 GLY n 
2 1029 GLY n 
2 1030 GLN n 
2 1031 ARG n 
2 1032 PHE n 
2 1033 GLY n 
2 1034 GLU n 
2 1035 MET n 
2 1036 GLU n 
2 1037 VAL n 
2 1038 TRP n 
2 1039 ALA n 
2 1040 LEU n 
2 1041 GLU n 
2 1042 ALA n 
2 1043 TYR n 
2 1044 GLY n 
2 1045 ALA n 
2 1046 ALA n 
2 1047 HIS n 
2 1048 THR n 
2 1049 LEU n 
2 1050 GLN n 
2 1051 GLU n 
2 1052 MET n 
2 1053 LEU n 
2 1054 THR n 
2 1055 LEU n 
2 1056 LYS n 
2 1057 SER n 
2 1058 ASP n 
2 1059 ASP n 
2 1060 ILE n 
2 1061 GLU n 
2 1062 GLY n 
2 1063 ARG n 
2 1064 ASN n 
2 1065 ALA n 
2 1066 ALA n 
2 1067 TYR n 
2 1068 GLU n 
2 1069 ALA n 
2 1070 ILE n 
2 1071 ILE n 
2 1072 LYS n 
2 1073 GLY n 
2 1074 GLU n 
2 1075 ASP n 
2 1076 VAL n 
2 1077 PRO n 
2 1078 GLU n 
2 1079 PRO n 
2 1080 SER n 
2 1081 VAL n 
2 1082 PRO n 
2 1083 GLU n 
2 1084 SER n 
2 1085 PHE n 
2 1086 ARG n 
2 1087 VAL n 
2 1088 LEU n 
2 1089 VAL n 
2 1090 LYS n 
2 1091 GLU n 
2 1092 LEU n 
2 1093 GLN n 
2 1094 ALA n 
2 1095 LEU n 
2 1096 ALA n 
2 1097 LEU n 
2 1098 ASP n 
2 1099 VAL n 
2 1100 GLN n 
2 1101 THR n 
2 1102 LEU n 
2 1103 ASP n 
2 1104 GLU n 
2 1105 LYS n 
2 1106 ASP n 
2 1107 ASN n 
2 1108 PRO n 
2 1109 VAL n 
2 1110 ASP n 
2 1111 ILE n 
2 1112 PHE n 
2 1113 GLU n 
2 1114 GLY n 
2 1115 LEU n 
2 1116 ALA n 
2 1117 SER n 
2 1118 LYS n 
2 1119 ARG n 
3 1    MET n 
3 2    LYS n 
3 3    LYS n 
3 4    GLU n 
3 5    VAL n 
3 6    ARG n 
3 7    LYS n 
3 8    VAL n 
3 9    ARG n 
3 10   ILE n 
3 11   ALA n 
3 12   LEU n 
3 13   ALA n 
3 14   SER n 
3 15   PRO n 
3 16   GLU n 
3 17   LYS n 
3 18   ILE n 
3 19   ARG n 
3 20   SER n 
3 21   TRP n 
3 22   SER n 
3 23   TYR n 
3 24   GLY n 
3 25   GLU n 
3 26   VAL n 
3 27   GLU n 
3 28   LYS n 
3 29   PRO n 
3 30   GLU n 
3 31   THR n 
3 32   ILE n 
3 33   ASN n 
3 34   TYR n 
3 35   ARG n 
3 36   THR n 
3 37   LEU n 
3 38   LYS n 
3 39   PRO n 
3 40   GLU n 
3 41   ARG n 
3 42   ASP n 
3 43   GLY n 
3 44   LEU n 
3 45   PHE n 
3 46   ASP n 
3 47   GLU n 
3 48   ARG n 
3 49   ILE n 
3 50   PHE n 
3 51   GLY n 
3 52   PRO n 
3 53   ILE n 
3 54   LYS n 
3 55   ASP n 
3 56   TYR n 
3 57   GLU n 
3 58   CYS n 
3 59   ALA n 
3 60   CYS n 
3 61   GLY n 
3 62   LYS n 
3 63   TYR n 
3 64   LYS n 
3 65   ARG n 
3 66   GLN n 
3 67   ARG n 
3 68   PHE n 
3 69   GLU n 
3 70   GLY n 
3 71   LYS n 
3 72   VAL n 
3 73   CYS n 
3 74   GLU n 
3 75   ARG n 
3 76   CYS n 
3 77   GLY n 
3 78   VAL n 
3 79   GLU n 
3 80   VAL n 
3 81   THR n 
3 82   LYS n 
3 83   SER n 
3 84   ILE n 
3 85   VAL n 
3 86   ARG n 
3 87   ARG n 
3 88   TYR n 
3 89   ARG n 
3 90   MET n 
3 91   GLY n 
3 92   HIS n 
3 93   ILE n 
3 94   GLU n 
3 95   LEU n 
3 96   ALA n 
3 97   THR n 
3 98   PRO n 
3 99   ALA n 
3 100  ALA n 
3 101  HIS n 
3 102  ILE n 
3 103  TRP n 
3 104  PHE n 
3 105  VAL n 
3 106  LYS n 
3 107  ASP n 
3 108  VAL n 
3 109  PRO n 
3 110  SER n 
3 111  LYS n 
3 112  ILE n 
3 113  GLY n 
3 114  THR n 
3 115  LEU n 
3 116  LEU n 
3 117  ASP n 
3 118  LEU n 
3 119  SER n 
3 120  ALA n 
3 121  THR n 
3 122  GLU n 
3 123  LEU n 
3 124  GLU n 
3 125  GLN n 
3 126  VAL n 
3 127  LEU n 
3 128  TYR n 
3 129  PHE n 
3 130  SER n 
3 131  LYS n 
3 132  TYR n 
3 133  ILE n 
3 134  VAL n 
3 135  LEU n 
3 136  ASP n 
3 137  PRO n 
3 138  LYS n 
3 139  GLY n 
3 140  ALA n 
3 141  ILE n 
3 142  LEU n 
3 143  ASN n 
3 144  GLY n 
3 145  VAL n 
3 146  PRO n 
3 147  VAL n 
3 148  GLU n 
3 149  LYS n 
3 150  ARG n 
3 151  GLN n 
3 152  LEU n 
3 153  LEU n 
3 154  THR n 
3 155  ASP n 
3 156  GLU n 
3 157  GLU n 
3 158  TYR n 
3 159  ARG n 
3 160  GLU n 
3 161  LEU n 
3 162  ARG n 
3 163  TYR n 
3 164  GLY n 
3 165  LYS n 
3 166  GLN n 
3 167  GLU n 
3 168  THR n 
3 169  TYR n 
3 170  PRO n 
3 171  LEU n 
3 172  PRO n 
3 173  PRO n 
3 174  GLY n 
3 175  VAL n 
3 176  ASP n 
3 177  ALA n 
3 178  LEU n 
3 179  VAL n 
3 180  LYS n 
3 181  ASP n 
3 182  GLY n 
3 183  GLU n 
3 184  GLU n 
3 185  VAL n 
3 186  VAL n 
3 187  LYS n 
3 188  GLY n 
3 189  GLN n 
3 190  GLU n 
3 191  LEU n 
3 192  ALA n 
3 193  PRO n 
3 194  GLY n 
3 195  VAL n 
3 196  VAL n 
3 197  SER n 
3 198  ARG n 
3 199  LEU n 
3 200  ASP n 
3 201  GLY n 
3 202  VAL n 
3 203  ALA n 
3 204  LEU n 
3 205  TYR n 
3 206  ARG n 
3 207  PHE n 
3 208  PRO n 
3 209  ARG n 
3 210  ARG n 
3 211  VAL n 
3 212  ARG n 
3 213  VAL n 
3 214  GLU n 
3 215  TYR n 
3 216  VAL n 
3 217  LYS n 
3 218  LYS n 
3 219  GLU n 
3 220  ARG n 
3 221  ALA n 
3 222  GLY n 
3 223  LEU n 
3 224  ARG n 
3 225  LEU n 
3 226  PRO n 
3 227  LEU n 
3 228  ALA n 
3 229  ALA n 
3 230  TRP n 
3 231  VAL n 
3 232  GLU n 
3 233  LYS n 
3 234  GLU n 
3 235  ALA n 
3 236  TYR n 
3 237  LYS n 
3 238  PRO n 
3 239  GLY n 
3 240  GLU n 
3 241  ILE n 
3 242  LEU n 
3 243  ALA n 
3 244  GLU n 
3 245  LEU n 
3 246  PRO n 
3 247  GLU n 
3 248  PRO n 
3 249  TYR n 
3 250  LEU n 
3 251  PHE n 
3 252  ARG n 
3 253  ALA n 
3 254  GLU n 
3 255  GLU n 
3 256  GLU n 
3 257  GLY n 
3 258  VAL n 
3 259  VAL n 
3 260  GLU n 
3 261  LEU n 
3 262  LYS n 
3 263  GLU n 
3 264  LEU n 
3 265  GLU n 
3 266  GLU n 
3 267  GLY n 
3 268  ALA n 
3 269  PHE n 
3 270  LEU n 
3 271  VAL n 
3 272  LEU n 
3 273  ARG n 
3 274  ARG n 
3 275  GLU n 
3 276  ASP n 
3 277  GLU n 
3 278  PRO n 
3 279  VAL n 
3 280  ALA n 
3 281  THR n 
3 282  TYR n 
3 283  PHE n 
3 284  LEU n 
3 285  PRO n 
3 286  VAL n 
3 287  GLY n 
3 288  MET n 
3 289  THR n 
3 290  PRO n 
3 291  LEU n 
3 292  VAL n 
3 293  VAL n 
3 294  HIS n 
3 295  GLY n 
3 296  GLU n 
3 297  ILE n 
3 298  VAL n 
3 299  GLU n 
3 300  LYS n 
3 301  GLY n 
3 302  GLN n 
3 303  PRO n 
3 304  LEU n 
3 305  ALA n 
3 306  GLU n 
3 307  ALA n 
3 308  LYS n 
3 309  GLY n 
3 310  LEU n 
3 311  LEU n 
3 312  ARG n 
3 313  MET n 
3 314  PRO n 
3 315  ARG n 
3 316  GLN n 
3 317  VAL n 
3 318  ARG n 
3 319  ALA n 
3 320  ALA n 
3 321  GLN n 
3 322  VAL n 
3 323  GLU n 
3 324  ALA n 
3 325  GLU n 
3 326  GLU n 
3 327  GLU n 
3 328  GLY n 
3 329  GLU n 
3 330  THR n 
3 331  VAL n 
3 332  TYR n 
3 333  LEU n 
3 334  THR n 
3 335  LEU n 
3 336  PHE n 
3 337  LEU n 
3 338  GLU n 
3 339  TRP n 
3 340  THR n 
3 341  GLU n 
3 342  PRO n 
3 343  LYS n 
3 344  ASP n 
3 345  TYR n 
3 346  ARG n 
3 347  VAL n 
3 348  GLN n 
3 349  PRO n 
3 350  HIS n 
3 351  MET n 
3 352  ASN n 
3 353  VAL n 
3 354  VAL n 
3 355  VAL n 
3 356  PRO n 
3 357  GLU n 
3 358  GLY n 
3 359  ALA n 
3 360  ARG n 
3 361  VAL n 
3 362  GLU n 
3 363  ALA n 
3 364  GLY n 
3 365  ASP n 
3 366  LYS n 
3 367  ILE n 
3 368  VAL n 
3 369  ALA n 
3 370  ALA n 
3 371  ILE n 
3 372  ASP n 
3 373  PRO n 
3 374  GLU n 
3 375  GLU n 
3 376  GLU n 
3 377  VAL n 
3 378  ILE n 
3 379  ALA n 
3 380  GLU n 
3 381  ALA n 
3 382  GLU n 
3 383  GLY n 
3 384  VAL n 
3 385  VAL n 
3 386  HIS n 
3 387  LEU n 
3 388  HIS n 
3 389  GLU n 
3 390  PRO n 
3 391  ALA n 
3 392  SER n 
3 393  ILE n 
3 394  LEU n 
3 395  VAL n 
3 396  VAL n 
3 397  LYS n 
3 398  ALA n 
3 399  ARG n 
3 400  VAL n 
3 401  TYR n 
3 402  PRO n 
3 403  PHE n 
3 404  GLU n 
3 405  ASP n 
3 406  ASP n 
3 407  VAL n 
3 408  GLU n 
3 409  VAL n 
3 410  SER n 
3 411  THR n 
3 412  GLY n 
3 413  ASP n 
3 414  ARG n 
3 415  VAL n 
3 416  ALA n 
3 417  PRO n 
3 418  GLY n 
3 419  ASP n 
3 420  VAL n 
3 421  LEU n 
3 422  ALA n 
3 423  ASP n 
3 424  GLY n 
3 425  GLY n 
3 426  LYS n 
3 427  VAL n 
3 428  LYS n 
3 429  SER n 
3 430  ASP n 
3 431  VAL n 
3 432  TYR n 
3 433  GLY n 
3 434  ARG n 
3 435  VAL n 
3 436  GLU n 
3 437  VAL n 
3 438  ASP n 
3 439  LEU n 
3 440  VAL n 
3 441  ARG n 
3 442  ASN n 
3 443  VAL n 
3 444  VAL n 
3 445  ARG n 
3 446  VAL n 
3 447  VAL n 
3 448  GLU n 
3 449  SER n 
3 450  TYR n 
3 451  ASP n 
3 452  ILE n 
3 453  ASP n 
3 454  ALA n 
3 455  ARG n 
3 456  MET n 
3 457  GLY n 
3 458  ALA n 
3 459  GLU n 
3 460  ALA n 
3 461  ILE n 
3 462  GLN n 
3 463  GLN n 
3 464  LEU n 
3 465  LEU n 
3 466  LYS n 
3 467  GLU n 
3 468  LEU n 
3 469  ASP n 
3 470  LEU n 
3 471  GLU n 
3 472  ALA n 
3 473  LEU n 
3 474  GLU n 
3 475  LYS n 
3 476  GLU n 
3 477  LEU n 
3 478  LEU n 
3 479  GLU n 
3 480  GLU n 
3 481  MET n 
3 482  LYS n 
3 483  HIS n 
3 484  PRO n 
3 485  SER n 
3 486  ARG n 
3 487  ALA n 
3 488  ARG n 
3 489  ARG n 
3 490  ALA n 
3 491  LYS n 
3 492  ALA n 
3 493  ARG n 
3 494  LYS n 
3 495  ARG n 
3 496  LEU n 
3 497  GLU n 
3 498  VAL n 
3 499  VAL n 
3 500  ARG n 
3 501  ALA n 
3 502  PHE n 
3 503  LEU n 
3 504  ASP n 
3 505  SER n 
3 506  GLY n 
3 507  ASN n 
3 508  ARG n 
3 509  PRO n 
3 510  GLU n 
3 511  TRP n 
3 512  MET n 
3 513  ILE n 
3 514  LEU n 
3 515  GLU n 
3 516  ALA n 
3 517  VAL n 
3 518  PRO n 
3 519  VAL n 
3 520  LEU n 
3 521  PRO n 
3 522  PRO n 
3 523  ASP n 
3 524  LEU n 
3 525  ARG n 
3 526  PRO n 
3 527  MET n 
3 528  VAL n 
3 529  GLN n 
3 530  VAL n 
3 531  ASP n 
3 532  GLY n 
3 533  GLY n 
3 534  ARG n 
3 535  PHE n 
3 536  ALA n 
3 537  THR n 
3 538  SER n 
3 539  ASP n 
3 540  LEU n 
3 541  ASN n 
3 542  ASP n 
3 543  LEU n 
3 544  TYR n 
3 545  ARG n 
3 546  ARG n 
3 547  LEU n 
3 548  ILE n 
3 549  ASN n 
3 550  ARG n 
3 551  ASN n 
3 552  ASN n 
3 553  ARG n 
3 554  LEU n 
3 555  LYS n 
3 556  LYS n 
3 557  LEU n 
3 558  LEU n 
3 559  ALA n 
3 560  GLN n 
3 561  GLY n 
3 562  ALA n 
3 563  PRO n 
3 564  GLU n 
3 565  ILE n 
3 566  ILE n 
3 567  ILE n 
3 568  ARG n 
3 569  ASN n 
3 570  GLU n 
3 571  LYS n 
3 572  ARG n 
3 573  MET n 
3 574  LEU n 
3 575  GLN n 
3 576  GLU n 
3 577  ALA n 
3 578  VAL n 
3 579  ASP n 
3 580  ALA n 
3 581  LEU n 
3 582  LEU n 
3 583  ASP n 
3 584  ASN n 
3 585  GLY n 
3 586  ARG n 
3 587  ARG n 
3 588  GLY n 
3 589  ALA n 
3 590  PRO n 
3 591  VAL n 
3 592  THR n 
3 593  ASN n 
3 594  PRO n 
3 595  GLY n 
3 596  SER n 
3 597  ASP n 
3 598  ARG n 
3 599  PRO n 
3 600  LEU n 
3 601  ARG n 
3 602  SER n 
3 603  LEU n 
3 604  THR n 
3 605  ASP n 
3 606  ILE n 
3 607  LEU n 
3 608  SER n 
3 609  GLY n 
3 610  LYS n 
3 611  GLN n 
3 612  GLY n 
3 613  ARG n 
3 614  PHE n 
3 615  ARG n 
3 616  GLN n 
3 617  ASN n 
3 618  LEU n 
3 619  LEU n 
3 620  GLY n 
3 621  LYS n 
3 622  ARG n 
3 623  VAL n 
3 624  ASP n 
3 625  TYR n 
3 626  SER n 
3 627  GLY n 
3 628  ARG n 
3 629  SER n 
3 630  VAL n 
3 631  ILE n 
3 632  VAL n 
3 633  VAL n 
3 634  GLY n 
3 635  PRO n 
3 636  GLN n 
3 637  LEU n 
3 638  LYS n 
3 639  LEU n 
3 640  HIS n 
3 641  GLN n 
3 642  CYS n 
3 643  GLY n 
3 644  LEU n 
3 645  PRO n 
3 646  LYS n 
3 647  ARG n 
3 648  MET n 
3 649  ALA n 
3 650  LEU n 
3 651  GLU n 
3 652  LEU n 
3 653  PHE n 
3 654  LYS n 
3 655  PRO n 
3 656  PHE n 
3 657  LEU n 
3 658  LEU n 
3 659  LYS n 
3 660  LYS n 
3 661  MET n 
3 662  GLU n 
3 663  GLU n 
3 664  LYS n 
3 665  GLY n 
3 666  ILE n 
3 667  ALA n 
3 668  PRO n 
3 669  ASN n 
3 670  VAL n 
3 671  LYS n 
3 672  ALA n 
3 673  ALA n 
3 674  ARG n 
3 675  ARG n 
3 676  MET n 
3 677  LEU n 
3 678  GLU n 
3 679  ARG n 
3 680  GLN n 
3 681  ARG n 
3 682  ASP n 
3 683  ILE n 
3 684  LYS n 
3 685  ASP n 
3 686  GLU n 
3 687  VAL n 
3 688  TRP n 
3 689  ASP n 
3 690  ALA n 
3 691  LEU n 
3 692  GLU n 
3 693  GLU n 
3 694  VAL n 
3 695  ILE n 
3 696  HIS n 
3 697  GLY n 
3 698  LYS n 
3 699  VAL n 
3 700  VAL n 
3 701  LEU n 
3 702  LEU n 
3 703  ASN n 
3 704  ARG n 
3 705  ALA n 
3 706  PRO n 
3 707  THR n 
3 708  LEU n 
3 709  HIS n 
3 710  ARG n 
3 711  LEU n 
3 712  GLY n 
3 713  ILE n 
3 714  GLN n 
3 715  ALA n 
3 716  PHE n 
3 717  GLN n 
3 718  PRO n 
3 719  VAL n 
3 720  LEU n 
3 721  VAL n 
3 722  GLU n 
3 723  GLY n 
3 724  GLN n 
3 725  SER n 
3 726  ILE n 
3 727  GLN n 
3 728  LEU n 
3 729  HIS n 
3 730  PRO n 
3 731  LEU n 
3 732  VAL n 
3 733  CYS n 
3 734  GLU n 
3 735  ALA n 
3 736  PHE n 
3 737  ASN n 
3 738  ALA n 
3 739  ASP n 
3 740  PHE n 
3 741  ASP n 
3 742  GLY n 
3 743  ASP n 
3 744  GLN n 
3 745  MET n 
3 746  ALA n 
3 747  VAL n 
3 748  HIS n 
3 749  VAL n 
3 750  PRO n 
3 751  LEU n 
3 752  SER n 
3 753  SER n 
3 754  PHE n 
3 755  ALA n 
3 756  GLN n 
3 757  ALA n 
3 758  GLU n 
3 759  ALA n 
3 760  ARG n 
3 761  ILE n 
3 762  GLN n 
3 763  MET n 
3 764  LEU n 
3 765  SER n 
3 766  ALA n 
3 767  HIS n 
3 768  ASN n 
3 769  LEU n 
3 770  LEU n 
3 771  SER n 
3 772  PRO n 
3 773  ALA n 
3 774  SER n 
3 775  GLY n 
3 776  GLU n 
3 777  PRO n 
3 778  LEU n 
3 779  ALA n 
3 780  LYS n 
3 781  PRO n 
3 782  SER n 
3 783  ARG n 
3 784  ASP n 
3 785  ILE n 
3 786  ILE n 
3 787  LEU n 
3 788  GLY n 
3 789  LEU n 
3 790  TYR n 
3 791  TYR n 
3 792  ILE n 
3 793  THR n 
3 794  GLN n 
3 795  VAL n 
3 796  ARG n 
3 797  LYS n 
3 798  GLU n 
3 799  LYS n 
3 800  LYS n 
3 801  GLY n 
3 802  ALA n 
3 803  GLY n 
3 804  LEU n 
3 805  GLU n 
3 806  PHE n 
3 807  ALA n 
3 808  THR n 
3 809  PRO n 
3 810  GLU n 
3 811  GLU n 
3 812  ALA n 
3 813  LEU n 
3 814  ALA n 
3 815  ALA n 
3 816  HIS n 
3 817  GLU n 
3 818  ARG n 
3 819  GLY n 
3 820  GLU n 
3 821  VAL n 
3 822  ALA n 
3 823  LEU n 
3 824  ASN n 
3 825  ALA n 
3 826  PRO n 
3 827  ILE n 
3 828  LYS n 
3 829  VAL n 
3 830  ALA n 
3 831  GLY n 
3 832  ARG n 
3 833  GLU n 
3 834  THR n 
3 835  SER n 
3 836  VAL n 
3 837  GLY n 
3 838  ARG n 
3 839  LEU n 
3 840  LYS n 
3 841  TYR n 
3 842  VAL n 
3 843  PHE n 
3 844  ALA n 
3 845  ASN n 
3 846  PRO n 
3 847  ASP n 
3 848  GLU n 
3 849  ALA n 
3 850  LEU n 
3 851  LEU n 
3 852  ALA n 
3 853  VAL n 
3 854  ALA n 
3 855  HIS n 
3 856  GLY n 
3 857  ILE n 
3 858  VAL n 
3 859  ASP n 
3 860  LEU n 
3 861  GLN n 
3 862  ASP n 
3 863  VAL n 
3 864  VAL n 
3 865  THR n 
3 866  VAL n 
3 867  ARG n 
3 868  TYR n 
3 869  MET n 
3 870  GLY n 
3 871  LYS n 
3 872  ARG n 
3 873  LEU n 
3 874  GLU n 
3 875  THR n 
3 876  SER n 
3 877  PRO n 
3 878  GLY n 
3 879  ARG n 
3 880  ILE n 
3 881  LEU n 
3 882  PHE n 
3 883  ALA n 
3 884  ARG n 
3 885  ILE n 
3 886  VAL n 
3 887  ALA n 
3 888  GLU n 
3 889  ALA n 
3 890  VAL n 
3 891  GLU n 
3 892  ASP n 
3 893  GLU n 
3 894  LYS n 
3 895  VAL n 
3 896  ALA n 
3 897  TRP n 
3 898  GLU n 
3 899  LEU n 
3 900  ILE n 
3 901  GLN n 
3 902  LEU n 
3 903  ASP n 
3 904  VAL n 
3 905  PRO n 
3 906  GLN n 
3 907  GLU n 
3 908  LYS n 
3 909  ASN n 
3 910  SER n 
3 911  LEU n 
3 912  LYS n 
3 913  ASP n 
3 914  LEU n 
3 915  VAL n 
3 916  TYR n 
3 917  GLN n 
3 918  ALA n 
3 919  PHE n 
3 920  LEU n 
3 921  ARG n 
3 922  LEU n 
3 923  GLY n 
3 924  MET n 
3 925  GLU n 
3 926  LYS n 
3 927  THR n 
3 928  ALA n 
3 929  ARG n 
3 930  LEU n 
3 931  LEU n 
3 932  ASP n 
3 933  ALA n 
3 934  LEU n 
3 935  LYS n 
3 936  TYR n 
3 937  TYR n 
3 938  GLY n 
3 939  PHE n 
3 940  THR n 
3 941  PHE n 
3 942  SER n 
3 943  THR n 
3 944  THR n 
3 945  SER n 
3 946  GLY n 
3 947  ILE n 
3 948  THR n 
3 949  ILE n 
3 950  GLY n 
3 951  ILE n 
3 952  ASP n 
3 953  ASP n 
3 954  ALA n 
3 955  VAL n 
3 956  ILE n 
3 957  PRO n 
3 958  GLU n 
3 959  GLU n 
3 960  LYS n 
3 961  LYS n 
3 962  GLN n 
3 963  TYR n 
3 964  LEU n 
3 965  GLU n 
3 966  GLU n 
3 967  ALA n 
3 968  ASP n 
3 969  ARG n 
3 970  LYS n 
3 971  LEU n 
3 972  LEU n 
3 973  GLN n 
3 974  ILE n 
3 975  GLU n 
3 976  GLN n 
3 977  ALA n 
3 978  TYR n 
3 979  GLU n 
3 980  MET n 
3 981  GLY n 
3 982  PHE n 
3 983  LEU n 
3 984  THR n 
3 985  ASP n 
3 986  ARG n 
3 987  GLU n 
3 988  ARG n 
3 989  TYR n 
3 990  ASP n 
3 991  GLN n 
3 992  ILE n 
3 993  LEU n 
3 994  GLN n 
3 995  LEU n 
3 996  TRP n 
3 997  THR n 
3 998  GLU n 
3 999  THR n 
3 1000 THR n 
3 1001 GLU n 
3 1002 LYS n 
3 1003 VAL n 
3 1004 THR n 
3 1005 GLN n 
3 1006 ALA n 
3 1007 VAL n 
3 1008 PHE n 
3 1009 LYS n 
3 1010 ASN n 
3 1011 PHE n 
3 1012 GLU n 
3 1013 GLU n 
3 1014 ASN n 
3 1015 TYR n 
3 1016 PRO n 
3 1017 PHE n 
3 1018 ASN n 
3 1019 PRO n 
3 1020 LEU n 
3 1021 TYR n 
3 1022 VAL n 
3 1023 MET n 
3 1024 ALA n 
3 1025 GLN n 
3 1026 SER n 
3 1027 GLY n 
3 1028 ALA n 
3 1029 ARG n 
3 1030 GLY n 
3 1031 ASN n 
3 1032 PRO n 
3 1033 GLN n 
3 1034 GLN n 
3 1035 ILE n 
3 1036 ARG n 
3 1037 GLN n 
3 1038 LEU n 
3 1039 CYS n 
3 1040 GLY n 
3 1041 LEU n 
3 1042 ARG n 
3 1043 GLY n 
3 1044 LEU n 
3 1045 MET n 
3 1046 GLN n 
3 1047 LYS n 
3 1048 PRO n 
3 1049 SER n 
3 1050 GLY n 
3 1051 GLU n 
3 1052 THR n 
3 1053 PHE n 
3 1054 GLU n 
3 1055 VAL n 
3 1056 PRO n 
3 1057 VAL n 
3 1058 ARG n 
3 1059 SER n 
3 1060 SER n 
3 1061 PHE n 
3 1062 ARG n 
3 1063 GLU n 
3 1064 GLY n 
3 1065 LEU n 
3 1066 THR n 
3 1067 VAL n 
3 1068 LEU n 
3 1069 GLU n 
3 1070 TYR n 
3 1071 PHE n 
3 1072 ILE n 
3 1073 SER n 
3 1074 SER n 
3 1075 HIS n 
3 1076 GLY n 
3 1077 ALA n 
3 1078 ARG n 
3 1079 LYS n 
3 1080 GLY n 
3 1081 GLY n 
3 1082 ALA n 
3 1083 ASP n 
3 1084 THR n 
3 1085 ALA n 
3 1086 LEU n 
3 1087 ARG n 
3 1088 THR n 
3 1089 ALA n 
3 1090 ASP n 
3 1091 SER n 
3 1092 GLY n 
3 1093 TYR n 
3 1094 LEU n 
3 1095 THR n 
3 1096 ARG n 
3 1097 LYS n 
3 1098 LEU n 
3 1099 VAL n 
3 1100 ASP n 
3 1101 VAL n 
3 1102 THR n 
3 1103 HIS n 
3 1104 GLU n 
3 1105 ILE n 
3 1106 VAL n 
3 1107 VAL n 
3 1108 ARG n 
3 1109 GLU n 
3 1110 ALA n 
3 1111 ASP n 
3 1112 CYS n 
3 1113 GLY n 
3 1114 THR n 
3 1115 THR n 
3 1116 ASN n 
3 1117 TYR n 
3 1118 ILE n 
3 1119 SER n 
3 1120 VAL n 
3 1121 PRO n 
3 1122 LEU n 
3 1123 PHE n 
3 1124 GLN n 
3 1125 PRO n 
3 1126 ASP n 
3 1127 GLU n 
3 1128 VAL n 
3 1129 THR n 
3 1130 ARG n 
3 1131 SER n 
3 1132 LEU n 
3 1133 ARG n 
3 1134 LEU n 
3 1135 ARG n 
3 1136 LYS n 
3 1137 ARG n 
3 1138 ALA n 
3 1139 ASP n 
3 1140 ILE n 
3 1141 GLU n 
3 1142 ALA n 
3 1143 GLY n 
3 1144 LEU n 
3 1145 TYR n 
3 1146 GLY n 
3 1147 ARG n 
3 1148 VAL n 
3 1149 LEU n 
3 1150 ALA n 
3 1151 ARG n 
3 1152 GLU n 
3 1153 VAL n 
3 1154 GLU n 
3 1155 VAL n 
3 1156 LEU n 
3 1157 GLY n 
3 1158 VAL n 
3 1159 ARG n 
3 1160 LEU n 
3 1161 GLU n 
3 1162 GLU n 
3 1163 GLY n 
3 1164 ARG n 
3 1165 TYR n 
3 1166 LEU n 
3 1167 SER n 
3 1168 MET n 
3 1169 ASP n 
3 1170 ASP n 
3 1171 VAL n 
3 1172 HIS n 
3 1173 LEU n 
3 1174 LEU n 
3 1175 ILE n 
3 1176 LYS n 
3 1177 ALA n 
3 1178 ALA n 
3 1179 GLU n 
3 1180 ALA n 
3 1181 GLY n 
3 1182 GLU n 
3 1183 ILE n 
3 1184 GLN n 
3 1185 GLU n 
3 1186 VAL n 
3 1187 PRO n 
3 1188 VAL n 
3 1189 ARG n 
3 1190 SER n 
3 1191 PRO n 
3 1192 LEU n 
3 1193 THR n 
3 1194 CYS n 
3 1195 GLN n 
3 1196 THR n 
3 1197 ARG n 
3 1198 TYR n 
3 1199 GLY n 
3 1200 VAL n 
3 1201 CYS n 
3 1202 GLN n 
3 1203 LYS n 
3 1204 CYS n 
3 1205 TYR n 
3 1206 GLY n 
3 1207 TYR n 
3 1208 ASP n 
3 1209 LEU n 
3 1210 SER n 
3 1211 MET n 
3 1212 ALA n 
3 1213 ARG n 
3 1214 PRO n 
3 1215 VAL n 
3 1216 SER n 
3 1217 ILE n 
3 1218 GLY n 
3 1219 GLU n 
3 1220 ALA n 
3 1221 VAL n 
3 1222 GLY n 
3 1223 ILE n 
3 1224 VAL n 
3 1225 ALA n 
3 1226 ALA n 
3 1227 GLN n 
3 1228 SER n 
3 1229 ILE n 
3 1230 GLY n 
3 1231 GLU n 
3 1232 PRO n 
3 1233 GLY n 
3 1234 THR n 
3 1235 GLN n 
3 1236 LEU n 
3 1237 THR n 
3 1238 MET n 
3 1239 ARG n 
3 1240 THR n 
3 1241 PHE n 
3 1242 HIS n 
3 1243 THR n 
3 1244 GLY n 
3 1245 GLY n 
3 1246 VAL n 
3 1247 ALA n 
3 1248 GLY n 
3 1249 ALA n 
3 1250 ALA n 
3 1251 ASP n 
3 1252 ILE n 
3 1253 THR n 
3 1254 GLN n 
3 1255 GLY n 
3 1256 LEU n 
3 1257 PRO n 
3 1258 ARG n 
3 1259 VAL n 
3 1260 ILE n 
3 1261 GLU n 
3 1262 LEU n 
3 1263 PHE n 
3 1264 GLU n 
3 1265 ALA n 
3 1266 ARG n 
3 1267 ARG n 
3 1268 PRO n 
3 1269 LYS n 
3 1270 ALA n 
3 1271 LYS n 
3 1272 ALA n 
3 1273 VAL n 
3 1274 ILE n 
3 1275 SER n 
3 1276 GLU n 
3 1277 ILE n 
3 1278 ASP n 
3 1279 GLY n 
3 1280 VAL n 
3 1281 VAL n 
3 1282 ARG n 
3 1283 ILE n 
3 1284 GLU n 
3 1285 GLU n 
3 1286 THR n 
3 1287 GLU n 
3 1288 GLU n 
3 1289 LYS n 
3 1290 LEU n 
3 1291 SER n 
3 1292 VAL n 
3 1293 PHE n 
3 1294 VAL n 
3 1295 GLU n 
3 1296 SER n 
3 1297 GLU n 
3 1298 GLY n 
3 1299 PHE n 
3 1300 SER n 
3 1301 LYS n 
3 1302 GLU n 
3 1303 TYR n 
3 1304 LYS n 
3 1305 LEU n 
3 1306 PRO n 
3 1307 LYS n 
3 1308 GLU n 
3 1309 ALA n 
3 1310 ARG n 
3 1311 LEU n 
3 1312 LEU n 
3 1313 VAL n 
3 1314 LYS n 
3 1315 ASP n 
3 1316 GLY n 
3 1317 ASP n 
3 1318 TYR n 
3 1319 VAL n 
3 1320 GLU n 
3 1321 ALA n 
3 1322 GLY n 
3 1323 GLN n 
3 1324 PRO n 
3 1325 LEU n 
3 1326 THR n 
3 1327 ARG n 
3 1328 GLY n 
3 1329 ALA n 
3 1330 ILE n 
3 1331 ASP n 
3 1332 PRO n 
3 1333 HIS n 
3 1334 GLN n 
3 1335 LEU n 
3 1336 LEU n 
3 1337 GLU n 
3 1338 ALA n 
3 1339 LYS n 
3 1340 GLY n 
3 1341 PRO n 
3 1342 GLU n 
3 1343 ALA n 
3 1344 VAL n 
3 1345 GLU n 
3 1346 ARG n 
3 1347 TYR n 
3 1348 LEU n 
3 1349 VAL n 
3 1350 GLU n 
3 1351 GLU n 
3 1352 ILE n 
3 1353 GLN n 
3 1354 LYS n 
3 1355 VAL n 
3 1356 TYR n 
3 1357 ARG n 
3 1358 ALA n 
3 1359 GLN n 
3 1360 GLY n 
3 1361 VAL n 
3 1362 LYS n 
3 1363 LEU n 
3 1364 HIS n 
3 1365 ASP n 
3 1366 LYS n 
3 1367 HIS n 
3 1368 ILE n 
3 1369 GLU n 
3 1370 ILE n 
3 1371 VAL n 
3 1372 VAL n 
3 1373 ARG n 
3 1374 GLN n 
3 1375 MET n 
3 1376 MET n 
3 1377 LYS n 
3 1378 TYR n 
3 1379 VAL n 
3 1380 GLU n 
3 1381 VAL n 
3 1382 THR n 
3 1383 ASP n 
3 1384 PRO n 
3 1385 GLY n 
3 1386 ASP n 
3 1387 SER n 
3 1388 ARG n 
3 1389 LEU n 
3 1390 LEU n 
3 1391 GLU n 
3 1392 GLY n 
3 1393 GLN n 
3 1394 VAL n 
3 1395 LEU n 
3 1396 GLU n 
3 1397 LYS n 
3 1398 TRP n 
3 1399 ASP n 
3 1400 VAL n 
3 1401 GLU n 
3 1402 ALA n 
3 1403 LEU n 
3 1404 ASN n 
3 1405 GLU n 
3 1406 ARG n 
3 1407 LEU n 
3 1408 ILE n 
3 1409 ALA n 
3 1410 GLU n 
3 1411 GLY n 
3 1412 LYS n 
3 1413 THR n 
3 1414 PRO n 
3 1415 VAL n 
3 1416 ALA n 
3 1417 TRP n 
3 1418 LYS n 
3 1419 PRO n 
3 1420 LEU n 
3 1421 LEU n 
3 1422 MET n 
3 1423 GLY n 
3 1424 VAL n 
3 1425 THR n 
3 1426 LYS n 
3 1427 SER n 
3 1428 ALA n 
3 1429 LEU n 
3 1430 SER n 
3 1431 THR n 
3 1432 LYS n 
3 1433 SER n 
3 1434 TRP n 
3 1435 LEU n 
3 1436 SER n 
3 1437 ALA n 
3 1438 ALA n 
3 1439 SER n 
3 1440 PHE n 
3 1441 GLN n 
3 1442 ASN n 
3 1443 THR n 
3 1444 THR n 
3 1445 HIS n 
3 1446 VAL n 
3 1447 LEU n 
3 1448 THR n 
3 1449 GLU n 
3 1450 ALA n 
3 1451 ALA n 
3 1452 ILE n 
3 1453 ALA n 
3 1454 GLY n 
3 1455 LYS n 
3 1456 LYS n 
3 1457 ASP n 
3 1458 GLU n 
3 1459 LEU n 
3 1460 ILE n 
3 1461 GLY n 
3 1462 LEU n 
3 1463 LYS n 
3 1464 GLU n 
3 1465 ASN n 
3 1466 VAL n 
3 1467 ILE n 
3 1468 LEU n 
3 1469 GLY n 
3 1470 ARG n 
3 1471 LEU n 
3 1472 ILE n 
3 1473 PRO n 
3 1474 ALA n 
3 1475 GLY n 
3 1476 THR n 
3 1477 GLY n 
3 1478 SER n 
3 1479 ASP n 
3 1480 PHE n 
3 1481 VAL n 
3 1482 ARG n 
3 1483 PHE n 
3 1484 THR n 
3 1485 GLN n 
3 1486 VAL n 
3 1487 VAL n 
3 1488 ASP n 
3 1489 GLN n 
3 1490 LYS n 
3 1491 THR n 
3 1492 LEU n 
3 1493 LYS n 
3 1494 ALA n 
3 1495 ILE n 
3 1496 GLU n 
3 1497 GLU n 
3 1498 ALA n 
3 1499 ARG n 
3 1500 LYS n 
3 1501 GLU n 
3 1502 ALA n 
3 1503 VAL n 
3 1504 GLU n 
3 1505 ALA n 
3 1506 LYS n 
3 1507 GLU n 
3 1508 ARG n 
3 1509 PRO n 
3 1510 ALA n 
3 1511 ALA n 
3 1512 ARG n 
3 1513 ARG n 
3 1514 GLY n 
3 1515 VAL n 
3 1516 LYS n 
3 1517 ARG n 
3 1518 GLU n 
3 1519 GLN n 
3 1520 PRO n 
3 1521 GLY n 
3 1522 LYS n 
3 1523 GLN n 
3 1524 ALA n 
4 1    MET n 
4 2    ALA n 
4 3    GLU n 
4 4    PRO n 
4 5    GLY n 
4 6    ILE n 
4 7    ASP n 
4 8    LYS n 
4 9    LEU n 
4 10   PHE n 
4 11   GLY n 
4 12   MET n 
4 13   VAL n 
4 14   ASP n 
4 15   SER n 
4 16   LYS n 
4 17   TYR n 
4 18   ARG n 
4 19   LEU n 
4 20   THR n 
4 21   VAL n 
4 22   VAL n 
4 23   VAL n 
4 24   ALA n 
4 25   LYS n 
4 26   ARG n 
4 27   ALA n 
4 28   GLN n 
4 29   GLN n 
4 30   LEU n 
4 31   LEU n 
4 32   ARG n 
4 33   HIS n 
4 34   GLY n 
4 35   PHE n 
4 36   LYS n 
4 37   ASN n 
4 38   THR n 
4 39   VAL n 
4 40   LEU n 
4 41   GLU n 
4 42   PRO n 
4 43   GLU n 
4 44   GLU n 
4 45   ARG n 
4 46   PRO n 
4 47   LYS n 
4 48   MET n 
4 49   GLN n 
4 50   THR n 
4 51   LEU n 
4 52   GLU n 
4 53   GLY n 
4 54   LEU n 
4 55   PHE n 
4 56   ASP n 
4 57   ASP n 
4 58   PRO n 
4 59   ASN n 
4 60   ALA n 
4 61   VAL n 
4 62   THR n 
4 63   TRP n 
4 64   ALA n 
4 65   MET n 
4 66   LYS n 
4 67   GLU n 
4 68   LEU n 
4 69   LEU n 
4 70   THR n 
4 71   GLY n 
4 72   ARG n 
4 73   LEU n 
4 74   VAL n 
4 75   PHE n 
4 76   GLY n 
4 77   GLU n 
4 78   ASN n 
4 79   LEU n 
4 80   VAL n 
4 81   PRO n 
4 82   GLU n 
4 83   ASP n 
4 84   ARG n 
4 85   LEU n 
4 86   GLN n 
4 87   LYS n 
4 88   GLU n 
4 89   MET n 
4 90   GLU n 
4 91   ARG n 
4 92   LEU n 
4 93   TYR n 
4 94   PRO n 
4 95   VAL n 
4 96   GLU n 
4 97   ARG n 
4 98   GLU n 
4 99   GLU n 
5 1    MET n 
5 2    GLY n 
5 3    SER n 
5 4    SER n 
5 5    HIS n 
5 6    HIS n 
5 7    HIS n 
5 8    HIS n 
5 9    HIS n 
5 10   HIS n 
5 11   SER n 
5 12   SER n 
5 13   GLY n 
5 14   LEU n 
5 15   VAL n 
5 16   PRO n 
5 17   ARG n 
5 18   GLY n 
5 19   SER n 
5 20   HIS n 
5 21   MET n 
5 22   LYS n 
5 23   LYS n 
5 24   SER n 
5 25   LYS n 
5 26   ARG n 
5 27   LYS n 
5 28   ASN n 
5 29   ALA n 
5 30   GLN n 
5 31   ALA n 
5 32   GLN n 
5 33   GLU n 
5 34   ALA n 
5 35   GLN n 
5 36   GLU n 
5 37   THR n 
5 38   GLU n 
5 39   VAL n 
5 40   LEU n 
5 41   VAL n 
5 42   GLN n 
5 43   GLU n 
5 44   GLU n 
5 45   ALA n 
5 46   GLU n 
5 47   GLU n 
5 48   LEU n 
5 49   PRO n 
5 50   GLU n 
5 51   PHE n 
5 52   PRO n 
5 53   GLU n 
5 54   GLY n 
5 55   GLU n 
5 56   PRO n 
5 57   ASP n 
5 58   PRO n 
5 59   ASP n 
5 60   LEU n 
5 61   GLU n 
5 62   ASP n 
5 63   PRO n 
5 64   ASP n 
5 65   LEU n 
5 66   THR n 
5 67   LEU n 
5 68   GLU n 
5 69   ASP n 
5 70   ASP n 
5 71   LEU n 
5 72   LEU n 
5 73   ASP n 
5 74   LEU n 
5 75   PRO n 
5 76   GLU n 
5 77   GLU n 
5 78   GLY n 
5 79   GLU n 
5 80   GLY n 
5 81   LEU n 
5 82   ASP n 
5 83   LEU n 
5 84   GLU n 
5 85   GLU n 
5 86   GLU n 
5 87   GLU n 
5 88   GLU n 
5 89   ASP n 
5 90   LEU n 
5 91   PRO n 
5 92   ILE n 
5 93   PRO n 
5 94   LYS n 
5 95   ILE n 
5 96   SER n 
5 97   THR n 
5 98   SER n 
5 99   ASP n 
5 100  PRO n 
5 101  VAL n 
5 102  ARG n 
5 103  GLN n 
5 104  TYR n 
5 105  LEU n 
5 106  HIS n 
5 107  GLU n 
5 108  ILE n 
5 109  GLY n 
5 110  GLN n 
5 111  VAL n 
5 112  PRO n 
5 113  LEU n 
5 114  LEU n 
5 115  THR n 
5 116  LEU n 
5 117  GLU n 
5 118  GLU n 
5 119  GLU n 
5 120  VAL n 
5 121  GLU n 
5 122  LEU n 
5 123  ALA n 
5 124  ARG n 
5 125  LYS n 
5 126  VAL n 
5 127  GLU n 
5 128  GLU n 
5 129  GLY n 
5 130  MET n 
5 131  GLU n 
5 132  ALA n 
5 133  ILE n 
5 134  LYS n 
5 135  LYS n 
5 136  LEU n 
5 137  SER n 
5 138  GLU n 
5 139  ILE n 
5 140  THR n 
5 141  GLY n 
5 142  LEU n 
5 143  ASP n 
5 144  PRO n 
5 145  ASP n 
5 146  LEU n 
5 147  ILE n 
5 148  ARG n 
5 149  GLU n 
5 150  VAL n 
5 151  VAL n 
5 152  ARG n 
5 153  ALA n 
5 154  LYS n 
5 155  ILE n 
5 156  LEU n 
5 157  GLY n 
5 158  SER n 
5 159  ALA n 
5 160  ARG n 
5 161  VAL n 
5 162  ARG n 
5 163  HIS n 
5 164  ILE n 
5 165  PRO n 
5 166  GLY n 
5 167  LEU n 
5 168  LYS n 
5 169  GLU n 
5 170  THR n 
5 171  LEU n 
5 172  ASP n 
5 173  PRO n 
5 174  LYS n 
5 175  THR n 
5 176  VAL n 
5 177  GLU n 
5 178  GLU n 
5 179  ILE n 
5 180  ASP n 
5 181  GLN n 
5 182  LYS n 
5 183  LEU n 
5 184  LYS n 
5 185  SER n 
5 186  LEU n 
5 187  PRO n 
5 188  LYS n 
5 189  GLU n 
5 190  HIS n 
5 191  LYS n 
5 192  ARG n 
5 193  TYR n 
5 194  LEU n 
5 195  HIS n 
5 196  ILE n 
5 197  ALA n 
5 198  ARG n 
5 199  GLU n 
5 200  GLY n 
5 201  GLU n 
5 202  ALA n 
5 203  ALA n 
5 204  ARG n 
5 205  GLN n 
5 206  HIS n 
5 207  LEU n 
5 208  ILE n 
5 209  GLU n 
5 210  ALA n 
5 211  ASN n 
5 212  LEU n 
5 213  ARG n 
5 214  LEU n 
5 215  VAL n 
5 216  VAL n 
5 217  SER n 
5 218  ILE n 
5 219  ALA n 
5 220  LYS n 
5 221  LYS n 
5 222  TYR n 
5 223  THR n 
5 224  GLY n 
5 225  ARG n 
5 226  GLY n 
5 227  LEU n 
5 228  SER n 
5 229  PHE n 
5 230  LEU n 
5 231  ASP n 
5 232  LEU n 
5 233  ILE n 
5 234  GLN n 
5 235  GLU n 
5 236  GLY n 
5 237  ASN n 
5 238  GLN n 
5 239  GLY n 
5 240  LEU n 
5 241  ILE n 
5 242  ARG n 
5 243  ALA n 
5 244  VAL n 
5 245  GLU n 
5 246  LYS n 
5 247  PHE n 
5 248  GLU n 
5 249  TYR n 
5 250  LYS n 
5 251  ARG n 
5 252  ARG n 
5 253  PHE n 
5 254  LYS n 
5 255  PHE n 
5 256  SER n 
5 257  THR n 
5 258  TYR n 
5 259  ALA n 
5 260  THR n 
5 261  TRP n 
5 262  TRP n 
5 263  ILE n 
5 264  ARG n 
5 265  GLN n 
5 266  ALA n 
5 267  ILE n 
5 268  ASN n 
5 269  ARG n 
5 270  ALA n 
5 271  ILE n 
5 272  ALA n 
5 273  ASP n 
5 274  GLN n 
5 275  ALA n 
5 276  ARG n 
5 277  THR n 
5 278  ILE n 
5 279  ARG n 
5 280  ILE n 
5 281  PRO n 
5 282  VAL n 
5 283  HIS n 
5 284  MET n 
5 285  VAL n 
5 286  GLU n 
5 287  THR n 
5 288  ILE n 
5 289  ASN n 
5 290  LYS n 
5 291  LEU n 
5 292  SER n 
5 293  ARG n 
5 294  THR n 
5 295  ALA n 
5 296  ARG n 
5 297  GLN n 
5 298  LEU n 
5 299  GLN n 
5 300  GLN n 
5 301  GLU n 
5 302  LEU n 
5 303  GLY n 
5 304  ARG n 
5 305  GLU n 
5 306  PRO n 
5 307  THR n 
5 308  TYR n 
5 309  GLU n 
5 310  GLU n 
5 311  ILE n 
5 312  ALA n 
5 313  GLU n 
5 314  ALA n 
5 315  MET n 
5 316  GLY n 
5 317  PRO n 
5 318  GLY n 
5 319  TRP n 
5 320  ASP n 
5 321  ALA n 
5 322  LYS n 
5 323  ARG n 
5 324  VAL n 
5 325  GLU n 
5 326  GLU n 
5 327  THR n 
5 328  LEU n 
5 329  LYS n 
5 330  ILE n 
5 331  ALA n 
5 332  GLN n 
5 333  GLU n 
5 334  PRO n 
5 335  VAL n 
5 336  SER n 
5 337  LEU n 
5 338  GLU n 
5 339  THR n 
5 340  PRO n 
5 341  ILE n 
5 342  GLY n 
5 343  ASP n 
5 344  GLU n 
5 345  LYS n 
5 346  ASP n 
5 347  SER n 
5 348  PHE n 
5 349  TYR n 
5 350  GLY n 
5 351  ASP n 
5 352  PHE n 
5 353  ILE n 
5 354  PRO n 
5 355  ASP n 
5 356  GLU n 
5 357  HIS n 
5 358  LEU n 
5 359  PRO n 
5 360  SER n 
5 361  PRO n 
5 362  VAL n 
5 363  ASP n 
5 364  ALA n 
5 365  ALA n 
5 366  THR n 
5 367  GLN n 
5 368  SER n 
5 369  LEU n 
5 370  LEU n 
5 371  SER n 
5 372  GLU n 
5 373  GLU n 
5 374  LEU n 
5 375  GLU n 
5 376  LYS n 
5 377  ALA n 
5 378  LEU n 
5 379  SER n 
5 380  LYS n 
5 381  LEU n 
5 382  SER n 
5 383  GLU n 
5 384  ARG n 
5 385  GLU n 
5 386  ALA n 
5 387  MET n 
5 388  VAL n 
5 389  LEU n 
5 390  LYS n 
5 391  LEU n 
5 392  ARG n 
5 393  LYS n 
5 394  GLY n 
5 395  LEU n 
5 396  ILE n 
5 397  ASP n 
5 398  GLY n 
5 399  ARG n 
5 400  GLU n 
5 401  HIS n 
5 402  THR n 
5 403  LEU n 
5 404  GLU n 
5 405  GLU n 
5 406  VAL n 
5 407  GLY n 
5 408  ALA n 
5 409  PHE n 
5 410  PHE n 
5 411  GLY n 
5 412  VAL n 
5 413  THR n 
5 414  ARG n 
5 415  GLU n 
5 416  ARG n 
5 417  ILE n 
5 418  ARG n 
5 419  GLN n 
5 420  ILE n 
5 421  GLU n 
5 422  ASN n 
5 423  LYS n 
5 424  ALA n 
5 425  LEU n 
5 426  ARG n 
5 427  LYS n 
5 428  LEU n 
5 429  LYS n 
5 430  TYR n 
5 431  HIS n 
5 432  GLU n 
5 433  SER n 
5 434  ARG n 
5 435  THR n 
5 436  ARG n 
5 437  LYS n 
5 438  LEU n 
5 439  ARG n 
5 440  ASP n 
5 441  PHE n 
5 442  LEU n 
5 443  ASP n 
6 1    DT  n 
6 2    DA  n 
6 3    DT  n 
6 4    DA  n 
6 5    DA  n 
6 6    DT  n 
6 7    DG  n 
6 8    DG  n 
6 9    DG  n 
6 10   DA  n 
6 11   DG  n 
6 12   DC  n 
6 13   DT  n 
6 14   DG  n 
6 15   DT  n 
6 16   DC  n 
6 17   DA  n 
6 18   DC  n 
6 19   DG  n 
6 20   DG  n 
6 21   DA  n 
6 22   DT  n 
6 23   DG  n 
6 24   DC  n 
6 25   DA  n 
6 26   DG  n 
6 27   DG  n 
7 1    DC  n 
7 2    DC  n 
7 3    DT  n 
7 4    DG  n 
7 5    DC  n 
7 6    DA  n 
7 7    DT  n 
7 8    DC  n 
7 9    DC  n 
7 10   DG  n 
7 11   DT  n 
7 12   DG  n 
7 13   DA  n 
7 14   DG  n 
7 15   BRU n 
7 16   DC  n 
7 17   DG  n 
7 18   DA  n 
7 19   DG  n 
7 20   DG  n 
7 21   DG  n 
# 
_entity_src_gen.entity_id                          5 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'rpoD, TTHA0532' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    HB8 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermus thermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     300852 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? ? 'Thermus thermophilus' 300852 ? ? HB8 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? 'Thermus thermophilus' 300852 ? ? HB8 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? ? 'Thermus thermophilus' 300852 ? ? HB8 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? 'Thermus thermophilus' 300852 ? ? HB8 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP RPOA_THET8   Q5SHR6 1 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
1 ? 
2 UNP RPOB_THET8   Q8RQE9 2 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
1 ? 
3 UNP RPOC_THET8   Q8RQE8 3 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
1 ? 
4 UNP RPOZ_THET8   Q8RQE7 4 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
1 ? 
5 UNP Q5SKW1_THET8 Q5SKW1 5 
;MKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEGLDLEEEEEDLPIPKISTSDP
VRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEID
QKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYAT
WWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETP
IGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQI
ENKALRKLKYHESRTRKLRDFLD
;
1 ? 
6 PDB 4G7Z         4G7Z   6 TATAATGGGAGCTGTCACGGATGCAGG 1 ? 
7 PDB 4G7Z         4G7Z   7 'CCTGCATCCGTGAG(BRU)CGAGGG' 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 4G7Z A 1  ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
2  1 4G7Z B 1  ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
3  2 4G7Z C 1  ? 1119 ? Q8RQE9 1 ? 1119 ? 1 1119 
4  3 4G7Z D 1  ? 1524 ? Q8RQE8 1 ? 1524 ? 1 1524 
5  4 4G7Z E 1  ? 99   ? Q8RQE7 1 ? 99   ? 1 99   
6  5 4G7Z F 21 ? 443  ? Q5SKW1 1 ? 423  ? 1 423  
7  1 4G7Z K 1  ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
8  1 4G7Z L 1  ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
9  2 4G7Z M 1  ? 1119 ? Q8RQE9 1 ? 1119 ? 1 1119 
10 3 4G7Z N 1  ? 1524 ? Q8RQE8 1 ? 1524 ? 1 1524 
11 4 4G7Z O 1  ? 99   ? Q8RQE7 1 ? 99   ? 1 99   
12 5 4G7Z P 21 ? 443  ? Q5SKW1 1 ? 423  ? 1 423  
13 6 4G7Z H 1  ? 27   ? 4G7Z   1 ? 27   ? 1 27   
14 6 4G7Z R 1  ? 27   ? 4G7Z   1 ? 27   ? 1 27   
15 7 4G7Z G 1  ? 21   ? 4G7Z   1 ? 21   ? 1 21   
16 7 4G7Z Q 1  ? 21   ? 4G7Z   1 ? 21   ? 1 21   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
6  4G7Z MET F 1  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -19 1  
6  4G7Z GLY F 2  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -18 2  
6  4G7Z SER F 3  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -17 3  
6  4G7Z SER F 4  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -16 4  
6  4G7Z HIS F 5  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -15 5  
6  4G7Z HIS F 6  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -14 6  
6  4G7Z HIS F 7  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -13 7  
6  4G7Z HIS F 8  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -12 8  
6  4G7Z HIS F 9  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -11 9  
6  4G7Z HIS F 10 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -10 10 
6  4G7Z SER F 11 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -9  11 
6  4G7Z SER F 12 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -8  12 
6  4G7Z GLY F 13 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -7  13 
6  4G7Z LEU F 14 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -6  14 
6  4G7Z VAL F 15 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -5  15 
6  4G7Z PRO F 16 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -4  16 
6  4G7Z ARG F 17 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -3  17 
6  4G7Z GLY F 18 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -2  18 
6  4G7Z SER F 19 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -1  19 
6  4G7Z HIS F 20 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' 0   20 
12 4G7Z MET P 1  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -19 21 
12 4G7Z GLY P 2  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -18 22 
12 4G7Z SER P 3  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -17 23 
12 4G7Z SER P 4  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -16 24 
12 4G7Z HIS P 5  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -15 25 
12 4G7Z HIS P 6  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -14 26 
12 4G7Z HIS P 7  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -13 27 
12 4G7Z HIS P 8  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -12 28 
12 4G7Z HIS P 9  ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -11 29 
12 4G7Z HIS P 10 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -10 30 
12 4G7Z SER P 11 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -9  31 
12 4G7Z SER P 12 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -8  32 
12 4G7Z GLY P 13 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -7  33 
12 4G7Z LEU P 14 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -6  34 
12 4G7Z VAL P 15 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -5  35 
12 4G7Z PRO P 16 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -4  36 
12 4G7Z ARG P 17 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -3  37 
12 4G7Z GLY P 18 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -2  38 
12 4G7Z SER P 19 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' -1  39 
12 4G7Z HIS P 20 ? UNP Q5SKW1 ? ? 'EXPRESSION TAG' 0   40 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                    ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                            ? 'C4 H7 N O4'        133.103 
BRU 'DNA linking'       n "5-BROMO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" ? 'C9 H12 Br N2 O8 P' 387.078 
CYS 'L-peptide linking' y CYSTEINE                                   ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"       ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"        ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"       ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"               ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                  ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                 ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                            ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                     ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                  ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                 ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                   ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                     ? 'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                                 ? 'Zn 2'              65.409  
# 
_exptl.entry_id          4G7Z 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.18 
_exptl_crystal.density_percent_sol   61.32 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.7 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;100 mM Tris-HCl, pH 8.7, 200 mM potassium chloride, 50 mM magnesium chloride, 10% PEG4000, VAPOR DIFFUSION, HANGING DROP, temperature 295K
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 270' 
_diffrn_detector.pdbx_collection_date   2011-06-04 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'single crystal Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9180 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9180 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4G7Z 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            3.8 
_reflns.number_obs                   97590 
_reflns.number_all                   109211 
_reflns.percent_possible_obs         89.4 
_reflns.pdbx_Rmerge_I_obs            0.174 
_reflns.pdbx_Rsym_value              0.174 
_reflns.pdbx_netI_over_sigmaI        9.5 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.4 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             3.80 
_reflns_shell.d_res_low              3.87 
_reflns_shell.percent_possible_all   46.7 
_reflns_shell.Rmerge_I_obs           0.553 
_reflns_shell.pdbx_Rsym_value        0.553 
_reflns_shell.meanI_over_sigI_obs    2.1 
_reflns_shell.pdbx_redundancy        4.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4G7Z 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     109682 
_refine.ls_number_reflns_all                     215830 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             49.846 
_refine.ls_d_res_high                            3.815 
_refine.ls_percent_reflns_obs                    51.65 
_refine.ls_R_factor_obs                          0.1770 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1760 
_refine.ls_R_factor_R_free                       0.2322 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 1.84 
_refine.ls_number_reflns_R_free                  2014 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -0.5453 
_refine.aniso_B[2][2]                            9.4089 
_refine.aniso_B[3][3]                            -8.8636 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            19.5943 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.302 
_refine.solvent_model_param_bsol                 109.109 
_refine.pdbx_solvent_vdw_probe_radii             1.10 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.86 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 4G7H' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.46 
_refine.pdbx_overall_phase_error                 26.88 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        55220 
_refine_hist.pdbx_number_atoms_nucleic_acid   1646 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               56872 
_refine_hist.d_res_high                       3.815 
_refine_hist.d_res_low                        49.846 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.007  ? ? 58067 'X-RAY DIFFRACTION' ? 
f_angle_d          1.163  ? ? 78875 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 15.919 ? ? 22541 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.077  ? ? 8879  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.006  ? ? 10062 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 3.8152 3.9106  3375  0.2873 23.00 0.3339 . . 54  . . . . 
'X-RAY DIFFRACTION' . 3.9106 4.0163  4253  0.2610 28.00 0.3044 . . 78  . . . . 
'X-RAY DIFFRACTION' . 4.0163 4.1344  4997  0.2387 34.00 0.2654 . . 101 . . . . 
'X-RAY DIFFRACTION' . 4.1344 4.2678  5918  0.2245 40.00 0.3011 . . 118 . . . . 
'X-RAY DIFFRACTION' . 4.2678 4.4202  6793  0.1990 45.00 0.2689 . . 123 . . . . 
'X-RAY DIFFRACTION' . 4.4202 4.5971  7174  0.1870 49.00 0.2514 . . 132 . . . . 
'X-RAY DIFFRACTION' . 4.5971 4.8061  7521  0.1815 50.00 0.2430 . . 142 . . . . 
'X-RAY DIFFRACTION' . 4.8061 5.0593  7664  0.1942 51.00 0.2465 . . 147 . . . . 
'X-RAY DIFFRACTION' . 5.0593 5.3759  7735  0.1901 52.00 0.2281 . . 148 . . . . 
'X-RAY DIFFRACTION' . 5.3759 5.7905  7915  0.1959 53.00 0.2762 . . 148 . . . . 
'X-RAY DIFFRACTION' . 5.7905 6.3721  8196  0.1857 55.00 0.2640 . . 154 . . . . 
'X-RAY DIFFRACTION' . 6.3721 7.2917  9782  0.1578 66.00 0.2503 . . 179 . . . . 
'X-RAY DIFFRACTION' . 7.2917 9.1774  12549 0.1294 84.00 0.1874 . . 234 . . . . 
'X-RAY DIFFRACTION' . 9.1774 49.8499 13796 0.1690 93.00 0.1989 . . 256 . . . . 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    4G7Z 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
_struct.entry_id                  4G7Z 
_struct.title                     
'Crystal structure of Thermus thermophilus transcription initiation complex containing 5-BrU at template-strand position +1' 
_struct.pdbx_descriptor           
;DNA-directed RNA polymerase subunit alpha (E.C.2.7.7.6), DNA-directed RNA polymerase subunit beta (E.C.2.7.7.6), DNA-directed RNA polymerase subunit beta' (E.C.2.7.7.6), DNA-directed RNA polymerase subunit omega (E.C.2.7.7.6), RNA polymerase sigma factor
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4G7Z 
_struct_keywords.pdbx_keywords   'TRANSCRIPTION, TRANSFERASE/DNA' 
_struct_keywords.text            
;protein-DNA complex, transcription initiation complex, RNAP-promoter complex, RNAP-promoter open complex, open complex, RPo, RNA polymerase, transcription initiation, transcription Initiation factor sigma A, promoter DNA, nucleoid, TRANSCRIPTION, TRANSFERASE-DNA complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 1 ? 
H N N 1 ? 
I N N 2 ? 
J N N 3 ? 
K N N 4 ? 
L N N 5 ? 
M N N 6 ? 
N N N 7 ? 
O N N 6 ? 
P N N 7 ? 
Q N N 8 ? 
R N N 8 ? 
S N N 9 ? 
T N N 8 ? 
U N N 8 ? 
V N N 9 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   GLY A 31   ? LEU A 45   ? GLY A 31   LEU A 45   1 ? 15 
HELX_P HELX_P2   2   ASP A 74   ? LYS A 83   ? ASP A 74   LYS A 83   1 ? 10 
HELX_P HELX_P3   3   ARG A 112  ? PHE A 114  ? ARG A 112  PHE A 114  5 ? 3  
HELX_P HELX_P4   4   PRO A 152  ? GLY A 157  ? PRO A 152  GLY A 157  1 ? 6  
HELX_P HELX_P5   5   THR A 206  ? THR A 223  ? THR A 206  THR A 223  1 ? 18 
HELX_P HELX_P6   6   TYR A 224  ? SER A 226  ? TYR A 224  SER A 226  5 ? 3  
HELX_P HELX_P7   7   GLY B 31   ? LEU B 45   ? GLY B 31   LEU B 45   1 ? 15 
HELX_P HELX_P8   8   ASP B 74   ? GLU B 84   ? ASP B 74   GLU B 84   1 ? 11 
HELX_P HELX_P9   9   ARG B 112  ? PHE B 114  ? ARG B 112  PHE B 114  5 ? 3  
HELX_P HELX_P10  10  PRO B 152  ? GLY B 157  ? PRO B 152  GLY B 157  1 ? 6  
HELX_P HELX_P11  11  THR B 206  ? LEU B 222  ? THR B 206  LEU B 222  1 ? 17 
HELX_P HELX_P12  12  THR B 223  ? SER B 226  ? THR B 223  SER B 226  5 ? 4  
HELX_P HELX_P13  13  THR C 19   ? GLN C 31   ? THR C 19   GLN C 31   1 ? 13 
HELX_P HELX_P14  14  GLY C 43   ? PHE C 52   ? GLY C 43   PHE C 52   1 ? 10 
HELX_P HELX_P15  15  PRO C 79   ? LYS C 86   ? PRO C 79   LYS C 86   1 ? 8  
HELX_P HELX_P16  16  LEU C 193  ? LEU C 200  ? LEU C 193  LEU C 200  1 ? 8  
HELX_P HELX_P17  17  ASP C 203  ? LEU C 211  ? ASP C 203  LEU C 211  1 ? 9  
HELX_P HELX_P18  18  LEU C 217  ? MET C 222  ? LEU C 217  MET C 222  1 ? 6  
HELX_P HELX_P19  19  SER C 225  ? MET C 229  ? SER C 225  MET C 229  5 ? 5  
HELX_P HELX_P20  20  ARG C 230  ? ARG C 243  ? ARG C 230  ARG C 243  1 ? 14 
HELX_P HELX_P21  21  ARG C 250  ? GLY C 259  ? ARG C 250  GLY C 259  1 ? 10 
HELX_P HELX_P22  22  GLY C 270  ? LEU C 281  ? GLY C 270  LEU C 281  1 ? 12 
HELX_P HELX_P23  23  VAL C 302  ? ALA C 315  ? VAL C 302  ALA C 315  1 ? 14 
HELX_P HELX_P24  24  THR C 335  ? MET C 359  ? THR C 335  MET C 359  1 ? 25 
HELX_P HELX_P25  25  SER C 375  ? SER C 389  ? SER C 375  SER C 389  1 ? 15 
HELX_P HELX_P26  26  ASN C 399  ? HIS C 406  ? ASN C 399  HIS C 406  1 ? 8  
HELX_P HELX_P27  27  GLY C 424  ? ASP C 429  ? GLY C 424  ASP C 429  1 ? 6  
HELX_P HELX_P28  28  THR C 489  ? ARG C 493  ? THR C 489  ARG C 493  5 ? 5  
HELX_P HELX_P29  29  SER C 535  ? PHE C 540  ? SER C 535  PHE C 540  5 ? 6  
HELX_P HELX_P30  30  VAL C 542  ? ILE C 547  ? VAL C 542  ILE C 547  5 ? 6  
HELX_P HELX_P31  31  PHE C 549  ? ASP C 553  ? PHE C 549  ASP C 553  5 ? 5  
HELX_P HELX_P32  32  ASP C 554  ? THR C 566  ? ASP C 554  THR C 566  1 ? 13 
HELX_P HELX_P33  33  LEU C 583  ? SER C 591  ? LEU C 583  SER C 591  1 ? 9  
HELX_P HELX_P34  34  ASN C 683  ? ALA C 687  ? ASN C 683  ALA C 687  5 ? 5  
HELX_P HELX_P35  35  GLU C 692  ? ARG C 697  ? GLU C 692  ARG C 697  1 ? 6  
HELX_P HELX_P36  36  SER C 730  ? ARG C 735  ? SER C 730  ARG C 735  1 ? 6  
HELX_P HELX_P37  37  THR C 768  ? GLY C 779  ? THR C 768  GLY C 779  1 ? 12 
HELX_P HELX_P38  38  LEU C 874  ? MET C 880  ? LEU C 874  MET C 880  1 ? 7  
HELX_P HELX_P39  39  LEU C 882  ? LEU C 897  ? LEU C 882  LEU C 897  1 ? 16 
HELX_P HELX_P40  40  LYS C 910  ? GLU C 932  ? LYS C 910  GLU C 932  1 ? 23 
HELX_P HELX_P41  41  ASP C 937  ? LEU C 950  ? ASP C 937  LEU C 950  1 ? 14 
HELX_P HELX_P42  42  THR C 958  ? LEU C 968  ? THR C 958  LEU C 968  1 ? 11 
HELX_P HELX_P43  43  MET C 1000 ? MET C 1005 ? MET C 1000 MET C 1005 1 ? 6  
HELX_P HELX_P44  44  GLY C 1033 ? GLY C 1044 ? GLY C 1033 GLY C 1044 1 ? 12 
HELX_P HELX_P45  45  ALA C 1045 ? THR C 1054 ? ALA C 1045 THR C 1054 1 ? 10 
HELX_P HELX_P46  46  ASP C 1059 ? GLY C 1073 ? ASP C 1059 GLY C 1073 1 ? 15 
HELX_P HELX_P47  47  PRO C 1082 ? ALA C 1094 ? PRO C 1082 ALA C 1094 1 ? 13 
HELX_P HELX_P48  48  SER D 14   ? TRP D 21   ? SER D 14   TRP D 21   1 ? 8  
HELX_P HELX_P49  49  LYS D 82   ? TYR D 88   ? LYS D 82   TYR D 88   5 ? 7  
HELX_P HELX_P50  50  HIS D 101  ? ASP D 107  ? HIS D 101  ASP D 107  1 ? 7  
HELX_P HELX_P51  51  SER D 110  ? LEU D 116  ? SER D 110  LEU D 116  1 ? 7  
HELX_P HELX_P52  52  SER D 119  ? TYR D 128  ? SER D 119  TYR D 128  1 ? 10 
HELX_P HELX_P53  53  THR D 154  ? GLY D 164  ? THR D 154  GLY D 164  1 ? 11 
HELX_P HELX_P54  54  ASP D 423  ? LYS D 426  ? ASP D 423  LYS D 426  5 ? 4  
HELX_P HELX_P55  55  GLY D 457  ? GLU D 467  ? GLY D 457  GLU D 467  1 ? 11 
HELX_P HELX_P56  56  ASP D 469  ? MET D 481  ? ASP D 469  MET D 481  1 ? 13 
HELX_P HELX_P57  57  SER D 485  ? GLY D 506  ? SER D 485  GLY D 506  1 ? 22 
HELX_P HELX_P58  58  ARG D 508  ? TRP D 511  ? ARG D 508  TRP D 511  5 ? 4  
HELX_P HELX_P59  59  SER D 538  ? GLN D 560  ? SER D 538  GLN D 560  1 ? 23 
HELX_P HELX_P60  60  PRO D 563  ? LEU D 574  ? PRO D 563  LEU D 574  1 ? 12 
HELX_P HELX_P61  61  LEU D 574  ? ASP D 583  ? LEU D 574  ASP D 583  1 ? 10 
HELX_P HELX_P62  62  SER D 602  ? SER D 608  ? SER D 602  SER D 608  1 ? 7  
HELX_P HELX_P63  63  GLY D 612  ? ASN D 617  ? GLY D 612  ASN D 617  1 ? 6  
HELX_P HELX_P64  64  LYS D 646  ? LYS D 664  ? LYS D 646  LYS D 664  1 ? 19 
HELX_P HELX_P65  65  ASN D 669  ? LEU D 677  ? ASN D 669  LEU D 677  1 ? 9  
HELX_P HELX_P66  66  ARG D 679  ? ILE D 683  ? ARG D 679  ILE D 683  5 ? 5  
HELX_P HELX_P67  67  LYS D 684  ? HIS D 696  ? LYS D 684  HIS D 696  1 ? 13 
HELX_P HELX_P68  68  HIS D 709  ? LEU D 711  ? HIS D 709  LEU D 711  5 ? 3  
HELX_P HELX_P69  69  HIS D 729  ? ASN D 737  ? HIS D 729  ASN D 737  1 ? 9  
HELX_P HELX_P70  70  SER D 752  ? GLN D 762  ? SER D 752  GLN D 762  1 ? 11 
HELX_P HELX_P71  71  ARG D 783  ? GLN D 794  ? ARG D 783  GLN D 794  1 ? 12 
HELX_P HELX_P72  72  THR D 808  ? ARG D 818  ? THR D 808  ARG D 818  1 ? 11 
HELX_P HELX_P73  73  VAL D 836  ? TYR D 841  ? VAL D 836  TYR D 841  1 ? 6  
HELX_P HELX_P74  74  ASN D 845  ? HIS D 855  ? ASN D 845  HIS D 855  1 ? 11 
HELX_P HELX_P75  75  SER D 876  ? GLU D 891  ? SER D 876  GLU D 891  1 ? 16 
HELX_P HELX_P76  76  ASP D 892  ? ILE D 900  ? ASP D 892  ILE D 900  1 ? 9  
HELX_P HELX_P77  77  GLU D 907  ? LEU D 922  ? GLU D 907  LEU D 922  1 ? 16 
HELX_P HELX_P78  78  GLY D 923  ? SER D 945  ? GLY D 923  SER D 945  1 ? 23 
HELX_P HELX_P79  79  GLY D 950  ? ALA D 954  ? GLY D 950  ALA D 954  5 ? 5  
HELX_P HELX_P80  80  GLU D 958  ? MET D 980  ? GLU D 958  MET D 980  1 ? 23 
HELX_P HELX_P81  81  THR D 984  ? TYR D 1015 ? THR D 984  TYR D 1015 1 ? 32 
HELX_P HELX_P82  82  ASN D 1018 ? GLY D 1027 ? ASN D 1018 GLY D 1027 1 ? 10 
HELX_P HELX_P83  83  ASN D 1031 ? GLY D 1040 ? ASN D 1031 GLY D 1040 1 ? 10 
HELX_P HELX_P84  84  THR D 1066 ? THR D 1102 ? THR D 1066 THR D 1102 1 ? 37 
HELX_P HELX_P85  85  LYS D 1136 ? TYR D 1145 ? LYS D 1136 TYR D 1145 1 ? 10 
HELX_P HELX_P86  86  SER D 1167 ? ALA D 1180 ? SER D 1167 ALA D 1180 1 ? 14 
HELX_P HELX_P87  87  GLN D 1202 ? GLY D 1206 ? GLN D 1202 GLY D 1206 1 ? 5  
HELX_P HELX_P88  88  ALA D 1220 ? GLU D 1231 ? ALA D 1220 GLU D 1231 1 ? 12 
HELX_P HELX_P89  89  PRO D 1232 ? LEU D 1236 ? PRO D 1232 LEU D 1236 5 ? 5  
HELX_P HELX_P90  90  GLY D 1255 ? GLU D 1264 ? GLY D 1255 GLU D 1264 1 ? 10 
HELX_P HELX_P91  91  ASP D 1331 ? GLY D 1340 ? ASP D 1331 GLY D 1340 1 ? 10 
HELX_P HELX_P92  92  GLY D 1340 ? GLN D 1359 ? GLY D 1340 GLN D 1359 1 ? 20 
HELX_P HELX_P93  93  HIS D 1364 ? MET D 1376 ? HIS D 1364 MET D 1376 1 ? 13 
HELX_P HELX_P94  94  LYS D 1397 ? ALA D 1409 ? LYS D 1397 ALA D 1409 1 ? 13 
HELX_P HELX_P95  95  GLY D 1423 ? SER D 1430 ? GLY D 1423 SER D 1430 1 ? 8  
HELX_P HELX_P96  96  SER D 1433 ? SER D 1439 ? SER D 1433 SER D 1439 1 ? 7  
HELX_P HELX_P97  97  ASN D 1442 ? GLY D 1454 ? ASN D 1442 GLY D 1454 1 ? 13 
HELX_P HELX_P98  98  GLY D 1461 ? GLY D 1469 ? GLY D 1461 GLY D 1469 1 ? 9  
HELX_P HELX_P99  99  ALA D 1474 ? GLY D 1477 ? ALA D 1474 GLY D 1477 5 ? 4  
HELX_P HELX_P100 100 SER D 1478 ? PHE D 1483 ? SER D 1478 PHE D 1483 1 ? 6  
HELX_P HELX_P101 101 GLN D 1489 ? GLU D 1496 ? GLN D 1489 GLU D 1496 1 ? 8  
HELX_P HELX_P102 102 GLY E 5    ? MET E 12   ? GLY E 5    MET E 12   1 ? 8  
HELX_P HELX_P103 103 SER E 15   ? HIS E 33   ? SER E 15   HIS E 33   1 ? 19 
HELX_P HELX_P104 104 ASN E 59   ? THR E 70   ? ASN E 59   THR E 70   1 ? 12 
HELX_P HELX_P105 105 PRO E 81   ? TYR E 93   ? PRO E 81   TYR E 93   1 ? 13 
HELX_P HELX_P106 106 ASP F 99   ? GLY F 109  ? ASP F 79   GLY F 89   1 ? 11 
HELX_P HELX_P107 107 THR F 115  ? GLY F 141  ? THR F 95   GLY F 121  1 ? 27 
HELX_P HELX_P108 108 ASP F 143  ? GLY F 157  ? ASP F 123  GLY F 137  1 ? 15 
HELX_P HELX_P109 109 ASP F 172  ? LYS F 184  ? ASP F 152  LYS F 164  1 ? 13 
HELX_P HELX_P110 110 PRO F 187  ? ASN F 211  ? PRO F 167  ASN F 191  1 ? 25 
HELX_P HELX_P111 111 ASN F 211  ? LYS F 220  ? ASN F 191  LYS F 200  1 ? 10 
HELX_P HELX_P112 112 LYS F 221  ? THR F 223  ? LYS F 201  THR F 203  5 ? 3  
HELX_P HELX_P113 113 SER F 228  ? PHE F 247  ? SER F 208  PHE F 227  1 ? 20 
HELX_P HELX_P114 114 LYS F 254  ? ALA F 275  ? LYS F 234  ALA F 255  1 ? 22 
HELX_P HELX_P115 115 PRO F 281  ? GLY F 303  ? PRO F 261  GLY F 283  1 ? 23 
HELX_P HELX_P116 116 THR F 307  ? MET F 315  ? THR F 287  MET F 295  1 ? 9  
HELX_P HELX_P117 117 ASP F 320  ? ALA F 331  ? ASP F 300  ALA F 311  1 ? 12 
HELX_P HELX_P118 118 PHE F 348  ? PHE F 352  ? PHE F 328  PHE F 332  5 ? 5  
HELX_P HELX_P119 119 SER F 360  ? LEU F 378  ? SER F 340  LEU F 358  1 ? 19 
HELX_P HELX_P120 120 ARG F 384  ? LYS F 393  ? ARG F 364  LYS F 373  1 ? 10 
HELX_P HELX_P121 121 THR F 402  ? GLY F 411  ? THR F 382  GLY F 391  1 ? 10 
HELX_P HELX_P122 122 GLU F 415  ? ARG F 436  ? GLU F 395  ARG F 416  1 ? 22 
HELX_P HELX_P123 123 LYS F 437  ? ASP F 443  ? LYS F 417  ASP F 423  5 ? 7  
HELX_P HELX_P124 124 GLY G 31   ? ILE G 48   ? GLY K 31   ILE K 48   1 ? 18 
HELX_P HELX_P125 125 ASP G 74   ? LYS G 83   ? ASP K 74   LYS K 83   1 ? 10 
HELX_P HELX_P126 126 ARG G 112  ? PHE G 114  ? ARG K 112  PHE K 114  5 ? 3  
HELX_P HELX_P127 127 PRO G 152  ? GLY G 157  ? PRO K 152  GLY K 157  1 ? 6  
HELX_P HELX_P128 128 THR G 206  ? THR G 223  ? THR K 206  THR K 223  1 ? 18 
HELX_P HELX_P129 129 TYR G 224  ? SER G 226  ? TYR K 224  SER K 226  5 ? 3  
HELX_P HELX_P130 130 GLY H 31   ? LEU H 45   ? GLY L 31   LEU L 45   1 ? 15 
HELX_P HELX_P131 131 ASP H 74   ? GLU H 84   ? ASP L 74   GLU L 84   1 ? 11 
HELX_P HELX_P132 132 ARG H 112  ? PHE H 114  ? ARG L 112  PHE L 114  5 ? 3  
HELX_P HELX_P133 133 PRO H 152  ? GLY H 157  ? PRO L 152  GLY L 157  1 ? 6  
HELX_P HELX_P134 134 THR H 206  ? LEU H 222  ? THR L 206  LEU L 222  1 ? 17 
HELX_P HELX_P135 135 THR H 223  ? SER H 226  ? THR L 223  SER L 226  5 ? 4  
HELX_P HELX_P136 136 THR I 19   ? GLN I 31   ? THR M 19   GLN M 31   1 ? 13 
HELX_P HELX_P137 137 PRO I 35   ? ARG I 39   ? PRO M 35   ARG M 39   5 ? 5  
HELX_P HELX_P138 138 GLY I 43   ? PHE I 52   ? GLY M 43   PHE M 52   1 ? 10 
HELX_P HELX_P139 139 PRO I 79   ? LYS I 86   ? PRO M 79   LYS M 86   1 ? 8  
HELX_P HELX_P140 140 LEU I 193  ? LEU I 200  ? LEU M 193  LEU M 200  1 ? 8  
HELX_P HELX_P141 141 ASP I 203  ? GLY I 212  ? ASP M 203  GLY M 212  1 ? 10 
HELX_P HELX_P142 142 LEU I 217  ? MET I 222  ? LEU M 217  MET M 222  1 ? 6  
HELX_P HELX_P143 143 SER I 225  ? MET I 229  ? SER M 225  MET M 229  5 ? 5  
HELX_P HELX_P144 144 ARG I 230  ? ARG I 243  ? ARG M 230  ARG M 243  1 ? 14 
HELX_P HELX_P145 145 ARG I 250  ? ILE I 261  ? ARG M 250  ILE M 261  1 ? 12 
HELX_P HELX_P146 146 GLY I 270  ? GLY I 282  ? GLY M 270  GLY M 282  1 ? 13 
HELX_P HELX_P147 147 VAL I 302  ? ALA I 315  ? VAL M 302  ALA M 315  1 ? 14 
HELX_P HELX_P148 148 THR I 335  ? MET I 359  ? THR M 335  MET M 359  1 ? 25 
HELX_P HELX_P149 149 THR I 368  ? VAL I 373  ? THR M 368  VAL M 373  1 ? 6  
HELX_P HELX_P150 150 SER I 375  ? SER I 389  ? SER M 375  SER M 389  1 ? 15 
HELX_P HELX_P151 151 ASN I 399  ? ARG I 408  ? ASN M 399  ARG M 408  1 ? 10 
HELX_P HELX_P152 152 GLY I 424  ? ASP I 429  ? GLY M 424  ASP M 429  1 ? 6  
HELX_P HELX_P153 153 ALA I 488  ? ASP I 492  ? ALA M 488  ASP M 492  1 ? 5  
HELX_P HELX_P154 154 SER I 525  ? VAL I 529  ? SER M 525  VAL M 529  5 ? 5  
HELX_P HELX_P155 155 PRO I 536  ? PHE I 540  ? PRO M 536  PHE M 540  5 ? 5  
HELX_P HELX_P156 156 VAL I 542  ? ILE I 547  ? VAL M 542  ILE M 547  5 ? 6  
HELX_P HELX_P157 157 PHE I 549  ? ASP I 553  ? PHE M 549  ASP M 553  5 ? 5  
HELX_P HELX_P158 158 ASP I 554  ? THR I 566  ? ASP M 554  THR M 566  1 ? 13 
HELX_P HELX_P159 159 LEU I 583  ? SER I 591  ? LEU M 583  SER M 591  1 ? 9  
HELX_P HELX_P160 160 ASN I 683  ? ALA I 687  ? ASN M 683  ALA M 687  5 ? 5  
HELX_P HELX_P161 161 GLU I 692  ? ARG I 697  ? GLU M 692  ARG M 697  1 ? 6  
HELX_P HELX_P162 162 SER I 730  ? ARG I 735  ? SER M 730  ARG M 735  1 ? 6  
HELX_P HELX_P163 163 THR I 768  ? GLY I 779  ? THR M 768  GLY M 779  1 ? 12 
HELX_P HELX_P164 164 PRO I 854  ? MET I 858  ? PRO M 854  MET M 858  5 ? 5  
HELX_P HELX_P165 165 LEU I 874  ? MET I 880  ? LEU M 874  MET M 880  1 ? 7  
HELX_P HELX_P166 166 LEU I 882  ? GLY I 898  ? LEU M 882  GLY M 898  1 ? 17 
HELX_P HELX_P167 167 LYS I 910  ? GLU I 932  ? LYS M 910  GLU M 932  1 ? 23 
HELX_P HELX_P168 168 ASP I 937  ? LYS I 949  ? ASP M 937  LYS M 949  1 ? 13 
HELX_P HELX_P169 169 THR I 958  ? LEU I 968  ? THR M 958  LEU M 968  1 ? 11 
HELX_P HELX_P170 170 MET I 1000 ? MET I 1005 ? MET M 1000 MET M 1005 1 ? 6  
HELX_P HELX_P171 171 GLY I 1033 ? GLY I 1044 ? GLY M 1033 GLY M 1044 1 ? 12 
HELX_P HELX_P172 172 ALA I 1045 ? THR I 1054 ? ALA M 1045 THR M 1054 1 ? 10 
HELX_P HELX_P173 173 ASP I 1059 ? GLY I 1073 ? ASP M 1059 GLY M 1073 1 ? 15 
HELX_P HELX_P174 174 PRO I 1082 ? ALA I 1094 ? PRO M 1082 ALA M 1094 1 ? 13 
HELX_P HELX_P175 175 SER J 14   ? TRP J 21   ? SER N 14   TRP N 21   1 ? 8  
HELX_P HELX_P176 176 LYS J 82   ? TYR J 88   ? LYS N 82   TYR N 88   5 ? 7  
HELX_P HELX_P177 177 HIS J 101  ? ASP J 107  ? HIS N 101  ASP N 107  1 ? 7  
HELX_P HELX_P178 178 SER J 110  ? LEU J 116  ? SER N 110  LEU N 116  1 ? 7  
HELX_P HELX_P179 179 SER J 119  ? TYR J 128  ? SER N 119  TYR N 128  1 ? 10 
HELX_P HELX_P180 180 THR J 154  ? GLY J 164  ? THR N 154  GLY N 164  1 ? 11 
HELX_P HELX_P181 181 ASP J 423  ? LYS J 426  ? ASP N 423  LYS N 426  5 ? 4  
HELX_P HELX_P182 182 MET J 456  ? GLU J 467  ? MET N 456  GLU N 467  1 ? 12 
HELX_P HELX_P183 183 ASP J 469  ? MET J 481  ? ASP N 469  MET N 481  1 ? 13 
HELX_P HELX_P184 184 SER J 485  ? GLY J 506  ? SER N 485  GLY N 506  1 ? 22 
HELX_P HELX_P185 185 ARG J 508  ? TRP J 511  ? ARG N 508  TRP N 511  5 ? 4  
HELX_P HELX_P186 186 PRO J 521  ? ARG J 525  ? PRO N 521  ARG N 525  5 ? 5  
HELX_P HELX_P187 187 SER J 538  ? GLN J 560  ? SER N 538  GLN N 560  1 ? 23 
HELX_P HELX_P188 188 PRO J 563  ? ASP J 583  ? PRO N 563  ASP N 583  1 ? 21 
HELX_P HELX_P189 189 SER J 602  ? SER J 608  ? SER N 602  SER N 608  1 ? 7  
HELX_P HELX_P190 190 GLY J 612  ? ASN J 617  ? GLY N 612  ASN N 617  1 ? 6  
HELX_P HELX_P191 191 LYS J 646  ? PHE J 653  ? LYS N 646  PHE N 653  1 ? 8  
HELX_P HELX_P192 192 PHE J 653  ? LYS J 664  ? PHE N 653  LYS N 664  1 ? 12 
HELX_P HELX_P193 193 ASN J 669  ? ARG J 679  ? ASN N 669  ARG N 679  1 ? 11 
HELX_P HELX_P194 194 GLN J 680  ? ILE J 683  ? GLN N 680  ILE N 683  5 ? 4  
HELX_P HELX_P195 195 LYS J 684  ? ILE J 695  ? LYS N 684  ILE N 695  1 ? 12 
HELX_P HELX_P196 196 HIS J 709  ? LEU J 711  ? HIS N 709  LEU N 711  5 ? 3  
HELX_P HELX_P197 197 VAL J 732  ? ASN J 737  ? VAL N 732  ASN N 737  1 ? 6  
HELX_P HELX_P198 198 SER J 752  ? GLN J 762  ? SER N 752  GLN N 762  1 ? 11 
HELX_P HELX_P199 199 LEU J 764  ? ASN J 768  ? LEU N 764  ASN N 768  5 ? 5  
HELX_P HELX_P200 200 ARG J 783  ? GLN J 794  ? ARG N 783  GLN N 794  1 ? 12 
HELX_P HELX_P201 201 THR J 808  ? ARG J 818  ? THR N 808  ARG N 818  1 ? 11 
HELX_P HELX_P202 202 SER J 835  ? TYR J 841  ? SER N 835  TYR N 841  1 ? 7  
HELX_P HELX_P203 203 ASN J 845  ? HIS J 855  ? ASN N 845  HIS N 855  1 ? 11 
HELX_P HELX_P204 204 SER J 876  ? GLU J 891  ? SER N 876  GLU N 891  1 ? 16 
HELX_P HELX_P205 205 ASP J 892  ? ILE J 900  ? ASP N 892  ILE N 900  1 ? 9  
HELX_P HELX_P206 206 GLU J 907  ? LEU J 922  ? GLU N 907  LEU N 922  1 ? 16 
HELX_P HELX_P207 207 GLY J 923  ? SER J 945  ? GLY N 923  SER N 945  1 ? 23 
HELX_P HELX_P208 208 GLY J 950  ? ALA J 954  ? GLY N 950  ALA N 954  5 ? 5  
HELX_P HELX_P209 209 GLU J 958  ? MET J 980  ? GLU N 958  MET N 980  1 ? 23 
HELX_P HELX_P210 210 THR J 984  ? TYR J 1015 ? THR N 984  TYR N 1015 1 ? 32 
HELX_P HELX_P211 211 ASN J 1018 ? GLY J 1027 ? ASN N 1018 GLY N 1027 1 ? 10 
HELX_P HELX_P212 212 ASN J 1031 ? GLY J 1040 ? ASN N 1031 GLY N 1040 1 ? 10 
HELX_P HELX_P213 213 THR J 1066 ? HIS J 1103 ? THR N 1066 HIS N 1103 1 ? 38 
HELX_P HELX_P214 214 GLU J 1127 ? ARG J 1130 ? GLU N 1127 ARG N 1130 5 ? 4  
HELX_P HELX_P215 215 LYS J 1136 ? TYR J 1145 ? LYS N 1136 TYR N 1145 1 ? 10 
HELX_P HELX_P216 216 SER J 1167 ? ALA J 1180 ? SER N 1167 ALA N 1180 1 ? 14 
HELX_P HELX_P217 217 GLN J 1202 ? GLY J 1206 ? GLN N 1202 GLY N 1206 1 ? 5  
HELX_P HELX_P218 218 ALA J 1220 ? GLU J 1231 ? ALA N 1220 GLU N 1231 1 ? 12 
HELX_P HELX_P219 219 PRO J 1232 ? LEU J 1236 ? PRO N 1232 LEU N 1236 5 ? 5  
HELX_P HELX_P220 220 GLN J 1254 ? GLU J 1264 ? GLN N 1254 GLU N 1264 1 ? 11 
HELX_P HELX_P221 221 ASP J 1331 ? GLY J 1340 ? ASP N 1331 GLY N 1340 1 ? 10 
HELX_P HELX_P222 222 GLY J 1340 ? GLN J 1359 ? GLY N 1340 GLN N 1359 1 ? 20 
HELX_P HELX_P223 223 HIS J 1364 ? MET J 1376 ? HIS N 1364 MET N 1376 1 ? 13 
HELX_P HELX_P224 224 LYS J 1397 ? ALA J 1409 ? LYS N 1397 ALA N 1409 1 ? 13 
HELX_P HELX_P225 225 GLY J 1423 ? SER J 1430 ? GLY N 1423 SER N 1430 1 ? 8  
HELX_P HELX_P226 226 SER J 1433 ? GLN J 1441 ? SER N 1433 GLN N 1441 1 ? 9  
HELX_P HELX_P227 227 ASN J 1442 ? GLY J 1454 ? ASN N 1442 GLY N 1454 1 ? 13 
HELX_P HELX_P228 228 GLY J 1461 ? GLY J 1469 ? GLY N 1461 GLY N 1469 1 ? 9  
HELX_P HELX_P229 229 ALA J 1474 ? GLY J 1477 ? ALA N 1474 GLY N 1477 5 ? 4  
HELX_P HELX_P230 230 SER J 1478 ? PHE J 1483 ? SER N 1478 PHE N 1483 1 ? 6  
HELX_P HELX_P231 231 GLN J 1489 ? GLU J 1497 ? GLN N 1489 GLU N 1497 1 ? 9  
HELX_P HELX_P232 232 GLY K 5    ? MET K 12   ? GLY O 5    MET O 12   1 ? 8  
HELX_P HELX_P233 233 SER K 15   ? HIS K 33   ? SER O 15   HIS O 33   1 ? 19 
HELX_P HELX_P234 234 ASN K 59   ? THR K 70   ? ASN O 59   THR O 70   1 ? 12 
HELX_P HELX_P235 235 PRO K 81   ? TYR K 93   ? PRO O 81   TYR O 93   1 ? 13 
HELX_P HELX_P236 236 ASP L 99   ? GLN L 110  ? ASP P 79   GLN P 90   1 ? 12 
HELX_P HELX_P237 237 THR L 115  ? GLY L 141  ? THR P 95   GLY P 121  1 ? 27 
HELX_P HELX_P238 238 ASP L 143  ? GLY L 157  ? ASP P 123  GLY P 137  1 ? 15 
HELX_P HELX_P239 239 ASP L 172  ? LYS L 184  ? ASP P 152  LYS P 164  1 ? 13 
HELX_P HELX_P240 240 PRO L 187  ? ASN L 211  ? PRO P 167  ASN P 191  1 ? 25 
HELX_P HELX_P241 241 ASN L 211  ? LYS L 220  ? ASN P 191  LYS P 200  1 ? 10 
HELX_P HELX_P242 242 LYS L 221  ? GLY L 226  ? LYS P 201  GLY P 206  5 ? 6  
HELX_P HELX_P243 243 SER L 228  ? LYS L 246  ? SER P 208  LYS P 226  1 ? 19 
HELX_P HELX_P244 244 LYS L 254  ? ALA L 275  ? LYS P 234  ALA P 255  1 ? 22 
HELX_P HELX_P245 245 PRO L 281  ? GLY L 303  ? PRO P 261  GLY P 283  1 ? 23 
HELX_P HELX_P246 246 THR L 307  ? GLY L 316  ? THR P 287  GLY P 296  1 ? 10 
HELX_P HELX_P247 247 ASP L 320  ? ALA L 331  ? ASP P 300  ALA P 311  1 ? 12 
HELX_P HELX_P248 248 PHE L 348  ? PHE L 352  ? PHE P 328  PHE P 332  5 ? 5  
HELX_P HELX_P249 249 SER L 360  ? SER L 382  ? SER P 340  SER P 362  1 ? 23 
HELX_P HELX_P250 250 SER L 382  ? LYS L 393  ? SER P 362  LYS P 373  1 ? 12 
HELX_P HELX_P251 251 GLU L 405  ? GLY L 411  ? GLU P 385  GLY P 391  1 ? 7  
HELX_P HELX_P252 252 ARG L 416  ? GLU L 432  ? ARG P 396  GLU P 412  1 ? 17 
HELX_P HELX_P253 253 SER L 433  ? LYS L 437  ? SER P 413  LYS P 417  5 ? 5  
HELX_P HELX_P254 254 ARG L 439  ? ASP L 443  ? ARG P 419  ASP P 423  5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? N DG  14   "O3'" ? ? ? 1_555 N BRU 15 P  ? ? G DG  14   G BRU 15   1_555 ? ? ? ? ? ? ?            1.600 ? 
covale2  covale ? ? N BRU 15   "O3'" ? ? ? 1_555 N DC  16 P  ? ? G BRU 15   G DC  16   1_555 ? ? ? ? ? ? ?            1.600 ? 
covale3  covale ? ? P DG  14   "O3'" ? ? ? 1_555 P BRU 15 P  ? ? Q DG  14   Q BRU 15   1_555 ? ? ? ? ? ? ?            1.600 ? 
covale4  covale ? ? P BRU 15   "O3'" ? ? ? 1_555 P DC  16 P  ? ? Q BRU 15   Q DC  16   1_555 ? ? ? ? ? ? ?            1.600 ? 
metalc1  metalc ? ? D CYS 1201 SG    ? ? ? 1_555 Q ZN  .  ZN ? ? D CYS 1201 D ZN  2001 1_555 ? ? ? ? ? ? ?            1.981 ? 
metalc2  metalc ? ? J ASP 739  OD1   ? ? ? 1_555 V MG  .  MG ? ? N ASP 739  N MG  2003 1_555 ? ? ? ? ? ? ?            2.001 ? 
metalc3  metalc ? ? D CYS 76   SG    ? ? ? 1_555 R ZN  .  ZN ? ? D CYS 76   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.077 ? 
metalc4  metalc ? ? D CYS 1204 SG    ? ? ? 1_555 Q ZN  .  ZN ? ? D CYS 1204 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.106 ? 
metalc5  metalc ? ? J CYS 1201 SG    ? ? ? 1_555 T ZN  .  ZN ? ? N CYS 1201 N ZN  2001 1_555 ? ? ? ? ? ? ?            2.116 ? 
metalc6  metalc ? ? D ASP 743  OD1   ? ? ? 1_555 S MG  .  MG ? ? D ASP 743  D MG  2003 1_555 ? ? ? ? ? ? ?            2.162 ? 
metalc7  metalc ? ? J CYS 1194 SG    ? ? ? 1_555 T ZN  .  ZN ? ? N CYS 1194 N ZN  2001 1_555 ? ? ? ? ? ? ?            2.173 ? 
metalc8  metalc ? ? J CYS 1112 SG    ? ? ? 1_555 T ZN  .  ZN ? ? N CYS 1112 N ZN  2001 1_555 ? ? ? ? ? ? ?            2.174 ? 
metalc9  metalc ? ? J ASP 743  OD1   ? ? ? 1_555 V MG  .  MG ? ? N ASP 743  N MG  2003 1_555 ? ? ? ? ? ? ?            2.178 ? 
metalc10 metalc ? ? D ASP 741  OD2   ? ? ? 1_555 S MG  .  MG ? ? D ASP 741  D MG  2003 1_555 ? ? ? ? ? ? ?            2.187 ? 
metalc11 metalc ? ? J CYS 1204 SG    ? ? ? 1_555 T ZN  .  ZN ? ? N CYS 1204 N ZN  2001 1_555 ? ? ? ? ? ? ?            2.210 ? 
metalc12 metalc ? ? J ASP 741  OD2   ? ? ? 1_555 V MG  .  MG ? ? N ASP 741  N MG  2003 1_555 ? ? ? ? ? ? ?            2.217 ? 
metalc13 metalc ? ? J ASP 741  OD1   ? ? ? 1_555 V MG  .  MG ? ? N ASP 741  N MG  2003 1_555 ? ? ? ? ? ? ?            2.240 ? 
metalc14 metalc ? ? J CYS 73   SG    ? ? ? 1_555 U ZN  .  ZN ? ? N CYS 73   N ZN  2002 1_555 ? ? ? ? ? ? ?            2.243 ? 
metalc15 metalc ? ? D ASP 741  OD1   ? ? ? 1_555 S MG  .  MG ? ? D ASP 741  D MG  2003 1_555 ? ? ? ? ? ? ?            2.284 ? 
metalc16 metalc ? ? J CYS 58   SG    ? ? ? 1_555 U ZN  .  ZN ? ? N CYS 58   N ZN  2002 1_555 ? ? ? ? ? ? ?            2.318 ? 
metalc17 metalc ? ? D CYS 1112 SG    ? ? ? 1_555 Q ZN  .  ZN ? ? D CYS 1112 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.348 ? 
metalc18 metalc ? ? J CYS 60   SG    ? ? ? 1_555 U ZN  .  ZN ? ? N CYS 60   N ZN  2002 1_555 ? ? ? ? ? ? ?            2.363 ? 
metalc19 metalc ? ? J CYS 76   SG    ? ? ? 1_555 U ZN  .  ZN ? ? N CYS 76   N ZN  2002 1_555 ? ? ? ? ? ? ?            2.365 ? 
metalc20 metalc ? ? D ASP 739  OD1   ? ? ? 1_555 S MG  .  MG ? ? D ASP 739  D MG  2003 1_555 ? ? ? ? ? ? ?            2.366 ? 
metalc21 metalc ? ? D CYS 73   SG    ? ? ? 1_555 R ZN  .  ZN ? ? D CYS 73   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.387 ? 
metalc22 metalc ? ? D CYS 1194 SG    ? ? ? 1_555 Q ZN  .  ZN ? ? D CYS 1194 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.403 ? 
metalc23 metalc ? ? D CYS 58   SG    ? ? ? 1_555 R ZN  .  ZN ? ? D CYS 58   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.439 ? 
metalc24 metalc ? ? D CYS 60   SG    ? ? ? 1_555 R ZN  .  ZN ? ? D CYS 60   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.449 ? 
hydrog1  hydrog ? ? M DT  15   N3    ? ? ? 1_555 N DA  13 N1 ? ? H DT  15   G DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? M DT  15   O4    ? ? ? 1_555 N DA  13 N6 ? ? H DT  15   G DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? M DC  16   N3    ? ? ? 1_555 N DG  12 N1 ? ? H DC  16   G DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? M DC  16   N4    ? ? ? 1_555 N DG  12 O6 ? ? H DC  16   G DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? M DC  16   O2    ? ? ? 1_555 N DG  12 N2 ? ? H DC  16   G DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? M DA  17   N1    ? ? ? 1_555 N DT  11 N3 ? ? H DA  17   G DT  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? M DA  17   N6    ? ? ? 1_555 N DT  11 O4 ? ? H DA  17   G DT  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? M DC  18   O2    ? ? ? 1_555 N DG  10 N1 ? ? H DC  18   G DG  10   1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog9  hydrog ? ? M DG  19   N1    ? ? ? 1_555 N DC  9  N3 ? ? H DG  19   G DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? M DG  19   N2    ? ? ? 1_555 N DC  9  O2 ? ? H DG  19   G DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? M DG  19   O6    ? ? ? 1_555 N DC  9  N4 ? ? H DG  19   G DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? M DG  20   N1    ? ? ? 1_555 N DC  8  N3 ? ? H DG  20   G DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? M DG  20   N2    ? ? ? 1_555 N DC  8  O2 ? ? H DG  20   G DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? M DG  20   O6    ? ? ? 1_555 N DC  8  N4 ? ? H DG  20   G DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? M DA  21   N1    ? ? ? 1_555 N DT  7  N3 ? ? H DA  21   G DT  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? M DA  21   N6    ? ? ? 1_555 N DT  7  O4 ? ? H DA  21   G DT  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? M DT  22   N3    ? ? ? 1_555 N DA  6  N1 ? ? H DT  22   G DA  6    1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? 
hydrog18 hydrog ? ? M DG  23   N1    ? ? ? 1_555 N DC  5  N3 ? ? H DG  23   G DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? M DG  23   N2    ? ? ? 1_555 N DC  5  O2 ? ? H DG  23   G DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? M DG  23   O6    ? ? ? 1_555 N DC  5  N4 ? ? H DG  23   G DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? M DC  24   N3    ? ? ? 1_555 N DG  4  N1 ? ? H DC  24   G DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? M DC  24   N4    ? ? ? 1_555 N DG  4  O6 ? ? H DC  24   G DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? M DC  24   O2    ? ? ? 1_555 N DG  4  N2 ? ? H DC  24   G DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? O DT  15   N3    ? ? ? 1_555 P DA  13 N1 ? ? R DT  15   Q DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? O DT  15   O4    ? ? ? 1_555 P DA  13 N6 ? ? R DT  15   Q DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? O DC  16   O2    ? ? ? 1_555 P DG  12 N1 ? ? R DC  16   Q DG  12   1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog27 hydrog ? ? O DA  17   N1    ? ? ? 1_555 P DT  11 N3 ? ? R DA  17   Q DT  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? O DA  17   N6    ? ? ? 1_555 P DT  11 O4 ? ? R DA  17   Q DT  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? O DC  18   N3    ? ? ? 1_555 P DG  10 N1 ? ? R DC  18   Q DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? O DC  18   N4    ? ? ? 1_555 P DG  10 O6 ? ? R DC  18   Q DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? O DC  18   O2    ? ? ? 1_555 P DG  10 N2 ? ? R DC  18   Q DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? O DG  19   N1    ? ? ? 1_555 P DC  9  N3 ? ? R DG  19   Q DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? O DG  19   N2    ? ? ? 1_555 P DC  9  O2 ? ? R DG  19   Q DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? O DG  19   O6    ? ? ? 1_555 P DC  9  N4 ? ? R DG  19   Q DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? O DG  20   N1    ? ? ? 1_555 P DC  8  N3 ? ? R DG  20   Q DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? O DG  20   N2    ? ? ? 1_555 P DC  8  O2 ? ? R DG  20   Q DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? O DG  20   O6    ? ? ? 1_555 P DC  8  N4 ? ? R DG  20   Q DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? O DA  21   N1    ? ? ? 1_555 P DT  7  N3 ? ? R DA  21   Q DT  7    1_555 ? ? ? ? ? ? 'DA-DT PAIR' ?     ? 
hydrog39 hydrog ? ? O DT  22   N3    ? ? ? 1_555 P DA  6  N1 ? ? R DT  22   Q DA  6    1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? 
hydrog40 hydrog ? ? O DG  23   N1    ? ? ? 1_555 P DC  5  N3 ? ? R DG  23   Q DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? O DG  23   N2    ? ? ? 1_555 P DC  5  O2 ? ? R DG  23   Q DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? O DG  23   O6    ? ? ? 1_555 P DC  5  N4 ? ? R DG  23   Q DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? O DC  24   N3    ? ? ? 1_555 P DG  4  N1 ? ? R DC  24   Q DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? O DC  24   N4    ? ? ? 1_555 P DG  4  O6 ? ? R DC  24   Q DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? O DC  24   O2    ? ? ? 1_555 P DG  4  N2 ? ? R DC  24   Q DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  GLU 26  A . ? GLU 26  A PRO 27  A ? PRO 27  A 1 -7.11  
2  GLU 26  B . ? GLU 26  B PRO 27  B ? PRO 27  B 1 -6.17  
3  PHE 52  C . ? PHE 52  C PRO 53  C ? PRO 53  C 1 6.03   
4  GLU 177 C . ? GLU 177 C PRO 178 C ? PRO 178 C 1 -9.31  
5  ASP 295 C . ? ASP 295 C GLY 296 C ? GLY 296 C 1 -7.54  
6  ALA 705 D . ? ALA 705 D PRO 706 D ? PRO 706 D 1 10.87  
7  GLU 26  G . ? GLU 26  K PRO 27  G ? PRO 27  K 1 -5.06  
8  GLU 26  H . ? GLU 26  L PRO 27  H ? PRO 27  L 1 -10.06 
9  PHE 52  I . ? PHE 52  M PRO 53  I ? PRO 53  M 1 5.23   
10 GLU 177 I . ? GLU 177 M PRO 178 I ? PRO 178 M 1 -8.07  
11 ALA 705 J . ? ALA 705 N PRO 706 J ? PRO 706 N 1 7.37   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 4 ? 
B  ? 4 ? 
C  ? 2 ? 
D  ? 2 ? 
E  ? 2 ? 
F  ? 4 ? 
G  ? 4 ? 
H  ? 2 ? 
I  ? 2 ? 
J  ? 2 ? 
K  ? 3 ? 
L  ? 3 ? 
M  ? 3 ? 
N  ? 4 ? 
O  ? 5 ? 
P  ? 2 ? 
Q  ? 3 ? 
R  ? 6 ? 
S  ? 2 ? 
T  ? 3 ? 
U  ? 4 ? 
V  ? 2 ? 
W  ? 2 ? 
X  ? 8 ? 
Y  ? 7 ? 
Z  ? 2 ? 
AA ? 8 ? 
AB ? 2 ? 
AC ? 3 ? 
AD ? 3 ? 
AE ? 3 ? 
AF ? 4 ? 
AG ? 5 ? 
AH ? 3 ? 
AI ? 3 ? 
AJ ? 4 ? 
AK ? 2 ? 
AL ? 4 ? 
AM ? 2 ? 
AN ? 3 ? 
AO ? 2 ? 
AP ? 2 ? 
AQ ? 3 ? 
AR ? 2 ? 
AS ? 2 ? 
AT ? 2 ? 
AU ? 2 ? 
AV ? 4 ? 
AW ? 3 ? 
AX ? 2 ? 
AY ? 2 ? 
AZ ? 4 ? 
BA ? 4 ? 
BB ? 2 ? 
BC ? 2 ? 
BD ? 2 ? 
BE ? 4 ? 
BF ? 4 ? 
BG ? 2 ? 
BH ? 2 ? 
BI ? 2 ? 
BJ ? 3 ? 
BK ? 3 ? 
BL ? 3 ? 
BM ? 4 ? 
BN ? 5 ? 
BO ? 2 ? 
BP ? 3 ? 
BQ ? 6 ? 
BR ? 2 ? 
BS ? 3 ? 
BT ? 4 ? 
BU ? 8 ? 
BV ? 4 ? 
BW ? 2 ? 
BX ? 2 ? 
BY ? 8 ? 
BZ ? 2 ? 
CA ? 4 ? 
CB ? 3 ? 
CC ? 3 ? 
CD ? 4 ? 
CE ? 5 ? 
CF ? 3 ? 
CG ? 3 ? 
CH ? 4 ? 
CI ? 2 ? 
CJ ? 4 ? 
CK ? 2 ? 
CL ? 3 ? 
CM ? 2 ? 
CN ? 3 ? 
CO ? 2 ? 
CP ? 2 ? 
CQ ? 2 ? 
CR ? 2 ? 
CS ? 2 ? 
CT ? 4 ? 
CU ? 3 ? 
CV ? 2 ? 
CW ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
C  1 2 ? anti-parallel 
D  1 2 ? anti-parallel 
E  1 2 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? anti-parallel 
H  1 2 ? anti-parallel 
I  1 2 ? anti-parallel 
J  1 2 ? anti-parallel 
K  1 2 ? parallel      
K  2 3 ? parallel      
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? parallel      
N  3 4 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
O  3 4 ? anti-parallel 
O  4 5 ? anti-parallel 
P  1 2 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
R  3 4 ? parallel      
R  4 5 ? anti-parallel 
R  5 6 ? anti-parallel 
S  1 2 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
U  3 4 ? anti-parallel 
V  1 2 ? anti-parallel 
W  1 2 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
X  4 5 ? parallel      
X  5 6 ? anti-parallel 
X  6 7 ? parallel      
X  7 8 ? anti-parallel 
Y  1 2 ? anti-parallel 
Y  2 3 ? anti-parallel 
Y  3 4 ? anti-parallel 
Y  4 5 ? anti-parallel 
Y  5 6 ? anti-parallel 
Y  6 7 ? anti-parallel 
Z  1 2 ? anti-parallel 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AA 5 6 ? parallel      
AA 6 7 ? anti-parallel 
AA 7 8 ? parallel      
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AD 1 2 ? parallel      
AD 2 3 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AG 3 4 ? anti-parallel 
AG 4 5 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AJ 3 4 ? anti-parallel 
AK 1 2 ? anti-parallel 
AL 1 2 ? anti-parallel 
AL 2 3 ? anti-parallel 
AL 3 4 ? anti-parallel 
AM 1 2 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? parallel      
AO 1 2 ? anti-parallel 
AP 1 2 ? parallel      
AQ 1 2 ? parallel      
AQ 2 3 ? anti-parallel 
AR 1 2 ? parallel      
AS 1 2 ? anti-parallel 
AT 1 2 ? anti-parallel 
AU 1 2 ? anti-parallel 
AV 1 2 ? anti-parallel 
AV 2 3 ? anti-parallel 
AV 3 4 ? anti-parallel 
AW 1 2 ? anti-parallel 
AW 2 3 ? anti-parallel 
AX 1 2 ? anti-parallel 
AY 1 2 ? anti-parallel 
AZ 1 2 ? anti-parallel 
AZ 2 3 ? anti-parallel 
AZ 3 4 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BB 1 2 ? anti-parallel 
BC 1 2 ? anti-parallel 
BD 1 2 ? anti-parallel 
BE 1 2 ? anti-parallel 
BE 2 3 ? anti-parallel 
BE 3 4 ? anti-parallel 
BF 1 2 ? anti-parallel 
BF 2 3 ? anti-parallel 
BF 3 4 ? anti-parallel 
BG 1 2 ? anti-parallel 
BH 1 2 ? anti-parallel 
BI 1 2 ? anti-parallel 
BJ 1 2 ? parallel      
BJ 2 3 ? parallel      
BK 1 2 ? anti-parallel 
BK 2 3 ? anti-parallel 
BL 1 2 ? anti-parallel 
BL 2 3 ? anti-parallel 
BM 1 2 ? anti-parallel 
BM 2 3 ? parallel      
BM 3 4 ? anti-parallel 
BN 1 2 ? anti-parallel 
BN 2 3 ? anti-parallel 
BN 3 4 ? anti-parallel 
BN 4 5 ? anti-parallel 
BO 1 2 ? anti-parallel 
BP 1 2 ? anti-parallel 
BP 2 3 ? anti-parallel 
BQ 1 2 ? anti-parallel 
BQ 2 3 ? anti-parallel 
BQ 3 4 ? parallel      
BQ 4 5 ? anti-parallel 
BQ 5 6 ? anti-parallel 
BR 1 2 ? anti-parallel 
BS 1 2 ? anti-parallel 
BS 2 3 ? anti-parallel 
BT 1 2 ? anti-parallel 
BT 2 3 ? anti-parallel 
BT 3 4 ? anti-parallel 
BU 1 2 ? anti-parallel 
BU 2 3 ? anti-parallel 
BU 3 4 ? anti-parallel 
BU 4 5 ? parallel      
BU 5 6 ? anti-parallel 
BU 6 7 ? parallel      
BU 7 8 ? anti-parallel 
BV 1 2 ? anti-parallel 
BV 2 3 ? anti-parallel 
BV 3 4 ? anti-parallel 
BW 1 2 ? anti-parallel 
BX 1 2 ? anti-parallel 
BY 1 2 ? anti-parallel 
BY 2 3 ? anti-parallel 
BY 3 4 ? anti-parallel 
BY 4 5 ? anti-parallel 
BY 5 6 ? parallel      
BY 6 7 ? anti-parallel 
BY 7 8 ? parallel      
BZ 1 2 ? anti-parallel 
CA 1 2 ? anti-parallel 
CA 2 3 ? anti-parallel 
CA 3 4 ? anti-parallel 
CB 1 2 ? parallel      
CB 2 3 ? anti-parallel 
CC 1 2 ? anti-parallel 
CC 2 3 ? anti-parallel 
CD 1 2 ? anti-parallel 
CD 2 3 ? anti-parallel 
CD 3 4 ? anti-parallel 
CE 1 2 ? anti-parallel 
CE 2 3 ? anti-parallel 
CE 3 4 ? anti-parallel 
CE 4 5 ? anti-parallel 
CF 1 2 ? anti-parallel 
CF 2 3 ? anti-parallel 
CG 1 2 ? anti-parallel 
CG 2 3 ? anti-parallel 
CH 1 2 ? anti-parallel 
CH 2 3 ? anti-parallel 
CH 3 4 ? anti-parallel 
CI 1 2 ? anti-parallel 
CJ 1 2 ? anti-parallel 
CJ 2 3 ? anti-parallel 
CJ 3 4 ? anti-parallel 
CK 1 2 ? anti-parallel 
CL 1 2 ? anti-parallel 
CL 2 3 ? parallel      
CM 1 2 ? parallel      
CN 1 2 ? parallel      
CN 2 3 ? anti-parallel 
CO 1 2 ? parallel      
CP 1 2 ? anti-parallel 
CQ 1 2 ? anti-parallel 
CR 1 2 ? anti-parallel 
CS 1 2 ? anti-parallel 
CT 1 2 ? anti-parallel 
CT 2 3 ? anti-parallel 
CT 3 4 ? anti-parallel 
CU 1 2 ? anti-parallel 
CU 2 3 ? anti-parallel 
CV 1 2 ? anti-parallel 
CW 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 VAL A 10   ? GLN A 16   ? VAL A 10   GLN A 16   
A  2 TYR A 20   ? LEU A 28   ? TYR A 20   LEU A 28   
A  3 ASP A 193  ? THR A 201  ? ASP A 193  THR A 201  
A  4 VAL A 174  ? ASP A 183  ? VAL A 174  ASP A 183  
B  1 THR A 96   ? GLU A 104  ? THR A 96   GLU A 104  
B  2 ARG A 137  ? VAL A 148  ? ARG A 137  VAL A 148  
B  3 PRO A 49   ? ILE A 58   ? PRO A 49   ILE A 58   
B  4 ILE A 165  ? PRO A 166  ? ILE A 165  PRO A 166  
C  1 VAL A 87   ? PHE A 89   ? VAL A 87   PHE A 89   
C  2 VAL A 120  ? ILE A 122  ? VAL A 120  ILE A 122  
D  1 GLU A 108  ? LYS A 110  ? GLU A 108  LYS A 110  
D  2 HIS A 128  ? THR A 131  ? HIS A 128  THR A 131  
E  1 TYR A 150  ? VAL A 151  ? TYR A 150  VAL A 151  
E  2 ALA A 169  ? VAL A 170  ? ALA A 169  VAL A 170  
F  1 VAL B 10   ? GLN B 16   ? VAL B 10   GLN B 16   
F  2 TYR B 20   ? LEU B 28   ? TYR B 20   LEU B 28   
F  3 ARG B 189  ? THR B 201  ? ARG B 189  THR B 201  
F  4 VAL B 174  ? LEU B 186  ? VAL B 174  LEU B 186  
G  1 THR B 96   ? GLU B 104  ? THR B 96   GLU B 104  
G  2 ARG B 137  ? VAL B 148  ? ARG B 137  VAL B 148  
G  3 PRO B 49   ? ILE B 58   ? PRO B 49   ILE B 58   
G  4 ILE B 165  ? PRO B 166  ? ILE B 165  PRO B 166  
H  1 VAL B 87   ? PHE B 89   ? VAL B 87   PHE B 89   
H  2 VAL B 120  ? ILE B 122  ? VAL B 120  ILE B 122  
I  1 GLU B 108  ? LYS B 110  ? GLU B 108  LYS B 110  
I  2 HIS B 128  ? THR B 131  ? HIS B 128  THR B 131  
J  1 TYR B 150  ? VAL B 151  ? TYR B 150  VAL B 151  
J  2 ALA B 169  ? VAL B 170  ? ALA B 169  VAL B 170  
K  1 GLU C 2    ? ARG C 5    ? GLU C 2    ARG C 5    
K  2 GLN C 899  ? ILE C 902  ? GLN C 899  ILE C 902  
K  3 VAL C 579  ? MET C 580  ? VAL C 579  MET C 580  
L  1 VAL C 65   ? LEU C 73   ? VAL C 65   LEU C 73   
L  2 GLN C 91   ? ILE C 101  ? GLN C 91   ILE C 101  
L  3 ILE C 108  ? PRO C 119  ? ILE C 108  PRO C 119  
M  1 PHE C 127  ? ILE C 128  ? PHE C 127  ILE C 128  
M  2 ASP C 133  ? ILE C 136  ? ASP C 133  ILE C 136  
M  3 SER C 392  ? PHE C 394  ? SER C 392  PHE C 394  
N  1 ARG C 331  ? ARG C 334  ? ARG C 331  ARG C 334  
N  2 SER C 138  ? ARG C 142  ? SER C 138  ARG C 142  
N  3 ARG C 409  ? SER C 411  ? ARG C 409  SER C 411  
N  4 ILE C 452  ? SER C 454  ? ILE C 452  SER C 454  
O  1 GLY C 145  ? PRO C 150  ? GLY C 145  PRO C 150  
O  2 TYR C 158  ? ILE C 163  ? TYR C 158  ILE C 163  
O  3 ILE C 172  ? GLU C 175  ? ILE C 172  GLU C 175  
O  4 SER C 183  ? VAL C 186  ? SER C 183  VAL C 186  
O  5 ARG C 189  ? PRO C 192  ? ARG C 189  PRO C 192  
P  1 ALA C 291  ? ARG C 292  ? ALA C 291  ARG C 292  
P  2 LYS C 299  ? ASP C 300  ? LYS C 299  ASP C 300  
Q  1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
Q  2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
Q  3 VAL C 478  ? MET C 486  ? VAL C 478  MET C 486  
R  1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
R  2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
R  3 PHE C 531  ? ASP C 533  ? PHE C 531  ASP C 533  
R  4 THR C 495  ? ALA C 497  ? THR C 495  ALA C 497  
R  5 VAL C 513  ? ARG C 517  ? VAL C 513  ARG C 517  
R  6 GLU C 520  ? VAL C 524  ? GLU C 520  VAL C 524  
S  1 LEU C 503  ? GLU C 504  ? LEU C 503  GLU C 504  
S  2 ARG C 507  ? ILE C 508  ? ARG C 507  ILE C 508  
T  1 LEU C 595  ? TYR C 596  ? LEU C 595  TYR C 596  
T  2 LEU C 654  ? ASP C 657  ? LEU C 654  ASP C 657  
T  3 ARG C 640  ? PRO C 641  ? ARG C 640  PRO C 641  
U  1 LEU C 620  ? PRO C 624  ? LEU C 620  PRO C 624  
U  2 ARG C 610  ? TYR C 615  ? ARG C 610  TYR C 615  
U  3 GLY C 601  ? VAL C 606  ? GLY C 601  VAL C 606  
U  4 ARG C 648  ? VAL C 649  ? ARG C 648  VAL C 649  
V  1 TYR C 629  ? ARG C 630  ? TYR C 629  ARG C 630  
V  2 ALA C 636  ? LEU C 637  ? ALA C 636  LEU C 637  
W  1 SER C 661  ? GLU C 662  ? SER C 661  GLU C 662  
W  2 PHE C 665  ? LEU C 666  ? PHE C 665  LEU C 666  
X  1 LYS C 971  ? VAL C 972  ? LYS C 971  VAL C 972  
X  2 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
X  3 LYS C 838  ? ASN C 841  ? LYS C 838  ASN C 841  
X  4 LYS C 846  ? LEU C 853  ? LYS C 846  LEU C 853  
X  5 ILE C 688  ? SER C 691  ? ILE C 688  SER C 691  
X  6 VAL C 869  ? ILE C 870  ? VAL C 869  ILE C 870  
X  7 GLN C 670  ? ALA C 675  ? GLN C 670  ALA C 675  
X  8 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
Y  1 GLU C 748  ? VAL C 749  ? GLU C 748  VAL C 749  
Y  2 GLY C 798  ? ARG C 807  ? GLY C 798  ARG C 807  
Y  3 VAL C 819  ? ARG C 831  ? VAL C 819  ARG C 831  
Y  4 SER C 702  ? THR C 715  ? SER C 702  THR C 715  
Y  5 GLY C 718  ? ILE C 722  ? GLY C 718  ILE C 722  
Y  6 ARG C 758  ? PHE C 761  ? ARG C 758  PHE C 761  
Y  7 VAL C 785  ? ASP C 787  ? VAL C 785  ASP C 787  
Z  1 ILE C 754  ? VAL C 756  ? ILE C 754  VAL C 756  
Z  2 LEU C 790  ? ARG C 791  ? LEU C 790  ARG C 791  
AA 1 HIS C 1006 ? ARG C 1008 ? HIS C 1006 ARG C 1008 
AA 2 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AA 3 GLN D 744  ? HIS D 748  ? GLN D 744  HIS D 748  
AA 4 VAL D 700  ? ASN D 703  ? VAL D 700  ASN D 703  
AA 5 ILE D 713  ? VAL D 721  ? ILE D 713  VAL D 721  
AA 6 GLN D 641  ? PRO D 645  ? GLN D 641  PRO D 645  
AA 7 ILE D 726  ? LEU D 728  ? ILE D 726  LEU D 728  
AA 8 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AB 1 ARG C 1031 ? PHE C 1032 ? ARG C 1031 PHE C 1032 
AB 2 LYS D 621  ? ARG D 622  ? LYS D 621  ARG D 622  
AC 1 LEU C 1097 ? LEU C 1102 ? LEU C 1097 LEU C 1102 
AC 2 LYS D 7    ? LEU D 12   ? LYS D 7    LEU D 12   
AC 3 LYS D 1456 ? GLU D 1458 ? LYS D 1456 GLU D 1458 
AD 1 SER D 22   ? GLU D 25   ? SER D 22   GLU D 25   
AD 2 MET D 90   ? ALA D 100  ? MET D 90   ALA D 100  
AD 3 ILE D 513  ? VAL D 519  ? ILE D 513  VAL D 519  
AE 1 LEU D 152  ? LEU D 153  ? LEU D 152  LEU D 153  
AE 2 TYR D 132  ? ASP D 136  ? TYR D 132  ASP D 136  
AE 3 ASP D 453  ? ARG D 455  ? ASP D 453  ARG D 455  
AF 1 GLN D 166  ? PRO D 170  ? GLN D 166  PRO D 170  
AF 2 PRO D 390  ? VAL D 396  ? PRO D 390  VAL D 396  
AF 3 GLY D 201  ? PRO D 208  ? GLY D 201  PRO D 208  
AF 4 GLU D 184  ? VAL D 185  ? GLU D 184  VAL D 185  
AG 1 VAL D 317  ? GLU D 327  ? VAL D 317  GLU D 327  
AG 2 THR D 330  ? ARG D 346  ? THR D 330  ARG D 346  
AG 3 ARG D 210  ? PRO D 226  ? ARG D 210  PRO D 226  
AG 4 GLY D 383  ? VAL D 385  ? GLY D 383  VAL D 385  
AG 5 ALA D 359  ? VAL D 361  ? ALA D 359  VAL D 361  
AH 1 ILE D 241  ? GLU D 244  ? ILE D 241  GLU D 244  
AH 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AH 3 TYR D 249  ? ARG D 252  ? TYR D 249  ARG D 252  
AI 1 ILE D 241  ? GLU D 244  ? ILE D 241  GLU D 244  
AI 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AI 3 VAL D 286  ? PRO D 290  ? VAL D 286  PRO D 290  
AJ 1 PRO D 278  ? LEU D 284  ? PRO D 278  LEU D 284  
AJ 2 ALA D 268  ? ARG D 273  ? ALA D 268  ARG D 273  
AJ 3 GLY D 257  ? GLU D 263  ? GLY D 257  GLU D 263  
AJ 4 ILE D 297  ? VAL D 298  ? ILE D 297  VAL D 298  
AK 1 LYS D 366  ? VAL D 368  ? LYS D 366  VAL D 368  
AK 2 VAL D 377  ? ILE D 378  ? VAL D 377  ILE D 378  
AL 1 ALA D 398  ? PRO D 402  ? ALA D 398  PRO D 402  
AL 2 VAL D 443  ? GLU D 448  ? VAL D 443  GLU D 448  
AL 3 GLY D 433  ? ASP D 438  ? GLY D 433  ASP D 438  
AL 4 ARG D 414  ? VAL D 415  ? ARG D 414  VAL D 415  
AM 1 VAL D 420  ? ALA D 422  ? VAL D 420  ALA D 422  
AM 2 VAL D 427  ? LYS D 428  ? VAL D 427  LYS D 428  
AN 1 MET D 527  ? GLN D 529  ? MET D 527  GLN D 529  
AN 2 PHE D 535  ? THR D 537  ? PHE D 535  THR D 537  
AN 3 VAL F 335  ? SER F 336  ? VAL F 315  SER F 316  
AO 1 VAL D 591  ? ASN D 593  ? VAL D 591  ASN D 593  
AO 2 SER D 596  ? PRO D 599  ? SER D 596  PRO D 599  
AP 1 GLU D 805  ? PHE D 806  ? GLU D 805  PHE D 806  
AP 2 LYS D 828  ? VAL D 829  ? LYS D 828  VAL D 829  
AQ 1 VAL D 842  ? PHE D 843  ? VAL D 842  PHE D 843  
AQ 2 VAL D 864  ? TYR D 868  ? VAL D 864  TYR D 868  
AQ 3 LYS D 871  ? THR D 875  ? LYS D 871  THR D 875  
AR 1 VAL D 1106 ? GLU D 1109 ? VAL D 1106 GLU D 1109 
AR 2 GLY D 1199 ? CYS D 1201 ? GLY D 1199 CYS D 1201 
AS 1 ILE D 1118 ? PRO D 1121 ? ILE D 1118 PRO D 1121 
AS 2 GLU D 1185 ? VAL D 1188 ? GLU D 1185 VAL D 1188 
AT 1 PHE D 1123 ? PRO D 1125 ? PHE D 1123 PRO D 1125 
AT 2 LEU D 1132 ? LEU D 1134 ? LEU D 1132 LEU D 1134 
AU 1 VAL D 1153 ? VAL D 1155 ? VAL D 1153 VAL D 1155 
AU 2 VAL D 1158 ? LEU D 1160 ? VAL D 1158 LEU D 1160 
AV 1 SER D 1300 ? LEU D 1305 ? SER D 1300 LEU D 1305 
AV 2 LEU D 1290 ? GLU D 1295 ? LEU D 1290 GLU D 1295 
AV 3 GLY D 1279 ? GLU D 1285 ? GLY D 1279 GLU D 1285 
AV 4 TYR D 1318 ? VAL D 1319 ? TYR D 1318 VAL D 1319 
AW 1 VAL D 1394 ? GLU D 1396 ? VAL D 1394 GLU D 1396 
AW 2 TYR D 1378 ? ASP D 1383 ? TYR D 1378 ASP D 1383 
AW 3 ALA D 1416 ? LEU D 1420 ? ALA D 1416 LEU D 1420 
AX 1 GLN D 1485 ? ASP D 1488 ? GLN D 1485 ASP D 1488 
AX 2 LEU E 73   ? GLY E 76   ? LEU E 73   GLY E 76   
AY 1 LYS E 47   ? GLN E 49   ? LYS E 47   GLN E 49   
AY 2 LEU E 54   ? ASP E 56   ? LEU E 54   ASP E 56   
AZ 1 VAL G 10   ? GLN G 16   ? VAL K 10   GLN K 16   
AZ 2 TYR G 20   ? LEU G 28   ? TYR K 20   LEU K 28   
AZ 3 ASP G 193  ? THR G 201  ? ASP K 193  THR K 201  
AZ 4 VAL G 174  ? ASP G 183  ? VAL K 174  ASP K 183  
BA 1 THR G 96   ? GLU G 104  ? THR K 96   GLU K 104  
BA 2 ARG G 137  ? VAL G 148  ? ARG K 137  VAL K 148  
BA 3 PRO G 49   ? ILE G 58   ? PRO K 49   ILE K 58   
BA 4 ILE G 165  ? PRO G 166  ? ILE K 165  PRO K 166  
BB 1 VAL G 87   ? PHE G 89   ? VAL K 87   PHE K 89   
BB 2 VAL G 120  ? ILE G 122  ? VAL K 120  ILE K 122  
BC 1 GLU G 108  ? LYS G 110  ? GLU K 108  LYS K 110  
BC 2 HIS G 128  ? THR G 131  ? HIS K 128  THR K 131  
BD 1 TYR G 150  ? VAL G 151  ? TYR K 150  VAL K 151  
BD 2 ALA G 169  ? VAL G 170  ? ALA K 169  VAL K 170  
BE 1 VAL H 10   ? GLN H 16   ? VAL L 10   GLN L 16   
BE 2 TYR H 20   ? LEU H 28   ? TYR L 20   LEU L 28   
BE 3 ARG H 189  ? THR H 201  ? ARG L 189  THR L 201  
BE 4 VAL H 174  ? LEU H 186  ? VAL L 174  LEU L 186  
BF 1 THR H 96   ? GLU H 104  ? THR L 96   GLU L 104  
BF 2 ARG H 137  ? VAL H 148  ? ARG L 137  VAL L 148  
BF 3 PRO H 49   ? ILE H 58   ? PRO L 49   ILE L 58   
BF 4 ILE H 165  ? PRO H 166  ? ILE L 165  PRO L 166  
BG 1 VAL H 87   ? PHE H 89   ? VAL L 87   PHE L 89   
BG 2 VAL H 120  ? ILE H 122  ? VAL L 120  ILE L 122  
BH 1 LYS H 107  ? LYS H 110  ? LYS L 107  LYS L 110  
BH 2 HIS H 128  ? LEU H 132  ? HIS L 128  LEU L 132  
BI 1 TYR H 150  ? VAL H 151  ? TYR L 150  VAL L 151  
BI 2 ALA H 169  ? VAL H 170  ? ALA L 169  VAL L 170  
BJ 1 GLU I 2    ? ARG I 5    ? GLU M 2    ARG M 5    
BJ 2 GLN I 899  ? ILE I 902  ? GLN M 899  ILE M 902  
BJ 3 VAL I 579  ? MET I 580  ? VAL M 579  MET M 580  
BK 1 VAL I 65   ? LEU I 73   ? VAL M 65   LEU M 73   
BK 2 GLN I 91   ? ILE I 101  ? GLN M 91   ILE M 101  
BK 3 ILE I 108  ? PRO I 119  ? ILE M 108  PRO M 119  
BL 1 PHE I 127  ? ILE I 128  ? PHE M 127  ILE M 128  
BL 2 ASP I 133  ? ILE I 136  ? ASP M 133  ILE M 136  
BL 3 SER I 392  ? PHE I 394  ? SER M 392  PHE M 394  
BM 1 ARG I 331  ? ARG I 334  ? ARG M 331  ARG M 334  
BM 2 SER I 138  ? ARG I 142  ? SER M 138  ARG M 142  
BM 3 ARG I 409  ? SER I 411  ? ARG M 409  SER M 411  
BM 4 ILE I 452  ? SER I 454  ? ILE M 452  SER M 454  
BN 1 GLY I 145  ? PRO I 150  ? GLY M 145  PRO M 150  
BN 2 TYR I 158  ? ILE I 163  ? TYR M 158  ILE M 163  
BN 3 ILE I 172  ? GLU I 175  ? ILE M 172  GLU M 175  
BN 4 SER I 183  ? VAL I 186  ? SER M 183  VAL M 186  
BN 5 ARG I 189  ? PRO I 192  ? ARG M 189  PRO M 192  
BO 1 ALA I 291  ? ARG I 292  ? ALA M 291  ARG M 292  
BO 2 LYS I 299  ? ASP I 300  ? LYS M 299  ASP M 300  
BP 1 ARG I 460  ? VAL I 461  ? ARG M 460  VAL M 461  
BP 2 ILE I 467  ? VAL I 475  ? ILE M 467  VAL M 475  
BP 3 VAL I 478  ? THR I 487  ? VAL M 478  THR M 487  
BQ 1 ARG I 460  ? VAL I 461  ? ARG M 460  VAL M 461  
BQ 2 ILE I 467  ? VAL I 475  ? ILE M 467  VAL M 475  
BQ 3 PHE I 531  ? ASP I 533  ? PHE M 531  ASP M 533  
BQ 4 THR I 495  ? ALA I 497  ? THR M 495  ALA M 497  
BQ 5 VAL I 513  ? ARG I 517  ? VAL M 513  ARG M 517  
BQ 6 GLU I 520  ? VAL I 524  ? GLU M 520  VAL M 524  
BR 1 LEU I 503  ? GLU I 504  ? LEU M 503  GLU M 504  
BR 2 ARG I 507  ? ILE I 508  ? ARG M 507  ILE M 508  
BS 1 LEU I 595  ? TYR I 596  ? LEU M 595  TYR M 596  
BS 2 LEU I 654  ? ASP I 657  ? LEU M 654  ASP M 657  
BS 3 ARG I 640  ? PRO I 641  ? ARG M 640  PRO M 641  
BT 1 LEU I 620  ? PRO I 624  ? LEU M 620  PRO M 624  
BT 2 ARG I 610  ? TYR I 615  ? ARG M 610  TYR M 615  
BT 3 GLY I 601  ? VAL I 606  ? GLY M 601  VAL M 606  
BT 4 ARG I 648  ? VAL I 649  ? ARG M 648  VAL M 649  
BU 1 LYS I 971  ? VAL I 972  ? LYS M 971  VAL M 972  
BU 2 ILE I 987  ? LYS I 996  ? ILE M 987  LYS M 996  
BU 3 LYS I 838  ? ASN I 841  ? LYS M 838  ASN M 841  
BU 4 LYS I 846  ? LEU I 853  ? LYS M 846  LEU M 853  
BU 5 ILE I 688  ? SER I 691  ? ILE M 688  SER M 691  
BU 6 VAL I 869  ? ILE I 870  ? VAL M 869  ILE M 870  
BU 7 GLN I 670  ? ILE I 676  ? GLN M 670  ILE M 676  
BU 8 ILE I 987  ? LYS I 996  ? ILE M 987  LYS M 996  
BV 1 SER I 702  ? ARG I 713  ? SER M 702  ARG M 713  
BV 2 VAL I 819  ? ARG I 831  ? VAL M 819  ARG M 831  
BV 3 GLY I 798  ? LEU I 806  ? GLY M 798  LEU M 806  
BV 4 GLU I 748  ? VAL I 749  ? GLU M 748  VAL M 749  
BW 1 ILE I 754  ? VAL I 756  ? ILE M 754  VAL M 756  
BW 2 LEU I 790  ? ARG I 791  ? LEU M 790  ARG M 791  
BX 1 THR I 759  ? PHE I 761  ? THR M 759  PHE M 761  
BX 2 VAL I 785  ? ASP I 787  ? VAL M 785  ASP M 787  
BY 1 HIS I 1006 ? ARG I 1008 ? HIS M 1006 ARG M 1008 
BY 2 SER J 626  ? VAL J 633  ? SER N 626  VAL N 633  
BY 3 GLN J 744  ? HIS J 748  ? GLN N 744  HIS N 748  
BY 4 VAL J 700  ? ASN J 703  ? VAL N 700  ASN N 703  
BY 5 ILE J 713  ? VAL J 721  ? ILE N 713  VAL N 721  
BY 6 GLN J 641  ? PRO J 645  ? GLN N 641  PRO N 645  
BY 7 ILE J 726  ? LEU J 728  ? ILE N 726  LEU N 728  
BY 8 SER J 626  ? VAL J 633  ? SER N 626  VAL N 633  
BZ 1 ARG I 1031 ? PHE I 1032 ? ARG M 1031 PHE M 1032 
BZ 2 LYS J 621  ? ARG J 622  ? LYS N 621  ARG N 622  
CA 1 PRO I 1108 ? VAL I 1109 ? PRO M 1108 VAL M 1109 
CA 2 LEU I 1097 ? LEU I 1102 ? LEU M 1097 LEU M 1102 
CA 3 LYS J 7    ? LEU J 12   ? LYS N 7    LEU N 12   
CA 4 LYS J 1456 ? GLU J 1458 ? LYS N 1456 GLU N 1458 
CB 1 SER J 22   ? GLU J 25   ? SER N 22   GLU N 25   
CB 2 MET J 90   ? ALA J 100  ? MET N 90   ALA N 100  
CB 3 ILE J 513  ? VAL J 519  ? ILE N 513  VAL N 519  
CC 1 LEU J 152  ? LEU J 153  ? LEU N 152  LEU N 153  
CC 2 TYR J 132  ? ASP J 136  ? TYR N 132  ASP N 136  
CC 3 ASP J 453  ? ARG J 455  ? ASP N 453  ARG N 455  
CD 1 GLN J 166  ? PRO J 170  ? GLN N 166  PRO N 170  
CD 2 SER J 392  ? VAL J 396  ? SER N 392  VAL N 396  
CD 3 GLY J 201  ? ARG J 206  ? GLY N 201  ARG N 206  
CD 4 GLU J 184  ? VAL J 185  ? GLU N 184  VAL N 185  
CE 1 VAL J 317  ? GLU J 327  ? VAL N 317  GLU N 327  
CE 2 THR J 330  ? ARG J 346  ? THR N 330  ARG N 346  
CE 3 ARG J 210  ? PRO J 226  ? ARG N 210  PRO N 226  
CE 4 GLY J 383  ? GLU J 389  ? GLY N 383  GLU N 389  
CE 5 ARG J 360  ? VAL J 361  ? ARG N 360  VAL N 361  
CF 1 ILE J 241  ? GLU J 244  ? ILE N 241  GLU N 244  
CF 2 PRO J 303  ? ARG J 312  ? PRO N 303  ARG N 312  
CF 3 TYR J 249  ? ARG J 252  ? TYR N 249  ARG N 252  
CG 1 ILE J 241  ? GLU J 244  ? ILE N 241  GLU N 244  
CG 2 PRO J 303  ? ARG J 312  ? PRO N 303  ARG N 312  
CG 3 VAL J 286  ? PRO J 290  ? VAL N 286  PRO N 290  
CH 1 PRO J 278  ? LEU J 284  ? PRO N 278  LEU N 284  
CH 2 ALA J 268  ? ARG J 273  ? ALA N 268  ARG N 273  
CH 3 GLY J 257  ? GLU J 263  ? GLY N 257  GLU N 263  
CH 4 ILE J 297  ? VAL J 298  ? ILE N 297  VAL N 298  
CI 1 ASN J 352  ? VAL J 353  ? ASN N 352  VAL N 353  
CI 2 VAL J 368  ? ALA J 369  ? VAL N 368  ALA N 369  
CJ 1 ALA J 398  ? PRO J 402  ? ALA N 398  PRO N 402  
CJ 2 VAL J 443  ? GLU J 448  ? VAL N 443  GLU N 448  
CJ 3 GLY J 433  ? ASP J 438  ? GLY N 433  ASP N 438  
CJ 4 ARG J 414  ? VAL J 415  ? ARG N 414  VAL N 415  
CK 1 VAL J 420  ? ALA J 422  ? VAL N 420  ALA N 422  
CK 2 VAL J 427  ? LYS J 428  ? VAL N 427  LYS N 428  
CL 1 MET J 527  ? GLN J 529  ? MET N 527  GLN N 529  
CL 2 PHE J 535  ? THR J 537  ? PHE N 535  THR N 537  
CL 3 VAL L 335  ? SER L 336  ? VAL P 315  SER P 316  
CM 1 GLU J 805  ? PHE J 806  ? GLU N 805  PHE N 806  
CM 2 LYS J 828  ? VAL J 829  ? LYS N 828  VAL N 829  
CN 1 VAL J 842  ? PHE J 843  ? VAL N 842  PHE N 843  
CN 2 VAL J 864  ? TYR J 868  ? VAL N 864  TYR N 868  
CN 3 LYS J 871  ? THR J 875  ? LYS N 871  THR N 875  
CO 1 VAL J 1106 ? GLU J 1109 ? VAL N 1106 GLU N 1109 
CO 2 GLY J 1199 ? CYS J 1201 ? GLY N 1199 CYS N 1201 
CP 1 ILE J 1118 ? PRO J 1121 ? ILE N 1118 PRO N 1121 
CP 2 GLU J 1185 ? VAL J 1188 ? GLU N 1185 VAL N 1188 
CQ 1 PHE J 1123 ? PRO J 1125 ? PHE N 1123 PRO N 1125 
CQ 2 LEU J 1132 ? LEU J 1134 ? LEU N 1132 LEU N 1134 
CR 1 VAL J 1153 ? VAL J 1155 ? VAL N 1153 VAL N 1155 
CR 2 VAL J 1158 ? LEU J 1160 ? VAL N 1158 LEU N 1160 
CS 1 TYR J 1207 ? ASP J 1208 ? TYR N 1207 ASP N 1208 
CS 2 ARG J 1213 ? PRO J 1214 ? ARG N 1213 PRO N 1214 
CT 1 SER J 1300 ? LEU J 1305 ? SER N 1300 LEU N 1305 
CT 2 LEU J 1290 ? GLU J 1295 ? LEU N 1290 GLU N 1295 
CT 3 GLY J 1279 ? GLU J 1285 ? GLY N 1279 GLU N 1285 
CT 4 TYR J 1318 ? VAL J 1319 ? TYR N 1318 VAL N 1319 
CU 1 VAL J 1394 ? GLU J 1396 ? VAL N 1394 GLU N 1396 
CU 2 TYR J 1378 ? ASP J 1383 ? TYR N 1378 ASP N 1383 
CU 3 ALA J 1416 ? LEU J 1420 ? ALA N 1416 LEU N 1420 
CV 1 THR J 1484 ? ASP J 1488 ? THR N 1484 ASP N 1488 
CV 2 LEU K 73   ? GLU K 77   ? LEU O 73   GLU O 77   
CW 1 LYS K 47   ? GLN K 49   ? LYS O 47   GLN O 49   
CW 2 LEU K 54   ? ASP K 56   ? LEU O 54   ASP O 56   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N ARG A 14   ? N ARG A 14   O GLU A 22   ? O GLU A 22   
A  2 3 N PHE A 23   ? N PHE A 23   O LEU A 197  ? O LEU A 197  
A  3 4 O LYS A 194  ? O LYS A 194  N GLU A 182  ? N GLU A 182  
B  1 2 N ALA A 103  ? N ALA A 103  O LEU A 138  ? O LEU A 138  
B  2 3 O GLY A 147  ? O GLY A 147  N GLY A 50   ? N GLY A 50   
B  3 4 N VAL A 56   ? N VAL A 56   O ILE A 165  ? O ILE A 165  
C  1 2 N ARG A 88   ? N ARG A 88   O GLU A 121  ? O GLU A 121  
D  1 2 N VAL A 109  ? N VAL A 109  O ILE A 129  ? O ILE A 129  
E  1 2 N VAL A 151  ? N VAL A 151  O ALA A 169  ? O ALA A 169  
F  1 2 N THR B 12   ? N THR B 12   O VAL B 24   ? O VAL B 24   
F  2 3 N LEU B 28   ? N LEU B 28   O ASP B 193  ? O ASP B 193  
F  3 4 O ARG B 189  ? O ARG B 189  N LEU B 186  ? N LEU B 186  
G  1 2 N LEU B 101  ? N LEU B 101  O MET B 140  ? O MET B 140  
G  2 3 O ARG B 143  ? O ARG B 143  N SER B 55   ? N SER B 55   
G  3 4 N VAL B 56   ? N VAL B 56   O ILE B 165  ? O ILE B 165  
H  1 2 N ARG B 88   ? N ARG B 88   O GLU B 121  ? O GLU B 121  
I  1 2 N VAL B 109  ? N VAL B 109  O ILE B 129  ? O ILE B 129  
J  1 2 N VAL B 151  ? N VAL B 151  O ALA B 169  ? O ALA B 169  
K  1 2 N LYS C 4    ? N LYS C 4    O ILE C 902  ? O ILE C 902  
K  2 3 O TYR C 901  ? O TYR C 901  N MET C 580  ? N MET C 580  
L  1 2 N VAL C 65   ? N VAL C 65   O ILE C 101  ? O ILE C 101  
L  2 3 N ALA C 96   ? N ALA C 96   O VAL C 113  ? O VAL C 113  
M  1 2 N PHE C 127  ? N PHE C 127  O ARG C 134  ? O ARG C 134  
M  2 3 N VAL C 135  ? N VAL C 135  O GLN C 393  ? O GLN C 393  
N  1 2 O ARG C 334  ? O ARG C 334  N GLN C 139  ? N GLN C 139  
N  2 3 N ILE C 140  ? N ILE C 140  O SER C 411  ? O SER C 411  
N  3 4 N ILE C 410  ? N ILE C 410  O THR C 453  ? O THR C 453  
O  1 2 N TYR C 147  ? N TYR C 147  O SER C 161  ? O SER C 161  
O  2 3 N ALA C 160  ? N ALA C 160  O LEU C 174  ? O LEU C 174  
O  3 4 N GLU C 175  ? N GLU C 175  O SER C 183  ? O SER C 183  
O  4 5 N MET C 184  ? N MET C 184  O PHE C 191  ? O PHE C 191  
P  1 2 N ARG C 292  ? N ARG C 292  O LYS C 299  ? O LYS C 299  
Q  1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
Q  2 3 N TYR C 471  ? N TYR C 471  O VAL C 484  ? O VAL C 484  
R  1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
R  2 3 N ARG C 472  ? N ARG C 472  O MET C 532  ? O MET C 532  
R  3 4 O ASP C 533  ? O ASP C 533  N ALA C 497  ? N ALA C 497  
R  4 5 N ILE C 496  ? N ILE C 496  O ARG C 516  ? O ARG C 516  
R  5 6 N ALA C 515  ? N ALA C 515  O VAL C 522  ? O VAL C 522  
S  1 2 N GLU C 504  ? N GLU C 504  O ARG C 507  ? O ARG C 507  
T  1 2 N LEU C 595  ? N LEU C 595  O ALA C 656  ? O ALA C 656  
T  2 3 O ASP C 657  ? O ASP C 657  N ARG C 640  ? N ARG C 640  
U  1 2 O VAL C 621  ? O VAL C 621  N VAL C 613  ? N VAL C 613  
U  2 3 O VAL C 612  ? O VAL C 612  N ALA C 604  ? N ALA C 604  
U  3 4 N GLY C 601  ? N GLY C 601  O VAL C 649  ? O VAL C 649  
V  1 2 N TYR C 629  ? N TYR C 629  O LEU C 637  ? O LEU C 637  
W  1 2 N GLU C 662  ? N GLU C 662  O PHE C 665  ? O PHE C 665  
X  1 2 N VAL C 972  ? N VAL C 972  O ILE C 987  ? O ILE C 987  
X  2 3 O MET C 995  ? O MET C 995  N ALA C 840  ? N ALA C 840  
X  3 4 N LEU C 839  ? N LEU C 839  O GLY C 847  ? O GLY C 847  
X  4 5 O LYS C 851  ? O LYS C 851  N ILE C 690  ? N ILE C 690  
X  5 6 N VAL C 689  ? N VAL C 689  O ILE C 870  ? O ILE C 870  
X  6 7 O VAL C 869  ? O VAL C 869  N ALA C 675  ? N ALA C 675  
X  7 8 N GLN C 670  ? N GLN C 670  O ILE C 994  ? O ILE C 994  
Y  1 2 N VAL C 749  ? N VAL C 749  O GLY C 798  ? O GLY C 798  
Y  2 3 N VAL C 804  ? N VAL C 804  O ARG C 824  ? O ARG C 824  
Y  3 4 O VAL C 827  ? O VAL C 827  N GLU C 706  ? N GLU C 706  
Y  4 5 N THR C 715  ? N THR C 715  O GLY C 718  ? O GLY C 718  
Y  5 6 N ARG C 721  ? N ARG C 721  O THR C 759  ? O THR C 759  
Y  6 7 N SER C 760  ? N SER C 760  O LYS C 786  ? O LYS C 786  
Z  1 2 N LEU C 755  ? N LEU C 755  O LEU C 790  ? O LEU C 790  
AA 1 2 N HIS C 1006 ? N HIS C 1006 O ARG D 628  ? O ARG D 628  
AA 2 3 N SER D 629  ? N SER D 629  O MET D 745  ? O MET D 745  
AA 3 4 O ALA D 746  ? O ALA D 746  N ASN D 703  ? N ASN D 703  
AA 4 5 N VAL D 700  ? N VAL D 700  O PHE D 716  ? O PHE D 716  
AA 5 6 O VAL D 719  ? O VAL D 719  N CYS D 642  ? N CYS D 642  
AA 6 7 N GLY D 643  ? N GLY D 643  O GLN D 727  ? O GLN D 727  
AA 7 8 O ILE D 726  ? O ILE D 726  N VAL D 632  ? N VAL D 632  
AB 1 2 N PHE C 1032 ? N PHE C 1032 O LYS D 621  ? O LYS D 621  
AC 1 2 N GLN C 1100 ? N GLN C 1100 O ARG D 9    ? O ARG D 9    
AC 2 3 N VAL D 8    ? N VAL D 8    O ASP D 1457 ? O ASP D 1457 
AD 1 2 N TYR D 23   ? N TYR D 23   O MET D 90   ? O MET D 90   
AD 2 3 N GLY D 91   ? N GLY D 91   O VAL D 519  ? O VAL D 519  
AE 1 2 O LEU D 153  ? O LEU D 153  N TYR D 132  ? N TYR D 132  
AE 2 3 N ILE D 133  ? N ILE D 133  O ARG D 455  ? O ARG D 455  
AF 1 2 N TYR D 169  ? N TYR D 169  O ILE D 393  ? O ILE D 393  
AF 2 3 O LEU D 394  ? O LEU D 394  N LEU D 204  ? N LEU D 204  
AF 3 4 O GLY D 201  ? O GLY D 201  N VAL D 185  ? N VAL D 185  
AG 1 2 N ARG D 318  ? N ARG D 318  O GLU D 338  ? O GLU D 338  
AG 2 3 O VAL D 331  ? O VAL D 331  N LEU D 225  ? N LEU D 225  
AG 3 4 N GLU D 214  ? N GLU D 214  O VAL D 384  ? O VAL D 384  
AG 4 5 O GLY D 383  ? O GLY D 383  N VAL D 361  ? N VAL D 361  
AH 1 2 N ALA D 243  ? N ALA D 243  O LEU D 311  ? O LEU D 311  
AH 2 3 O ALA D 307  ? O ALA D 307  N TYR D 249  ? N TYR D 249  
AI 1 2 N ALA D 243  ? N ALA D 243  O LEU D 311  ? O LEU D 311  
AI 2 3 O GLU D 306  ? O GLU D 306  N THR D 289  ? N THR D 289  
AJ 1 2 O VAL D 279  ? O VAL D 279  N LEU D 272  ? N LEU D 272  
AJ 2 3 O VAL D 271  ? O VAL D 271  N GLU D 260  ? N GLU D 260  
AJ 3 4 N GLY D 257  ? N GLY D 257  O VAL D 298  ? O VAL D 298  
AK 1 2 N VAL D 368  ? N VAL D 368  O VAL D 377  ? O VAL D 377  
AL 1 2 N TYR D 401  ? N TYR D 401  O VAL D 444  ? O VAL D 444  
AL 2 3 O ARG D 445  ? O ARG D 445  N GLU D 436  ? N GLU D 436  
AL 3 4 O GLY D 433  ? O GLY D 433  N VAL D 415  ? N VAL D 415  
AM 1 2 N ALA D 422  ? N ALA D 422  O VAL D 427  ? O VAL D 427  
AN 1 2 N VAL D 528  ? N VAL D 528  O ALA D 536  ? O ALA D 536  
AN 2 3 N PHE D 535  ? N PHE D 535  O VAL F 335  ? O VAL F 315  
AO 1 2 N THR D 592  ? N THR D 592  O ARG D 598  ? O ARG D 598  
AP 1 2 N PHE D 806  ? N PHE D 806  O LYS D 828  ? O LYS D 828  
AQ 1 2 N PHE D 843  ? N PHE D 843  O THR D 865  ? O THR D 865  
AQ 2 3 N VAL D 866  ? N VAL D 866  O LEU D 873  ? O LEU D 873  
AR 1 2 N VAL D 1106 ? N VAL D 1106 O VAL D 1200 ? O VAL D 1200 
AS 1 2 N VAL D 1120 ? N VAL D 1120 O VAL D 1186 ? O VAL D 1186 
AT 1 2 N GLN D 1124 ? N GLN D 1124 O ARG D 1133 ? O ARG D 1133 
AU 1 2 N VAL D 1153 ? N VAL D 1153 O LEU D 1160 ? O LEU D 1160 
AV 1 2 O TYR D 1303 ? O TYR D 1303 N VAL D 1292 ? N VAL D 1292 
AV 2 3 O GLU D 1295 ? O GLU D 1295 N VAL D 1280 ? N VAL D 1280 
AV 3 4 N GLY D 1279 ? N GLY D 1279 O VAL D 1319 ? O VAL D 1319 
AW 1 2 O LEU D 1395 ? O LEU D 1395 N VAL D 1379 ? N VAL D 1379 
AW 2 3 N ASP D 1383 ? N ASP D 1383 O ALA D 1416 ? O ALA D 1416 
AX 1 2 N GLN D 1485 ? N GLN D 1485 O GLY E 76   ? O GLY E 76   
AY 1 2 N MET E 48   ? N MET E 48   O PHE E 55   ? O PHE E 55   
AZ 1 2 N ARG G 14   ? N ARG K 14   O GLU G 22   ? O GLU K 22   
AZ 2 3 N PHE G 23   ? N PHE K 23   O LEU G 197  ? O LEU K 197  
AZ 3 4 O ARG G 198  ? O ARG K 198  N ALA G 178  ? N ALA K 178  
BA 1 2 N VAL G 97   ? N VAL K 97   O VAL G 144  ? O VAL K 144  
BA 2 3 O ARG G 143  ? O ARG K 143  N SER G 55   ? N SER K 55   
BA 3 4 N VAL G 56   ? N VAL K 56   O ILE G 165  ? O ILE K 165  
BB 1 2 N ARG G 88   ? N ARG K 88   O GLU G 121  ? O GLU K 121  
BC 1 2 N VAL G 109  ? N VAL K 109  O ILE G 129  ? O ILE K 129  
BD 1 2 N VAL G 151  ? N VAL K 151  O ALA G 169  ? O ALA K 169  
BE 1 2 N ARG H 14   ? N ARG L 14   O GLU H 22   ? O GLU L 22   
BE 2 3 N PHE H 23   ? N PHE L 23   O LEU H 197  ? O LEU L 197  
BE 3 4 O ARG H 198  ? O ARG L 198  N ALA H 178  ? N ALA L 178  
BF 1 2 N VAL H 97   ? N VAL L 97   O VAL H 144  ? O VAL L 144  
BF 2 3 O ARG H 143  ? O ARG L 143  N SER H 55   ? N SER L 55   
BF 3 4 N VAL H 56   ? N VAL L 56   O ILE H 165  ? O ILE L 165  
BG 1 2 N ARG H 88   ? N ARG L 88   O GLU H 121  ? O GLU L 121  
BH 1 2 N VAL H 109  ? N VAL L 109  O ALA H 130  ? O ALA L 130  
BI 1 2 N VAL H 151  ? N VAL L 151  O ALA H 169  ? O ALA L 169  
BJ 1 2 N GLU I 2    ? N GLU M 2    O ARG I 900  ? O ARG M 900  
BJ 2 3 O TYR I 901  ? O TYR M 901  N MET I 580  ? N MET M 580  
BK 1 2 N VAL I 65   ? N VAL M 65   O ILE I 101  ? O ILE M 101  
BK 2 3 N LEU I 98   ? N LEU M 98   O ASP I 111  ? O ASP M 111  
BL 1 2 N PHE I 127  ? N PHE M 127  O ARG I 134  ? O ARG M 134  
BL 2 3 N VAL I 135  ? N VAL M 135  O GLN I 393  ? O GLN M 393  
BM 1 2 O ARG I 334  ? O ARG M 334  N GLN I 139  ? N GLN M 139  
BM 2 3 N SER I 138  ? N SER M 138  O SER I 411  ? O SER M 411  
BM 3 4 N ILE I 410  ? N ILE M 410  O THR I 453  ? O THR M 453  
BN 1 2 N THR I 149  ? N THR M 149  O ILE I 159  ? O ILE M 159  
BN 2 3 N ALA I 160  ? N ALA M 160  O LEU I 174  ? O LEU M 174  
BN 3 4 N GLU I 175  ? N GLU M 175  O SER I 183  ? O SER M 183  
BN 4 5 N MET I 184  ? N MET M 184  O PHE I 191  ? O PHE M 191  
BO 1 2 N ARG I 292  ? N ARG M 292  O LYS I 299  ? O LYS M 299  
BP 1 2 N ARG I 460  ? N ARG M 460  O ARG I 468  ? O ARG M 468  
BP 2 3 N ARG I 473  ? N ARG M 473  O THR I 480  ? O THR M 480  
BQ 1 2 N ARG I 460  ? N ARG M 460  O ARG I 468  ? O ARG M 468  
BQ 2 3 N ARG I 472  ? N ARG M 472  O MET I 532  ? O MET M 532  
BQ 3 4 O PHE I 531  ? O PHE M 531  N ALA I 497  ? N ALA M 497  
BQ 4 5 N ILE I 496  ? N ILE M 496  O ARG I 516  ? O ARG M 516  
BQ 5 6 N VAL I 513  ? N VAL M 513  O VAL I 524  ? O VAL M 524  
BR 1 2 N GLU I 504  ? N GLU M 504  O ARG I 507  ? O ARG M 507  
BS 1 2 N LEU I 595  ? N LEU M 595  O LEU I 655  ? O LEU M 655  
BS 2 3 O ASP I 657  ? O ASP M 657  N ARG I 640  ? N ARG M 640  
BT 1 2 O TYR I 623  ? O TYR M 623  N ILE I 611  ? N ILE M 611  
BT 2 3 O VAL I 612  ? O VAL M 612  N ALA I 604  ? N ALA M 604  
BT 3 4 N GLY I 601  ? N GLY M 601  O VAL I 649  ? O VAL M 649  
BU 1 2 N VAL I 972  ? N VAL M 972  O ILE I 987  ? O ILE M 987  
BU 2 3 O MET I 995  ? O MET M 995  N ALA I 840  ? N ALA M 840  
BU 3 4 N LEU I 839  ? N LEU M 839  O GLY I 847  ? O GLY M 847  
BU 4 5 O LYS I 851  ? O LYS M 851  N ILE I 690  ? N ILE M 690  
BU 5 6 N VAL I 689  ? N VAL M 689  O ILE I 870  ? O ILE M 870  
BU 6 7 O VAL I 869  ? O VAL M 869  N ALA I 675  ? N ALA M 675  
BU 7 8 N VAL I 674  ? N VAL M 674  O GLY I 990  ? O GLY M 990  
BV 1 2 N SER I 702  ? N SER M 702  O ARG I 831  ? O ARG M 831  
BV 2 3 O ARG I 824  ? O ARG M 824  N VAL I 804  ? N VAL M 804  
BV 3 4 O GLY I 798  ? O GLY M 798  N VAL I 749  ? N VAL M 749  
BW 1 2 N VAL I 756  ? N VAL M 756  O LEU I 790  ? O LEU M 790  
BX 1 2 N SER I 760  ? N SER M 760  O LYS I 786  ? O LYS M 786  
BY 1 2 N HIS I 1006 ? N HIS M 1006 O ARG J 628  ? O ARG N 628  
BY 2 3 N GLY J 627  ? N GLY N 627  O VAL J 747  ? O VAL N 747  
BY 3 4 O ALA J 746  ? O ALA N 746  N ASN J 703  ? N ASN N 703  
BY 4 5 N VAL J 700  ? N VAL N 700  O PHE J 716  ? O PHE N 716  
BY 5 6 O VAL J 721  ? O VAL N 721  N LEU J 644  ? N LEU N 644  
BY 6 7 N GLY J 643  ? N GLY N 643  O GLN J 727  ? O GLN N 727  
BY 7 8 O ILE J 726  ? O ILE N 726  N VAL J 632  ? N VAL N 632  
BZ 1 2 N PHE I 1032 ? N PHE M 1032 O LYS J 621  ? O LYS N 621  
CA 1 2 O VAL I 1109 ? O VAL M 1109 N THR I 1101 ? N THR M 1101 
CA 2 3 N ASP I 1098 ? N ASP M 1098 O ALA J 11   ? O ALA N 11   
CA 3 4 N VAL J 8    ? N VAL N 8    O ASP J 1457 ? O ASP N 1457 
CB 1 2 N TYR J 23   ? N TYR N 23   O MET J 90   ? O MET N 90   
CB 2 3 N GLY J 91   ? N GLY N 91   O VAL J 519  ? O VAL N 519  
CC 1 2 O LEU J 153  ? O LEU N 153  N TYR J 132  ? N TYR N 132  
CC 2 3 N ASP J 136  ? N ASP N 136  O ASP J 453  ? O ASP N 453  
CD 1 2 N TYR J 169  ? N TYR N 169  O ILE J 393  ? O ILE N 393  
CD 2 3 O VAL J 396  ? O VAL N 396  N VAL J 202  ? N VAL N 202  
CD 3 4 O GLY J 201  ? O GLY N 201  N VAL J 185  ? N VAL N 185  
CE 1 2 N ALA J 320  ? N ALA N 320  O PHE J 336  ? O PHE N 336  
CE 2 3 O LEU J 337  ? O LEU N 337  N GLU J 219  ? N GLU N 219  
CE 3 4 N ARG J 212  ? N ARG N 212  O HIS J 386  ? O HIS N 386  
CE 4 5 O GLY J 383  ? O GLY N 383  N VAL J 361  ? N VAL N 361  
CF 1 2 N LEU J 242  ? N LEU N 242  O LEU J 311  ? O LEU N 311  
CF 2 3 O ALA J 307  ? O ALA N 307  N TYR J 249  ? N TYR N 249  
CG 1 2 N LEU J 242  ? N LEU N 242  O LEU J 311  ? O LEU N 311  
CG 2 3 O GLU J 306  ? O GLU N 306  N THR J 289  ? N THR N 289  
CH 1 2 O TYR J 282  ? O TYR N 282  N LEU J 270  ? N LEU N 270  
CH 2 3 O PHE J 269  ? O PHE N 269  N LYS J 262  ? N LYS N 262  
CH 3 4 N GLY J 257  ? N GLY N 257  O VAL J 298  ? O VAL N 298  
CI 1 2 N ASN J 352  ? N ASN N 352  O ALA J 369  ? O ALA N 369  
CJ 1 2 N TYR J 401  ? N TYR N 401  O VAL J 444  ? O VAL N 444  
CJ 2 3 O ARG J 445  ? O ARG N 445  N GLU J 436  ? N GLU N 436  
CJ 3 4 O GLY J 433  ? O GLY N 433  N VAL J 415  ? N VAL N 415  
CK 1 2 N ALA J 422  ? N ALA N 422  O VAL J 427  ? O VAL N 427  
CL 1 2 N VAL J 528  ? N VAL N 528  O ALA J 536  ? O ALA N 536  
CL 2 3 N PHE J 535  ? N PHE N 535  O VAL L 335  ? O VAL P 315  
CM 1 2 N PHE J 806  ? N PHE N 806  O LYS J 828  ? O LYS N 828  
CN 1 2 N PHE J 843  ? N PHE N 843  O THR J 865  ? O THR N 865  
CN 2 3 N VAL J 864  ? N VAL N 864  O THR J 875  ? O THR N 875  
CO 1 2 N VAL J 1106 ? N VAL N 1106 O VAL J 1200 ? O VAL N 1200 
CP 1 2 N ILE J 1118 ? N ILE N 1118 O VAL J 1188 ? O VAL N 1188 
CQ 1 2 N GLN J 1124 ? N GLN N 1124 O ARG J 1133 ? O ARG N 1133 
CR 1 2 N VAL J 1153 ? N VAL N 1153 O LEU J 1160 ? O LEU N 1160 
CS 1 2 N ASP J 1208 ? N ASP N 1208 O ARG J 1213 ? O ARG N 1213 
CT 1 2 O TYR J 1303 ? O TYR N 1303 N VAL J 1292 ? N VAL N 1292 
CT 2 3 O PHE J 1293 ? O PHE N 1293 N ARG J 1282 ? N ARG N 1282 
CT 3 4 N GLY J 1279 ? N GLY N 1279 O VAL J 1319 ? O VAL N 1319 
CU 1 2 O LEU J 1395 ? O LEU N 1395 N VAL J 1379 ? N VAL N 1379 
CU 2 3 N GLU J 1380 ? N GLU N 1380 O LYS J 1418 ? O LYS N 1418 
CV 1 2 N GLN J 1485 ? N GLN N 1485 O GLY K 76   ? O GLY O 76   
CW 1 2 N MET K 48   ? N MET O 48   O PHE K 55   ? O PHE O 55   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN D 2001' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN D 2002' 
AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG D 2003' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN N 2001' 
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN N 2002' 
AC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG N 2003' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS D 1112 ? CYS D 1112 . ? 1_555 ? 
2  AC1 4 CYS D 1194 ? CYS D 1194 . ? 1_555 ? 
3  AC1 4 CYS D 1201 ? CYS D 1201 . ? 1_555 ? 
4  AC1 4 CYS D 1204 ? CYS D 1204 . ? 1_555 ? 
5  AC2 4 CYS D 58   ? CYS D 58   . ? 1_555 ? 
6  AC2 4 CYS D 60   ? CYS D 60   . ? 1_555 ? 
7  AC2 4 CYS D 73   ? CYS D 73   . ? 1_555 ? 
8  AC2 4 CYS D 76   ? CYS D 76   . ? 1_555 ? 
9  AC3 3 ASP D 739  ? ASP D 739  . ? 1_555 ? 
10 AC3 3 ASP D 741  ? ASP D 741  . ? 1_555 ? 
11 AC3 3 ASP D 743  ? ASP D 743  . ? 1_555 ? 
12 AC4 5 CYS J 1112 ? CYS N 1112 . ? 1_555 ? 
13 AC4 5 CYS J 1194 ? CYS N 1194 . ? 1_555 ? 
14 AC4 5 GLN J 1195 ? GLN N 1195 . ? 1_555 ? 
15 AC4 5 CYS J 1201 ? CYS N 1201 . ? 1_555 ? 
16 AC4 5 CYS J 1204 ? CYS N 1204 . ? 1_555 ? 
17 AC5 4 CYS J 58   ? CYS N 58   . ? 1_555 ? 
18 AC5 4 CYS J 60   ? CYS N 60   . ? 1_555 ? 
19 AC5 4 CYS J 73   ? CYS N 73   . ? 1_555 ? 
20 AC5 4 CYS J 76   ? CYS N 76   . ? 1_555 ? 
21 AC6 3 ASP J 739  ? ASP N 739  . ? 1_555 ? 
22 AC6 3 ASP J 741  ? ASP N 741  . ? 1_555 ? 
23 AC6 3 ASP J 743  ? ASP N 743  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4G7Z 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4G7Z 
_atom_sites.fract_transf_matrix[1][1]   0.005392 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000809 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009653 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003410 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BR 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . SER A 1 4    ? 31.595  18.032  145.251 1.00 160.00 ? 4    SER A N     1 
ATOM   2     C  CA    . SER A 1 4    ? 31.491  17.020  144.201 1.00 171.48 ? 4    SER A CA    1 
ATOM   3     C  C     . SER A 1 4    ? 32.436  17.386  143.061 1.00 168.62 ? 4    SER A C     1 
ATOM   4     O  O     . SER A 1 4    ? 32.486  16.713  142.026 1.00 163.17 ? 4    SER A O     1 
ATOM   5     C  CB    . SER A 1 4    ? 30.044  16.881  143.699 1.00 177.29 ? 4    SER A CB    1 
ATOM   6     O  OG    . SER A 1 4    ? 29.799  15.613  143.097 1.00 170.16 ? 4    SER A OG    1 
ATOM   7     N  N     . LYS A 1 5    ? 33.182  18.468  143.266 1.00 167.26 ? 5    LYS A N     1 
ATOM   8     C  CA    . LYS A 1 5    ? 34.254  18.848  142.353 1.00 168.81 ? 5    LYS A CA    1 
ATOM   9     C  C     . LYS A 1 5    ? 35.423  17.890  142.583 1.00 162.42 ? 5    LYS A C     1 
ATOM   10    O  O     . LYS A 1 5    ? 35.664  17.467  143.718 1.00 165.10 ? 5    LYS A O     1 
ATOM   11    C  CB    . LYS A 1 5    ? 34.672  20.309  142.605 1.00 167.86 ? 5    LYS A CB    1 
ATOM   12    C  CG    . LYS A 1 5    ? 35.819  20.833  141.723 1.00 165.47 ? 5    LYS A CG    1 
ATOM   13    C  CD    . LYS A 1 5    ? 35.364  21.246  140.319 1.00 164.01 ? 5    LYS A CD    1 
ATOM   14    C  CE    . LYS A 1 5    ? 36.552  21.544  139.393 1.00 160.26 ? 5    LYS A CE    1 
ATOM   15    N  NZ    . LYS A 1 5    ? 37.499  22.574  139.920 1.00 148.11 ? 5    LYS A NZ    1 
ATOM   16    N  N     . LEU A 1 6    ? 36.116  17.506  141.513 1.00 151.84 ? 6    LEU A N     1 
ATOM   17    C  CA    . LEU A 1 6    ? 37.332  16.710  141.664 1.00 148.10 ? 6    LEU A CA    1 
ATOM   18    C  C     . LEU A 1 6    ? 38.551  17.573  141.989 1.00 144.11 ? 6    LEU A C     1 
ATOM   19    O  O     . LEU A 1 6    ? 38.606  18.746  141.631 1.00 144.28 ? 6    LEU A O     1 
ATOM   20    C  CB    . LEU A 1 6    ? 37.594  15.847  140.434 1.00 146.64 ? 6    LEU A CB    1 
ATOM   21    C  CG    . LEU A 1 6    ? 37.701  14.350  140.733 1.00 142.11 ? 6    LEU A CG    1 
ATOM   22    C  CD1   . LEU A 1 6    ? 38.978  14.004  141.494 1.00 135.89 ? 6    LEU A CD1   1 
ATOM   23    C  CD2   . LEU A 1 6    ? 36.482  13.922  141.513 1.00 147.13 ? 6    LEU A CD2   1 
ATOM   24    N  N     . LYS A 1 7    ? 39.535  16.978  142.651 1.00 139.85 ? 7    LYS A N     1 
ATOM   25    C  CA    . LYS A 1 7    ? 40.694  17.713  143.136 1.00 137.01 ? 7    LYS A CA    1 
ATOM   26    C  C     . LYS A 1 7    ? 41.974  16.995  142.741 1.00 135.31 ? 7    LYS A C     1 
ATOM   27    O  O     . LYS A 1 7    ? 41.930  15.879  142.225 1.00 138.32 ? 7    LYS A O     1 
ATOM   28    C  CB    . LYS A 1 7    ? 40.636  17.862  144.652 1.00 145.19 ? 7    LYS A CB    1 
ATOM   29    C  CG    . LYS A 1 7    ? 39.313  18.393  145.187 1.00 148.25 ? 7    LYS A CG    1 
ATOM   30    C  CD    . LYS A 1 7    ? 39.276  19.909  145.246 1.00 147.12 ? 7    LYS A CD    1 
ATOM   31    C  CE    . LYS A 1 7    ? 38.070  20.391  146.036 1.00 148.99 ? 7    LYS A CE    1 
ATOM   32    N  NZ    . LYS A 1 7    ? 38.059  21.873  146.165 1.00 153.08 ? 7    LYS A NZ    1 
ATOM   33    N  N     . ALA A 1 8    ? 43.106  17.651  142.974 1.00 132.79 ? 8    ALA A N     1 
ATOM   34    C  CA    . ALA A 1 8    ? 44.418  17.157  142.558 1.00 137.85 ? 8    ALA A CA    1 
ATOM   35    C  C     . ALA A 1 8    ? 44.713  15.704  142.985 1.00 142.60 ? 8    ALA A C     1 
ATOM   36    O  O     . ALA A 1 8    ? 44.695  15.393  144.173 1.00 143.16 ? 8    ALA A O     1 
ATOM   37    C  CB    . ALA A 1 8    ? 45.499  18.091  143.092 1.00 139.48 ? 8    ALA A CB    1 
ATOM   38    N  N     . PRO A 1 9    ? 44.976  14.817  142.001 1.00 138.69 ? 9    PRO A N     1 
ATOM   39    C  CA    . PRO A 1 9    ? 45.235  13.372  142.064 1.00 129.60 ? 9    PRO A CA    1 
ATOM   40    C  C     . PRO A 1 9    ? 46.660  12.963  142.399 1.00 125.04 ? 9    PRO A C     1 
ATOM   41    O  O     . PRO A 1 9    ? 47.594  13.721  142.154 1.00 119.95 ? 9    PRO A O     1 
ATOM   42    C  CB    . PRO A 1 9    ? 44.910  12.901  140.650 1.00 131.62 ? 9    PRO A CB    1 
ATOM   43    C  CG    . PRO A 1 9    ? 44.852  14.143  139.802 1.00 135.28 ? 9    PRO A CG    1 
ATOM   44    C  CD    . PRO A 1 9    ? 45.220  15.311  140.645 1.00 137.66 ? 9    PRO A CD    1 
ATOM   45    N  N     . VAL A 1 10   ? 46.810  11.738  142.901 1.00 129.54 ? 10   VAL A N     1 
ATOM   46    C  CA    . VAL A 1 10   ? 48.108  11.222  143.335 1.00 131.40 ? 10   VAL A CA    1 
ATOM   47    C  C     . VAL A 1 10   ? 49.043  10.902  142.186 1.00 129.67 ? 10   VAL A C     1 
ATOM   48    O  O     . VAL A 1 10   ? 48.736  10.096  141.312 1.00 132.91 ? 10   VAL A O     1 
ATOM   49    C  CB    . VAL A 1 10   ? 47.992  9.938   144.236 1.00 138.90 ? 10   VAL A CB    1 
ATOM   50    C  CG1   . VAL A 1 10   ? 47.252  10.241  145.535 1.00 139.25 ? 10   VAL A CG1   1 
ATOM   51    C  CG2   . VAL A 1 10   ? 47.360  8.742   143.494 1.00 131.92 ? 10   VAL A CG2   1 
ATOM   52    N  N     . PHE A 1 11   ? 50.208  11.522  142.193 1.00 128.83 ? 11   PHE A N     1 
ATOM   53    C  CA    . PHE A 1 11   ? 51.206  11.159  141.214 1.00 132.59 ? 11   PHE A CA    1 
ATOM   54    C  C     . PHE A 1 11   ? 52.190  10.189  141.860 1.00 138.64 ? 11   PHE A C     1 
ATOM   55    O  O     . PHE A 1 11   ? 52.752  10.480  142.918 1.00 144.69 ? 11   PHE A O     1 
ATOM   56    C  CB    . PHE A 1 11   ? 51.904  12.403  140.681 1.00 134.88 ? 11   PHE A CB    1 
ATOM   57    C  CG    . PHE A 1 11   ? 53.026  12.101  139.750 1.00 137.42 ? 11   PHE A CG    1 
ATOM   58    C  CD1   . PHE A 1 11   ? 54.329  12.408  140.093 1.00 141.45 ? 11   PHE A CD1   1 
ATOM   59    C  CD2   . PHE A 1 11   ? 52.784  11.483  138.539 1.00 136.17 ? 11   PHE A CD2   1 
ATOM   60    C  CE1   . PHE A 1 11   ? 55.366  12.121  139.237 1.00 137.97 ? 11   PHE A CE1   1 
ATOM   61    C  CE2   . PHE A 1 11   ? 53.821  11.192  137.675 1.00 133.49 ? 11   PHE A CE2   1 
ATOM   62    C  CZ    . PHE A 1 11   ? 55.112  11.510  138.027 1.00 134.76 ? 11   PHE A CZ    1 
ATOM   63    N  N     . THR A 1 12   ? 52.368  9.022   141.248 1.00 135.33 ? 12   THR A N     1 
ATOM   64    C  CA    . THR A 1 12   ? 53.266  8.009   141.795 1.00 134.84 ? 12   THR A CA    1 
ATOM   65    C  C     . THR A 1 12   ? 54.220  7.537   140.711 1.00 131.04 ? 12   THR A C     1 
ATOM   66    O  O     . THR A 1 12   ? 53.793  7.255   139.595 1.00 127.71 ? 12   THR A O     1 
ATOM   67    C  CB    . THR A 1 12   ? 52.497  6.783   142.334 1.00 135.27 ? 12   THR A CB    1 
ATOM   68    O  OG1   . THR A 1 12   ? 51.180  7.168   142.771 1.00 125.86 ? 12   THR A OG1   1 
ATOM   69    C  CG2   . THR A 1 12   ? 53.283  6.130   143.474 1.00 137.20 ? 12   THR A CG2   1 
ATOM   70    N  N     . VAL A 1 13   ? 55.507  7.443   141.032 1.00 134.60 ? 13   VAL A N     1 
ATOM   71    C  CA    . VAL A 1 13   ? 56.499  7.017   140.043 1.00 128.50 ? 13   VAL A CA    1 
ATOM   72    C  C     . VAL A 1 13   ? 57.004  5.594   140.299 1.00 128.14 ? 13   VAL A C     1 
ATOM   73    O  O     . VAL A 1 13   ? 57.087  5.151   141.449 1.00 130.77 ? 13   VAL A O     1 
ATOM   74    C  CB    . VAL A 1 13   ? 57.710  7.981   139.996 1.00 124.06 ? 13   VAL A CB    1 
ATOM   75    C  CG1   . VAL A 1 13   ? 58.500  7.749   138.744 1.00 121.44 ? 13   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A 1 13   ? 57.263  9.428   140.072 1.00 124.87 ? 13   VAL A CG2   1 
ATOM   77    N  N     . ARG A 1 14   ? 57.307  4.885   139.213 1.00 128.69 ? 14   ARG A N     1 
ATOM   78    C  CA    . ARG A 1 14   ? 58.086  3.643   139.244 1.00 133.50 ? 14   ARG A CA    1 
ATOM   79    C  C     . ARG A 1 14   ? 59.208  3.755   138.194 1.00 136.58 ? 14   ARG A C     1 
ATOM   80    O  O     . ARG A 1 14   ? 58.922  3.957   137.015 1.00 134.68 ? 14   ARG A O     1 
ATOM   81    C  CB    . ARG A 1 14   ? 57.197  2.421   138.954 1.00 124.83 ? 14   ARG A CB    1 
ATOM   82    C  CG    . ARG A 1 14   ? 56.090  2.173   139.974 1.00 122.90 ? 14   ARG A CG    1 
ATOM   83    C  CD    . ARG A 1 14   ? 55.309  0.878   139.701 1.00 122.24 ? 14   ARG A CD    1 
ATOM   84    N  NE    . ARG A 1 14   ? 54.089  1.068   138.903 1.00 130.48 ? 14   ARG A NE    1 
ATOM   85    C  CZ    . ARG A 1 14   ? 52.864  1.259   139.405 1.00 133.83 ? 14   ARG A CZ    1 
ATOM   86    N  NH1   . ARG A 1 14   ? 52.683  1.301   140.717 1.00 139.43 ? 14   ARG A NH1   1 
ATOM   87    N  NH2   . ARG A 1 14   ? 51.811  1.415   138.601 1.00 127.31 ? 14   ARG A NH2   1 
ATOM   88    N  N     . THR A 1 15   ? 60.474  3.657   138.613 1.00 141.62 ? 15   THR A N     1 
ATOM   89    C  CA    . THR A 1 15   ? 61.603  3.743   137.672 1.00 146.29 ? 15   THR A CA    1 
ATOM   90    C  C     . THR A 1 15   ? 62.605  2.573   137.763 1.00 150.67 ? 15   THR A C     1 
ATOM   91    O  O     . THR A 1 15   ? 63.154  2.288   138.835 1.00 148.91 ? 15   THR A O     1 
ATOM   92    C  CB    . THR A 1 15   ? 62.392  5.100   137.778 1.00 142.56 ? 15   THR A CB    1 
ATOM   93    O  OG1   . THR A 1 15   ? 62.458  5.518   139.145 1.00 133.74 ? 15   THR A OG1   1 
ATOM   94    C  CG2   . THR A 1 15   ? 61.747  6.210   136.924 1.00 135.08 ? 15   THR A CG2   1 
ATOM   95    N  N     . GLN A 1 16   ? 62.818  1.906   136.623 1.00 149.13 ? 16   GLN A N     1 
ATOM   96    C  CA    . GLN A 1 16   ? 63.889  0.925   136.434 1.00 148.86 ? 16   GLN A CA    1 
ATOM   97    C  C     . GLN A 1 16   ? 64.948  1.535   135.552 1.00 148.64 ? 16   GLN A C     1 
ATOM   98    O  O     . GLN A 1 16   ? 64.704  1.739   134.368 1.00 149.42 ? 16   GLN A O     1 
ATOM   99    C  CB    . GLN A 1 16   ? 63.380  -0.297  135.681 1.00 146.54 ? 16   GLN A CB    1 
ATOM   100   C  CG    . GLN A 1 16   ? 62.650  -1.322  136.509 1.00 159.67 ? 16   GLN A CG    1 
ATOM   101   C  CD    . GLN A 1 16   ? 62.181  -2.491  135.664 1.00 162.04 ? 16   GLN A CD    1 
ATOM   102   O  OE1   . GLN A 1 16   ? 62.755  -2.771  134.610 1.00 152.32 ? 16   GLN A OE1   1 
ATOM   103   N  NE2   . GLN A 1 16   ? 61.124  -3.171  136.114 1.00 168.32 ? 16   GLN A NE2   1 
ATOM   104   N  N     . GLY A 1 17   ? 66.119  1.823   136.107 1.00 151.85 ? 17   GLY A N     1 
ATOM   105   C  CA    . GLY A 1 17   ? 67.199  2.396   135.324 1.00 150.26 ? 17   GLY A CA    1 
ATOM   106   C  C     . GLY A 1 17   ? 66.795  3.699   134.655 1.00 148.69 ? 17   GLY A C     1 
ATOM   107   O  O     . GLY A 1 17   ? 65.794  4.324   135.029 1.00 147.18 ? 17   GLY A O     1 
ATOM   108   N  N     . ARG A 1 18   ? 67.567  4.099   133.649 1.00 145.04 ? 18   ARG A N     1 
ATOM   109   C  CA    . ARG A 1 18   ? 67.252  5.283   132.856 1.00 146.87 ? 18   ARG A CA    1 
ATOM   110   C  C     . ARG A 1 18   ? 66.453  4.840   131.639 1.00 147.68 ? 18   ARG A C     1 
ATOM   111   O  O     . ARG A 1 18   ? 66.083  5.654   130.790 1.00 146.42 ? 18   ARG A O     1 
ATOM   112   C  CB    . ARG A 1 18   ? 68.532  5.993   132.388 1.00 148.65 ? 18   ARG A CB    1 
ATOM   113   C  CG    . ARG A 1 18   ? 69.537  6.354   133.485 1.00 150.43 ? 18   ARG A CG    1 
ATOM   114   C  CD    . ARG A 1 18   ? 70.805  6.996   132.906 1.00 147.61 ? 18   ARG A CD    1 
ATOM   115   N  NE    . ARG A 1 18   ? 70.519  8.264   132.236 1.00 151.77 ? 18   ARG A NE    1 
ATOM   116   C  CZ    . ARG A 1 18   ? 70.721  9.461   132.776 1.00 152.53 ? 18   ARG A CZ    1 
ATOM   117   N  NH1   . ARG A 1 18   ? 71.228  9.559   134.001 1.00 160.45 ? 18   ARG A NH1   1 
ATOM   118   N  NH2   . ARG A 1 18   ? 70.420  10.560  132.090 1.00 144.28 ? 18   ARG A NH2   1 
ATOM   119   N  N     . GLU A 1 19   ? 66.236  3.531   131.548 1.00 147.26 ? 19   GLU A N     1 
ATOM   120   C  CA    . GLU A 1 19   ? 65.582  2.910   130.396 1.00 145.76 ? 19   GLU A CA    1 
ATOM   121   C  C     . GLU A 1 19   ? 64.052  2.938   130.425 1.00 141.71 ? 19   GLU A C     1 
ATOM   122   O  O     . GLU A 1 19   ? 63.415  2.903   129.373 1.00 137.41 ? 19   GLU A O     1 
ATOM   123   C  CB    . GLU A 1 19   ? 66.049  1.456   130.240 1.00 151.38 ? 19   GLU A CB    1 
ATOM   124   C  CG    . GLU A 1 19   ? 67.550  1.221   130.450 1.00 159.74 ? 19   GLU A CG    1 
ATOM   125   C  CD    . GLU A 1 19   ? 68.382  1.405   129.182 1.00 164.90 ? 19   GLU A CD    1 
ATOM   126   O  OE1   . GLU A 1 19   ? 68.285  2.482   128.551 1.00 162.90 ? 19   GLU A OE1   1 
ATOM   127   O  OE2   . GLU A 1 19   ? 69.140  0.474   128.821 1.00 166.09 ? 19   GLU A OE2   1 
ATOM   128   N  N     . TYR A 1 20   ? 63.476  2.980   131.627 1.00 144.95 ? 20   TYR A N     1 
ATOM   129   C  CA    . TYR A 1 20   ? 62.045  2.738   131.824 1.00 138.87 ? 20   TYR A CA    1 
ATOM   130   C  C     . TYR A 1 20   ? 61.489  3.568   132.981 1.00 142.01 ? 20   TYR A C     1 
ATOM   131   O  O     . TYR A 1 20   ? 62.212  3.890   133.927 1.00 147.66 ? 20   TYR A O     1 
ATOM   132   C  CB    . TYR A 1 20   ? 61.813  1.252   132.116 1.00 132.77 ? 20   TYR A CB    1 
ATOM   133   C  CG    . TYR A 1 20   ? 60.375  0.816   132.035 1.00 124.88 ? 20   TYR A CG    1 
ATOM   134   C  CD1   . TYR A 1 20   ? 59.968  -0.391  132.576 1.00 131.43 ? 20   TYR A CD1   1 
ATOM   135   C  CD2   . TYR A 1 20   ? 59.425  1.596   131.395 1.00 127.58 ? 20   TYR A CD2   1 
ATOM   136   C  CE1   . TYR A 1 20   ? 58.642  -0.797  132.504 1.00 132.85 ? 20   TYR A CE1   1 
ATOM   137   C  CE2   . TYR A 1 20   ? 58.104  1.207   131.321 1.00 129.90 ? 20   TYR A CE2   1 
ATOM   138   C  CZ    . TYR A 1 20   ? 57.714  0.008   131.873 1.00 129.90 ? 20   TYR A CZ    1 
ATOM   139   O  OH    . TYR A 1 20   ? 56.393  -0.384  131.789 1.00 125.67 ? 20   TYR A OH    1 
ATOM   140   N  N     . GLY A 1 21   ? 60.215  3.943   132.879 1.00 136.97 ? 21   GLY A N     1 
ATOM   141   C  CA    . GLY A 1 21   ? 59.458  4.461   134.006 1.00 133.21 ? 21   GLY A CA    1 
ATOM   142   C  C     . GLY A 1 21   ? 57.981  4.181   133.790 1.00 129.84 ? 21   GLY A C     1 
ATOM   143   O  O     . GLY A 1 21   ? 57.541  4.075   132.653 1.00 130.99 ? 21   GLY A O     1 
ATOM   144   N  N     . GLU A 1 22   ? 57.220  4.046   134.876 1.00 130.03 ? 22   GLU A N     1 
ATOM   145   C  CA    . GLU A 1 22   ? 55.760  3.946   134.814 1.00 123.76 ? 22   GLU A CA    1 
ATOM   146   C  C     . GLU A 1 22   ? 55.275  5.130   135.597 1.00 125.43 ? 22   GLU A C     1 
ATOM   147   O  O     . GLU A 1 22   ? 55.774  5.402   136.685 1.00 130.61 ? 22   GLU A O     1 
ATOM   148   C  CB    . GLU A 1 22   ? 55.227  2.671   135.470 1.00 121.31 ? 22   GLU A CB    1 
ATOM   149   C  CG    . GLU A 1 22   ? 55.382  1.394   134.640 1.00 129.03 ? 22   GLU A CG    1 
ATOM   150   C  CD    . GLU A 1 22   ? 54.760  0.164   135.310 1.00 135.34 ? 22   GLU A CD    1 
ATOM   151   O  OE1   . GLU A 1 22   ? 53.911  0.349   136.202 1.00 140.70 ? 22   GLU A OE1   1 
ATOM   152   O  OE2   . GLU A 1 22   ? 55.114  -0.987  134.955 1.00 134.60 ? 22   GLU A OE2   1 
ATOM   153   N  N     . PHE A 1 23   ? 54.324  5.861   135.051 1.00 122.68 ? 23   PHE A N     1 
ATOM   154   C  CA    . PHE A 1 23   ? 53.890  7.067   135.723 1.00 125.12 ? 23   PHE A CA    1 
ATOM   155   C  C     . PHE A 1 23   ? 52.377  7.004   135.889 1.00 131.44 ? 23   PHE A C     1 
ATOM   156   O  O     . PHE A 1 23   ? 51.648  6.869   134.906 1.00 132.75 ? 23   PHE A O     1 
ATOM   157   C  CB    . PHE A 1 23   ? 54.412  8.300   134.974 1.00 118.38 ? 23   PHE A CB    1 
ATOM   158   C  CG    . PHE A 1 23   ? 55.913  8.328   134.879 1.00 120.09 ? 23   PHE A CG    1 
ATOM   159   C  CD1   . PHE A 1 23   ? 56.667  9.009   135.807 1.00 124.71 ? 23   PHE A CD1   1 
ATOM   160   C  CD2   . PHE A 1 23   ? 56.572  7.616   133.897 1.00 122.77 ? 23   PHE A CD2   1 
ATOM   161   C  CE1   . PHE A 1 23   ? 58.048  9.008   135.728 1.00 129.19 ? 23   PHE A CE1   1 
ATOM   162   C  CE2   . PHE A 1 23   ? 57.950  7.605   133.825 1.00 124.61 ? 23   PHE A CE2   1 
ATOM   163   C  CZ    . PHE A 1 23   ? 58.687  8.299   134.740 1.00 127.63 ? 23   PHE A CZ    1 
ATOM   164   N  N     . VAL A 1 24   ? 51.915  7.031   137.142 1.00 131.28 ? 24   VAL A N     1 
ATOM   165   C  CA    . VAL A 1 24   ? 50.494  6.876   137.453 1.00 124.39 ? 24   VAL A CA    1 
ATOM   166   C  C     . VAL A 1 24   ? 49.885  8.202   137.876 1.00 122.53 ? 24   VAL A C     1 
ATOM   167   O  O     . VAL A 1 24   ? 50.478  8.956   138.645 1.00 126.78 ? 24   VAL A O     1 
ATOM   168   C  CB    . VAL A 1 24   ? 50.252  5.815   138.566 1.00 126.41 ? 24   VAL A CB    1 
ATOM   169   C  CG1   . VAL A 1 24   ? 48.961  6.099   139.326 1.00 129.81 ? 24   VAL A CG1   1 
ATOM   170   C  CG2   . VAL A 1 24   ? 50.233  4.400   137.985 1.00 122.86 ? 24   VAL A CG2   1 
ATOM   171   N  N     . LEU A 1 25   ? 48.710  8.500   137.345 1.00 120.38 ? 25   LEU A N     1 
ATOM   172   C  CA    . LEU A 1 25   ? 47.956  9.629   137.833 1.00 123.45 ? 25   LEU A CA    1 
ATOM   173   C  C     . LEU A 1 25   ? 46.536  9.187   138.163 1.00 127.31 ? 25   LEU A C     1 
ATOM   174   O  O     . LEU A 1 25   ? 45.778  8.787   137.273 1.00 124.42 ? 25   LEU A O     1 
ATOM   175   C  CB    . LEU A 1 25   ? 47.953  10.745  136.809 1.00 116.89 ? 25   LEU A CB    1 
ATOM   176   C  CG    . LEU A 1 25   ? 47.985  12.082  137.512 1.00 118.71 ? 25   LEU A CG    1 
ATOM   177   C  CD1   . LEU A 1 25   ? 49.338  12.282  138.138 1.00 119.04 ? 25   LEU A CD1   1 
ATOM   178   C  CD2   . LEU A 1 25   ? 47.693  13.128  136.503 1.00 128.40 ? 25   LEU A CD2   1 
ATOM   179   N  N     . GLU A 1 26   ? 46.192  9.220   139.451 1.00 131.23 ? 26   GLU A N     1 
ATOM   180   C  CA    . GLU A 1 26   ? 44.862  8.799   139.870 1.00 130.53 ? 26   GLU A CA    1 
ATOM   181   C  C     . GLU A 1 26   ? 44.292  9.477   141.134 1.00 127.60 ? 26   GLU A C     1 
ATOM   182   O  O     . GLU A 1 26   ? 45.032  9.825   142.040 1.00 124.97 ? 26   GLU A O     1 
ATOM   183   C  CB    . GLU A 1 26   ? 44.837  7.283   140.001 1.00 130.00 ? 26   GLU A CB    1 
ATOM   184   C  CG    . GLU A 1 26   ? 45.293  6.743   141.311 1.00 126.40 ? 26   GLU A CG    1 
ATOM   185   C  CD    . GLU A 1 26   ? 44.978  5.276   141.397 1.00 130.51 ? 26   GLU A CD    1 
ATOM   186   O  OE1   . GLU A 1 26   ? 43.836  4.921   141.773 1.00 126.65 ? 26   GLU A OE1   1 
ATOM   187   O  OE2   . GLU A 1 26   ? 45.861  4.475   141.037 1.00 134.08 ? 26   GLU A OE2   1 
ATOM   188   N  N     . PRO A 1 27   ? 42.961  9.658   141.185 1.00 126.44 ? 27   PRO A N     1 
ATOM   189   C  CA    . PRO A 1 27   ? 42.055  9.394   140.074 1.00 131.91 ? 27   PRO A CA    1 
ATOM   190   C  C     . PRO A 1 27   ? 41.840  10.675  139.276 1.00 141.19 ? 27   PRO A C     1 
ATOM   191   O  O     . PRO A 1 27   ? 42.202  11.761  139.750 1.00 142.56 ? 27   PRO A O     1 
ATOM   192   C  CB    . PRO A 1 27   ? 40.765  9.067   140.796 1.00 127.78 ? 27   PRO A CB    1 
ATOM   193   C  CG    . PRO A 1 27   ? 40.773  10.053  141.904 1.00 136.07 ? 27   PRO A CG    1 
ATOM   194   C  CD    . PRO A 1 27   ? 42.230  10.250  142.309 1.00 131.08 ? 27   PRO A CD    1 
ATOM   195   N  N     . LEU A 1 28   ? 41.155  10.573  138.141 1.00 140.45 ? 28   LEU A N     1 
ATOM   196   C  CA    . LEU A 1 28   ? 40.916  11.743  137.306 1.00 134.80 ? 28   LEU A CA    1 
ATOM   197   C  C     . LEU A 1 28   ? 39.502  11.633  136.804 1.00 130.87 ? 28   LEU A C     1 
ATOM   198   O  O     . LEU A 1 28   ? 38.960  10.527  136.757 1.00 129.85 ? 28   LEU A O     1 
ATOM   199   C  CB    . LEU A 1 28   ? 41.910  11.796  136.143 1.00 135.54 ? 28   LEU A CB    1 
ATOM   200   C  CG    . LEU A 1 28   ? 43.359  12.214  136.453 1.00 135.95 ? 28   LEU A CG    1 
ATOM   201   C  CD1   . LEU A 1 28   ? 44.365  11.628  135.459 1.00 127.63 ? 28   LEU A CD1   1 
ATOM   202   C  CD2   . LEU A 1 28   ? 43.472  13.731  136.489 1.00 138.56 ? 28   LEU A CD2   1 
ATOM   203   N  N     . GLU A 1 29   ? 38.902  12.762  136.437 1.00 132.93 ? 29   GLU A N     1 
ATOM   204   C  CA    . GLU A 1 29   ? 37.509  12.748  135.992 1.00 142.84 ? 29   GLU A CA    1 
ATOM   205   C  C     . GLU A 1 29   ? 37.365  11.741  134.849 1.00 141.79 ? 29   GLU A C     1 
ATOM   206   O  O     . GLU A 1 29   ? 38.315  11.540  134.101 1.00 141.36 ? 29   GLU A O     1 
ATOM   207   C  CB    . GLU A 1 29   ? 37.042  14.151  135.574 1.00 143.09 ? 29   GLU A CB    1 
ATOM   208   C  CG    . GLU A 1 29   ? 36.611  15.060  136.736 1.00 144.55 ? 29   GLU A CG    1 
ATOM   209   C  CD    . GLU A 1 29   ? 35.443  14.490  137.555 1.00 141.13 ? 29   GLU A CD    1 
ATOM   210   O  OE1   . GLU A 1 29   ? 34.787  13.521  137.108 1.00 135.35 ? 29   GLU A OE1   1 
ATOM   211   O  OE2   . GLU A 1 29   ? 35.178  15.019  138.655 1.00 139.07 ? 29   GLU A OE2   1 
ATOM   212   N  N     . ARG A 1 30   ? 36.216  11.070  134.748 1.00 140.05 ? 30   ARG A N     1 
ATOM   213   C  CA    . ARG A 1 30   ? 36.067  9.961   133.793 1.00 142.93 ? 30   ARG A CA    1 
ATOM   214   C  C     . ARG A 1 30   ? 36.428  10.372  132.362 1.00 141.22 ? 30   ARG A C     1 
ATOM   215   O  O     . ARG A 1 30   ? 36.087  11.467  131.914 1.00 141.08 ? 30   ARG A O     1 
ATOM   216   C  CB    . ARG A 1 30   ? 34.650  9.358   133.843 1.00 153.47 ? 30   ARG A CB    1 
ATOM   217   C  CG    . ARG A 1 30   ? 34.442  8.082   132.974 1.00 158.07 ? 30   ARG A CG    1 
ATOM   218   C  CD    . ARG A 1 30   ? 32.954  7.673   132.884 1.00 162.24 ? 30   ARG A CD    1 
ATOM   219   N  NE    . ARG A 1 30   ? 32.135  8.801   132.430 1.00 160.64 ? 30   ARG A NE    1 
ATOM   220   C  CZ    . ARG A 1 30   ? 31.528  8.876   131.249 1.00 149.98 ? 30   ARG A CZ    1 
ATOM   221   N  NH1   . ARG A 1 30   ? 31.605  7.868   130.390 1.00 153.56 ? 30   ARG A NH1   1 
ATOM   222   N  NH2   . ARG A 1 30   ? 30.827  9.958   130.934 1.00 135.23 ? 30   ARG A NH2   1 
ATOM   223   N  N     . GLY A 1 31   ? 37.159  9.508   131.662 1.00 140.41 ? 31   GLY A N     1 
ATOM   224   C  CA    . GLY A 1 31   ? 37.492  9.751   130.268 1.00 140.90 ? 31   GLY A CA    1 
ATOM   225   C  C     . GLY A 1 31   ? 38.676  10.679  130.065 1.00 135.30 ? 31   GLY A C     1 
ATOM   226   O  O     . GLY A 1 31   ? 39.277  10.697  128.984 1.00 131.23 ? 31   GLY A O     1 
ATOM   227   N  N     . PHE A 1 32   ? 39.018  11.428  131.116 1.00 133.67 ? 32   PHE A N     1 
ATOM   228   C  CA    . PHE A 1 32   ? 40.193  12.304  131.142 1.00 127.82 ? 32   PHE A CA    1 
ATOM   229   C  C     . PHE A 1 32   ? 41.472  11.471  131.187 1.00 124.27 ? 32   PHE A C     1 
ATOM   230   O  O     . PHE A 1 32   ? 42.572  12.008  131.245 1.00 119.18 ? 32   PHE A O     1 
ATOM   231   C  CB    . PHE A 1 32   ? 40.140  13.282  132.322 1.00 130.94 ? 32   PHE A CB    1 
ATOM   232   C  CG    . PHE A 1 32   ? 39.482  14.602  132.001 1.00 135.53 ? 32   PHE A CG    1 
ATOM   233   C  CD1   . PHE A 1 32   ? 38.385  14.670  131.140 1.00 136.98 ? 32   PHE A CD1   1 
ATOM   234   C  CD2   . PHE A 1 32   ? 39.952  15.775  132.582 1.00 133.06 ? 32   PHE A CD2   1 
ATOM   235   C  CE1   . PHE A 1 32   ? 37.781  15.891  130.855 1.00 132.89 ? 32   PHE A CE1   1 
ATOM   236   C  CE2   . PHE A 1 32   ? 39.358  16.995  132.307 1.00 133.04 ? 32   PHE A CE2   1 
ATOM   237   C  CZ    . PHE A 1 32   ? 38.271  17.056  131.441 1.00 134.16 ? 32   PHE A CZ    1 
ATOM   238   N  N     . GLY A 1 33   ? 41.309  10.153  131.232 1.00 129.31 ? 33   GLY A N     1 
ATOM   239   C  CA    . GLY A 1 33   ? 42.420  9.238   131.055 1.00 125.96 ? 33   GLY A CA    1 
ATOM   240   C  C     . GLY A 1 33   ? 43.160  9.492   129.756 1.00 118.90 ? 33   GLY A C     1 
ATOM   241   O  O     . GLY A 1 33   ? 44.376  9.639   129.752 1.00 116.40 ? 33   GLY A O     1 
ATOM   242   N  N     . VAL A 1 34   ? 42.430  9.536   128.647 1.00 118.54 ? 34   VAL A N     1 
ATOM   243   C  CA    . VAL A 1 34   ? 43.051  9.801   127.354 1.00 119.16 ? 34   VAL A CA    1 
ATOM   244   C  C     . VAL A 1 34   ? 43.018  11.274  126.948 1.00 117.00 ? 34   VAL A C     1 
ATOM   245   O  O     . VAL A 1 34   ? 43.653  11.666  125.965 1.00 120.43 ? 34   VAL A O     1 
ATOM   246   C  CB    . VAL A 1 34   ? 42.488  8.894   126.225 1.00 121.77 ? 34   VAL A CB    1 
ATOM   247   C  CG1   . VAL A 1 34   ? 41.768  7.700   126.828 1.00 124.36 ? 34   VAL A CG1   1 
ATOM   248   C  CG2   . VAL A 1 34   ? 41.570  9.662   125.288 1.00 120.22 ? 34   VAL A CG2   1 
ATOM   249   N  N     . THR A 1 35   ? 42.293  12.097  127.697 1.00 115.21 ? 35   THR A N     1 
ATOM   250   C  CA    . THR A 1 35   ? 42.354  13.528  127.434 1.00 113.64 ? 35   THR A CA    1 
ATOM   251   C  C     . THR A 1 35   ? 43.755  14.009  127.807 1.00 113.25 ? 35   THR A C     1 
ATOM   252   O  O     . THR A 1 35   ? 44.357  14.803  127.100 1.00 115.08 ? 35   THR A O     1 
ATOM   253   C  CB    . THR A 1 35   ? 41.237  14.326  128.138 1.00 110.01 ? 35   THR A CB    1 
ATOM   254   O  OG1   . THR A 1 35   ? 39.989  14.037  127.506 1.00 108.48 ? 35   THR A OG1   1 
ATOM   255   C  CG2   . THR A 1 35   ? 41.482  15.812  128.019 1.00 105.94 ? 35   THR A CG2   1 
ATOM   256   N  N     . LEU A 1 36   ? 44.287  13.499  128.906 1.00 114.68 ? 36   LEU A N     1 
ATOM   257   C  CA    . LEU A 1 36   ? 45.675  13.762  129.254 1.00 114.66 ? 36   LEU A CA    1 
ATOM   258   C  C     . LEU A 1 36   ? 46.636  12.880  128.463 1.00 115.08 ? 36   LEU A C     1 
ATOM   259   O  O     . LEU A 1 36   ? 47.602  13.365  127.888 1.00 115.03 ? 36   LEU A O     1 
ATOM   260   C  CB    . LEU A 1 36   ? 45.914  13.514  130.749 1.00 123.90 ? 36   LEU A CB    1 
ATOM   261   C  CG    . LEU A 1 36   ? 46.156  14.636  131.762 1.00 122.00 ? 36   LEU A CG    1 
ATOM   262   C  CD1   . LEU A 1 36   ? 46.680  14.043  133.072 1.00 124.43 ? 36   LEU A CD1   1 
ATOM   263   C  CD2   . LEU A 1 36   ? 47.101  15.706  131.231 1.00 125.70 ? 36   LEU A CD2   1 
ATOM   264   N  N     . GLY A 1 37   ? 46.363  11.580  128.440 1.00 116.54 ? 37   GLY A N     1 
ATOM   265   C  CA    . GLY A 1 37   ? 47.320  10.607  127.948 1.00 115.28 ? 37   GLY A CA    1 
ATOM   266   C  C     . GLY A 1 37   ? 47.819  10.846  126.538 1.00 117.15 ? 37   GLY A C     1 
ATOM   267   O  O     . GLY A 1 37   ? 49.024  10.925  126.319 1.00 118.19 ? 37   GLY A O     1 
ATOM   268   N  N     . ASN A 1 38   ? 46.898  10.955  125.583 1.00 118.05 ? 38   ASN A N     1 
ATOM   269   C  CA    . ASN A 1 38   ? 47.261  10.988  124.159 1.00 117.22 ? 38   ASN A CA    1 
ATOM   270   C  C     . ASN A 1 38   ? 48.029  12.197  123.598 1.00 116.62 ? 38   ASN A C     1 
ATOM   271   O  O     . ASN A 1 38   ? 48.872  12.031  122.724 1.00 119.32 ? 38   ASN A O     1 
ATOM   272   C  CB    . ASN A 1 38   ? 46.099  10.575  123.254 1.00 117.31 ? 38   ASN A CB    1 
ATOM   273   C  CG    . ASN A 1 38   ? 46.566  9.734   122.077 1.00 122.85 ? 38   ASN A CG    1 
ATOM   274   O  OD1   . ASN A 1 38   ? 46.874  8.551   122.222 1.00 121.63 ? 38   ASN A OD1   1 
ATOM   275   N  ND2   . ASN A 1 38   ? 46.647  10.350  120.907 1.00 127.26 ? 38   ASN A ND2   1 
ATOM   276   N  N     . PRO A 1 39   ? 47.718  13.413  124.060 1.00 112.30 ? 39   PRO A N     1 
ATOM   277   C  CA    . PRO A 1 39   ? 48.649  14.507  123.779 1.00 113.77 ? 39   PRO A CA    1 
ATOM   278   C  C     . PRO A 1 39   ? 50.064  14.159  124.225 1.00 116.86 ? 39   PRO A C     1 
ATOM   279   O  O     . PRO A 1 39   ? 51.018  14.367  123.485 1.00 115.88 ? 39   PRO A O     1 
ATOM   280   C  CB    . PRO A 1 39   ? 48.127  15.635  124.656 1.00 107.97 ? 39   PRO A CB    1 
ATOM   281   C  CG    . PRO A 1 39   ? 46.726  15.353  124.819 1.00 105.39 ? 39   PRO A CG    1 
ATOM   282   C  CD    . PRO A 1 39   ? 46.444  13.909  124.585 1.00 109.61 ? 39   PRO A CD    1 
ATOM   283   N  N     . LEU A 1 40   ? 50.188  13.610  125.428 1.00 120.29 ? 40   LEU A N     1 
ATOM   284   C  CA    . LEU A 1 40   ? 51.497  13.313  126.002 1.00 122.27 ? 40   LEU A CA    1 
ATOM   285   C  C     . LEU A 1 40   ? 52.180  12.158  125.283 1.00 120.21 ? 40   LEU A C     1 
ATOM   286   O  O     . LEU A 1 40   ? 53.400  12.073  125.250 1.00 124.94 ? 40   LEU A O     1 
ATOM   287   C  CB    . LEU A 1 40   ? 51.404  13.026  127.509 1.00 120.85 ? 40   LEU A CB    1 
ATOM   288   C  CG    . LEU A 1 40   ? 51.137  14.191  128.472 1.00 120.53 ? 40   LEU A CG    1 
ATOM   289   C  CD1   . LEU A 1 40   ? 51.315  13.741  129.915 1.00 119.16 ? 40   LEU A CD1   1 
ATOM   290   C  CD2   . LEU A 1 40   ? 52.028  15.390  128.173 1.00 126.59 ? 40   LEU A CD2   1 
ATOM   291   N  N     . ARG A 1 41   ? 51.398  11.264  124.703 1.00 117.19 ? 41   ARG A N     1 
ATOM   292   C  CA    . ARG A 1 41   ? 51.992  10.212  123.911 1.00 116.52 ? 41   ARG A CA    1 
ATOM   293   C  C     . ARG A 1 41   ? 52.547  10.863  122.663 1.00 120.63 ? 41   ARG A C     1 
ATOM   294   O  O     . ARG A 1 41   ? 53.727  10.730  122.355 1.00 124.43 ? 41   ARG A O     1 
ATOM   295   C  CB    . ARG A 1 41   ? 50.950  9.174   123.529 1.00 113.44 ? 41   ARG A CB    1 
ATOM   296   C  CG    . ARG A 1 41   ? 51.535  8.032   122.779 1.00 108.26 ? 41   ARG A CG    1 
ATOM   297   C  CD    . ARG A 1 41   ? 50.486  7.090   122.287 1.00 108.97 ? 41   ARG A CD    1 
ATOM   298   N  NE    . ARG A 1 41   ? 51.141  5.960   121.646 1.00 118.16 ? 41   ARG A NE    1 
ATOM   299   C  CZ    . ARG A 1 41   ? 51.185  5.754   120.334 1.00 122.53 ? 41   ARG A CZ    1 
ATOM   300   N  NH1   . ARG A 1 41   ? 50.575  6.586   119.491 1.00 119.67 ? 41   ARG A NH1   1 
ATOM   301   N  NH2   . ARG A 1 41   ? 51.829  4.694   119.868 1.00 120.14 ? 41   ARG A NH2   1 
ATOM   302   N  N     . ARG A 1 42   ? 51.690  11.604  121.970 1.00 119.45 ? 42   ARG A N     1 
ATOM   303   C  CA    . ARG A 1 42   ? 52.022  12.184  120.672 1.00 122.23 ? 42   ARG A CA    1 
ATOM   304   C  C     . ARG A 1 42   ? 53.102  13.278  120.715 1.00 126.60 ? 42   ARG A C     1 
ATOM   305   O  O     . ARG A 1 42   ? 53.707  13.604  119.685 1.00 126.93 ? 42   ARG A O     1 
ATOM   306   C  CB    . ARG A 1 42   ? 50.752  12.724  120.013 1.00 123.96 ? 42   ARG A CB    1 
ATOM   307   C  CG    . ARG A 1 42   ? 49.685  11.671  119.737 1.00 118.46 ? 42   ARG A CG    1 
ATOM   308   C  CD    . ARG A 1 42   ? 48.401  12.337  119.259 1.00 119.27 ? 42   ARG A CD    1 
ATOM   309   N  NE    . ARG A 1 42   ? 48.682  13.452  118.361 1.00 124.97 ? 42   ARG A NE    1 
ATOM   310   C  CZ    . ARG A 1 42   ? 49.070  13.309  117.098 1.00 126.39 ? 42   ARG A CZ    1 
ATOM   311   N  NH1   . ARG A 1 42   ? 49.220  12.096  116.584 1.00 122.45 ? 42   ARG A NH1   1 
ATOM   312   N  NH2   . ARG A 1 42   ? 49.313  14.374  116.348 1.00 129.23 ? 42   ARG A NH2   1 
ATOM   313   N  N     . ILE A 1 43   ? 53.311  13.867  121.891 1.00 126.22 ? 43   ILE A N     1 
ATOM   314   C  CA    . ILE A 1 43   ? 54.429  14.785  122.101 1.00 125.92 ? 43   ILE A CA    1 
ATOM   315   C  C     . ILE A 1 43   ? 55.719  14.002  122.371 1.00 127.33 ? 43   ILE A C     1 
ATOM   316   O  O     . ILE A 1 43   ? 56.795  14.373  121.901 1.00 127.47 ? 43   ILE A O     1 
ATOM   317   C  CB    . ILE A 1 43   ? 54.164  15.757  123.264 1.00 121.30 ? 43   ILE A CB    1 
ATOM   318   C  CG1   . ILE A 1 43   ? 52.917  16.582  122.994 1.00 121.25 ? 43   ILE A CG1   1 
ATOM   319   C  CG2   . ILE A 1 43   ? 55.333  16.694  123.453 1.00 125.48 ? 43   ILE A CG2   1 
ATOM   320   C  CD1   . ILE A 1 43   ? 52.317  17.147  124.247 1.00 123.59 ? 43   ILE A CD1   1 
ATOM   321   N  N     . LEU A 1 44   ? 55.598  12.917  123.133 1.00 126.14 ? 44   LEU A N     1 
ATOM   322   C  CA    . LEU A 1 44   ? 56.740  12.078  123.475 1.00 123.42 ? 44   LEU A CA    1 
ATOM   323   C  C     . LEU A 1 44   ? 57.293  11.363  122.257 1.00 127.50 ? 44   LEU A C     1 
ATOM   324   O  O     . LEU A 1 44   ? 58.500  11.231  122.110 1.00 133.39 ? 44   LEU A O     1 
ATOM   325   C  CB    . LEU A 1 44   ? 56.370  11.036  124.532 1.00 115.50 ? 44   LEU A CB    1 
ATOM   326   C  CG    . LEU A 1 44   ? 56.267  11.474  125.986 1.00 113.36 ? 44   LEU A CG    1 
ATOM   327   C  CD1   . LEU A 1 44   ? 55.740  10.309  126.753 1.00 118.82 ? 44   LEU A CD1   1 
ATOM   328   C  CD2   . LEU A 1 44   ? 57.588  11.919  126.555 1.00 118.77 ? 44   LEU A CD2   1 
ATOM   329   N  N     . LEU A 1 45   ? 56.424  10.892  121.375 1.00 124.82 ? 45   LEU A N     1 
ATOM   330   C  CA    . LEU A 1 45   ? 56.930  10.141  120.237 1.00 126.45 ? 45   LEU A CA    1 
ATOM   331   C  C     . LEU A 1 45   ? 57.565  11.053  119.167 1.00 135.82 ? 45   LEU A C     1 
ATOM   332   O  O     . LEU A 1 45   ? 58.326  10.581  118.320 1.00 141.35 ? 45   LEU A O     1 
ATOM   333   C  CB    . LEU A 1 45   ? 55.863  9.188   119.672 1.00 119.22 ? 45   LEU A CB    1 
ATOM   334   C  CG    . LEU A 1 45   ? 55.551  7.960   120.546 1.00 111.19 ? 45   LEU A CG    1 
ATOM   335   C  CD1   . LEU A 1 45   ? 54.488  7.066   119.933 1.00 101.87 ? 45   LEU A CD1   1 
ATOM   336   C  CD2   . LEU A 1 45   ? 56.801  7.152   120.853 1.00 112.76 ? 45   LEU A CD2   1 
ATOM   337   N  N     . SER A 1 46   ? 57.295  12.358  119.230 1.00 134.96 ? 46   SER A N     1 
ATOM   338   C  CA    . SER A 1 46   ? 57.898  13.296  118.273 1.00 134.57 ? 46   SER A CA    1 
ATOM   339   C  C     . SER A 1 46   ? 58.971  14.228  118.858 1.00 132.63 ? 46   SER A C     1 
ATOM   340   O  O     . SER A 1 46   ? 60.178  14.083  118.591 1.00 126.13 ? 46   SER A O     1 
ATOM   341   C  CB    . SER A 1 46   ? 56.809  14.137  117.581 1.00 131.41 ? 46   SER A CB    1 
ATOM   342   O  OG    . SER A 1 46   ? 56.199  15.067  118.463 1.00 121.79 ? 46   SER A OG    1 
ATOM   343   N  N     . SER A 1 47   ? 58.497  15.143  119.699 1.00 133.53 ? 47   SER A N     1 
ATOM   344   C  CA    . SER A 1 47   ? 59.166  16.411  120.015 1.00 135.82 ? 47   SER A CA    1 
ATOM   345   C  C     . SER A 1 47   ? 60.171  16.379  121.174 1.00 128.30 ? 47   SER A C     1 
ATOM   346   O  O     . SER A 1 47   ? 60.566  17.421  121.710 1.00 119.53 ? 47   SER A O     1 
ATOM   347   C  CB    . SER A 1 47   ? 58.145  17.547  120.157 1.00 136.31 ? 47   SER A CB    1 
ATOM   348   O  OG    . SER A 1 47   ? 57.431  17.707  118.938 1.00 134.45 ? 47   SER A OG    1 
ATOM   349   N  N     . ILE A 1 48   ? 60.516  15.174  121.601 1.00 128.72 ? 48   ILE A N     1 
ATOM   350   C  CA    . ILE A 1 48   ? 61.647  15.000  122.495 1.00 133.25 ? 48   ILE A CA    1 
ATOM   351   C  C     . ILE A 1 48   ? 62.983  15.141  121.766 1.00 133.56 ? 48   ILE A C     1 
ATOM   352   O  O     . ILE A 1 48   ? 63.250  14.440  120.780 1.00 131.90 ? 48   ILE A O     1 
ATOM   353   C  CB    . ILE A 1 48   ? 61.592  13.653  123.221 1.00 133.70 ? 48   ILE A CB    1 
ATOM   354   C  CG1   . ILE A 1 48   ? 60.267  13.532  123.964 1.00 134.07 ? 48   ILE A CG1   1 
ATOM   355   C  CG2   . ILE A 1 48   ? 62.737  13.529  124.207 1.00 133.06 ? 48   ILE A CG2   1 
ATOM   356   C  CD1   . ILE A 1 48   ? 59.977  14.706  124.885 1.00 136.65 ? 48   ILE A CD1   1 
ATOM   357   N  N     . PRO A 1 49   ? 63.816  16.077  122.247 1.00 130.98 ? 49   PRO A N     1 
ATOM   358   C  CA    . PRO A 1 49   ? 65.183  16.322  121.782 1.00 132.71 ? 49   PRO A CA    1 
ATOM   359   C  C     . PRO A 1 49   ? 66.124  15.254  122.316 1.00 131.42 ? 49   PRO A C     1 
ATOM   360   O  O     . PRO A 1 49   ? 65.931  14.769  123.432 1.00 131.15 ? 49   PRO A O     1 
ATOM   361   C  CB    . PRO A 1 49   ? 65.522  17.689  122.396 1.00 135.69 ? 49   PRO A CB    1 
ATOM   362   C  CG    . PRO A 1 49   ? 64.182  18.262  122.858 1.00 130.37 ? 49   PRO A CG    1 
ATOM   363   C  CD    . PRO A 1 49   ? 63.393  17.073  123.243 1.00 125.53 ? 49   PRO A CD    1 
ATOM   364   N  N     . GLY A 1 50   ? 67.144  14.913  121.539 1.00 130.09 ? 50   GLY A N     1 
ATOM   365   C  CA    . GLY A 1 50   ? 67.978  13.768  121.844 1.00 131.00 ? 50   GLY A CA    1 
ATOM   366   C  C     . GLY A 1 50   ? 69.275  13.775  121.069 1.00 133.02 ? 50   GLY A C     1 
ATOM   367   O  O     . GLY A 1 50   ? 69.689  14.798  120.533 1.00 132.17 ? 50   GLY A O     1 
ATOM   368   N  N     . THR A 1 51   ? 69.941  12.629  121.033 1.00 135.50 ? 51   THR A N     1 
ATOM   369   C  CA    . THR A 1 51   ? 71.252  12.556  120.407 1.00 137.08 ? 51   THR A CA    1 
ATOM   370   C  C     . THR A 1 51   ? 71.427  11.385  119.433 1.00 139.52 ? 51   THR A C     1 
ATOM   371   O  O     . THR A 1 51   ? 71.237  10.213  119.798 1.00 138.27 ? 51   THR A O     1 
ATOM   372   C  CB    . THR A 1 51   ? 72.351  12.491  121.474 1.00 134.29 ? 51   THR A CB    1 
ATOM   373   O  OG1   . THR A 1 51   ? 72.098  11.388  122.350 1.00 132.69 ? 51   THR A OG1   1 
ATOM   374   C  CG2   . THR A 1 51   ? 72.371  13.769  122.279 1.00 136.83 ? 51   THR A CG2   1 
ATOM   375   N  N     . ALA A 1 52   ? 71.792  11.716  118.195 1.00 132.93 ? 52   ALA A N     1 
ATOM   376   C  CA    . ALA A 1 52   ? 72.085  10.712  117.176 1.00 133.29 ? 52   ALA A CA    1 
ATOM   377   C  C     . ALA A 1 52   ? 73.278  11.131  116.333 1.00 127.16 ? 52   ALA A C     1 
ATOM   378   O  O     . ALA A 1 52   ? 73.710  12.280  116.402 1.00 123.82 ? 52   ALA A O     1 
ATOM   379   C  CB    . ALA A 1 52   ? 70.881  10.470  116.300 1.00 139.19 ? 52   ALA A CB    1 
ATOM   380   N  N     . VAL A 1 53   ? 73.783  10.202  115.521 1.00 127.43 ? 53   VAL A N     1 
ATOM   381   C  CA    . VAL A 1 53   ? 75.025  10.407  114.775 1.00 127.51 ? 53   VAL A CA    1 
ATOM   382   C  C     . VAL A 1 53   ? 74.775  11.056  113.423 1.00 130.22 ? 53   VAL A C     1 
ATOM   383   O  O     . VAL A 1 53   ? 74.173  10.447  112.550 1.00 137.04 ? 53   VAL A O     1 
ATOM   384   C  CB    . VAL A 1 53   ? 75.708  9.055   114.503 1.00 120.69 ? 53   VAL A CB    1 
ATOM   385   C  CG1   . VAL A 1 53   ? 76.843  9.209   113.519 1.00 119.33 ? 53   VAL A CG1   1 
ATOM   386   C  CG2   . VAL A 1 53   ? 76.194  8.447   115.786 1.00 125.25 ? 53   VAL A CG2   1 
ATOM   387   N  N     . THR A 1 54   ? 75.242  12.287  113.242 1.00 125.98 ? 54   THR A N     1 
ATOM   388   C  CA    . THR A 1 54   ? 74.972  13.013  112.002 1.00 126.86 ? 54   THR A CA    1 
ATOM   389   C  C     . THR A 1 54   ? 75.874  12.707  110.784 1.00 135.53 ? 54   THR A C     1 
ATOM   390   O  O     . THR A 1 54   ? 75.359  12.554  109.680 1.00 137.83 ? 54   THR A O     1 
ATOM   391   C  CB    . THR A 1 54   ? 74.878  14.542  112.240 1.00 130.01 ? 54   THR A CB    1 
ATOM   392   O  OG1   . THR A 1 54   ? 76.158  15.060  112.626 1.00 131.25 ? 54   THR A OG1   1 
ATOM   393   C  CG2   . THR A 1 54   ? 73.851  14.840  113.318 1.00 131.02 ? 54   THR A CG2   1 
ATOM   394   N  N     . SER A 1 55   ? 77.194  12.610  110.982 1.00 138.12 ? 55   SER A N     1 
ATOM   395   C  CA    . SER A 1 55   ? 78.159  12.465  109.876 1.00 128.14 ? 55   SER A CA    1 
ATOM   396   C  C     . SER A 1 55   ? 79.382  11.624  110.263 1.00 125.19 ? 55   SER A C     1 
ATOM   397   O  O     . SER A 1 55   ? 79.910  11.783  111.353 1.00 130.67 ? 55   SER A O     1 
ATOM   398   C  CB    . SER A 1 55   ? 78.619  13.855  109.442 1.00 125.79 ? 55   SER A CB    1 
ATOM   399   O  OG    . SER A 1 55   ? 79.776  13.813  108.628 1.00 127.69 ? 55   SER A OG    1 
ATOM   400   N  N     . VAL A 1 56   ? 79.852  10.757  109.368 1.00 123.69 ? 56   VAL A N     1 
ATOM   401   C  CA    . VAL A 1 56   ? 81.006  9.881   109.650 1.00 127.28 ? 56   VAL A CA    1 
ATOM   402   C  C     . VAL A 1 56   ? 82.188  10.102  108.674 1.00 134.61 ? 56   VAL A C     1 
ATOM   403   O  O     . VAL A 1 56   ? 81.971  10.490  107.531 1.00 140.91 ? 56   VAL A O     1 
ATOM   404   C  CB    . VAL A 1 56   ? 80.571  8.397   109.601 1.00 119.11 ? 56   VAL A CB    1 
ATOM   405   C  CG1   . VAL A 1 56   ? 81.671  7.489   110.095 1.00 124.32 ? 56   VAL A CG1   1 
ATOM   406   C  CG2   . VAL A 1 56   ? 79.334  8.192   110.428 1.00 122.95 ? 56   VAL A CG2   1 
ATOM   407   N  N     . TYR A 1 57   ? 83.432  9.886   109.114 1.00 136.87 ? 57   TYR A N     1 
ATOM   408   C  CA    . TYR A 1 57   ? 84.585  9.828   108.184 1.00 147.90 ? 57   TYR A CA    1 
ATOM   409   C  C     . TYR A 1 57   ? 85.410  8.570   108.450 1.00 149.38 ? 57   TYR A C     1 
ATOM   410   O  O     . TYR A 1 57   ? 85.642  8.223   109.599 1.00 149.88 ? 57   TYR A O     1 
ATOM   411   C  CB    . TYR A 1 57   ? 85.483  11.092  108.252 1.00 153.55 ? 57   TYR A CB    1 
ATOM   412   C  CG    . TYR A 1 57   ? 86.809  11.022  107.467 1.00 157.13 ? 57   TYR A CG    1 
ATOM   413   C  CD1   . TYR A 1 57   ? 86.838  11.081  106.073 1.00 160.60 ? 57   TYR A CD1   1 
ATOM   414   C  CD2   . TYR A 1 57   ? 88.031  10.925  108.127 1.00 155.23 ? 57   TYR A CD2   1 
ATOM   415   C  CE1   . TYR A 1 57   ? 88.054  11.023  105.366 1.00 160.05 ? 57   TYR A CE1   1 
ATOM   416   C  CE2   . TYR A 1 57   ? 89.243  10.865  107.419 1.00 158.89 ? 57   TYR A CE2   1 
ATOM   417   C  CZ    . TYR A 1 57   ? 89.245  10.920  106.044 1.00 158.33 ? 57   TYR A CZ    1 
ATOM   418   O  OH    . TYR A 1 57   ? 90.430  10.865  105.342 1.00 153.62 ? 57   TYR A OH    1 
ATOM   419   N  N     . ILE A 1 58   ? 85.841  7.891   107.389 1.00 151.52 ? 58   ILE A N     1 
ATOM   420   C  CA    . ILE A 1 58   ? 86.680  6.705   107.526 1.00 150.66 ? 58   ILE A CA    1 
ATOM   421   C  C     . ILE A 1 58   ? 88.041  6.982   106.920 1.00 153.87 ? 58   ILE A C     1 
ATOM   422   O  O     . ILE A 1 58   ? 88.160  7.837   106.043 1.00 157.46 ? 58   ILE A O     1 
ATOM   423   C  CB    . ILE A 1 58   ? 86.058  5.495   106.823 1.00 151.29 ? 58   ILE A CB    1 
ATOM   424   C  CG1   . ILE A 1 58   ? 84.617  5.316   107.271 1.00 144.85 ? 58   ILE A CG1   1 
ATOM   425   C  CG2   . ILE A 1 58   ? 86.808  4.222   107.164 1.00 155.95 ? 58   ILE A CG2   1 
ATOM   426   C  CD1   . ILE A 1 58   ? 84.498  4.891   108.700 1.00 141.93 ? 58   ILE A CD1   1 
ATOM   427   N  N     . GLU A 1 59   ? 89.050  6.256   107.395 1.00 154.89 ? 59   GLU A N     1 
ATOM   428   C  CA    . GLU A 1 59   ? 90.427  6.441   106.977 1.00 162.79 ? 59   GLU A CA    1 
ATOM   429   C  C     . GLU A 1 59   ? 90.461  6.549   105.463 1.00 164.93 ? 59   GLU A C     1 
ATOM   430   O  O     . GLU A 1 59   ? 90.584  7.654   104.919 1.00 162.78 ? 59   GLU A O     1 
ATOM   431   C  CB    . GLU A 1 59   ? 91.262  5.243   107.467 1.00 169.08 ? 59   GLU A CB    1 
ATOM   432   C  CG    . GLU A 1 59   ? 92.684  5.103   106.885 1.00 179.91 ? 59   GLU A CG    1 
ATOM   433   C  CD    . GLU A 1 59   ? 93.706  6.057   107.505 1.00 181.73 ? 59   GLU A CD    1 
ATOM   434   O  OE1   . GLU A 1 59   ? 93.303  6.987   108.244 1.00 182.32 ? 59   GLU A OE1   1 
ATOM   435   O  OE2   . GLU A 1 59   ? 94.918  5.876   107.244 1.00 179.26 ? 59   GLU A OE2   1 
ATOM   436   N  N     . ASP A 1 60   ? 90.270  5.432   104.772 1.00 165.18 ? 60   ASP A N     1 
ATOM   437   C  CA    . ASP A 1 60   ? 90.085  5.540   103.344 1.00 162.63 ? 60   ASP A CA    1 
ATOM   438   C  C     . ASP A 1 60   ? 88.679  5.086   103.018 1.00 158.80 ? 60   ASP A C     1 
ATOM   439   O  O     . ASP A 1 60   ? 88.405  3.891   102.898 1.00 155.61 ? 60   ASP A O     1 
ATOM   440   C  CB    . ASP A 1 60   ? 91.105  4.659   102.620 1.00 165.42 ? 60   ASP A CB    1 
ATOM   441   C  CG    . ASP A 1 60   ? 92.539  4.995   102.998 1.00 165.96 ? 60   ASP A CG    1 
ATOM   442   O  OD1   . ASP A 1 60   ? 92.943  6.159   102.797 1.00 165.26 ? 60   ASP A OD1   1 
ATOM   443   O  OD2   . ASP A 1 60   ? 93.256  4.103   103.507 1.00 164.43 ? 60   ASP A OD2   1 
ATOM   444   N  N     . VAL A 1 61   ? 87.795  6.063   102.871 1.00 157.09 ? 61   VAL A N     1 
ATOM   445   C  CA    . VAL A 1 61   ? 86.515  5.884   102.219 1.00 150.35 ? 61   VAL A CA    1 
ATOM   446   C  C     . VAL A 1 61   ? 86.155  7.215   101.567 1.00 147.04 ? 61   VAL A C     1 
ATOM   447   O  O     . VAL A 1 61   ? 86.190  8.263   102.222 1.00 148.86 ? 61   VAL A O     1 
ATOM   448   C  CB    . VAL A 1 61   ? 85.439  5.419   103.215 1.00 148.25 ? 61   VAL A CB    1 
ATOM   449   C  CG1   . VAL A 1 61   ? 84.081  5.993   102.863 1.00 147.98 ? 61   VAL A CG1   1 
ATOM   450   C  CG2   . VAL A 1 61   ? 85.385  3.897   103.258 1.00 141.89 ? 61   VAL A CG2   1 
ATOM   451   N  N     . LEU A 1 62   ? 85.812  7.181   100.289 1.00 139.05 ? 62   LEU A N     1 
ATOM   452   C  CA    . LEU A 1 62   ? 85.410  8.392   99.591  1.00 140.84 ? 62   LEU A CA    1 
ATOM   453   C  C     . LEU A 1 62   ? 83.919  8.703   99.794  1.00 137.28 ? 62   LEU A C     1 
ATOM   454   O  O     . LEU A 1 62   ? 83.481  9.868   99.724  1.00 127.74 ? 62   LEU A O     1 
ATOM   455   C  CB    . LEU A 1 62   ? 85.739  8.235   98.106  1.00 143.58 ? 62   LEU A CB    1 
ATOM   456   C  CG    . LEU A 1 62   ? 87.207  7.949   97.777  1.00 138.26 ? 62   LEU A CG    1 
ATOM   457   C  CD1   . LEU A 1 62   ? 87.394  7.520   96.323  1.00 135.43 ? 62   LEU A CD1   1 
ATOM   458   C  CD2   . LEU A 1 62   ? 88.047  9.176   98.072  1.00 142.19 ? 62   LEU A CD2   1 
ATOM   459   N  N     . HIS A 1 63   ? 83.170  7.653   100.129 1.00 135.85 ? 63   HIS A N     1 
ATOM   460   C  CA    . HIS A 1 63   ? 81.713  7.671   100.081 1.00 136.59 ? 63   HIS A CA    1 
ATOM   461   C  C     . HIS A 1 63   ? 81.096  6.384   100.661 1.00 135.35 ? 63   HIS A C     1 
ATOM   462   O  O     . HIS A 1 63   ? 81.778  5.355   100.749 1.00 130.35 ? 63   HIS A O     1 
ATOM   463   C  CB    . HIS A 1 63   ? 81.259  7.854   98.629  1.00 140.01 ? 63   HIS A CB    1 
ATOM   464   C  CG    . HIS A 1 63   ? 81.709  6.759   97.696  1.00 138.99 ? 63   HIS A CG    1 
ATOM   465   N  ND1   . HIS A 1 63   ? 81.645  5.421   98.018  1.00 135.02 ? 63   HIS A ND1   1 
ATOM   466   C  CD2   . HIS A 1 63   ? 82.203  6.816   96.434  1.00 137.12 ? 63   HIS A CD2   1 
ATOM   467   C  CE1   . HIS A 1 63   ? 82.088  4.699   97.003  1.00 134.29 ? 63   HIS A CE1   1 
ATOM   468   N  NE2   . HIS A 1 63   ? 82.433  5.521   96.029  1.00 136.14 ? 63   HIS A NE2   1 
ATOM   469   N  N     . GLU A 1 64   ? 79.797  6.443   100.998 1.00 135.62 ? 64   GLU A N     1 
ATOM   470   C  CA    . GLU A 1 64   ? 79.085  5.375   101.741 1.00 132.45 ? 64   GLU A CA    1 
ATOM   471   C  C     . GLU A 1 64   ? 79.154  3.984   101.069 1.00 133.60 ? 64   GLU A C     1 
ATOM   472   O  O     . GLU A 1 64   ? 79.020  2.958   101.742 1.00 130.63 ? 64   GLU A O     1 
ATOM   473   C  CB    . GLU A 1 64   ? 77.609  5.785   102.052 1.00 125.31 ? 64   GLU A CB    1 
ATOM   474   C  CG    . GLU A 1 64   ? 76.841  4.895   103.099 1.00 128.41 ? 64   GLU A CG    1 
ATOM   475   C  CD    . GLU A 1 64   ? 75.365  5.307   103.352 1.00 126.70 ? 64   GLU A CD    1 
ATOM   476   O  OE1   . GLU A 1 64   ? 75.021  6.490   103.130 1.00 124.55 ? 64   GLU A OE1   1 
ATOM   477   O  OE2   . GLU A 1 64   ? 74.549  4.445   103.780 1.00 117.58 ? 64   GLU A OE2   1 
ATOM   478   N  N     . PHE A 1 65   ? 79.409  3.956   99.759  1.00 135.39 ? 65   PHE A N     1 
ATOM   479   C  CA    . PHE A 1 65   ? 79.293  2.734   98.953  1.00 128.25 ? 65   PHE A CA    1 
ATOM   480   C  C     . PHE A 1 65   ? 80.567  1.915   98.888  1.00 123.94 ? 65   PHE A C     1 
ATOM   481   O  O     . PHE A 1 65   ? 80.653  0.984   98.097  1.00 122.12 ? 65   PHE A O     1 
ATOM   482   C  CB    . PHE A 1 65   ? 78.809  3.047   97.534  1.00 126.25 ? 65   PHE A CB    1 
ATOM   483   C  CG    . PHE A 1 65   ? 77.425  3.652   97.480  1.00 126.20 ? 65   PHE A CG    1 
ATOM   484   C  CD1   . PHE A 1 65   ? 77.252  5.018   97.315  1.00 126.83 ? 65   PHE A CD1   1 
ATOM   485   C  CD2   . PHE A 1 65   ? 76.296  2.852   97.596  1.00 120.23 ? 65   PHE A CD2   1 
ATOM   486   C  CE1   . PHE A 1 65   ? 75.980  5.570   97.266  1.00 125.18 ? 65   PHE A CE1   1 
ATOM   487   C  CE2   . PHE A 1 65   ? 75.016  3.403   97.548  1.00 114.88 ? 65   PHE A CE2   1 
ATOM   488   C  CZ    . PHE A 1 65   ? 74.859  4.759   97.383  1.00 117.76 ? 65   PHE A CZ    1 
ATOM   489   N  N     . SER A 1 66   ? 81.562  2.301   99.682  1.00 126.73 ? 66   SER A N     1 
ATOM   490   C  CA    . SER A 1 66   ? 82.849  1.603   99.727  1.00 135.45 ? 66   SER A CA    1 
ATOM   491   C  C     . SER A 1 66   ? 82.838  0.317   100.566 1.00 130.27 ? 66   SER A C     1 
ATOM   492   O  O     . SER A 1 66   ? 81.808  -0.075  101.115 1.00 123.44 ? 66   SER A O     1 
ATOM   493   C  CB    . SER A 1 66   ? 83.951  2.545   100.242 1.00 139.09 ? 66   SER A CB    1 
ATOM   494   O  OG    . SER A 1 66   ? 84.472  3.371   99.210  1.00 141.21 ? 66   SER A OG    1 
ATOM   495   N  N     . THR A 1 67   ? 83.991  -0.349  100.618 1.00 131.49 ? 67   THR A N     1 
ATOM   496   C  CA    . THR A 1 67   ? 84.238  -1.431  101.566 1.00 130.49 ? 67   THR A CA    1 
ATOM   497   C  C     . THR A 1 67   ? 85.735  -1.494  101.893 1.00 135.12 ? 67   THR A C     1 
ATOM   498   O  O     . THR A 1 67   ? 86.570  -1.299  101.004 1.00 138.48 ? 67   THR A O     1 
ATOM   499   C  CB    . THR A 1 67   ? 83.759  -2.778  101.023 1.00 125.88 ? 67   THR A CB    1 
ATOM   500   O  OG1   . THR A 1 67   ? 84.263  -3.833  101.851 1.00 126.05 ? 67   THR A OG1   1 
ATOM   501   C  CG2   . THR A 1 67   ? 84.250  -2.966  99.608  1.00 128.67 ? 67   THR A CG2   1 
ATOM   502   N  N     . ILE A 1 68   ? 86.059  -1.757  103.165 1.00 134.81 ? 68   ILE A N     1 
ATOM   503   C  CA    . ILE A 1 68   ? 87.442  -1.739  103.676 1.00 135.25 ? 68   ILE A CA    1 
ATOM   504   C  C     . ILE A 1 68   ? 88.045  -3.124  103.858 1.00 138.10 ? 68   ILE A C     1 
ATOM   505   O  O     . ILE A 1 68   ? 87.406  -4.004  104.439 1.00 137.74 ? 68   ILE A O     1 
ATOM   506   C  CB    . ILE A 1 68   ? 87.560  -1.048  105.046 1.00 133.40 ? 68   ILE A CB    1 
ATOM   507   C  CG1   . ILE A 1 68   ? 86.721  0.221   105.096 1.00 140.79 ? 68   ILE A CG1   1 
ATOM   508   C  CG2   . ILE A 1 68   ? 89.020  -0.737  105.373 1.00 134.60 ? 68   ILE A CG2   1 
ATOM   509   C  CD1   . ILE A 1 68   ? 86.375  0.628   106.508 1.00 146.04 ? 68   ILE A CD1   1 
ATOM   510   N  N     . PRO A 1 69   ? 89.281  -3.321  103.363 1.00 138.97 ? 69   PRO A N     1 
ATOM   511   C  CA    . PRO A 1 69   ? 89.998  -4.583  103.551 1.00 136.28 ? 69   PRO A CA    1 
ATOM   512   C  C     . PRO A 1 69   ? 90.250  -4.886  105.026 1.00 137.26 ? 69   PRO A C     1 
ATOM   513   O  O     . PRO A 1 69   ? 90.442  -3.971  105.832 1.00 133.16 ? 69   PRO A O     1 
ATOM   514   C  CB    . PRO A 1 69   ? 91.322  -4.342  102.816 1.00 136.96 ? 69   PRO A CB    1 
ATOM   515   C  CG    . PRO A 1 69   ? 91.005  -3.297  101.808 1.00 137.02 ? 69   PRO A CG    1 
ATOM   516   C  CD    . PRO A 1 69   ? 90.039  -2.393  102.505 1.00 139.81 ? 69   PRO A CD    1 
ATOM   517   N  N     . GLY A 1 70   ? 90.225  -6.174  105.362 1.00 141.14 ? 70   GLY A N     1 
ATOM   518   C  CA    . GLY A 1 70   ? 90.403  -6.638  106.720 1.00 139.36 ? 70   GLY A CA    1 
ATOM   519   C  C     . GLY A 1 70   ? 89.094  -6.545  107.467 1.00 143.79 ? 70   GLY A C     1 
ATOM   520   O  O     . GLY A 1 70   ? 88.927  -7.181  108.501 1.00 149.92 ? 70   GLY A O     1 
ATOM   521   N  N     . VAL A 1 71   ? 88.163  -5.756  106.928 1.00 144.53 ? 71   VAL A N     1 
ATOM   522   C  CA    . VAL A 1 71   ? 86.860  -5.518  107.552 1.00 143.03 ? 71   VAL A CA    1 
ATOM   523   C  C     . VAL A 1 71   ? 85.744  -6.285  106.848 1.00 141.71 ? 71   VAL A C     1 
ATOM   524   O  O     . VAL A 1 71   ? 85.596  -6.218  105.624 1.00 138.16 ? 71   VAL A O     1 
ATOM   525   C  CB    . VAL A 1 71   ? 86.505  -4.004  107.607 1.00 138.63 ? 71   VAL A CB    1 
ATOM   526   C  CG1   . VAL A 1 71   ? 85.034  -3.805  107.895 1.00 135.37 ? 71   VAL A CG1   1 
ATOM   527   C  CG2   . VAL A 1 71   ? 87.340  -3.301  108.655 1.00 139.88 ? 71   VAL A CG2   1 
ATOM   528   N  N     . LYS A 1 72   ? 84.971  -7.012  107.652 1.00 142.71 ? 72   LYS A N     1 
ATOM   529   C  CA    . LYS A 1 72   ? 83.874  -7.849  107.186 1.00 143.19 ? 72   LYS A CA    1 
ATOM   530   C  C     . LYS A 1 72   ? 82.687  -7.022  106.659 1.00 147.01 ? 72   LYS A C     1 
ATOM   531   O  O     . LYS A 1 72   ? 82.178  -7.261  105.550 1.00 145.39 ? 72   LYS A O     1 
ATOM   532   C  CB    . LYS A 1 72   ? 83.433  -8.768  108.326 1.00 135.17 ? 72   LYS A CB    1 
ATOM   533   C  CG    . LYS A 1 72   ? 82.396  -9.768  107.921 1.00 135.32 ? 72   LYS A CG    1 
ATOM   534   C  CD    . LYS A 1 72   ? 82.050  -10.668 109.071 1.00 136.96 ? 72   LYS A CD    1 
ATOM   535   C  CE    . LYS A 1 72   ? 80.703  -11.325 108.845 1.00 130.65 ? 72   LYS A CE    1 
ATOM   536   N  NZ    . LYS A 1 72   ? 80.243  -12.099 110.029 1.00 132.22 ? 72   LYS A NZ    1 
ATOM   537   N  N     . GLU A 1 73   ? 82.267  -6.042  107.457 1.00 143.52 ? 73   GLU A N     1 
ATOM   538   C  CA    . GLU A 1 73   ? 81.179  -5.136  107.094 1.00 136.73 ? 73   GLU A CA    1 
ATOM   539   C  C     . GLU A 1 73   ? 81.519  -4.203  105.935 1.00 138.98 ? 73   GLU A C     1 
ATOM   540   O  O     . GLU A 1 73   ? 82.627  -3.670  105.851 1.00 136.49 ? 73   GLU A O     1 
ATOM   541   C  CB    . GLU A 1 73   ? 80.793  -4.267  108.290 1.00 131.85 ? 73   GLU A CB    1 
ATOM   542   C  CG    . GLU A 1 73   ? 79.855  -4.913  109.294 1.00 140.56 ? 73   GLU A CG    1 
ATOM   543   C  CD    . GLU A 1 73   ? 80.585  -5.652  110.401 1.00 148.34 ? 73   GLU A CD    1 
ATOM   544   O  OE1   . GLU A 1 73   ? 81.757  -6.021  110.186 1.00 150.48 ? 73   GLU A OE1   1 
ATOM   545   O  OE2   . GLU A 1 73   ? 79.990  -5.857  111.487 1.00 147.44 ? 73   GLU A OE2   1 
ATOM   546   N  N     . ASP A 1 74   ? 80.552  -3.999  105.047 1.00 140.35 ? 74   ASP A N     1 
ATOM   547   C  CA    . ASP A 1 74   ? 80.607  -2.886  104.104 1.00 136.37 ? 74   ASP A CA    1 
ATOM   548   C  C     . ASP A 1 74   ? 80.337  -1.594  104.866 1.00 131.50 ? 74   ASP A C     1 
ATOM   549   O  O     . ASP A 1 74   ? 79.844  -1.628  105.989 1.00 132.79 ? 74   ASP A O     1 
ATOM   550   C  CB    . ASP A 1 74   ? 79.592  -3.063  102.964 1.00 134.82 ? 74   ASP A CB    1 
ATOM   551   C  CG    . ASP A 1 74   ? 78.204  -3.451  103.460 1.00 131.00 ? 74   ASP A CG    1 
ATOM   552   O  OD1   . ASP A 1 74   ? 77.546  -2.618  104.110 1.00 127.41 ? 74   ASP A OD1   1 
ATOM   553   O  OD2   . ASP A 1 74   ? 77.764  -4.587  103.183 1.00 132.23 ? 74   ASP A OD2   1 
ATOM   554   N  N     . VAL A 1 75   ? 80.686  -0.457  104.278 1.00 126.96 ? 75   VAL A N     1 
ATOM   555   C  CA    . VAL A 1 75   ? 80.418  0.823   104.924 1.00 123.97 ? 75   VAL A CA    1 
ATOM   556   C  C     . VAL A 1 75   ? 78.917  1.057   105.175 1.00 124.78 ? 75   VAL A C     1 
ATOM   557   O  O     . VAL A 1 75   ? 78.550  1.629   106.198 1.00 126.39 ? 75   VAL A O     1 
ATOM   558   C  CB    . VAL A 1 75   ? 81.076  2.013   104.171 1.00 124.25 ? 75   VAL A CB    1 
ATOM   559   C  CG1   . VAL A 1 75   ? 80.482  3.340   104.610 1.00 123.95 ? 75   VAL A CG1   1 
ATOM   560   C  CG2   . VAL A 1 75   ? 82.583  2.013   104.390 1.00 120.38 ? 75   VAL A CG2   1 
ATOM   561   N  N     . VAL A 1 76   ? 78.043  0.593   104.282 1.00 126.26 ? 76   VAL A N     1 
ATOM   562   C  CA    . VAL A 1 76   ? 76.607  0.770   104.523 1.00 125.34 ? 76   VAL A CA    1 
ATOM   563   C  C     . VAL A 1 76   ? 76.185  0.026   105.793 1.00 128.08 ? 76   VAL A C     1 
ATOM   564   O  O     . VAL A 1 76   ? 75.319  0.496   106.528 1.00 125.71 ? 76   VAL A O     1 
ATOM   565   C  CB    . VAL A 1 76   ? 75.702  0.437   103.282 1.00 118.78 ? 76   VAL A CB    1 
ATOM   566   C  CG1   . VAL A 1 76   ? 75.201  -1.001  103.304 1.00 115.80 ? 76   VAL A CG1   1 
ATOM   567   C  CG2   . VAL A 1 76   ? 74.515  1.386   103.236 1.00 114.23 ? 76   VAL A CG2   1 
ATOM   568   N  N     . GLU A 1 77   ? 76.838  -1.103  106.074 1.00 129.82 ? 77   GLU A N     1 
ATOM   569   C  CA    . GLU A 1 77   ? 76.533  -1.888  107.275 1.00 130.62 ? 77   GLU A CA    1 
ATOM   570   C  C     . GLU A 1 77   ? 77.125  -1.281  108.551 1.00 133.40 ? 77   GLU A C     1 
ATOM   571   O  O     . GLU A 1 77   ? 76.671  -1.579  109.654 1.00 136.59 ? 77   GLU A O     1 
ATOM   572   C  CB    . GLU A 1 77   ? 76.970  -3.355  107.117 1.00 128.15 ? 77   GLU A CB    1 
ATOM   573   C  CG    . GLU A 1 77   ? 76.421  -4.297  108.188 1.00 127.90 ? 77   GLU A CG    1 
ATOM   574   C  CD    . GLU A 1 77   ? 76.418  -5.765  107.771 1.00 135.22 ? 77   GLU A CD    1 
ATOM   575   O  OE1   . GLU A 1 77   ? 76.274  -6.612  108.673 1.00 139.56 ? 77   GLU A OE1   1 
ATOM   576   O  OE2   . GLU A 1 77   ? 76.545  -6.080  106.563 1.00 134.87 ? 77   GLU A OE2   1 
ATOM   577   N  N     . ILE A 1 78   ? 78.147  -0.446  108.409 1.00 131.88 ? 78   ILE A N     1 
ATOM   578   C  CA    . ILE A 1 78   ? 78.715  0.227   109.571 1.00 129.47 ? 78   ILE A CA    1 
ATOM   579   C  C     . ILE A 1 78   ? 77.909  1.471   109.934 1.00 128.39 ? 78   ILE A C     1 
ATOM   580   O  O     . ILE A 1 78   ? 77.639  1.708   111.109 1.00 130.99 ? 78   ILE A O     1 
ATOM   581   C  CB    . ILE A 1 78   ? 80.213  0.519   109.392 1.00 126.32 ? 78   ILE A CB    1 
ATOM   582   C  CG1   . ILE A 1 78   ? 80.926  -0.755  108.937 1.00 127.62 ? 78   ILE A CG1   1 
ATOM   583   C  CG2   . ILE A 1 78   ? 80.818  1.016   110.691 1.00 131.91 ? 78   ILE A CG2   1 
ATOM   584   C  CD1   . ILE A 1 78   ? 82.426  -0.649  108.864 1.00 129.55 ? 78   ILE A CD1   1 
ATOM   585   N  N     . ILE A 1 79   ? 77.509  2.238   108.920 1.00 127.32 ? 79   ILE A N     1 
ATOM   586   C  CA    . ILE A 1 79   ? 76.637  3.401   109.100 1.00 129.24 ? 79   ILE A CA    1 
ATOM   587   C  C     . ILE A 1 79   ? 75.333  2.989   109.785 1.00 132.88 ? 79   ILE A C     1 
ATOM   588   O  O     . ILE A 1 79   ? 74.780  3.743   110.596 1.00 132.74 ? 79   ILE A O     1 
ATOM   589   C  CB    . ILE A 1 79   ? 76.337  4.102   107.735 1.00 129.64 ? 79   ILE A CB    1 
ATOM   590   C  CG1   . ILE A 1 79   ? 77.559  4.864   107.237 1.00 127.84 ? 79   ILE A CG1   1 
ATOM   591   C  CG2   . ILE A 1 79   ? 75.191  5.096   107.836 1.00 126.69 ? 79   ILE A CG2   1 
ATOM   592   C  CD1   . ILE A 1 79   ? 77.939  5.992   108.128 1.00 125.80 ? 79   ILE A CD1   1 
ATOM   593   N  N     . LEU A 1 80   ? 74.861  1.780   109.468 1.00 132.31 ? 80   LEU A N     1 
ATOM   594   C  CA    . LEU A 1 80   ? 73.610  1.232   110.023 1.00 132.84 ? 80   LEU A CA    1 
ATOM   595   C  C     . LEU A 1 80   ? 73.776  0.698   111.445 1.00 135.74 ? 80   LEU A C     1 
ATOM   596   O  O     . LEU A 1 80   ? 72.813  0.608   112.226 1.00 130.65 ? 80   LEU A O     1 
ATOM   597   C  CB    . LEU A 1 80   ? 73.077  0.114   109.132 1.00 120.13 ? 80   LEU A CB    1 
ATOM   598   C  CG    . LEU A 1 80   ? 71.915  0.483   108.226 1.00 112.24 ? 80   LEU A CG    1 
ATOM   599   C  CD1   . LEU A 1 80   ? 72.385  1.356   107.089 1.00 119.52 ? 80   LEU A CD1   1 
ATOM   600   C  CD2   . LEU A 1 80   ? 71.299  -0.769  107.708 1.00 106.14 ? 80   LEU A CD2   1 
ATOM   601   N  N     . ASN A 1 81   ? 75.005  0.299   111.746 1.00 137.67 ? 81   ASN A N     1 
ATOM   602   C  CA    . ASN A 1 81   ? 75.388  -0.065  113.088 1.00 136.05 ? 81   ASN A CA    1 
ATOM   603   C  C     . ASN A 1 81   ? 75.682  1.207   113.874 1.00 139.93 ? 81   ASN A C     1 
ATOM   604   O  O     . ASN A 1 81   ? 75.561  1.224   115.092 1.00 147.73 ? 81   ASN A O     1 
ATOM   605   C  CB    . ASN A 1 81   ? 76.580  -1.028  113.068 1.00 135.33 ? 81   ASN A CB    1 
ATOM   606   C  CG    . ASN A 1 81   ? 76.196  -2.434  112.590 1.00 138.15 ? 81   ASN A CG    1 
ATOM   607   O  OD1   . ASN A 1 81   ? 75.049  -2.878  112.740 1.00 135.35 ? 81   ASN A OD1   1 
ATOM   608   N  ND2   . ASN A 1 81   ? 77.163  -3.141  112.017 1.00 136.42 ? 81   ASN A ND2   1 
ATOM   609   N  N     . LEU A 1 82   ? 76.039  2.279   113.167 1.00 139.07 ? 82   LEU A N     1 
ATOM   610   C  CA    . LEU A 1 82   ? 76.326  3.574   113.803 1.00 140.15 ? 82   LEU A CA    1 
ATOM   611   C  C     . LEU A 1 82   ? 75.090  4.422   114.143 1.00 138.69 ? 82   LEU A C     1 
ATOM   612   O  O     . LEU A 1 82   ? 75.175  5.321   114.977 1.00 141.69 ? 82   LEU A O     1 
ATOM   613   C  CB    . LEU A 1 82   ? 77.311  4.408   112.965 1.00 140.98 ? 82   LEU A CB    1 
ATOM   614   C  CG    . LEU A 1 82   ? 78.826  4.180   113.053 1.00 139.05 ? 82   LEU A CG    1 
ATOM   615   C  CD1   . LEU A 1 82   ? 79.485  4.608   111.741 1.00 136.44 ? 82   LEU A CD1   1 
ATOM   616   C  CD2   . LEU A 1 82   ? 79.441  4.939   114.226 1.00 129.26 ? 82   LEU A CD2   1 
ATOM   617   N  N     . LYS A 1 83   ? 73.953  4.161   113.503 1.00 138.27 ? 83   LYS A N     1 
ATOM   618   C  CA    . LYS A 1 83   ? 72.734  4.893   113.846 1.00 142.47 ? 83   LYS A CA    1 
ATOM   619   C  C     . LYS A 1 83   ? 72.307  4.519   115.262 1.00 146.34 ? 83   LYS A C     1 
ATOM   620   O  O     . LYS A 1 83   ? 71.696  5.325   115.978 1.00 148.12 ? 83   LYS A O     1 
ATOM   621   C  CB    . LYS A 1 83   ? 71.601  4.548   112.878 1.00 140.30 ? 83   LYS A CB    1 
ATOM   622   C  CG    . LYS A 1 83   ? 71.639  5.232   111.527 1.00 132.90 ? 83   LYS A CG    1 
ATOM   623   C  CD    . LYS A 1 83   ? 70.448  4.759   110.696 1.00 130.95 ? 83   LYS A CD    1 
ATOM   624   C  CE    . LYS A 1 83   ? 70.370  5.450   109.347 1.00 133.37 ? 83   LYS A CE    1 
ATOM   625   N  NZ    . LYS A 1 83   ? 69.177  4.996   108.578 1.00 129.48 ? 83   LYS A NZ    1 
ATOM   626   N  N     . GLU A 1 84   ? 72.644  3.287   115.647 1.00 146.62 ? 84   GLU A N     1 
ATOM   627   C  CA    . GLU A 1 84   ? 72.237  2.699   116.923 1.00 146.55 ? 84   GLU A CA    1 
ATOM   628   C  C     . GLU A 1 84   ? 72.955  3.300   118.116 1.00 142.40 ? 84   GLU A C     1 
ATOM   629   O  O     . GLU A 1 84   ? 72.604  3.030   119.269 1.00 141.73 ? 84   GLU A O     1 
ATOM   630   C  CB    . GLU A 1 84   ? 72.488  1.181   116.929 1.00 147.58 ? 84   GLU A CB    1 
ATOM   631   C  CG    . GLU A 1 84   ? 71.839  0.401   115.792 1.00 152.19 ? 84   GLU A CG    1 
ATOM   632   C  CD    . GLU A 1 84   ? 70.319  0.496   115.788 1.00 172.67 ? 84   GLU A CD    1 
ATOM   633   O  OE1   . GLU A 1 84   ? 69.729  0.951   116.794 1.00 176.55 ? 84   GLU A OE1   1 
ATOM   634   O  OE2   . GLU A 1 84   ? 69.705  0.111   114.768 1.00 185.78 ? 84   GLU A OE2   1 
ATOM   635   N  N     . LEU A 1 85   ? 73.952  4.130   117.850 1.00 139.26 ? 85   LEU A N     1 
ATOM   636   C  CA    . LEU A 1 85   ? 74.745  4.641   118.946 1.00 138.36 ? 85   LEU A CA    1 
ATOM   637   C  C     . LEU A 1 85   ? 73.956  5.673   119.726 1.00 136.93 ? 85   LEU A C     1 
ATOM   638   O  O     . LEU A 1 85   ? 73.562  6.730   119.213 1.00 131.52 ? 85   LEU A O     1 
ATOM   639   C  CB    . LEU A 1 85   ? 76.048  5.255   118.454 1.00 132.43 ? 85   LEU A CB    1 
ATOM   640   C  CG    . LEU A 1 85   ? 76.989  5.654   119.595 1.00 131.30 ? 85   LEU A CG    1 
ATOM   641   C  CD1   . LEU A 1 85   ? 77.630  4.422   120.220 1.00 133.99 ? 85   LEU A CD1   1 
ATOM   642   C  CD2   . LEU A 1 85   ? 78.044  6.658   119.151 1.00 118.66 ? 85   LEU A CD2   1 
ATOM   643   N  N     . VAL A 1 86   ? 73.750  5.349   120.992 1.00 133.46 ? 86   VAL A N     1 
ATOM   644   C  CA    . VAL A 1 86   ? 73.067  6.240   121.886 1.00 134.41 ? 86   VAL A CA    1 
ATOM   645   C  C     . VAL A 1 86   ? 74.143  6.864   122.730 1.00 128.98 ? 86   VAL A C     1 
ATOM   646   O  O     . VAL A 1 86   ? 75.030  6.180   123.233 1.00 128.52 ? 86   VAL A O     1 
ATOM   647   C  CB    . VAL A 1 86   ? 72.050  5.485   122.738 1.00 138.33 ? 86   VAL A CB    1 
ATOM   648   C  CG1   . VAL A 1 86   ? 72.570  4.113   123.071 1.00 137.12 ? 86   VAL A CG1   1 
ATOM   649   C  CG2   . VAL A 1 86   ? 71.699  6.271   123.990 1.00 136.51 ? 86   VAL A CG2   1 
ATOM   650   N  N     . VAL A 1 87   ? 74.086  8.180   122.835 1.00 129.86 ? 87   VAL A N     1 
ATOM   651   C  CA    . VAL A 1 87   ? 75.108  8.919   123.542 1.00 135.59 ? 87   VAL A CA    1 
ATOM   652   C  C     . VAL A 1 87   ? 74.516  10.046  124.379 1.00 140.70 ? 87   VAL A C     1 
ATOM   653   O  O     . VAL A 1 87   ? 73.820  10.926  123.863 1.00 140.80 ? 87   VAL A O     1 
ATOM   654   C  CB    . VAL A 1 87   ? 76.092  9.498   122.545 1.00 133.46 ? 87   VAL A CB    1 
ATOM   655   C  CG1   . VAL A 1 87   ? 75.348  9.901   121.292 1.00 135.85 ? 87   VAL A CG1   1 
ATOM   656   C  CG2   . VAL A 1 87   ? 76.843  10.667  123.154 1.00 136.22 ? 87   VAL A CG2   1 
ATOM   657   N  N     . ARG A 1 88   ? 74.808  10.019  125.673 1.00 138.27 ? 88   ARG A N     1 
ATOM   658   C  CA    . ARG A 1 88   ? 74.244  10.979  126.591 1.00 136.69 ? 88   ARG A CA    1 
ATOM   659   C  C     . ARG A 1 88   ? 75.180  12.155  126.731 1.00 141.97 ? 88   ARG A C     1 
ATOM   660   O  O     . ARG A 1 88   ? 76.388  11.965  126.836 1.00 142.65 ? 88   ARG A O     1 
ATOM   661   C  CB    . ARG A 1 88   ? 74.066  10.323  127.941 1.00 138.32 ? 88   ARG A CB    1 
ATOM   662   C  CG    . ARG A 1 88   ? 73.328  11.173  128.908 1.00 149.93 ? 88   ARG A CG    1 
ATOM   663   C  CD    . ARG A 1 88   ? 73.493  10.676  130.316 1.00 151.92 ? 88   ARG A CD    1 
ATOM   664   N  NE    . ARG A 1 88   ? 72.968  11.671  131.240 1.00 158.42 ? 88   ARG A NE    1 
ATOM   665   C  CZ    . ARG A 1 88   ? 73.196  11.678  132.546 1.00 161.60 ? 88   ARG A CZ    1 
ATOM   666   N  NH1   . ARG A 1 88   ? 73.945  10.729  133.094 1.00 161.77 ? 88   ARG A NH1   1 
ATOM   667   N  NH2   . ARG A 1 88   ? 72.674  12.642  133.298 1.00 158.72 ? 88   ARG A NH2   1 
ATOM   668   N  N     . PHE A 1 89   ? 74.628  13.366  126.724 1.00 146.87 ? 89   PHE A N     1 
ATOM   669   C  CA    . PHE A 1 89   ? 75.425  14.576  126.944 1.00 148.97 ? 89   PHE A CA    1 
ATOM   670   C  C     . PHE A 1 89   ? 75.199  15.166  128.315 1.00 151.65 ? 89   PHE A C     1 
ATOM   671   O  O     . PHE A 1 89   ? 74.153  15.765  128.568 1.00 152.73 ? 89   PHE A O     1 
ATOM   672   C  CB    . PHE A 1 89   ? 75.057  15.661  125.944 1.00 150.20 ? 89   PHE A CB    1 
ATOM   673   C  CG    . PHE A 1 89   ? 75.550  15.407  124.564 1.00 153.31 ? 89   PHE A CG    1 
ATOM   674   C  CD1   . PHE A 1 89   ? 76.401  14.352  124.298 1.00 148.95 ? 89   PHE A CD1   1 
ATOM   675   C  CD2   . PHE A 1 89   ? 75.162  16.236  123.521 1.00 155.08 ? 89   PHE A CD2   1 
ATOM   676   C  CE1   . PHE A 1 89   ? 76.851  14.127  123.015 1.00 149.02 ? 89   PHE A CE1   1 
ATOM   677   C  CE2   . PHE A 1 89   ? 75.608  16.017  122.237 1.00 147.62 ? 89   PHE A CE2   1 
ATOM   678   C  CZ    . PHE A 1 89   ? 76.452  14.963  121.982 1.00 147.84 ? 89   PHE A CZ    1 
ATOM   679   N  N     . LEU A 1 90   ? 76.200  15.041  129.177 1.00 153.16 ? 90   LEU A N     1 
ATOM   680   C  CA    . LEU A 1 90   ? 76.109  15.565  130.532 1.00 155.46 ? 90   LEU A CA    1 
ATOM   681   C  C     . LEU A 1 90   ? 75.937  17.086  130.518 1.00 153.09 ? 90   LEU A C     1 
ATOM   682   O  O     . LEU A 1 90   ? 74.952  17.604  131.040 1.00 148.42 ? 90   LEU A O     1 
ATOM   683   C  CB    . LEU A 1 90   ? 77.328  15.149  131.370 1.00 156.49 ? 90   LEU A CB    1 
ATOM   684   C  CG    . LEU A 1 90   ? 77.534  13.693  131.824 1.00 151.29 ? 90   LEU A CG    1 
ATOM   685   C  CD1   . LEU A 1 90   ? 76.262  13.101  132.397 1.00 155.61 ? 90   LEU A CD1   1 
ATOM   686   C  CD2   . LEU A 1 90   ? 78.057  12.804  130.717 1.00 150.83 ? 90   LEU A CD2   1 
ATOM   687   N  N     . ASN A 1 91   ? 76.881  17.789  129.896 1.00 154.38 ? 91   ASN A N     1 
ATOM   688   C  CA    . ASN A 1 91   ? 76.806  19.240  129.798 1.00 153.05 ? 91   ASN A CA    1 
ATOM   689   C  C     . ASN A 1 91   ? 75.717  19.607  128.800 1.00 155.07 ? 91   ASN A C     1 
ATOM   690   O  O     . ASN A 1 91   ? 75.840  19.331  127.613 1.00 156.42 ? 91   ASN A O     1 
ATOM   691   C  CB    . ASN A 1 91   ? 78.157  19.808  129.354 1.00 151.83 ? 91   ASN A CB    1 
ATOM   692   C  CG    . ASN A 1 91   ? 78.272  21.304  129.592 1.00 154.01 ? 91   ASN A CG    1 
ATOM   693   O  OD1   . ASN A 1 91   ? 77.587  21.863  130.448 1.00 148.38 ? 91   ASN A OD1   1 
ATOM   694   N  ND2   . ASN A 1 91   ? 79.149  21.959  128.835 1.00 155.94 ? 91   ASN A ND2   1 
ATOM   695   N  N     . PRO A 1 92   ? 74.627  20.210  129.286 1.00 155.25 ? 92   PRO A N     1 
ATOM   696   C  CA    . PRO A 1 92   ? 73.467  20.533  128.451 1.00 158.81 ? 92   PRO A CA    1 
ATOM   697   C  C     . PRO A 1 92   ? 73.763  21.670  127.491 1.00 158.76 ? 92   PRO A C     1 
ATOM   698   O  O     . PRO A 1 92   ? 73.193  21.734  126.403 1.00 159.30 ? 92   PRO A O     1 
ATOM   699   C  CB    . PRO A 1 92   ? 72.415  20.973  129.473 1.00 162.48 ? 92   PRO A CB    1 
ATOM   700   C  CG    . PRO A 1 92   ? 72.915  20.454  130.797 1.00 162.19 ? 92   PRO A CG    1 
ATOM   701   C  CD    . PRO A 1 92   ? 74.394  20.567  130.690 1.00 158.38 ? 92   PRO A CD    1 
ATOM   702   N  N     . SER A 1 93   ? 74.662  22.558  127.893 1.00 157.45 ? 93   SER A N     1 
ATOM   703   C  CA    . SER A 1 93   ? 75.042  23.674  127.046 1.00 158.25 ? 93   SER A CA    1 
ATOM   704   C  C     . SER A 1 93   ? 75.900  23.178  125.865 1.00 157.10 ? 93   SER A C     1 
ATOM   705   O  O     . SER A 1 93   ? 76.257  23.957  124.983 1.00 160.23 ? 93   SER A O     1 
ATOM   706   C  CB    . SER A 1 93   ? 75.741  24.769  127.869 1.00 159.40 ? 93   SER A CB    1 
ATOM   707   O  OG    . SER A 1 93   ? 74.850  25.377  128.802 1.00 147.07 ? 93   SER A OG    1 
ATOM   708   N  N     . LEU A 1 94   ? 76.205  21.876  125.860 1.00 154.61 ? 94   LEU A N     1 
ATOM   709   C  CA    . LEU A 1 94   ? 77.066  21.218  124.856 1.00 157.52 ? 94   LEU A CA    1 
ATOM   710   C  C     . LEU A 1 94   ? 76.285  20.540  123.708 1.00 154.03 ? 94   LEU A C     1 
ATOM   711   O  O     . LEU A 1 94   ? 75.591  19.552  123.930 1.00 155.29 ? 94   LEU A O     1 
ATOM   712   C  CB    . LEU A 1 94   ? 77.940  20.180  125.583 1.00 161.49 ? 94   LEU A CB    1 
ATOM   713   C  CG    . LEU A 1 94   ? 78.665  19.021  124.892 1.00 156.25 ? 94   LEU A CG    1 
ATOM   714   C  CD1   . LEU A 1 94   ? 79.652  19.573  123.891 1.00 154.06 ? 94   LEU A CD1   1 
ATOM   715   C  CD2   . LEU A 1 94   ? 79.367  18.120  125.924 1.00 150.11 ? 94   LEU A CD2   1 
ATOM   716   N  N     . GLN A 1 95   ? 76.361  21.094  122.497 1.00 149.51 ? 95   GLN A N     1 
ATOM   717   C  CA    . GLN A 1 95   ? 75.603  20.555  121.355 1.00 146.88 ? 95   GLN A CA    1 
ATOM   718   C  C     . GLN A 1 95   ? 76.256  19.741  120.220 1.00 145.55 ? 95   GLN A C     1 
ATOM   719   O  O     . GLN A 1 95   ? 75.551  19.364  119.287 1.00 146.24 ? 95   GLN A O     1 
ATOM   720   C  CB    . GLN A 1 95   ? 74.677  21.622  120.771 1.00 150.95 ? 95   GLN A CB    1 
ATOM   721   C  CG    . GLN A 1 95   ? 73.557  22.011  121.712 1.00 156.41 ? 95   GLN A CG    1 
ATOM   722   C  CD    . GLN A 1 95   ? 73.057  23.405  121.433 1.00 167.54 ? 95   GLN A CD    1 
ATOM   723   O  OE1   . GLN A 1 95   ? 72.999  23.828  120.277 1.00 168.06 ? 95   GLN A OE1   1 
ATOM   724   N  NE2   . GLN A 1 95   ? 72.714  24.142  122.490 1.00 168.79 ? 95   GLN A NE2   1 
ATOM   725   N  N     . THR A 1 96   ? 77.573  19.540  120.226 1.00 150.44 ? 96   THR A N     1 
ATOM   726   C  CA    . THR A 1 96   ? 78.203  18.641  119.228 1.00 148.16 ? 96   THR A CA    1 
ATOM   727   C  C     . THR A 1 96   ? 79.553  18.022  119.632 1.00 146.51 ? 96   THR A C     1 
ATOM   728   O  O     . THR A 1 96   ? 80.374  18.678  120.268 1.00 155.12 ? 96   THR A O     1 
ATOM   729   C  CB    . THR A 1 96   ? 78.372  19.319  117.848 1.00 142.59 ? 96   THR A CB    1 
ATOM   730   O  OG1   . THR A 1 96   ? 78.801  18.343  116.889 1.00 135.20 ? 96   THR A OG1   1 
ATOM   731   C  CG2   . THR A 1 96   ? 79.393  20.447  117.917 1.00 146.20 ? 96   THR A CG2   1 
ATOM   732   N  N     . VAL A 1 97   ? 79.805  16.784  119.211 1.00 137.42 ? 97   VAL A N     1 
ATOM   733   C  CA    . VAL A 1 97   ? 81.020  16.073  119.604 1.00 135.15 ? 97   VAL A CA    1 
ATOM   734   C  C     . VAL A 1 97   ? 81.615  15.369  118.401 1.00 138.50 ? 97   VAL A C     1 
ATOM   735   O  O     . VAL A 1 97   ? 80.905  15.017  117.472 1.00 143.15 ? 97   VAL A O     1 
ATOM   736   C  CB    . VAL A 1 97   ? 80.727  15.002  120.682 1.00 137.60 ? 97   VAL A CB    1 
ATOM   737   C  CG1   . VAL A 1 97   ? 82.005  14.350  121.170 1.00 140.09 ? 97   VAL A CG1   1 
ATOM   738   C  CG2   . VAL A 1 97   ? 79.988  15.608  121.856 1.00 146.47 ? 97   VAL A CG2   1 
ATOM   739   N  N     . THR A 1 98   ? 82.924  15.176  118.400 1.00 140.76 ? 98   THR A N     1 
ATOM   740   C  CA    . THR A 1 98   ? 83.526  14.307  117.410 1.00 142.63 ? 98   THR A CA    1 
ATOM   741   C  C     . THR A 1 98   ? 84.352  13.244  118.136 1.00 148.91 ? 98   THR A C     1 
ATOM   742   O  O     . THR A 1 98   ? 85.375  13.539  118.767 1.00 151.05 ? 98   THR A O     1 
ATOM   743   C  CB    . THR A 1 98   ? 84.331  15.113  116.359 1.00 145.11 ? 98   THR A CB    1 
ATOM   744   O  OG1   . THR A 1 98   ? 83.424  15.918  115.588 1.00 139.12 ? 98   THR A OG1   1 
ATOM   745   C  CG2   . THR A 1 98   ? 85.088  14.183  115.416 1.00 147.79 ? 98   THR A CG2   1 
ATOM   746   N  N     . LEU A 1 99   ? 83.862  12.007  118.058 1.00 150.12 ? 99   LEU A N     1 
ATOM   747   C  CA    . LEU A 1 99   ? 84.492  10.849  118.692 1.00 151.90 ? 99   LEU A CA    1 
ATOM   748   C  C     . LEU A 1 99   ? 85.490  10.215  117.765 1.00 150.97 ? 99   LEU A C     1 
ATOM   749   O  O     . LEU A 1 99   ? 85.282  10.180  116.558 1.00 150.53 ? 99   LEU A O     1 
ATOM   750   C  CB    . LEU A 1 99   ? 83.470  9.773   119.022 1.00 145.84 ? 99   LEU A CB    1 
ATOM   751   C  CG    . LEU A 1 99   ? 82.644  9.899   120.286 1.00 148.49 ? 99   LEU A CG    1 
ATOM   752   C  CD1   . LEU A 1 99   ? 81.633  11.005  120.117 1.00 149.99 ? 99   LEU A CD1   1 
ATOM   753   C  CD2   . LEU A 1 99   ? 81.954  8.581   120.532 1.00 150.34 ? 99   LEU A CD2   1 
ATOM   754   N  N     . LEU A 1 100  ? 86.567  9.685   118.323 1.00 155.34 ? 100  LEU A N     1 
ATOM   755   C  CA    . LEU A 1 100  ? 87.507  8.934   117.504 1.00 154.74 ? 100  LEU A CA    1 
ATOM   756   C  C     . LEU A 1 100  ? 87.432  7.437   117.794 1.00 152.32 ? 100  LEU A C     1 
ATOM   757   O  O     . LEU A 1 100  ? 87.042  7.020   118.890 1.00 150.03 ? 100  LEU A O     1 
ATOM   758   C  CB    . LEU A 1 100  ? 88.940  9.454   117.663 1.00 152.82 ? 100  LEU A CB    1 
ATOM   759   C  CG    . LEU A 1 100  ? 89.219  10.780  116.956 1.00 147.58 ? 100  LEU A CG    1 
ATOM   760   C  CD1   . LEU A 1 100  ? 88.945  11.956  117.892 1.00 137.68 ? 100  LEU A CD1   1 
ATOM   761   C  CD2   . LEU A 1 100  ? 90.646  10.791  116.405 1.00 153.96 ? 100  LEU A CD2   1 
ATOM   762   N  N     . LEU A 1 101  ? 87.739  6.642   116.774 1.00 150.58 ? 101  LEU A N     1 
ATOM   763   C  CA    . LEU A 1 101  ? 87.958  5.217   116.952 1.00 149.74 ? 101  LEU A CA    1 
ATOM   764   C  C     . LEU A 1 101  ? 89.169  4.754   116.160 1.00 152.65 ? 101  LEU A C     1 
ATOM   765   O  O     . LEU A 1 101  ? 89.178  4.812   114.935 1.00 153.52 ? 101  LEU A O     1 
ATOM   766   C  CB    . LEU A 1 101  ? 86.730  4.416   116.539 1.00 143.99 ? 101  LEU A CB    1 
ATOM   767   C  CG    . LEU A 1 101  ? 86.705  2.977   117.047 1.00 142.85 ? 101  LEU A CG    1 
ATOM   768   C  CD1   . LEU A 1 101  ? 85.289  2.607   117.403 1.00 145.75 ? 101  LEU A CD1   1 
ATOM   769   C  CD2   . LEU A 1 101  ? 87.261  2.019   116.016 1.00 142.54 ? 101  LEU A CD2   1 
ATOM   770   N  N     . LYS A 1 102  ? 90.177  4.267   116.873 1.00 157.46 ? 102  LYS A N     1 
ATOM   771   C  CA    . LYS A 1 102  ? 91.374  3.724   116.256 1.00 157.82 ? 102  LYS A CA    1 
ATOM   772   C  C     . LYS A 1 102  ? 91.541  2.305   116.801 1.00 155.48 ? 102  LYS A C     1 
ATOM   773   O  O     . LYS A 1 102  ? 91.767  2.111   117.999 1.00 154.27 ? 102  LYS A O     1 
ATOM   774   C  CB    . LYS A 1 102  ? 92.585  4.613   116.586 1.00 167.93 ? 102  LYS A CB    1 
ATOM   775   C  CG    . LYS A 1 102  ? 92.374  6.112   116.257 1.00 167.21 ? 102  LYS A CG    1 
ATOM   776   C  CD    . LYS A 1 102  ? 93.380  7.046   116.956 1.00 175.68 ? 102  LYS A CD    1 
ATOM   777   C  CE    . LYS A 1 102  ? 94.843  6.712   116.625 1.00 177.48 ? 102  LYS A CE    1 
ATOM   778   N  NZ    . LYS A 1 102  ? 95.225  6.979   115.209 1.00 162.42 ? 102  LYS A NZ    1 
ATOM   779   N  N     . ALA A 1 103  ? 91.387  1.318   115.922 1.00 150.80 ? 103  ALA A N     1 
ATOM   780   C  CA    . ALA A 1 103  ? 91.430  -0.086  116.316 1.00 152.67 ? 103  ALA A CA    1 
ATOM   781   C  C     . ALA A 1 103  ? 91.875  -0.946  115.147 1.00 151.94 ? 103  ALA A C     1 
ATOM   782   O  O     . ALA A 1 103  ? 91.697  -0.568  113.998 1.00 152.28 ? 103  ALA A O     1 
ATOM   783   C  CB    . ALA A 1 103  ? 90.069  -0.542  116.815 1.00 149.45 ? 103  ALA A CB    1 
ATOM   784   N  N     . GLU A 1 104  ? 92.454  -2.104  115.442 1.00 155.76 ? 104  GLU A N     1 
ATOM   785   C  CA    . GLU A 1 104  ? 92.963  -2.980  114.397 1.00 152.76 ? 104  GLU A CA    1 
ATOM   786   C  C     . GLU A 1 104  ? 93.202  -4.382  114.914 1.00 150.05 ? 104  GLU A C     1 
ATOM   787   O  O     . GLU A 1 104  ? 92.805  -4.734  116.030 1.00 147.99 ? 104  GLU A O     1 
ATOM   788   C  CB    . GLU A 1 104  ? 94.266  -2.436  113.820 1.00 156.38 ? 104  GLU A CB    1 
ATOM   789   C  CG    . GLU A 1 104  ? 95.311  -2.124  114.868 1.00 162.08 ? 104  GLU A CG    1 
ATOM   790   C  CD    . GLU A 1 104  ? 96.723  -2.250  114.343 1.00 172.09 ? 104  GLU A CD    1 
ATOM   791   O  OE1   . GLU A 1 104  ? 97.667  -2.086  115.148 1.00 178.21 ? 104  GLU A OE1   1 
ATOM   792   O  OE2   . GLU A 1 104  ? 96.888  -2.521  113.132 1.00 176.00 ? 104  GLU A OE2   1 
ATOM   793   N  N     . GLY A 1 105  ? 93.836  -5.190  114.075 1.00 149.04 ? 105  GLY A N     1 
ATOM   794   C  CA    . GLY A 1 105  ? 94.173  -6.546  114.441 1.00 152.12 ? 105  GLY A CA    1 
ATOM   795   C  C     . GLY A 1 105  ? 92.889  -7.322  114.586 1.00 154.91 ? 105  GLY A C     1 
ATOM   796   O  O     . GLY A 1 105  ? 91.805  -6.765  114.461 1.00 157.16 ? 105  GLY A O     1 
ATOM   797   N  N     . PRO A 1 106  ? 92.995  -8.618  114.869 1.00 153.09 ? 106  PRO A N     1 
ATOM   798   C  CA    . PRO A 1 106  ? 91.798  -9.453  114.985 1.00 149.40 ? 106  PRO A CA    1 
ATOM   799   C  C     . PRO A 1 106  ? 91.001  -9.190  116.259 1.00 153.72 ? 106  PRO A C     1 
ATOM   800   O  O     . PRO A 1 106  ? 91.125  -9.960  117.204 1.00 160.59 ? 106  PRO A O     1 
ATOM   801   C  CB    . PRO A 1 106  ? 92.373  -10.864 115.023 1.00 147.90 ? 106  PRO A CB    1 
ATOM   802   C  CG    . PRO A 1 106  ? 93.742  -10.686 115.590 1.00 153.06 ? 106  PRO A CG    1 
ATOM   803   C  CD    . PRO A 1 106  ? 94.234  -9.391  115.043 1.00 157.63 ? 106  PRO A CD    1 
ATOM   804   N  N     . LYS A 1 107  ? 90.213  -8.118  116.291 1.00 153.93 ? 107  LYS A N     1 
ATOM   805   C  CA    . LYS A 1 107  ? 89.274  -7.869  117.393 1.00 154.05 ? 107  LYS A CA    1 
ATOM   806   C  C     . LYS A 1 107  ? 87.951  -7.422  116.799 1.00 147.40 ? 107  LYS A C     1 
ATOM   807   O  O     . LYS A 1 107  ? 87.917  -6.970  115.665 1.00 149.84 ? 107  LYS A O     1 
ATOM   808   C  CB    . LYS A 1 107  ? 89.794  -6.780  118.347 1.00 158.25 ? 107  LYS A CB    1 
ATOM   809   C  CG    . LYS A 1 107  ? 89.578  -5.338  117.865 1.00 152.04 ? 107  LYS A CG    1 
ATOM   810   C  CD    . LYS A 1 107  ? 90.083  -4.315  118.874 1.00 141.45 ? 107  LYS A CD    1 
ATOM   811   C  CE    . LYS A 1 107  ? 89.349  -4.449  120.188 1.00 131.66 ? 107  LYS A CE    1 
ATOM   812   N  NZ    . LYS A 1 107  ? 89.872  -3.479  121.177 1.00 133.48 ? 107  LYS A NZ    1 
ATOM   813   N  N     . GLU A 1 108  ? 86.864  -7.542  117.550 1.00 147.30 ? 108  GLU A N     1 
ATOM   814   C  CA    . GLU A 1 108  ? 85.578  -7.030  117.086 1.00 146.08 ? 108  GLU A CA    1 
ATOM   815   C  C     . GLU A 1 108  ? 85.318  -5.708  117.755 1.00 143.83 ? 108  GLU A C     1 
ATOM   816   O  O     . GLU A 1 108  ? 85.076  -5.664  118.953 1.00 151.55 ? 108  GLU A O     1 
ATOM   817   C  CB    . GLU A 1 108  ? 84.440  -7.970  117.457 1.00 150.67 ? 108  GLU A CB    1 
ATOM   818   C  CG    . GLU A 1 108  ? 84.495  -9.323  116.808 1.00 155.61 ? 108  GLU A CG    1 
ATOM   819   C  CD    . GLU A 1 108  ? 83.273  -10.148 117.144 1.00 165.40 ? 108  GLU A CD    1 
ATOM   820   O  OE1   . GLU A 1 108  ? 82.503  -9.746  118.055 1.00 156.86 ? 108  GLU A OE1   1 
ATOM   821   O  OE2   . GLU A 1 108  ? 83.084  -11.194 116.488 1.00 175.30 ? 108  GLU A OE2   1 
ATOM   822   N  N     . VAL A 1 109  ? 85.346  -4.629  116.991 1.00 140.00 ? 109  VAL A N     1 
ATOM   823   C  CA    . VAL A 1 109  ? 85.191  -3.317  117.592 1.00 143.09 ? 109  VAL A CA    1 
ATOM   824   C  C     . VAL A 1 109  ? 83.772  -3.092  118.124 1.00 147.27 ? 109  VAL A C     1 
ATOM   825   O  O     . VAL A 1 109  ? 82.786  -3.383  117.450 1.00 149.07 ? 109  VAL A O     1 
ATOM   826   C  CB    . VAL A 1 109  ? 85.626  -2.207  116.630 1.00 140.65 ? 109  VAL A CB    1 
ATOM   827   C  CG1   . VAL A 1 109  ? 85.501  -0.868  117.297 1.00 136.06 ? 109  VAL A CG1   1 
ATOM   828   C  CG2   . VAL A 1 109  ? 87.065  -2.442  116.193 1.00 144.26 ? 109  VAL A CG2   1 
ATOM   829   N  N     . LYS A 1 110  ? 83.692  -2.581  119.349 1.00 147.09 ? 110  LYS A N     1 
ATOM   830   C  CA    . LYS A 1 110  ? 82.432  -2.329  120.028 1.00 142.98 ? 110  LYS A CA    1 
ATOM   831   C  C     . LYS A 1 110  ? 82.357  -0.817  120.242 1.00 143.51 ? 110  LYS A C     1 
ATOM   832   O  O     . LYS A 1 110  ? 83.372  -0.134  120.141 1.00 147.43 ? 110  LYS A O     1 
ATOM   833   C  CB    . LYS A 1 110  ? 82.401  -3.065  121.373 1.00 145.51 ? 110  LYS A CB    1 
ATOM   834   C  CG    . LYS A 1 110  ? 82.500  -4.589  121.285 1.00 145.69 ? 110  LYS A CG    1 
ATOM   835   C  CD    . LYS A 1 110  ? 81.267  -5.186  120.612 1.00 150.70 ? 110  LYS A CD    1 
ATOM   836   C  CE    . LYS A 1 110  ? 81.262  -6.709  120.643 1.00 151.67 ? 110  LYS A CE    1 
ATOM   837   N  NZ    . LYS A 1 110  ? 79.973  -7.285  120.157 1.00 143.29 ? 110  LYS A NZ    1 
ATOM   838   N  N     . ALA A 1 111  ? 81.168  -0.281  120.491 1.00 140.30 ? 111  ALA A N     1 
ATOM   839   C  CA    . ALA A 1 111  ? 81.023  1.154   120.723 1.00 138.51 ? 111  ALA A CA    1 
ATOM   840   C  C     . ALA A 1 111  ? 81.945  1.638   121.836 1.00 142.74 ? 111  ALA A C     1 
ATOM   841   O  O     . ALA A 1 111  ? 82.425  2.767   121.807 1.00 138.89 ? 111  ALA A O     1 
ATOM   842   C  CB    . ALA A 1 111  ? 79.589  1.491   121.054 1.00 145.60 ? 111  ALA A CB    1 
ATOM   843   N  N     . ARG A 1 112  ? 82.205  0.763   122.806 1.00 149.56 ? 112  ARG A N     1 
ATOM   844   C  CA    . ARG A 1 112  ? 83.069  1.082   123.950 1.00 150.64 ? 112  ARG A CA    1 
ATOM   845   C  C     . ARG A 1 112  ? 84.507  1.452   123.561 1.00 150.90 ? 112  ARG A C     1 
ATOM   846   O  O     . ARG A 1 112  ? 85.228  2.054   124.358 1.00 152.38 ? 112  ARG A O     1 
ATOM   847   C  CB    . ARG A 1 112  ? 83.093  -0.075  124.965 1.00 146.67 ? 112  ARG A CB    1 
ATOM   848   C  CG    . ARG A 1 112  ? 83.894  -1.284  124.511 1.00 145.89 ? 112  ARG A CG    1 
ATOM   849   C  CD    . ARG A 1 112  ? 84.165  -2.252  125.645 1.00 150.61 ? 112  ARG A CD    1 
ATOM   850   N  NE    . ARG A 1 112  ? 82.947  -2.735  126.291 1.00 159.02 ? 112  ARG A NE    1 
ATOM   851   C  CZ    . ARG A 1 112  ? 82.315  -3.863  125.973 1.00 162.62 ? 112  ARG A CZ    1 
ATOM   852   N  NH1   . ARG A 1 112  ? 82.767  -4.649  124.997 1.00 150.86 ? 112  ARG A NH1   1 
ATOM   853   N  NH2   . ARG A 1 112  ? 81.219  -4.201  126.640 1.00 167.61 ? 112  ARG A NH2   1 
ATOM   854   N  N     . ASP A 1 113  ? 84.907  1.129   122.331 1.00 149.29 ? 113  ASP A N     1 
ATOM   855   C  CA    . ASP A 1 113  ? 86.291  1.316   121.890 1.00 145.48 ? 113  ASP A CA    1 
ATOM   856   C  C     . ASP A 1 113  ? 86.523  2.756   121.475 1.00 144.41 ? 113  ASP A C     1 
ATOM   857   O  O     . ASP A 1 113  ? 87.599  3.121   121.007 1.00 144.73 ? 113  ASP A O     1 
ATOM   858   C  CB    . ASP A 1 113  ? 86.647  0.362   120.746 1.00 143.63 ? 113  ASP A CB    1 
ATOM   859   C  CG    . ASP A 1 113  ? 86.784  -1.080  121.211 1.00 148.69 ? 113  ASP A CG    1 
ATOM   860   O  OD1   . ASP A 1 113  ? 87.873  -1.448  121.713 1.00 153.04 ? 113  ASP A OD1   1 
ATOM   861   O  OD2   . ASP A 1 113  ? 85.803  -1.846  121.082 1.00 148.52 ? 113  ASP A OD2   1 
ATOM   862   N  N     . PHE A 1 114  ? 85.490  3.566   121.653 1.00 145.13 ? 114  PHE A N     1 
ATOM   863   C  CA    . PHE A 1 114  ? 85.548  4.975   121.319 1.00 146.23 ? 114  PHE A CA    1 
ATOM   864   C  C     . PHE A 1 114  ? 86.357  5.792   122.297 1.00 141.12 ? 114  PHE A C     1 
ATOM   865   O  O     . PHE A 1 114  ? 86.197  5.648   123.508 1.00 138.55 ? 114  PHE A O     1 
ATOM   866   C  CB    . PHE A 1 114  ? 84.138  5.533   121.212 1.00 149.81 ? 114  PHE A CB    1 
ATOM   867   C  CG    . PHE A 1 114  ? 83.576  5.430   119.834 1.00 154.42 ? 114  PHE A CG    1 
ATOM   868   C  CD1   . PHE A 1 114  ? 82.667  4.438   119.507 1.00 148.15 ? 114  PHE A CD1   1 
ATOM   869   C  CD2   . PHE A 1 114  ? 84.001  6.303   118.844 1.00 152.29 ? 114  PHE A CD2   1 
ATOM   870   C  CE1   . PHE A 1 114  ? 82.167  4.340   118.229 1.00 144.78 ? 114  PHE A CE1   1 
ATOM   871   C  CE2   . PHE A 1 114  ? 83.508  6.210   117.564 1.00 148.72 ? 114  PHE A CE2   1 
ATOM   872   C  CZ    . PHE A 1 114  ? 82.589  5.223   117.250 1.00 146.90 ? 114  PHE A CZ    1 
ATOM   873   N  N     . LEU A 1 115  ? 87.204  6.665   121.755 1.00 140.53 ? 115  LEU A N     1 
ATOM   874   C  CA    . LEU A 1 115  ? 88.091  7.474   122.574 1.00 144.81 ? 115  LEU A CA    1 
ATOM   875   C  C     . LEU A 1 115  ? 87.259  8.368   123.471 1.00 145.84 ? 115  LEU A C     1 
ATOM   876   O  O     . LEU A 1 115  ? 86.577  9.281   122.978 1.00 140.16 ? 115  LEU A O     1 
ATOM   877   C  CB    . LEU A 1 115  ? 89.040  8.323   121.716 1.00 147.70 ? 115  LEU A CB    1 
ATOM   878   C  CG    . LEU A 1 115  ? 90.159  7.608   120.940 1.00 153.30 ? 115  LEU A CG    1 
ATOM   879   C  CD1   . LEU A 1 115  ? 91.249  8.580   120.450 1.00 149.34 ? 115  LEU A CD1   1 
ATOM   880   C  CD2   . LEU A 1 115  ? 90.771  6.465   121.753 1.00 150.52 ? 115  LEU A CD2   1 
ATOM   881   N  N     . PRO A 1 116  ? 87.333  8.105   124.799 1.00 146.01 ? 116  PRO A N     1 
ATOM   882   C  CA    . PRO A 1 116  ? 86.555  8.757   125.855 1.00 143.59 ? 116  PRO A CA    1 
ATOM   883   C  C     . PRO A 1 116  ? 86.793  10.264  125.902 1.00 148.55 ? 116  PRO A C     1 
ATOM   884   O  O     . PRO A 1 116  ? 87.931  10.726  125.952 1.00 148.73 ? 116  PRO A O     1 
ATOM   885   C  CB    . PRO A 1 116  ? 87.080  8.091   127.137 1.00 133.34 ? 116  PRO A CB    1 
ATOM   886   C  CG    . PRO A 1 116  ? 87.598  6.787   126.709 1.00 128.15 ? 116  PRO A CG    1 
ATOM   887   C  CD    . PRO A 1 116  ? 88.205  7.057   125.362 1.00 141.01 ? 116  PRO A CD    1 
ATOM   888   N  N     . VAL A 1 117  ? 85.707  11.024  125.892 1.00 151.29 ? 117  VAL A N     1 
ATOM   889   C  CA    . VAL A 1 117  ? 85.777  12.473  125.945 1.00 155.36 ? 117  VAL A CA    1 
ATOM   890   C  C     . VAL A 1 117  ? 84.928  12.920  127.144 1.00 161.23 ? 117  VAL A C     1 
ATOM   891   O  O     . VAL A 1 117  ? 84.118  12.143  127.661 1.00 157.48 ? 117  VAL A O     1 
ATOM   892   C  CB    . VAL A 1 117  ? 85.295  13.107  124.608 1.00 153.54 ? 117  VAL A CB    1 
ATOM   893   C  CG1   . VAL A 1 117  ? 85.667  14.576  124.537 1.00 154.82 ? 117  VAL A CG1   1 
ATOM   894   C  CG2   . VAL A 1 117  ? 85.887  12.358  123.403 1.00 142.66 ? 117  VAL A CG2   1 
ATOM   895   N  N     . ALA A 1 118  ? 85.131  14.152  127.604 1.00 168.38 ? 118  ALA A N     1 
ATOM   896   C  CA    . ALA A 1 118  ? 84.488  14.637  128.825 1.00 165.49 ? 118  ALA A CA    1 
ATOM   897   C  C     . ALA A 1 118  ? 83.075  15.161  128.579 1.00 161.67 ? 118  ALA A C     1 
ATOM   898   O  O     . ALA A 1 118  ? 82.791  15.743  127.524 1.00 158.36 ? 118  ALA A O     1 
ATOM   899   C  CB    . ALA A 1 118  ? 85.351  15.707  129.490 1.00 168.71 ? 118  ALA A CB    1 
ATOM   900   N  N     . ASP A 1 119  ? 82.209  14.953  129.570 1.00 159.91 ? 119  ASP A N     1 
ATOM   901   C  CA    . ASP A 1 119  ? 80.790  15.308  129.493 1.00 164.06 ? 119  ASP A CA    1 
ATOM   902   C  C     . ASP A 1 119  ? 80.038  14.500  128.421 1.00 158.82 ? 119  ASP A C     1 
ATOM   903   O  O     . ASP A 1 119  ? 79.060  14.990  127.839 1.00 156.48 ? 119  ASP A O     1 
ATOM   904   C  CB    . ASP A 1 119  ? 80.588  16.822  129.268 1.00 164.54 ? 119  ASP A CB    1 
ATOM   905   C  CG    . ASP A 1 119  ? 81.150  17.679  130.399 1.00 162.68 ? 119  ASP A CG    1 
ATOM   906   O  OD1   . ASP A 1 119  ? 81.377  17.163  131.519 1.00 155.53 ? 119  ASP A OD1   1 
ATOM   907   O  OD2   . ASP A 1 119  ? 81.353  18.888  130.148 1.00 162.76 ? 119  ASP A OD2   1 
ATOM   908   N  N     . VAL A 1 120  ? 80.510  13.278  128.157 1.00 152.02 ? 120  VAL A N     1 
ATOM   909   C  CA    . VAL A 1 120  ? 79.912  12.395  127.148 1.00 146.85 ? 120  VAL A CA    1 
ATOM   910   C  C     . VAL A 1 120  ? 79.950  10.912  127.564 1.00 141.44 ? 120  VAL A C     1 
ATOM   911   O  O     . VAL A 1 120  ? 81.008  10.411  127.938 1.00 143.18 ? 120  VAL A O     1 
ATOM   912   C  CB    . VAL A 1 120  ? 80.647  12.542  125.791 1.00 150.68 ? 120  VAL A CB    1 
ATOM   913   C  CG1   . VAL A 1 120  ? 80.127  11.537  124.788 1.00 151.27 ? 120  VAL A CG1   1 
ATOM   914   C  CG2   . VAL A 1 120  ? 80.522  13.964  125.235 1.00 151.91 ? 120  VAL A CG2   1 
ATOM   915   N  N     . GLU A 1 121  ? 78.819  10.205  127.469 1.00 137.86 ? 121  GLU A N     1 
ATOM   916   C  CA    . GLU A 1 121  ? 78.751  8.785   127.862 1.00 138.18 ? 121  GLU A CA    1 
ATOM   917   C  C     . GLU A 1 121  ? 78.118  7.890   126.798 1.00 140.32 ? 121  GLU A C     1 
ATOM   918   O  O     . GLU A 1 121  ? 77.088  8.253   126.230 1.00 142.24 ? 121  GLU A O     1 
ATOM   919   C  CB    . GLU A 1 121  ? 77.956  8.627   129.164 1.00 149.64 ? 121  GLU A CB    1 
ATOM   920   C  CG    . GLU A 1 121  ? 77.664  7.166   129.561 1.00 155.14 ? 121  GLU A CG    1 
ATOM   921   C  CD    . GLU A 1 121  ? 76.783  7.031   130.809 1.00 161.42 ? 121  GLU A CD    1 
ATOM   922   O  OE1   . GLU A 1 121  ? 76.194  8.048   131.251 1.00 162.18 ? 121  GLU A OE1   1 
ATOM   923   O  OE2   . GLU A 1 121  ? 76.680  5.901   131.345 1.00 152.54 ? 121  GLU A OE2   1 
ATOM   924   N  N     . ILE A 1 122  ? 78.707  6.713   126.555 1.00 137.95 ? 122  ILE A N     1 
ATOM   925   C  CA    . ILE A 1 122  ? 78.180  5.779   125.559 1.00 135.96 ? 122  ILE A CA    1 
ATOM   926   C  C     . ILE A 1 122  ? 77.253  4.799   126.235 1.00 136.32 ? 122  ILE A C     1 
ATOM   927   O  O     . ILE A 1 122  ? 77.702  3.837   126.843 1.00 135.68 ? 122  ILE A O     1 
ATOM   928   C  CB    . ILE A 1 122  ? 79.289  4.891   124.995 1.00 134.48 ? 122  ILE A CB    1 
ATOM   929   C  CG1   . ILE A 1 122  ? 80.596  5.667   124.838 1.00 134.23 ? 122  ILE A CG1   1 
ATOM   930   C  CG2   . ILE A 1 122  ? 78.829  4.228   123.707 1.00 136.72 ? 122  ILE A CG2   1 
ATOM   931   C  CD1   . ILE A 1 122  ? 81.833  4.793   124.930 1.00 135.32 ? 122  ILE A CD1   1 
ATOM   932   N  N     . MET A 1 123  ? 75.959  4.972   126.022 1.00 138.89 ? 123  MET A N     1 
ATOM   933   C  CA    . MET A 1 123  ? 74.959  4.269   126.811 1.00 142.27 ? 123  MET A CA    1 
ATOM   934   C  C     . MET A 1 123  ? 74.830  2.798   126.432 1.00 147.17 ? 123  MET A C     1 
ATOM   935   O  O     . MET A 1 123  ? 74.088  2.050   127.073 1.00 149.40 ? 123  MET A O     1 
ATOM   936   C  CB    . MET A 1 123  ? 73.607  4.963   126.675 1.00 142.49 ? 123  MET A CB    1 
ATOM   937   C  CG    . MET A 1 123  ? 73.681  6.474   126.785 1.00 137.97 ? 123  MET A CG    1 
ATOM   938   S  SD    . MET A 1 123  ? 73.928  6.998   128.476 1.00 140.34 ? 123  MET A SD    1 
ATOM   939   C  CE    . MET A 1 123  ? 72.729  5.962   129.316 1.00 143.18 ? 123  MET A CE    1 
ATOM   940   N  N     . ASN A 1 124  ? 75.529  2.388   125.379 1.00 148.58 ? 124  ASN A N     1 
ATOM   941   C  CA    . ASN A 1 124  ? 75.544  0.980   124.988 1.00 151.28 ? 124  ASN A CA    1 
ATOM   942   C  C     . ASN A 1 124  ? 76.933  0.516   124.579 1.00 151.33 ? 124  ASN A C     1 
ATOM   943   O  O     . ASN A 1 124  ? 77.183  0.256   123.404 1.00 155.08 ? 124  ASN A O     1 
ATOM   944   C  CB    . ASN A 1 124  ? 74.495  0.669   123.896 1.00 154.21 ? 124  ASN A CB    1 
ATOM   945   C  CG    . ASN A 1 124  ? 74.628  1.554   122.642 1.00 148.15 ? 124  ASN A CG    1 
ATOM   946   O  OD1   . ASN A 1 124  ? 75.313  2.578   122.644 1.00 147.02 ? 124  ASN A OD1   1 
ATOM   947   N  ND2   . ASN A 1 124  ? 73.940  1.160   121.573 1.00 141.78 ? 124  ASN A ND2   1 
ATOM   948   N  N     . PRO A 1 125  ? 77.834  0.374   125.559 1.00 147.62 ? 125  PRO A N     1 
ATOM   949   C  CA    . PRO A 1 125  ? 79.232  0.131   125.228 1.00 149.81 ? 125  PRO A CA    1 
ATOM   950   C  C     . PRO A 1 125  ? 79.335  -1.185  124.491 1.00 151.88 ? 125  PRO A C     1 
ATOM   951   O  O     . PRO A 1 125  ? 80.259  -1.385  123.710 1.00 151.32 ? 125  PRO A O     1 
ATOM   952   C  CB    . PRO A 1 125  ? 79.887  0.005   126.601 1.00 156.47 ? 125  PRO A CB    1 
ATOM   953   C  CG    . PRO A 1 125  ? 78.833  -0.610  127.431 1.00 155.47 ? 125  PRO A CG    1 
ATOM   954   C  CD    . PRO A 1 125  ? 77.544  0.017   126.955 1.00 153.47 ? 125  PRO A CD    1 
ATOM   955   N  N     . ASP A 1 126  ? 78.364  -2.063  124.710 1.00 152.20 ? 126  ASP A N     1 
ATOM   956   C  CA    . ASP A 1 126  ? 78.416  -3.383  124.115 1.00 160.28 ? 126  ASP A CA    1 
ATOM   957   C  C     . ASP A 1 126  ? 77.922  -3.396  122.662 1.00 161.35 ? 126  ASP A C     1 
ATOM   958   O  O     . ASP A 1 126  ? 77.972  -4.441  122.004 1.00 165.12 ? 126  ASP A O     1 
ATOM   959   C  CB    . ASP A 1 126  ? 77.642  -4.393  124.971 1.00 166.83 ? 126  ASP A CB    1 
ATOM   960   C  CG    . ASP A 1 126  ? 78.243  -5.795  124.917 1.00 166.13 ? 126  ASP A CG    1 
ATOM   961   O  OD1   . ASP A 1 126  ? 78.681  -6.244  123.833 1.00 159.49 ? 126  ASP A OD1   1 
ATOM   962   O  OD2   . ASP A 1 126  ? 78.279  -6.451  125.977 1.00 167.06 ? 126  ASP A OD2   1 
ATOM   963   N  N     . LEU A 1 127  ? 77.470  -2.249  122.151 1.00 154.70 ? 127  LEU A N     1 
ATOM   964   C  CA    . LEU A 1 127  ? 76.983  -2.190  120.765 1.00 152.61 ? 127  LEU A CA    1 
ATOM   965   C  C     . LEU A 1 127  ? 78.058  -2.581  119.743 1.00 155.15 ? 127  LEU A C     1 
ATOM   966   O  O     . LEU A 1 127  ? 79.190  -2.095  119.806 1.00 155.95 ? 127  LEU A O     1 
ATOM   967   C  CB    . LEU A 1 127  ? 76.416  -0.811  120.423 1.00 148.94 ? 127  LEU A CB    1 
ATOM   968   C  CG    . LEU A 1 127  ? 76.186  -0.551  118.926 1.00 146.83 ? 127  LEU A CG    1 
ATOM   969   C  CD1   . LEU A 1 127  ? 75.103  -1.461  118.334 1.00 146.36 ? 127  LEU A CD1   1 
ATOM   970   C  CD2   . LEU A 1 127  ? 75.860  0.912   118.682 1.00 145.46 ? 127  LEU A CD2   1 
ATOM   971   N  N     . HIS A 1 128  ? 77.695  -3.453  118.803 1.00 154.03 ? 128  HIS A N     1 
ATOM   972   C  CA    . HIS A 1 128  ? 78.648  -3.992  117.831 1.00 152.69 ? 128  HIS A CA    1 
ATOM   973   C  C     . HIS A 1 128  ? 78.824  -3.094  116.607 1.00 148.15 ? 128  HIS A C     1 
ATOM   974   O  O     . HIS A 1 128  ? 77.867  -2.860  115.877 1.00 149.59 ? 128  HIS A O     1 
ATOM   975   C  CB    . HIS A 1 128  ? 78.200  -5.382  117.379 1.00 155.82 ? 128  HIS A CB    1 
ATOM   976   C  CG    . HIS A 1 128  ? 79.154  -6.046  116.437 1.00 153.71 ? 128  HIS A CG    1 
ATOM   977   N  ND1   . HIS A 1 128  ? 79.235  -5.715  115.102 1.00 149.11 ? 128  HIS A ND1   1 
ATOM   978   C  CD2   . HIS A 1 128  ? 80.064  -7.027  116.638 1.00 154.03 ? 128  HIS A CD2   1 
ATOM   979   C  CE1   . HIS A 1 128  ? 80.158  -6.461  114.520 1.00 147.82 ? 128  HIS A CE1   1 
ATOM   980   N  NE2   . HIS A 1 128  ? 80.675  -7.266  115.431 1.00 153.43 ? 128  HIS A NE2   1 
ATOM   981   N  N     . ILE A 1 129  ? 80.049  -2.619  116.371 1.00 145.94 ? 129  ILE A N     1 
ATOM   982   C  CA    . ILE A 1 129  ? 80.331  -1.749  115.225 1.00 142.43 ? 129  ILE A CA    1 
ATOM   983   C  C     . ILE A 1 129  ? 80.870  -2.527  114.031 1.00 148.04 ? 129  ILE A C     1 
ATOM   984   O  O     . ILE A 1 129  ? 80.166  -2.700  113.037 1.00 148.54 ? 129  ILE A O     1 
ATOM   985   C  CB    . ILE A 1 129  ? 81.320  -0.634  115.573 1.00 132.22 ? 129  ILE A CB    1 
ATOM   986   C  CG1   . ILE A 1 129  ? 80.742  0.243   116.670 1.00 136.72 ? 129  ILE A CG1   1 
ATOM   987   C  CG2   . ILE A 1 129  ? 81.612  0.209   114.359 1.00 124.52 ? 129  ILE A CG2   1 
ATOM   988   C  CD1   . ILE A 1 129  ? 81.623  1.357   117.027 1.00 136.76 ? 129  ILE A CD1   1 
ATOM   989   N  N     . ALA A 1 130  ? 82.111  -3.007  114.138 1.00 151.04 ? 130  ALA A N     1 
ATOM   990   C  CA    . ALA A 1 130  ? 82.764  -3.746  113.047 1.00 145.78 ? 130  ALA A CA    1 
ATOM   991   C  C     . ALA A 1 130  ? 83.527  -4.991  113.522 1.00 144.45 ? 130  ALA A C     1 
ATOM   992   O  O     . ALA A 1 130  ? 84.165  -4.966  114.574 1.00 145.91 ? 130  ALA A O     1 
ATOM   993   C  CB    . ALA A 1 130  ? 83.705  -2.826  112.278 1.00 139.71 ? 130  ALA A CB    1 
ATOM   994   N  N     . THR A 1 131  ? 83.451  -6.074  112.747 1.00 144.62 ? 131  THR A N     1 
ATOM   995   C  CA    . THR A 1 131  ? 84.346  -7.222  112.919 1.00 147.74 ? 131  THR A CA    1 
ATOM   996   C  C     . THR A 1 131  ? 85.566  -7.023  112.010 1.00 152.51 ? 131  THR A C     1 
ATOM   997   O  O     . THR A 1 131  ? 85.419  -6.646  110.848 1.00 151.25 ? 131  THR A O     1 
ATOM   998   C  CB    . THR A 1 131  ? 83.648  -8.577  112.595 1.00 146.77 ? 131  THR A CB    1 
ATOM   999   O  OG1   . THR A 1 131  ? 82.745  -8.928  113.649 1.00 143.13 ? 131  THR A OG1   1 
ATOM   1000  C  CG2   . THR A 1 131  ? 84.669  -9.710  112.433 1.00 150.26 ? 131  THR A CG2   1 
ATOM   1001  N  N     . LEU A 1 132  ? 86.763  -7.270  112.546 1.00 156.18 ? 132  LEU A N     1 
ATOM   1002  C  CA    . LEU A 1 132  ? 88.024  -7.066  111.829 1.00 147.35 ? 132  LEU A CA    1 
ATOM   1003  C  C     . LEU A 1 132  ? 88.801  -8.379  111.776 1.00 147.22 ? 132  LEU A C     1 
ATOM   1004  O  O     . LEU A 1 132  ? 88.464  -9.355  112.445 1.00 146.99 ? 132  LEU A O     1 
ATOM   1005  C  CB    . LEU A 1 132  ? 88.877  -5.964  112.479 1.00 144.14 ? 132  LEU A CB    1 
ATOM   1006  C  CG    . LEU A 1 132  ? 88.743  -4.492  112.064 1.00 142.39 ? 132  LEU A CG    1 
ATOM   1007  C  CD1   . LEU A 1 132  ? 87.324  -3.975  112.223 1.00 141.54 ? 132  LEU A CD1   1 
ATOM   1008  C  CD2   . LEU A 1 132  ? 89.699  -3.639  112.879 1.00 146.00 ? 132  LEU A CD2   1 
ATOM   1009  N  N     . GLU A 1 133  ? 89.822  -8.408  110.937 1.00 153.12 ? 133  GLU A N     1 
ATOM   1010  C  CA    . GLU A 1 133  ? 90.617  -9.608  110.749 1.00 160.64 ? 133  GLU A CA    1 
ATOM   1011  C  C     . GLU A 1 133  ? 92.095  -9.276  110.978 1.00 162.87 ? 133  GLU A C     1 
ATOM   1012  O  O     . GLU A 1 133  ? 92.419  -8.161  111.396 1.00 161.99 ? 133  GLU A O     1 
ATOM   1013  C  CB    . GLU A 1 133  ? 90.394  -10.140 109.338 1.00 161.95 ? 133  GLU A CB    1 
ATOM   1014  C  CG    . GLU A 1 133  ? 90.420  -11.636 109.241 1.00 160.45 ? 133  GLU A CG    1 
ATOM   1015  C  CD    . GLU A 1 133  ? 90.993  -12.097 107.929 1.00 159.78 ? 133  GLU A CD    1 
ATOM   1016  O  OE1   . GLU A 1 133  ? 90.921  -11.325 106.940 1.00 157.12 ? 133  GLU A OE1   1 
ATOM   1017  O  OE2   . GLU A 1 133  ? 91.533  -13.223 107.903 1.00 157.27 ? 133  GLU A OE2   1 
ATOM   1018  N  N     . GLU A 1 134  ? 92.993  -10.228 110.730 1.00 163.20 ? 134  GLU A N     1 
ATOM   1019  C  CA    . GLU A 1 134  ? 94.411  -9.928  110.898 1.00 168.17 ? 134  GLU A CA    1 
ATOM   1020  C  C     . GLU A 1 134  ? 94.830  -8.818  109.945 1.00 167.70 ? 134  GLU A C     1 
ATOM   1021  O  O     . GLU A 1 134  ? 94.538  -8.850  108.741 1.00 160.01 ? 134  GLU A O     1 
ATOM   1022  C  CB    . GLU A 1 134  ? 95.316  -11.158 110.730 1.00 173.90 ? 134  GLU A CB    1 
ATOM   1023  C  CG    . GLU A 1 134  ? 96.375  -11.330 111.854 1.00 174.66 ? 134  GLU A CG    1 
ATOM   1024  C  CD    . GLU A 1 134  ? 97.360  -10.153 111.995 1.00 176.53 ? 134  GLU A CD    1 
ATOM   1025  O  OE1   . GLU A 1 134  ? 97.481  -9.602  113.115 1.00 172.46 ? 134  GLU A OE1   1 
ATOM   1026  O  OE2   . GLU A 1 134  ? 98.034  -9.792  111.002 1.00 173.08 ? 134  GLU A OE2   1 
ATOM   1027  N  N     . GLY A 1 135  ? 95.444  -7.799  110.534 1.00 169.98 ? 135  GLY A N     1 
ATOM   1028  C  CA    . GLY A 1 135  ? 96.076  -6.720  109.808 1.00 170.11 ? 135  GLY A CA    1 
ATOM   1029  C  C     . GLY A 1 135  ? 95.035  -5.729  109.356 1.00 162.68 ? 135  GLY A C     1 
ATOM   1030  O  O     . GLY A 1 135  ? 95.344  -4.562  109.140 1.00 162.80 ? 135  GLY A O     1 
ATOM   1031  N  N     . GLY A 1 136  ? 93.792  -6.195  109.261 1.00 154.07 ? 136  GLY A N     1 
ATOM   1032  C  CA    . GLY A 1 136  ? 92.695  -5.351  108.852 1.00 152.88 ? 136  GLY A CA    1 
ATOM   1033  C  C     . GLY A 1 136  ? 92.592  -4.212  109.830 1.00 157.43 ? 136  GLY A C     1 
ATOM   1034  O  O     . GLY A 1 136  ? 92.481  -4.427  111.036 1.00 161.21 ? 136  GLY A O     1 
ATOM   1035  N  N     . ARG A 1 137  ? 92.654  -2.993  109.316 1.00 154.75 ? 137  ARG A N     1 
ATOM   1036  C  CA    . ARG A 1 137  ? 92.696  -1.837  110.188 1.00 161.02 ? 137  ARG A CA    1 
ATOM   1037  C  C     . ARG A 1 137  ? 91.499  -0.923  109.963 1.00 155.80 ? 137  ARG A C     1 
ATOM   1038  O  O     . ARG A 1 137  ? 90.909  -0.899  108.883 1.00 150.30 ? 137  ARG A O     1 
ATOM   1039  C  CB    . ARG A 1 137  ? 94.034  -1.092  110.044 1.00 165.37 ? 137  ARG A CB    1 
ATOM   1040  C  CG    . ARG A 1 137  ? 95.231  -1.920  110.510 1.00 164.84 ? 137  ARG A CG    1 
ATOM   1041  C  CD    . ARG A 1 137  ? 96.560  -1.243  110.255 1.00 174.30 ? 137  ARG A CD    1 
ATOM   1042  N  NE    . ARG A 1 137  ? 97.597  -2.199  109.862 1.00 185.43 ? 137  ARG A NE    1 
ATOM   1043  C  CZ    . ARG A 1 137  ? 98.136  -2.256  108.646 1.00 195.42 ? 137  ARG A CZ    1 
ATOM   1044  N  NH1   . ARG A 1 137  ? 97.746  -1.408  107.703 1.00 199.10 ? 137  ARG A NH1   1 
ATOM   1045  N  NH2   . ARG A 1 137  ? 99.074  -3.155  108.372 1.00 197.93 ? 137  ARG A NH2   1 
ATOM   1046  N  N     . LEU A 1 138  ? 91.125  -0.220  111.026 1.00 159.75 ? 138  LEU A N     1 
ATOM   1047  C  CA    . LEU A 1 138  ? 90.039  0.740   110.996 1.00 155.72 ? 138  LEU A CA    1 
ATOM   1048  C  C     . LEU A 1 138  ? 90.343  2.002   111.830 1.00 153.85 ? 138  LEU A C     1 
ATOM   1049  O  O     . LEU A 1 138  ? 90.571  1.919   113.041 1.00 155.40 ? 138  LEU A O     1 
ATOM   1050  C  CB    . LEU A 1 138  ? 88.778  0.059   111.509 1.00 149.23 ? 138  LEU A CB    1 
ATOM   1051  C  CG    . LEU A 1 138  ? 87.557  0.957   111.598 1.00 151.71 ? 138  LEU A CG    1 
ATOM   1052  C  CD1   . LEU A 1 138  ? 87.354  1.654   110.266 1.00 152.07 ? 138  LEU A CD1   1 
ATOM   1053  C  CD2   . LEU A 1 138  ? 86.340  0.134   111.984 1.00 156.75 ? 138  LEU A CD2   1 
ATOM   1054  N  N     . ASN A 1 139  ? 90.319  3.164   111.186 1.00 146.37 ? 139  ASN A N     1 
ATOM   1055  C  CA    . ASN A 1 139  ? 90.385  4.435   111.891 1.00 148.78 ? 139  ASN A CA    1 
ATOM   1056  C  C     . ASN A 1 139  ? 89.200  5.254   111.425 1.00 152.31 ? 139  ASN A C     1 
ATOM   1057  O  O     . ASN A 1 139  ? 88.830  5.170   110.257 1.00 156.33 ? 139  ASN A O     1 
ATOM   1058  C  CB    . ASN A 1 139  ? 91.694  5.172   111.584 1.00 153.29 ? 139  ASN A CB    1 
ATOM   1059  C  CG    . ASN A 1 139  ? 91.703  6.622   112.093 1.00 159.13 ? 139  ASN A CG    1 
ATOM   1060  O  OD1   . ASN A 1 139  ? 91.031  6.964   113.065 1.00 165.84 ? 139  ASN A OD1   1 
ATOM   1061  N  ND2   . ASN A 1 139  ? 92.473  7.474   111.429 1.00 157.20 ? 139  ASN A ND2   1 
ATOM   1062  N  N     . MET A 1 140  ? 88.583  6.019   112.325 1.00 150.53 ? 140  MET A N     1 
ATOM   1063  C  CA    . MET A 1 140  ? 87.483  6.907   111.930 1.00 145.12 ? 140  MET A CA    1 
ATOM   1064  C  C     . MET A 1 140  ? 87.207  8.103   112.836 1.00 141.17 ? 140  MET A C     1 
ATOM   1065  O  O     . MET A 1 140  ? 87.793  8.230   113.904 1.00 145.10 ? 140  MET A O     1 
ATOM   1066  C  CB    . MET A 1 140  ? 86.191  6.136   111.657 1.00 142.84 ? 140  MET A CB    1 
ATOM   1067  C  CG    . MET A 1 140  ? 85.598  5.359   112.792 1.00 140.77 ? 140  MET A CG    1 
ATOM   1068  S  SD    . MET A 1 140  ? 83.959  4.820   112.253 1.00 138.54 ? 140  MET A SD    1 
ATOM   1069  C  CE    . MET A 1 140  ? 83.860  3.161   112.937 1.00 143.46 ? 140  MET A CE    1 
ATOM   1070  N  N     . GLU A 1 141  ? 86.390  9.030   112.340 1.00 140.20 ? 141  GLU A N     1 
ATOM   1071  C  CA    . GLU A 1 141  ? 85.888  10.141  113.144 1.00 141.37 ? 141  GLU A CA    1 
ATOM   1072  C  C     . GLU A 1 141  ? 84.390  10.391  112.923 1.00 139.90 ? 141  GLU A C     1 
ATOM   1073  O  O     . GLU A 1 141  ? 83.994  10.847  111.854 1.00 138.49 ? 141  GLU A O     1 
ATOM   1074  C  CB    . GLU A 1 141  ? 86.672  11.413  112.823 1.00 144.44 ? 141  GLU A CB    1 
ATOM   1075  C  CG    . GLU A 1 141  ? 88.178  11.224  112.838 1.00 145.65 ? 141  GLU A CG    1 
ATOM   1076  C  CD    . GLU A 1 141  ? 88.911  12.468  112.414 1.00 149.16 ? 141  GLU A CD    1 
ATOM   1077  O  OE1   . GLU A 1 141  ? 88.237  13.465  112.064 1.00 150.87 ? 141  GLU A OE1   1 
ATOM   1078  O  OE2   . GLU A 1 141  ? 90.159  12.446  112.435 1.00 145.68 ? 141  GLU A OE2   1 
ATOM   1079  N  N     . VAL A 1 142  ? 83.577  10.167  113.958 1.00 145.32 ? 142  VAL A N     1 
ATOM   1080  C  CA    . VAL A 1 142  ? 82.109  10.305  113.867 1.00 139.68 ? 142  VAL A CA    1 
ATOM   1081  C  C     . VAL A 1 142  ? 81.492  11.470  114.694 1.00 138.50 ? 142  VAL A C     1 
ATOM   1082  O  O     . VAL A 1 142  ? 81.636  11.532  115.922 1.00 138.75 ? 142  VAL A O     1 
ATOM   1083  C  CB    . VAL A 1 142  ? 81.394  8.950   114.176 1.00 131.61 ? 142  VAL A CB    1 
ATOM   1084  C  CG1   . VAL A 1 142  ? 82.294  8.029   114.973 1.00 127.51 ? 142  VAL A CG1   1 
ATOM   1085  C  CG2   . VAL A 1 142  ? 80.065  9.167   114.878 1.00 129.55 ? 142  VAL A CG2   1 
ATOM   1086  N  N     . ARG A 1 143  ? 80.817  12.391  114.002 1.00 132.97 ? 143  ARG A N     1 
ATOM   1087  C  CA    . ARG A 1 143  ? 80.197  13.560  114.634 1.00 134.52 ? 143  ARG A CA    1 
ATOM   1088  C  C     . ARG A 1 143  ? 78.763  13.277  115.142 1.00 135.36 ? 143  ARG A C     1 
ATOM   1089  O  O     . ARG A 1 143  ? 77.928  12.764  114.401 1.00 134.98 ? 143  ARG A O     1 
ATOM   1090  C  CB    . ARG A 1 143  ? 80.240  14.770  113.680 1.00 129.98 ? 143  ARG A CB    1 
ATOM   1091  C  CG    . ARG A 1 143  ? 79.270  15.880  114.034 1.00 129.14 ? 143  ARG A CG    1 
ATOM   1092  C  CD    . ARG A 1 143  ? 79.598  17.187  113.341 1.00 130.55 ? 143  ARG A CD    1 
ATOM   1093  N  NE    . ARG A 1 143  ? 78.489  18.139  113.436 1.00 137.64 ? 143  ARG A NE    1 
ATOM   1094  C  CZ    . ARG A 1 143  ? 78.571  19.443  113.162 1.00 140.40 ? 143  ARG A CZ    1 
ATOM   1095  N  NH1   . ARG A 1 143  ? 79.724  19.982  112.776 1.00 140.48 ? 143  ARG A NH1   1 
ATOM   1096  N  NH2   . ARG A 1 143  ? 77.492  20.215  113.282 1.00 133.99 ? 143  ARG A NH2   1 
ATOM   1097  N  N     . VAL A 1 144  ? 78.498  13.600  116.412 1.00 136.53 ? 144  VAL A N     1 
ATOM   1098  C  CA    . VAL A 1 144  ? 77.190  13.405  117.048 1.00 126.29 ? 144  VAL A CA    1 
ATOM   1099  C  C     . VAL A 1 144  ? 76.559  14.737  117.450 1.00 131.20 ? 144  VAL A C     1 
ATOM   1100  O  O     . VAL A 1 144  ? 77.132  15.472  118.247 1.00 135.12 ? 144  VAL A O     1 
ATOM   1101  C  CB    . VAL A 1 144  ? 77.319  12.592  118.343 1.00 117.94 ? 144  VAL A CB    1 
ATOM   1102  C  CG1   . VAL A 1 144  ? 76.027  12.619  119.084 1.00 124.79 ? 144  VAL A CG1   1 
ATOM   1103  C  CG2   . VAL A 1 144  ? 77.728  11.170  118.049 1.00 120.83 ? 144  VAL A CG2   1 
ATOM   1104  N  N     . ASP A 1 145  ? 75.381  15.049  116.913 1.00 134.93 ? 145  ASP A N     1 
ATOM   1105  C  CA    . ASP A 1 145  ? 74.660  16.268  117.302 1.00 136.38 ? 145  ASP A CA    1 
ATOM   1106  C  C     . ASP A 1 145  ? 73.425  15.989  118.170 1.00 140.51 ? 145  ASP A C     1 
ATOM   1107  O  O     . ASP A 1 145  ? 72.753  14.957  118.015 1.00 139.60 ? 145  ASP A O     1 
ATOM   1108  C  CB    . ASP A 1 145  ? 74.239  17.085  116.072 1.00 132.45 ? 145  ASP A CB    1 
ATOM   1109  C  CG    . ASP A 1 145  ? 75.409  17.689  115.342 1.00 131.78 ? 145  ASP A CG    1 
ATOM   1110  O  OD1   . ASP A 1 145  ? 76.478  17.821  115.962 1.00 133.78 ? 145  ASP A OD1   1 
ATOM   1111  O  OD2   . ASP A 1 145  ? 75.255  18.038  114.153 1.00 130.93 ? 145  ASP A OD2   1 
ATOM   1112  N  N     . ARG A 1 146  ? 73.137  16.906  119.091 1.00 139.45 ? 146  ARG A N     1 
ATOM   1113  C  CA    . ARG A 1 146  ? 71.848  16.903  119.754 1.00 133.92 ? 146  ARG A CA    1 
ATOM   1114  C  C     . ARG A 1 146  ? 70.862  17.525  118.769 1.00 133.66 ? 146  ARG A C     1 
ATOM   1115  O  O     . ARG A 1 146  ? 71.112  18.592  118.187 1.00 123.93 ? 146  ARG A O     1 
ATOM   1116  C  CB    . ARG A 1 146  ? 71.877  17.680  121.076 1.00 136.01 ? 146  ARG A CB    1 
ATOM   1117  C  CG    . ARG A 1 146  ? 70.570  17.596  121.862 1.00 138.71 ? 146  ARG A CG    1 
ATOM   1118  C  CD    . ARG A 1 146  ? 70.502  18.596  123.011 1.00 143.62 ? 146  ARG A CD    1 
ATOM   1119  N  NE    . ARG A 1 146  ? 70.960  18.037  124.283 1.00 148.72 ? 146  ARG A NE    1 
ATOM   1120  C  CZ    . ARG A 1 146  ? 72.143  18.293  124.833 1.00 147.94 ? 146  ARG A CZ    1 
ATOM   1121  N  NH1   . ARG A 1 146  ? 72.996  19.102  124.220 1.00 149.24 ? 146  ARG A NH1   1 
ATOM   1122  N  NH2   . ARG A 1 146  ? 72.474  17.745  125.995 1.00 143.33 ? 146  ARG A NH2   1 
ATOM   1123  N  N     . GLY A 1 147  ? 69.747  16.833  118.567 1.00 138.04 ? 147  GLY A N     1 
ATOM   1124  C  CA    . GLY A 1 147  ? 68.718  17.278  117.645 1.00 136.95 ? 147  GLY A CA    1 
ATOM   1125  C  C     . GLY A 1 147  ? 67.364  16.737  118.068 1.00 134.92 ? 147  GLY A C     1 
ATOM   1126  O  O     . GLY A 1 147  ? 67.221  16.119  119.130 1.00 135.23 ? 147  GLY A O     1 
ATOM   1127  N  N     . VAL A 1 148  ? 66.356  16.977  117.245 1.00 128.82 ? 148  VAL A N     1 
ATOM   1128  C  CA    . VAL A 1 148  ? 65.024  16.519  117.570 1.00 127.11 ? 148  VAL A CA    1 
ATOM   1129  C  C     . VAL A 1 148  ? 64.511  15.729  116.379 1.00 129.89 ? 148  VAL A C     1 
ATOM   1130  O  O     . VAL A 1 148  ? 64.883  16.018  115.245 1.00 128.43 ? 148  VAL A O     1 
ATOM   1131  C  CB    . VAL A 1 148  ? 64.097  17.712  117.841 1.00 129.79 ? 148  VAL A CB    1 
ATOM   1132  C  CG1   . VAL A 1 148  ? 62.727  17.241  118.273 1.00 132.19 ? 148  VAL A CG1   1 
ATOM   1133  C  CG2   . VAL A 1 148  ? 64.704  18.632  118.898 1.00 125.06 ? 148  VAL A CG2   1 
ATOM   1134  N  N     . GLY A 1 149  ? 63.682  14.719  116.636 1.00 131.41 ? 149  GLY A N     1 
ATOM   1135  C  CA    . GLY A 1 149  ? 63.009  13.984  115.577 1.00 130.20 ? 149  GLY A CA    1 
ATOM   1136  C  C     . GLY A 1 149  ? 63.909  13.281  114.571 1.00 128.24 ? 149  GLY A C     1 
ATOM   1137  O  O     . GLY A 1 149  ? 65.072  12.986  114.866 1.00 126.13 ? 149  GLY A O     1 
ATOM   1138  N  N     . TYR A 1 150  ? 63.358  13.024  113.379 1.00 127.81 ? 150  TYR A N     1 
ATOM   1139  C  CA    . TYR A 1 150  ? 64.042  12.293  112.298 1.00 124.95 ? 150  TYR A CA    1 
ATOM   1140  C  C     . TYR A 1 150  ? 64.500  13.235  111.211 1.00 121.79 ? 150  TYR A C     1 
ATOM   1141  O  O     . TYR A 1 150  ? 63.693  13.772  110.447 1.00 122.61 ? 150  TYR A O     1 
ATOM   1142  C  CB    . TYR A 1 150  ? 63.104  11.237  111.688 1.00 123.92 ? 150  TYR A CB    1 
ATOM   1143  C  CG    . TYR A 1 150  ? 63.558  10.563  110.393 1.00 121.46 ? 150  TYR A CG    1 
ATOM   1144  C  CD1   . TYR A 1 150  ? 64.535  9.570   110.394 1.00 121.27 ? 150  TYR A CD1   1 
ATOM   1145  C  CD2   . TYR A 1 150  ? 62.962  10.883  109.177 1.00 124.20 ? 150  TYR A CD2   1 
ATOM   1146  C  CE1   . TYR A 1 150  ? 64.929  8.943   109.210 1.00 121.90 ? 150  TYR A CE1   1 
ATOM   1147  C  CE2   . TYR A 1 150  ? 63.348  10.261  107.993 1.00 124.08 ? 150  TYR A CE2   1 
ATOM   1148  C  CZ    . TYR A 1 150  ? 64.330  9.297   108.016 1.00 122.88 ? 150  TYR A CZ    1 
ATOM   1149  O  OH    . TYR A 1 150  ? 64.704  8.690   106.842 1.00 117.10 ? 150  TYR A OH    1 
ATOM   1150  N  N     . VAL A 1 151  ? 65.804  13.437  111.141 1.00 116.15 ? 151  VAL A N     1 
ATOM   1151  C  CA    . VAL A 1 151  ? 66.342  14.275  110.104 1.00 118.32 ? 151  VAL A CA    1 
ATOM   1152  C  C     . VAL A 1 151  ? 67.235  13.425  109.223 1.00 126.17 ? 151  VAL A C     1 
ATOM   1153  O  O     . VAL A 1 151  ? 68.282  12.952  109.668 1.00 127.66 ? 151  VAL A O     1 
ATOM   1154  C  CB    . VAL A 1 151  ? 67.055  15.485  110.689 1.00 114.79 ? 151  VAL A CB    1 
ATOM   1155  C  CG1   . VAL A 1 151  ? 67.909  16.143  109.651 1.00 120.83 ? 151  VAL A CG1   1 
ATOM   1156  C  CG2   . VAL A 1 151  ? 66.027  16.466  111.205 1.00 114.11 ? 151  VAL A CG2   1 
ATOM   1157  N  N     . PRO A 1 152  ? 66.788  13.191  107.975 1.00 128.08 ? 152  PRO A N     1 
ATOM   1158  C  CA    . PRO A 1 152  ? 67.488  12.341  107.014 1.00 126.79 ? 152  PRO A CA    1 
ATOM   1159  C  C     . PRO A 1 152  ? 68.705  13.050  106.478 1.00 127.93 ? 152  PRO A C     1 
ATOM   1160  O  O     . PRO A 1 152  ? 68.718  14.275  106.423 1.00 129.78 ? 152  PRO A O     1 
ATOM   1161  C  CB    . PRO A 1 152  ? 66.465  12.160  105.879 1.00 127.31 ? 152  PRO A CB    1 
ATOM   1162  C  CG    . PRO A 1 152  ? 65.176  12.658  106.404 1.00 126.37 ? 152  PRO A CG    1 
ATOM   1163  C  CD    . PRO A 1 152  ? 65.525  13.697  107.421 1.00 128.95 ? 152  PRO A CD    1 
ATOM   1164  N  N     . ALA A 1 153  ? 69.701  12.274  106.074 1.00 127.30 ? 153  ALA A N     1 
ATOM   1165  C  CA    . ALA A 1 153  ? 70.933  12.786  105.475 1.00 134.82 ? 153  ALA A CA    1 
ATOM   1166  C  C     . ALA A 1 153  ? 70.733  13.769  104.304 1.00 138.55 ? 153  ALA A C     1 
ATOM   1167  O  O     . ALA A 1 153  ? 71.473  14.746  104.148 1.00 134.74 ? 153  ALA A O     1 
ATOM   1168  C  CB    . ALA A 1 153  ? 71.784  11.618  105.016 1.00 140.38 ? 153  ALA A CB    1 
ATOM   1169  N  N     . GLU A 1 154  ? 69.741  13.494  103.471 1.00 141.77 ? 154  GLU A N     1 
ATOM   1170  C  CA    . GLU A 1 154  ? 69.466  14.341  102.330 1.00 135.91 ? 154  GLU A CA    1 
ATOM   1171  C  C     . GLU A 1 154  ? 69.093  15.749  102.802 1.00 133.63 ? 154  GLU A C     1 
ATOM   1172  O  O     . GLU A 1 154  ? 69.312  16.723  102.095 1.00 135.98 ? 154  GLU A O     1 
ATOM   1173  C  CB    . GLU A 1 154  ? 68.364  13.720  101.456 1.00 142.32 ? 154  GLU A CB    1 
ATOM   1174  C  CG    . GLU A 1 154  ? 68.619  12.241  101.054 1.00 152.76 ? 154  GLU A CG    1 
ATOM   1175  C  CD    . GLU A 1 154  ? 68.159  11.201  102.111 1.00 156.39 ? 154  GLU A CD    1 
ATOM   1176  O  OE1   . GLU A 1 154  ? 67.037  11.343  102.660 1.00 147.15 ? 154  GLU A OE1   1 
ATOM   1177  O  OE2   . GLU A 1 154  ? 68.909  10.225  102.382 1.00 150.70 ? 154  GLU A OE2   1 
ATOM   1178  N  N     . LYS A 1 155  ? 68.535  15.853  104.003 1.00 131.72 ? 155  LYS A N     1 
ATOM   1179  C  CA    . LYS A 1 155  ? 68.158  17.151  104.555 1.00 131.72 ? 155  LYS A CA    1 
ATOM   1180  C  C     . LYS A 1 155  ? 69.266  17.986  105.224 1.00 128.61 ? 155  LYS A C     1 
ATOM   1181  O  O     . LYS A 1 155  ? 69.348  19.193  104.995 1.00 130.23 ? 155  LYS A O     1 
ATOM   1182  C  CB    . LYS A 1 155  ? 66.931  17.014  105.460 1.00 133.79 ? 155  LYS A CB    1 
ATOM   1183  C  CG    . LYS A 1 155  ? 65.633  16.857  104.664 1.00 146.81 ? 155  LYS A CG    1 
ATOM   1184  C  CD    . LYS A 1 155  ? 65.544  17.920  103.553 1.00 163.90 ? 155  LYS A CD    1 
ATOM   1185  C  CE    . LYS A 1 155  ? 64.267  17.810  102.702 1.00 170.37 ? 155  LYS A CE    1 
ATOM   1186  N  NZ    . LYS A 1 155  ? 64.235  16.622  101.797 1.00 154.02 ? 155  LYS A NZ    1 
ATOM   1187  N  N     . HIS A 1 156  ? 70.065  17.373  106.096 1.00 126.55 ? 156  HIS A N     1 
ATOM   1188  C  CA    . HIS A 1 156  ? 71.189  18.073  106.738 1.00 126.15 ? 156  HIS A CA    1 
ATOM   1189  C  C     . HIS A 1 156  ? 72.515  18.092  105.970 1.00 134.90 ? 156  HIS A C     1 
ATOM   1190  O  O     . HIS A 1 156  ? 73.233  19.098  105.980 1.00 141.47 ? 156  HIS A O     1 
ATOM   1191  C  CB    . HIS A 1 156  ? 71.390  17.620  108.184 1.00 125.39 ? 156  HIS A CB    1 
ATOM   1192  C  CG    . HIS A 1 156  ? 71.914  16.230  108.322 1.00 124.87 ? 156  HIS A CG    1 
ATOM   1193  N  ND1   . HIS A 1 156  ? 73.251  15.958  108.491 1.00 125.58 ? 156  HIS A ND1   1 
ATOM   1194  C  CD2   . HIS A 1 156  ? 71.281  15.034  108.332 1.00 127.23 ? 156  HIS A CD2   1 
ATOM   1195  C  CE1   . HIS A 1 156  ? 73.423  14.653  108.593 1.00 128.80 ? 156  HIS A CE1   1 
ATOM   1196  N  NE2   . HIS A 1 156  ? 72.243  14.068  108.498 1.00 126.69 ? 156  HIS A NE2   1 
ATOM   1197  N  N     . GLY A 1 157  ? 72.855  16.964  105.348 1.00 136.60 ? 157  GLY A N     1 
ATOM   1198  C  CA    . GLY A 1 157  ? 74.079  16.843  104.564 1.00 138.96 ? 157  GLY A CA    1 
ATOM   1199  C  C     . GLY A 1 157  ? 75.333  17.218  105.333 1.00 139.56 ? 157  GLY A C     1 
ATOM   1200  O  O     . GLY A 1 157  ? 76.264  17.813  104.788 1.00 142.33 ? 157  GLY A O     1 
ATOM   1201  N  N     . ILE A 1 158  ? 75.352  16.870  106.612 1.00 139.50 ? 158  ILE A N     1 
ATOM   1202  C  CA    . ILE A 1 158  ? 76.437  17.291  107.474 1.00 139.13 ? 158  ILE A CA    1 
ATOM   1203  C  C     . ILE A 1 158  ? 77.729  16.589  107.074 1.00 137.01 ? 158  ILE A C     1 
ATOM   1204  O  O     . ILE A 1 158  ? 77.787  15.369  106.934 1.00 131.55 ? 158  ILE A O     1 
ATOM   1205  C  CB    . ILE A 1 158  ? 76.077  17.144  108.981 1.00 134.91 ? 158  ILE A CB    1 
ATOM   1206  C  CG1   . ILE A 1 158  ? 75.212  18.337  109.418 1.00 130.43 ? 158  ILE A CG1   1 
ATOM   1207  C  CG2   . ILE A 1 158  ? 77.319  17.037  109.838 1.00 138.90 ? 158  ILE A CG2   1 
ATOM   1208  C  CD1   . ILE A 1 158  ? 75.226  18.627  110.903 1.00 129.81 ? 158  ILE A CD1   1 
ATOM   1209  N  N     . LYS A 1 159  ? 78.740  17.406  106.810 1.00 140.88 ? 159  LYS A N     1 
ATOM   1210  C  CA    . LYS A 1 159  ? 80.068  16.931  106.502 1.00 141.53 ? 159  LYS A CA    1 
ATOM   1211  C  C     . LYS A 1 159  ? 81.057  17.784  107.281 1.00 146.39 ? 159  LYS A C     1 
ATOM   1212  O  O     . LYS A 1 159  ? 81.107  19.006  107.114 1.00 146.17 ? 159  LYS A O     1 
ATOM   1213  C  CB    . LYS A 1 159  ? 80.344  17.039  105.000 1.00 141.24 ? 159  LYS A CB    1 
ATOM   1214  C  CG    . LYS A 1 159  ? 79.295  16.374  104.128 1.00 139.15 ? 159  LYS A CG    1 
ATOM   1215  C  CD    . LYS A 1 159  ? 79.483  16.701  102.648 1.00 145.49 ? 159  LYS A CD    1 
ATOM   1216  C  CE    . LYS A 1 159  ? 80.628  15.908  102.020 1.00 147.53 ? 159  LYS A CE    1 
ATOM   1217  N  NZ    . LYS A 1 159  ? 80.685  16.058  100.532 1.00 143.38 ? 159  LYS A NZ    1 
ATOM   1218  N  N     . ASP A 1 160  ? 81.822  17.136  108.152 1.00 148.06 ? 160  ASP A N     1 
ATOM   1219  C  CA    . ASP A 1 160  ? 82.973  17.772  108.781 1.00 157.24 ? 160  ASP A CA    1 
ATOM   1220  C  C     . ASP A 1 160  ? 84.035  18.113  107.710 1.00 157.45 ? 160  ASP A C     1 
ATOM   1221  O  O     . ASP A 1 160  ? 84.432  19.271  107.556 1.00 154.31 ? 160  ASP A O     1 
ATOM   1222  C  CB    . ASP A 1 160  ? 83.567  16.860  109.872 1.00 161.48 ? 160  ASP A CB    1 
ATOM   1223  C  CG    . ASP A 1 160  ? 82.732  16.838  111.154 1.00 152.37 ? 160  ASP A CG    1 
ATOM   1224  O  OD1   . ASP A 1 160  ? 81.911  17.762  111.349 1.00 145.83 ? 160  ASP A OD1   1 
ATOM   1225  O  OD2   . ASP A 1 160  ? 82.914  15.906  111.973 1.00 149.40 ? 160  ASP A OD2   1 
ATOM   1226  N  N     . ARG A 1 161  ? 84.465  17.101  106.960 1.00 155.09 ? 161  ARG A N     1 
ATOM   1227  C  CA    . ARG A 1 161  ? 85.478  17.261  105.918 1.00 155.22 ? 161  ARG A CA    1 
ATOM   1228  C  C     . ARG A 1 161  ? 84.931  16.826  104.548 1.00 158.73 ? 161  ARG A C     1 
ATOM   1229  O  O     . ARG A 1 161  ? 83.736  16.561  104.421 1.00 156.19 ? 161  ARG A O     1 
ATOM   1230  C  CB    . ARG A 1 161  ? 86.739  16.482  106.276 1.00 158.79 ? 161  ARG A CB    1 
ATOM   1231  C  CG    . ARG A 1 161  ? 86.674  15.004  105.951 1.00 158.13 ? 161  ARG A CG    1 
ATOM   1232  C  CD    . ARG A 1 161  ? 87.947  14.334  106.362 1.00 160.40 ? 161  ARG A CD    1 
ATOM   1233  N  NE    . ARG A 1 161  ? 88.134  14.447  107.804 1.00 165.41 ? 161  ARG A NE    1 
ATOM   1234  C  CZ    . ARG A 1 161  ? 89.263  14.150  108.437 1.00 169.58 ? 161  ARG A CZ    1 
ATOM   1235  N  NH1   . ARG A 1 161  ? 90.314  13.723  107.747 1.00 171.16 ? 161  ARG A NH1   1 
ATOM   1236  N  NH2   . ARG A 1 161  ? 89.343  14.287  109.757 1.00 165.43 ? 161  ARG A NH2   1 
ATOM   1237  N  N     . ILE A 1 162  ? 85.785  16.777  103.522 1.00 161.89 ? 162  ILE A N     1 
ATOM   1238  C  CA    . ILE A 1 162  ? 85.319  16.517  102.149 1.00 156.98 ? 162  ILE A CA    1 
ATOM   1239  C  C     . ILE A 1 162  ? 85.066  15.021  101.794 1.00 153.29 ? 162  ILE A C     1 
ATOM   1240  O  O     . ILE A 1 162  ? 84.311  14.705  100.867 1.00 151.72 ? 162  ILE A O     1 
ATOM   1241  C  CB    . ILE A 1 162  ? 86.225  17.244  101.101 1.00 150.76 ? 162  ILE A CB    1 
ATOM   1242  C  CG1   . ILE A 1 162  ? 86.511  18.689  101.544 1.00 152.71 ? 162  ILE A CG1   1 
ATOM   1243  C  CG2   . ILE A 1 162  ? 85.582  17.252  99.726  1.00 149.64 ? 162  ILE A CG2   1 
ATOM   1244  C  CD1   . ILE A 1 162  ? 85.305  19.639  101.491 1.00 148.35 ? 162  ILE A CD1   1 
ATOM   1245  N  N     . ASN A 1 163  ? 85.680  14.111  102.544 1.00 152.87 ? 163  ASN A N     1 
ATOM   1246  C  CA    . ASN A 1 163  ? 85.399  12.675  102.419 1.00 151.98 ? 163  ASN A CA    1 
ATOM   1247  C  C     . ASN A 1 163  ? 84.350  12.165  103.409 1.00 150.86 ? 163  ASN A C     1 
ATOM   1248  O  O     . ASN A 1 163  ? 84.185  10.954  103.581 1.00 144.02 ? 163  ASN A O     1 
ATOM   1249  C  CB    . ASN A 1 163  ? 86.669  11.856  102.586 1.00 151.94 ? 163  ASN A CB    1 
ATOM   1250  C  CG    . ASN A 1 163  ? 87.499  11.816  101.345 1.00 146.18 ? 163  ASN A CG    1 
ATOM   1251  O  OD1   . ASN A 1 163  ? 86.974  11.885  100.234 1.00 144.96 ? 163  ASN A OD1   1 
ATOM   1252  N  ND2   . ASN A 1 163  ? 88.810  11.693  101.517 1.00 143.44 ? 163  ASN A ND2   1 
ATOM   1253  N  N     . ALA A 1 164  ? 83.710  13.092  104.116 1.00 149.88 ? 164  ALA A N     1 
ATOM   1254  C  CA    . ALA A 1 164  ? 82.717  12.751  105.131 1.00 141.05 ? 164  ALA A CA    1 
ATOM   1255  C  C     . ALA A 1 164  ? 81.340  12.407  104.551 1.00 138.31 ? 164  ALA A C     1 
ATOM   1256  O  O     . ALA A 1 164  ? 80.885  13.001  103.570 1.00 138.64 ? 164  ALA A O     1 
ATOM   1257  C  CB    . ALA A 1 164  ? 82.600  13.873  106.155 1.00 144.57 ? 164  ALA A CB    1 
ATOM   1258  N  N     . ILE A 1 165  ? 80.689  11.443  105.196 1.00 136.82 ? 165  ILE A N     1 
ATOM   1259  C  CA    . ILE A 1 165  ? 79.397  10.903  104.793 1.00 131.25 ? 165  ILE A CA    1 
ATOM   1260  C  C     . ILE A 1 165  ? 78.272  11.423  105.686 1.00 132.71 ? 165  ILE A C     1 
ATOM   1261  O  O     . ILE A 1 165  ? 78.262  11.162  106.890 1.00 131.12 ? 165  ILE A O     1 
ATOM   1262  C  CB    . ILE A 1 165  ? 79.403  9.376   104.953 1.00 126.35 ? 165  ILE A CB    1 
ATOM   1263  C  CG1   . ILE A 1 165  ? 80.519  8.748   104.122 1.00 127.82 ? 165  ILE A CG1   1 
ATOM   1264  C  CG2   . ILE A 1 165  ? 78.045  8.788   104.620 1.00 130.42 ? 165  ILE A CG2   1 
ATOM   1265  C  CD1   . ILE A 1 165  ? 80.698  7.275   104.377 1.00 124.66 ? 165  ILE A CD1   1 
ATOM   1266  N  N     . PRO A 1 166  ? 77.325  12.178  105.112 1.00 132.90 ? 166  PRO A N     1 
ATOM   1267  C  CA    . PRO A 1 166  ? 76.133  12.441  105.914 1.00 130.93 ? 166  PRO A CA    1 
ATOM   1268  C  C     . PRO A 1 166  ? 75.402  11.136  106.300 1.00 133.90 ? 166  PRO A C     1 
ATOM   1269  O  O     . PRO A 1 166  ? 75.315  10.213  105.481 1.00 130.46 ? 166  PRO A O     1 
ATOM   1270  C  CB    . PRO A 1 166  ? 75.288  13.312  104.979 1.00 130.71 ? 166  PRO A CB    1 
ATOM   1271  C  CG    . PRO A 1 166  ? 76.279  14.042  104.175 1.00 128.51 ? 166  PRO A CG    1 
ATOM   1272  C  CD    . PRO A 1 166  ? 77.386  13.052  103.927 1.00 136.75 ? 166  PRO A CD    1 
ATOM   1273  N  N     . VAL A 1 167  ? 74.920  11.066  107.547 1.00 137.70 ? 167  VAL A N     1 
ATOM   1274  C  CA    . VAL A 1 167  ? 74.154  9.926   108.073 1.00 134.11 ? 167  VAL A CA    1 
ATOM   1275  C  C     . VAL A 1 167  ? 72.731  10.362  108.442 1.00 134.64 ? 167  VAL A C     1 
ATOM   1276  O  O     . VAL A 1 167  ? 72.507  11.518  108.808 1.00 133.62 ? 167  VAL A O     1 
ATOM   1277  C  CB    . VAL A 1 167  ? 74.803  9.360   109.357 1.00 129.86 ? 167  VAL A CB    1 
ATOM   1278  C  CG1   . VAL A 1 167  ? 74.164  8.036   109.753 1.00 131.53 ? 167  VAL A CG1   1 
ATOM   1279  C  CG2   . VAL A 1 167  ? 76.283  9.193   109.168 1.00 133.28 ? 167  VAL A CG2   1 
ATOM   1280  N  N     . ASP A 1 168  ? 71.772  9.444   108.344 1.00 134.17 ? 168  ASP A N     1 
ATOM   1281  C  CA    . ASP A 1 168  ? 70.427  9.711   108.827 1.00 128.93 ? 168  ASP A CA    1 
ATOM   1282  C  C     . ASP A 1 168  ? 70.428  9.626   110.345 1.00 127.99 ? 168  ASP A C     1 
ATOM   1283  O  O     . ASP A 1 168  ? 70.959  8.679   110.938 1.00 126.18 ? 168  ASP A O     1 
ATOM   1284  C  CB    . ASP A 1 168  ? 69.427  8.720   108.235 1.00 130.32 ? 168  ASP A CB    1 
ATOM   1285  C  CG    . ASP A 1 168  ? 69.337  8.814   106.723 1.00 137.04 ? 168  ASP A CG    1 
ATOM   1286  O  OD1   . ASP A 1 168  ? 69.387  9.945   106.192 1.00 135.47 ? 168  ASP A OD1   1 
ATOM   1287  O  OD2   . ASP A 1 168  ? 69.222  7.754   106.065 1.00 137.48 ? 168  ASP A OD2   1 
ATOM   1288  N  N     . ALA A 1 169  ? 69.845  10.632  110.975 1.00 125.18 ? 169  ALA A N     1 
ATOM   1289  C  CA    . ALA A 1 169  ? 69.841  10.698  112.419 1.00 125.38 ? 169  ALA A CA    1 
ATOM   1290  C  C     . ALA A 1 169  ? 68.414  10.660  112.936 1.00 129.66 ? 169  ALA A C     1 
ATOM   1291  O  O     . ALA A 1 169  ? 67.594  11.512  112.567 1.00 127.80 ? 169  ALA A O     1 
ATOM   1292  C  CB    . ALA A 1 169  ? 70.530  11.969  112.872 1.00 128.37 ? 169  ALA A CB    1 
ATOM   1293  N  N     . VAL A 1 170  ? 68.113  9.662   113.769 1.00 130.43 ? 170  VAL A N     1 
ATOM   1294  C  CA    . VAL A 1 170  ? 66.875  9.678   114.542 1.00 129.37 ? 170  VAL A CA    1 
ATOM   1295  C  C     . VAL A 1 170  ? 67.236  10.125  115.946 1.00 132.12 ? 170  VAL A C     1 
ATOM   1296  O  O     . VAL A 1 170  ? 67.806  9.369   116.742 1.00 136.14 ? 170  VAL A O     1 
ATOM   1297  C  CB    . VAL A 1 170  ? 66.186  8.306   114.604 1.00 123.29 ? 170  VAL A CB    1 
ATOM   1298  C  CG1   . VAL A 1 170  ? 64.878  8.412   115.384 1.00 124.79 ? 170  VAL A CG1   1 
ATOM   1299  C  CG2   . VAL A 1 170  ? 65.922  7.787   113.213 1.00 117.91 ? 170  VAL A CG2   1 
ATOM   1300  N  N     . PHE A 1 171  ? 66.875  11.365  116.242 1.00 127.64 ? 171  PHE A N     1 
ATOM   1301  C  CA    . PHE A 1 171  ? 67.326  12.021  117.444 1.00 129.80 ? 171  PHE A CA    1 
ATOM   1302  C  C     . PHE A 1 171  ? 66.527  11.573  118.635 1.00 132.89 ? 171  PHE A C     1 
ATOM   1303  O  O     . PHE A 1 171  ? 67.091  11.335  119.706 1.00 132.38 ? 171  PHE A O     1 
ATOM   1304  C  CB    . PHE A 1 171  ? 67.194  13.520  117.272 1.00 131.56 ? 171  PHE A CB    1 
ATOM   1305  C  CG    . PHE A 1 171  ? 68.230  14.103  116.386 1.00 127.63 ? 171  PHE A CG    1 
ATOM   1306  C  CD1   . PHE A 1 171  ? 69.566  13.820  116.602 1.00 127.93 ? 171  PHE A CD1   1 
ATOM   1307  C  CD2   . PHE A 1 171  ? 67.876  14.922  115.332 1.00 124.94 ? 171  PHE A CD2   1 
ATOM   1308  C  CE1   . PHE A 1 171  ? 70.528  14.352  115.790 1.00 131.45 ? 171  PHE A CE1   1 
ATOM   1309  C  CE2   . PHE A 1 171  ? 68.836  15.462  114.516 1.00 127.49 ? 171  PHE A CE2   1 
ATOM   1310  C  CZ    . PHE A 1 171  ? 70.165  15.177  114.741 1.00 131.17 ? 171  PHE A CZ    1 
ATOM   1311  N  N     . SER A 1 172  ? 65.216  11.448  118.428 1.00 133.63 ? 172  SER A N     1 
ATOM   1312  C  CA    . SER A 1 172  ? 64.284  11.205  119.517 1.00 135.60 ? 172  SER A CA    1 
ATOM   1313  C  C     . SER A 1 172  ? 64.727  9.963   120.271 1.00 137.53 ? 172  SER A C     1 
ATOM   1314  O  O     . SER A 1 172  ? 64.791  8.877   119.697 1.00 135.10 ? 172  SER A O     1 
ATOM   1315  C  CB    . SER A 1 172  ? 62.857  11.031  118.988 1.00 133.41 ? 172  SER A CB    1 
ATOM   1316  O  OG    . SER A 1 172  ? 61.927  10.967  120.055 1.00 129.57 ? 172  SER A OG    1 
ATOM   1317  N  N     . PRO A 1 173  ? 65.097  10.152  121.553 1.00 139.78 ? 173  PRO A N     1 
ATOM   1318  C  CA    . PRO A 1 173  ? 65.545  9.158   122.535 1.00 133.64 ? 173  PRO A CA    1 
ATOM   1319  C  C     . PRO A 1 173  ? 64.424  8.249   123.006 1.00 133.46 ? 173  PRO A C     1 
ATOM   1320  O  O     . PRO A 1 173  ? 64.695  7.292   123.724 1.00 134.80 ? 173  PRO A O     1 
ATOM   1321  C  CB    . PRO A 1 173  ? 66.085  10.008  123.683 1.00 129.62 ? 173  PRO A CB    1 
ATOM   1322  C  CG    . PRO A 1 173  ? 65.291  11.239  123.616 1.00 131.34 ? 173  PRO A CG    1 
ATOM   1323  C  CD    . PRO A 1 173  ? 65.003  11.492  122.161 1.00 137.14 ? 173  PRO A CD    1 
ATOM   1324  N  N     . VAL A 1 174  ? 63.183  8.583   122.667 1.00 133.81 ? 174  VAL A N     1 
ATOM   1325  C  CA    . VAL A 1 174  ? 62.039  7.788   123.093 1.00 131.79 ? 174  VAL A CA    1 
ATOM   1326  C  C     . VAL A 1 174  ? 61.899  6.536   122.245 1.00 134.58 ? 174  VAL A C     1 
ATOM   1327  O  O     . VAL A 1 174  ? 61.578  6.628   121.059 1.00 136.43 ? 174  VAL A O     1 
ATOM   1328  C  CB    . VAL A 1 174  ? 60.760  8.581   122.848 1.00 128.68 ? 174  VAL A CB    1 
ATOM   1329  C  CG1   . VAL A 1 174  ? 59.565  7.877   123.472 1.00 124.69 ? 174  VAL A CG1   1 
ATOM   1330  C  CG2   . VAL A 1 174  ? 60.925  9.981   123.373 1.00 133.40 ? 174  VAL A CG2   1 
ATOM   1331  N  N     . ARG A 1 175  ? 62.076  5.366   122.859 1.00 134.73 ? 175  ARG A N     1 
ATOM   1332  C  CA    . ARG A 1 175  ? 61.981  4.107   122.120 1.00 130.47 ? 175  ARG A CA    1 
ATOM   1333  C  C     . ARG A 1 175  ? 60.512  3.740   121.926 1.00 125.89 ? 175  ARG A C     1 
ATOM   1334  O  O     . ARG A 1 175  ? 60.097  3.437   120.810 1.00 125.64 ? 175  ARG A O     1 
ATOM   1335  C  CB    . ARG A 1 175  ? 62.784  2.965   122.788 1.00 132.01 ? 175  ARG A CB    1 
ATOM   1336  C  CG    . ARG A 1 175  ? 64.332  3.134   122.755 1.00 137.55 ? 175  ARG A CG    1 
ATOM   1337  C  CD    . ARG A 1 175  ? 64.952  2.910   121.350 1.00 153.49 ? 175  ARG A CD    1 
ATOM   1338  N  NE    . ARG A 1 175  ? 66.191  3.677   121.109 1.00 160.08 ? 175  ARG A NE    1 
ATOM   1339  C  CZ    . ARG A 1 175  ? 66.964  3.567   120.020 1.00 160.89 ? 175  ARG A CZ    1 
ATOM   1340  N  NH1   . ARG A 1 175  ? 66.647  2.707   119.057 1.00 160.66 ? 175  ARG A NH1   1 
ATOM   1341  N  NH2   . ARG A 1 175  ? 68.063  4.311   119.893 1.00 148.72 ? 175  ARG A NH2   1 
ATOM   1342  N  N     . ARG A 1 176  ? 59.729  3.807   123.006 1.00 125.80 ? 176  ARG A N     1 
ATOM   1343  C  CA    . ARG A 1 176  ? 58.292  3.481   122.979 1.00 129.57 ? 176  ARG A CA    1 
ATOM   1344  C  C     . ARG A 1 176  ? 57.477  4.206   124.070 1.00 130.96 ? 176  ARG A C     1 
ATOM   1345  O  O     . ARG A 1 176  ? 57.999  4.489   125.150 1.00 130.77 ? 176  ARG A O     1 
ATOM   1346  C  CB    . ARG A 1 176  ? 58.091  1.958   123.077 1.00 128.72 ? 176  ARG A CB    1 
ATOM   1347  C  CG    . ARG A 1 176  ? 56.653  1.466   122.945 1.00 122.32 ? 176  ARG A CG    1 
ATOM   1348  C  CD    . ARG A 1 176  ? 56.594  0.107   122.282 1.00 118.85 ? 176  ARG A CD    1 
ATOM   1349  N  NE    . ARG A 1 176  ? 57.563  -0.822  122.843 1.00 125.47 ? 176  ARG A NE    1 
ATOM   1350  C  CZ    . ARG A 1 176  ? 57.325  -1.626  123.874 1.00 129.22 ? 176  ARG A CZ    1 
ATOM   1351  N  NH1   . ARG A 1 176  ? 56.135  -1.626  124.465 1.00 125.42 ? 176  ARG A NH1   1 
ATOM   1352  N  NH2   . ARG A 1 176  ? 58.285  -2.436  124.311 1.00 136.60 ? 176  ARG A NH2   1 
ATOM   1353  N  N     . VAL A 1 177  ? 56.204  4.499   123.776 1.00 131.98 ? 177  VAL A N     1 
ATOM   1354  C  CA    . VAL A 1 177  ? 55.259  5.120   124.728 1.00 128.22 ? 177  VAL A CA    1 
ATOM   1355  C  C     . VAL A 1 177  ? 53.845  4.502   124.644 1.00 126.27 ? 177  VAL A C     1 
ATOM   1356  O  O     . VAL A 1 177  ? 53.235  4.483   123.570 1.00 124.80 ? 177  VAL A O     1 
ATOM   1357  C  CB    . VAL A 1 177  ? 55.166  6.675   124.509 1.00 124.01 ? 177  VAL A CB    1 
ATOM   1358  C  CG1   . VAL A 1 177  ? 53.949  7.274   125.187 1.00 116.12 ? 177  VAL A CG1   1 
ATOM   1359  C  CG2   . VAL A 1 177  ? 56.426  7.368   124.989 1.00 123.71 ? 177  VAL A CG2   1 
ATOM   1360  N  N     . ALA A 1 178  ? 53.341  4.003   125.777 1.00 129.72 ? 178  ALA A N     1 
ATOM   1361  C  CA    . ALA A 1 178  ? 51.970  3.471   125.903 1.00 127.91 ? 178  ALA A CA    1 
ATOM   1362  C  C     . ALA A 1 178  ? 51.279  3.963   127.198 1.00 130.82 ? 178  ALA A C     1 
ATOM   1363  O  O     . ALA A 1 178  ? 51.953  4.198   128.206 1.00 131.71 ? 178  ALA A O     1 
ATOM   1364  C  CB    . ALA A 1 178  ? 51.993  1.948   125.866 1.00 117.92 ? 178  ALA A CB    1 
ATOM   1365  N  N     . PHE A 1 179  ? 49.951  4.125   127.188 1.00 129.10 ? 179  PHE A N     1 
ATOM   1366  C  CA    . PHE A 1 179  ? 49.230  4.415   128.448 1.00 129.31 ? 179  PHE A CA    1 
ATOM   1367  C  C     . PHE A 1 179  ? 48.000  3.532   128.763 1.00 129.52 ? 179  PHE A C     1 
ATOM   1368  O  O     . PHE A 1 179  ? 47.305  3.045   127.867 1.00 129.19 ? 179  PHE A O     1 
ATOM   1369  C  CB    . PHE A 1 179  ? 48.932  5.921   128.651 1.00 126.43 ? 179  PHE A CB    1 
ATOM   1370  C  CG    . PHE A 1 179  ? 47.971  6.515   127.654 1.00 122.07 ? 179  PHE A CG    1 
ATOM   1371  C  CD1   . PHE A 1 179  ? 46.605  6.337   127.782 1.00 123.58 ? 179  PHE A CD1   1 
ATOM   1372  C  CD2   . PHE A 1 179  ? 48.436  7.288   126.612 1.00 117.49 ? 179  PHE A CD2   1 
ATOM   1373  C  CE1   . PHE A 1 179  ? 45.733  6.895   126.864 1.00 121.77 ? 179  PHE A CE1   1 
ATOM   1374  C  CE2   . PHE A 1 179  ? 47.567  7.838   125.694 1.00 114.50 ? 179  PHE A CE2   1 
ATOM   1375  C  CZ    . PHE A 1 179  ? 46.219  7.648   125.820 1.00 115.35 ? 179  PHE A CZ    1 
ATOM   1376  N  N     . GLN A 1 180  ? 47.752  3.333   130.053 1.00 126.83 ? 180  GLN A N     1 
ATOM   1377  C  CA    . GLN A 1 180  ? 46.710  2.430   130.505 1.00 127.45 ? 180  GLN A CA    1 
ATOM   1378  C  C     . GLN A 1 180  ? 45.634  3.233   131.223 1.00 126.18 ? 180  GLN A C     1 
ATOM   1379  O  O     . GLN A 1 180  ? 45.928  3.983   132.154 1.00 127.34 ? 180  GLN A O     1 
ATOM   1380  C  CB    . GLN A 1 180  ? 47.319  1.379   131.442 1.00 130.59 ? 180  GLN A CB    1 
ATOM   1381  C  CG    . GLN A 1 180  ? 46.616  0.029   131.469 1.00 132.85 ? 180  GLN A CG    1 
ATOM   1382  C  CD    . GLN A 1 180  ? 46.760  -0.755  130.170 1.00 139.78 ? 180  GLN A CD    1 
ATOM   1383  O  OE1   . GLN A 1 180  ? 47.485  -0.356  129.246 1.00 132.09 ? 180  GLN A OE1   1 
ATOM   1384  N  NE2   . GLN A 1 180  ? 46.064  -1.886  130.096 1.00 144.83 ? 180  GLN A NE2   1 
ATOM   1385  N  N     . VAL A 1 181  ? 44.390  3.093   130.784 1.00 122.97 ? 181  VAL A N     1 
ATOM   1386  C  CA    . VAL A 1 181  ? 43.294  3.729   131.490 1.00 124.44 ? 181  VAL A CA    1 
ATOM   1387  C  C     . VAL A 1 181  ? 42.406  2.658   132.108 1.00 127.30 ? 181  VAL A C     1 
ATOM   1388  O  O     . VAL A 1 181  ? 41.673  1.972   131.407 1.00 128.10 ? 181  VAL A O     1 
ATOM   1389  C  CB    . VAL A 1 181  ? 42.488  4.644   130.552 1.00 125.19 ? 181  VAL A CB    1 
ATOM   1390  C  CG1   . VAL A 1 181  ? 41.210  5.131   131.220 1.00 128.00 ? 181  VAL A CG1   1 
ATOM   1391  C  CG2   . VAL A 1 181  ? 43.346  5.818   130.124 1.00 122.95 ? 181  VAL A CG2   1 
ATOM   1392  N  N     . GLU A 1 182  ? 42.478  2.523   133.430 1.00 129.32 ? 182  GLU A N     1 
ATOM   1393  C  CA    . GLU A 1 182  ? 41.788  1.449   134.137 1.00 129.25 ? 182  GLU A CA    1 
ATOM   1394  C  C     . GLU A 1 182  ? 40.855  2.069   135.145 1.00 130.97 ? 182  GLU A C     1 
ATOM   1395  O  O     . GLU A 1 182  ? 41.021  3.226   135.516 1.00 130.00 ? 182  GLU A O     1 
ATOM   1396  C  CB    . GLU A 1 182  ? 42.792  0.538   134.829 1.00 125.13 ? 182  GLU A CB    1 
ATOM   1397  C  CG    . GLU A 1 182  ? 44.088  0.470   134.061 1.00 134.24 ? 182  GLU A CG    1 
ATOM   1398  C  CD    . GLU A 1 182  ? 45.166  -0.296  134.770 1.00 140.38 ? 182  GLU A CD    1 
ATOM   1399  O  OE1   . GLU A 1 182  ? 45.063  -1.539  134.810 1.00 145.69 ? 182  GLU A OE1   1 
ATOM   1400  O  OE2   . GLU A 1 182  ? 46.123  0.342   135.267 1.00 138.85 ? 182  GLU A OE2   1 
ATOM   1401  N  N     . ASP A 1 183  ? 39.868  1.303   135.584 1.00 133.60 ? 183  ASP A N     1 
ATOM   1402  C  CA    . ASP A 1 183  ? 38.839  1.847   136.454 1.00 137.68 ? 183  ASP A CA    1 
ATOM   1403  C  C     . ASP A 1 183  ? 39.324  2.060   137.906 1.00 137.74 ? 183  ASP A C     1 
ATOM   1404  O  O     . ASP A 1 183  ? 40.018  1.217   138.490 1.00 132.86 ? 183  ASP A O     1 
ATOM   1405  C  CB    . ASP A 1 183  ? 37.586  0.965   136.398 1.00 144.05 ? 183  ASP A CB    1 
ATOM   1406  C  CG    . ASP A 1 183  ? 36.288  1.776   136.462 1.00 151.77 ? 183  ASP A CG    1 
ATOM   1407  O  OD1   . ASP A 1 183  ? 36.361  2.970   136.815 1.00 152.18 ? 183  ASP A OD1   1 
ATOM   1408  O  OD2   . ASP A 1 183  ? 35.193  1.228   136.179 1.00 155.93 ? 183  ASP A OD2   1 
ATOM   1409  N  N     . THR A 1 184  ? 38.946  3.209   138.463 1.00 135.97 ? 184  THR A N     1 
ATOM   1410  C  CA    . THR A 1 184  ? 39.268  3.597   139.827 1.00 131.02 ? 184  THR A CA    1 
ATOM   1411  C  C     . THR A 1 184  ? 38.077  4.399   140.340 1.00 139.11 ? 184  THR A C     1 
ATOM   1412  O  O     . THR A 1 184  ? 37.255  4.850   139.542 1.00 141.17 ? 184  THR A O     1 
ATOM   1413  C  CB    . THR A 1 184  ? 40.519  4.476   139.865 1.00 124.57 ? 184  THR A CB    1 
ATOM   1414  O  OG1   . THR A 1 184  ? 41.189  4.307   141.113 1.00 120.68 ? 184  THR A OG1   1 
ATOM   1415  C  CG2   . THR A 1 184  ? 40.150  5.934   139.693 1.00 126.10 ? 184  THR A CG2   1 
ATOM   1416  N  N     . ARG A 1 185  ? 37.962  4.571   141.658 1.00 144.36 ? 185  ARG A N     1 
ATOM   1417  C  CA    . ARG A 1 185  ? 36.818  5.298   142.221 1.00 146.06 ? 185  ARG A CA    1 
ATOM   1418  C  C     . ARG A 1 185  ? 37.122  5.959   143.569 1.00 144.30 ? 185  ARG A C     1 
ATOM   1419  O  O     . ARG A 1 185  ? 38.086  5.596   144.239 1.00 140.53 ? 185  ARG A O     1 
ATOM   1420  C  CB    . ARG A 1 185  ? 35.600  4.372   142.344 1.00 154.79 ? 185  ARG A CB    1 
ATOM   1421  C  CG    . ARG A 1 185  ? 35.553  3.521   143.597 1.00 160.11 ? 185  ARG A CG    1 
ATOM   1422  C  CD    . ARG A 1 185  ? 34.133  3.040   143.886 1.00 168.32 ? 185  ARG A CD    1 
ATOM   1423  N  NE    . ARG A 1 185  ? 34.049  2.312   145.154 1.00 182.67 ? 185  ARG A NE    1 
ATOM   1424  C  CZ    . ARG A 1 185  ? 32.939  2.172   145.877 1.00 185.92 ? 185  ARG A CZ    1 
ATOM   1425  N  NH1   . ARG A 1 185  ? 31.793  2.718   145.475 1.00 183.09 ? 185  ARG A NH1   1 
ATOM   1426  N  NH2   . ARG A 1 185  ? 32.981  1.489   147.015 1.00 184.84 ? 185  ARG A NH2   1 
ATOM   1427  N  N     . LEU A 1 186  ? 36.301  6.937   143.953 1.00 150.12 ? 186  LEU A N     1 
ATOM   1428  C  CA    . LEU A 1 186  ? 36.461  7.620   145.239 1.00 152.11 ? 186  LEU A CA    1 
ATOM   1429  C  C     . LEU A 1 186  ? 35.564  7.030   146.334 1.00 162.45 ? 186  LEU A C     1 
ATOM   1430  O  O     . LEU A 1 186  ? 35.622  7.425   147.503 1.00 154.73 ? 186  LEU A O     1 
ATOM   1431  C  CB    . LEU A 1 186  ? 36.200  9.111   145.078 1.00 145.07 ? 186  LEU A CB    1 
ATOM   1432  C  CG    . LEU A 1 186  ? 37.055  9.921   146.042 1.00 144.89 ? 186  LEU A CG    1 
ATOM   1433  C  CD1   . LEU A 1 186  ? 38.418  9.276   146.200 1.00 140.57 ? 186  LEU A CD1   1 
ATOM   1434  C  CD2   . LEU A 1 186  ? 37.195  11.345  145.564 1.00 152.07 ? 186  LEU A CD2   1 
ATOM   1435  N  N     . GLY A 1 187  ? 34.759  6.057   145.919 1.00 172.21 ? 187  GLY A N     1 
ATOM   1436  C  CA    . GLY A 1 187  ? 33.798  5.341   146.743 1.00 173.53 ? 187  GLY A CA    1 
ATOM   1437  C  C     . GLY A 1 187  ? 32.392  5.902   146.594 1.00 176.19 ? 187  GLY A C     1 
ATOM   1438  O  O     . GLY A 1 187  ? 31.398  5.167   146.698 1.00 175.42 ? 187  GLY A O     1 
ATOM   1439  N  N     . GLN A 1 188  ? 32.305  7.198   146.302 1.00 174.76 ? 188  GLN A N     1 
ATOM   1440  C  CA    . GLN A 1 188  ? 31.037  7.817   145.935 1.00 174.39 ? 188  GLN A CA    1 
ATOM   1441  C  C     . GLN A 1 188  ? 30.785  7.642   144.451 1.00 173.19 ? 188  GLN A C     1 
ATOM   1442  O  O     . GLN A 1 188  ? 29.672  7.325   144.031 1.00 176.37 ? 188  GLN A O     1 
ATOM   1443  C  CB    . GLN A 1 188  ? 31.031  9.305   146.278 1.00 170.52 ? 188  GLN A CB    1 
ATOM   1444  C  CG    . GLN A 1 188  ? 31.860  9.665   147.482 1.00 166.57 ? 188  GLN A CG    1 
ATOM   1445  C  CD    . GLN A 1 188  ? 32.821  10.786  147.176 1.00 166.02 ? 188  GLN A CD    1 
ATOM   1446  O  OE1   . GLN A 1 188  ? 33.906  10.559  146.634 1.00 165.38 ? 188  GLN A OE1   1 
ATOM   1447  N  NE2   . GLN A 1 188  ? 32.423  12.011  147.507 1.00 165.83 ? 188  GLN A NE2   1 
ATOM   1448  N  N     . ARG A 1 189  ? 31.840  7.853   143.667 1.00 163.09 ? 189  ARG A N     1 
ATOM   1449  C  CA    . ARG A 1 189  ? 31.733  7.898   142.218 1.00 160.28 ? 189  ARG A CA    1 
ATOM   1450  C  C     . ARG A 1 189  ? 32.464  6.732   141.595 1.00 154.60 ? 189  ARG A C     1 
ATOM   1451  O  O     . ARG A 1 189  ? 33.634  6.528   141.868 1.00 154.03 ? 189  ARG A O     1 
ATOM   1452  C  CB    . ARG A 1 189  ? 32.315  9.209   141.705 1.00 159.75 ? 189  ARG A CB    1 
ATOM   1453  C  CG    . ARG A 1 189  ? 33.103  9.986   142.749 1.00 155.07 ? 189  ARG A CG    1 
ATOM   1454  C  CD    . ARG A 1 189  ? 33.381  11.376  142.223 1.00 151.61 ? 189  ARG A CD    1 
ATOM   1455  N  NE    . ARG A 1 189  ? 34.133  12.211  143.153 1.00 153.44 ? 189  ARG A NE    1 
ATOM   1456  C  CZ    . ARG A 1 189  ? 33.730  13.409  143.565 1.00 158.55 ? 189  ARG A CZ    1 
ATOM   1457  N  NH1   . ARG A 1 189  ? 32.576  13.898  143.135 1.00 165.49 ? 189  ARG A NH1   1 
ATOM   1458  N  NH2   . ARG A 1 189  ? 34.475  14.119  144.407 1.00 154.96 ? 189  ARG A NH2   1 
ATOM   1459  N  N     . THR A 1 190  ? 31.764  5.961   140.772 1.00 154.93 ? 190  THR A N     1 
ATOM   1460  C  CA    . THR A 1 190  ? 32.333  4.744   140.191 1.00 162.43 ? 190  THR A CA    1 
ATOM   1461  C  C     . THR A 1 190  ? 32.866  4.868   138.747 1.00 162.60 ? 190  THR A C     1 
ATOM   1462  O  O     . THR A 1 190  ? 33.391  3.906   138.175 1.00 159.52 ? 190  THR A O     1 
ATOM   1463  C  CB    . THR A 1 190  ? 31.318  3.589   140.278 1.00 165.00 ? 190  THR A CB    1 
ATOM   1464  O  OG1   . THR A 1 190  ? 30.080  4.004   139.682 1.00 164.42 ? 190  THR A OG1   1 
ATOM   1465  C  CG2   . THR A 1 190  ? 31.082  3.201   141.737 1.00 161.77 ? 190  THR A CG2   1 
ATOM   1466  N  N     . ASP A 1 191  ? 32.710  6.050   138.165 1.00 158.38 ? 191  ASP A N     1 
ATOM   1467  C  CA    . ASP A 1 191  ? 33.044  6.290   136.766 1.00 148.69 ? 191  ASP A CA    1 
ATOM   1468  C  C     . ASP A 1 191  ? 34.515  6.598   136.514 1.00 142.96 ? 191  ASP A C     1 
ATOM   1469  O  O     . ASP A 1 191  ? 34.997  6.397   135.406 1.00 142.07 ? 191  ASP A O     1 
ATOM   1470  C  CB    . ASP A 1 191  ? 32.215  7.460   136.277 1.00 156.66 ? 191  ASP A CB    1 
ATOM   1471  C  CG    . ASP A 1 191  ? 32.170  8.592   137.298 1.00 165.38 ? 191  ASP A CG    1 
ATOM   1472  O  OD1   . ASP A 1 191  ? 32.053  8.292   138.512 1.00 163.90 ? 191  ASP A OD1   1 
ATOM   1473  O  OD2   . ASP A 1 191  ? 32.256  9.778   136.900 1.00 164.77 ? 191  ASP A OD2   1 
ATOM   1474  N  N     . LEU A 1 192  ? 35.224  7.049   137.550 1.00 143.05 ? 192  LEU A N     1 
ATOM   1475  C  CA    . LEU A 1 192  ? 36.576  7.618   137.427 1.00 140.38 ? 192  LEU A CA    1 
ATOM   1476  C  C     . LEU A 1 192  ? 37.604  6.649   136.879 1.00 138.82 ? 192  LEU A C     1 
ATOM   1477  O  O     . LEU A 1 192  ? 37.395  5.444   136.898 1.00 143.14 ? 192  LEU A O     1 
ATOM   1478  C  CB    . LEU A 1 192  ? 37.092  8.073   138.785 1.00 135.97 ? 192  LEU A CB    1 
ATOM   1479  C  CG    . LEU A 1 192  ? 36.215  9.027   139.569 1.00 139.28 ? 192  LEU A CG    1 
ATOM   1480  C  CD1   . LEU A 1 192  ? 36.908  9.359   140.863 1.00 137.53 ? 192  LEU A CD1   1 
ATOM   1481  C  CD2   . LEU A 1 192  ? 35.973  10.268  138.744 1.00 144.22 ? 192  LEU A CD2   1 
ATOM   1482  N  N     . ASP A 1 193  ? 38.718  7.172   136.372 1.00 137.32 ? 193  ASP A N     1 
ATOM   1483  C  CA    . ASP A 1 193  ? 39.780  6.288   135.885 1.00 136.26 ? 193  ASP A CA    1 
ATOM   1484  C  C     . ASP A 1 193  ? 41.214  6.671   136.269 1.00 132.10 ? 193  ASP A C     1 
ATOM   1485  O  O     . ASP A 1 193  ? 41.503  7.833   136.577 1.00 126.24 ? 193  ASP A O     1 
ATOM   1486  C  CB    . ASP A 1 193  ? 39.674  6.052   134.374 1.00 135.97 ? 193  ASP A CB    1 
ATOM   1487  C  CG    . ASP A 1 193  ? 39.364  7.314   133.599 1.00 136.62 ? 193  ASP A CG    1 
ATOM   1488  O  OD1   . ASP A 1 193  ? 39.414  8.403   134.205 1.00 139.78 ? 193  ASP A OD1   1 
ATOM   1489  O  OD2   . ASP A 1 193  ? 39.077  7.216   132.382 1.00 132.53 ? 193  ASP A OD2   1 
ATOM   1490  N  N     . LYS A 1 194  ? 42.092  5.663   136.251 1.00 131.93 ? 194  LYS A N     1 
ATOM   1491  C  CA    . LYS A 1 194  ? 43.504  5.819   136.593 1.00 127.09 ? 194  LYS A CA    1 
ATOM   1492  C  C     . LYS A 1 194  ? 44.351  5.718   135.343 1.00 129.29 ? 194  LYS A C     1 
ATOM   1493  O  O     . LYS A 1 194  ? 44.203  4.796   134.538 1.00 130.38 ? 194  LYS A O     1 
ATOM   1494  C  CB    . LYS A 1 194  ? 43.964  4.760   137.603 1.00 126.03 ? 194  LYS A CB    1 
ATOM   1495  C  CG    . LYS A 1 194  ? 44.139  3.363   137.029 1.00 126.75 ? 194  LYS A CG    1 
ATOM   1496  C  CD    . LYS A 1 194  ? 44.703  2.381   138.048 1.00 135.06 ? 194  LYS A CD    1 
ATOM   1497  C  CE    . LYS A 1 194  ? 46.230  2.324   138.042 1.00 137.25 ? 194  LYS A CE    1 
ATOM   1498  N  NZ    . LYS A 1 194  ? 46.753  1.180   138.864 1.00 134.76 ? 194  LYS A NZ    1 
ATOM   1499  N  N     . LEU A 1 195  ? 45.241  6.683   135.182 1.00 128.35 ? 195  LEU A N     1 
ATOM   1500  C  CA    . LEU A 1 195  ? 46.077  6.753   134.000 1.00 124.13 ? 195  LEU A CA    1 
ATOM   1501  C  C     . LEU A 1 195  ? 47.478  6.286   134.343 1.00 124.63 ? 195  LEU A C     1 
ATOM   1502  O  O     . LEU A 1 195  ? 48.106  6.852   135.233 1.00 127.11 ? 195  LEU A O     1 
ATOM   1503  C  CB    . LEU A 1 195  ? 46.122  8.195   133.504 1.00 122.37 ? 195  LEU A CB    1 
ATOM   1504  C  CG    . LEU A 1 195  ? 46.988  8.451   132.278 1.00 125.58 ? 195  LEU A CG    1 
ATOM   1505  C  CD1   . LEU A 1 195  ? 46.452  7.662   131.098 1.00 125.20 ? 195  LEU A CD1   1 
ATOM   1506  C  CD2   . LEU A 1 195  ? 47.035  9.938   131.978 1.00 122.73 ? 195  LEU A CD2   1 
ATOM   1507  N  N     . THR A 1 196  ? 47.968  5.252   133.662 1.00 124.55 ? 196  THR A N     1 
ATOM   1508  C  CA    . THR A 1 196  ? 49.354  4.811   133.863 1.00 127.84 ? 196  THR A CA    1 
ATOM   1509  C  C     . THR A 1 196  ? 50.181  4.964   132.587 1.00 125.57 ? 196  THR A C     1 
ATOM   1510  O  O     . THR A 1 196  ? 49.936  4.273   131.598 1.00 127.00 ? 196  THR A O     1 
ATOM   1511  C  CB    . THR A 1 196  ? 49.466  3.340   134.358 1.00 129.88 ? 196  THR A CB    1 
ATOM   1512  O  OG1   . THR A 1 196  ? 48.587  3.116   135.469 1.00 127.42 ? 196  THR A OG1   1 
ATOM   1513  C  CG2   . THR A 1 196  ? 50.904  3.030   134.778 1.00 126.51 ? 196  THR A CG2   1 
ATOM   1514  N  N     . LEU A 1 197  ? 51.167  5.859   132.620 1.00 124.29 ? 197  LEU A N     1 
ATOM   1515  C  CA    . LEU A 1 197  ? 52.031  6.114   131.462 1.00 127.55 ? 197  LEU A CA    1 
ATOM   1516  C  C     . LEU A 1 197  ? 53.330  5.304   131.483 1.00 130.55 ? 197  LEU A C     1 
ATOM   1517  O  O     . LEU A 1 197  ? 54.188  5.529   132.340 1.00 132.72 ? 197  LEU A O     1 
ATOM   1518  C  CB    . LEU A 1 197  ? 52.365  7.603   131.365 1.00 121.76 ? 197  LEU A CB    1 
ATOM   1519  C  CG    . LEU A 1 197  ? 51.471  8.376   130.405 1.00 117.86 ? 197  LEU A CG    1 
ATOM   1520  C  CD1   . LEU A 1 197  ? 51.757  9.853   130.483 1.00 115.25 ? 197  LEU A CD1   1 
ATOM   1521  C  CD2   . LEU A 1 197  ? 51.717  7.869   129.012 1.00 118.27 ? 197  LEU A CD2   1 
ATOM   1522  N  N     . ARG A 1 198  ? 53.473  4.372   130.537 1.00 127.21 ? 198  ARG A N     1 
ATOM   1523  C  CA    . ARG A 1 198  ? 54.693  3.572   130.405 1.00 125.03 ? 198  ARG A CA    1 
ATOM   1524  C  C     . ARG A 1 198  ? 55.622  4.264   129.416 1.00 131.49 ? 198  ARG A C     1 
ATOM   1525  O  O     . ARG A 1 198  ? 55.189  4.639   128.332 1.00 134.29 ? 198  ARG A O     1 
ATOM   1526  C  CB    . ARG A 1 198  ? 54.377  2.152   129.916 1.00 122.04 ? 198  ARG A CB    1 
ATOM   1527  C  CG    . ARG A 1 198  ? 53.084  1.568   130.466 1.00 125.50 ? 198  ARG A CG    1 
ATOM   1528  C  CD    . ARG A 1 198  ? 53.298  0.202   131.082 1.00 126.00 ? 198  ARG A CD    1 
ATOM   1529  N  NE    . ARG A 1 198  ? 52.881  -0.888  130.209 1.00 129.89 ? 198  ARG A NE    1 
ATOM   1530  C  CZ    . ARG A 1 198  ? 53.562  -2.020  130.059 1.00 135.76 ? 198  ARG A CZ    1 
ATOM   1531  N  NH1   . ARG A 1 198  ? 53.109  -2.970  129.247 1.00 137.57 ? 198  ARG A NH1   1 
ATOM   1532  N  NH2   . ARG A 1 198  ? 54.699  -2.201  130.721 1.00 135.70 ? 198  ARG A NH2   1 
ATOM   1533  N  N     . ILE A 1 199  ? 56.891  4.441   129.783 1.00 136.79 ? 199  ILE A N     1 
ATOM   1534  C  CA    . ILE A 1 199  ? 57.849  5.174   128.942 1.00 129.65 ? 199  ILE A CA    1 
ATOM   1535  C  C     . ILE A 1 199  ? 59.191  4.448   128.783 1.00 126.67 ? 199  ILE A C     1 
ATOM   1536  O  O     . ILE A 1 199  ? 59.884  4.195   129.766 1.00 129.77 ? 199  ILE A O     1 
ATOM   1537  C  CB    . ILE A 1 199  ? 58.104  6.596   129.494 1.00 121.93 ? 199  ILE A CB    1 
ATOM   1538  C  CG1   . ILE A 1 199  ? 56.838  7.443   129.386 1.00 117.07 ? 199  ILE A CG1   1 
ATOM   1539  C  CG2   . ILE A 1 199  ? 59.231  7.254   128.751 1.00 123.60 ? 199  ILE A CG2   1 
ATOM   1540  C  CD1   . ILE A 1 199  ? 57.028  8.855   129.835 1.00 122.73 ? 199  ILE A CD1   1 
ATOM   1541  N  N     . TRP A 1 200  ? 59.547  4.120   127.543 1.00 124.11 ? 200  TRP A N     1 
ATOM   1542  C  CA    . TRP A 1 200  ? 60.843  3.513   127.235 1.00 130.10 ? 200  TRP A CA    1 
ATOM   1543  C  C     . TRP A 1 200  ? 61.803  4.498   126.521 1.00 136.47 ? 200  TRP A C     1 
ATOM   1544  O  O     . TRP A 1 200  ? 61.424  5.153   125.547 1.00 137.00 ? 200  TRP A O     1 
ATOM   1545  C  CB    . TRP A 1 200  ? 60.644  2.275   126.369 1.00 128.74 ? 200  TRP A CB    1 
ATOM   1546  C  CG    . TRP A 1 200  ? 59.909  1.128   127.009 1.00 127.18 ? 200  TRP A CG    1 
ATOM   1547  C  CD1   . TRP A 1 200  ? 60.458  0.076   127.678 1.00 129.06 ? 200  TRP A CD1   1 
ATOM   1548  C  CD2   . TRP A 1 200  ? 58.499  0.893   126.989 1.00 123.15 ? 200  TRP A CD2   1 
ATOM   1549  N  NE1   . TRP A 1 200  ? 59.479  -0.791  128.091 1.00 124.23 ? 200  TRP A NE1   1 
ATOM   1550  C  CE2   . TRP A 1 200  ? 58.266  -0.310  127.679 1.00 122.46 ? 200  TRP A CE2   1 
ATOM   1551  C  CE3   . TRP A 1 200  ? 57.412  1.587   126.464 1.00 126.01 ? 200  TRP A CE3   1 
ATOM   1552  C  CZ2   . TRP A 1 200  ? 56.992  -0.830  127.856 1.00 126.71 ? 200  TRP A CZ2   1 
ATOM   1553  C  CZ3   . TRP A 1 200  ? 56.149  1.067   126.640 1.00 128.41 ? 200  TRP A CZ3   1 
ATOM   1554  C  CH2   . TRP A 1 200  ? 55.949  -0.130  127.331 1.00 128.25 ? 200  TRP A CH2   1 
ATOM   1555  N  N     . THR A 1 201  ? 63.042  4.593   127.005 1.00 136.83 ? 201  THR A N     1 
ATOM   1556  C  CA    . THR A 1 201  ? 64.031  5.533   126.477 1.00 133.25 ? 201  THR A CA    1 
ATOM   1557  C  C     . THR A 1 201  ? 65.346  4.787   126.214 1.00 138.72 ? 201  THR A C     1 
ATOM   1558  O  O     . THR A 1 201  ? 65.546  3.696   126.737 1.00 142.31 ? 201  THR A O     1 
ATOM   1559  C  CB    . THR A 1 201  ? 64.311  6.676   127.490 1.00 136.06 ? 201  THR A CB    1 
ATOM   1560  O  OG1   . THR A 1 201  ? 63.091  7.131   128.088 1.00 135.25 ? 201  THR A OG1   1 
ATOM   1561  C  CG2   . THR A 1 201  ? 64.964  7.840   126.814 1.00 139.21 ? 201  THR A CG2   1 
ATOM   1562  N  N     . ASP A 1 202  ? 66.242  5.358   125.407 1.00 141.94 ? 202  ASP A N     1 
ATOM   1563  C  CA    . ASP A 1 202  ? 67.580  4.782   125.234 1.00 139.43 ? 202  ASP A CA    1 
ATOM   1564  C  C     . ASP A 1 202  ? 68.483  5.098   126.427 1.00 142.72 ? 202  ASP A C     1 
ATOM   1565  O  O     . ASP A 1 202  ? 69.555  4.509   126.566 1.00 145.85 ? 202  ASP A O     1 
ATOM   1566  C  CB    . ASP A 1 202  ? 68.237  5.219   123.911 1.00 134.10 ? 202  ASP A CB    1 
ATOM   1567  C  CG    . ASP A 1 202  ? 68.286  6.738   123.733 1.00 131.69 ? 202  ASP A CG    1 
ATOM   1568  O  OD1   . ASP A 1 202  ? 68.681  7.454   124.668 1.00 133.79 ? 202  ASP A OD1   1 
ATOM   1569  O  OD2   . ASP A 1 202  ? 67.941  7.228   122.642 1.00 133.98 ? 202  ASP A OD2   1 
ATOM   1570  N  N     . GLY A 1 203  ? 68.042  6.029   127.274 1.00 138.44 ? 203  GLY A N     1 
ATOM   1571  C  CA    . GLY A 1 203  ? 68.794  6.431   128.446 1.00 134.51 ? 203  GLY A CA    1 
ATOM   1572  C  C     . GLY A 1 203  ? 69.607  7.711   128.297 1.00 139.75 ? 203  GLY A C     1 
ATOM   1573  O  O     . GLY A 1 203  ? 70.304  8.095   129.229 1.00 143.10 ? 203  GLY A O     1 
ATOM   1574  N  N     . SER A 1 204  ? 69.537  8.372   127.139 1.00 142.82 ? 204  SER A N     1 
ATOM   1575  C  CA    . SER A 1 204  ? 70.268  9.633   126.926 1.00 139.97 ? 204  SER A CA    1 
ATOM   1576  C  C     . SER A 1 204  ? 69.566  10.775  127.643 1.00 141.56 ? 204  SER A C     1 
ATOM   1577  O  O     . SER A 1 204  ? 70.208  11.674  128.193 1.00 146.09 ? 204  SER A O     1 
ATOM   1578  C  CB    . SER A 1 204  ? 70.447  9.949   125.437 1.00 140.37 ? 204  SER A CB    1 
ATOM   1579  O  OG    . SER A 1 204  ? 69.308  9.583   124.676 1.00 138.83 ? 204  SER A OG    1 
ATOM   1580  N  N     . VAL A 1 205  ? 68.239  10.748  127.598 1.00 138.84 ? 205  VAL A N     1 
ATOM   1581  C  CA    . VAL A 1 205  ? 67.450  11.362  128.651 1.00 138.90 ? 205  VAL A CA    1 
ATOM   1582  C  C     . VAL A 1 205  ? 66.672  10.230  129.327 1.00 140.60 ? 205  VAL A C     1 
ATOM   1583  O  O     . VAL A 1 205  ? 66.775  9.070   128.931 1.00 137.25 ? 205  VAL A O     1 
ATOM   1584  C  CB    . VAL A 1 205  ? 66.528  12.508  128.164 1.00 129.62 ? 205  VAL A CB    1 
ATOM   1585  C  CG1   . VAL A 1 205  ? 67.353  13.655  127.585 1.00 127.49 ? 205  VAL A CG1   1 
ATOM   1586  C  CG2   . VAL A 1 205  ? 65.520  11.999  127.175 1.00 130.16 ? 205  VAL A CG2   1 
ATOM   1587  N  N     . THR A 1 206  ? 65.907  10.571  130.351 1.00 142.04 ? 206  THR A N     1 
ATOM   1588  C  CA    . THR A 1 206  ? 65.361  9.587   131.257 1.00 136.50 ? 206  THR A CA    1 
ATOM   1589  C  C     . THR A 1 206  ? 63.863  9.621   131.097 1.00 138.46 ? 206  THR A C     1 
ATOM   1590  O  O     . THR A 1 206  ? 63.318  10.662  130.742 1.00 140.68 ? 206  THR A O     1 
ATOM   1591  C  CB    . THR A 1 206  ? 65.807  9.938   132.686 1.00 135.83 ? 206  THR A CB    1 
ATOM   1592  O  OG1   . THR A 1 206  ? 66.849  9.045   133.082 1.00 139.10 ? 206  THR A OG1   1 
ATOM   1593  C  CG2   . THR A 1 206  ? 64.665  9.895   133.691 1.00 138.03 ? 206  THR A CG2   1 
ATOM   1594  N  N     . PRO A 1 207  ? 63.192  8.484   131.335 1.00 135.55 ? 207  PRO A N     1 
ATOM   1595  C  CA    . PRO A 1 207  ? 61.741  8.424   131.195 1.00 137.31 ? 207  PRO A CA    1 
ATOM   1596  C  C     . PRO A 1 207  ? 61.104  9.616   131.899 1.00 140.18 ? 207  PRO A C     1 
ATOM   1597  O  O     . PRO A 1 207  ? 60.303  10.331  131.288 1.00 137.23 ? 207  PRO A O     1 
ATOM   1598  C  CB    . PRO A 1 207  ? 61.397  7.137   131.937 1.00 131.99 ? 207  PRO A CB    1 
ATOM   1599  C  CG    . PRO A 1 207  ? 62.558  6.304   131.713 1.00 129.92 ? 207  PRO A CG    1 
ATOM   1600  C  CD    . PRO A 1 207  ? 63.745  7.182   131.717 1.00 131.61 ? 207  PRO A CD    1 
ATOM   1601  N  N     . LEU A 1 208  ? 61.530  9.886   133.127 1.00 140.99 ? 208  LEU A N     1 
ATOM   1602  C  CA    . LEU A 1 208  ? 61.031  11.051  133.839 1.00 140.41 ? 208  LEU A CA    1 
ATOM   1603  C  C     . LEU A 1 208  ? 61.291  12.333  133.063 1.00 138.36 ? 208  LEU A C     1 
ATOM   1604  O  O     . LEU A 1 208  ? 60.359  13.086  132.795 1.00 141.81 ? 208  LEU A O     1 
ATOM   1605  C  CB    . LEU A 1 208  ? 61.628  11.171  135.246 1.00 144.73 ? 208  LEU A CB    1 
ATOM   1606  C  CG    . LEU A 1 208  ? 61.139  12.440  135.967 1.00 138.69 ? 208  LEU A CG    1 
ATOM   1607  C  CD1   . LEU A 1 208  ? 59.635  12.391  136.178 1.00 130.23 ? 208  LEU A CD1   1 
ATOM   1608  C  CD2   . LEU A 1 208  ? 61.862  12.679  137.285 1.00 139.47 ? 208  LEU A CD2   1 
ATOM   1609  N  N     . GLU A 1 209  ? 62.547  12.575  132.699 1.00 136.19 ? 209  GLU A N     1 
ATOM   1610  C  CA    . GLU A 1 209  ? 62.921  13.859  132.111 1.00 140.42 ? 209  GLU A CA    1 
ATOM   1611  C  C     . GLU A 1 209  ? 62.087  14.149  130.880 1.00 140.44 ? 209  GLU A C     1 
ATOM   1612  O  O     . GLU A 1 209  ? 61.632  15.280  130.667 1.00 138.91 ? 209  GLU A O     1 
ATOM   1613  C  CB    . GLU A 1 209  ? 64.390  13.868  131.720 1.00 140.43 ? 209  GLU A CB    1 
ATOM   1614  C  CG    . GLU A 1 209  ? 65.323  13.347  132.773 1.00 138.29 ? 209  GLU A CG    1 
ATOM   1615  C  CD    . GLU A 1 209  ? 66.763  13.561  132.387 1.00 141.87 ? 209  GLU A CD    1 
ATOM   1616  O  OE1   . GLU A 1 209  ? 67.545  12.585  132.425 1.00 143.93 ? 209  GLU A OE1   1 
ATOM   1617  O  OE2   . GLU A 1 209  ? 67.111  14.711  132.038 1.00 143.12 ? 209  GLU A OE2   1 
ATOM   1618  N  N     . ALA A 1 210  ? 61.892  13.102  130.085 1.00 140.29 ? 210  ALA A N     1 
ATOM   1619  C  CA    . ALA A 1 210  ? 61.128  13.183  128.854 1.00 139.75 ? 210  ALA A CA    1 
ATOM   1620  C  C     . ALA A 1 210  ? 59.728  13.707  129.161 1.00 139.07 ? 210  ALA A C     1 
ATOM   1621  O  O     . ALA A 1 210  ? 59.323  14.781  128.694 1.00 139.09 ? 210  ALA A O     1 
ATOM   1622  C  CB    . ALA A 1 210  ? 61.056  11.803  128.214 1.00 133.02 ? 210  ALA A CB    1 
ATOM   1623  N  N     . LEU A 1 211  ? 59.026  12.957  130.001 1.00 134.58 ? 211  LEU A N     1 
ATOM   1624  C  CA    . LEU A 1 211  ? 57.688  13.298  130.441 1.00 131.09 ? 211  LEU A CA    1 
ATOM   1625  C  C     . LEU A 1 211  ? 57.622  14.753  130.889 1.00 131.94 ? 211  LEU A C     1 
ATOM   1626  O  O     . LEU A 1 211  ? 56.666  15.460  130.593 1.00 131.43 ? 211  LEU A O     1 
ATOM   1627  C  CB    . LEU A 1 211  ? 57.315  12.382  131.603 1.00 131.37 ? 211  LEU A CB    1 
ATOM   1628  C  CG    . LEU A 1 211  ? 55.900  12.442  132.164 1.00 127.45 ? 211  LEU A CG    1 
ATOM   1629  C  CD1   . LEU A 1 211  ? 54.920  12.501  131.019 1.00 128.39 ? 211  LEU A CD1   1 
ATOM   1630  C  CD2   . LEU A 1 211  ? 55.623  11.232  133.057 1.00 122.54 ? 211  LEU A CD2   1 
ATOM   1631  N  N     . ASN A 1 212  ? 58.660  15.197  131.587 1.00 132.56 ? 212  ASN A N     1 
ATOM   1632  C  CA    . ASN A 1 212  ? 58.733  16.563  132.071 1.00 132.45 ? 212  ASN A CA    1 
ATOM   1633  C  C     . ASN A 1 212  ? 58.912  17.577  130.963 1.00 134.69 ? 212  ASN A C     1 
ATOM   1634  O  O     . ASN A 1 212  ? 58.274  18.628  130.970 1.00 138.21 ? 212  ASN A O     1 
ATOM   1635  C  CB    . ASN A 1 212  ? 59.872  16.706  133.071 1.00 136.02 ? 212  ASN A CB    1 
ATOM   1636  C  CG    . ASN A 1 212  ? 59.462  16.319  134.462 1.00 135.60 ? 212  ASN A CG    1 
ATOM   1637  O  OD1   . ASN A 1 212  ? 60.152  15.556  135.136 1.00 133.80 ? 212  ASN A OD1   1 
ATOM   1638  N  ND2   . ASN A 1 212  ? 58.324  16.843  134.905 1.00 137.04 ? 212  ASN A ND2   1 
ATOM   1639  N  N     . GLN A 1 213  ? 59.801  17.281  130.025 1.00 134.00 ? 213  GLN A N     1 
ATOM   1640  C  CA    . GLN A 1 213  ? 59.993  18.174  128.898 1.00 134.93 ? 213  GLN A CA    1 
ATOM   1641  C  C     . GLN A 1 213  ? 58.763  18.087  128.022 1.00 136.12 ? 213  GLN A C     1 
ATOM   1642  O  O     . GLN A 1 213  ? 58.426  19.043  127.334 1.00 136.41 ? 213  GLN A O     1 
ATOM   1643  C  CB    . GLN A 1 213  ? 61.241  17.798  128.117 1.00 135.97 ? 213  GLN A CB    1 
ATOM   1644  C  CG    . GLN A 1 213  ? 62.507  17.913  128.940 1.00 144.84 ? 213  GLN A CG    1 
ATOM   1645  C  CD    . GLN A 1 213  ? 63.512  16.814  128.637 1.00 147.98 ? 213  GLN A CD    1 
ATOM   1646  O  OE1   . GLN A 1 213  ? 64.086  16.217  129.551 1.00 146.13 ? 213  GLN A OE1   1 
ATOM   1647  N  NE2   . GLN A 1 213  ? 63.741  16.549  127.351 1.00 140.21 ? 213  GLN A NE2   1 
ATOM   1648  N  N     . ALA A 1 214  ? 58.090  16.937  128.073 1.00 137.09 ? 214  ALA A N     1 
ATOM   1649  C  CA    . ALA A 1 214  ? 56.834  16.722  127.347 1.00 135.46 ? 214  ALA A CA    1 
ATOM   1650  C  C     . ALA A 1 214  ? 55.724  17.638  127.858 1.00 134.91 ? 214  ALA A C     1 
ATOM   1651  O  O     . ALA A 1 214  ? 55.095  18.358  127.078 1.00 130.43 ? 214  ALA A O     1 
ATOM   1652  C  CB    . ALA A 1 214  ? 56.398  15.258  127.436 1.00 127.08 ? 214  ALA A CB    1 
ATOM   1653  N  N     . VAL A 1 215  ? 55.482  17.608  129.168 1.00 138.74 ? 215  VAL A N     1 
ATOM   1654  C  CA    . VAL A 1 215  ? 54.467  18.483  129.756 1.00 139.22 ? 215  VAL A CA    1 
ATOM   1655  C  C     . VAL A 1 215  ? 54.825  19.947  129.546 1.00 138.82 ? 215  VAL A C     1 
ATOM   1656  O  O     . VAL A 1 215  ? 53.957  20.752  129.202 1.00 137.04 ? 215  VAL A O     1 
ATOM   1657  C  CB    . VAL A 1 215  ? 54.173  18.194  131.261 1.00 132.30 ? 215  VAL A CB    1 
ATOM   1658  C  CG1   . VAL A 1 215  ? 53.595  16.804  131.427 1.00 129.31 ? 215  VAL A CG1   1 
ATOM   1659  C  CG2   . VAL A 1 215  ? 55.411  18.389  132.134 1.00 131.55 ? 215  VAL A CG2   1 
ATOM   1660  N  N     . GLU A 1 216  ? 56.099  20.282  129.741 1.00 138.14 ? 216  GLU A N     1 
ATOM   1661  C  CA    . GLU A 1 216  ? 56.560  21.627  129.469 1.00 140.80 ? 216  GLU A CA    1 
ATOM   1662  C  C     . GLU A 1 216  ? 56.059  22.005  128.085 1.00 141.12 ? 216  GLU A C     1 
ATOM   1663  O  O     . GLU A 1 216  ? 55.439  23.054  127.924 1.00 144.77 ? 216  GLU A O     1 
ATOM   1664  C  CB    . GLU A 1 216  ? 58.088  21.731  129.552 1.00 146.21 ? 216  GLU A CB    1 
ATOM   1665  C  CG    . GLU A 1 216  ? 58.628  23.159  129.367 1.00 148.56 ? 216  GLU A CG    1 
ATOM   1666  C  CD    . GLU A 1 216  ? 57.946  24.176  130.281 1.00 145.84 ? 216  GLU A CD    1 
ATOM   1667  O  OE1   . GLU A 1 216  ? 57.768  23.880  131.484 1.00 142.32 ? 216  GLU A OE1   1 
ATOM   1668  O  OE2   . GLU A 1 216  ? 57.587  25.270  129.795 1.00 142.60 ? 216  GLU A OE2   1 
ATOM   1669  N  N     . ILE A 1 217  ? 56.260  21.116  127.112 1.00 137.18 ? 217  ILE A N     1 
ATOM   1670  C  CA    . ILE A 1 217  ? 55.828  21.366  125.731 1.00 138.81 ? 217  ILE A CA    1 
ATOM   1671  C  C     . ILE A 1 217  ? 54.319  21.572  125.579 1.00 136.16 ? 217  ILE A C     1 
ATOM   1672  O  O     . ILE A 1 217  ? 53.865  22.417  124.798 1.00 138.64 ? 217  ILE A O     1 
ATOM   1673  C  CB    . ILE A 1 217  ? 56.279  20.243  124.790 1.00 132.40 ? 217  ILE A CB    1 
ATOM   1674  C  CG1   . ILE A 1 217  ? 57.792  20.259  124.660 1.00 132.17 ? 217  ILE A CG1   1 
ATOM   1675  C  CG2   . ILE A 1 217  ? 55.658  20.392  123.411 1.00 125.71 ? 217  ILE A CG2   1 
ATOM   1676  C  CD1   . ILE A 1 217  ? 58.310  19.085  123.895 1.00 137.22 ? 217  ILE A CD1   1 
ATOM   1677  N  N     . LEU A 1 218  ? 53.540  20.810  126.329 1.00 127.33 ? 218  LEU A N     1 
ATOM   1678  C  CA    . LEU A 1 218  ? 52.104  20.946  126.243 1.00 126.02 ? 218  LEU A CA    1 
ATOM   1679  C  C     . LEU A 1 218  ? 51.655  22.300  126.770 1.00 128.31 ? 218  LEU A C     1 
ATOM   1680  O  O     . LEU A 1 218  ? 50.942  23.028  126.088 1.00 128.08 ? 218  LEU A O     1 
ATOM   1681  C  CB    . LEU A 1 218  ? 51.430  19.832  127.021 1.00 127.20 ? 218  LEU A CB    1 
ATOM   1682  C  CG    . LEU A 1 218  ? 50.034  19.463  126.549 1.00 119.30 ? 218  LEU A CG    1 
ATOM   1683  C  CD1   . LEU A 1 218  ? 49.938  19.626  125.048 1.00 113.86 ? 218  LEU A CD1   1 
ATOM   1684  C  CD2   . LEU A 1 218  ? 49.743  18.035  126.956 1.00 113.74 ? 218  LEU A CD2   1 
ATOM   1685  N  N     . ARG A 1 219  ? 52.072  22.639  127.984 1.00 129.86 ? 219  ARG A N     1 
ATOM   1686  C  CA    . ARG A 1 219  ? 51.640  23.892  128.587 1.00 132.94 ? 219  ARG A CA    1 
ATOM   1687  C  C     . ARG A 1 219  ? 52.127  25.032  127.730 1.00 132.92 ? 219  ARG A C     1 
ATOM   1688  O  O     . ARG A 1 219  ? 51.375  25.956  127.424 1.00 134.08 ? 219  ARG A O     1 
ATOM   1689  C  CB    . ARG A 1 219  ? 52.141  24.047  130.034 1.00 140.87 ? 219  ARG A CB    1 
ATOM   1690  C  CG    . ARG A 1 219  ? 53.643  24.255  130.204 1.00 139.08 ? 219  ARG A CG    1 
ATOM   1691  C  CD    . ARG A 1 219  ? 53.974  25.011  131.482 1.00 141.31 ? 219  ARG A CD    1 
ATOM   1692  N  NE    . ARG A 1 219  ? 53.954  26.464  131.322 1.00 138.33 ? 219  ARG A NE    1 
ATOM   1693  C  CZ    . ARG A 1 219  ? 54.893  27.153  130.681 1.00 141.07 ? 219  ARG A CZ    1 
ATOM   1694  N  NH1   . ARG A 1 219  ? 54.813  28.475  130.587 1.00 146.40 ? 219  ARG A NH1   1 
ATOM   1695  N  NH2   . ARG A 1 219  ? 55.910  26.521  130.119 1.00 136.88 ? 219  ARG A NH2   1 
ATOM   1696  N  N     . GLU A 1 220  ? 53.384  24.933  127.315 1.00 132.32 ? 220  GLU A N     1 
ATOM   1697  C  CA    . GLU A 1 220  ? 54.008  25.954  126.512 1.00 134.97 ? 220  GLU A CA    1 
ATOM   1698  C  C     . GLU A 1 220  ? 53.139  26.135  125.301 1.00 136.75 ? 220  GLU A C     1 
ATOM   1699  O  O     . GLU A 1 220  ? 53.011  27.234  124.787 1.00 143.60 ? 220  GLU A O     1 
ATOM   1700  C  CB    . GLU A 1 220  ? 55.398  25.508  126.088 1.00 138.73 ? 220  GLU A CB    1 
ATOM   1701  C  CG    . GLU A 1 220  ? 56.173  26.525  125.293 1.00 146.60 ? 220  GLU A CG    1 
ATOM   1702  C  CD    . GLU A 1 220  ? 57.472  25.957  124.749 1.00 153.42 ? 220  GLU A CD    1 
ATOM   1703  O  OE1   . GLU A 1 220  ? 58.111  25.116  125.433 1.00 147.79 ? 220  GLU A OE1   1 
ATOM   1704  O  OE2   . GLU A 1 220  ? 57.845  26.352  123.625 1.00 156.66 ? 220  GLU A OE2   1 
ATOM   1705  N  N     . HIS A 1 221  ? 52.514  25.050  124.861 1.00 133.30 ? 221  HIS A N     1 
ATOM   1706  C  CA    . HIS A 1 221  ? 51.609  25.124  123.724 1.00 137.73 ? 221  HIS A CA    1 
ATOM   1707  C  C     . HIS A 1 221  ? 50.282  25.839  124.008 1.00 138.25 ? 221  HIS A C     1 
ATOM   1708  O  O     . HIS A 1 221  ? 49.703  26.451  123.108 1.00 138.24 ? 221  HIS A O     1 
ATOM   1709  C  CB    . HIS A 1 221  ? 51.369  23.738  123.130 1.00 134.16 ? 221  HIS A CB    1 
ATOM   1710  C  CG    . HIS A 1 221  ? 52.207  23.456  121.923 1.00 135.12 ? 221  HIS A CG    1 
ATOM   1711  N  ND1   . HIS A 1 221  ? 53.583  23.390  121.974 1.00 136.16 ? 221  HIS A ND1   1 
ATOM   1712  C  CD2   . HIS A 1 221  ? 51.866  23.249  120.630 1.00 133.32 ? 221  HIS A CD2   1 
ATOM   1713  C  CE1   . HIS A 1 221  ? 54.051  23.143  120.764 1.00 139.33 ? 221  HIS A CE1   1 
ATOM   1714  N  NE2   . HIS A 1 221  ? 53.028  23.051  119.928 1.00 135.04 ? 221  HIS A NE2   1 
ATOM   1715  N  N     . LEU A 1 222  ? 49.800  25.776  125.245 1.00 135.93 ? 222  LEU A N     1 
ATOM   1716  C  CA    . LEU A 1 222  ? 48.534  26.430  125.578 1.00 137.06 ? 222  LEU A CA    1 
ATOM   1717  C  C     . LEU A 1 222  ? 48.742  27.929  125.738 1.00 139.00 ? 222  LEU A C     1 
ATOM   1718  O  O     . LEU A 1 222  ? 47.790  28.717  125.724 1.00 138.56 ? 222  LEU A O     1 
ATOM   1719  C  CB    . LEU A 1 222  ? 47.946  25.837  126.851 1.00 131.51 ? 222  LEU A CB    1 
ATOM   1720  C  CG    . LEU A 1 222  ? 48.073  24.318  126.916 1.00 128.43 ? 222  LEU A CG    1 
ATOM   1721  C  CD1   . LEU A 1 222  ? 47.668  23.820  128.279 1.00 132.50 ? 222  LEU A CD1   1 
ATOM   1722  C  CD2   . LEU A 1 222  ? 47.233  23.663  125.840 1.00 127.37 ? 222  LEU A CD2   1 
ATOM   1723  N  N     . THR A 1 223  ? 50.006  28.302  125.897 1.00 136.89 ? 223  THR A N     1 
ATOM   1724  C  CA    . THR A 1 223  ? 50.411  29.691  125.959 1.00 139.73 ? 223  THR A CA    1 
ATOM   1725  C  C     . THR A 1 223  ? 49.906  30.433  124.727 1.00 146.94 ? 223  THR A C     1 
ATOM   1726  O  O     . THR A 1 223  ? 49.435  31.566  124.821 1.00 151.94 ? 223  THR A O     1 
ATOM   1727  C  CB    . THR A 1 223  ? 51.948  29.789  126.022 1.00 138.44 ? 223  THR A CB    1 
ATOM   1728  O  OG1   . THR A 1 223  ? 52.413  29.178  127.232 1.00 131.52 ? 223  THR A OG1   1 
ATOM   1729  C  CG2   . THR A 1 223  ? 52.422  31.235  125.948 1.00 144.48 ? 223  THR A CG2   1 
ATOM   1730  N  N     . TYR A 1 224  ? 49.966  29.757  123.584 1.00 145.43 ? 224  TYR A N     1 
ATOM   1731  C  CA    . TYR A 1 224  ? 49.786  30.379  122.270 1.00 147.47 ? 224  TYR A CA    1 
ATOM   1732  C  C     . TYR A 1 224  ? 48.378  30.896  122.011 1.00 148.13 ? 224  TYR A C     1 
ATOM   1733  O  O     . TYR A 1 224  ? 48.134  31.619  121.040 1.00 145.48 ? 224  TYR A O     1 
ATOM   1734  C  CB    . TYR A 1 224  ? 50.200  29.389  121.184 1.00 146.35 ? 224  TYR A CB    1 
ATOM   1735  C  CG    . TYR A 1 224  ? 51.623  28.899  121.351 1.00 146.79 ? 224  TYR A CG    1 
ATOM   1736  C  CD1   . TYR A 1 224  ? 52.583  29.682  121.995 1.00 149.79 ? 224  TYR A CD1   1 
ATOM   1737  C  CD2   . TYR A 1 224  ? 52.009  27.655  120.879 1.00 143.23 ? 224  TYR A CD2   1 
ATOM   1738  C  CE1   . TYR A 1 224  ? 53.898  29.238  122.156 1.00 150.70 ? 224  TYR A CE1   1 
ATOM   1739  C  CE2   . TYR A 1 224  ? 53.322  27.201  121.032 1.00 149.22 ? 224  TYR A CE2   1 
ATOM   1740  C  CZ    . TYR A 1 224  ? 54.265  27.996  121.671 1.00 150.21 ? 224  TYR A CZ    1 
ATOM   1741  O  OH    . TYR A 1 224  ? 55.568  27.551  121.828 1.00 143.56 ? 224  TYR A OH    1 
ATOM   1742  N  N     . PHE A 1 225  ? 47.470  30.536  122.912 1.00 150.68 ? 225  PHE A N     1 
ATOM   1743  C  CA    . PHE A 1 225  ? 46.072  30.940  122.853 1.00 151.63 ? 225  PHE A CA    1 
ATOM   1744  C  C     . PHE A 1 225  ? 45.914  32.292  123.486 1.00 153.71 ? 225  PHE A C     1 
ATOM   1745  O  O     . PHE A 1 225  ? 44.800  32.775  123.674 1.00 153.06 ? 225  PHE A O     1 
ATOM   1746  C  CB    . PHE A 1 225  ? 45.210  29.933  123.597 1.00 149.34 ? 225  PHE A CB    1 
ATOM   1747  C  CG    . PHE A 1 225  ? 45.190  28.588  122.950 1.00 149.16 ? 225  PHE A CG    1 
ATOM   1748  C  CD1   . PHE A 1 225  ? 46.181  27.652  123.222 1.00 146.86 ? 225  PHE A CD1   1 
ATOM   1749  C  CD2   . PHE A 1 225  ? 44.201  28.265  122.036 1.00 141.56 ? 225  PHE A CD2   1 
ATOM   1750  C  CE1   . PHE A 1 225  ? 46.169  26.406  122.603 1.00 138.26 ? 225  PHE A CE1   1 
ATOM   1751  C  CE2   . PHE A 1 225  ? 44.185  27.026  121.421 1.00 131.43 ? 225  PHE A CE2   1 
ATOM   1752  C  CZ    . PHE A 1 225  ? 45.167  26.095  121.702 1.00 129.27 ? 225  PHE A CZ    1 
ATOM   1753  N  N     . SER A 1 226  ? 47.047  32.872  123.858 1.00 158.35 ? 226  SER A N     1 
ATOM   1754  C  CA    . SER A 1 226  ? 47.062  34.147  124.544 1.00 164.98 ? 226  SER A CA    1 
ATOM   1755  C  C     . SER A 1 226  ? 46.337  35.267  123.776 1.00 168.59 ? 226  SER A C     1 
ATOM   1756  O  O     . SER A 1 226  ? 45.188  35.586  124.096 1.00 170.93 ? 226  SER A O     1 
ATOM   1757  C  CB    . SER A 1 226  ? 48.512  34.545  124.851 1.00 159.84 ? 226  SER A CB    1 
ATOM   1758  O  OG    . SER A 1 226  ? 49.159  33.561  125.645 1.00 146.69 ? 226  SER A OG    1 
ATOM   1759  N  N     . ASN A 1 227  ? 46.953  35.808  122.725 1.00 164.74 ? 227  ASN A N     1 
ATOM   1760  C  CA    . ASN A 1 227  ? 46.403  37.015  122.101 1.00 162.35 ? 227  ASN A CA    1 
ATOM   1761  C  C     . ASN A 1 227  ? 45.326  36.684  121.096 1.00 157.70 ? 227  ASN A C     1 
ATOM   1762  O  O     . ASN A 1 227  ? 45.620  36.136  120.038 1.00 156.63 ? 227  ASN A O     1 
ATOM   1763  C  CB    . ASN A 1 227  ? 47.486  37.830  121.391 1.00 167.15 ? 227  ASN A CB    1 
ATOM   1764  C  CG    . ASN A 1 227  ? 48.739  38.005  122.225 1.00 173.56 ? 227  ASN A CG    1 
ATOM   1765  O  OD1   . ASN A 1 227  ? 49.062  37.173  123.076 1.00 169.90 ? 227  ASN A OD1   1 
ATOM   1766  N  ND2   . ASN A 1 227  ? 49.467  39.084  121.968 1.00 178.90 ? 227  ASN A ND2   1 
ATOM   1767  N  N     . PRO A 1 228  ? 44.075  37.040  121.405 1.00 160.07 ? 228  PRO A N     1 
ATOM   1768  C  CA    . PRO A 1 228  ? 42.994  36.780  120.448 1.00 161.96 ? 228  PRO A CA    1 
ATOM   1769  C  C     . PRO A 1 228  ? 43.064  37.765  119.262 1.00 165.35 ? 228  PRO A C     1 
ATOM   1770  O  O     . PRO A 1 228  ? 43.646  38.840  119.435 1.00 172.26 ? 228  PRO A O     1 
ATOM   1771  C  CB    . PRO A 1 228  ? 41.733  36.982  121.291 1.00 156.31 ? 228  PRO A CB    1 
ATOM   1772  C  CG    . PRO A 1 228  ? 42.139  37.940  122.363 1.00 160.10 ? 228  PRO A CG    1 
ATOM   1773  C  CD    . PRO A 1 228  ? 43.610  37.751  122.609 1.00 162.41 ? 228  PRO A CD    1 
ATOM   1774  N  N     . GLN A 1 229  ? 42.517  37.399  118.096 1.00 157.03 ? 229  GLN A N     1 
ATOM   1775  C  CA    . GLN A 1 229  ? 42.539  38.259  116.901 1.00 148.50 ? 229  GLN A CA    1 
ATOM   1776  C  C     . GLN A 1 229  ? 41.388  37.951  115.939 1.00 139.17 ? 229  GLN A C     1 
ATOM   1777  O  O     . GLN A 1 229  ? 40.991  38.791  115.124 1.00 128.06 ? 229  GLN A O     1 
ATOM   1778  C  CB    . GLN A 1 229  ? 43.881  38.152  116.162 1.00 147.13 ? 229  GLN A CB    1 
ATOM   1779  C  CG    . GLN A 1 229  ? 44.936  39.180  116.585 1.00 155.46 ? 229  GLN A CG    1 
ATOM   1780  C  CD    . GLN A 1 229  ? 46.126  38.560  117.315 1.00 163.78 ? 229  GLN A CD    1 
ATOM   1781  O  OE1   . GLN A 1 229  ? 46.366  38.842  118.494 1.00 166.72 ? 229  GLN A OE1   1 
ATOM   1782  N  NE2   . GLN A 1 229  ? 46.885  37.723  116.609 1.00 160.46 ? 229  GLN A NE2   1 
ATOM   1783  N  N     . LYS B 1 7    ? 58.326  29.598  114.957 1.00 168.74 ? 7    LYS B N     1 
ATOM   1784  C  CA    . LYS B 1 7    ? 57.739  30.890  115.308 1.00 178.21 ? 7    LYS B CA    1 
ATOM   1785  C  C     . LYS B 1 7    ? 56.518  30.720  116.206 1.00 178.33 ? 7    LYS B C     1 
ATOM   1786  O  O     . LYS B 1 7    ? 55.839  29.691  116.158 1.00 173.48 ? 7    LYS B O     1 
ATOM   1787  C  CB    . LYS B 1 7    ? 57.350  31.678  114.051 1.00 172.35 ? 7    LYS B CB    1 
ATOM   1788  C  CG    . LYS B 1 7    ? 58.059  33.030  113.895 1.00 172.31 ? 7    LYS B CG    1 
ATOM   1789  C  CD    . LYS B 1 7    ? 57.422  34.138  114.732 1.00 165.79 ? 7    LYS B CD    1 
ATOM   1790  C  CE    . LYS B 1 7    ? 58.070  35.485  114.427 1.00 158.70 ? 7    LYS B CE    1 
ATOM   1791  N  NZ    . LYS B 1 7    ? 57.360  36.646  115.038 1.00 151.70 ? 7    LYS B NZ    1 
ATOM   1792  N  N     . ALA B 1 8    ? 56.249  31.734  117.026 1.00 173.86 ? 8    ALA B N     1 
ATOM   1793  C  CA    . ALA B 1 8    ? 55.074  31.739  117.886 1.00 158.29 ? 8    ALA B CA    1 
ATOM   1794  C  C     . ALA B 1 8    ? 53.813  31.913  117.042 1.00 157.59 ? 8    ALA B C     1 
ATOM   1795  O  O     . ALA B 1 8    ? 53.714  32.850  116.248 1.00 156.53 ? 8    ALA B O     1 
ATOM   1796  C  CB    . ALA B 1 8    ? 55.184  32.838  118.917 1.00 154.12 ? 8    ALA B CB    1 
ATOM   1797  N  N     . PRO B 1 9    ? 52.851  30.993  117.208 1.00 153.45 ? 9    PRO B N     1 
ATOM   1798  C  CA    . PRO B 1 9    ? 51.600  30.865  116.444 1.00 150.98 ? 9    PRO B CA    1 
ATOM   1799  C  C     . PRO B 1 9    ? 50.644  32.023  116.670 1.00 150.11 ? 9    PRO B C     1 
ATOM   1800  O  O     . PRO B 1 9    ? 50.645  32.580  117.762 1.00 159.07 ? 9    PRO B O     1 
ATOM   1801  C  CB    . PRO B 1 9    ? 50.973  29.593  117.018 1.00 144.91 ? 9    PRO B CB    1 
ATOM   1802  C  CG    . PRO B 1 9    ? 52.095  28.855  117.640 1.00 148.84 ? 9    PRO B CG    1 
ATOM   1803  C  CD    . PRO B 1 9    ? 53.012  29.897  118.174 1.00 150.10 ? 9    PRO B CD    1 
ATOM   1804  N  N     . VAL B 1 10   ? 49.825  32.358  115.675 1.00 146.41 ? 10   VAL B N     1 
ATOM   1805  C  CA    . VAL B 1 10   ? 48.880  33.468  115.822 1.00 151.01 ? 10   VAL B CA    1 
ATOM   1806  C  C     . VAL B 1 10   ? 47.409  33.059  115.974 1.00 151.08 ? 10   VAL B C     1 
ATOM   1807  O  O     . VAL B 1 10   ? 46.760  32.616  115.017 1.00 145.67 ? 10   VAL B O     1 
ATOM   1808  C  CB    . VAL B 1 10   ? 49.035  34.508  114.699 1.00 149.24 ? 10   VAL B CB    1 
ATOM   1809  C  CG1   . VAL B 1 10   ? 50.209  35.425  115.008 1.00 153.14 ? 10   VAL B CG1   1 
ATOM   1810  C  CG2   . VAL B 1 10   ? 49.207  33.817  113.350 1.00 151.40 ? 10   VAL B CG2   1 
ATOM   1811  N  N     . PHE B 1 11   ? 46.900  33.264  117.190 1.00 150.77 ? 11   PHE B N     1 
ATOM   1812  C  CA    . PHE B 1 11   ? 45.551  32.882  117.607 1.00 144.82 ? 11   PHE B CA    1 
ATOM   1813  C  C     . PHE B 1 11   ? 44.563  33.842  116.940 1.00 143.55 ? 11   PHE B C     1 
ATOM   1814  O  O     . PHE B 1 11   ? 44.656  35.055  117.119 1.00 147.87 ? 11   PHE B O     1 
ATOM   1815  C  CB    . PHE B 1 11   ? 45.494  32.984  119.145 1.00 148.49 ? 11   PHE B CB    1 
ATOM   1816  C  CG    . PHE B 1 11   ? 44.283  32.345  119.791 1.00 149.38 ? 11   PHE B CG    1 
ATOM   1817  C  CD1   . PHE B 1 11   ? 43.778  31.136  119.350 1.00 145.66 ? 11   PHE B CD1   1 
ATOM   1818  C  CD2   . PHE B 1 11   ? 43.682  32.948  120.884 1.00 149.00 ? 11   PHE B CD2   1 
ATOM   1819  C  CE1   . PHE B 1 11   ? 42.674  30.563  119.970 1.00 139.19 ? 11   PHE B CE1   1 
ATOM   1820  C  CE2   . PHE B 1 11   ? 42.589  32.377  121.498 1.00 143.78 ? 11   PHE B CE2   1 
ATOM   1821  C  CZ    . PHE B 1 11   ? 42.087  31.185  121.041 1.00 136.52 ? 11   PHE B CZ    1 
ATOM   1822  N  N     . THR B 1 12   ? 43.633  33.301  116.158 1.00 136.16 ? 12   THR B N     1 
ATOM   1823  C  CA    . THR B 1 12   ? 42.704  34.126  115.389 1.00 136.67 ? 12   THR B CA    1 
ATOM   1824  C  C     . THR B 1 12   ? 41.282  33.810  115.758 1.00 137.61 ? 12   THR B C     1 
ATOM   1825  O  O     . THR B 1 12   ? 40.925  32.649  115.878 1.00 139.73 ? 12   THR B O     1 
ATOM   1826  C  CB    . THR B 1 12   ? 42.819  33.860  113.896 1.00 137.50 ? 12   THR B CB    1 
ATOM   1827  O  OG1   . THR B 1 12   ? 44.200  33.852  113.518 1.00 142.74 ? 12   THR B OG1   1 
ATOM   1828  C  CG2   . THR B 1 12   ? 42.055  34.925  113.107 1.00 134.78 ? 12   THR B CG2   1 
ATOM   1829  N  N     . VAL B 1 13   ? 40.462  34.843  115.908 1.00 138.89 ? 13   VAL B N     1 
ATOM   1830  C  CA    . VAL B 1 13   ? 39.095  34.663  116.367 1.00 135.87 ? 13   VAL B CA    1 
ATOM   1831  C  C     . VAL B 1 13   ? 38.090  35.225  115.371 1.00 139.63 ? 13   VAL B C     1 
ATOM   1832  O  O     . VAL B 1 13   ? 38.389  36.183  114.655 1.00 142.49 ? 13   VAL B O     1 
ATOM   1833  C  CB    . VAL B 1 13   ? 38.890  35.358  117.719 1.00 136.15 ? 13   VAL B CB    1 
ATOM   1834  C  CG1   . VAL B 1 13   ? 37.550  34.977  118.304 1.00 138.48 ? 13   VAL B CG1   1 
ATOM   1835  C  CG2   . VAL B 1 13   ? 40.013  34.989  118.676 1.00 135.34 ? 13   VAL B CG2   1 
ATOM   1836  N  N     . ARG B 1 14   ? 36.920  34.593  115.305 1.00 139.85 ? 14   ARG B N     1 
ATOM   1837  C  CA    . ARG B 1 14   ? 35.733  35.164  114.673 1.00 144.45 ? 14   ARG B CA    1 
ATOM   1838  C  C     . ARG B 1 14   ? 34.536  34.766  115.522 1.00 143.03 ? 14   ARG B C     1 
ATOM   1839  O  O     . ARG B 1 14   ? 34.508  33.663  116.051 1.00 144.68 ? 14   ARG B O     1 
ATOM   1840  C  CB    . ARG B 1 14   ? 35.580  34.668  113.237 1.00 147.95 ? 14   ARG B CB    1 
ATOM   1841  C  CG    . ARG B 1 14   ? 36.577  35.309  112.269 1.00 156.39 ? 14   ARG B CG    1 
ATOM   1842  C  CD    . ARG B 1 14   ? 36.660  34.568  110.936 1.00 167.99 ? 14   ARG B CD    1 
ATOM   1843  N  NE    . ARG B 1 14   ? 36.998  33.150  111.103 1.00 176.96 ? 14   ARG B NE    1 
ATOM   1844  C  CZ    . ARG B 1 14   ? 38.207  32.621  110.908 1.00 171.44 ? 14   ARG B CZ    1 
ATOM   1845  N  NH1   . ARG B 1 14   ? 39.221  33.386  110.522 1.00 166.58 ? 14   ARG B NH1   1 
ATOM   1846  N  NH2   . ARG B 1 14   ? 38.402  31.317  111.094 1.00 163.21 ? 14   ARG B NH2   1 
ATOM   1847  N  N     . THR B 1 15   ? 33.568  35.664  115.702 1.00 147.16 ? 15   THR B N     1 
ATOM   1848  C  CA    . THR B 1 15   ? 32.442  35.363  116.596 1.00 151.25 ? 15   THR B CA    1 
ATOM   1849  C  C     . THR B 1 15   ? 31.062  35.774  116.105 1.00 152.63 ? 15   THR B C     1 
ATOM   1850  O  O     . THR B 1 15   ? 30.873  36.847  115.525 1.00 154.42 ? 15   THR B O     1 
ATOM   1851  C  CB    . THR B 1 15   ? 32.590  36.014  117.989 1.00 154.96 ? 15   THR B CB    1 
ATOM   1852  O  OG1   . THR B 1 15   ? 31.924  37.287  117.997 1.00 159.92 ? 15   THR B OG1   1 
ATOM   1853  C  CG2   . THR B 1 15   ? 34.057  36.173  118.381 1.00 151.29 ? 15   THR B CG2   1 
ATOM   1854  N  N     . GLN B 1 16   ? 30.099  34.899  116.369 1.00 151.63 ? 16   GLN B N     1 
ATOM   1855  C  CA    . GLN B 1 16   ? 28.691  35.222  116.191 1.00 161.10 ? 16   GLN B CA    1 
ATOM   1856  C  C     . GLN B 1 16   ? 27.872  35.033  117.467 1.00 157.95 ? 16   GLN B C     1 
ATOM   1857  O  O     . GLN B 1 16   ? 27.568  33.904  117.869 1.00 155.40 ? 16   GLN B O     1 
ATOM   1858  C  CB    . GLN B 1 16   ? 28.110  34.358  115.082 1.00 164.90 ? 16   GLN B CB    1 
ATOM   1859  C  CG    . GLN B 1 16   ? 28.187  34.997  113.725 1.00 172.33 ? 16   GLN B CG    1 
ATOM   1860  C  CD    . GLN B 1 16   ? 26.833  35.465  113.255 1.00 180.69 ? 16   GLN B CD    1 
ATOM   1861  O  OE1   . GLN B 1 16   ? 25.959  35.800  114.061 1.00 178.47 ? 16   GLN B OE1   1 
ATOM   1862  N  NE2   . GLN B 1 16   ? 26.640  35.474  111.945 1.00 194.05 ? 16   GLN B NE2   1 
ATOM   1863  N  N     . GLY B 1 17   ? 27.456  36.142  118.061 1.00 155.56 ? 17   GLY B N     1 
ATOM   1864  C  CA    . GLY B 1 17   ? 26.718  36.085  119.304 1.00 150.51 ? 17   GLY B CA    1 
ATOM   1865  C  C     . GLY B 1 17   ? 27.498  35.414  120.413 1.00 141.05 ? 17   GLY B C     1 
ATOM   1866  O  O     . GLY B 1 17   ? 28.719  35.290  120.353 1.00 139.27 ? 17   GLY B O     1 
ATOM   1867  N  N     . ARG B 1 18   ? 26.773  34.990  121.437 1.00 141.82 ? 18   ARG B N     1 
ATOM   1868  C  CA    . ARG B 1 18   ? 27.346  34.250  122.548 1.00 143.33 ? 18   ARG B CA    1 
ATOM   1869  C  C     . ARG B 1 18   ? 27.140  32.765  122.287 1.00 141.35 ? 18   ARG B C     1 
ATOM   1870  O  O     . ARG B 1 18   ? 27.420  31.919  123.139 1.00 137.89 ? 18   ARG B O     1 
ATOM   1871  C  CB    . ARG B 1 18   ? 26.656  34.659  123.855 1.00 144.75 ? 18   ARG B CB    1 
ATOM   1872  C  CG    . ARG B 1 18   ? 26.707  36.157  124.149 1.00 139.33 ? 18   ARG B CG    1 
ATOM   1873  C  CD    . ARG B 1 18   ? 25.873  36.534  125.369 1.00 136.70 ? 18   ARG B CD    1 
ATOM   1874  N  NE    . ARG B 1 18   ? 26.183  35.709  126.535 1.00 139.40 ? 18   ARG B NE    1 
ATOM   1875  C  CZ    . ARG B 1 18   ? 27.294  35.814  127.262 1.00 139.83 ? 18   ARG B CZ    1 
ATOM   1876  N  NH1   . ARG B 1 18   ? 27.485  35.017  128.306 1.00 136.27 ? 18   ARG B NH1   1 
ATOM   1877  N  NH2   . ARG B 1 18   ? 28.221  36.708  126.944 1.00 140.68 ? 18   ARG B NH2   1 
ATOM   1878  N  N     . GLU B 1 19   ? 26.560  32.471  121.129 1.00 143.42 ? 19   GLU B N     1 
ATOM   1879  C  CA    . GLU B 1 19   ? 26.263  31.100  120.735 1.00 142.62 ? 19   GLU B CA    1 
ATOM   1880  C  C     . GLU B 1 19   ? 27.193  30.437  119.720 1.00 139.66 ? 19   GLU B C     1 
ATOM   1881  O  O     . GLU B 1 19   ? 26.980  29.281  119.366 1.00 139.53 ? 19   GLU B O     1 
ATOM   1882  C  CB    . GLU B 1 19   ? 24.818  31.004  120.272 1.00 140.40 ? 19   GLU B CB    1 
ATOM   1883  C  CG    . GLU B 1 19   ? 23.868  31.529  121.313 1.00 141.81 ? 19   GLU B CG    1 
ATOM   1884  C  CD    . GLU B 1 19   ? 22.438  31.538  120.843 1.00 149.30 ? 19   GLU B CD    1 
ATOM   1885  O  OE1   . GLU B 1 19   ? 21.900  32.640  120.603 1.00 158.04 ? 19   GLU B OE1   1 
ATOM   1886  O  OE2   . GLU B 1 19   ? 21.851  30.443  120.720 1.00 148.28 ? 19   GLU B OE2   1 
ATOM   1887  N  N     . TYR B 1 20   ? 28.191  31.157  119.222 1.00 138.04 ? 20   TYR B N     1 
ATOM   1888  C  CA    . TYR B 1 20   ? 29.062  30.579  118.205 1.00 139.26 ? 20   TYR B CA    1 
ATOM   1889  C  C     . TYR B 1 20   ? 30.432  31.256  118.072 1.00 141.17 ? 20   TYR B C     1 
ATOM   1890  O  O     . TYR B 1 20   ? 30.595  32.415  118.436 1.00 146.62 ? 20   TYR B O     1 
ATOM   1891  C  CB    . TYR B 1 20   ? 28.347  30.581  116.860 1.00 139.55 ? 20   TYR B CB    1 
ATOM   1892  C  CG    . TYR B 1 20   ? 29.194  30.021  115.769 1.00 137.28 ? 20   TYR B CG    1 
ATOM   1893  C  CD1   . TYR B 1 20   ? 29.753  30.845  114.814 1.00 141.33 ? 20   TYR B CD1   1 
ATOM   1894  C  CD2   . TYR B 1 20   ? 29.485  28.670  115.725 1.00 138.76 ? 20   TYR B CD2   1 
ATOM   1895  C  CE1   . TYR B 1 20   ? 30.557  30.332  113.811 1.00 145.23 ? 20   TYR B CE1   1 
ATOM   1896  C  CE2   . TYR B 1 20   ? 30.287  28.145  114.730 1.00 141.95 ? 20   TYR B CE2   1 
ATOM   1897  C  CZ    . TYR B 1 20   ? 30.822  28.981  113.775 1.00 143.46 ? 20   TYR B CZ    1 
ATOM   1898  O  OH    . TYR B 1 20   ? 31.612  28.460  112.774 1.00 138.88 ? 20   TYR B OH    1 
ATOM   1899  N  N     . GLY B 1 21   ? 31.411  30.530  117.542 1.00 134.84 ? 21   GLY B N     1 
ATOM   1900  C  CA    . GLY B 1 21   ? 32.723  31.090  117.288 1.00 134.11 ? 21   GLY B CA    1 
ATOM   1901  C  C     . GLY B 1 21   ? 33.622  30.182  116.467 1.00 134.94 ? 21   GLY B C     1 
ATOM   1902  O  O     . GLY B 1 21   ? 33.433  28.971  116.440 1.00 132.69 ? 21   GLY B O     1 
ATOM   1903  N  N     . GLU B 1 22   ? 34.596  30.784  115.785 1.00 141.03 ? 22   GLU B N     1 
ATOM   1904  C  CA    . GLU B 1 22   ? 35.640  30.057  115.059 1.00 137.37 ? 22   GLU B CA    1 
ATOM   1905  C  C     . GLU B 1 22   ? 36.997  30.561  115.485 1.00 134.83 ? 22   GLU B C     1 
ATOM   1906  O  O     . GLU B 1 22   ? 37.204  31.765  115.629 1.00 138.78 ? 22   GLU B O     1 
ATOM   1907  C  CB    . GLU B 1 22   ? 35.524  30.233  113.546 1.00 143.99 ? 22   GLU B CB    1 
ATOM   1908  C  CG    . GLU B 1 22   ? 34.361  29.509  112.922 1.00 149.75 ? 22   GLU B CG    1 
ATOM   1909  C  CD    . GLU B 1 22   ? 34.532  29.285  111.431 1.00 156.73 ? 22   GLU B CD    1 
ATOM   1910  O  OE1   . GLU B 1 22   ? 35.654  28.917  111.010 1.00 153.04 ? 22   GLU B OE1   1 
ATOM   1911  O  OE2   . GLU B 1 22   ? 33.539  29.469  110.688 1.00 155.06 ? 22   GLU B OE2   1 
ATOM   1912  N  N     . PHE B 1 23   ? 37.925  29.632  115.654 1.00 132.08 ? 23   PHE B N     1 
ATOM   1913  C  CA    . PHE B 1 23   ? 39.253  29.947  116.159 1.00 137.72 ? 23   PHE B CA    1 
ATOM   1914  C  C     . PHE B 1 23   ? 40.310  29.350  115.258 1.00 140.19 ? 23   PHE B C     1 
ATOM   1915  O  O     . PHE B 1 23   ? 40.137  28.244  114.751 1.00 144.26 ? 23   PHE B O     1 
ATOM   1916  C  CB    . PHE B 1 23   ? 39.415  29.396  117.569 1.00 131.04 ? 23   PHE B CB    1 
ATOM   1917  C  CG    . PHE B 1 23   ? 38.312  29.785  118.472 1.00 130.21 ? 23   PHE B CG    1 
ATOM   1918  C  CD1   . PHE B 1 23   ? 38.423  30.902  119.264 1.00 131.32 ? 23   PHE B CD1   1 
ATOM   1919  C  CD2   . PHE B 1 23   ? 37.138  29.052  118.498 1.00 132.20 ? 23   PHE B CD2   1 
ATOM   1920  C  CE1   . PHE B 1 23   ? 37.392  31.268  120.078 1.00 137.81 ? 23   PHE B CE1   1 
ATOM   1921  C  CE2   . PHE B 1 23   ? 36.097  29.412  119.310 1.00 133.19 ? 23   PHE B CE2   1 
ATOM   1922  C  CZ    . PHE B 1 23   ? 36.220  30.519  120.104 1.00 136.73 ? 23   PHE B CZ    1 
ATOM   1923  N  N     . VAL B 1 24   ? 41.406  30.068  115.050 1.00 137.18 ? 24   VAL B N     1 
ATOM   1924  C  CA    . VAL B 1 24   ? 42.473  29.523  114.229 1.00 138.72 ? 24   VAL B CA    1 
ATOM   1925  C  C     . VAL B 1 24   ? 43.843  29.707  114.871 1.00 138.36 ? 24   VAL B C     1 
ATOM   1926  O  O     . VAL B 1 24   ? 44.228  30.817  115.238 1.00 142.63 ? 24   VAL B O     1 
ATOM   1927  C  CB    . VAL B 1 24   ? 42.448  30.093  112.794 1.00 145.60 ? 24   VAL B CB    1 
ATOM   1928  C  CG1   . VAL B 1 24   ? 43.729  29.729  112.045 1.00 145.66 ? 24   VAL B CG1   1 
ATOM   1929  C  CG2   . VAL B 1 24   ? 41.214  29.586  112.038 1.00 143.55 ? 24   VAL B CG2   1 
ATOM   1930  N  N     . LEU B 1 25   ? 44.558  28.596  115.027 1.00 135.06 ? 25   LEU B N     1 
ATOM   1931  C  CA    . LEU B 1 25   ? 45.933  28.612  115.509 1.00 139.01 ? 25   LEU B CA    1 
ATOM   1932  C  C     . LEU B 1 25   ? 46.864  27.988  114.469 1.00 140.52 ? 25   LEU B C     1 
ATOM   1933  O  O     . LEU B 1 25   ? 46.820  26.778  114.239 1.00 137.50 ? 25   LEU B O     1 
ATOM   1934  C  CB    . LEU B 1 25   ? 46.044  27.836  116.830 1.00 137.75 ? 25   LEU B CB    1 
ATOM   1935  C  CG    . LEU B 1 25   ? 47.372  27.839  117.603 1.00 139.50 ? 25   LEU B CG    1 
ATOM   1936  C  CD1   . LEU B 1 25   ? 47.629  29.186  118.277 1.00 147.04 ? 25   LEU B CD1   1 
ATOM   1937  C  CD2   . LEU B 1 25   ? 47.408  26.715  118.630 1.00 133.44 ? 25   LEU B CD2   1 
ATOM   1938  N  N     . GLU B 1 26   ? 47.697  28.817  113.842 1.00 144.41 ? 26   GLU B N     1 
ATOM   1939  C  CA    . GLU B 1 26   ? 48.726  28.350  112.916 1.00 138.24 ? 26   GLU B CA    1 
ATOM   1940  C  C     . GLU B 1 26   ? 49.919  29.288  112.980 1.00 136.35 ? 26   GLU B C     1 
ATOM   1941  O  O     . GLU B 1 26   ? 49.778  30.449  113.353 1.00 145.98 ? 26   GLU B O     1 
ATOM   1942  C  CB    . GLU B 1 26   ? 48.191  28.324  111.496 1.00 135.29 ? 26   GLU B CB    1 
ATOM   1943  C  CG    . GLU B 1 26   ? 47.927  29.690  110.969 1.00 134.74 ? 26   GLU B CG    1 
ATOM   1944  C  CD    . GLU B 1 26   ? 47.404  29.644  109.582 1.00 137.77 ? 26   GLU B CD    1 
ATOM   1945  O  OE1   . GLU B 1 26   ? 48.168  29.220  108.686 1.00 130.62 ? 26   GLU B OE1   1 
ATOM   1946  O  OE2   . GLU B 1 26   ? 46.223  30.010  109.400 1.00 141.24 ? 26   GLU B OE2   1 
ATOM   1947  N  N     . PRO B 1 27   ? 51.101  28.800  112.608 1.00 128.70 ? 27   PRO B N     1 
ATOM   1948  C  CA    . PRO B 1 27   ? 51.437  27.427  112.254 1.00 130.12 ? 27   PRO B CA    1 
ATOM   1949  C  C     . PRO B 1 27   ? 51.708  26.585  113.496 1.00 137.58 ? 27   PRO B C     1 
ATOM   1950  O  O     . PRO B 1 27   ? 52.117  27.123  114.529 1.00 136.29 ? 27   PRO B O     1 
ATOM   1951  C  CB    . PRO B 1 27   ? 52.718  27.605  111.465 1.00 133.04 ? 27   PRO B CB    1 
ATOM   1952  C  CG    . PRO B 1 27   ? 53.396  28.710  112.208 1.00 135.26 ? 27   PRO B CG    1 
ATOM   1953  C  CD    . PRO B 1 27   ? 52.310  29.632  112.691 1.00 135.88 ? 27   PRO B CD    1 
ATOM   1954  N  N     . LEU B 1 28   ? 51.493  25.276  113.387 1.00 140.82 ? 28   LEU B N     1 
ATOM   1955  C  CA    . LEU B 1 28   ? 51.819  24.343  114.456 1.00 133.87 ? 28   LEU B CA    1 
ATOM   1956  C  C     . LEU B 1 28   ? 52.736  23.276  113.909 1.00 133.83 ? 28   LEU B C     1 
ATOM   1957  O  O     . LEU B 1 28   ? 52.664  22.935  112.732 1.00 131.80 ? 28   LEU B O     1 
ATOM   1958  C  CB    . LEU B 1 28   ? 50.556  23.693  115.008 1.00 129.50 ? 28   LEU B CB    1 
ATOM   1959  C  CG    . LEU B 1 28   ? 49.714  24.572  115.924 1.00 127.74 ? 28   LEU B CG    1 
ATOM   1960  C  CD1   . LEU B 1 28   ? 48.415  23.877  116.254 1.00 125.44 ? 28   LEU B CD1   1 
ATOM   1961  C  CD2   . LEU B 1 28   ? 50.500  24.886  117.183 1.00 131.70 ? 28   LEU B CD2   1 
ATOM   1962  N  N     . GLU B 1 29   ? 53.589  22.741  114.771 1.00 134.51 ? 29   GLU B N     1 
ATOM   1963  C  CA    . GLU B 1 29   ? 54.516  21.694  114.368 1.00 137.54 ? 29   GLU B CA    1 
ATOM   1964  C  C     . GLU B 1 29   ? 53.740  20.469  113.891 1.00 140.58 ? 29   GLU B C     1 
ATOM   1965  O  O     . GLU B 1 29   ? 52.600  20.274  114.301 1.00 143.38 ? 29   GLU B O     1 
ATOM   1966  C  CB    . GLU B 1 29   ? 55.439  21.335  115.531 1.00 139.82 ? 29   GLU B CB    1 
ATOM   1967  C  CG    . GLU B 1 29   ? 56.610  20.433  115.152 1.00 151.69 ? 29   GLU B CG    1 
ATOM   1968  C  CD    . GLU B 1 29   ? 57.480  21.000  114.024 1.00 160.96 ? 29   GLU B CD    1 
ATOM   1969  O  OE1   . GLU B 1 29   ? 57.022  21.023  112.857 1.00 157.80 ? 29   GLU B OE1   1 
ATOM   1970  O  OE2   . GLU B 1 29   ? 58.635  21.408  114.300 1.00 163.93 ? 29   GLU B OE2   1 
ATOM   1971  N  N     . ARG B 1 30   ? 54.331  19.659  113.013 1.00 137.74 ? 30   ARG B N     1 
ATOM   1972  C  CA    . ARG B 1 30   ? 53.584  18.557  112.403 1.00 137.76 ? 30   ARG B CA    1 
ATOM   1973  C  C     . ARG B 1 30   ? 53.036  17.550  113.402 1.00 141.61 ? 30   ARG B C     1 
ATOM   1974  O  O     . ARG B 1 30   ? 53.785  16.962  114.181 1.00 143.58 ? 30   ARG B O     1 
ATOM   1975  C  CB    . ARG B 1 30   ? 54.411  17.806  111.372 1.00 140.42 ? 30   ARG B CB    1 
ATOM   1976  C  CG    . ARG B 1 30   ? 53.656  16.610  110.808 1.00 144.55 ? 30   ARG B CG    1 
ATOM   1977  C  CD    . ARG B 1 30   ? 54.585  15.601  110.173 1.00 147.78 ? 30   ARG B CD    1 
ATOM   1978  N  NE    . ARG B 1 30   ? 55.286  14.783  111.158 1.00 144.37 ? 30   ARG B NE    1 
ATOM   1979  C  CZ    . ARG B 1 30   ? 56.331  14.011  110.876 1.00 136.42 ? 30   ARG B CZ    1 
ATOM   1980  N  NH1   . ARG B 1 30   ? 56.805  13.962  109.635 1.00 121.56 ? 30   ARG B NH1   1 
ATOM   1981  N  NH2   . ARG B 1 30   ? 56.905  13.299  111.839 1.00 136.67 ? 30   ARG B NH2   1 
ATOM   1982  N  N     . GLY B 1 31   ? 51.725  17.330  113.338 1.00 144.39 ? 31   GLY B N     1 
ATOM   1983  C  CA    . GLY B 1 31   ? 51.047  16.419  114.242 1.00 142.21 ? 31   GLY B CA    1 
ATOM   1984  C  C     . GLY B 1 31   ? 50.633  17.090  115.542 1.00 140.55 ? 31   GLY B C     1 
ATOM   1985  O  O     . GLY B 1 31   ? 50.190  16.418  116.475 1.00 135.80 ? 31   GLY B O     1 
ATOM   1986  N  N     . PHE B 1 32   ? 50.796  18.411  115.620 1.00 137.79 ? 32   PHE B N     1 
ATOM   1987  C  CA    . PHE B 1 32   ? 50.372  19.154  116.806 1.00 131.15 ? 32   PHE B CA    1 
ATOM   1988  C  C     . PHE B 1 32   ? 49.012  19.831  116.678 1.00 125.76 ? 32   PHE B C     1 
ATOM   1989  O  O     . PHE B 1 32   ? 48.513  20.432  117.623 1.00 124.31 ? 32   PHE B O     1 
ATOM   1990  C  CB    . PHE B 1 32   ? 51.447  20.144  117.260 1.00 130.58 ? 32   PHE B CB    1 
ATOM   1991  C  CG    . PHE B 1 32   ? 52.326  19.600  118.335 1.00 130.61 ? 32   PHE B CG    1 
ATOM   1992  C  CD1   . PHE B 1 32   ? 53.294  18.655  118.041 1.00 134.53 ? 32   PHE B CD1   1 
ATOM   1993  C  CD2   . PHE B 1 32   ? 52.161  19.999  119.646 1.00 129.99 ? 32   PHE B CD2   1 
ATOM   1994  C  CE1   . PHE B 1 32   ? 54.094  18.134  119.036 1.00 135.24 ? 32   PHE B CE1   1 
ATOM   1995  C  CE2   . PHE B 1 32   ? 52.959  19.484  120.646 1.00 132.81 ? 32   PHE B CE2   1 
ATOM   1996  C  CZ    . PHE B 1 32   ? 53.929  18.550  120.341 1.00 132.57 ? 32   PHE B CZ    1 
ATOM   1997  N  N     . GLY B 1 33   ? 48.401  19.736  115.511 1.00 126.23 ? 33   GLY B N     1 
ATOM   1998  C  CA    . GLY B 1 33   ? 47.065  20.268  115.370 1.00 123.63 ? 33   GLY B CA    1 
ATOM   1999  C  C     . GLY B 1 33   ? 46.123  19.305  116.046 1.00 118.14 ? 33   GLY B C     1 
ATOM   2000  O  O     . GLY B 1 33   ? 45.262  19.704  116.814 1.00 112.53 ? 33   GLY B O     1 
ATOM   2001  N  N     . VAL B 1 34   ? 46.318  18.024  115.758 1.00 124.37 ? 34   VAL B N     1 
ATOM   2002  C  CA    . VAL B 1 34   ? 45.475  16.946  116.256 1.00 120.28 ? 34   VAL B CA    1 
ATOM   2003  C  C     . VAL B 1 34   ? 45.841  16.606  117.705 1.00 120.80 ? 34   VAL B C     1 
ATOM   2004  O  O     . VAL B 1 34   ? 45.000  16.120  118.475 1.00 115.79 ? 34   VAL B O     1 
ATOM   2005  C  CB    . VAL B 1 34   ? 45.585  15.723  115.310 1.00 120.44 ? 34   VAL B CB    1 
ATOM   2006  C  CG1   . VAL B 1 34   ? 46.607  16.011  114.195 1.00 121.55 ? 34   VAL B CG1   1 
ATOM   2007  C  CG2   . VAL B 1 34   ? 45.930  14.447  116.069 1.00 118.60 ? 34   VAL B CG2   1 
ATOM   2008  N  N     . THR B 1 35   ? 47.096  16.891  118.064 1.00 126.08 ? 35   THR B N     1 
ATOM   2009  C  CA    . THR B 1 35   ? 47.574  16.840  119.455 1.00 125.22 ? 35   THR B CA    1 
ATOM   2010  C  C     . THR B 1 35   ? 46.813  17.828  120.369 1.00 123.63 ? 35   THR B C     1 
ATOM   2011  O  O     . THR B 1 35   ? 46.354  17.456  121.446 1.00 120.58 ? 35   THR B O     1 
ATOM   2012  C  CB    . THR B 1 35   ? 49.115  17.087  119.538 1.00 119.02 ? 35   THR B CB    1 
ATOM   2013  O  OG1   . THR B 1 35   ? 49.815  15.944  119.042 1.00 118.60 ? 35   THR B OG1   1 
ATOM   2014  C  CG2   . THR B 1 35   ? 49.571  17.343  120.958 1.00 114.30 ? 35   THR B CG2   1 
ATOM   2015  N  N     . LEU B 1 36   ? 46.682  19.080  119.939 1.00 121.76 ? 36   LEU B N     1 
ATOM   2016  C  CA    . LEU B 1 36   ? 45.920  20.070  120.693 1.00 110.07 ? 36   LEU B CA    1 
ATOM   2017  C  C     . LEU B 1 36   ? 44.424  19.986  120.423 1.00 111.28 ? 36   LEU B C     1 
ATOM   2018  O  O     . LEU B 1 36   ? 43.624  20.491  121.191 1.00 110.34 ? 36   LEU B O     1 
ATOM   2019  C  CB    . LEU B 1 36   ? 46.403  21.485  120.383 1.00 106.60 ? 36   LEU B CB    1 
ATOM   2020  C  CG    . LEU B 1 36   ? 47.673  21.947  121.079 1.00 107.93 ? 36   LEU B CG    1 
ATOM   2021  C  CD1   . LEU B 1 36   ? 47.976  23.383  120.713 1.00 116.40 ? 36   LEU B CD1   1 
ATOM   2022  C  CD2   . LEU B 1 36   ? 47.522  21.809  122.576 1.00 112.36 ? 36   LEU B CD2   1 
ATOM   2023  N  N     . GLY B 1 37   ? 44.039  19.368  119.317 1.00 116.87 ? 37   GLY B N     1 
ATOM   2024  C  CA    . GLY B 1 37   ? 42.648  19.407  118.899 1.00 116.55 ? 37   GLY B CA    1 
ATOM   2025  C  C     . GLY B 1 37   ? 41.667  18.640  119.754 1.00 109.80 ? 37   GLY B C     1 
ATOM   2026  O  O     . GLY B 1 37   ? 40.721  19.198  120.285 1.00 104.12 ? 37   GLY B O     1 
ATOM   2027  N  N     . ASN B 1 38   ? 41.902  17.348  119.900 1.00 111.32 ? 38   ASN B N     1 
ATOM   2028  C  CA    . ASN B 1 38   ? 40.993  16.515  120.669 1.00 112.96 ? 38   ASN B CA    1 
ATOM   2029  C  C     . ASN B 1 38   ? 40.880  16.841  122.158 1.00 117.91 ? 38   ASN B C     1 
ATOM   2030  O  O     . ASN B 1 38   ? 39.768  17.015  122.657 1.00 121.89 ? 38   ASN B O     1 
ATOM   2031  C  CB    . ASN B 1 38   ? 41.276  15.040  120.427 1.00 111.26 ? 38   ASN B CB    1 
ATOM   2032  C  CG    . ASN B 1 38   ? 41.172  14.697  118.980 1.00 115.66 ? 38   ASN B CG    1 
ATOM   2033  O  OD1   . ASN B 1 38   ? 40.077  14.697  118.414 1.00 113.83 ? 38   ASN B OD1   1 
ATOM   2034  N  ND2   . ASN B 1 38   ? 42.311  14.442  118.347 1.00 119.91 ? 38   ASN B ND2   1 
ATOM   2035  N  N     . PRO B 1 39   ? 42.014  16.940  122.874 1.00 113.35 ? 39   PRO B N     1 
ATOM   2036  C  CA    . PRO B 1 39   ? 41.958  17.182  124.319 1.00 109.27 ? 39   PRO B CA    1 
ATOM   2037  C  C     . PRO B 1 39   ? 41.025  18.314  124.663 1.00 107.74 ? 39   PRO B C     1 
ATOM   2038  O  O     . PRO B 1 39   ? 40.268  18.210  125.616 1.00 109.68 ? 39   PRO B O     1 
ATOM   2039  C  CB    . PRO B 1 39   ? 43.376  17.616  124.644 1.00 109.95 ? 39   PRO B CB    1 
ATOM   2040  C  CG    . PRO B 1 39   ? 44.182  16.948  123.640 1.00 110.97 ? 39   PRO B CG    1 
ATOM   2041  C  CD    . PRO B 1 39   ? 43.401  16.890  122.396 1.00 112.52 ? 39   PRO B CD    1 
ATOM   2042  N  N     . LEU B 1 40   ? 41.061  19.373  123.870 1.00 108.00 ? 40   LEU B N     1 
ATOM   2043  C  CA    . LEU B 1 40   ? 40.178  20.495  124.105 1.00 111.05 ? 40   LEU B CA    1 
ATOM   2044  C  C     . LEU B 1 40   ? 38.761  20.162  123.670 1.00 114.48 ? 40   LEU B C     1 
ATOM   2045  O  O     . LEU B 1 40   ? 37.814  20.734  124.178 1.00 116.93 ? 40   LEU B O     1 
ATOM   2046  C  CB    . LEU B 1 40   ? 40.685  21.748  123.398 1.00 107.25 ? 40   LEU B CB    1 
ATOM   2047  C  CG    . LEU B 1 40   ? 42.164  22.035  123.657 1.00 108.56 ? 40   LEU B CG    1 
ATOM   2048  C  CD1   . LEU B 1 40   ? 42.619  23.270  122.903 1.00 110.47 ? 40   LEU B CD1   1 
ATOM   2049  C  CD2   . LEU B 1 40   ? 42.451  22.172  125.141 1.00 115.29 ? 40   LEU B CD2   1 
ATOM   2050  N  N     . ARG B 1 41   ? 38.607  19.230  122.739 1.00 114.70 ? 41   ARG B N     1 
ATOM   2051  C  CA    . ARG B 1 41   ? 37.267  18.827  122.353 1.00 113.27 ? 41   ARG B CA    1 
ATOM   2052  C  C     . ARG B 1 41   ? 36.670  18.056  123.519 1.00 110.02 ? 41   ARG B C     1 
ATOM   2053  O  O     . ARG B 1 41   ? 35.554  18.329  123.957 1.00 111.04 ? 41   ARG B O     1 
ATOM   2054  C  CB    . ARG B 1 41   ? 37.286  17.965  121.092 1.00 110.66 ? 41   ARG B CB    1 
ATOM   2055  C  CG    . ARG B 1 41   ? 35.908  17.654  120.622 1.00 112.55 ? 41   ARG B CG    1 
ATOM   2056  C  CD    . ARG B 1 41   ? 35.853  16.579  119.575 1.00 115.18 ? 41   ARG B CD    1 
ATOM   2057  N  NE    . ARG B 1 41   ? 34.458  16.382  119.185 1.00 124.24 ? 41   ARG B NE    1 
ATOM   2058  C  CZ    . ARG B 1 41   ? 33.706  15.341  119.535 1.00 126.02 ? 41   ARG B CZ    1 
ATOM   2059  N  NH1   . ARG B 1 41   ? 34.215  14.352  120.268 1.00 120.56 ? 41   ARG B NH1   1 
ATOM   2060  N  NH2   . ARG B 1 41   ? 32.442  15.283  119.130 1.00 126.19 ? 41   ARG B NH2   1 
ATOM   2061  N  N     . ARG B 1 42   ? 37.452  17.124  124.046 1.00 106.55 ? 42   ARG B N     1 
ATOM   2062  C  CA    . ARG B 1 42   ? 37.003  16.240  125.112 1.00 111.41 ? 42   ARG B CA    1 
ATOM   2063  C  C     . ARG B 1 42   ? 36.689  16.949  126.447 1.00 119.54 ? 42   ARG B C     1 
ATOM   2064  O  O     . ARG B 1 42   ? 35.840  16.487  127.218 1.00 120.90 ? 42   ARG B O     1 
ATOM   2065  C  CB    . ARG B 1 42   ? 38.018  15.108  125.294 1.00 108.48 ? 42   ARG B CB    1 
ATOM   2066  C  CG    . ARG B 1 42   ? 38.213  14.262  124.035 1.00 108.74 ? 42   ARG B CG    1 
ATOM   2067  C  CD    . ARG B 1 42   ? 39.429  13.365  124.144 1.00 110.12 ? 42   ARG B CD    1 
ATOM   2068  N  NE    . ARG B 1 42   ? 39.399  12.554  125.355 1.00 111.83 ? 42   ARG B NE    1 
ATOM   2069  C  CZ    . ARG B 1 42   ? 38.754  11.397  125.452 1.00 117.40 ? 42   ARG B CZ    1 
ATOM   2070  N  NH1   . ARG B 1 42   ? 38.091  10.928  124.406 1.00 122.01 ? 42   ARG B NH1   1 
ATOM   2071  N  NH2   . ARG B 1 42   ? 38.771  10.705  126.585 1.00 115.49 ? 42   ARG B NH2   1 
ATOM   2072  N  N     . ILE B 1 43   ? 37.390  18.051  126.717 1.00 119.85 ? 43   ILE B N     1 
ATOM   2073  C  CA    . ILE B 1 43   ? 37.157  18.880  127.899 1.00 113.15 ? 43   ILE B CA    1 
ATOM   2074  C  C     . ILE B 1 43   ? 35.975  19.799  127.690 1.00 112.74 ? 43   ILE B C     1 
ATOM   2075  O  O     . ILE B 1 43   ? 35.125  19.929  128.556 1.00 116.90 ? 43   ILE B O     1 
ATOM   2076  C  CB    . ILE B 1 43   ? 38.350  19.780  128.188 1.00 110.07 ? 43   ILE B CB    1 
ATOM   2077  C  CG1   . ILE B 1 43   ? 39.589  18.951  128.483 1.00 109.11 ? 43   ILE B CG1   1 
ATOM   2078  C  CG2   . ILE B 1 43   ? 38.050  20.672  129.355 1.00 117.19 ? 43   ILE B CG2   1 
ATOM   2079  C  CD1   . ILE B 1 43   ? 40.857  19.740  128.359 1.00 109.08 ? 43   ILE B CD1   1 
ATOM   2080  N  N     . LEU B 1 44   ? 35.950  20.450  126.533 1.00 112.11 ? 44   LEU B N     1 
ATOM   2081  C  CA    . LEU B 1 44   ? 34.856  21.331  126.149 1.00 114.42 ? 44   LEU B CA    1 
ATOM   2082  C  C     . LEU B 1 44   ? 33.520  20.635  126.257 1.00 119.58 ? 44   LEU B C     1 
ATOM   2083  O  O     . LEU B 1 44   ? 32.510  21.239  126.614 1.00 121.81 ? 44   LEU B O     1 
ATOM   2084  C  CB    . LEU B 1 44   ? 35.038  21.803  124.712 1.00 111.03 ? 44   LEU B CB    1 
ATOM   2085  C  CG    . LEU B 1 44   ? 35.980  22.986  124.547 1.00 114.15 ? 44   LEU B CG    1 
ATOM   2086  C  CD1   . LEU B 1 44   ? 36.275  23.218  123.084 1.00 110.45 ? 44   LEU B CD1   1 
ATOM   2087  C  CD2   . LEU B 1 44   ? 35.361  24.199  125.185 1.00 127.70 ? 44   LEU B CD2   1 
ATOM   2088  N  N     . LEU B 1 45   ? 33.505  19.356  125.928 1.00 117.26 ? 45   LEU B N     1 
ATOM   2089  C  CA    . LEU B 1 45   ? 32.239  18.662  125.844 1.00 116.89 ? 45   LEU B CA    1 
ATOM   2090  C  C     . LEU B 1 45   ? 31.785  18.023  127.154 1.00 116.87 ? 45   LEU B C     1 
ATOM   2091  O  O     . LEU B 1 45   ? 30.619  17.681  127.297 1.00 120.14 ? 45   LEU B O     1 
ATOM   2092  C  CB    . LEU B 1 45   ? 32.246  17.675  124.675 1.00 115.17 ? 45   LEU B CB    1 
ATOM   2093  C  CG    . LEU B 1 45   ? 32.028  18.350  123.310 1.00 112.03 ? 45   LEU B CG    1 
ATOM   2094  C  CD1   . LEU B 1 45   ? 32.222  17.423  122.117 1.00 110.43 ? 45   LEU B CD1   1 
ATOM   2095  C  CD2   . LEU B 1 45   ? 30.643  18.963  123.247 1.00 118.08 ? 45   LEU B CD2   1 
ATOM   2096  N  N     . SER B 1 46   ? 32.684  17.908  128.126 1.00 119.85 ? 46   SER B N     1 
ATOM   2097  C  CA    . SER B 1 46   ? 32.309  17.374  129.443 1.00 129.21 ? 46   SER B CA    1 
ATOM   2098  C  C     . SER B 1 46   ? 32.445  18.374  130.615 1.00 133.61 ? 46   SER B C     1 
ATOM   2099  O  O     . SER B 1 46   ? 31.451  18.821  131.205 1.00 130.55 ? 46   SER B O     1 
ATOM   2100  C  CB    . SER B 1 46   ? 33.088  16.086  129.747 1.00 129.37 ? 46   SER B CB    1 
ATOM   2101  O  OG    . SER B 1 46   ? 34.493  16.296  129.741 1.00 131.99 ? 46   SER B OG    1 
ATOM   2102  N  N     . SER B 1 47   ? 33.685  18.740  130.922 1.00 135.74 ? 47   SER B N     1 
ATOM   2103  C  CA    . SER B 1 47   ? 34.018  19.439  132.165 1.00 133.23 ? 47   SER B CA    1 
ATOM   2104  C  C     . SER B 1 47   ? 33.859  20.975  132.179 1.00 132.27 ? 47   SER B C     1 
ATOM   2105  O  O     . SER B 1 47   ? 34.235  21.624  133.158 1.00 131.25 ? 47   SER B O     1 
ATOM   2106  C  CB    . SER B 1 47   ? 35.416  19.023  132.643 1.00 136.95 ? 47   SER B CB    1 
ATOM   2107  O  OG    . SER B 1 47   ? 35.489  17.613  132.814 1.00 140.20 ? 47   SER B OG    1 
ATOM   2108  N  N     . ILE B 1 48   ? 33.338  21.549  131.093 1.00 132.74 ? 48   ILE B N     1 
ATOM   2109  C  CA    . ILE B 1 48   ? 32.924  22.956  131.076 1.00 132.75 ? 48   ILE B CA    1 
ATOM   2110  C  C     . ILE B 1 48   ? 31.557  23.062  131.777 1.00 138.13 ? 48   ILE B C     1 
ATOM   2111  O  O     . ILE B 1 48   ? 30.599  22.397  131.346 1.00 132.18 ? 48   ILE B O     1 
ATOM   2112  C  CB    . ILE B 1 48   ? 32.855  23.542  129.631 1.00 126.78 ? 48   ILE B CB    1 
ATOM   2113  C  CG1   . ILE B 1 48   ? 34.191  24.146  129.199 1.00 123.30 ? 48   ILE B CG1   1 
ATOM   2114  C  CG2   . ILE B 1 48   ? 31.875  24.667  129.567 1.00 128.15 ? 48   ILE B CG2   1 
ATOM   2115  C  CD1   . ILE B 1 48   ? 35.332  23.185  129.148 1.00 123.22 ? 48   ILE B CD1   1 
ATOM   2116  N  N     . PRO B 1 49   ? 31.480  23.882  132.870 1.00 143.73 ? 49   PRO B N     1 
ATOM   2117  C  CA    . PRO B 1 49   ? 30.367  24.044  133.834 1.00 131.69 ? 49   PRO B CA    1 
ATOM   2118  C  C     . PRO B 1 49   ? 29.124  24.656  133.231 1.00 130.82 ? 49   PRO B C     1 
ATOM   2119  O  O     . PRO B 1 49   ? 29.209  25.496  132.331 1.00 137.05 ? 49   PRO B O     1 
ATOM   2120  C  CB    . PRO B 1 49   ? 30.922  25.022  134.882 1.00 123.44 ? 49   PRO B CB    1 
ATOM   2121  C  CG    . PRO B 1 49   ? 32.383  25.020  134.701 1.00 133.42 ? 49   PRO B CG    1 
ATOM   2122  C  CD    . PRO B 1 49   ? 32.616  24.748  133.234 1.00 140.93 ? 49   PRO B CD    1 
ATOM   2123  N  N     . GLY B 1 50   ? 27.974  24.273  133.765 1.00 125.54 ? 50   GLY B N     1 
ATOM   2124  C  CA    . GLY B 1 50   ? 26.723  24.612  133.133 1.00 128.29 ? 50   GLY B CA    1 
ATOM   2125  C  C     . GLY B 1 50   ? 25.571  24.447  134.081 1.00 131.24 ? 50   GLY B C     1 
ATOM   2126  O  O     . GLY B 1 50   ? 25.746  24.377  135.299 1.00 131.92 ? 50   GLY B O     1 
ATOM   2127  N  N     . THR B 1 51   ? 24.378  24.439  133.509 1.00 131.40 ? 51   THR B N     1 
ATOM   2128  C  CA    . THR B 1 51   ? 23.154  24.423  134.283 1.00 130.66 ? 51   THR B CA    1 
ATOM   2129  C  C     . THR B 1 51   ? 22.091  23.624  133.546 1.00 131.19 ? 51   THR B C     1 
ATOM   2130  O  O     . THR B 1 51   ? 21.896  23.801  132.338 1.00 136.11 ? 51   THR B O     1 
ATOM   2131  C  CB    . THR B 1 51   ? 22.671  25.846  134.446 1.00 128.40 ? 51   THR B CB    1 
ATOM   2132  O  OG1   . THR B 1 51   ? 22.869  26.530  133.207 1.00 131.97 ? 51   THR B OG1   1 
ATOM   2133  C  CG2   . THR B 1 51   ? 23.493  26.552  135.494 1.00 137.27 ? 51   THR B CG2   1 
ATOM   2134  N  N     . ALA B 1 52   ? 21.387  22.758  134.261 1.00 124.38 ? 52   ALA B N     1 
ATOM   2135  C  CA    . ALA B 1 52   ? 20.471  21.846  133.594 1.00 128.16 ? 52   ALA B CA    1 
ATOM   2136  C  C     . ALA B 1 52   ? 19.200  21.701  134.358 1.00 132.19 ? 52   ALA B C     1 
ATOM   2137  O  O     . ALA B 1 52   ? 19.172  21.942  135.560 1.00 135.14 ? 52   ALA B O     1 
ATOM   2138  C  CB    . ALA B 1 52   ? 21.094  20.494  133.444 1.00 132.87 ? 52   ALA B CB    1 
ATOM   2139  N  N     . VAL B 1 53   ? 18.164  21.234  133.671 1.00 135.65 ? 53   VAL B N     1 
ATOM   2140  C  CA    . VAL B 1 53   ? 16.896  20.985  134.328 1.00 136.00 ? 53   VAL B CA    1 
ATOM   2141  C  C     . VAL B 1 53   ? 16.941  19.550  134.785 1.00 133.86 ? 53   VAL B C     1 
ATOM   2142  O  O     . VAL B 1 53   ? 16.884  18.638  133.968 1.00 136.84 ? 53   VAL B O     1 
ATOM   2143  C  CB    . VAL B 1 53   ? 15.719  21.123  133.353 1.00 131.47 ? 53   VAL B CB    1 
ATOM   2144  C  CG1   . VAL B 1 53   ? 14.434  20.714  134.034 1.00 128.55 ? 53   VAL B CG1   1 
ATOM   2145  C  CG2   . VAL B 1 53   ? 15.622  22.537  132.823 1.00 132.90 ? 53   VAL B CG2   1 
ATOM   2146  N  N     . THR B 1 54   ? 17.063  19.356  136.093 1.00 132.22 ? 54   THR B N     1 
ATOM   2147  C  CA    . THR B 1 54   ? 17.241  18.024  136.659 1.00 134.92 ? 54   THR B CA    1 
ATOM   2148  C  C     . THR B 1 54   ? 15.961  17.219  136.919 1.00 137.53 ? 54   THR B C     1 
ATOM   2149  O  O     . THR B 1 54   ? 15.885  16.041  136.569 1.00 136.20 ? 54   THR B O     1 
ATOM   2150  C  CB    . THR B 1 54   ? 18.093  18.085  137.935 1.00 136.30 ? 54   THR B CB    1 
ATOM   2151  O  OG1   . THR B 1 54   ? 17.373  18.771  138.963 1.00 138.30 ? 54   THR B OG1   1 
ATOM   2152  C  CG2   . THR B 1 54   ? 19.387  18.824  137.655 1.00 135.47 ? 54   THR B CG2   1 
ATOM   2153  N  N     . SER B 1 55   ? 14.955  17.859  137.512 1.00 136.11 ? 55   SER B N     1 
ATOM   2154  C  CA    . SER B 1 55   ? 13.720  17.171  137.879 1.00 134.17 ? 55   SER B CA    1 
ATOM   2155  C  C     . SER B 1 55   ? 12.543  18.143  137.828 1.00 136.54 ? 55   SER B C     1 
ATOM   2156  O  O     . SER B 1 55   ? 12.724  19.338  138.072 1.00 135.66 ? 55   SER B O     1 
ATOM   2157  C  CB    . SER B 1 55   ? 13.855  16.555  139.272 1.00 134.02 ? 55   SER B CB    1 
ATOM   2158  O  OG    . SER B 1 55   ? 12.700  15.821  139.632 1.00 138.14 ? 55   SER B OG    1 
ATOM   2159  N  N     . VAL B 1 56   ? 11.351  17.640  137.492 1.00 140.19 ? 56   VAL B N     1 
ATOM   2160  C  CA    . VAL B 1 56   ? 10.154  18.481  137.348 1.00 142.34 ? 56   VAL B CA    1 
ATOM   2161  C  C     . VAL B 1 56   ? 8.860   17.891  137.940 1.00 153.96 ? 56   VAL B C     1 
ATOM   2162  O  O     . VAL B 1 56   ? 8.494   16.758  137.609 1.00 155.27 ? 56   VAL B O     1 
ATOM   2163  C  CB    . VAL B 1 56   ? 9.855   18.770  135.874 1.00 135.02 ? 56   VAL B CB    1 
ATOM   2164  C  CG1   . VAL B 1 56   ? 8.693   19.719  135.774 1.00 144.03 ? 56   VAL B CG1   1 
ATOM   2165  C  CG2   . VAL B 1 56   ? 11.062  19.355  135.181 1.00 140.24 ? 56   VAL B CG2   1 
ATOM   2166  N  N     . TYR B 1 57   ? 8.163   18.667  138.783 1.00 156.01 ? 57   TYR B N     1 
ATOM   2167  C  CA    . TYR B 1 57   ? 6.883   18.250  139.381 1.00 156.50 ? 57   TYR B CA    1 
ATOM   2168  C  C     . TYR B 1 57   ? 5.668   18.926  138.749 1.00 156.70 ? 57   TYR B C     1 
ATOM   2169  O  O     . TYR B 1 57   ? 5.668   20.139  138.549 1.00 151.89 ? 57   TYR B O     1 
ATOM   2170  C  CB    . TYR B 1 57   ? 6.859   18.541  140.885 1.00 161.66 ? 57   TYR B CB    1 
ATOM   2171  C  CG    . TYR B 1 57   ? 5.544   18.161  141.554 1.00 171.64 ? 57   TYR B CG    1 
ATOM   2172  C  CD1   . TYR B 1 57   ? 5.099   16.839  141.557 1.00 174.41 ? 57   TYR B CD1   1 
ATOM   2173  C  CD2   . TYR B 1 57   ? 4.747   19.116  142.186 1.00 167.70 ? 57   TYR B CD2   1 
ATOM   2174  C  CE1   . TYR B 1 57   ? 3.900   16.480  142.165 1.00 169.03 ? 57   TYR B CE1   1 
ATOM   2175  C  CE2   . TYR B 1 57   ? 3.541   18.755  142.795 1.00 163.46 ? 57   TYR B CE2   1 
ATOM   2176  C  CZ    . TYR B 1 57   ? 3.130   17.434  142.779 1.00 163.54 ? 57   TYR B CZ    1 
ATOM   2177  O  OH    . TYR B 1 57   ? 1.953   17.043  143.367 1.00 163.33 ? 57   TYR B OH    1 
ATOM   2178  N  N     . ILE B 1 58   ? 4.628   18.141  138.455 1.00 159.45 ? 58   ILE B N     1 
ATOM   2179  C  CA    . ILE B 1 58   ? 3.380   18.684  137.905 1.00 166.07 ? 58   ILE B CA    1 
ATOM   2180  C  C     . ILE B 1 58   ? 2.163   18.241  138.674 1.00 167.83 ? 58   ILE B C     1 
ATOM   2181  O  O     . ILE B 1 58   ? 1.968   17.045  138.884 1.00 169.94 ? 58   ILE B O     1 
ATOM   2182  C  CB    . ILE B 1 58   ? 3.112   18.204  136.499 1.00 171.28 ? 58   ILE B CB    1 
ATOM   2183  C  CG1   . ILE B 1 58   ? 4.400   18.167  135.691 1.00 166.46 ? 58   ILE B CG1   1 
ATOM   2184  C  CG2   . ILE B 1 58   ? 2.040   19.082  135.849 1.00 175.93 ? 58   ILE B CG2   1 
ATOM   2185  C  CD1   . ILE B 1 58   ? 4.995   19.508  135.479 1.00 157.76 ? 58   ILE B CD1   1 
ATOM   2186  N  N     . GLU B 1 59   ? 1.314   19.202  139.018 1.00 164.82 ? 59   GLU B N     1 
ATOM   2187  C  CA    . GLU B 1 59   ? 0.295   18.982  140.029 1.00 175.20 ? 59   GLU B CA    1 
ATOM   2188  C  C     . GLU B 1 59   ? -0.587  17.772  139.751 1.00 180.70 ? 59   GLU B C     1 
ATOM   2189  O  O     . GLU B 1 59   ? -0.481  16.737  140.424 1.00 180.87 ? 59   GLU B O     1 
ATOM   2190  C  CB    . GLU B 1 59   ? -0.562  20.232  140.226 1.00 175.54 ? 59   GLU B CB    1 
ATOM   2191  C  CG    . GLU B 1 59   ? -1.302  20.207  141.550 1.00 169.20 ? 59   GLU B CG    1 
ATOM   2192  C  CD    . GLU B 1 59   ? -2.109  21.446  141.790 1.00 160.13 ? 59   GLU B CD    1 
ATOM   2193  O  OE1   . GLU B 1 59   ? -1.579  22.548  141.550 1.00 158.33 ? 59   GLU B OE1   1 
ATOM   2194  O  OE2   . GLU B 1 59   ? -3.273  21.310  142.215 1.00 158.93 ? 59   GLU B OE2   1 
ATOM   2195  N  N     . ASP B 1 60   ? -1.422  17.881  138.728 1.00 179.42 ? 60   ASP B N     1 
ATOM   2196  C  CA    . ASP B 1 60   ? -2.386  16.827  138.472 1.00 181.44 ? 60   ASP B CA    1 
ATOM   2197  C  C     . ASP B 1 60   ? -1.738  15.758  137.615 1.00 177.78 ? 60   ASP B C     1 
ATOM   2198  O  O     . ASP B 1 60   ? -2.404  14.838  137.146 1.00 178.81 ? 60   ASP B O     1 
ATOM   2199  C  CB    . ASP B 1 60   ? -3.703  17.368  137.889 1.00 181.50 ? 60   ASP B CB    1 
ATOM   2200  C  CG    . ASP B 1 60   ? -4.651  17.888  138.977 1.00 174.11 ? 60   ASP B CG    1 
ATOM   2201  O  OD1   . ASP B 1 60   ? -4.450  17.536  140.159 1.00 169.66 ? 60   ASP B OD1   1 
ATOM   2202  O  OD2   . ASP B 1 60   ? -5.594  18.643  138.665 1.00 166.91 ? 60   ASP B OD2   1 
ATOM   2203  N  N     . VAL B 1 61   ? -0.429  15.898  137.410 1.00 174.51 ? 61   VAL B N     1 
ATOM   2204  C  CA    . VAL B 1 61   ? 0.330   14.887  136.689 1.00 176.03 ? 61   VAL B CA    1 
ATOM   2205  C  C     . VAL B 1 61   ? 1.229   14.007  137.530 1.00 176.09 ? 61   VAL B C     1 
ATOM   2206  O  O     . VAL B 1 61   ? 2.209   14.446  138.136 1.00 171.21 ? 61   VAL B O     1 
ATOM   2207  C  CB    . VAL B 1 61   ? 1.180   15.475  135.591 1.00 173.41 ? 61   VAL B CB    1 
ATOM   2208  C  CG1   . VAL B 1 61   ? 1.991   14.372  134.937 1.00 177.77 ? 61   VAL B CG1   1 
ATOM   2209  C  CG2   . VAL B 1 61   ? 0.297   16.160  134.581 1.00 180.40 ? 61   VAL B CG2   1 
ATOM   2210  N  N     . LEU B 1 62   ? 0.885   12.733  137.514 1.00 181.85 ? 62   LEU B N     1 
ATOM   2211  C  CA    . LEU B 1 62   ? 1.651   11.728  138.192 1.00 188.77 ? 62   LEU B CA    1 
ATOM   2212  C  C     . LEU B 1 62   ? 2.393   10.951  137.125 1.00 195.47 ? 62   LEU B C     1 
ATOM   2213  O  O     . LEU B 1 62   ? 1.786   10.489  136.163 1.00 199.59 ? 62   LEU B O     1 
ATOM   2214  C  CB    . LEU B 1 62   ? 0.699   10.792  138.933 1.00 193.83 ? 62   LEU B CB    1 
ATOM   2215  C  CG    . LEU B 1 62   ? -0.655  11.380  139.336 1.00 194.76 ? 62   LEU B CG    1 
ATOM   2216  C  CD1   . LEU B 1 62   ? -1.630  10.262  139.644 1.00 201.06 ? 62   LEU B CD1   1 
ATOM   2217  C  CD2   . LEU B 1 62   ? -0.543  12.331  140.528 1.00 191.89 ? 62   LEU B CD2   1 
ATOM   2218  N  N     . HIS B 1 63   ? 3.712   10.860  137.266 1.00 197.32 ? 63   HIS B N     1 
ATOM   2219  C  CA    . HIS B 1 63   ? 4.478   9.773   136.641 1.00 205.55 ? 63   HIS B CA    1 
ATOM   2220  C  C     . HIS B 1 63   ? 4.724   9.798   135.105 1.00 198.57 ? 63   HIS B C     1 
ATOM   2221  O  O     . HIS B 1 63   ? 5.338   8.869   134.580 1.00 195.02 ? 63   HIS B O     1 
ATOM   2222  C  CB    . HIS B 1 63   ? 3.894   8.407   137.069 1.00 215.85 ? 63   HIS B CB    1 
ATOM   2223  C  CG    . HIS B 1 63   ? 3.842   8.191   138.557 1.00 225.34 ? 63   HIS B CG    1 
ATOM   2224  N  ND1   . HIS B 1 63   ? 3.235   9.076   139.426 1.00 220.89 ? 63   HIS B ND1   1 
ATOM   2225  C  CD2   . HIS B 1 63   ? 4.303   7.175   139.326 1.00 233.05 ? 63   HIS B CD2   1 
ATOM   2226  C  CE1   . HIS B 1 63   ? 3.335   8.621   140.663 1.00 219.57 ? 63   HIS B CE1   1 
ATOM   2227  N  NE2   . HIS B 1 63   ? 3.980   7.468   140.630 1.00 235.44 ? 63   HIS B NE2   1 
ATOM   2228  N  N     . GLU B 1 64   ? 4.217   10.812  134.397 1.00 193.83 ? 64   GLU B N     1 
ATOM   2229  C  CA    . GLU B 1 64   ? 4.312   10.917  132.923 1.00 188.00 ? 64   GLU B CA    1 
ATOM   2230  C  C     . GLU B 1 64   ? 3.403   9.896   132.237 1.00 198.40 ? 64   GLU B C     1 
ATOM   2231  O  O     . GLU B 1 64   ? 3.132   9.988   131.039 1.00 193.44 ? 64   GLU B O     1 
ATOM   2232  C  CB    . GLU B 1 64   ? 5.762   10.791  132.425 1.00 183.13 ? 64   GLU B CB    1 
ATOM   2233  C  CG    . GLU B 1 64   ? 6.060   11.335  131.016 1.00 183.12 ? 64   GLU B CG    1 
ATOM   2234  C  CD    . GLU B 1 64   ? 5.580   10.445  129.875 1.00 183.44 ? 64   GLU B CD    1 
ATOM   2235  O  OE1   . GLU B 1 64   ? 6.052   9.296   129.746 1.00 180.77 ? 64   GLU B OE1   1 
ATOM   2236  O  OE2   . GLU B 1 64   ? 4.719   10.906  129.098 1.00 179.50 ? 64   GLU B OE2   1 
ATOM   2237  N  N     . PHE B 1 65   ? 2.874   8.964   133.026 1.00 208.59 ? 65   PHE B N     1 
ATOM   2238  C  CA    . PHE B 1 65   ? 1.997   7.902   132.527 1.00 216.39 ? 65   PHE B CA    1 
ATOM   2239  C  C     . PHE B 1 65   ? 0.720   8.425   131.813 1.00 221.43 ? 65   PHE B C     1 
ATOM   2240  O  O     . PHE B 1 65   ? 0.002   7.640   131.196 1.00 229.26 ? 65   PHE B O     1 
ATOM   2241  C  CB    . PHE B 1 65   ? 1.626   6.915   133.657 1.00 210.81 ? 65   PHE B CB    1 
ATOM   2242  C  CG    . PHE B 1 65   ? 2.617   5.777   133.853 1.00 209.20 ? 65   PHE B CG    1 
ATOM   2243  C  CD1   . PHE B 1 65   ? 3.514   5.404   132.850 1.00 204.95 ? 65   PHE B CD1   1 
ATOM   2244  C  CD2   . PHE B 1 65   ? 2.630   5.069   135.048 1.00 202.82 ? 65   PHE B CD2   1 
ATOM   2245  C  CE1   . PHE B 1 65   ? 4.402   4.359   133.053 1.00 196.14 ? 65   PHE B CE1   1 
ATOM   2246  C  CE2   . PHE B 1 65   ? 3.514   4.030   135.247 1.00 200.16 ? 65   PHE B CE2   1 
ATOM   2247  C  CZ    . PHE B 1 65   ? 4.397   3.679   134.249 1.00 197.93 ? 65   PHE B CZ    1 
ATOM   2248  N  N     . SER B 1 66   ? 0.426   9.726   131.904 1.00 213.54 ? 66   SER B N     1 
ATOM   2249  C  CA    . SER B 1 66   ? -0.743  10.298  131.211 1.00 204.01 ? 66   SER B CA    1 
ATOM   2250  C  C     . SER B 1 66   ? -0.404  11.446  130.249 1.00 192.89 ? 66   SER B C     1 
ATOM   2251  O  O     . SER B 1 66   ? 0.762   11.728  129.989 1.00 181.65 ? 66   SER B O     1 
ATOM   2252  C  CB    . SER B 1 66   ? -1.827  10.749  132.204 1.00 200.59 ? 66   SER B CB    1 
ATOM   2253  O  OG    . SER B 1 66   ? -3.050  10.991  131.521 1.00 192.17 ? 66   SER B OG    1 
ATOM   2254  N  N     . THR B 1 67   ? -1.446  12.058  129.691 1.00 192.57 ? 67   THR B N     1 
ATOM   2255  C  CA    . THR B 1 67   ? -1.332  13.280  128.903 1.00 181.46 ? 67   THR B CA    1 
ATOM   2256  C  C     . THR B 1 67   ? -2.196  14.317  129.606 1.00 183.06 ? 67   THR B C     1 
ATOM   2257  O  O     . THR B 1 67   ? -3.037  13.965  130.435 1.00 181.84 ? 67   THR B O     1 
ATOM   2258  C  CB    . THR B 1 67   ? -1.799  13.090  127.446 1.00 170.34 ? 67   THR B CB    1 
ATOM   2259  O  OG1   . THR B 1 67   ? -1.660  14.324  126.741 1.00 163.45 ? 67   THR B OG1   1 
ATOM   2260  C  CG2   . THR B 1 67   ? -3.259  12.659  127.390 1.00 167.61 ? 67   THR B CG2   1 
ATOM   2261  N  N     . ILE B 1 68   ? -1.980  15.591  129.304 1.00 180.50 ? 68   ILE B N     1 
ATOM   2262  C  CA    . ILE B 1 68   ? -2.704  16.652  129.997 1.00 180.32 ? 68   ILE B CA    1 
ATOM   2263  C  C     . ILE B 1 68   ? -4.023  17.028  129.329 1.00 187.18 ? 68   ILE B C     1 
ATOM   2264  O  O     . ILE B 1 68   ? -4.066  17.252  128.113 1.00 187.16 ? 68   ILE B O     1 
ATOM   2265  C  CB    . ILE B 1 68   ? -1.870  17.931  130.100 1.00 176.37 ? 68   ILE B CB    1 
ATOM   2266  C  CG1   . ILE B 1 68   ? -0.548  17.646  130.797 1.00 173.62 ? 68   ILE B CG1   1 
ATOM   2267  C  CG2   . ILE B 1 68   ? -2.641  19.015  130.849 1.00 179.57 ? 68   ILE B CG2   1 
ATOM   2268  C  CD1   . ILE B 1 68   ? 0.228   18.897  131.130 1.00 167.88 ? 68   ILE B CD1   1 
ATOM   2269  N  N     . PRO B 1 69   ? -5.110  17.073  130.122 1.00 187.41 ? 69   PRO B N     1 
ATOM   2270  C  CA    . PRO B 1 69   ? -6.366  17.716  129.719 1.00 184.34 ? 69   PRO B CA    1 
ATOM   2271  C  C     . PRO B 1 69   ? -6.233  19.241  129.676 1.00 182.08 ? 69   PRO B C     1 
ATOM   2272  O  O     . PRO B 1 69   ? -5.754  19.852  130.637 1.00 175.71 ? 69   PRO B O     1 
ATOM   2273  C  CB    . PRO B 1 69   ? -7.340  17.310  130.831 1.00 178.24 ? 69   PRO B CB    1 
ATOM   2274  C  CG    . PRO B 1 69   ? -6.740  16.105  131.452 1.00 176.25 ? 69   PRO B CG    1 
ATOM   2275  C  CD    . PRO B 1 69   ? -5.261  16.325  131.380 1.00 183.44 ? 69   PRO B CD    1 
ATOM   2276  N  N     . GLY B 1 70   ? -6.688  19.845  128.582 1.00 182.53 ? 70   GLY B N     1 
ATOM   2277  C  CA    . GLY B 1 70   ? -6.643  21.287  128.431 1.00 184.85 ? 70   GLY B CA    1 
ATOM   2278  C  C     . GLY B 1 70   ? -5.352  21.806  127.821 1.00 184.93 ? 70   GLY B C     1 
ATOM   2279  O  O     . GLY B 1 70   ? -5.305  22.911  127.279 1.00 183.66 ? 70   GLY B O     1 
ATOM   2280  N  N     . VAL B 1 71   ? -4.294  21.010  127.909 1.00 185.26 ? 71   VAL B N     1 
ATOM   2281  C  CA    . VAL B 1 71   ? -3.022  21.397  127.315 1.00 180.30 ? 71   VAL B CA    1 
ATOM   2282  C  C     . VAL B 1 71   ? -2.637  20.440  126.194 1.00 175.50 ? 71   VAL B C     1 
ATOM   2283  O  O     . VAL B 1 71   ? -2.579  19.222  126.390 1.00 172.88 ? 71   VAL B O     1 
ATOM   2284  C  CB    . VAL B 1 71   ? -1.909  21.467  128.362 1.00 178.67 ? 71   VAL B CB    1 
ATOM   2285  C  CG1   . VAL B 1 71   ? -0.596  21.857  127.709 1.00 174.06 ? 71   VAL B CG1   1 
ATOM   2286  C  CG2   . VAL B 1 71   ? -2.287  22.454  129.463 1.00 178.78 ? 71   VAL B CG2   1 
ATOM   2287  N  N     . LYS B 1 72   ? -2.367  21.009  125.024 1.00 172.80 ? 72   LYS B N     1 
ATOM   2288  C  CA    . LYS B 1 72   ? -2.199  20.227  123.806 1.00 173.37 ? 72   LYS B CA    1 
ATOM   2289  C  C     . LYS B 1 72   ? -1.053  19.221  123.893 1.00 169.11 ? 72   LYS B C     1 
ATOM   2290  O  O     . LYS B 1 72   ? -1.280  18.014  123.797 1.00 166.91 ? 72   LYS B O     1 
ATOM   2291  C  CB    . LYS B 1 72   ? -1.996  21.165  122.606 1.00 173.72 ? 72   LYS B CB    1 
ATOM   2292  C  CG    . LYS B 1 72   ? -1.929  20.471  121.248 1.00 173.19 ? 72   LYS B CG    1 
ATOM   2293  C  CD    . LYS B 1 72   ? -1.551  21.437  120.120 1.00 174.12 ? 72   LYS B CD    1 
ATOM   2294  C  CE    . LYS B 1 72   ? -1.308  20.685  118.811 1.00 176.01 ? 72   LYS B CE    1 
ATOM   2295  N  NZ    . LYS B 1 72   ? -0.819  21.562  117.711 1.00 173.23 ? 72   LYS B NZ    1 
ATOM   2296  N  N     . GLU B 1 73   ? 0.165   19.707  124.111 1.00 164.77 ? 73   GLU B N     1 
ATOM   2297  C  CA    . GLU B 1 73   ? 1.337   18.836  124.040 1.00 159.08 ? 73   GLU B CA    1 
ATOM   2298  C  C     . GLU B 1 73   ? 1.483   17.936  125.250 1.00 158.50 ? 73   GLU B C     1 
ATOM   2299  O  O     . GLU B 1 73   ? 1.307   18.367  126.385 1.00 163.45 ? 73   GLU B O     1 
ATOM   2300  C  CB    . GLU B 1 73   ? 2.623   19.631  123.826 1.00 155.57 ? 73   GLU B CB    1 
ATOM   2301  C  CG    . GLU B 1 73   ? 2.841   20.736  124.817 1.00 157.06 ? 73   GLU B CG    1 
ATOM   2302  C  CD    . GLU B 1 73   ? 2.167   22.012  124.400 1.00 166.13 ? 73   GLU B CD    1 
ATOM   2303  O  OE1   . GLU B 1 73   ? 1.031   22.240  124.864 1.00 170.94 ? 73   GLU B OE1   1 
ATOM   2304  O  OE2   . GLU B 1 73   ? 2.768   22.776  123.610 1.00 162.65 ? 73   GLU B OE2   1 
ATOM   2305  N  N     . ASP B 1 74   ? 1.829   16.683  124.987 1.00 157.49 ? 74   ASP B N     1 
ATOM   2306  C  CA    . ASP B 1 74   ? 1.943   15.669  126.027 1.00 160.52 ? 74   ASP B CA    1 
ATOM   2307  C  C     . ASP B 1 74   ? 3.104   15.932  126.983 1.00 158.32 ? 74   ASP B C     1 
ATOM   2308  O  O     . ASP B 1 74   ? 3.997   16.726  126.680 1.00 155.59 ? 74   ASP B O     1 
ATOM   2309  C  CB    . ASP B 1 74   ? 2.039   14.264  125.419 1.00 162.99 ? 74   ASP B CB    1 
ATOM   2310  C  CG    . ASP B 1 74   ? 3.245   14.091  124.515 1.00 160.02 ? 74   ASP B CG    1 
ATOM   2311  O  OD1   . ASP B 1 74   ? 4.329   13.734  125.028 1.00 156.32 ? 74   ASP B OD1   1 
ATOM   2312  O  OD2   . ASP B 1 74   ? 3.103   14.297  123.289 1.00 166.24 ? 74   ASP B OD2   1 
ATOM   2313  N  N     . VAL B 1 75   ? 3.063   15.255  128.132 1.00 158.03 ? 75   VAL B N     1 
ATOM   2314  C  CA    . VAL B 1 75   ? 4.021   15.424  129.220 1.00 151.72 ? 75   VAL B CA    1 
ATOM   2315  C  C     . VAL B 1 75   ? 5.456   15.475  128.728 1.00 149.77 ? 75   VAL B C     1 
ATOM   2316  O  O     . VAL B 1 75   ? 6.248   16.310  129.162 1.00 144.56 ? 75   VAL B O     1 
ATOM   2317  C  CB    . VAL B 1 75   ? 3.940   14.235  130.176 1.00 153.42 ? 75   VAL B CB    1 
ATOM   2318  C  CG1   . VAL B 1 75   ? 4.819   14.473  131.370 1.00 155.47 ? 75   VAL B CG1   1 
ATOM   2319  C  CG2   . VAL B 1 75   ? 2.517   14.020  130.606 1.00 161.21 ? 75   VAL B CG2   1 
ATOM   2320  N  N     . VAL B 1 76   ? 5.777   14.585  127.802 1.00 147.96 ? 76   VAL B N     1 
ATOM   2321  C  CA    . VAL B 1 76   ? 7.124   14.499  127.277 1.00 144.05 ? 76   VAL B CA    1 
ATOM   2322  C  C     . VAL B 1 76   ? 7.515   15.700  126.418 1.00 140.25 ? 76   VAL B C     1 
ATOM   2323  O  O     . VAL B 1 76   ? 8.609   16.237  126.574 1.00 137.58 ? 76   VAL B O     1 
ATOM   2324  C  CB    . VAL B 1 76   ? 7.316   13.207  126.500 1.00 146.64 ? 76   VAL B CB    1 
ATOM   2325  C  CG1   . VAL B 1 76   ? 8.567   13.283  125.638 1.00 141.99 ? 76   VAL B CG1   1 
ATOM   2326  C  CG2   . VAL B 1 76   ? 7.384   12.039  127.476 1.00 152.28 ? 76   VAL B CG2   1 
ATOM   2327  N  N     . GLU B 1 77   ? 6.626   16.134  125.528 1.00 142.82 ? 77   GLU B N     1 
ATOM   2328  C  CA    . GLU B 1 77   ? 6.931   17.270  124.656 1.00 142.16 ? 77   GLU B CA    1 
ATOM   2329  C  C     . GLU B 1 77   ? 7.223   18.504  125.502 1.00 136.99 ? 77   GLU B C     1 
ATOM   2330  O  O     . GLU B 1 77   ? 7.897   19.434  125.066 1.00 137.26 ? 77   GLU B O     1 
ATOM   2331  C  CB    . GLU B 1 77   ? 5.795   17.534  123.650 1.00 146.76 ? 77   GLU B CB    1 
ATOM   2332  C  CG    . GLU B 1 77   ? 6.001   18.737  122.701 1.00 145.75 ? 77   GLU B CG    1 
ATOM   2333  C  CD    . GLU B 1 77   ? 7.057   18.516  121.618 1.00 142.99 ? 77   GLU B CD    1 
ATOM   2334  O  OE1   . GLU B 1 77   ? 7.629   19.520  121.136 1.00 134.97 ? 77   GLU B OE1   1 
ATOM   2335  O  OE2   . GLU B 1 77   ? 7.302   17.351  121.236 1.00 146.13 ? 77   GLU B OE2   1 
ATOM   2336  N  N     . ILE B 1 78   ? 6.727   18.504  126.728 1.00 135.15 ? 78   ILE B N     1 
ATOM   2337  C  CA    . ILE B 1 78   ? 7.020   19.606  127.616 1.00 136.27 ? 78   ILE B CA    1 
ATOM   2338  C  C     . ILE B 1 78   ? 8.430   19.456  128.183 1.00 134.22 ? 78   ILE B C     1 
ATOM   2339  O  O     . ILE B 1 78   ? 9.237   20.389  128.117 1.00 130.67 ? 78   ILE B O     1 
ATOM   2340  C  CB    . ILE B 1 78   ? 5.959   19.732  128.724 1.00 134.71 ? 78   ILE B CB    1 
ATOM   2341  C  CG1   . ILE B 1 78   ? 4.575   19.392  128.164 1.00 140.16 ? 78   ILE B CG1   1 
ATOM   2342  C  CG2   . ILE B 1 78   ? 5.980   21.130  129.323 1.00 132.34 ? 78   ILE B CG2   1 
ATOM   2343  C  CD1   . ILE B 1 78   ? 3.458   20.298  128.633 1.00 137.55 ? 78   ILE B CD1   1 
ATOM   2344  N  N     . ILE B 1 79   ? 8.744   18.266  128.686 1.00 135.18 ? 79   ILE B N     1 
ATOM   2345  C  CA    . ILE B 1 79   ? 10.061  18.034  129.269 1.00 134.52 ? 79   ILE B CA    1 
ATOM   2346  C  C     . ILE B 1 79   ? 11.175  18.199  128.230 1.00 135.19 ? 79   ILE B C     1 
ATOM   2347  O  O     . ILE B 1 79   ? 12.301  18.551  128.573 1.00 135.97 ? 79   ILE B O     1 
ATOM   2348  C  CB    . ILE B 1 79   ? 10.154  16.681  130.049 1.00 134.17 ? 79   ILE B CB    1 
ATOM   2349  C  CG1   . ILE B 1 79   ? 10.295  15.472  129.122 1.00 145.25 ? 79   ILE B CG1   1 
ATOM   2350  C  CG2   . ILE B 1 79   ? 8.937   16.491  130.909 1.00 133.92 ? 79   ILE B CG2   1 
ATOM   2351  C  CD1   . ILE B 1 79   ? 10.120  14.113  129.841 1.00 140.28 ? 79   ILE B CD1   1 
ATOM   2352  N  N     . LEU B 1 80   ? 10.857  17.979  126.957 1.00 135.71 ? 80   LEU B N     1 
ATOM   2353  C  CA    . LEU B 1 80   ? 11.832  18.214  125.893 1.00 135.36 ? 80   LEU B CA    1 
ATOM   2354  C  C     . LEU B 1 80   ? 12.268  19.687  125.856 1.00 133.68 ? 80   LEU B C     1 
ATOM   2355  O  O     . LEU B 1 80   ? 13.445  19.996  126.043 1.00 132.22 ? 80   LEU B O     1 
ATOM   2356  C  CB    . LEU B 1 80   ? 11.270  17.769  124.539 1.00 133.66 ? 80   LEU B CB    1 
ATOM   2357  C  CG    . LEU B 1 80   ? 11.635  16.357  124.074 1.00 130.29 ? 80   LEU B CG    1 
ATOM   2358  C  CD1   . LEU B 1 80   ? 11.446  15.359  125.202 1.00 128.94 ? 80   LEU B CD1   1 
ATOM   2359  C  CD2   . LEU B 1 80   ? 10.818  15.960  122.847 1.00 127.36 ? 80   LEU B CD2   1 
ATOM   2360  N  N     . ASN B 1 81   ? 11.306  20.587  125.662 1.00 134.07 ? 81   ASN B N     1 
ATOM   2361  C  CA    . ASN B 1 81   ? 11.569  22.022  125.628 1.00 133.77 ? 81   ASN B CA    1 
ATOM   2362  C  C     . ASN B 1 81   ? 12.270  22.479  126.884 1.00 134.67 ? 81   ASN B C     1 
ATOM   2363  O  O     . ASN B 1 81   ? 13.050  23.435  126.887 1.00 136.67 ? 81   ASN B O     1 
ATOM   2364  C  CB    . ASN B 1 81   ? 10.264  22.786  125.473 1.00 130.77 ? 81   ASN B CB    1 
ATOM   2365  C  CG    . ASN B 1 81   ? 9.500   22.359  124.258 1.00 133.24 ? 81   ASN B CG    1 
ATOM   2366  O  OD1   . ASN B 1 81   ? 9.839   22.733  123.138 1.00 137.04 ? 81   ASN B OD1   1 
ATOM   2367  N  ND2   . ASN B 1 81   ? 8.469   21.558  124.463 1.00 133.60 ? 81   ASN B ND2   1 
ATOM   2368  N  N     . LEU B 1 82   ? 11.974  21.779  127.962 1.00 130.51 ? 82   LEU B N     1 
ATOM   2369  C  CA    . LEU B 1 82   ? 12.642  22.020  129.214 1.00 131.83 ? 82   LEU B CA    1 
ATOM   2370  C  C     . LEU B 1 82   ? 14.143  21.850  129.091 1.00 129.83 ? 82   LEU B C     1 
ATOM   2371  O  O     . LEU B 1 82   ? 14.913  22.698  129.532 1.00 131.66 ? 82   LEU B O     1 
ATOM   2372  C  CB    . LEU B 1 82   ? 12.101  21.057  130.246 1.00 132.65 ? 82   LEU B CB    1 
ATOM   2373  C  CG    . LEU B 1 82   ? 11.128  21.733  131.182 1.00 128.01 ? 82   LEU B CG    1 
ATOM   2374  C  CD1   . LEU B 1 82   ? 10.216  20.692  131.763 1.00 130.87 ? 82   LEU B CD1   1 
ATOM   2375  C  CD2   . LEU B 1 82   ? 11.934  22.428  132.258 1.00 129.37 ? 82   LEU B CD2   1 
ATOM   2376  N  N     . LYS B 1 83   ? 14.557  20.755  128.478 1.00 124.65 ? 83   LYS B N     1 
ATOM   2377  C  CA    . LYS B 1 83   ? 15.965  20.465  128.375 1.00 129.23 ? 83   LYS B CA    1 
ATOM   2378  C  C     . LYS B 1 83   ? 16.641  21.633  127.674 1.00 135.48 ? 83   LYS B C     1 
ATOM   2379  O  O     . LYS B 1 83   ? 17.809  21.926  127.924 1.00 140.93 ? 83   LYS B O     1 
ATOM   2380  C  CB    . LYS B 1 83   ? 16.175  19.176  127.583 1.00 135.08 ? 83   LYS B CB    1 
ATOM   2381  C  CG    . LYS B 1 83   ? 15.722  17.891  128.283 1.00 131.29 ? 83   LYS B CG    1 
ATOM   2382  C  CD    . LYS B 1 83   ? 15.689  16.711  127.305 1.00 125.81 ? 83   LYS B CD    1 
ATOM   2383  C  CE    . LYS B 1 83   ? 15.287  15.421  127.995 1.00 125.53 ? 83   LYS B CE    1 
ATOM   2384  N  NZ    . LYS B 1 83   ? 14.890  14.393  126.998 1.00 123.25 ? 83   LYS B NZ    1 
ATOM   2385  N  N     . GLU B 1 84   ? 15.877  22.310  126.816 1.00 137.35 ? 84   GLU B N     1 
ATOM   2386  C  CA    . GLU B 1 84   ? 16.373  23.425  126.000 1.00 143.86 ? 84   GLU B CA    1 
ATOM   2387  C  C     . GLU B 1 84   ? 16.355  24.769  126.735 1.00 141.55 ? 84   GLU B C     1 
ATOM   2388  O  O     . GLU B 1 84   ? 16.803  25.787  126.196 1.00 140.83 ? 84   GLU B O     1 
ATOM   2389  C  CB    . GLU B 1 84   ? 15.567  23.543  124.695 1.00 146.61 ? 84   GLU B CB    1 
ATOM   2390  C  CG    . GLU B 1 84   ? 15.966  22.568  123.580 1.00 142.41 ? 84   GLU B CG    1 
ATOM   2391  C  CD    . GLU B 1 84   ? 14.876  22.403  122.522 1.00 140.35 ? 84   GLU B CD    1 
ATOM   2392  O  OE1   . GLU B 1 84   ? 13.876  23.158  122.552 1.00 141.16 ? 84   GLU B OE1   1 
ATOM   2393  O  OE2   . GLU B 1 84   ? 15.016  21.504  121.663 1.00 141.26 ? 84   GLU B OE2   1 
ATOM   2394  N  N     . LEU B 1 85   ? 15.839  24.776  127.959 1.00 138.50 ? 85   LEU B N     1 
ATOM   2395  C  CA    . LEU B 1 85   ? 15.900  25.981  128.778 1.00 140.95 ? 85   LEU B CA    1 
ATOM   2396  C  C     . LEU B 1 85   ? 17.312  26.262  129.305 1.00 140.68 ? 85   LEU B C     1 
ATOM   2397  O  O     . LEU B 1 85   ? 17.924  25.434  129.999 1.00 136.28 ? 85   LEU B O     1 
ATOM   2398  C  CB    . LEU B 1 85   ? 14.922  25.903  129.946 1.00 141.60 ? 85   LEU B CB    1 
ATOM   2399  C  CG    . LEU B 1 85   ? 15.000  27.086  130.920 1.00 142.06 ? 85   LEU B CG    1 
ATOM   2400  C  CD1   . LEU B 1 85   ? 14.614  28.400  130.239 1.00 144.05 ? 85   LEU B CD1   1 
ATOM   2401  C  CD2   . LEU B 1 85   ? 14.150  26.844  132.163 1.00 136.65 ? 85   LEU B CD2   1 
ATOM   2402  N  N     . VAL B 1 86   ? 17.801  27.457  128.996 1.00 135.89 ? 86   VAL B N     1 
ATOM   2403  C  CA    . VAL B 1 86   ? 19.171  27.833  129.268 1.00 131.91 ? 86   VAL B CA    1 
ATOM   2404  C  C     . VAL B 1 86   ? 19.199  28.838  130.398 1.00 136.23 ? 86   VAL B C     1 
ATOM   2405  O  O     . VAL B 1 86   ? 18.861  29.994  130.188 1.00 143.19 ? 86   VAL B O     1 
ATOM   2406  C  CB    . VAL B 1 86   ? 19.743  28.543  128.044 1.00 139.34 ? 86   VAL B CB    1 
ATOM   2407  C  CG1   . VAL B 1 86   ? 21.209  28.882  128.250 1.00 144.61 ? 86   VAL B CG1   1 
ATOM   2408  C  CG2   . VAL B 1 86   ? 19.531  27.697  126.784 1.00 142.48 ? 86   VAL B CG2   1 
ATOM   2409  N  N     . VAL B 1 87   ? 19.650  28.418  131.579 1.00 141.52 ? 87   VAL B N     1 
ATOM   2410  C  CA    . VAL B 1 87   ? 19.620  29.258  132.792 1.00 143.71 ? 87   VAL B CA    1 
ATOM   2411  C  C     . VAL B 1 87   ? 21.005  29.631  133.323 1.00 147.31 ? 87   VAL B C     1 
ATOM   2412  O  O     . VAL B 1 87   ? 21.862  28.763  133.467 1.00 150.96 ? 87   VAL B O     1 
ATOM   2413  C  CB    . VAL B 1 87   ? 18.901  28.535  133.942 1.00 140.98 ? 87   VAL B CB    1 
ATOM   2414  C  CG1   . VAL B 1 87   ? 18.891  29.407  135.185 1.00 147.93 ? 87   VAL B CG1   1 
ATOM   2415  C  CG2   . VAL B 1 87   ? 17.496  28.154  133.539 1.00 144.78 ? 87   VAL B CG2   1 
ATOM   2416  N  N     . ARG B 1 88   ? 21.205  30.907  133.652 1.00 148.25 ? 88   ARG B N     1 
ATOM   2417  C  CA    . ARG B 1 88   ? 22.521  31.419  134.051 1.00 151.92 ? 88   ARG B CA    1 
ATOM   2418  C  C     . ARG B 1 88   ? 22.548  31.833  135.533 1.00 159.43 ? 88   ARG B C     1 
ATOM   2419  O  O     . ARG B 1 88   ? 21.721  32.634  135.976 1.00 164.68 ? 88   ARG B O     1 
ATOM   2420  C  CB    . ARG B 1 88   ? 22.879  32.593  133.129 1.00 150.73 ? 88   ARG B CB    1 
ATOM   2421  C  CG    . ARG B 1 88   ? 24.236  33.254  133.298 1.00 148.89 ? 88   ARG B CG    1 
ATOM   2422  C  CD    . ARG B 1 88   ? 24.395  34.285  132.177 1.00 153.35 ? 88   ARG B CD    1 
ATOM   2423  N  NE    . ARG B 1 88   ? 25.550  35.175  132.303 1.00 155.84 ? 88   ARG B NE    1 
ATOM   2424  C  CZ    . ARG B 1 88   ? 26.015  35.930  131.306 1.00 158.94 ? 88   ARG B CZ    1 
ATOM   2425  N  NH1   . ARG B 1 88   ? 25.426  35.890  130.117 1.00 155.02 ? 88   ARG B NH1   1 
ATOM   2426  N  NH2   . ARG B 1 88   ? 27.071  36.718  131.489 1.00 160.56 ? 88   ARG B NH2   1 
ATOM   2427  N  N     . PHE B 1 89   ? 23.482  31.267  136.300 1.00 158.47 ? 89   PHE B N     1 
ATOM   2428  C  CA    . PHE B 1 89   ? 23.642  31.608  137.719 1.00 161.76 ? 89   PHE B CA    1 
ATOM   2429  C  C     . PHE B 1 89   ? 24.596  32.793  137.872 1.00 169.60 ? 89   PHE B C     1 
ATOM   2430  O  O     . PHE B 1 89   ? 25.760  32.702  137.483 1.00 169.27 ? 89   PHE B O     1 
ATOM   2431  C  CB    . PHE B 1 89   ? 24.229  30.433  138.520 1.00 159.68 ? 89   PHE B CB    1 
ATOM   2432  C  CG    . PHE B 1 89   ? 23.266  29.298  138.783 1.00 153.70 ? 89   PHE B CG    1 
ATOM   2433  C  CD1   . PHE B 1 89   ? 21.949  29.359  138.375 1.00 152.63 ? 89   PHE B CD1   1 
ATOM   2434  C  CD2   . PHE B 1 89   ? 23.697  28.162  139.461 1.00 151.85 ? 89   PHE B CD2   1 
ATOM   2435  C  CE1   . PHE B 1 89   ? 21.084  28.300  138.628 1.00 150.13 ? 89   PHE B CE1   1 
ATOM   2436  C  CE2   . PHE B 1 89   ? 22.838  27.108  139.715 1.00 145.83 ? 89   PHE B CE2   1 
ATOM   2437  C  CZ    . PHE B 1 89   ? 21.535  27.176  139.300 1.00 144.04 ? 89   PHE B CZ    1 
ATOM   2438  N  N     . LEU B 1 90   ? 24.116  33.893  138.449 1.00 174.40 ? 90   LEU B N     1 
ATOM   2439  C  CA    . LEU B 1 90   ? 24.967  35.058  138.700 1.00 173.39 ? 90   LEU B CA    1 
ATOM   2440  C  C     . LEU B 1 90   ? 25.647  34.948  140.067 1.00 171.56 ? 90   LEU B C     1 
ATOM   2441  O  O     . LEU B 1 90   ? 26.567  35.704  140.391 1.00 165.49 ? 90   LEU B O     1 
ATOM   2442  C  CB    . LEU B 1 90   ? 24.142  36.342  138.611 1.00 176.34 ? 90   LEU B CB    1 
ATOM   2443  C  CG    . LEU B 1 90   ? 23.435  36.608  137.280 1.00 173.94 ? 90   LEU B CG    1 
ATOM   2444  C  CD1   . LEU B 1 90   ? 22.380  37.701  137.440 1.00 175.37 ? 90   LEU B CD1   1 
ATOM   2445  C  CD2   . LEU B 1 90   ? 24.450  36.978  136.199 1.00 166.14 ? 90   LEU B CD2   1 
ATOM   2446  N  N     . ASN B 1 91   ? 25.184  33.980  140.852 1.00 174.75 ? 91   ASN B N     1 
ATOM   2447  C  CA    . ASN B 1 91   ? 25.692  33.731  142.191 1.00 173.70 ? 91   ASN B CA    1 
ATOM   2448  C  C     . ASN B 1 91   ? 26.658  32.552  142.154 1.00 169.57 ? 91   ASN B C     1 
ATOM   2449  O  O     . ASN B 1 91   ? 26.237  31.403  142.003 1.00 164.78 ? 91   ASN B O     1 
ATOM   2450  C  CB    . ASN B 1 91   ? 24.522  33.423  143.136 1.00 177.43 ? 91   ASN B CB    1 
ATOM   2451  C  CG    . ASN B 1 91   ? 24.787  33.851  144.574 1.00 179.48 ? 91   ASN B CG    1 
ATOM   2452  O  OD1   . ASN B 1 91   ? 25.923  33.813  145.048 1.00 179.67 ? 91   ASN B OD1   1 
ATOM   2453  N  ND2   . ASN B 1 91   ? 23.726  34.256  145.279 1.00 180.88 ? 91   ASN B ND2   1 
ATOM   2454  N  N     . PRO B 1 92   ? 27.962  32.837  142.302 1.00 167.79 ? 92   PRO B N     1 
ATOM   2455  C  CA    . PRO B 1 92   ? 29.043  31.842  142.305 1.00 165.47 ? 92   PRO B CA    1 
ATOM   2456  C  C     . PRO B 1 92   ? 28.822  30.729  143.331 1.00 167.42 ? 92   PRO B C     1 
ATOM   2457  O  O     . PRO B 1 92   ? 29.387  29.641  143.221 1.00 162.35 ? 92   PRO B O     1 
ATOM   2458  C  CB    . PRO B 1 92   ? 30.283  32.669  142.687 1.00 160.53 ? 92   PRO B CB    1 
ATOM   2459  C  CG    . PRO B 1 92   ? 29.767  33.994  143.156 1.00 163.37 ? 92   PRO B CG    1 
ATOM   2460  C  CD    . PRO B 1 92   ? 28.484  34.206  142.432 1.00 165.04 ? 92   PRO B CD    1 
ATOM   2461  N  N     . SER B 1 93   ? 27.998  31.019  144.329 1.00 173.21 ? 93   SER B N     1 
ATOM   2462  C  CA    . SER B 1 93   ? 27.741  30.094  145.415 1.00 171.65 ? 93   SER B CA    1 
ATOM   2463  C  C     . SER B 1 93   ? 26.555  29.197  145.115 1.00 168.07 ? 93   SER B C     1 
ATOM   2464  O  O     . SER B 1 93   ? 26.329  28.206  145.805 1.00 169.40 ? 93   SER B O     1 
ATOM   2465  C  CB    . SER B 1 93   ? 27.456  30.878  146.698 1.00 173.49 ? 93   SER B CB    1 
ATOM   2466  O  OG    . SER B 1 93   ? 28.402  31.913  146.913 1.00 172.12 ? 93   SER B OG    1 
ATOM   2467  N  N     . LEU B 1 94   ? 25.807  29.529  144.072 1.00 164.84 ? 94   LEU B N     1 
ATOM   2468  C  CA    . LEU B 1 94   ? 24.515  28.905  143.878 1.00 161.99 ? 94   LEU B CA    1 
ATOM   2469  C  C     . LEU B 1 94   ? 24.705  27.504  143.318 1.00 162.05 ? 94   LEU B C     1 
ATOM   2470  O  O     . LEU B 1 94   ? 25.195  27.350  142.205 1.00 161.28 ? 94   LEU B O     1 
ATOM   2471  C  CB    . LEU B 1 94   ? 23.727  29.746  142.880 1.00 159.49 ? 94   LEU B CB    1 
ATOM   2472  C  CG    . LEU B 1 94   ? 22.328  30.110  143.345 1.00 158.62 ? 94   LEU B CG    1 
ATOM   2473  C  CD1   . LEU B 1 94   ? 21.526  30.882  142.307 1.00 157.64 ? 94   LEU B CD1   1 
ATOM   2474  C  CD2   . LEU B 1 94   ? 21.642  28.836  143.714 1.00 153.44 ? 94   LEU B CD2   1 
ATOM   2475  N  N     . GLN B 1 95   ? 24.326  26.477  144.075 1.00 159.17 ? 95   GLN B N     1 
ATOM   2476  C  CA    . GLN B 1 95   ? 24.515  25.118  143.574 1.00 157.53 ? 95   GLN B CA    1 
ATOM   2477  C  C     . GLN B 1 95   ? 23.247  24.508  143.003 1.00 147.54 ? 95   GLN B C     1 
ATOM   2478  O  O     . GLN B 1 95   ? 23.305  23.465  142.351 1.00 142.99 ? 95   GLN B O     1 
ATOM   2479  C  CB    . GLN B 1 95   ? 25.095  24.203  144.660 1.00 165.52 ? 95   GLN B CB    1 
ATOM   2480  C  CG    . GLN B 1 95   ? 26.433  24.666  145.248 1.00 169.38 ? 95   GLN B CG    1 
ATOM   2481  C  CD    . GLN B 1 95   ? 27.609  24.498  144.294 1.00 169.77 ? 95   GLN B CD    1 
ATOM   2482  O  OE1   . GLN B 1 95   ? 27.588  23.653  143.388 1.00 165.67 ? 95   GLN B OE1   1 
ATOM   2483  N  NE2   . GLN B 1 95   ? 28.650  25.304  144.502 1.00 166.57 ? 95   GLN B NE2   1 
ATOM   2484  N  N     . THR B 1 96   ? 22.124  25.198  143.189 1.00 146.42 ? 96   THR B N     1 
ATOM   2485  C  CA    . THR B 1 96   ? 20.813  24.676  142.800 1.00 146.42 ? 96   THR B CA    1 
ATOM   2486  C  C     . THR B 1 96   ? 19.713  25.684  143.077 1.00 148.89 ? 96   THR B C     1 
ATOM   2487  O  O     . THR B 1 96   ? 19.861  26.555  143.924 1.00 153.15 ? 96   THR B O     1 
ATOM   2488  C  CB    . THR B 1 96   ? 20.432  23.407  143.604 1.00 144.83 ? 96   THR B CB    1 
ATOM   2489  O  OG1   . THR B 1 96   ? 19.058  23.074  143.359 1.00 136.47 ? 96   THR B OG1   1 
ATOM   2490  C  CG2   . THR B 1 96   ? 20.610  23.649  145.095 1.00 151.20 ? 96   THR B CG2   1 
ATOM   2491  N  N     . VAL B 1 97   ? 18.590  25.526  142.380 1.00 148.41 ? 97   VAL B N     1 
ATOM   2492  C  CA    . VAL B 1 97   ? 17.416  26.384  142.527 1.00 148.47 ? 97   VAL B CA    1 
ATOM   2493  C  C     . VAL B 1 97   ? 16.190  25.527  142.218 1.00 149.28 ? 97   VAL B C     1 
ATOM   2494  O  O     . VAL B 1 97   ? 16.310  24.439  141.658 1.00 147.35 ? 97   VAL B O     1 
ATOM   2495  C  CB    . VAL B 1 97   ? 17.435  27.602  141.545 1.00 144.22 ? 97   VAL B CB    1 
ATOM   2496  C  CG1   . VAL B 1 97   ? 16.337  28.593  141.878 1.00 144.89 ? 97   VAL B CG1   1 
ATOM   2497  C  CG2   . VAL B 1 97   ? 18.761  28.328  141.577 1.00 148.46 ? 97   VAL B CG2   1 
ATOM   2498  N  N     . THR B 1 98   ? 15.018  26.002  142.614 1.00 154.12 ? 98   THR B N     1 
ATOM   2499  C  CA    . THR B 1 98   ? 13.760  25.443  142.150 1.00 152.29 ? 98   THR B CA    1 
ATOM   2500  C  C     . THR B 1 98   ? 12.950  26.599  141.570 1.00 152.09 ? 98   THR B C     1 
ATOM   2501  O  O     . THR B 1 98   ? 12.934  27.706  142.116 1.00 153.59 ? 98   THR B O     1 
ATOM   2502  C  CB    . THR B 1 98   ? 12.987  24.736  143.289 1.00 155.26 ? 98   THR B CB    1 
ATOM   2503  O  OG1   . THR B 1 98   ? 13.737  23.602  143.754 1.00 153.13 ? 98   THR B OG1   1 
ATOM   2504  C  CG2   . THR B 1 98   ? 11.621  24.270  142.816 1.00 153.84 ? 98   THR B CG2   1 
ATOM   2505  N  N     . LEU B 1 99   ? 12.297  26.349  140.446 1.00 152.17 ? 99   LEU B N     1 
ATOM   2506  C  CA    . LEU B 1 99   ? 11.569  27.401  139.759 1.00 153.44 ? 99   LEU B CA    1 
ATOM   2507  C  C     . LEU B 1 99   ? 10.072  27.144  139.694 1.00 151.93 ? 99   LEU B C     1 
ATOM   2508  O  O     . LEU B 1 99   ? 9.613   26.000  139.639 1.00 145.70 ? 99   LEU B O     1 
ATOM   2509  C  CB    . LEU B 1 99   ? 12.129  27.606  138.358 1.00 150.00 ? 99   LEU B CB    1 
ATOM   2510  C  CG    . LEU B 1 99   ? 13.236  28.650  138.289 1.00 149.02 ? 99   LEU B CG    1 
ATOM   2511  C  CD1   . LEU B 1 99   ? 14.496  28.125  138.949 1.00 145.03 ? 99   LEU B CD1   1 
ATOM   2512  C  CD2   . LEU B 1 99   ? 13.483  29.071  136.843 1.00 152.76 ? 99   LEU B CD2   1 
ATOM   2513  N  N     . LEU B 1 100  ? 9.307   28.222  139.683 1.00 149.90 ? 100  LEU B N     1 
ATOM   2514  C  CA    . LEU B 1 100  ? 7.880   28.068  139.761 1.00 150.34 ? 100  LEU B CA    1 
ATOM   2515  C  C     . LEU B 1 100  ? 7.204   28.618  138.528 1.00 148.72 ? 100  LEU B C     1 
ATOM   2516  O  O     . LEU B 1 100  ? 7.539   29.705  138.056 1.00 146.16 ? 100  LEU B O     1 
ATOM   2517  C  CB    . LEU B 1 100  ? 7.344   28.749  141.022 1.00 162.80 ? 100  LEU B CB    1 
ATOM   2518  C  CG    . LEU B 1 100  ? 7.812   28.169  142.368 1.00 167.70 ? 100  LEU B CG    1 
ATOM   2519  C  CD1   . LEU B 1 100  ? 9.160   28.767  142.806 1.00 164.84 ? 100  LEU B CD1   1 
ATOM   2520  C  CD2   . LEU B 1 100  ? 6.746   28.319  143.470 1.00 160.91 ? 100  LEU B CD2   1 
ATOM   2521  N  N     . LEU B 1 101  ? 6.265   27.841  138.000 1.00 151.75 ? 101  LEU B N     1 
ATOM   2522  C  CA    . LEU B 1 101  ? 5.336   28.349  136.996 1.00 160.23 ? 101  LEU B CA    1 
ATOM   2523  C  C     . LEU B 1 101  ? 3.913   27.786  137.124 1.00 163.49 ? 101  LEU B C     1 
ATOM   2524  O  O     . LEU B 1 101  ? 3.697   26.582  137.331 1.00 155.16 ? 101  LEU B O     1 
ATOM   2525  C  CB    . LEU B 1 101  ? 5.873   28.173  135.570 1.00 159.28 ? 101  LEU B CB    1 
ATOM   2526  C  CG    . LEU B 1 101  ? 5.052   28.882  134.488 1.00 153.40 ? 101  LEU B CG    1 
ATOM   2527  C  CD1   . LEU B 1 101  ? 5.940   29.665  133.562 1.00 152.72 ? 101  LEU B CD1   1 
ATOM   2528  C  CD2   . LEU B 1 101  ? 4.224   27.892  133.701 1.00 150.77 ? 101  LEU B CD2   1 
ATOM   2529  N  N     . LYS B 1 102  ? 2.959   28.709  137.012 1.00 173.19 ? 102  LYS B N     1 
ATOM   2530  C  CA    . LYS B 1 102  ? 1.537   28.418  136.929 1.00 170.75 ? 102  LYS B CA    1 
ATOM   2531  C  C     . LYS B 1 102  ? 0.855   29.479  136.066 1.00 168.75 ? 102  LYS B C     1 
ATOM   2532  O  O     . LYS B 1 102  ? 1.207   30.658  136.121 1.00 163.98 ? 102  LYS B O     1 
ATOM   2533  C  CB    . LYS B 1 102  ? 0.899   28.393  138.319 1.00 172.77 ? 102  LYS B CB    1 
ATOM   2534  C  CG    . LYS B 1 102  ? -0.540  27.891  138.333 1.00 179.71 ? 102  LYS B CG    1 
ATOM   2535  C  CD    . LYS B 1 102  ? -1.097  27.807  139.749 1.00 192.02 ? 102  LYS B CD    1 
ATOM   2536  C  CE    . LYS B 1 102  ? -2.112  28.909  140.027 1.00 198.92 ? 102  LYS B CE    1 
ATOM   2537  N  NZ    . LYS B 1 102  ? -3.326  28.791  139.169 1.00 198.81 ? 102  LYS B NZ    1 
ATOM   2538  N  N     . ALA B 1 103  ? -0.102  29.045  135.255 1.00 170.71 ? 103  ALA B N     1 
ATOM   2539  C  CA    . ALA B 1 103  ? -1.009  29.933  134.528 1.00 176.37 ? 103  ALA B CA    1 
ATOM   2540  C  C     . ALA B 1 103  ? -2.154  29.051  134.072 1.00 178.45 ? 103  ALA B C     1 
ATOM   2541  O  O     . ALA B 1 103  ? -2.150  27.851  134.346 1.00 177.53 ? 103  ALA B O     1 
ATOM   2542  C  CB    . ALA B 1 103  ? -0.325  30.589  133.331 1.00 169.31 ? 103  ALA B CB    1 
ATOM   2543  N  N     . GLU B 1 104  ? -3.138  29.626  133.394 1.00 179.11 ? 104  GLU B N     1 
ATOM   2544  C  CA    . GLU B 1 104  ? -4.274  28.827  132.953 1.00 184.14 ? 104  GLU B CA    1 
ATOM   2545  C  C     . GLU B 1 104  ? -5.129  29.504  131.898 1.00 187.60 ? 104  GLU B C     1 
ATOM   2546  O  O     . GLU B 1 104  ? -4.747  30.540  131.341 1.00 183.64 ? 104  GLU B O     1 
ATOM   2547  C  CB    . GLU B 1 104  ? -5.137  28.358  134.134 1.00 188.56 ? 104  GLU B CB    1 
ATOM   2548  C  CG    . GLU B 1 104  ? -5.603  29.441  135.086 1.00 188.46 ? 104  GLU B CG    1 
ATOM   2549  C  CD    . GLU B 1 104  ? -6.565  28.903  136.131 1.00 188.41 ? 104  GLU B CD    1 
ATOM   2550  O  OE1   . GLU B 1 104  ? -6.336  29.148  137.333 1.00 190.96 ? 104  GLU B OE1   1 
ATOM   2551  O  OE2   . GLU B 1 104  ? -7.552  28.236  135.749 1.00 187.60 ? 104  GLU B OE2   1 
ATOM   2552  N  N     . GLY B 1 105  ? -6.275  28.884  131.618 1.00 188.58 ? 105  GLY B N     1 
ATOM   2553  C  CA    . GLY B 1 105  ? -7.190  29.368  130.606 1.00 187.35 ? 105  GLY B CA    1 
ATOM   2554  C  C     . GLY B 1 105  ? -6.499  29.294  129.269 1.00 188.69 ? 105  GLY B C     1 
ATOM   2555  O  O     . GLY B 1 105  ? -5.527  28.570  129.116 1.00 194.32 ? 105  GLY B O     1 
ATOM   2556  N  N     . PRO B 1 106  ? -6.991  30.046  128.290 1.00 188.13 ? 106  PRO B N     1 
ATOM   2557  C  CA    . PRO B 1 106  ? -6.394  30.080  126.952 1.00 188.60 ? 106  PRO B CA    1 
ATOM   2558  C  C     . PRO B 1 106  ? -5.113  30.915  126.902 1.00 188.01 ? 106  PRO B C     1 
ATOM   2559  O  O     . PRO B 1 106  ? -5.182  32.107  126.617 1.00 188.11 ? 106  PRO B O     1 
ATOM   2560  C  CB    . PRO B 1 106  ? -7.490  30.713  126.102 1.00 191.85 ? 106  PRO B CB    1 
ATOM   2561  C  CG    . PRO B 1 106  ? -8.245  31.565  127.067 1.00 199.27 ? 106  PRO B CG    1 
ATOM   2562  C  CD    . PRO B 1 106  ? -8.212  30.859  128.381 1.00 193.47 ? 106  PRO B CD    1 
ATOM   2563  N  N     . LYS B 1 107  ? -3.969  30.311  127.219 1.00 188.93 ? 107  LYS B N     1 
ATOM   2564  C  CA    . LYS B 1 107  ? -2.688  31.028  127.173 1.00 185.51 ? 107  LYS B CA    1 
ATOM   2565  C  C     . LYS B 1 107  ? -1.549  30.191  126.575 1.00 178.60 ? 107  LYS B C     1 
ATOM   2566  O  O     . LYS B 1 107  ? -1.581  28.963  126.630 1.00 175.93 ? 107  LYS B O     1 
ATOM   2567  C  CB    . LYS B 1 107  ? -2.300  31.509  128.577 1.00 186.59 ? 107  LYS B CB    1 
ATOM   2568  C  CG    . LYS B 1 107  ? -1.076  32.416  128.629 1.00 180.21 ? 107  LYS B CG    1 
ATOM   2569  C  CD    . LYS B 1 107  ? -0.638  32.634  130.058 1.00 178.47 ? 107  LYS B CD    1 
ATOM   2570  C  CE    . LYS B 1 107  ? 0.670   33.379  130.120 1.00 167.21 ? 107  LYS B CE    1 
ATOM   2571  N  NZ    . LYS B 1 107  ? 1.081   33.508  131.534 1.00 173.84 ? 107  LYS B NZ    1 
ATOM   2572  N  N     . GLU B 1 108  ? -0.553  30.865  125.997 1.00 176.12 ? 108  GLU B N     1 
ATOM   2573  C  CA    . GLU B 1 108  ? 0.669   30.209  125.518 1.00 177.43 ? 108  GLU B CA    1 
ATOM   2574  C  C     . GLU B 1 108  ? 1.889   30.691  126.283 1.00 175.77 ? 108  GLU B C     1 
ATOM   2575  O  O     . GLU B 1 108  ? 2.295   31.846  126.167 1.00 174.71 ? 108  GLU B O     1 
ATOM   2576  C  CB    . GLU B 1 108  ? 0.886   30.464  124.034 1.00 179.42 ? 108  GLU B CB    1 
ATOM   2577  C  CG    . GLU B 1 108  ? -0.098  29.756  123.138 1.00 186.02 ? 108  GLU B CG    1 
ATOM   2578  C  CD    . GLU B 1 108  ? 0.053   30.175  121.698 1.00 185.16 ? 108  GLU B CD    1 
ATOM   2579  O  OE1   . GLU B 1 108  ? 1.066   30.843  121.393 1.00 181.01 ? 108  GLU B OE1   1 
ATOM   2580  O  OE2   . GLU B 1 108  ? -0.836  29.845  120.881 1.00 182.26 ? 108  GLU B OE2   1 
ATOM   2581  N  N     . VAL B 1 109  ? 2.490   29.781  127.035 1.00 171.67 ? 109  VAL B N     1 
ATOM   2582  C  CA    . VAL B 1 109  ? 3.457   30.153  128.048 1.00 164.58 ? 109  VAL B CA    1 
ATOM   2583  C  C     . VAL B 1 109  ? 4.861   30.251  127.507 1.00 159.10 ? 109  VAL B C     1 
ATOM   2584  O  O     . VAL B 1 109  ? 5.301   29.395  126.756 1.00 162.66 ? 109  VAL B O     1 
ATOM   2585  C  CB    . VAL B 1 109  ? 3.438   29.143  129.194 1.00 161.59 ? 109  VAL B CB    1 
ATOM   2586  C  CG1   . VAL B 1 109  ? 4.491   29.488  130.221 1.00 161.99 ? 109  VAL B CG1   1 
ATOM   2587  C  CG2   . VAL B 1 109  ? 2.062   29.117  129.833 1.00 170.14 ? 109  VAL B CG2   1 
ATOM   2588  N  N     . LYS B 1 110  ? 5.566   31.304  127.889 1.00 156.90 ? 110  LYS B N     1 
ATOM   2589  C  CA    . LYS B 1 110  ? 6.962   31.416  127.530 1.00 158.64 ? 110  LYS B CA    1 
ATOM   2590  C  C     . LYS B 1 110  ? 7.817   31.312  128.784 1.00 157.87 ? 110  LYS B C     1 
ATOM   2591  O  O     . LYS B 1 110  ? 7.291   31.221  129.885 1.00 159.22 ? 110  LYS B O     1 
ATOM   2592  C  CB    . LYS B 1 110  ? 7.210   32.727  126.797 1.00 164.79 ? 110  LYS B CB    1 
ATOM   2593  C  CG    . LYS B 1 110  ? 6.655   32.741  125.377 1.00 165.24 ? 110  LYS B CG    1 
ATOM   2594  C  CD    . LYS B 1 110  ? 7.010   34.042  124.679 1.00 164.49 ? 110  LYS B CD    1 
ATOM   2595  C  CE    . LYS B 1 110  ? 6.803   33.956  123.180 1.00 160.00 ? 110  LYS B CE    1 
ATOM   2596  N  NZ    . LYS B 1 110  ? 7.303   35.206  122.544 1.00 156.18 ? 110  LYS B NZ    1 
ATOM   2597  N  N     . ALA B 1 111  ? 9.135   31.325  128.616 1.00 157.85 ? 111  ALA B N     1 
ATOM   2598  C  CA    . ALA B 1 111  ? 10.053  31.065  129.722 1.00 157.49 ? 111  ALA B CA    1 
ATOM   2599  C  C     . ALA B 1 111  ? 10.186  32.262  130.654 1.00 165.16 ? 111  ALA B C     1 
ATOM   2600  O  O     . ALA B 1 111  ? 10.751  32.165  131.743 1.00 165.53 ? 111  ALA B O     1 
ATOM   2601  C  CB    . ALA B 1 111  ? 11.409  30.657  129.192 1.00 155.45 ? 111  ALA B CB    1 
ATOM   2602  N  N     . ARG B 1 112  ? 9.660   33.397  130.214 1.00 170.44 ? 112  ARG B N     1 
ATOM   2603  C  CA    . ARG B 1 112  ? 9.621   34.601  131.034 1.00 174.24 ? 112  ARG B CA    1 
ATOM   2604  C  C     . ARG B 1 112  ? 8.675   34.403  132.211 1.00 174.22 ? 112  ARG B C     1 
ATOM   2605  O  O     . ARG B 1 112  ? 8.938   34.875  133.323 1.00 175.67 ? 112  ARG B O     1 
ATOM   2606  C  CB    . ARG B 1 112  ? 9.148   35.792  130.191 1.00 178.68 ? 112  ARG B CB    1 
ATOM   2607  C  CG    . ARG B 1 112  ? 8.043   35.447  129.176 1.00 174.74 ? 112  ARG B CG    1 
ATOM   2608  C  CD    . ARG B 1 112  ? 7.601   36.667  128.380 1.00 176.98 ? 112  ARG B CD    1 
ATOM   2609  N  NE    . ARG B 1 112  ? 8.742   37.523  128.075 1.00 179.57 ? 112  ARG B NE    1 
ATOM   2610  C  CZ    . ARG B 1 112  ? 9.396   37.517  126.920 1.00 172.12 ? 112  ARG B CZ    1 
ATOM   2611  N  NH1   . ARG B 1 112  ? 9.006   36.707  125.942 1.00 163.94 ? 112  ARG B NH1   1 
ATOM   2612  N  NH2   . ARG B 1 112  ? 10.432  38.330  126.746 1.00 172.60 ? 112  ARG B NH2   1 
ATOM   2613  N  N     . ASP B 1 113  ? 7.599   33.656  131.957 1.00 171.49 ? 113  ASP B N     1 
ATOM   2614  C  CA    . ASP B 1 113  ? 6.468   33.522  132.874 1.00 166.78 ? 113  ASP B CA    1 
ATOM   2615  C  C     . ASP B 1 113  ? 6.852   32.751  134.136 1.00 163.37 ? 113  ASP B C     1 
ATOM   2616  O  O     . ASP B 1 113  ? 6.037   32.562  135.043 1.00 157.55 ? 113  ASP B O     1 
ATOM   2617  C  CB    . ASP B 1 113  ? 5.277   32.874  132.159 1.00 166.80 ? 113  ASP B CB    1 
ATOM   2618  C  CG    . ASP B 1 113  ? 4.880   33.619  130.880 1.00 168.31 ? 113  ASP B CG    1 
ATOM   2619  O  OD1   . ASP B 1 113  ? 5.480   34.671  130.588 1.00 164.22 ? 113  ASP B OD1   1 
ATOM   2620  O  OD2   . ASP B 1 113  ? 3.956   33.166  130.168 1.00 170.20 ? 113  ASP B OD2   1 
ATOM   2621  N  N     . PHE B 1 114  ? 8.093   32.274  134.155 1.00 164.95 ? 114  PHE B N     1 
ATOM   2622  C  CA    . PHE B 1 114  ? 8.720   31.756  135.360 1.00 162.97 ? 114  PHE B CA    1 
ATOM   2623  C  C     . PHE B 1 114  ? 8.943   32.842  136.371 1.00 166.59 ? 114  PHE B C     1 
ATOM   2624  O  O     . PHE B 1 114  ? 9.548   33.866  136.054 1.00 169.41 ? 114  PHE B O     1 
ATOM   2625  C  CB    . PHE B 1 114  ? 10.070  31.144  135.030 1.00 157.02 ? 114  PHE B CB    1 
ATOM   2626  C  CG    . PHE B 1 114  ? 9.974   29.731  134.629 1.00 156.10 ? 114  PHE B CG    1 
ATOM   2627  C  CD1   . PHE B 1 114  ? 9.594   28.772  135.549 1.00 158.36 ? 114  PHE B CD1   1 
ATOM   2628  C  CD2   . PHE B 1 114  ? 10.207  29.354  133.331 1.00 156.51 ? 114  PHE B CD2   1 
ATOM   2629  C  CE1   . PHE B 1 114  ? 9.473   27.448  135.184 1.00 154.78 ? 114  PHE B CE1   1 
ATOM   2630  C  CE2   . PHE B 1 114  ? 10.089  28.037  132.960 1.00 157.00 ? 114  PHE B CE2   1 
ATOM   2631  C  CZ    . PHE B 1 114  ? 9.720   27.081  133.890 1.00 153.07 ? 114  PHE B CZ    1 
ATOM   2632  N  N     . LEU B 1 115  ? 8.480   32.604  137.594 1.00 163.99 ? 115  LEU B N     1 
ATOM   2633  C  CA    . LEU B 1 115  ? 8.659   33.573  138.659 1.00 166.52 ? 115  LEU B CA    1 
ATOM   2634  C  C     . LEU B 1 115  ? 10.133  33.736  138.934 1.00 166.69 ? 115  LEU B C     1 
ATOM   2635  O  O     . LEU B 1 115  ? 10.773  32.808  139.427 1.00 163.67 ? 115  LEU B O     1 
ATOM   2636  C  CB    . LEU B 1 115  ? 7.976   33.103  139.931 1.00 165.39 ? 115  LEU B CB    1 
ATOM   2637  C  CG    . LEU B 1 115  ? 6.466   32.978  139.839 1.00 161.45 ? 115  LEU B CG    1 
ATOM   2638  C  CD1   . LEU B 1 115  ? 5.909   32.948  141.239 1.00 156.92 ? 115  LEU B CD1   1 
ATOM   2639  C  CD2   . LEU B 1 115  ? 5.885   34.132  139.038 1.00 162.47 ? 115  LEU B CD2   1 
ATOM   2640  N  N     . PRO B 1 116  ? 10.666  34.932  138.634 1.00 167.29 ? 116  PRO B N     1 
ATOM   2641  C  CA    . PRO B 1 116  ? 12.095  35.218  138.759 1.00 164.79 ? 116  PRO B CA    1 
ATOM   2642  C  C     . PRO B 1 116  ? 12.568  34.922  140.171 1.00 161.82 ? 116  PRO B C     1 
ATOM   2643  O  O     . PRO B 1 116  ? 11.850  35.198  141.127 1.00 160.36 ? 116  PRO B O     1 
ATOM   2644  C  CB    . PRO B 1 116  ? 12.180  36.713  138.439 1.00 162.69 ? 116  PRO B CB    1 
ATOM   2645  C  CG    . PRO B 1 116  ? 11.009  36.953  137.532 1.00 163.44 ? 116  PRO B CG    1 
ATOM   2646  C  CD    . PRO B 1 116  ? 9.923   36.094  138.116 1.00 168.28 ? 116  PRO B CD    1 
ATOM   2647  N  N     . VAL B 1 117  ? 13.749  34.323  140.280 1.00 161.80 ? 117  VAL B N     1 
ATOM   2648  C  CA    . VAL B 1 117  ? 14.275  33.843  141.547 1.00 163.09 ? 117  VAL B CA    1 
ATOM   2649  C  C     . VAL B 1 117  ? 15.757  34.182  141.645 1.00 168.65 ? 117  VAL B C     1 
ATOM   2650  O  O     . VAL B 1 117  ? 16.501  34.036  140.675 1.00 169.01 ? 117  VAL B O     1 
ATOM   2651  C  CB    . VAL B 1 117  ? 14.092  32.309  141.691 1.00 163.91 ? 117  VAL B CB    1 
ATOM   2652  C  CG1   . VAL B 1 117  ? 14.798  31.793  142.933 1.00 164.14 ? 117  VAL B CG1   1 
ATOM   2653  C  CG2   . VAL B 1 117  ? 12.613  31.934  141.725 1.00 163.16 ? 117  VAL B CG2   1 
ATOM   2654  N  N     . ALA B 1 118  ? 16.153  34.693  142.807 1.00 174.60 ? 118  ALA B N     1 
ATOM   2655  C  CA    . ALA B 1 118  ? 17.545  35.002  143.140 1.00 178.50 ? 118  ALA B CA    1 
ATOM   2656  C  C     . ALA B 1 118  ? 18.268  35.779  142.048 1.00 176.67 ? 118  ALA B C     1 
ATOM   2657  O  O     . ALA B 1 118  ? 17.680  36.603  141.330 1.00 169.10 ? 118  ALA B O     1 
ATOM   2658  C  CB    . ALA B 1 118  ? 18.326  33.720  143.501 1.00 171.00 ? 118  ALA B CB    1 
ATOM   2659  N  N     . ASP B 1 119  ? 19.538  35.443  141.878 1.00 179.69 ? 119  ASP B N     1 
ATOM   2660  C  CA    . ASP B 1 119  ? 20.317  36.033  140.816 1.00 182.27 ? 119  ASP B CA    1 
ATOM   2661  C  C     . ASP B 1 119  ? 20.355  34.947  139.744 1.00 181.23 ? 119  ASP B C     1 
ATOM   2662  O  O     . ASP B 1 119  ? 21.104  33.972  139.845 1.00 177.69 ? 119  ASP B O     1 
ATOM   2663  C  CB    . ASP B 1 119  ? 21.720  36.362  141.346 1.00 183.67 ? 119  ASP B CB    1 
ATOM   2664  C  CG    . ASP B 1 119  ? 21.687  36.982  142.749 1.00 186.70 ? 119  ASP B CG    1 
ATOM   2665  O  OD1   . ASP B 1 119  ? 20.916  37.941  142.945 1.00 187.38 ? 119  ASP B OD1   1 
ATOM   2666  O  OD2   . ASP B 1 119  ? 22.412  36.509  143.659 1.00 187.53 ? 119  ASP B OD2   1 
ATOM   2667  N  N     . VAL B 1 120  ? 19.537  35.138  138.713 1.00 180.36 ? 120  VAL B N     1 
ATOM   2668  C  CA    . VAL B 1 120  ? 19.324  34.134  137.676 1.00 174.35 ? 120  VAL B CA    1 
ATOM   2669  C  C     . VAL B 1 120  ? 18.920  34.835  136.382 1.00 173.12 ? 120  VAL B C     1 
ATOM   2670  O  O     . VAL B 1 120  ? 18.156  35.800  136.411 1.00 176.04 ? 120  VAL B O     1 
ATOM   2671  C  CB    . VAL B 1 120  ? 18.215  33.119  138.108 1.00 167.75 ? 120  VAL B CB    1 
ATOM   2672  C  CG1   . VAL B 1 120  ? 17.403  32.618  136.916 1.00 166.39 ? 120  VAL B CG1   1 
ATOM   2673  C  CG2   . VAL B 1 120  ? 18.810  31.955  138.886 1.00 161.82 ? 120  VAL B CG2   1 
ATOM   2674  N  N     . GLU B 1 121  ? 19.411  34.350  135.247 1.00 167.49 ? 121  GLU B N     1 
ATOM   2675  C  CA    . GLU B 1 121  ? 18.929  34.841  133.966 1.00 161.27 ? 121  GLU B CA    1 
ATOM   2676  C  C     . GLU B 1 121  ? 18.219  33.734  133.221 1.00 157.54 ? 121  GLU B C     1 
ATOM   2677  O  O     . GLU B 1 121  ? 18.684  32.599  133.185 1.00 154.75 ? 121  GLU B O     1 
ATOM   2678  C  CB    . GLU B 1 121  ? 20.076  35.342  133.101 1.00 156.61 ? 121  GLU B CB    1 
ATOM   2679  C  CG    . GLU B 1 121  ? 21.000  36.309  133.797 1.00 165.62 ? 121  GLU B CG    1 
ATOM   2680  C  CD    . GLU B 1 121  ? 21.834  37.099  132.814 1.00 168.97 ? 121  GLU B CD    1 
ATOM   2681  O  OE1   . GLU B 1 121  ? 21.366  37.271  131.668 1.00 167.86 ? 121  GLU B OE1   1 
ATOM   2682  O  OE2   . GLU B 1 121  ? 22.948  37.543  133.182 1.00 169.20 ? 121  GLU B OE2   1 
ATOM   2683  N  N     . ILE B 1 122  ? 17.096  34.064  132.607 1.00 155.97 ? 122  ILE B N     1 
ATOM   2684  C  CA    . ILE B 1 122  ? 16.520  33.144  131.664 1.00 151.36 ? 122  ILE B CA    1 
ATOM   2685  C  C     . ILE B 1 122  ? 16.952  33.712  130.318 1.00 154.11 ? 122  ILE B C     1 
ATOM   2686  O  O     . ILE B 1 122  ? 16.384  34.686  129.833 1.00 158.00 ? 122  ILE B O     1 
ATOM   2687  C  CB    . ILE B 1 122  ? 15.003  33.126  131.820 1.00 149.08 ? 122  ILE B CB    1 
ATOM   2688  C  CG1   . ILE B 1 122  ? 14.655  32.771  133.268 1.00 150.24 ? 122  ILE B CG1   1 
ATOM   2689  C  CG2   . ILE B 1 122  ? 14.367  32.156  130.847 1.00 150.03 ? 122  ILE B CG2   1 
ATOM   2690  C  CD1   . ILE B 1 122  ? 13.201  32.989  133.628 1.00 162.74 ? 122  ILE B CD1   1 
ATOM   2691  N  N     . MET B 1 123  ? 17.947  33.067  129.713 1.00 148.17 ? 123  MET B N     1 
ATOM   2692  C  CA    . MET B 1 123  ? 18.618  33.589  128.534 1.00 141.35 ? 123  MET B CA    1 
ATOM   2693  C  C     . MET B 1 123  ? 17.639  33.686  127.398 1.00 143.77 ? 123  MET B C     1 
ATOM   2694  O  O     . MET B 1 123  ? 17.646  34.645  126.635 1.00 145.33 ? 123  MET B O     1 
ATOM   2695  C  CB    . MET B 1 123  ? 19.748  32.659  128.114 1.00 142.01 ? 123  MET B CB    1 
ATOM   2696  C  CG    . MET B 1 123  ? 20.744  32.362  129.205 1.00 141.98 ? 123  MET B CG    1 
ATOM   2697  S  SD    . MET B 1 123  ? 21.542  33.850  129.800 1.00 145.86 ? 123  MET B SD    1 
ATOM   2698  C  CE    . MET B 1 123  ? 22.335  34.446  128.305 1.00 148.22 ? 123  MET B CE    1 
ATOM   2699  N  N     . ASN B 1 124  ? 16.765  32.694  127.321 1.00 148.17 ? 124  ASN B N     1 
ATOM   2700  C  CA    . ASN B 1 124  ? 15.858  32.556  126.201 1.00 154.47 ? 124  ASN B CA    1 
ATOM   2701  C  C     . ASN B 1 124  ? 14.431  32.694  126.688 1.00 159.29 ? 124  ASN B C     1 
ATOM   2702  O  O     . ASN B 1 124  ? 13.663  31.737  126.621 1.00 163.16 ? 124  ASN B O     1 
ATOM   2703  C  CB    . ASN B 1 124  ? 16.040  31.172  125.551 1.00 155.44 ? 124  ASN B CB    1 
ATOM   2704  C  CG    . ASN B 1 124  ? 16.079  30.022  126.579 1.00 147.36 ? 124  ASN B CG    1 
ATOM   2705  O  OD1   . ASN B 1 124  ? 16.670  30.147  127.649 1.00 146.35 ? 124  ASN B OD1   1 
ATOM   2706  N  ND2   . ASN B 1 124  ? 15.452  28.899  126.240 1.00 143.14 ? 124  ASN B ND2   1 
ATOM   2707  N  N     . PRO B 1 125  ? 14.053  33.896  127.158 1.00 159.04 ? 125  PRO B N     1 
ATOM   2708  C  CA    . PRO B 1 125  ? 12.726  34.021  127.760 1.00 165.57 ? 125  PRO B CA    1 
ATOM   2709  C  C     . PRO B 1 125  ? 11.653  33.779  126.712 1.00 168.62 ? 125  PRO B C     1 
ATOM   2710  O  O     . PRO B 1 125  ? 10.497  33.538  127.060 1.00 170.63 ? 125  PRO B O     1 
ATOM   2711  C  CB    . PRO B 1 125  ? 12.685  35.483  128.237 1.00 169.37 ? 125  PRO B CB    1 
ATOM   2712  C  CG    . PRO B 1 125  ? 14.087  35.963  128.173 1.00 165.15 ? 125  PRO B CG    1 
ATOM   2713  C  CD    . PRO B 1 125  ? 14.718  35.201  127.058 1.00 158.96 ? 125  PRO B CD    1 
ATOM   2714  N  N     . ASP B 1 126  ? 12.036  33.839  125.439 1.00 165.17 ? 126  ASP B N     1 
ATOM   2715  C  CA    . ASP B 1 126  ? 11.081  33.636  124.359 1.00 169.18 ? 126  ASP B CA    1 
ATOM   2716  C  C     . ASP B 1 126  ? 10.650  32.163  124.177 1.00 170.08 ? 126  ASP B C     1 
ATOM   2717  O  O     . ASP B 1 126  ? 9.623   31.891  123.540 1.00 174.10 ? 126  ASP B O     1 
ATOM   2718  C  CB    . ASP B 1 126  ? 11.613  34.232  123.045 1.00 168.49 ? 126  ASP B CB    1 
ATOM   2719  C  CG    . ASP B 1 126  ? 11.423  35.741  122.963 1.00 164.16 ? 126  ASP B CG    1 
ATOM   2720  O  OD1   . ASP B 1 126  ? 10.273  36.197  122.743 1.00 157.24 ? 126  ASP B OD1   1 
ATOM   2721  O  OD2   . ASP B 1 126  ? 12.433  36.463  123.105 1.00 160.97 ? 126  ASP B OD2   1 
ATOM   2722  N  N     . LEU B 1 127  ? 11.404  31.229  124.765 1.00 164.14 ? 127  LEU B N     1 
ATOM   2723  C  CA    . LEU B 1 127  ? 11.179  29.795  124.530 1.00 161.35 ? 127  LEU B CA    1 
ATOM   2724  C  C     . LEU B 1 127  ? 9.744   29.391  124.806 1.00 160.57 ? 127  LEU B C     1 
ATOM   2725  O  O     . LEU B 1 127  ? 9.211   29.648  125.880 1.00 161.38 ? 127  LEU B O     1 
ATOM   2726  C  CB    . LEU B 1 127  ? 12.136  28.927  125.365 1.00 157.85 ? 127  LEU B CB    1 
ATOM   2727  C  CG    . LEU B 1 127  ? 11.980  27.395  125.332 1.00 155.25 ? 127  LEU B CG    1 
ATOM   2728  C  CD1   . LEU B 1 127  ? 11.872  26.853  123.904 1.00 154.11 ? 127  LEU B CD1   1 
ATOM   2729  C  CD2   . LEU B 1 127  ? 13.122  26.695  126.084 1.00 143.41 ? 127  LEU B CD2   1 
ATOM   2730  N  N     . HIS B 1 128  ? 9.114   28.768  123.819 1.00 160.52 ? 128  HIS B N     1 
ATOM   2731  C  CA    . HIS B 1 128  ? 7.760   28.293  124.010 1.00 159.63 ? 128  HIS B CA    1 
ATOM   2732  C  C     . HIS B 1 128  ? 7.787   27.087  124.937 1.00 157.18 ? 128  HIS B C     1 
ATOM   2733  O  O     . HIS B 1 128  ? 8.669   26.240  124.831 1.00 153.65 ? 128  HIS B O     1 
ATOM   2734  C  CB    . HIS B 1 128  ? 7.117   27.916  122.682 1.00 163.16 ? 128  HIS B CB    1 
ATOM   2735  C  CG    . HIS B 1 128  ? 5.746   27.351  122.834 1.00 167.35 ? 128  HIS B CG    1 
ATOM   2736  N  ND1   . HIS B 1 128  ? 4.671   28.113  123.244 1.00 170.81 ? 128  HIS B ND1   1 
ATOM   2737  C  CD2   . HIS B 1 128  ? 5.274   26.091  122.673 1.00 168.84 ? 128  HIS B CD2   1 
ATOM   2738  C  CE1   . HIS B 1 128  ? 3.596   27.349  123.309 1.00 171.82 ? 128  HIS B CE1   1 
ATOM   2739  N  NE2   . HIS B 1 128  ? 3.933   26.119  122.968 1.00 167.10 ? 128  HIS B NE2   1 
ATOM   2740  N  N     . ILE B 1 129  ? 6.824   27.022  125.852 1.00 161.09 ? 129  ILE B N     1 
ATOM   2741  C  CA    . ILE B 1 129  ? 6.706   25.889  126.770 1.00 158.53 ? 129  ILE B CA    1 
ATOM   2742  C  C     . ILE B 1 129  ? 5.466   25.016  126.517 1.00 161.29 ? 129  ILE B C     1 
ATOM   2743  O  O     . ILE B 1 129  ? 5.589   23.851  126.148 1.00 160.87 ? 129  ILE B O     1 
ATOM   2744  C  CB    . ILE B 1 129  ? 6.752   26.317  128.248 1.00 147.60 ? 129  ILE B CB    1 
ATOM   2745  C  CG1   . ILE B 1 129  ? 8.181   26.644  128.665 1.00 139.00 ? 129  ILE B CG1   1 
ATOM   2746  C  CG2   . ILE B 1 129  ? 6.256   25.197  129.122 1.00 148.92 ? 129  ILE B CG2   1 
ATOM   2747  C  CD1   . ILE B 1 129  ? 8.561   28.053  128.449 1.00 146.35 ? 129  ILE B CD1   1 
ATOM   2748  N  N     . ALA B 1 130  ? 4.274   25.560  126.711 1.00 161.37 ? 130  ALA B N     1 
ATOM   2749  C  CA    . ALA B 1 130  ? 3.085   24.762  126.452 1.00 166.09 ? 130  ALA B CA    1 
ATOM   2750  C  C     . ALA B 1 130  ? 1.878   25.597  126.030 1.00 175.97 ? 130  ALA B C     1 
ATOM   2751  O  O     . ALA B 1 130  ? 1.733   26.757  126.427 1.00 175.37 ? 130  ALA B O     1 
ATOM   2752  C  CB    . ALA B 1 130  ? 2.757   23.893  127.655 1.00 160.76 ? 130  ALA B CB    1 
ATOM   2753  N  N     . THR B 1 131  ? 1.024   24.996  125.204 1.00 179.21 ? 131  THR B N     1 
ATOM   2754  C  CA    . THR B 1 131  ? -0.188  25.655  124.729 1.00 178.28 ? 131  THR B CA    1 
ATOM   2755  C  C     . THR B 1 131  ? -1.386  25.248  125.591 1.00 178.86 ? 131  THR B C     1 
ATOM   2756  O  O     . THR B 1 131  ? -1.607  24.062  125.852 1.00 175.13 ? 131  THR B O     1 
ATOM   2757  C  CB    . THR B 1 131  ? -0.460  25.350  123.227 1.00 176.50 ? 131  THR B CB    1 
ATOM   2758  O  OG1   . THR B 1 131  ? -0.476  23.935  123.014 1.00 180.58 ? 131  THR B OG1   1 
ATOM   2759  C  CG2   . THR B 1 131  ? 0.619   25.959  122.342 1.00 170.23 ? 131  THR B CG2   1 
ATOM   2760  N  N     . LEU B 1 132  ? -2.150  26.242  126.036 1.00 181.15 ? 132  LEU B N     1 
ATOM   2761  C  CA    . LEU B 1 132  ? -3.277  25.996  126.923 1.00 180.30 ? 132  LEU B CA    1 
ATOM   2762  C  C     . LEU B 1 132  ? -4.594  26.445  126.304 1.00 180.14 ? 132  LEU B C     1 
ATOM   2763  O  O     . LEU B 1 132  ? -4.717  27.576  125.839 1.00 178.60 ? 132  LEU B O     1 
ATOM   2764  C  CB    . LEU B 1 132  ? -3.056  26.703  128.258 1.00 181.71 ? 132  LEU B CB    1 
ATOM   2765  C  CG    . LEU B 1 132  ? -1.883  26.238  129.127 1.00 179.51 ? 132  LEU B CG    1 
ATOM   2766  C  CD1   . LEU B 1 132  ? -0.590  26.922  128.741 1.00 171.98 ? 132  LEU B CD1   1 
ATOM   2767  C  CD2   . LEU B 1 132  ? -2.185  26.475  130.593 1.00 185.89 ? 132  LEU B CD2   1 
ATOM   2768  N  N     . GLU B 1 133  ? -5.574  25.547  126.301 1.00 183.52 ? 133  GLU B N     1 
ATOM   2769  C  CA    . GLU B 1 133  ? -6.905  25.858  125.792 1.00 191.54 ? 133  GLU B CA    1 
ATOM   2770  C  C     . GLU B 1 133  ? -7.800  26.382  126.901 1.00 195.51 ? 133  GLU B C     1 
ATOM   2771  O  O     . GLU B 1 133  ? -7.343  26.727  127.990 1.00 195.29 ? 133  GLU B O     1 
ATOM   2772  C  CB    . GLU B 1 133  ? -7.578  24.622  125.205 1.00 191.13 ? 133  GLU B CB    1 
ATOM   2773  C  CG    . GLU B 1 133  ? -6.665  23.661  124.510 1.00 188.76 ? 133  GLU B CG    1 
ATOM   2774  C  CD    . GLU B 1 133  ? -7.264  22.280  124.477 1.00 191.64 ? 133  GLU B CD    1 
ATOM   2775  O  OE1   . GLU B 1 133  ? -8.266  22.061  125.197 1.00 188.55 ? 133  GLU B OE1   1 
ATOM   2776  O  OE2   . GLU B 1 133  ? -6.740  21.421  123.737 1.00 190.52 ? 133  GLU B OE2   1 
ATOM   2777  N  N     . GLU B 1 134  ? -9.092  26.437  126.611 1.00 194.23 ? 134  GLU B N     1 
ATOM   2778  C  CA    . GLU B 1 134  ? -10.061 26.793  127.625 1.00 194.16 ? 134  GLU B CA    1 
ATOM   2779  C  C     . GLU B 1 134  ? -10.194 25.681  128.656 1.00 192.35 ? 134  GLU B C     1 
ATOM   2780  O  O     . GLU B 1 134  ? -10.440 24.521  128.312 1.00 191.02 ? 134  GLU B O     1 
ATOM   2781  C  CB    . GLU B 1 134  ? -11.410 27.086  126.979 1.00 200.72 ? 134  GLU B CB    1 
ATOM   2782  C  CG    . GLU B 1 134  ? -11.359 28.187  125.930 1.00 200.89 ? 134  GLU B CG    1 
ATOM   2783  C  CD    . GLU B 1 134  ? -11.079 29.565  126.516 1.00 200.42 ? 134  GLU B CD    1 
ATOM   2784  O  OE1   . GLU B 1 134  ? -10.857 30.501  125.722 1.00 200.01 ? 134  GLU B OE1   1 
ATOM   2785  O  OE2   . GLU B 1 134  ? -11.089 29.720  127.758 1.00 198.71 ? 134  GLU B OE2   1 
ATOM   2786  N  N     . GLY B 1 135  ? -10.022 26.048  129.922 1.00 191.76 ? 135  GLY B N     1 
ATOM   2787  C  CA    . GLY B 1 135  ? -10.139 25.107  131.021 1.00 194.55 ? 135  GLY B CA    1 
ATOM   2788  C  C     . GLY B 1 135  ? -8.802  24.461  131.292 1.00 190.25 ? 135  GLY B C     1 
ATOM   2789  O  O     . GLY B 1 135  ? -8.650  23.634  132.196 1.00 182.73 ? 135  GLY B O     1 
ATOM   2790  N  N     . GLY B 1 136  ? -7.833  24.831  130.466 1.00 193.25 ? 136  GLY B N     1 
ATOM   2791  C  CA    . GLY B 1 136  ? -6.473  24.353  130.609 1.00 193.19 ? 136  GLY B CA    1 
ATOM   2792  C  C     . GLY B 1 136  ? -5.796  24.976  131.803 1.00 186.46 ? 136  GLY B C     1 
ATOM   2793  O  O     . GLY B 1 136  ? -5.783  26.197  131.949 1.00 180.86 ? 136  GLY B O     1 
ATOM   2794  N  N     . ARG B 1 137  ? -5.232  24.132  132.656 1.00 189.09 ? 137  ARG B N     1 
ATOM   2795  C  CA    . ARG B 1 137  ? -4.518  24.605  133.830 1.00 191.10 ? 137  ARG B CA    1 
ATOM   2796  C  C     . ARG B 1 137  ? -3.117  24.005  133.874 1.00 181.72 ? 137  ARG B C     1 
ATOM   2797  O  O     . ARG B 1 137  ? -2.906  22.849  133.497 1.00 177.76 ? 137  ARG B O     1 
ATOM   2798  C  CB    . ARG B 1 137  ? -5.292  24.285  135.123 1.00 198.73 ? 137  ARG B CB    1 
ATOM   2799  C  CG    . ARG B 1 137  ? -6.582  25.100  135.338 1.00 199.69 ? 137  ARG B CG    1 
ATOM   2800  C  CD    . ARG B 1 137  ? -7.011  25.121  136.816 1.00 200.88 ? 137  ARG B CD    1 
ATOM   2801  N  NE    . ARG B 1 137  ? -8.368  25.641  137.010 1.00 205.36 ? 137  ARG B NE    1 
ATOM   2802  C  CZ    . ARG B 1 137  ? -8.960  25.782  138.195 1.00 205.99 ? 137  ARG B CZ    1 
ATOM   2803  N  NH1   . ARG B 1 137  ? -8.320  25.451  139.309 1.00 206.52 ? 137  ARG B NH1   1 
ATOM   2804  N  NH2   . ARG B 1 137  ? -10.197 26.257  138.269 1.00 202.74 ? 137  ARG B NH2   1 
ATOM   2805  N  N     . LEU B 1 138  ? -2.161  24.817  134.309 1.00 177.57 ? 138  LEU B N     1 
ATOM   2806  C  CA    . LEU B 1 138  ? -0.783  24.379  134.423 1.00 172.43 ? 138  LEU B CA    1 
ATOM   2807  C  C     . LEU B 1 138  ? -0.113  24.866  135.693 1.00 168.02 ? 138  LEU B C     1 
ATOM   2808  O  O     . LEU B 1 138  ? 0.029   26.060  135.903 1.00 165.86 ? 138  LEU B O     1 
ATOM   2809  C  CB    . LEU B 1 138  ? 0.021   24.869  133.230 1.00 175.33 ? 138  LEU B CB    1 
ATOM   2810  C  CG    . LEU B 1 138  ? 1.520   24.664  133.418 1.00 171.50 ? 138  LEU B CG    1 
ATOM   2811  C  CD1   . LEU B 1 138  ? 1.817   23.182  133.555 1.00 173.48 ? 138  LEU B CD1   1 
ATOM   2812  C  CD2   . LEU B 1 138  ? 2.278   25.270  132.258 1.00 168.74 ? 138  LEU B CD2   1 
ATOM   2813  N  N     . ASN B 1 139  ? 0.336   23.927  136.509 1.00 167.00 ? 139  ASN B N     1 
ATOM   2814  C  CA    . ASN B 1 139  ? 1.029   24.244  137.741 1.00 168.07 ? 139  ASN B CA    1 
ATOM   2815  C  C     . ASN B 1 139  ? 2.245   23.340  137.796 1.00 164.01 ? 139  ASN B C     1 
ATOM   2816  O  O     . ASN B 1 139  ? 2.099   22.118  137.683 1.00 163.92 ? 139  ASN B O     1 
ATOM   2817  C  CB    . ASN B 1 139  ? 0.102   23.962  138.930 1.00 173.35 ? 139  ASN B CB    1 
ATOM   2818  C  CG    . ASN B 1 139  ? 0.620   24.541  140.238 1.00 173.41 ? 139  ASN B CG    1 
ATOM   2819  O  OD1   . ASN B 1 139  ? 1.414   25.483  140.242 1.00 173.12 ? 139  ASN B OD1   1 
ATOM   2820  N  ND2   . ASN B 1 139  ? 0.164   23.979  141.358 1.00 169.93 ? 139  ASN B ND2   1 
ATOM   2821  N  N     . MET B 1 140  ? 3.440   23.917  137.941 1.00 159.46 ? 140  MET B N     1 
ATOM   2822  C  CA    . MET B 1 140  ? 4.652   23.089  137.964 1.00 156.52 ? 140  MET B CA    1 
ATOM   2823  C  C     . MET B 1 140  ? 5.924   23.664  138.600 1.00 152.09 ? 140  MET B C     1 
ATOM   2824  O  O     . MET B 1 140  ? 6.097   24.880  138.733 1.00 149.24 ? 140  MET B O     1 
ATOM   2825  C  CB    . MET B 1 140  ? 5.002   22.652  136.555 1.00 158.59 ? 140  MET B CB    1 
ATOM   2826  C  CG    . MET B 1 140  ? 5.605   23.758  135.726 1.00 168.20 ? 140  MET B CG    1 
ATOM   2827  S  SD    . MET B 1 140  ? 6.519   23.164  134.291 1.00 165.79 ? 140  MET B SD    1 
ATOM   2828  C  CE    . MET B 1 140  ? 5.234   22.271  133.432 1.00 156.45 ? 140  MET B CE    1 
ATOM   2829  N  N     . GLU B 1 141  ? 6.831   22.748  138.931 1.00 151.61 ? 141  GLU B N     1 
ATOM   2830  C  CA    . GLU B 1 141  ? 8.119   23.066  139.537 1.00 154.49 ? 141  GLU B CA    1 
ATOM   2831  C  C     . GLU B 1 141  ? 9.279   22.385  138.818 1.00 155.66 ? 141  GLU B C     1 
ATOM   2832  O  O     . GLU B 1 141  ? 9.223   21.183  138.563 1.00 153.20 ? 141  GLU B O     1 
ATOM   2833  C  CB    . GLU B 1 141  ? 8.143   22.568  140.971 1.00 158.68 ? 141  GLU B CB    1 
ATOM   2834  C  CG    . GLU B 1 141  ? 7.364   23.382  141.945 1.00 158.05 ? 141  GLU B CG    1 
ATOM   2835  C  CD    . GLU B 1 141  ? 7.850   23.139  143.343 1.00 162.23 ? 141  GLU B CD    1 
ATOM   2836  O  OE1   . GLU B 1 141  ? 8.725   22.253  143.514 1.00 162.94 ? 141  GLU B OE1   1 
ATOM   2837  O  OE2   . GLU B 1 141  ? 7.370   23.838  144.258 1.00 163.62 ? 141  GLU B OE2   1 
ATOM   2838  N  N     . VAL B 1 142  ? 10.341  23.141  138.531 1.00 155.00 ? 142  VAL B N     1 
ATOM   2839  C  CA    . VAL B 1 142  ? 11.551  22.590  137.902 1.00 147.70 ? 142  VAL B CA    1 
ATOM   2840  C  C     . VAL B 1 142  ? 12.845  22.877  138.702 1.00 148.63 ? 142  VAL B C     1 
ATOM   2841  O  O     . VAL B 1 142  ? 13.104  24.011  139.113 1.00 154.26 ? 142  VAL B O     1 
ATOM   2842  C  CB    . VAL B 1 142  ? 11.702  23.074  136.427 1.00 143.63 ? 142  VAL B CB    1 
ATOM   2843  C  CG1   . VAL B 1 142  ? 10.391  22.927  135.683 1.00 144.15 ? 142  VAL B CG1   1 
ATOM   2844  C  CG2   . VAL B 1 142  ? 12.159  24.521  136.355 1.00 145.62 ? 142  VAL B CG2   1 
ATOM   2845  N  N     . ARG B 1 143  ? 13.648  21.844  138.942 1.00 141.01 ? 143  ARG B N     1 
ATOM   2846  C  CA    . ARG B 1 143  ? 14.910  22.019  139.660 1.00 140.54 ? 143  ARG B CA    1 
ATOM   2847  C  C     . ARG B 1 143  ? 15.991  22.424  138.665 1.00 140.99 ? 143  ARG B C     1 
ATOM   2848  O  O     . ARG B 1 143  ? 15.948  22.000  137.515 1.00 143.18 ? 143  ARG B O     1 
ATOM   2849  C  CB    . ARG B 1 143  ? 15.289  20.725  140.391 1.00 139.58 ? 143  ARG B CB    1 
ATOM   2850  C  CG    . ARG B 1 143  ? 16.518  20.810  141.295 1.00 140.35 ? 143  ARG B CG    1 
ATOM   2851  C  CD    . ARG B 1 143  ? 16.576  19.625  142.246 1.00 141.33 ? 143  ARG B CD    1 
ATOM   2852  N  NE    . ARG B 1 143  ? 17.886  19.445  142.869 1.00 144.63 ? 143  ARG B NE    1 
ATOM   2853  C  CZ    . ARG B 1 143  ? 18.123  18.637  143.902 1.00 150.61 ? 143  ARG B CZ    1 
ATOM   2854  N  NH1   . ARG B 1 143  ? 17.134  17.928  144.441 1.00 148.31 ? 143  ARG B NH1   1 
ATOM   2855  N  NH2   . ARG B 1 143  ? 19.353  18.547  144.401 1.00 147.32 ? 143  ARG B NH2   1 
ATOM   2856  N  N     . VAL B 1 144  ? 16.929  23.278  139.070 1.00 141.09 ? 144  VAL B N     1 
ATOM   2857  C  CA    . VAL B 1 144  ? 18.056  23.626  138.195 1.00 138.77 ? 144  VAL B CA    1 
ATOM   2858  C  C     . VAL B 1 144  ? 19.412  23.599  138.917 1.00 137.58 ? 144  VAL B C     1 
ATOM   2859  O  O     . VAL B 1 144  ? 19.662  24.403  139.807 1.00 142.64 ? 144  VAL B O     1 
ATOM   2860  C  CB    . VAL B 1 144  ? 17.846  25.008  137.528 1.00 139.06 ? 144  VAL B CB    1 
ATOM   2861  C  CG1   . VAL B 1 144  ? 19.045  25.378  136.674 1.00 139.88 ? 144  VAL B CG1   1 
ATOM   2862  C  CG2   . VAL B 1 144  ? 16.579  25.013  136.686 1.00 137.62 ? 144  VAL B CG2   1 
ATOM   2863  N  N     . ASP B 1 145  ? 20.295  22.693  138.514 1.00 130.81 ? 145  ASP B N     1 
ATOM   2864  C  CA    . ASP B 1 145  ? 21.563  22.534  139.211 1.00 133.03 ? 145  ASP B CA    1 
ATOM   2865  C  C     . ASP B 1 145  ? 22.753  22.893  138.345 1.00 134.87 ? 145  ASP B C     1 
ATOM   2866  O  O     . ASP B 1 145  ? 22.749  22.668  137.131 1.00 131.67 ? 145  ASP B O     1 
ATOM   2867  C  CB    . ASP B 1 145  ? 21.725  21.101  139.715 1.00 139.29 ? 145  ASP B CB    1 
ATOM   2868  C  CG    . ASP B 1 145  ? 20.713  20.735  140.791 1.00 146.56 ? 145  ASP B CG    1 
ATOM   2869  O  OD1   . ASP B 1 145  ? 19.541  20.464  140.453 1.00 143.37 ? 145  ASP B OD1   1 
ATOM   2870  O  OD2   . ASP B 1 145  ? 21.093  20.697  141.981 1.00 152.99 ? 145  ASP B OD2   1 
ATOM   2871  N  N     . ARG B 1 146  ? 23.780  23.447  138.983 1.00 140.06 ? 146  ARG B N     1 
ATOM   2872  C  CA    . ARG B 1 146  ? 25.036  23.713  138.301 1.00 138.98 ? 146  ARG B CA    1 
ATOM   2873  C  C     . ARG B 1 146  ? 25.800  22.416  138.208 1.00 143.67 ? 146  ARG B C     1 
ATOM   2874  O  O     . ARG B 1 146  ? 26.151  21.814  139.225 1.00 147.70 ? 146  ARG B O     1 
ATOM   2875  C  CB    . ARG B 1 146  ? 25.887  24.722  139.063 1.00 143.09 ? 146  ARG B CB    1 
ATOM   2876  C  CG    . ARG B 1 146  ? 27.350  24.688  138.656 1.00 142.91 ? 146  ARG B CG    1 
ATOM   2877  C  CD    . ARG B 1 146  ? 28.205  25.494  139.603 1.00 153.23 ? 146  ARG B CD    1 
ATOM   2878  N  NE    . ARG B 1 146  ? 27.928  26.924  139.490 1.00 162.92 ? 146  ARG B NE    1 
ATOM   2879  C  CZ    . ARG B 1 146  ? 27.984  27.785  140.504 1.00 168.40 ? 146  ARG B CZ    1 
ATOM   2880  N  NH1   . ARG B 1 146  ? 28.306  27.363  141.721 1.00 169.87 ? 146  ARG B NH1   1 
ATOM   2881  N  NH2   . ARG B 1 146  ? 27.712  29.071  140.303 1.00 165.40 ? 146  ARG B NH2   1 
ATOM   2882  N  N     . GLY B 1 147  ? 26.074  21.996  136.980 1.00 146.67 ? 147  GLY B N     1 
ATOM   2883  C  CA    . GLY B 1 147  ? 26.762  20.737  136.738 1.00 146.76 ? 147  GLY B CA    1 
ATOM   2884  C  C     . GLY B 1 147  ? 27.442  20.718  135.378 1.00 143.45 ? 147  GLY B C     1 
ATOM   2885  O  O     . GLY B 1 147  ? 27.500  21.750  134.692 1.00 143.38 ? 147  GLY B O     1 
ATOM   2886  N  N     . VAL B 1 148  ? 27.956  19.553  134.986 1.00 136.73 ? 148  VAL B N     1 
ATOM   2887  C  CA    . VAL B 1 148  ? 28.762  19.451  133.777 1.00 132.95 ? 148  VAL B CA    1 
ATOM   2888  C  C     . VAL B 1 148  ? 28.339  18.321  132.855 1.00 135.01 ? 148  VAL B C     1 
ATOM   2889  O  O     . VAL B 1 148  ? 27.942  17.240  133.301 1.00 136.07 ? 148  VAL B O     1 
ATOM   2890  C  CB    . VAL B 1 148  ? 30.230  19.229  134.127 1.00 130.12 ? 148  VAL B CB    1 
ATOM   2891  C  CG1   . VAL B 1 148  ? 30.847  20.510  134.614 1.00 133.79 ? 148  VAL B CG1   1 
ATOM   2892  C  CG2   . VAL B 1 148  ? 30.345  18.149  135.179 1.00 132.65 ? 148  VAL B CG2   1 
ATOM   2893  N  N     . GLY B 1 149  ? 28.434  18.579  131.558 1.00 133.26 ? 149  GLY B N     1 
ATOM   2894  C  CA    . GLY B 1 149  ? 28.252  17.537  130.565 1.00 130.90 ? 149  GLY B CA    1 
ATOM   2895  C  C     . GLY B 1 149  ? 26.851  16.976  130.462 1.00 123.65 ? 149  GLY B C     1 
ATOM   2896  O  O     . GLY B 1 149  ? 25.892  17.712  130.272 1.00 127.64 ? 149  GLY B O     1 
ATOM   2897  N  N     . TYR B 1 150  ? 26.738  15.659  130.552 1.00 119.09 ? 150  TYR B N     1 
ATOM   2898  C  CA    . TYR B 1 150  ? 25.445  15.008  130.392 1.00 120.59 ? 150  TYR B CA    1 
ATOM   2899  C  C     . TYR B 1 150  ? 25.237  13.865  131.393 1.00 125.06 ? 150  TYR B C     1 
ATOM   2900  O  O     . TYR B 1 150  ? 26.014  12.904  131.442 1.00 123.16 ? 150  TYR B O     1 
ATOM   2901  C  CB    . TYR B 1 150  ? 25.294  14.522  128.953 1.00 114.08 ? 150  TYR B CB    1 
ATOM   2902  C  CG    . TYR B 1 150  ? 23.897  14.168  128.518 1.00 107.85 ? 150  TYR B CG    1 
ATOM   2903  C  CD1   . TYR B 1 150  ? 23.086  15.113  127.922 1.00 113.81 ? 150  TYR B CD1   1 
ATOM   2904  C  CD2   . TYR B 1 150  ? 23.404  12.877  128.662 1.00 110.00 ? 150  TYR B CD2   1 
ATOM   2905  C  CE1   . TYR B 1 150  ? 21.807  14.796  127.496 1.00 117.10 ? 150  TYR B CE1   1 
ATOM   2906  C  CE2   . TYR B 1 150  ? 22.126  12.547  128.241 1.00 111.46 ? 150  TYR B CE2   1 
ATOM   2907  C  CZ    . TYR B 1 150  ? 21.329  13.513  127.658 1.00 113.29 ? 150  TYR B CZ    1 
ATOM   2908  O  OH    . TYR B 1 150  ? 20.051  13.209  127.235 1.00 111.31 ? 150  TYR B OH    1 
ATOM   2909  N  N     . VAL B 1 151  ? 24.200  14.000  132.213 1.00 126.11 ? 151  VAL B N     1 
ATOM   2910  C  CA    . VAL B 1 151  ? 23.746  12.921  133.072 1.00 124.03 ? 151  VAL B CA    1 
ATOM   2911  C  C     . VAL B 1 151  ? 22.306  12.566  132.710 1.00 123.38 ? 151  VAL B C     1 
ATOM   2912  O  O     . VAL B 1 151  ? 21.389  13.355  132.964 1.00 121.59 ? 151  VAL B O     1 
ATOM   2913  C  CB    . VAL B 1 151  ? 23.828  13.317  134.555 1.00 127.01 ? 151  VAL B CB    1 
ATOM   2914  C  CG1   . VAL B 1 151  ? 23.521  12.122  135.430 1.00 129.91 ? 151  VAL B CG1   1 
ATOM   2915  C  CG2   . VAL B 1 151  ? 25.216  13.871  134.876 1.00 128.33 ? 151  VAL B CG2   1 
ATOM   2916  N  N     . PRO B 1 152  ? 22.102  11.381  132.104 1.00 126.79 ? 152  PRO B N     1 
ATOM   2917  C  CA    . PRO B 1 152  ? 20.764  10.878  131.754 1.00 130.68 ? 152  PRO B CA    1 
ATOM   2918  C  C     . PRO B 1 152  ? 19.894  10.755  133.002 1.00 133.36 ? 152  PRO B C     1 
ATOM   2919  O  O     . PRO B 1 152  ? 20.434  10.793  134.105 1.00 136.47 ? 152  PRO B O     1 
ATOM   2920  C  CB    . PRO B 1 152  ? 21.051  9.494   131.159 1.00 127.42 ? 152  PRO B CB    1 
ATOM   2921  C  CG    . PRO B 1 152  ? 22.432  9.597   130.632 1.00 125.22 ? 152  PRO B CG    1 
ATOM   2922  C  CD    . PRO B 1 152  ? 23.172  10.523  131.563 1.00 123.45 ? 152  PRO B CD    1 
ATOM   2923  N  N     . ALA B 1 153  ? 18.578  10.641  132.838 1.00 134.01 ? 153  ALA B N     1 
ATOM   2924  C  CA    . ALA B 1 153  ? 17.649  10.615  133.977 1.00 134.39 ? 153  ALA B CA    1 
ATOM   2925  C  C     . ALA B 1 153  ? 17.858  9.433   134.924 1.00 130.73 ? 153  ALA B C     1 
ATOM   2926  O  O     . ALA B 1 153  ? 17.834  9.580   136.144 1.00 122.23 ? 153  ALA B O     1 
ATOM   2927  C  CB    . ALA B 1 153  ? 16.214  10.630  133.478 1.00 138.62 ? 153  ALA B CB    1 
ATOM   2928  N  N     . GLU B 1 154  ? 18.048  8.260   134.335 1.00 140.05 ? 154  GLU B N     1 
ATOM   2929  C  CA    . GLU B 1 154  ? 18.208  7.021   135.075 1.00 142.21 ? 154  GLU B CA    1 
ATOM   2930  C  C     . GLU B 1 154  ? 19.433  7.085   135.981 1.00 139.50 ? 154  GLU B C     1 
ATOM   2931  O  O     . GLU B 1 154  ? 19.472  6.436   137.024 1.00 133.62 ? 154  GLU B O     1 
ATOM   2932  C  CB    . GLU B 1 154  ? 18.291  5.830   134.097 1.00 149.23 ? 154  GLU B CB    1 
ATOM   2933  C  CG    . GLU B 1 154  ? 16.966  5.525   133.326 1.00 150.43 ? 154  GLU B CG    1 
ATOM   2934  C  CD    . GLU B 1 154  ? 16.651  6.498   132.156 1.00 151.83 ? 154  GLU B CD    1 
ATOM   2935  O  OE1   . GLU B 1 154  ? 17.565  7.216   131.685 1.00 152.45 ? 154  GLU B OE1   1 
ATOM   2936  O  OE2   . GLU B 1 154  ? 15.482  6.537   131.693 1.00 143.46 ? 154  GLU B OE2   1 
ATOM   2937  N  N     . LYS B 1 155  ? 20.436  7.850   135.553 1.00 144.66 ? 155  LYS B N     1 
ATOM   2938  C  CA    . LYS B 1 155  ? 21.687  8.029   136.302 1.00 145.00 ? 155  LYS B CA    1 
ATOM   2939  C  C     . LYS B 1 155  ? 21.717  9.112   137.409 1.00 143.06 ? 155  LYS B C     1 
ATOM   2940  O  O     . LYS B 1 155  ? 22.284  8.875   138.473 1.00 149.21 ? 155  LYS B O     1 
ATOM   2941  C  CB    . LYS B 1 155  ? 22.892  8.143   135.349 1.00 141.65 ? 155  LYS B CB    1 
ATOM   2942  C  CG    . LYS B 1 155  ? 23.085  6.917   134.446 1.00 142.86 ? 155  LYS B CG    1 
ATOM   2943  C  CD    . LYS B 1 155  ? 23.055  5.618   135.252 1.00 155.48 ? 155  LYS B CD    1 
ATOM   2944  C  CE    . LYS B 1 155  ? 22.886  4.386   134.366 1.00 168.67 ? 155  LYS B CE    1 
ATOM   2945  N  NZ    . LYS B 1 155  ? 24.108  4.072   133.562 1.00 182.91 ? 155  LYS B NZ    1 
ATOM   2946  N  N     . HIS B 1 156  ? 21.139  10.291  137.176 1.00 140.58 ? 156  HIS B N     1 
ATOM   2947  C  CA    . HIS B 1 156  ? 21.122  11.314  138.236 1.00 139.93 ? 156  HIS B CA    1 
ATOM   2948  C  C     . HIS B 1 156  ? 20.069  11.011  139.300 1.00 143.51 ? 156  HIS B C     1 
ATOM   2949  O  O     . HIS B 1 156  ? 20.350  11.070  140.504 1.00 141.15 ? 156  HIS B O     1 
ATOM   2950  C  CB    . HIS B 1 156  ? 20.978  12.744  137.684 1.00 135.34 ? 156  HIS B CB    1 
ATOM   2951  C  CG    . HIS B 1 156  ? 19.583  13.123  137.284 1.00 137.90 ? 156  HIS B CG    1 
ATOM   2952  N  ND1   . HIS B 1 156  ? 18.611  13.466  138.199 1.00 143.71 ? 156  HIS B ND1   1 
ATOM   2953  C  CD2   . HIS B 1 156  ? 19.007  13.248  136.064 1.00 136.37 ? 156  HIS B CD2   1 
ATOM   2954  C  CE1   . HIS B 1 156  ? 17.494  13.767  137.562 1.00 140.48 ? 156  HIS B CE1   1 
ATOM   2955  N  NE2   . HIS B 1 156  ? 17.707  13.646  136.266 1.00 134.08 ? 156  HIS B NE2   1 
ATOM   2956  N  N     . GLY B 1 157  ? 18.858  10.697  138.843 1.00 144.85 ? 157  GLY B N     1 
ATOM   2957  C  CA    . GLY B 1 157  ? 17.836  10.133  139.702 1.00 147.49 ? 157  GLY B CA    1 
ATOM   2958  C  C     . GLY B 1 157  ? 17.517  10.946  140.935 1.00 153.04 ? 157  GLY B C     1 
ATOM   2959  O  O     . GLY B 1 157  ? 17.728  10.468  142.048 1.00 160.87 ? 157  GLY B O     1 
ATOM   2960  N  N     . ILE B 1 158  ? 17.071  12.184  140.764 1.00 153.05 ? 158  ILE B N     1 
ATOM   2961  C  CA    . ILE B 1 158  ? 16.710  12.979  141.931 1.00 156.32 ? 158  ILE B CA    1 
ATOM   2962  C  C     . ILE B 1 158  ? 15.211  13.293  141.993 1.00 157.21 ? 158  ILE B C     1 
ATOM   2963  O  O     . ILE B 1 158  ? 14.563  13.491  140.961 1.00 151.28 ? 158  ILE B O     1 
ATOM   2964  C  CB    . ILE B 1 158  ? 17.581  14.248  142.063 1.00 149.61 ? 158  ILE B CB    1 
ATOM   2965  C  CG1   . ILE B 1 158  ? 17.491  15.088  140.797 1.00 143.60 ? 158  ILE B CG1   1 
ATOM   2966  C  CG2   . ILE B 1 158  ? 19.031  13.868  142.332 1.00 147.27 ? 158  ILE B CG2   1 
ATOM   2967  C  CD1   . ILE B 1 158  ? 17.025  16.464  141.047 1.00 143.49 ? 158  ILE B CD1   1 
ATOM   2968  N  N     . LYS B 1 159  ? 14.671  13.294  143.213 1.00 160.78 ? 159  LYS B N     1 
ATOM   2969  C  CA    . LYS B 1 159  ? 13.268  13.621  143.457 1.00 159.59 ? 159  LYS B CA    1 
ATOM   2970  C  C     . LYS B 1 159  ? 13.079  14.554  144.658 1.00 158.94 ? 159  LYS B C     1 
ATOM   2971  O  O     . LYS B 1 159  ? 13.446  14.231  145.786 1.00 158.58 ? 159  LYS B O     1 
ATOM   2972  C  CB    . LYS B 1 159  ? 12.444  12.345  143.643 1.00 157.28 ? 159  LYS B CB    1 
ATOM   2973  C  CG    . LYS B 1 159  ? 12.201  11.591  142.358 1.00 155.22 ? 159  LYS B CG    1 
ATOM   2974  C  CD    . LYS B 1 159  ? 11.487  10.292  142.612 1.00 153.51 ? 159  LYS B CD    1 
ATOM   2975  C  CE    . LYS B 1 159  ? 11.234  9.573   141.312 1.00 150.35 ? 159  LYS B CE    1 
ATOM   2976  N  NZ    . LYS B 1 159  ? 10.887  8.157   141.564 1.00 164.35 ? 159  LYS B NZ    1 
ATOM   2977  N  N     . ASP B 1 160  ? 12.516  15.725  144.400 1.00 157.28 ? 160  ASP B N     1 
ATOM   2978  C  CA    . ASP B 1 160  ? 12.080  16.589  145.474 1.00 155.47 ? 160  ASP B CA    1 
ATOM   2979  C  C     . ASP B 1 160  ? 10.834  15.952  146.099 1.00 152.54 ? 160  ASP B C     1 
ATOM   2980  O  O     . ASP B 1 160  ? 10.783  15.733  147.306 1.00 151.99 ? 160  ASP B O     1 
ATOM   2981  C  CB    . ASP B 1 160  ? 11.790  17.994  144.933 1.00 157.42 ? 160  ASP B CB    1 
ATOM   2982  C  CG    . ASP B 1 160  ? 13.027  18.874  144.890 1.00 153.75 ? 160  ASP B CG    1 
ATOM   2983  O  OD1   . ASP B 1 160  ? 14.141  18.380  145.190 1.00 150.46 ? 160  ASP B OD1   1 
ATOM   2984  O  OD2   . ASP B 1 160  ? 12.874  20.065  144.544 1.00 148.10 ? 160  ASP B OD2   1 
ATOM   2985  N  N     . ARG B 1 161  ? 9.870   15.596  145.249 1.00 153.20 ? 161  ARG B N     1 
ATOM   2986  C  CA    . ARG B 1 161  ? 8.546   15.114  145.654 1.00 147.39 ? 161  ARG B CA    1 
ATOM   2987  C  C     . ARG B 1 161  ? 8.379   13.646  145.286 1.00 149.68 ? 161  ARG B C     1 
ATOM   2988  O  O     . ARG B 1 161  ? 9.342   12.993  144.904 1.00 153.43 ? 161  ARG B O     1 
ATOM   2989  C  CB    . ARG B 1 161  ? 7.475   15.927  144.943 1.00 144.02 ? 161  ARG B CB    1 
ATOM   2990  C  CG    . ARG B 1 161  ? 6.105   15.875  145.567 1.00 147.77 ? 161  ARG B CG    1 
ATOM   2991  C  CD    . ARG B 1 161  ? 5.423   17.177  145.322 1.00 152.00 ? 161  ARG B CD    1 
ATOM   2992  N  NE    . ARG B 1 161  ? 6.394   18.252  145.439 1.00 150.44 ? 161  ARG B NE    1 
ATOM   2993  C  CZ    . ARG B 1 161  ? 6.089   19.540  145.434 1.00 154.33 ? 161  ARG B CZ    1 
ATOM   2994  N  NH1   . ARG B 1 161  ? 4.827   19.927  145.321 1.00 157.62 ? 161  ARG B NH1   1 
ATOM   2995  N  NH2   . ARG B 1 161  ? 7.050   20.441  145.552 1.00 157.17 ? 161  ARG B NH2   1 
ATOM   2996  N  N     . ILE B 1 162  ? 7.180   13.102  145.470 1.00 147.98 ? 162  ILE B N     1 
ATOM   2997  C  CA    . ILE B 1 162  ? 6.867   11.760  144.986 1.00 155.39 ? 162  ILE B CA    1 
ATOM   2998  C  C     . ILE B 1 162  ? 6.523   11.729  143.515 1.00 160.11 ? 162  ILE B C     1 
ATOM   2999  O  O     . ILE B 1 162  ? 7.026   10.889  142.774 1.00 164.85 ? 162  ILE B O     1 
ATOM   3000  C  CB    . ILE B 1 162  ? 5.701   11.122  145.744 1.00 158.32 ? 162  ILE B CB    1 
ATOM   3001  C  CG1   . ILE B 1 162  ? 6.205   10.473  147.031 1.00 157.30 ? 162  ILE B CG1   1 
ATOM   3002  C  CG2   . ILE B 1 162  ? 5.012   10.053  144.889 1.00 160.24 ? 162  ILE B CG2   1 
ATOM   3003  C  CD1   . ILE B 1 162  ? 5.118   9.724   147.817 1.00 153.68 ? 162  ILE B CD1   1 
ATOM   3004  N  N     . ASN B 1 163  ? 5.665   12.648  143.093 1.00 161.18 ? 163  ASN B N     1 
ATOM   3005  C  CA    . ASN B 1 163  ? 5.182   12.643  141.717 1.00 172.46 ? 163  ASN B CA    1 
ATOM   3006  C  C     . ASN B 1 163  ? 6.104   13.421  140.785 1.00 173.38 ? 163  ASN B C     1 
ATOM   3007  O  O     . ASN B 1 163  ? 5.795   13.631  139.602 1.00 166.17 ? 163  ASN B O     1 
ATOM   3008  C  CB    . ASN B 1 163  ? 3.755   13.165  141.655 1.00 177.30 ? 163  ASN B CB    1 
ATOM   3009  C  CG    . ASN B 1 163  ? 2.824   12.371  142.533 1.00 180.53 ? 163  ASN B CG    1 
ATOM   3010  O  OD1   . ASN B 1 163  ? 2.966   11.152  142.658 1.00 179.18 ? 163  ASN B OD1   1 
ATOM   3011  N  ND2   . ASN B 1 163  ? 1.870   13.055  143.161 1.00 181.07 ? 163  ASN B ND2   1 
ATOM   3012  N  N     . ALA B 1 164  ? 7.230   13.858  141.350 1.00 172.17 ? 164  ALA B N     1 
ATOM   3013  C  CA    . ALA B 1 164  ? 8.312   14.471  140.591 1.00 163.74 ? 164  ALA B CA    1 
ATOM   3014  C  C     . ALA B 1 164  ? 8.993   13.426  139.708 1.00 164.09 ? 164  ALA B C     1 
ATOM   3015  O  O     . ALA B 1 164  ? 9.336   12.320  140.163 1.00 159.54 ? 164  ALA B O     1 
ATOM   3016  C  CB    . ALA B 1 164  ? 9.329   15.134  141.528 1.00 155.89 ? 164  ALA B CB    1 
ATOM   3017  N  N     . ILE B 1 165  ? 9.153   13.789  138.436 1.00 164.35 ? 165  ILE B N     1 
ATOM   3018  C  CA    . ILE B 1 165  ? 9.805   12.956  137.428 1.00 156.13 ? 165  ILE B CA    1 
ATOM   3019  C  C     . ILE B 1 165  ? 11.121  13.584  136.912 1.00 149.12 ? 165  ILE B C     1 
ATOM   3020  O  O     . ILE B 1 165  ? 11.112  14.707  136.394 1.00 141.65 ? 165  ILE B O     1 
ATOM   3021  C  CB    . ILE B 1 165  ? 8.834   12.638  136.274 1.00 148.46 ? 165  ILE B CB    1 
ATOM   3022  C  CG1   . ILE B 1 165  ? 8.020   13.876  135.896 1.00 140.95 ? 165  ILE B CG1   1 
ATOM   3023  C  CG2   . ILE B 1 165  ? 7.894   11.512  136.676 1.00 159.22 ? 165  ILE B CG2   1 
ATOM   3024  C  CD1   . ILE B 1 165  ? 6.895   13.572  134.929 1.00 155.95 ? 165  ILE B CD1   1 
ATOM   3025  N  N     . PRO B 1 166  ? 12.257  12.867  137.087 1.00 143.94 ? 166  PRO B N     1 
ATOM   3026  C  CA    . PRO B 1 166  ? 13.612  13.349  136.791 1.00 138.29 ? 166  PRO B CA    1 
ATOM   3027  C  C     . PRO B 1 166  ? 13.920  13.451  135.291 1.00 138.70 ? 166  PRO B C     1 
ATOM   3028  O  O     . PRO B 1 166  ? 13.610  12.504  134.561 1.00 136.99 ? 166  PRO B O     1 
ATOM   3029  C  CB    . PRO B 1 166  ? 14.497  12.285  137.452 1.00 137.02 ? 166  PRO B CB    1 
ATOM   3030  C  CG    . PRO B 1 166  ? 13.715  11.051  137.348 1.00 132.62 ? 166  PRO B CG    1 
ATOM   3031  C  CD    . PRO B 1 166  ? 12.274  11.452  137.506 1.00 143.23 ? 166  PRO B CD    1 
ATOM   3032  N  N     . VAL B 1 167  ? 14.541  14.553  134.855 1.00 135.83 ? 167  VAL B N     1 
ATOM   3033  C  CA    . VAL B 1 167  ? 14.844  14.785  133.432 1.00 136.13 ? 167  VAL B CA    1 
ATOM   3034  C  C     . VAL B 1 167  ? 16.313  14.496  133.083 1.00 134.93 ? 167  VAL B C     1 
ATOM   3035  O  O     . VAL B 1 167  ? 17.198  14.730  133.908 1.00 130.95 ? 167  VAL B O     1 
ATOM   3036  C  CB    . VAL B 1 167  ? 14.467  16.240  132.995 1.00 135.38 ? 167  VAL B CB    1 
ATOM   3037  C  CG1   . VAL B 1 167  ? 15.041  16.595  131.618 1.00 132.29 ? 167  VAL B CG1   1 
ATOM   3038  C  CG2   . VAL B 1 167  ? 12.961  16.425  132.990 1.00 137.34 ? 167  VAL B CG2   1 
ATOM   3039  N  N     . ASP B 1 168  ? 16.559  13.965  131.878 1.00 134.60 ? 168  ASP B N     1 
ATOM   3040  C  CA    . ASP B 1 168  ? 17.913  13.787  131.370 1.00 126.19 ? 168  ASP B CA    1 
ATOM   3041  C  C     . ASP B 1 168  ? 18.558  15.175  131.444 1.00 123.00 ? 168  ASP B C     1 
ATOM   3042  O  O     . ASP B 1 168  ? 18.036  16.130  130.868 1.00 123.14 ? 168  ASP B O     1 
ATOM   3043  C  CB    . ASP B 1 168  ? 17.876  13.281  129.912 1.00 126.74 ? 168  ASP B CB    1 
ATOM   3044  C  CG    . ASP B 1 168  ? 16.885  12.104  129.687 1.00 131.29 ? 168  ASP B CG    1 
ATOM   3045  O  OD1   . ASP B 1 168  ? 17.174  10.955  130.095 1.00 130.99 ? 168  ASP B OD1   1 
ATOM   3046  O  OD2   . ASP B 1 168  ? 15.826  12.315  129.052 1.00 130.40 ? 168  ASP B OD2   1 
ATOM   3047  N  N     . ALA B 1 169  ? 19.681  15.298  132.149 1.00 120.05 ? 169  ALA B N     1 
ATOM   3048  C  CA    . ALA B 1 169  ? 20.179  16.625  132.527 1.00 119.28 ? 169  ALA B CA    1 
ATOM   3049  C  C     . ALA B 1 169  ? 21.183  17.181  131.547 1.00 119.87 ? 169  ALA B C     1 
ATOM   3050  O  O     . ALA B 1 169  ? 22.307  16.702  131.486 1.00 117.85 ? 169  ALA B O     1 
ATOM   3051  C  CB    . ALA B 1 169  ? 20.798  16.581  133.905 1.00 118.78 ? 169  ALA B CB    1 
ATOM   3052  N  N     . VAL B 1 170  ? 20.814  18.229  130.817 1.00 123.13 ? 170  VAL B N     1 
ATOM   3053  C  CA    . VAL B 1 170  ? 21.724  18.737  129.802 1.00 121.36 ? 170  VAL B CA    1 
ATOM   3054  C  C     . VAL B 1 170  ? 22.463  19.961  130.323 1.00 126.84 ? 170  VAL B C     1 
ATOM   3055  O  O     . VAL B 1 170  ? 21.949  21.089  130.291 1.00 130.14 ? 170  VAL B O     1 
ATOM   3056  C  CB    . VAL B 1 170  ? 20.956  19.129  128.528 1.00 124.59 ? 170  VAL B CB    1 
ATOM   3057  C  CG1   . VAL B 1 170  ? 21.922  19.544  127.437 1.00 135.67 ? 170  VAL B CG1   1 
ATOM   3058  C  CG2   . VAL B 1 170  ? 20.099  17.978  128.046 1.00 123.20 ? 170  VAL B CG2   1 
ATOM   3059  N  N     . PHE B 1 171  ? 23.717  19.736  130.706 1.00 125.31 ? 171  PHE B N     1 
ATOM   3060  C  CA    . PHE B 1 171  ? 24.482  20.725  131.447 1.00 126.94 ? 171  PHE B CA    1 
ATOM   3061  C  C     . PHE B 1 171  ? 25.283  21.547  130.493 1.00 128.34 ? 171  PHE B C     1 
ATOM   3062  O  O     . PHE B 1 171  ? 25.008  22.740  130.303 1.00 127.16 ? 171  PHE B O     1 
ATOM   3063  C  CB    . PHE B 1 171  ? 25.447  20.052  132.428 1.00 126.29 ? 171  PHE B CB    1 
ATOM   3064  C  CG    . PHE B 1 171  ? 24.776  19.440  133.620 1.00 130.98 ? 171  PHE B CG    1 
ATOM   3065  C  CD1   . PHE B 1 171  ? 24.232  20.238  134.616 1.00 136.57 ? 171  PHE B CD1   1 
ATOM   3066  C  CD2   . PHE B 1 171  ? 24.691  18.070  133.754 1.00 129.71 ? 171  PHE B CD2   1 
ATOM   3067  C  CE1   . PHE B 1 171  ? 23.608  19.674  135.717 1.00 135.79 ? 171  PHE B CE1   1 
ATOM   3068  C  CE2   . PHE B 1 171  ? 24.071  17.503  134.851 1.00 130.01 ? 171  PHE B CE2   1 
ATOM   3069  C  CZ    . PHE B 1 171  ? 23.530  18.306  135.830 1.00 132.84 ? 171  PHE B CZ    1 
ATOM   3070  N  N     . SER B 1 172  ? 26.243  20.863  129.866 1.00 132.76 ? 172  SER B N     1 
ATOM   3071  C  CA    . SER B 1 172  ? 27.336  21.496  129.146 1.00 134.01 ? 172  SER B CA    1 
ATOM   3072  C  C     . SER B 1 172  ? 26.758  22.525  128.209 1.00 130.99 ? 172  SER B C     1 
ATOM   3073  O  O     . SER B 1 172  ? 25.906  22.208  127.375 1.00 124.68 ? 172  SER B O     1 
ATOM   3074  C  CB    . SER B 1 172  ? 28.180  20.465  128.380 1.00 127.70 ? 172  SER B CB    1 
ATOM   3075  O  OG    . SER B 1 172  ? 29.570  20.753  128.482 1.00 121.20 ? 172  SER B OG    1 
ATOM   3076  N  N     . PRO B 1 173  ? 27.197  23.778  128.397 1.00 131.19 ? 173  PRO B N     1 
ATOM   3077  C  CA    . PRO B 1 173  ? 26.828  24.986  127.661 1.00 134.02 ? 173  PRO B CA    1 
ATOM   3078  C  C     . PRO B 1 173  ? 27.339  24.900  126.228 1.00 136.71 ? 173  PRO B C     1 
ATOM   3079  O  O     . PRO B 1 173  ? 26.970  25.706  125.375 1.00 135.76 ? 173  PRO B O     1 
ATOM   3080  C  CB    . PRO B 1 173  ? 27.513  26.103  128.451 1.00 135.68 ? 173  PRO B CB    1 
ATOM   3081  C  CG    . PRO B 1 173  ? 28.638  25.457  129.127 1.00 128.66 ? 173  PRO B CG    1 
ATOM   3082  C  CD    . PRO B 1 173  ? 28.217  24.057  129.424 1.00 128.45 ? 173  PRO B CD    1 
ATOM   3083  N  N     . VAL B 1 174  ? 28.206  23.920  125.987 1.00 136.41 ? 174  VAL B N     1 
ATOM   3084  C  CA    . VAL B 1 174  ? 28.686  23.598  124.650 1.00 132.05 ? 174  VAL B CA    1 
ATOM   3085  C  C     . VAL B 1 174  ? 27.638  22.743  123.900 1.00 134.02 ? 174  VAL B C     1 
ATOM   3086  O  O     . VAL B 1 174  ? 27.319  21.640  124.351 1.00 136.95 ? 174  VAL B O     1 
ATOM   3087  C  CB    . VAL B 1 174  ? 30.024  22.828  124.783 1.00 124.14 ? 174  VAL B CB    1 
ATOM   3088  C  CG1   . VAL B 1 174  ? 30.647  22.587  123.442 1.00 127.02 ? 174  VAL B CG1   1 
ATOM   3089  C  CG2   . VAL B 1 174  ? 30.981  23.615  125.663 1.00 122.81 ? 174  VAL B CG2   1 
ATOM   3090  N  N     . ARG B 1 175  ? 27.083  23.262  122.792 1.00 132.75 ? 175  ARG B N     1 
ATOM   3091  C  CA    . ARG B 1 175  ? 26.138  22.514  121.928 1.00 132.44 ? 175  ARG B CA    1 
ATOM   3092  C  C     . ARG B 1 175  ? 26.838  21.599  120.902 1.00 128.42 ? 175  ARG B C     1 
ATOM   3093  O  O     . ARG B 1 175  ? 26.320  20.536  120.533 1.00 121.28 ? 175  ARG B O     1 
ATOM   3094  C  CB    . ARG B 1 175  ? 25.141  23.452  121.215 1.00 132.87 ? 175  ARG B CB    1 
ATOM   3095  C  CG    . ARG B 1 175  ? 24.093  24.098  122.117 1.00 129.98 ? 175  ARG B CG    1 
ATOM   3096  C  CD    . ARG B 1 175  ? 22.654  23.757  121.709 1.00 132.61 ? 175  ARG B CD    1 
ATOM   3097  N  NE    . ARG B 1 175  ? 21.705  24.174  122.744 1.00 140.42 ? 175  ARG B NE    1 
ATOM   3098  C  CZ    . ARG B 1 175  ? 21.280  23.391  123.736 1.00 140.29 ? 175  ARG B CZ    1 
ATOM   3099  N  NH1   . ARG B 1 175  ? 21.708  22.139  123.820 1.00 136.24 ? 175  ARG B NH1   1 
ATOM   3100  N  NH2   . ARG B 1 175  ? 20.424  23.857  124.643 1.00 136.34 ? 175  ARG B NH2   1 
ATOM   3101  N  N     . ARG B 1 176  ? 27.977  22.060  120.392 1.00 125.54 ? 176  ARG B N     1 
ATOM   3102  C  CA    . ARG B 1 176  ? 28.864  21.219  119.604 1.00 125.88 ? 176  ARG B CA    1 
ATOM   3103  C  C     . ARG B 1 176  ? 30.304  21.723  119.614 1.00 122.67 ? 176  ARG B C     1 
ATOM   3104  O  O     . ARG B 1 176  ? 30.536  22.928  119.673 1.00 123.32 ? 176  ARG B O     1 
ATOM   3105  C  CB    . ARG B 1 176  ? 28.372  21.125  118.157 1.00 136.04 ? 176  ARG B CB    1 
ATOM   3106  C  CG    . ARG B 1 176  ? 29.379  20.476  117.202 1.00 137.95 ? 176  ARG B CG    1 
ATOM   3107  C  CD    . ARG B 1 176  ? 28.692  19.742  116.095 1.00 139.89 ? 176  ARG B CD    1 
ATOM   3108  N  NE    . ARG B 1 176  ? 28.096  20.665  115.144 1.00 139.67 ? 176  ARG B NE    1 
ATOM   3109  C  CZ    . ARG B 1 176  ? 28.535  20.824  113.905 1.00 144.26 ? 176  ARG B CZ    1 
ATOM   3110  N  NH1   . ARG B 1 176  ? 29.568  20.104  113.465 1.00 146.52 ? 176  ARG B NH1   1 
ATOM   3111  N  NH2   . ARG B 1 176  ? 27.928  21.689  113.105 1.00 145.15 ? 176  ARG B NH2   1 
ATOM   3112  N  N     . VAL B 1 177  ? 31.257  20.793  119.563 1.00 119.35 ? 177  VAL B N     1 
ATOM   3113  C  CA    . VAL B 1 177  ? 32.598  21.067  119.079 1.00 112.94 ? 177  VAL B CA    1 
ATOM   3114  C  C     . VAL B 1 177  ? 32.743  20.269  117.801 1.00 122.73 ? 177  VAL B C     1 
ATOM   3115  O  O     . VAL B 1 177  ? 32.295  19.119  117.736 1.00 125.87 ? 177  VAL B O     1 
ATOM   3116  C  CB    . VAL B 1 177  ? 33.682  20.555  120.040 1.00 107.17 ? 177  VAL B CB    1 
ATOM   3117  C  CG1   . VAL B 1 177  ? 35.051  20.917  119.538 1.00 100.68 ? 177  VAL B CG1   1 
ATOM   3118  C  CG2   . VAL B 1 177  ? 33.490  21.125  121.406 1.00 115.04 ? 177  VAL B CG2   1 
ATOM   3119  N  N     . ALA B 1 178  ? 33.320  20.887  116.774 1.00 125.99 ? 178  ALA B N     1 
ATOM   3120  C  CA    . ALA B 1 178  ? 33.927  20.155  115.656 1.00 129.22 ? 178  ALA B CA    1 
ATOM   3121  C  C     . ALA B 1 178  ? 35.198  20.908  115.245 1.00 125.70 ? 178  ALA B C     1 
ATOM   3122  O  O     . ALA B 1 178  ? 35.220  22.135  115.268 1.00 128.75 ? 178  ALA B O     1 
ATOM   3123  C  CB    . ALA B 1 178  ? 32.955  20.007  114.480 1.00 130.66 ? 178  ALA B CB    1 
ATOM   3124  N  N     . PHE B 1 179  ? 36.265  20.183  114.917 1.00 125.55 ? 179  PHE B N     1 
ATOM   3125  C  CA    . PHE B 1 179  ? 37.522  20.816  114.488 1.00 132.25 ? 179  PHE B CA    1 
ATOM   3126  C  C     . PHE B 1 179  ? 38.146  20.157  113.243 1.00 141.84 ? 179  PHE B C     1 
ATOM   3127  O  O     . PHE B 1 179  ? 37.921  18.971  112.974 1.00 144.28 ? 179  PHE B O     1 
ATOM   3128  C  CB    . PHE B 1 179  ? 38.540  20.912  115.639 1.00 125.59 ? 179  PHE B CB    1 
ATOM   3129  C  CG    . PHE B 1 179  ? 39.226  19.610  115.974 1.00 124.40 ? 179  PHE B CG    1 
ATOM   3130  C  CD1   . PHE B 1 179  ? 40.582  19.455  115.752 1.00 116.01 ? 179  PHE B CD1   1 
ATOM   3131  C  CD2   . PHE B 1 179  ? 38.513  18.548  116.531 1.00 126.77 ? 179  PHE B CD2   1 
ATOM   3132  C  CE1   . PHE B 1 179  ? 41.209  18.265  116.066 1.00 119.44 ? 179  PHE B CE1   1 
ATOM   3133  C  CE2   . PHE B 1 179  ? 39.137  17.349  116.852 1.00 120.36 ? 179  PHE B CE2   1 
ATOM   3134  C  CZ    . PHE B 1 179  ? 40.483  17.209  116.621 1.00 122.31 ? 179  PHE B CZ    1 
ATOM   3135  N  N     . GLN B 1 180  ? 38.904  20.943  112.476 1.00 141.15 ? 180  GLN B N     1 
ATOM   3136  C  CA    . GLN B 1 180  ? 39.486  20.484  111.219 1.00 138.67 ? 180  GLN B CA    1 
ATOM   3137  C  C     . GLN B 1 180  ? 40.951  20.913  111.120 1.00 133.41 ? 180  GLN B C     1 
ATOM   3138  O  O     . GLN B 1 180  ? 41.248  22.092  111.009 1.00 138.90 ? 180  GLN B O     1 
ATOM   3139  C  CB    . GLN B 1 180  ? 38.676  21.080  110.060 1.00 147.21 ? 180  GLN B CB    1 
ATOM   3140  C  CG    . GLN B 1 180  ? 38.553  20.220  108.804 1.00 155.56 ? 180  GLN B CG    1 
ATOM   3141  C  CD    . GLN B 1 180  ? 37.436  20.707  107.876 1.00 166.54 ? 180  GLN B CD    1 
ATOM   3142  O  OE1   . GLN B 1 180  ? 36.272  20.810  108.283 1.00 159.75 ? 180  GLN B OE1   1 
ATOM   3143  N  NE2   . GLN B 1 180  ? 37.791  21.016  106.625 1.00 171.10 ? 180  GLN B NE2   1 
ATOM   3144  N  N     . VAL B 1 181  ? 41.867  19.958  111.119 1.00 128.62 ? 181  VAL B N     1 
ATOM   3145  C  CA    . VAL B 1 181  ? 43.283  20.268  110.944 1.00 136.04 ? 181  VAL B CA    1 
ATOM   3146  C  C     . VAL B 1 181  ? 43.577  20.196  109.444 1.00 148.67 ? 181  VAL B C     1 
ATOM   3147  O  O     . VAL B 1 181  ? 42.930  19.422  108.741 1.00 150.57 ? 181  VAL B O     1 
ATOM   3148  C  CB    . VAL B 1 181  ? 44.185  19.282  111.739 1.00 132.81 ? 181  VAL B CB    1 
ATOM   3149  C  CG1   . VAL B 1 181  ? 45.658  19.498  111.437 1.00 129.77 ? 181  VAL B CG1   1 
ATOM   3150  C  CG2   . VAL B 1 181  ? 43.933  19.418  113.222 1.00 131.86 ? 181  VAL B CG2   1 
ATOM   3151  N  N     . GLU B 1 182  ? 44.480  21.046  108.944 1.00 153.35 ? 182  GLU B N     1 
ATOM   3152  C  CA    . GLU B 1 182  ? 44.868  21.048  107.518 1.00 153.77 ? 182  GLU B CA    1 
ATOM   3153  C  C     . GLU B 1 182  ? 46.342  21.418  107.281 1.00 151.22 ? 182  GLU B C     1 
ATOM   3154  O  O     . GLU B 1 182  ? 47.027  21.864  108.197 1.00 151.01 ? 182  GLU B O     1 
ATOM   3155  C  CB    . GLU B 1 182  ? 43.935  21.937  106.681 1.00 152.42 ? 182  GLU B CB    1 
ATOM   3156  C  CG    . GLU B 1 182  ? 43.926  23.405  107.057 1.00 153.92 ? 182  GLU B CG    1 
ATOM   3157  C  CD    . GLU B 1 182  ? 42.537  24.004  106.993 1.00 157.26 ? 182  GLU B CD    1 
ATOM   3158  O  OE1   . GLU B 1 182  ? 41.555  23.248  107.172 1.00 157.32 ? 182  GLU B OE1   1 
ATOM   3159  O  OE2   . GLU B 1 182  ? 42.432  25.229  106.761 1.00 163.44 ? 182  GLU B OE2   1 
ATOM   3160  N  N     . ASP B 1 183  ? 46.836  21.209  106.064 1.00 152.03 ? 183  ASP B N     1 
ATOM   3161  C  CA    . ASP B 1 183  ? 48.227  21.536  105.751 1.00 158.61 ? 183  ASP B CA    1 
ATOM   3162  C  C     . ASP B 1 183  ? 48.473  23.040  105.583 1.00 160.97 ? 183  ASP B C     1 
ATOM   3163  O  O     . ASP B 1 183  ? 47.585  23.782  105.163 1.00 160.64 ? 183  ASP B O     1 
ATOM   3164  C  CB    . ASP B 1 183  ? 48.690  20.773  104.509 1.00 165.93 ? 183  ASP B CB    1 
ATOM   3165  C  CG    . ASP B 1 183  ? 49.208  19.382  104.838 1.00 168.19 ? 183  ASP B CG    1 
ATOM   3166  O  OD1   . ASP B 1 183  ? 50.407  19.274  105.195 1.00 168.27 ? 183  ASP B OD1   1 
ATOM   3167  O  OD2   . ASP B 1 183  ? 48.422  18.406  104.734 1.00 162.57 ? 183  ASP B OD2   1 
ATOM   3168  N  N     . THR B 1 184  ? 49.677  23.489  105.931 1.00 160.27 ? 184  THR B N     1 
ATOM   3169  C  CA    . THR B 1 184  ? 50.036  24.895  105.758 1.00 162.15 ? 184  THR B CA    1 
ATOM   3170  C  C     . THR B 1 184  ? 51.506  25.089  105.376 1.00 170.50 ? 184  THR B C     1 
ATOM   3171  O  O     . THR B 1 184  ? 52.390  24.500  105.995 1.00 170.12 ? 184  THR B O     1 
ATOM   3172  C  CB    . THR B 1 184  ? 49.653  25.715  107.008 1.00 153.80 ? 184  THR B CB    1 
ATOM   3173  O  OG1   . THR B 1 184  ? 48.375  26.323  106.790 1.00 147.77 ? 184  THR B OG1   1 
ATOM   3174  C  CG2   . THR B 1 184  ? 50.677  26.797  107.312 1.00 158.78 ? 184  THR B CG2   1 
ATOM   3175  N  N     . ARG B 1 185  ? 51.750  25.921  104.358 1.00 178.74 ? 185  ARG B N     1 
ATOM   3176  C  CA    . ARG B 1 185  ? 53.102  26.195  103.845 1.00 185.78 ? 185  ARG B CA    1 
ATOM   3177  C  C     . ARG B 1 185  ? 53.715  27.399  104.561 1.00 188.70 ? 185  ARG B C     1 
ATOM   3178  O  O     . ARG B 1 185  ? 53.098  28.468  104.618 1.00 187.47 ? 185  ARG B O     1 
ATOM   3179  C  CB    . ARG B 1 185  ? 53.071  26.475  102.325 1.00 188.20 ? 185  ARG B CB    1 
ATOM   3180  C  CG    . ARG B 1 185  ? 53.972  25.585  101.446 1.00 184.77 ? 185  ARG B CG    1 
ATOM   3181  C  CD    . ARG B 1 185  ? 53.195  25.110  100.212 1.00 186.77 ? 185  ARG B CD    1 
ATOM   3182  N  NE    . ARG B 1 185  ? 51.750  25.185  100.460 1.00 197.92 ? 185  ARG B NE    1 
ATOM   3183  C  CZ    . ARG B 1 185  ? 50.938  24.146  100.677 1.00 191.01 ? 185  ARG B CZ    1 
ATOM   3184  N  NH1   . ARG B 1 185  ? 51.397  22.904  100.650 1.00 182.05 ? 185  ARG B NH1   1 
ATOM   3185  N  NH2   . ARG B 1 185  ? 49.646  24.351  100.908 1.00 176.81 ? 185  ARG B NH2   1 
ATOM   3186  N  N     . LEU B 1 186  ? 54.914  27.231  105.120 1.00 188.17 ? 186  LEU B N     1 
ATOM   3187  C  CA    . LEU B 1 186  ? 55.679  28.387  105.574 1.00 190.25 ? 186  LEU B CA    1 
ATOM   3188  C  C     . LEU B 1 186  ? 56.988  28.442  104.797 1.00 192.44 ? 186  LEU B C     1 
ATOM   3189  O  O     . LEU B 1 186  ? 57.915  27.683  105.086 1.00 192.28 ? 186  LEU B O     1 
ATOM   3190  C  CB    . LEU B 1 186  ? 55.956  28.300  107.081 1.00 185.85 ? 186  LEU B CB    1 
ATOM   3191  C  CG    . LEU B 1 186  ? 56.593  29.498  107.800 1.00 187.76 ? 186  LEU B CG    1 
ATOM   3192  C  CD1   . LEU B 1 186  ? 58.122  29.472  107.757 1.00 188.26 ? 186  LEU B CD1   1 
ATOM   3193  C  CD2   . LEU B 1 186  ? 56.065  30.808  107.229 1.00 192.85 ? 186  LEU B CD2   1 
ATOM   3194  N  N     . GLY B 1 187  ? 57.077  29.380  103.853 1.00 193.67 ? 187  GLY B N     1 
ATOM   3195  C  CA    . GLY B 1 187  ? 58.276  29.528  103.054 1.00 189.61 ? 187  GLY B CA    1 
ATOM   3196  C  C     . GLY B 1 187  ? 58.617  28.227  102.370 1.00 190.99 ? 187  GLY B C     1 
ATOM   3197  O  O     . GLY B 1 187  ? 57.886  27.718  101.510 1.00 183.37 ? 187  GLY B O     1 
ATOM   3198  N  N     . GLN B 1 188  ? 59.790  27.735  102.744 1.00 198.31 ? 188  GLN B N     1 
ATOM   3199  C  CA    . GLN B 1 188  ? 60.255  26.402  102.414 1.00 200.70 ? 188  GLN B CA    1 
ATOM   3200  C  C     . GLN B 1 188  ? 59.449  25.260  103.058 1.00 208.50 ? 188  GLN B C     1 
ATOM   3201  O  O     . GLN B 1 188  ? 59.333  24.199  102.448 1.00 210.48 ? 188  GLN B O     1 
ATOM   3202  C  CB    . GLN B 1 188  ? 61.723  26.272  102.821 1.00 201.87 ? 188  GLN B CB    1 
ATOM   3203  C  CG    . GLN B 1 188  ? 61.981  26.627  104.286 1.00 205.29 ? 188  GLN B CG    1 
ATOM   3204  C  CD    . GLN B 1 188  ? 63.454  26.587  104.654 1.00 218.18 ? 188  GLN B CD    1 
ATOM   3205  O  OE1   . GLN B 1 188  ? 64.330  26.618  103.784 1.00 216.51 ? 188  GLN B OE1   1 
ATOM   3206  N  NE2   . GLN B 1 188  ? 63.734  26.518  105.953 1.00 223.33 ? 188  GLN B NE2   1 
ATOM   3207  N  N     . ARG B 1 189  ? 58.887  25.461  104.261 1.00 206.30 ? 189  ARG B N     1 
ATOM   3208  C  CA    . ARG B 1 189  ? 58.287  24.343  105.032 1.00 195.84 ? 189  ARG B CA    1 
ATOM   3209  C  C     . ARG B 1 189  ? 56.807  24.085  104.704 1.00 190.09 ? 189  ARG B C     1 
ATOM   3210  O  O     . ARG B 1 189  ? 55.947  24.910  105.017 1.00 187.11 ? 189  ARG B O     1 
ATOM   3211  C  CB    . ARG B 1 189  ? 58.402  24.595  106.538 1.00 189.21 ? 189  ARG B CB    1 
ATOM   3212  C  CG    . ARG B 1 189  ? 59.765  25.027  107.053 1.00 192.43 ? 189  ARG B CG    1 
ATOM   3213  C  CD    . ARG B 1 189  ? 59.582  25.775  108.367 1.00 197.67 ? 189  ARG B CD    1 
ATOM   3214  N  NE    . ARG B 1 189  ? 60.788  25.857  109.194 1.00 207.79 ? 189  ARG B NE    1 
ATOM   3215  C  CZ    . ARG B 1 189  ? 60.905  25.324  110.411 1.00 210.36 ? 189  ARG B CZ    1 
ATOM   3216  N  NH1   . ARG B 1 189  ? 62.035  25.459  111.096 1.00 214.61 ? 189  ARG B NH1   1 
ATOM   3217  N  NH2   . ARG B 1 189  ? 59.893  24.655  110.950 1.00 202.74 ? 189  ARG B NH2   1 
ATOM   3218  N  N     . THR B 1 190  ? 56.525  22.927  104.098 1.00 187.69 ? 190  THR B N     1 
ATOM   3219  C  CA    . THR B 1 190  ? 55.192  22.599  103.548 1.00 188.02 ? 190  THR B CA    1 
ATOM   3220  C  C     . THR B 1 190  ? 54.241  21.794  104.475 1.00 180.29 ? 190  THR B C     1 
ATOM   3221  O  O     . THR B 1 190  ? 53.030  21.687  104.219 1.00 172.97 ? 190  THR B O     1 
ATOM   3222  C  CB    . THR B 1 190  ? 55.353  21.849  102.175 1.00 188.62 ? 190  THR B CB    1 
ATOM   3223  O  OG1   . THR B 1 190  ? 56.227  22.587  101.310 1.00 190.73 ? 190  THR B OG1   1 
ATOM   3224  C  CG2   . THR B 1 190  ? 54.027  21.658  101.460 1.00 183.20 ? 190  THR B CG2   1 
ATOM   3225  N  N     . ASP B 1 191  ? 54.777  21.259  105.568 1.00 176.95 ? 191  ASP B N     1 
ATOM   3226  C  CA    . ASP B 1 191  ? 54.034  20.265  106.340 1.00 171.77 ? 191  ASP B CA    1 
ATOM   3227  C  C     . ASP B 1 191  ? 53.286  20.769  107.568 1.00 162.92 ? 191  ASP B C     1 
ATOM   3228  O  O     . ASP B 1 191  ? 52.611  19.997  108.244 1.00 159.28 ? 191  ASP B O     1 
ATOM   3229  C  CB    . ASP B 1 191  ? 54.954  19.119  106.751 1.00 171.61 ? 191  ASP B CB    1 
ATOM   3230  C  CG    . ASP B 1 191  ? 54.274  17.769  106.643 1.00 173.43 ? 191  ASP B CG    1 
ATOM   3231  O  OD1   . ASP B 1 191  ? 53.232  17.687  105.955 1.00 175.24 ? 191  ASP B OD1   1 
ATOM   3232  O  OD2   . ASP B 1 191  ? 54.780  16.788  107.232 1.00 171.29 ? 191  ASP B OD2   1 
ATOM   3233  N  N     . LEU B 1 192  ? 53.391  22.055  107.853 1.00 160.59 ? 192  LEU B N     1 
ATOM   3234  C  CA    . LEU B 1 192  ? 52.950  22.555  109.145 1.00 156.94 ? 192  LEU B CA    1 
ATOM   3235  C  C     . LEU B 1 192  ? 51.426  22.457  109.315 1.00 157.57 ? 192  LEU B C     1 
ATOM   3236  O  O     . LEU B 1 192  ? 50.693  22.412  108.320 1.00 158.06 ? 192  LEU B O     1 
ATOM   3237  C  CB    . LEU B 1 192  ? 53.477  23.975  109.377 1.00 156.89 ? 192  LEU B CB    1 
ATOM   3238  C  CG    . LEU B 1 192  ? 54.999  24.136  109.575 1.00 159.27 ? 192  LEU B CG    1 
ATOM   3239  C  CD1   . LEU B 1 192  ? 55.768  22.803  109.599 1.00 157.88 ? 192  LEU B CD1   1 
ATOM   3240  C  CD2   . LEU B 1 192  ? 55.593  25.086  108.542 1.00 170.52 ? 192  LEU B CD2   1 
ATOM   3241  N  N     . ASP B 1 193  ? 50.977  22.391  110.576 1.00 151.37 ? 193  ASP B N     1 
ATOM   3242  C  CA    . ASP B 1 193  ? 49.564  22.192  110.951 1.00 144.73 ? 193  ASP B CA    1 
ATOM   3243  C  C     . ASP B 1 193  ? 48.820  23.534  111.127 1.00 139.89 ? 193  ASP B C     1 
ATOM   3244  O  O     . ASP B 1 193  ? 49.356  24.448  111.750 1.00 140.58 ? 193  ASP B O     1 
ATOM   3245  C  CB    . ASP B 1 193  ? 49.474  21.399  112.275 1.00 138.66 ? 193  ASP B CB    1 
ATOM   3246  C  CG    . ASP B 1 193  ? 49.580  19.875  112.091 1.00 136.01 ? 193  ASP B CG    1 
ATOM   3247  O  OD1   . ASP B 1 193  ? 50.671  19.392  111.735 1.00 141.25 ? 193  ASP B OD1   1 
ATOM   3248  O  OD2   . ASP B 1 193  ? 48.589  19.148  112.349 1.00 126.81 ? 193  ASP B OD2   1 
ATOM   3249  N  N     . LYS B 1 194  ? 47.602  23.648  110.583 1.00 137.65 ? 194  LYS B N     1 
ATOM   3250  C  CA    . LYS B 1 194  ? 46.706  24.793  110.841 1.00 136.29 ? 194  LYS B CA    1 
ATOM   3251  C  C     . LYS B 1 194  ? 45.418  24.309  111.482 1.00 136.55 ? 194  LYS B C     1 
ATOM   3252  O  O     . LYS B 1 194  ? 44.767  23.411  110.960 1.00 138.97 ? 194  LYS B O     1 
ATOM   3253  C  CB    . LYS B 1 194  ? 46.339  25.546  109.556 1.00 143.04 ? 194  LYS B CB    1 
ATOM   3254  C  CG    . LYS B 1 194  ? 45.045  26.385  109.685 1.00 142.44 ? 194  LYS B CG    1 
ATOM   3255  C  CD    . LYS B 1 194  ? 44.682  27.129  108.398 1.00 147.14 ? 194  LYS B CD    1 
ATOM   3256  C  CE    . LYS B 1 194  ? 43.495  28.075  108.597 1.00 147.18 ? 194  LYS B CE    1 
ATOM   3257  N  NZ    . LYS B 1 194  ? 43.146  28.829  107.350 1.00 148.58 ? 194  LYS B NZ    1 
ATOM   3258  N  N     . LEU B 1 195  ? 45.029  24.922  112.595 1.00 138.96 ? 195  LEU B N     1 
ATOM   3259  C  CA    . LEU B 1 195  ? 43.917  24.402  113.400 1.00 144.05 ? 195  LEU B CA    1 
ATOM   3260  C  C     . LEU B 1 195  ? 42.654  25.290  113.386 1.00 145.78 ? 195  LEU B C     1 
ATOM   3261  O  O     . LEU B 1 195  ? 42.634  26.371  113.978 1.00 146.78 ? 195  LEU B O     1 
ATOM   3262  C  CB    . LEU B 1 195  ? 44.408  24.148  114.842 1.00 134.70 ? 195  LEU B CB    1 
ATOM   3263  C  CG    . LEU B 1 195  ? 43.581  23.476  115.944 1.00 122.36 ? 195  LEU B CG    1 
ATOM   3264  C  CD1   . LEU B 1 195  ? 42.913  22.204  115.470 1.00 127.72 ? 195  LEU B CD1   1 
ATOM   3265  C  CD2   . LEU B 1 195  ? 44.505  23.170  117.102 1.00 120.13 ? 195  LEU B CD2   1 
ATOM   3266  N  N     . THR B 1 196  ? 41.606  24.823  112.707 1.00 143.47 ? 196  THR B N     1 
ATOM   3267  C  CA    . THR B 1 196  ? 40.312  25.500  112.712 1.00 138.12 ? 196  THR B CA    1 
ATOM   3268  C  C     . THR B 1 196  ? 39.422  24.796  113.736 1.00 132.61 ? 196  THR B C     1 
ATOM   3269  O  O     . THR B 1 196  ? 39.441  23.575  113.848 1.00 134.10 ? 196  THR B O     1 
ATOM   3270  C  CB    . THR B 1 196  ? 39.660  25.512  111.295 1.00 143.71 ? 196  THR B CB    1 
ATOM   3271  O  OG1   . THR B 1 196  ? 40.398  26.392  110.433 1.00 144.57 ? 196  THR B OG1   1 
ATOM   3272  C  CG2   . THR B 1 196  ? 38.192  25.967  111.345 1.00 141.73 ? 196  THR B CG2   1 
ATOM   3273  N  N     . LEU B 1 197  ? 38.681  25.572  114.516 1.00 131.43 ? 197  LEU B N     1 
ATOM   3274  C  CA    . LEU B 1 197  ? 37.809  25.017  115.536 1.00 124.78 ? 197  LEU B CA    1 
ATOM   3275  C  C     . LEU B 1 197  ? 36.520  25.824  115.644 1.00 127.31 ? 197  LEU B C     1 
ATOM   3276  O  O     . LEU B 1 197  ? 36.547  27.050  115.703 1.00 131.17 ? 197  LEU B O     1 
ATOM   3277  C  CB    . LEU B 1 197  ? 38.532  24.988  116.874 1.00 113.33 ? 197  LEU B CB    1 
ATOM   3278  C  CG    . LEU B 1 197  ? 37.643  24.663  118.061 1.00 110.56 ? 197  LEU B CG    1 
ATOM   3279  C  CD1   . LEU B 1 197  ? 36.977  23.333  117.848 1.00 116.69 ? 197  LEU B CD1   1 
ATOM   3280  C  CD2   . LEU B 1 197  ? 38.458  24.657  119.322 1.00 104.29 ? 197  LEU B CD2   1 
ATOM   3281  N  N     . ARG B 1 198  ? 35.391  25.129  115.666 1.00 124.05 ? 198  ARG B N     1 
ATOM   3282  C  CA    . ARG B 1 198  ? 34.097  25.776  115.775 1.00 126.59 ? 198  ARG B CA    1 
ATOM   3283  C  C     . ARG B 1 198  ? 33.436  25.323  117.069 1.00 124.32 ? 198  ARG B C     1 
ATOM   3284  O  O     . ARG B 1 198  ? 33.417  24.131  117.362 1.00 123.74 ? 198  ARG B O     1 
ATOM   3285  C  CB    . ARG B 1 198  ? 33.224  25.411  114.566 1.00 132.47 ? 198  ARG B CB    1 
ATOM   3286  C  CG    . ARG B 1 198  ? 33.911  25.613  113.199 1.00 139.12 ? 198  ARG B CG    1 
ATOM   3287  C  CD    . ARG B 1 198  ? 32.972  25.317  112.010 1.00 149.35 ? 198  ARG B CD    1 
ATOM   3288  N  NE    . ARG B 1 198  ? 32.765  23.883  111.771 1.00 154.09 ? 198  ARG B NE    1 
ATOM   3289  C  CZ    . ARG B 1 198  ? 31.931  23.373  110.862 1.00 152.01 ? 198  ARG B CZ    1 
ATOM   3290  N  NH1   . ARG B 1 198  ? 31.209  24.177  110.090 1.00 152.80 ? 198  ARG B NH1   1 
ATOM   3291  N  NH2   . ARG B 1 198  ? 31.811  22.053  110.727 1.00 142.37 ? 198  ARG B NH2   1 
ATOM   3292  N  N     . ILE B 1 199  ? 32.920  26.273  117.851 1.00 127.40 ? 199  ILE B N     1 
ATOM   3293  C  CA    . ILE B 1 199  ? 32.186  25.955  119.083 1.00 127.62 ? 199  ILE B CA    1 
ATOM   3294  C  C     . ILE B 1 199  ? 30.822  26.659  119.178 1.00 130.64 ? 199  ILE B C     1 
ATOM   3295  O  O     . ILE B 1 199  ? 30.746  27.888  119.137 1.00 137.02 ? 199  ILE B O     1 
ATOM   3296  C  CB    . ILE B 1 199  ? 32.973  26.334  120.352 1.00 121.35 ? 199  ILE B CB    1 
ATOM   3297  C  CG1   . ILE B 1 199  ? 34.432  25.914  120.267 1.00 113.33 ? 199  ILE B CG1   1 
ATOM   3298  C  CG2   . ILE B 1 199  ? 32.325  25.710  121.570 1.00 121.27 ? 199  ILE B CG2   1 
ATOM   3299  C  CD1   . ILE B 1 199  ? 35.175  26.172  121.551 1.00 112.10 ? 199  ILE B CD1   1 
ATOM   3300  N  N     . TRP B 1 200  ? 29.751  25.885  119.324 1.00 125.76 ? 200  TRP B N     1 
ATOM   3301  C  CA    . TRP B 1 200  ? 28.421  26.466  119.497 1.00 133.36 ? 200  TRP B CA    1 
ATOM   3302  C  C     . TRP B 1 200  ? 28.010  26.480  120.980 1.00 140.44 ? 200  TRP B C     1 
ATOM   3303  O  O     . TRP B 1 200  ? 28.288  25.528  121.711 1.00 139.33 ? 200  TRP B O     1 
ATOM   3304  C  CB    . TRP B 1 200  ? 27.384  25.697  118.670 1.00 136.45 ? 200  TRP B CB    1 
ATOM   3305  C  CG    . TRP B 1 200  ? 27.558  25.793  117.167 1.00 140.49 ? 200  TRP B CG    1 
ATOM   3306  C  CD1   . TRP B 1 200  ? 26.849  26.588  116.309 1.00 143.24 ? 200  TRP B CD1   1 
ATOM   3307  C  CD2   . TRP B 1 200  ? 28.482  25.054  116.351 1.00 141.59 ? 200  TRP B CD2   1 
ATOM   3308  N  NE1   . TRP B 1 200  ? 27.280  26.397  115.019 1.00 142.58 ? 200  TRP B NE1   1 
ATOM   3309  C  CE2   . TRP B 1 200  ? 28.283  25.459  115.018 1.00 140.72 ? 200  TRP B CE2   1 
ATOM   3310  C  CE3   . TRP B 1 200  ? 29.464  24.090  116.619 1.00 139.07 ? 200  TRP B CE3   1 
ATOM   3311  C  CZ2   . TRP B 1 200  ? 29.027  24.942  113.958 1.00 140.08 ? 200  TRP B CZ2   1 
ATOM   3312  C  CZ3   . TRP B 1 200  ? 30.201  23.576  115.565 1.00 133.07 ? 200  TRP B CZ3   1 
ATOM   3313  C  CH2   . TRP B 1 200  ? 29.979  24.004  114.255 1.00 138.23 ? 200  TRP B CH2   1 
ATOM   3314  N  N     . THR B 1 201  ? 27.351  27.551  121.426 1.00 143.70 ? 201  THR B N     1 
ATOM   3315  C  CA    . THR B 1 201  ? 26.879  27.642  122.813 1.00 137.38 ? 201  THR B CA    1 
ATOM   3316  C  C     . THR B 1 201  ? 25.377  27.886  122.837 1.00 136.30 ? 201  THR B C     1 
ATOM   3317  O  O     . THR B 1 201  ? 24.786  28.257  121.822 1.00 133.92 ? 201  THR B O     1 
ATOM   3318  C  CB    . THR B 1 201  ? 27.584  28.778  123.601 1.00 136.41 ? 201  THR B CB    1 
ATOM   3319  O  OG1   . THR B 1 201  ? 28.970  28.826  123.256 1.00 135.98 ? 201  THR B OG1   1 
ATOM   3320  C  CG2   . THR B 1 201  ? 27.488  28.551  125.077 1.00 131.56 ? 201  THR B CG2   1 
ATOM   3321  N  N     . ASP B 1 202  ? 24.760  27.665  123.996 1.00 139.59 ? 202  ASP B N     1 
ATOM   3322  C  CA    . ASP B 1 202  ? 23.365  28.044  124.201 1.00 144.15 ? 202  ASP B CA    1 
ATOM   3323  C  C     . ASP B 1 202  ? 23.286  29.518  124.602 1.00 145.95 ? 202  ASP B C     1 
ATOM   3324  O  O     . ASP B 1 202  ? 22.202  30.042  124.897 1.00 143.06 ? 202  ASP B O     1 
ATOM   3325  C  CB    . ASP B 1 202  ? 22.643  27.129  125.208 1.00 139.05 ? 202  ASP B CB    1 
ATOM   3326  C  CG    . ASP B 1 202  ? 23.410  26.942  126.512 1.00 136.65 ? 202  ASP B CG    1 
ATOM   3327  O  OD1   . ASP B 1 202  ? 24.296  27.766  126.813 1.00 135.66 ? 202  ASP B OD1   1 
ATOM   3328  O  OD2   . ASP B 1 202  ? 23.107  25.970  127.246 1.00 133.55 ? 202  ASP B OD2   1 
ATOM   3329  N  N     . GLY B 1 203  ? 24.450  30.170  124.611 1.00 141.91 ? 203  GLY B N     1 
ATOM   3330  C  CA    . GLY B 1 203  ? 24.537  31.594  124.853 1.00 140.07 ? 203  GLY B CA    1 
ATOM   3331  C  C     . GLY B 1 203  ? 24.654  31.941  126.321 1.00 145.95 ? 203  GLY B C     1 
ATOM   3332  O  O     . GLY B 1 203  ? 24.662  33.123  126.669 1.00 149.62 ? 203  GLY B O     1 
ATOM   3333  N  N     . SER B 1 204  ? 24.693  30.929  127.190 1.00 144.81 ? 204  SER B N     1 
ATOM   3334  C  CA    . SER B 1 204  ? 24.993  31.168  128.605 1.00 142.09 ? 204  SER B CA    1 
ATOM   3335  C  C     . SER B 1 204  ? 26.482  31.452  128.849 1.00 141.62 ? 204  SER B C     1 
ATOM   3336  O  O     . SER B 1 204  ? 26.851  32.501  129.375 1.00 140.98 ? 204  SER B O     1 
ATOM   3337  C  CB    . SER B 1 204  ? 24.483  30.023  129.493 1.00 136.65 ? 204  SER B CB    1 
ATOM   3338  O  OG    . SER B 1 204  ? 25.116  28.789  129.197 1.00 132.52 ? 204  SER B OG    1 
ATOM   3339  N  N     . VAL B 1 205  ? 27.342  30.534  128.435 1.00 139.76 ? 205  VAL B N     1 
ATOM   3340  C  CA    . VAL B 1 205  ? 28.759  30.827  128.428 1.00 136.78 ? 205  VAL B CA    1 
ATOM   3341  C  C     . VAL B 1 205  ? 29.017  31.256  126.988 1.00 137.20 ? 205  VAL B C     1 
ATOM   3342  O  O     . VAL B 1 205  ? 28.127  31.164  126.144 1.00 136.46 ? 205  VAL B O     1 
ATOM   3343  C  CB    . VAL B 1 205  ? 29.578  29.581  128.854 1.00 135.20 ? 205  VAL B CB    1 
ATOM   3344  C  CG1   . VAL B 1 205  ? 31.046  29.898  128.993 1.00 132.98 ? 205  VAL B CG1   1 
ATOM   3345  C  CG2   . VAL B 1 205  ? 29.052  29.043  130.179 1.00 135.26 ? 205  VAL B CG2   1 
ATOM   3346  N  N     . THR B 1 206  ? 30.217  31.718  126.684 1.00 134.75 ? 206  THR B N     1 
ATOM   3347  C  CA    . THR B 1 206  ? 30.473  32.229  125.354 1.00 135.19 ? 206  THR B CA    1 
ATOM   3348  C  C     . THR B 1 206  ? 31.477  31.279  124.767 1.00 136.72 ? 206  THR B C     1 
ATOM   3349  O  O     . THR B 1 206  ? 32.279  30.716  125.513 1.00 136.51 ? 206  THR B O     1 
ATOM   3350  C  CB    . THR B 1 206  ? 31.006  33.688  125.395 1.00 137.01 ? 206  THR B CB    1 
ATOM   3351  O  OG1   . THR B 1 206  ? 30.031  34.571  124.829 1.00 140.15 ? 206  THR B OG1   1 
ATOM   3352  C  CG2   . THR B 1 206  ? 32.304  33.846  124.622 1.00 135.32 ? 206  THR B CG2   1 
ATOM   3353  N  N     . PRO B 1 207  ? 31.413  31.059  123.441 1.00 136.69 ? 207  PRO B N     1 
ATOM   3354  C  CA    . PRO B 1 207  ? 32.342  30.133  122.792 1.00 135.31 ? 207  PRO B CA    1 
ATOM   3355  C  C     . PRO B 1 207  ? 33.801  30.394  123.201 1.00 133.56 ? 207  PRO B C     1 
ATOM   3356  O  O     . PRO B 1 207  ? 34.526  29.462  123.560 1.00 130.61 ? 207  PRO B O     1 
ATOM   3357  C  CB    . PRO B 1 207  ? 32.102  30.415  121.308 1.00 130.65 ? 207  PRO B CB    1 
ATOM   3358  C  CG    . PRO B 1 207  ? 30.667  30.730  121.263 1.00 127.63 ? 207  PRO B CG    1 
ATOM   3359  C  CD    . PRO B 1 207  ? 30.401  31.552  122.490 1.00 132.96 ? 207  PRO B CD    1 
ATOM   3360  N  N     . LEU B 1 208  ? 34.203  31.657  123.214 1.00 133.26 ? 208  LEU B N     1 
ATOM   3361  C  CA    . LEU B 1 208  ? 35.535  32.009  123.676 1.00 133.96 ? 208  LEU B CA    1 
ATOM   3362  C  C     . LEU B 1 208  ? 35.715  31.686  125.152 1.00 134.32 ? 208  LEU B C     1 
ATOM   3363  O  O     . LEU B 1 208  ? 36.718  31.085  125.542 1.00 131.89 ? 208  LEU B O     1 
ATOM   3364  C  CB    . LEU B 1 208  ? 35.809  33.489  123.441 1.00 136.23 ? 208  LEU B CB    1 
ATOM   3365  C  CG    . LEU B 1 208  ? 37.077  34.002  124.126 1.00 141.38 ? 208  LEU B CG    1 
ATOM   3366  C  CD1   . LEU B 1 208  ? 38.335  33.286  123.629 1.00 133.64 ? 208  LEU B CD1   1 
ATOM   3367  C  CD2   . LEU B 1 208  ? 37.195  35.507  123.938 1.00 149.55 ? 208  LEU B CD2   1 
ATOM   3368  N  N     . GLU B 1 209  ? 34.745  32.106  125.962 1.00 137.26 ? 209  GLU B N     1 
ATOM   3369  C  CA    . GLU B 1 209  ? 34.787  31.876  127.398 1.00 136.52 ? 209  GLU B CA    1 
ATOM   3370  C  C     . GLU B 1 209  ? 35.055  30.390  127.642 1.00 136.96 ? 209  GLU B C     1 
ATOM   3371  O  O     . GLU B 1 209  ? 35.957  30.038  128.405 1.00 137.81 ? 209  GLU B O     1 
ATOM   3372  C  CB    . GLU B 1 209  ? 33.485  32.358  128.080 1.00 135.83 ? 209  GLU B CB    1 
ATOM   3373  C  CG    . GLU B 1 209  ? 33.298  33.898  128.137 1.00 136.73 ? 209  GLU B CG    1 
ATOM   3374  C  CD    . GLU B 1 209  ? 32.012  34.356  128.858 1.00 135.95 ? 209  GLU B CD    1 
ATOM   3375  O  OE1   . GLU B 1 209  ? 31.838  35.580  129.053 1.00 130.39 ? 209  GLU B OE1   1 
ATOM   3376  O  OE2   . GLU B 1 209  ? 31.173  33.508  129.231 1.00 136.46 ? 209  GLU B OE2   1 
ATOM   3377  N  N     . ALA B 1 210  ? 34.321  29.535  126.927 1.00 135.31 ? 210  ALA B N     1 
ATOM   3378  C  CA    . ALA B 1 210  ? 34.356  28.080  127.133 1.00 132.40 ? 210  ALA B CA    1 
ATOM   3379  C  C     . ALA B 1 210  ? 35.711  27.452  126.851 1.00 127.57 ? 210  ALA B C     1 
ATOM   3380  O  O     . ALA B 1 210  ? 36.151  26.535  127.552 1.00 124.88 ? 210  ALA B O     1 
ATOM   3381  C  CB    . ALA B 1 210  ? 33.293  27.405  126.283 1.00 127.90 ? 210  ALA B CB    1 
ATOM   3382  N  N     . LEU B 1 211  ? 36.358  27.947  125.808 1.00 128.51 ? 211  LEU B N     1 
ATOM   3383  C  CA    . LEU B 1 211  ? 37.643  27.414  125.388 1.00 130.71 ? 211  LEU B CA    1 
ATOM   3384  C  C     . LEU B 1 211  ? 38.694  27.625  126.468 1.00 131.03 ? 211  LEU B C     1 
ATOM   3385  O  O     . LEU B 1 211  ? 39.462  26.722  126.798 1.00 130.31 ? 211  LEU B O     1 
ATOM   3386  C  CB    . LEU B 1 211  ? 38.088  28.087  124.089 1.00 128.51 ? 211  LEU B CB    1 
ATOM   3387  C  CG    . LEU B 1 211  ? 39.271  27.429  123.390 1.00 121.31 ? 211  LEU B CG    1 
ATOM   3388  C  CD1   . LEU B 1 211  ? 38.922  25.982  123.108 1.00 121.88 ? 211  LEU B CD1   1 
ATOM   3389  C  CD2   . LEU B 1 211  ? 39.635  28.165  122.107 1.00 123.60 ? 211  LEU B CD2   1 
ATOM   3390  N  N     . ASN B 1 212  ? 38.720  28.830  127.018 1.00 130.38 ? 212  ASN B N     1 
ATOM   3391  C  CA    . ASN B 1 212  ? 39.753  29.195  127.961 1.00 128.92 ? 212  ASN B CA    1 
ATOM   3392  C  C     . ASN B 1 212  ? 39.606  28.425  129.246 1.00 129.45 ? 212  ASN B C     1 
ATOM   3393  O  O     . ASN B 1 212  ? 40.600  28.124  129.899 1.00 130.74 ? 212  ASN B O     1 
ATOM   3394  C  CB    . ASN B 1 212  ? 39.724  30.691  128.231 1.00 135.35 ? 212  ASN B CB    1 
ATOM   3395  C  CG    . ASN B 1 212  ? 40.076  31.500  127.008 1.00 139.05 ? 212  ASN B CG    1 
ATOM   3396  O  OD1   . ASN B 1 212  ? 39.250  32.255  126.490 1.00 137.29 ? 212  ASN B OD1   1 
ATOM   3397  N  ND2   . ASN B 1 212  ? 41.311  31.346  126.532 1.00 138.24 ? 212  ASN B ND2   1 
ATOM   3398  N  N     . GLN B 1 213  ? 38.362  28.116  129.604 1.00 129.65 ? 213  GLN B N     1 
ATOM   3399  C  CA    . GLN B 1 213  ? 38.086  27.296  130.775 1.00 133.70 ? 213  GLN B CA    1 
ATOM   3400  C  C     . GLN B 1 213  ? 38.609  25.913  130.483 1.00 130.15 ? 213  GLN B C     1 
ATOM   3401  O  O     . GLN B 1 213  ? 39.197  25.270  131.344 1.00 129.58 ? 213  GLN B O     1 
ATOM   3402  C  CB    . GLN B 1 213  ? 36.587  27.221  131.060 1.00 135.36 ? 213  GLN B CB    1 
ATOM   3403  C  CG    . GLN B 1 213  ? 35.945  28.539  131.480 1.00 136.67 ? 213  GLN B CG    1 
ATOM   3404  C  CD    . GLN B 1 213  ? 34.421  28.468  131.478 1.00 141.58 ? 213  GLN B CD    1 
ATOM   3405  O  OE1   . GLN B 1 213  ? 33.832  27.406  131.715 1.00 139.31 ? 213  GLN B OE1   1 
ATOM   3406  N  NE2   . GLN B 1 213  ? 33.775  29.600  131.193 1.00 140.03 ? 213  GLN B NE2   1 
ATOM   3407  N  N     . ALA B 1 214  ? 38.392  25.468  129.251 1.00 127.51 ? 214  ALA B N     1 
ATOM   3408  C  CA    . ALA B 1 214  ? 38.894  24.178  128.807 1.00 128.55 ? 214  ALA B CA    1 
ATOM   3409  C  C     . ALA B 1 214  ? 40.427  24.105  128.843 1.00 131.33 ? 214  ALA B C     1 
ATOM   3410  O  O     . ALA B 1 214  ? 40.995  23.128  129.341 1.00 128.16 ? 214  ALA B O     1 
ATOM   3411  C  CB    . ALA B 1 214  ? 38.371  23.860  127.418 1.00 124.86 ? 214  ALA B CB    1 
ATOM   3412  N  N     . VAL B 1 215  ? 41.092  25.134  128.319 1.00 131.67 ? 215  VAL B N     1 
ATOM   3413  C  CA    . VAL B 1 215  ? 42.553  25.170  128.337 1.00 128.57 ? 215  VAL B CA    1 
ATOM   3414  C  C     . VAL B 1 215  ? 43.096  25.442  129.740 1.00 135.00 ? 215  VAL B C     1 
ATOM   3415  O  O     . VAL B 1 215  ? 44.118  24.884  130.126 1.00 137.30 ? 215  VAL B O     1 
ATOM   3416  C  CB    . VAL B 1 215  ? 43.146  26.166  127.309 1.00 120.14 ? 215  VAL B CB    1 
ATOM   3417  C  CG1   . VAL B 1 215  ? 42.538  25.923  125.971 1.00 122.47 ? 215  VAL B CG1   1 
ATOM   3418  C  CG2   . VAL B 1 215  ? 42.908  27.600  127.721 1.00 128.44 ? 215  VAL B CG2   1 
ATOM   3419  N  N     . GLU B 1 216  ? 42.409  26.290  130.499 1.00 132.75 ? 216  GLU B N     1 
ATOM   3420  C  CA    . GLU B 1 216  ? 42.766  26.507  131.882 1.00 133.12 ? 216  GLU B CA    1 
ATOM   3421  C  C     . GLU B 1 216  ? 42.808  25.168  132.576 1.00 136.78 ? 216  GLU B C     1 
ATOM   3422  O  O     . GLU B 1 216  ? 43.811  24.822  133.189 1.00 140.23 ? 216  GLU B O     1 
ATOM   3423  C  CB    . GLU B 1 216  ? 41.736  27.395  132.572 1.00 143.46 ? 216  GLU B CB    1 
ATOM   3424  C  CG    . GLU B 1 216  ? 41.663  27.221  134.083 1.00 151.45 ? 216  GLU B CG    1 
ATOM   3425  C  CD    . GLU B 1 216  ? 42.999  27.463  134.766 1.00 160.29 ? 216  GLU B CD    1 
ATOM   3426  O  OE1   . GLU B 1 216  ? 43.171  26.977  135.905 1.00 159.47 ? 216  GLU B OE1   1 
ATOM   3427  O  OE2   . GLU B 1 216  ? 43.877  28.137  134.173 1.00 160.67 ? 216  GLU B OE2   1 
ATOM   3428  N  N     . ILE B 1 217  ? 41.712  24.419  132.459 1.00 135.40 ? 217  ILE B N     1 
ATOM   3429  C  CA    . ILE B 1 217  ? 41.595  23.088  133.049 1.00 134.67 ? 217  ILE B CA    1 
ATOM   3430  C  C     . ILE B 1 217  ? 42.817  22.251  132.713 1.00 131.70 ? 217  ILE B C     1 
ATOM   3431  O  O     . ILE B 1 217  ? 43.424  21.617  133.582 1.00 129.12 ? 217  ILE B O     1 
ATOM   3432  C  CB    . ILE B 1 217  ? 40.340  22.351  132.516 1.00 128.89 ? 217  ILE B CB    1 
ATOM   3433  C  CG1   . ILE B 1 217  ? 39.070  22.922  133.131 1.00 126.94 ? 217  ILE B CG1   1 
ATOM   3434  C  CG2   . ILE B 1 217  ? 40.391  20.872  132.840 1.00 124.51 ? 217  ILE B CG2   1 
ATOM   3435  C  CD1   . ILE B 1 217  ? 37.816  22.453  132.447 1.00 127.26 ? 217  ILE B CD1   1 
ATOM   3436  N  N     . LEU B 1 218  ? 43.184  22.283  131.440 1.00 130.26 ? 218  LEU B N     1 
ATOM   3437  C  CA    . LEU B 1 218  ? 44.280  21.468  130.933 1.00 133.74 ? 218  LEU B CA    1 
ATOM   3438  C  C     . LEU B 1 218  ? 45.635  21.838  131.543 1.00 140.52 ? 218  LEU B C     1 
ATOM   3439  O  O     . LEU B 1 218  ? 46.343  20.965  132.054 1.00 141.92 ? 218  LEU B O     1 
ATOM   3440  C  CB    . LEU B 1 218  ? 44.330  21.540  129.407 1.00 129.48 ? 218  LEU B CB    1 
ATOM   3441  C  CG    . LEU B 1 218  ? 45.279  20.579  128.692 1.00 123.50 ? 218  LEU B CG    1 
ATOM   3442  C  CD1   . LEU B 1 218  ? 45.001  19.145  129.098 1.00 109.04 ? 218  LEU B CD1   1 
ATOM   3443  C  CD2   . LEU B 1 218  ? 45.165  20.747  127.180 1.00 123.31 ? 218  LEU B CD2   1 
ATOM   3444  N  N     . ARG B 1 219  ? 45.988  23.124  131.484 1.00 144.11 ? 219  ARG B N     1 
ATOM   3445  C  CA    . ARG B 1 219  ? 47.235  23.650  132.066 1.00 148.12 ? 219  ARG B CA    1 
ATOM   3446  C  C     . ARG B 1 219  ? 47.322  23.333  133.564 1.00 146.37 ? 219  ARG B C     1 
ATOM   3447  O  O     . ARG B 1 219  ? 48.409  23.115  134.115 1.00 143.24 ? 219  ARG B O     1 
ATOM   3448  C  CB    . ARG B 1 219  ? 47.320  25.172  131.840 1.00 154.43 ? 219  ARG B CB    1 
ATOM   3449  C  CG    . ARG B 1 219  ? 48.642  25.831  132.259 1.00 158.76 ? 219  ARG B CG    1 
ATOM   3450  C  CD    . ARG B 1 219  ? 48.459  27.331  132.525 1.00 156.96 ? 219  ARG B CD    1 
ATOM   3451  N  NE    . ARG B 1 219  ? 47.242  27.612  133.296 1.00 154.45 ? 219  ARG B NE    1 
ATOM   3452  C  CZ    . ARG B 1 219  ? 47.082  27.350  134.593 1.00 150.70 ? 219  ARG B CZ    1 
ATOM   3453  N  NH1   . ARG B 1 219  ? 48.053  26.786  135.300 1.00 152.66 ? 219  ARG B NH1   1 
ATOM   3454  N  NH2   . ARG B 1 219  ? 45.941  27.649  135.191 1.00 147.07 ? 219  ARG B NH2   1 
ATOM   3455  N  N     . GLU B 1 220  ? 46.154  23.315  134.201 1.00 144.23 ? 220  GLU B N     1 
ATOM   3456  C  CA    . GLU B 1 220  ? 46.003  23.004  135.613 1.00 144.09 ? 220  GLU B CA    1 
ATOM   3457  C  C     . GLU B 1 220  ? 46.200  21.518  135.829 1.00 141.22 ? 220  GLU B C     1 
ATOM   3458  O  O     . GLU B 1 220  ? 46.833  21.090  136.796 1.00 140.93 ? 220  GLU B O     1 
ATOM   3459  C  CB    . GLU B 1 220  ? 44.598  23.404  136.062 1.00 145.86 ? 220  GLU B CB    1 
ATOM   3460  C  CG    . GLU B 1 220  ? 44.201  22.957  137.452 1.00 145.38 ? 220  GLU B CG    1 
ATOM   3461  C  CD    . GLU B 1 220  ? 42.730  23.200  137.714 1.00 151.15 ? 220  GLU B CD    1 
ATOM   3462  O  OE1   . GLU B 1 220  ? 42.132  24.058  137.018 1.00 143.76 ? 220  GLU B OE1   1 
ATOM   3463  O  OE2   . GLU B 1 220  ? 42.169  22.522  138.603 1.00 161.28 ? 220  GLU B OE2   1 
ATOM   3464  N  N     . HIS B 1 221  ? 45.640  20.735  134.915 1.00 135.84 ? 221  HIS B N     1 
ATOM   3465  C  CA    . HIS B 1 221  ? 45.770  19.292  134.969 1.00 136.91 ? 221  HIS B CA    1 
ATOM   3466  C  C     . HIS B 1 221  ? 47.214  18.843  134.744 1.00 137.48 ? 221  HIS B C     1 
ATOM   3467  O  O     . HIS B 1 221  ? 47.661  17.859  135.328 1.00 137.96 ? 221  HIS B O     1 
ATOM   3468  C  CB    . HIS B 1 221  ? 44.842  18.642  133.955 1.00 134.71 ? 221  HIS B CB    1 
ATOM   3469  C  CG    . HIS B 1 221  ? 43.536  18.190  134.530 1.00 141.51 ? 221  HIS B CG    1 
ATOM   3470  N  ND1   . HIS B 1 221  ? 43.375  16.963  135.140 1.00 145.75 ? 221  HIS B ND1   1 
ATOM   3471  C  CD2   . HIS B 1 221  ? 42.320  18.787  134.564 1.00 145.46 ? 221  HIS B CD2   1 
ATOM   3472  C  CE1   . HIS B 1 221  ? 42.122  16.831  135.538 1.00 152.85 ? 221  HIS B CE1   1 
ATOM   3473  N  NE2   . HIS B 1 221  ? 41.460  17.922  135.198 1.00 154.53 ? 221  HIS B NE2   1 
ATOM   3474  N  N     . LEU B 1 222  ? 47.951  19.570  133.911 1.00 136.06 ? 222  LEU B N     1 
ATOM   3475  C  CA    . LEU B 1 222  ? 49.358  19.257  133.702 1.00 133.26 ? 222  LEU B CA    1 
ATOM   3476  C  C     . LEU B 1 222  ? 50.198  19.492  134.964 1.00 134.46 ? 222  LEU B C     1 
ATOM   3477  O  O     . LEU B 1 222  ? 51.351  19.072  135.024 1.00 135.57 ? 222  LEU B O     1 
ATOM   3478  C  CB    . LEU B 1 222  ? 49.940  20.051  132.525 1.00 132.51 ? 222  LEU B CB    1 
ATOM   3479  C  CG    . LEU B 1 222  ? 49.438  19.817  131.095 1.00 126.81 ? 222  LEU B CG    1 
ATOM   3480  C  CD1   . LEU B 1 222  ? 50.081  20.833  130.190 1.00 130.20 ? 222  LEU B CD1   1 
ATOM   3481  C  CD2   . LEU B 1 222  ? 49.737  18.425  130.584 1.00 120.70 ? 222  LEU B CD2   1 
ATOM   3482  N  N     . THR B 1 223  ? 49.638  20.156  135.973 1.00 134.94 ? 223  THR B N     1 
ATOM   3483  C  CA    . THR B 1 223  ? 50.396  20.384  137.197 1.00 133.37 ? 223  THR B CA    1 
ATOM   3484  C  C     . THR B 1 223  ? 50.595  19.081  137.938 1.00 139.80 ? 223  THR B C     1 
ATOM   3485  O  O     . THR B 1 223  ? 51.528  18.959  138.719 1.00 145.93 ? 223  THR B O     1 
ATOM   3486  C  CB    . THR B 1 223  ? 49.710  21.365  138.158 1.00 134.58 ? 223  THR B CB    1 
ATOM   3487  O  OG1   . THR B 1 223  ? 48.878  22.258  137.417 1.00 139.81 ? 223  THR B OG1   1 
ATOM   3488  C  CG2   . THR B 1 223  ? 50.759  22.165  138.930 1.00 134.28 ? 223  THR B CG2   1 
ATOM   3489  N  N     . TYR B 1 224  ? 49.742  18.100  137.650 1.00 138.40 ? 224  TYR B N     1 
ATOM   3490  C  CA    . TYR B 1 224  ? 49.600  16.877  138.457 1.00 136.53 ? 224  TYR B CA    1 
ATOM   3491  C  C     . TYR B 1 224  ? 50.812  15.943  138.485 1.00 135.10 ? 224  TYR B C     1 
ATOM   3492  O  O     . TYR B 1 224  ? 50.843  14.944  139.208 1.00 130.19 ? 224  TYR B O     1 
ATOM   3493  C  CB    . TYR B 1 224  ? 48.348  16.134  138.024 1.00 134.69 ? 224  TYR B CB    1 
ATOM   3494  C  CG    . TYR B 1 224  ? 47.092  16.927  138.288 1.00 141.99 ? 224  TYR B CG    1 
ATOM   3495  C  CD1   . TYR B 1 224  ? 47.098  17.995  139.183 1.00 143.69 ? 224  TYR B CD1   1 
ATOM   3496  C  CD2   . TYR B 1 224  ? 45.899  16.616  137.651 1.00 145.26 ? 224  TYR B CD2   1 
ATOM   3497  C  CE1   . TYR B 1 224  ? 45.949  18.730  139.440 1.00 147.31 ? 224  TYR B CE1   1 
ATOM   3498  C  CE2   . TYR B 1 224  ? 44.736  17.345  137.910 1.00 148.61 ? 224  TYR B CE2   1 
ATOM   3499  C  CZ    . TYR B 1 224  ? 44.769  18.402  138.804 1.00 148.18 ? 224  TYR B CZ    1 
ATOM   3500  O  OH    . TYR B 1 224  ? 43.629  19.133  139.062 1.00 146.82 ? 224  TYR B OH    1 
ATOM   3501  N  N     . PHE B 1 225  ? 51.793  16.293  137.669 1.00 139.86 ? 225  PHE B N     1 
ATOM   3502  C  CA    . PHE B 1 225  ? 53.082  15.622  137.576 1.00 141.81 ? 225  PHE B CA    1 
ATOM   3503  C  C     . PHE B 1 225  ? 54.135  16.271  138.456 1.00 148.28 ? 225  PHE B C     1 
ATOM   3504  O  O     . PHE B 1 225  ? 55.331  16.083  138.250 1.00 145.76 ? 225  PHE B O     1 
ATOM   3505  C  CB    . PHE B 1 225  ? 53.520  15.536  136.129 1.00 137.11 ? 225  PHE B CB    1 
ATOM   3506  C  CG    . PHE B 1 225  ? 52.504  14.868  135.264 1.00 139.23 ? 225  PHE B CG    1 
ATOM   3507  C  CD1   . PHE B 1 225  ? 51.565  15.616  134.567 1.00 141.69 ? 225  PHE B CD1   1 
ATOM   3508  C  CD2   . PHE B 1 225  ? 52.441  13.492  135.190 1.00 136.27 ? 225  PHE B CD2   1 
ATOM   3509  C  CE1   . PHE B 1 225  ? 50.601  15.001  133.774 1.00 134.86 ? 225  PHE B CE1   1 
ATOM   3510  C  CE2   . PHE B 1 225  ? 51.478  12.876  134.402 1.00 136.96 ? 225  PHE B CE2   1 
ATOM   3511  C  CZ    . PHE B 1 225  ? 50.557  13.635  133.692 1.00 130.32 ? 225  PHE B CZ    1 
ATOM   3512  N  N     . SER B 1 226  ? 53.665  17.123  139.362 1.00 154.46 ? 226  SER B N     1 
ATOM   3513  C  CA    . SER B 1 226  ? 54.512  17.844  140.305 1.00 155.94 ? 226  SER B CA    1 
ATOM   3514  C  C     . SER B 1 226  ? 55.084  16.969  141.426 1.00 152.45 ? 226  SER B C     1 
ATOM   3515  O  O     . SER B 1 226  ? 56.300  16.824  141.553 1.00 158.56 ? 226  SER B O     1 
ATOM   3516  C  CB    . SER B 1 226  ? 53.755  19.038  140.897 1.00 153.19 ? 226  SER B CB    1 
ATOM   3517  O  OG    . SER B 1 226  ? 53.402  19.967  139.880 1.00 152.60 ? 226  SER B OG    1 
ATOM   3518  N  N     . ASN B 1 227  ? 54.232  16.376  142.244 1.00 144.55 ? 227  ASN B N     1 
ATOM   3519  C  CA    . ASN B 1 227  ? 54.767  15.753  143.431 1.00 149.87 ? 227  ASN B CA    1 
ATOM   3520  C  C     . ASN B 1 227  ? 54.471  14.260  143.427 1.00 150.60 ? 227  ASN B C     1 
ATOM   3521  O  O     . ASN B 1 227  ? 53.356  13.854  143.110 1.00 149.91 ? 227  ASN B O     1 
ATOM   3522  C  CB    . ASN B 1 227  ? 54.122  16.425  144.645 1.00 156.19 ? 227  ASN B CB    1 
ATOM   3523  C  CG    . ASN B 1 227  ? 54.890  16.190  145.924 1.00 163.85 ? 227  ASN B CG    1 
ATOM   3524  O  OD1   . ASN B 1 227  ? 56.041  15.756  145.895 1.00 172.38 ? 227  ASN B OD1   1 
ATOM   3525  N  ND2   . ASN B 1 227  ? 54.259  16.484  147.061 1.00 153.67 ? 227  ASN B ND2   1 
ATOM   3526  N  N     . PRO B 1 228  ? 55.478  13.438  143.787 1.00 150.29 ? 228  PRO B N     1 
ATOM   3527  C  CA    . PRO B 1 228  ? 55.382  11.964  143.777 1.00 146.08 ? 228  PRO B CA    1 
ATOM   3528  C  C     . PRO B 1 228  ? 55.085  11.282  145.116 1.00 136.31 ? 228  PRO B C     1 
ATOM   3529  O  O     . PRO B 1 228  ? 55.191  10.049  145.153 1.00 128.67 ? 228  PRO B O     1 
ATOM   3530  C  CB    . PRO B 1 228  ? 56.767  11.522  143.272 1.00 145.40 ? 228  PRO B CB    1 
ATOM   3531  C  CG    . PRO B 1 228  ? 57.443  12.790  142.765 1.00 148.32 ? 228  PRO B CG    1 
ATOM   3532  C  CD    . PRO B 1 228  ? 56.869  13.884  143.599 1.00 146.70 ? 228  PRO B CD    1 
ATOM   3533  N  N     . MET C 2 1    ? 65.712  -17.017 114.253 1.00 160.49 ? 1    MET C N     1 
ATOM   3534  C  CA    . MET C 2 1    ? 64.344  -17.433 114.556 1.00 158.72 ? 1    MET C CA    1 
ATOM   3535  C  C     . MET C 2 1    ? 64.090  -18.898 114.136 1.00 157.03 ? 1    MET C C     1 
ATOM   3536  O  O     . MET C 2 1    ? 64.382  -19.281 112.998 1.00 153.20 ? 1    MET C O     1 
ATOM   3537  C  CB    . MET C 2 1    ? 63.331  -16.453 113.922 1.00 160.75 ? 1    MET C CB    1 
ATOM   3538  C  CG    . MET C 2 1    ? 63.150  -15.100 114.694 1.00 169.93 ? 1    MET C CG    1 
ATOM   3539  S  SD    . MET C 2 1    ? 61.796  -13.979 114.149 1.00 176.35 ? 1    MET C SD    1 
ATOM   3540  C  CE    . MET C 2 1    ? 61.776  -12.709 115.422 1.00 146.48 ? 1    MET C CE    1 
ATOM   3541  N  N     . GLU C 2 2    ? 63.569  -19.705 115.070 1.00 154.96 ? 2    GLU C N     1 
ATOM   3542  C  CA    . GLU C 2 2    ? 63.298  -21.141 114.856 1.00 151.89 ? 2    GLU C CA    1 
ATOM   3543  C  C     . GLU C 2 2    ? 62.165  -21.402 113.846 1.00 145.61 ? 2    GLU C C     1 
ATOM   3544  O  O     . GLU C 2 2    ? 61.122  -20.758 113.907 1.00 143.65 ? 2    GLU C O     1 
ATOM   3545  C  CB    . GLU C 2 2    ? 62.972  -21.827 116.192 1.00 150.64 ? 2    GLU C CB    1 
ATOM   3546  C  CG    . GLU C 2 2    ? 61.691  -22.665 116.157 1.00 151.56 ? 2    GLU C CG    1 
ATOM   3547  C  CD    . GLU C 2 2    ? 61.792  -23.928 116.976 1.00 158.45 ? 2    GLU C CD    1 
ATOM   3548  O  OE1   . GLU C 2 2    ? 62.908  -24.212 117.461 1.00 159.58 ? 2    GLU C OE1   1 
ATOM   3549  O  OE2   . GLU C 2 2    ? 60.765  -24.634 117.130 1.00 155.86 ? 2    GLU C OE2   1 
ATOM   3550  N  N     . ILE C 2 3    ? 62.351  -22.345 112.923 1.00 141.45 ? 3    ILE C N     1 
ATOM   3551  C  CA    . ILE C 2 3    ? 61.356  -22.514 111.862 1.00 134.53 ? 3    ILE C CA    1 
ATOM   3552  C  C     . ILE C 2 3    ? 60.558  -23.784 111.950 1.00 133.52 ? 3    ILE C C     1 
ATOM   3553  O  O     . ILE C 2 3    ? 61.053  -24.842 111.571 1.00 136.79 ? 3    ILE C O     1 
ATOM   3554  C  CB    . ILE C 2 3    ? 62.012  -22.597 110.485 1.00 133.91 ? 3    ILE C CB    1 
ATOM   3555  C  CG1   . ILE C 2 3    ? 63.123  -21.562 110.357 1.00 141.18 ? 3    ILE C CG1   1 
ATOM   3556  C  CG2   . ILE C 2 3    ? 60.967  -22.415 109.400 1.00 126.41 ? 3    ILE C CG2   1 
ATOM   3557  C  CD1   . ILE C 2 3    ? 62.631  -20.153 110.425 1.00 139.30 ? 3    ILE C CD1   1 
ATOM   3558  N  N     . LYS C 2 4    ? 59.297  -23.676 112.356 1.00 133.85 ? 4    LYS C N     1 
ATOM   3559  C  CA    . LYS C 2 4    ? 58.425  -24.844 112.351 1.00 137.47 ? 4    LYS C CA    1 
ATOM   3560  C  C     . LYS C 2 4    ? 57.738  -24.944 110.996 1.00 134.37 ? 4    LYS C C     1 
ATOM   3561  O  O     . LYS C 2 4    ? 57.255  -23.951 110.465 1.00 130.80 ? 4    LYS C O     1 
ATOM   3562  C  CB    . LYS C 2 4    ? 57.409  -24.822 113.500 1.00 134.46 ? 4    LYS C CB    1 
ATOM   3563  C  CG    . LYS C 2 4    ? 56.843  -26.215 113.840 1.00 141.37 ? 4    LYS C CG    1 
ATOM   3564  C  CD    . LYS C 2 4    ? 55.314  -26.273 113.664 1.00 145.68 ? 4    LYS C CD    1 
ATOM   3565  C  CE    . LYS C 2 4    ? 54.750  -27.694 113.857 1.00 144.00 ? 4    LYS C CE    1 
ATOM   3566  N  NZ    . LYS C 2 4    ? 53.256  -27.769 113.686 1.00 132.52 ? 4    LYS C NZ    1 
ATOM   3567  N  N     . ARG C 2 5    ? 57.706  -26.155 110.448 1.00 135.52 ? 5    ARG C N     1 
ATOM   3568  C  CA    . ARG C 2 5    ? 57.301  -26.385 109.067 1.00 133.19 ? 5    ARG C CA    1 
ATOM   3569  C  C     . ARG C 2 5    ? 56.114  -27.337 108.948 1.00 134.34 ? 5    ARG C C     1 
ATOM   3570  O  O     . ARG C 2 5    ? 56.138  -28.441 109.469 1.00 143.59 ? 5    ARG C O     1 
ATOM   3571  C  CB    . ARG C 2 5    ? 58.489  -26.933 108.277 1.00 134.47 ? 5    ARG C CB    1 
ATOM   3572  C  CG    . ARG C 2 5    ? 59.252  -28.050 108.993 1.00 141.55 ? 5    ARG C CG    1 
ATOM   3573  C  CD    . ARG C 2 5    ? 60.346  -28.631 108.111 1.00 143.83 ? 5    ARG C CD    1 
ATOM   3574  N  NE    . ARG C 2 5    ? 59.938  -28.698 106.706 1.00 146.65 ? 5    ARG C NE    1 
ATOM   3575  C  CZ    . ARG C 2 5    ? 60.648  -28.208 105.689 1.00 144.49 ? 5    ARG C CZ    1 
ATOM   3576  N  NH1   . ARG C 2 5    ? 61.821  -27.621 105.907 1.00 138.24 ? 5    ARG C NH1   1 
ATOM   3577  N  NH2   . ARG C 2 5    ? 60.186  -28.309 104.447 1.00 142.04 ? 5    ARG C NH2   1 
ATOM   3578  N  N     . PHE C 2 6    ? 55.069  -26.890 108.271 1.00 131.18 ? 6    PHE C N     1 
ATOM   3579  C  CA    . PHE C 2 6    ? 53.861  -27.685 108.077 1.00 137.66 ? 6    PHE C CA    1 
ATOM   3580  C  C     . PHE C 2 6    ? 53.850  -28.701 106.925 1.00 145.92 ? 6    PHE C C     1 
ATOM   3581  O  O     . PHE C 2 6    ? 54.630  -28.614 105.980 1.00 140.91 ? 6    PHE C O     1 
ATOM   3582  C  CB    . PHE C 2 6    ? 52.639  -26.777 107.996 1.00 136.93 ? 6    PHE C CB    1 
ATOM   3583  C  CG    . PHE C 2 6    ? 52.490  -25.868 109.178 1.00 139.14 ? 6    PHE C CG    1 
ATOM   3584  C  CD1   . PHE C 2 6    ? 52.190  -26.382 110.431 1.00 148.53 ? 6    PHE C CD1   1 
ATOM   3585  C  CD2   . PHE C 2 6    ? 52.649  -24.501 109.041 1.00 135.11 ? 6    PHE C CD2   1 
ATOM   3586  C  CE1   . PHE C 2 6    ? 52.048  -25.549 111.528 1.00 147.90 ? 6    PHE C CE1   1 
ATOM   3587  C  CE2   . PHE C 2 6    ? 52.508  -23.657 110.125 1.00 136.86 ? 6    PHE C CE2   1 
ATOM   3588  C  CZ    . PHE C 2 6    ? 52.208  -24.183 111.373 1.00 144.89 ? 6    PHE C CZ    1 
ATOM   3589  N  N     . GLY C 2 7    ? 52.969  -29.686 107.068 1.00 158.43 ? 7    GLY C N     1 
ATOM   3590  C  CA    . GLY C 2 7    ? 52.583  -30.624 106.025 1.00 166.58 ? 7    GLY C CA    1 
ATOM   3591  C  C     . GLY C 2 7    ? 53.390  -31.907 106.049 1.00 181.48 ? 7    GLY C C     1 
ATOM   3592  O  O     . GLY C 2 7    ? 54.609  -31.878 106.255 1.00 182.76 ? 7    GLY C O     1 
ATOM   3593  N  N     . ARG C 2 8    ? 52.723  -33.034 105.799 1.00 184.44 ? 8    ARG C N     1 
ATOM   3594  C  CA    . ARG C 2 8    ? 53.401  -34.326 105.876 1.00 192.23 ? 8    ARG C CA    1 
ATOM   3595  C  C     . ARG C 2 8    ? 53.821  -34.912 104.530 1.00 194.24 ? 8    ARG C C     1 
ATOM   3596  O  O     . ARG C 2 8    ? 54.532  -35.922 104.501 1.00 198.48 ? 8    ARG C O     1 
ATOM   3597  C  CB    . ARG C 2 8    ? 52.556  -35.336 106.653 1.00 195.09 ? 8    ARG C CB    1 
ATOM   3598  C  CG    . ARG C 2 8    ? 51.225  -35.610 106.013 1.00 199.08 ? 8    ARG C CG    1 
ATOM   3599  C  CD    . ARG C 2 8    ? 50.519  -36.767 106.677 1.00 209.34 ? 8    ARG C CD    1 
ATOM   3600  N  NE    . ARG C 2 8    ? 49.468  -37.293 105.814 1.00 213.95 ? 8    ARG C NE    1 
ATOM   3601  C  CZ    . ARG C 2 8    ? 48.729  -38.359 106.097 1.00 213.85 ? 8    ARG C CZ    1 
ATOM   3602  N  NH1   . ARG C 2 8    ? 48.921  -39.020 107.232 1.00 216.55 ? 8    ARG C NH1   1 
ATOM   3603  N  NH2   . ARG C 2 8    ? 47.799  -38.762 105.242 1.00 207.73 ? 8    ARG C NH2   1 
ATOM   3604  N  N     . ILE C 2 9    ? 53.413  -34.268 103.432 1.00 192.40 ? 9    ILE C N     1 
ATOM   3605  C  CA    . ILE C 2 9    ? 53.763  -34.729 102.084 1.00 190.15 ? 9    ILE C CA    1 
ATOM   3606  C  C     . ILE C 2 9    ? 55.282  -34.849 101.963 1.00 192.36 ? 9    ILE C C     1 
ATOM   3607  O  O     . ILE C 2 9    ? 56.021  -33.951 102.371 1.00 193.37 ? 9    ILE C O     1 
ATOM   3608  C  CB    . ILE C 2 9    ? 53.207  -33.791 100.966 1.00 179.92 ? 9    ILE C CB    1 
ATOM   3609  C  CG1   . ILE C 2 9    ? 51.709  -34.010 100.748 1.00 171.00 ? 9    ILE C CG1   1 
ATOM   3610  C  CG2   . ILE C 2 9    ? 53.925  -34.020 99.656  1.00 173.25 ? 9    ILE C CG2   1 
ATOM   3611  C  CD1   . ILE C 2 9    ? 51.182  -33.350 99.486  1.00 156.35 ? 9    ILE C CD1   1 
ATOM   3612  N  N     . ARG C 2 10   ? 55.741  -35.983 101.442 1.00 193.30 ? 10   ARG C N     1 
ATOM   3613  C  CA    . ARG C 2 10   ? 57.168  -36.225 101.254 1.00 195.73 ? 10   ARG C CA    1 
ATOM   3614  C  C     . ARG C 2 10   ? 57.526  -36.165 99.757  1.00 194.37 ? 10   ARG C C     1 
ATOM   3615  O  O     . ARG C 2 10   ? 56.827  -36.740 98.918  1.00 193.05 ? 10   ARG C O     1 
ATOM   3616  C  CB    . ARG C 2 10   ? 57.563  -37.586 101.852 1.00 200.43 ? 10   ARG C CB    1 
ATOM   3617  C  CG    . ARG C 2 10   ? 56.642  -38.089 102.971 1.00 203.54 ? 10   ARG C CG    1 
ATOM   3618  C  CD    . ARG C 2 10   ? 56.944  -39.548 103.380 1.00 213.80 ? 10   ARG C CD    1 
ATOM   3619  N  NE    . ARG C 2 10   ? 57.077  -40.472 102.244 1.00 212.83 ? 10   ARG C NE    1 
ATOM   3620  C  CZ    . ARG C 2 10   ? 56.345  -41.572 102.052 1.00 201.44 ? 10   ARG C CZ    1 
ATOM   3621  N  NH1   . ARG C 2 10   ? 55.396  -41.919 102.916 1.00 200.60 ? 10   ARG C NH1   1 
ATOM   3622  N  NH2   . ARG C 2 10   ? 56.565  -42.332 100.983 1.00 184.89 ? 10   ARG C NH2   1 
ATOM   3623  N  N     . GLU C 2 11   ? 58.609  -35.466 99.423  1.00 187.31 ? 11   GLU C N     1 
ATOM   3624  C  CA    . GLU C 2 11   ? 59.014  -35.305 98.030  1.00 170.33 ? 11   GLU C CA    1 
ATOM   3625  C  C     . GLU C 2 11   ? 60.055  -36.347 97.631  1.00 162.95 ? 11   GLU C C     1 
ATOM   3626  O  O     . GLU C 2 11   ? 61.204  -36.294 98.082  1.00 160.36 ? 11   GLU C O     1 
ATOM   3627  C  CB    . GLU C 2 11   ? 59.573  -33.896 97.815  1.00 170.12 ? 11   GLU C CB    1 
ATOM   3628  C  CG    . GLU C 2 11   ? 60.458  -33.403 98.962  1.00 176.20 ? 11   GLU C CG    1 
ATOM   3629  C  CD    . GLU C 2 11   ? 61.501  -32.389 98.516  1.00 176.93 ? 11   GLU C CD    1 
ATOM   3630  O  OE1   . GLU C 2 11   ? 61.126  -31.216 98.289  1.00 174.09 ? 11   GLU C OE1   1 
ATOM   3631  O  OE2   . GLU C 2 11   ? 62.693  -32.769 98.392  1.00 176.58 ? 11   GLU C OE2   1 
ATOM   3632  N  N     . VAL C 2 12   ? 59.661  -37.282 96.770  1.00 157.54 ? 12   VAL C N     1 
ATOM   3633  C  CA    . VAL C 2 12   ? 60.564  -38.360 96.368  1.00 157.06 ? 12   VAL C CA    1 
ATOM   3634  C  C     . VAL C 2 12   ? 61.836  -37.842 95.675  1.00 152.63 ? 12   VAL C C     1 
ATOM   3635  O  O     . VAL C 2 12   ? 62.937  -38.300 95.986  1.00 151.96 ? 12   VAL C O     1 
ATOM   3636  C  CB    . VAL C 2 12   ? 59.851  -39.443 95.510  1.00 148.12 ? 12   VAL C CB    1 
ATOM   3637  C  CG1   . VAL C 2 12   ? 59.262  -40.518 96.402  1.00 147.59 ? 12   VAL C CG1   1 
ATOM   3638  C  CG2   . VAL C 2 12   ? 58.770  -38.820 94.656  1.00 147.02 ? 12   VAL C CG2   1 
ATOM   3639  N  N     . ILE C 2 13   ? 61.683  -36.869 94.775  1.00 147.39 ? 13   ILE C N     1 
ATOM   3640  C  CA    . ILE C 2 13   ? 62.811  -36.275 94.056  1.00 144.32 ? 13   ILE C CA    1 
ATOM   3641  C  C     . ILE C 2 13   ? 62.820  -34.773 94.338  1.00 142.23 ? 13   ILE C C     1 
ATOM   3642  O  O     . ILE C 2 13   ? 61.770  -34.146 94.325  1.00 142.22 ? 13   ILE C O     1 
ATOM   3643  C  CB    . ILE C 2 13   ? 62.690  -36.563 92.508  1.00 141.31 ? 13   ILE C CB    1 
ATOM   3644  C  CG1   . ILE C 2 13   ? 63.714  -35.779 91.671  1.00 145.17 ? 13   ILE C CG1   1 
ATOM   3645  C  CG2   . ILE C 2 13   ? 61.289  -36.287 92.002  1.00 130.04 ? 13   ILE C CG2   1 
ATOM   3646  C  CD1   . ILE C 2 13   ? 64.733  -36.656 90.918  1.00 142.90 ? 13   ILE C CD1   1 
ATOM   3647  N  N     . PRO C 2 14   ? 64.006  -34.179 94.579  1.00 140.51 ? 14   PRO C N     1 
ATOM   3648  C  CA    . PRO C 2 14   ? 64.030  -32.727 94.772  1.00 135.72 ? 14   PRO C CA    1 
ATOM   3649  C  C     . PRO C 2 14   ? 63.862  -32.076 93.414  1.00 136.05 ? 14   PRO C C     1 
ATOM   3650  O  O     . PRO C 2 14   ? 63.795  -32.794 92.420  1.00 137.32 ? 14   PRO C O     1 
ATOM   3651  C  CB    . PRO C 2 14   ? 65.444  -32.478 95.282  1.00 135.13 ? 14   PRO C CB    1 
ATOM   3652  C  CG    . PRO C 2 14   ? 66.249  -33.537 94.610  1.00 130.39 ? 14   PRO C CG    1 
ATOM   3653  C  CD    . PRO C 2 14   ? 65.363  -34.754 94.635  1.00 139.86 ? 14   PRO C CD    1 
ATOM   3654  N  N     . LEU C 2 15   ? 63.808  -30.752 93.344  1.00 136.72 ? 15   LEU C N     1 
ATOM   3655  C  CA    . LEU C 2 15   ? 63.642  -30.111 92.039  1.00 132.29 ? 15   LEU C CA    1 
ATOM   3656  C  C     . LEU C 2 15   ? 64.888  -30.210 91.195  1.00 127.09 ? 15   LEU C C     1 
ATOM   3657  O  O     . LEU C 2 15   ? 65.990  -30.014 91.697  1.00 129.00 ? 15   LEU C O     1 
ATOM   3658  C  CB    . LEU C 2 15   ? 63.250  -28.648 92.175  1.00 127.05 ? 15   LEU C CB    1 
ATOM   3659  C  CG    . LEU C 2 15   ? 61.783  -28.414 91.863  1.00 116.73 ? 15   LEU C CG    1 
ATOM   3660  C  CD1   . LEU C 2 15   ? 60.993  -28.630 93.118  1.00 120.25 ? 15   LEU C CD1   1 
ATOM   3661  C  CD2   . LEU C 2 15   ? 61.588  -27.030 91.338  1.00 113.43 ? 15   LEU C CD2   1 
ATOM   3662  N  N     . PRO C 2 16   ? 64.713  -30.473 89.894  1.00 126.33 ? 16   PRO C N     1 
ATOM   3663  C  CA    . PRO C 2 16   ? 65.837  -30.621 88.959  1.00 137.06 ? 16   PRO C CA    1 
ATOM   3664  C  C     . PRO C 2 16   ? 66.674  -29.340 88.931  1.00 137.33 ? 16   PRO C C     1 
ATOM   3665  O  O     . PRO C 2 16   ? 66.205  -28.330 89.467  1.00 135.41 ? 16   PRO C O     1 
ATOM   3666  C  CB    . PRO C 2 16   ? 65.141  -30.857 87.613  1.00 137.11 ? 16   PRO C CB    1 
ATOM   3667  C  CG    . PRO C 2 16   ? 63.787  -31.416 87.987  1.00 134.02 ? 16   PRO C CG    1 
ATOM   3668  C  CD    . PRO C 2 16   ? 63.414  -30.674 89.231  1.00 124.74 ? 16   PRO C CD    1 
ATOM   3669  N  N     . PRO C 2 17   ? 67.913  -29.387 88.397  1.00 138.18 ? 17   PRO C N     1 
ATOM   3670  C  CA    . PRO C 2 17   ? 68.655  -28.116 88.365  1.00 136.07 ? 17   PRO C CA    1 
ATOM   3671  C  C     . PRO C 2 17   ? 67.835  -27.129 87.542  1.00 132.72 ? 17   PRO C C     1 
ATOM   3672  O  O     . PRO C 2 17   ? 67.480  -27.461 86.424  1.00 134.34 ? 17   PRO C O     1 
ATOM   3673  C  CB    . PRO C 2 17   ? 69.949  -28.481 87.632  1.00 140.11 ? 17   PRO C CB    1 
ATOM   3674  C  CG    . PRO C 2 17   ? 70.087  -29.982 87.814  1.00 144.29 ? 17   PRO C CG    1 
ATOM   3675  C  CD    . PRO C 2 17   ? 68.685  -30.514 87.839  1.00 137.98 ? 17   PRO C CD    1 
ATOM   3676  N  N     . LEU C 2 18   ? 67.527  -25.949 88.069  1.00 130.09 ? 18   LEU C N     1 
ATOM   3677  C  CA    . LEU C 2 18   ? 66.460  -25.144 87.459  1.00 128.38 ? 18   LEU C CA    1 
ATOM   3678  C  C     . LEU C 2 18   ? 66.841  -24.376 86.180  1.00 127.15 ? 18   LEU C C     1 
ATOM   3679  O  O     . LEU C 2 18   ? 65.987  -24.129 85.319  1.00 123.56 ? 18   LEU C O     1 
ATOM   3680  C  CB    . LEU C 2 18   ? 65.758  -24.264 88.510  1.00 124.47 ? 18   LEU C CB    1 
ATOM   3681  C  CG    . LEU C 2 18   ? 64.695  -25.022 89.324  1.00 115.80 ? 18   LEU C CG    1 
ATOM   3682  C  CD1   . LEU C 2 18   ? 64.395  -24.336 90.628  1.00 103.71 ? 18   LEU C CD1   1 
ATOM   3683  C  CD2   . LEU C 2 18   ? 63.413  -25.191 88.524  1.00 112.40 ? 18   LEU C CD2   1 
ATOM   3684  N  N     . THR C 2 19   ? 68.126  -24.047 86.052  1.00 129.27 ? 19   THR C N     1 
ATOM   3685  C  CA    . THR C 2 19   ? 68.659  -23.391 84.864  1.00 122.58 ? 19   THR C CA    1 
ATOM   3686  C  C     . THR C 2 19   ? 69.054  -24.451 83.837  1.00 124.70 ? 19   THR C C     1 
ATOM   3687  O  O     . THR C 2 19   ? 69.649  -24.123 82.815  1.00 124.92 ? 19   THR C O     1 
ATOM   3688  C  CB    . THR C 2 19   ? 69.891  -22.507 85.187  1.00 116.38 ? 19   THR C CB    1 
ATOM   3689  O  OG1   . THR C 2 19   ? 70.653  -23.104 86.243  1.00 120.66 ? 19   THR C OG1   1 
ATOM   3690  C  CG2   . THR C 2 19   ? 69.473  -21.116 85.618  1.00 112.33 ? 19   THR C CG2   1 
ATOM   3691  N  N     . GLU C 2 20   ? 68.739  -25.716 84.127  1.00 125.02 ? 20   GLU C N     1 
ATOM   3692  C  CA    . GLU C 2 20   ? 69.109  -26.837 83.261  1.00 123.56 ? 20   GLU C CA    1 
ATOM   3693  C  C     . GLU C 2 20   ? 68.664  -26.685 81.820  1.00 120.62 ? 20   GLU C C     1 
ATOM   3694  O  O     . GLU C 2 20   ? 69.351  -27.142 80.918  1.00 122.88 ? 20   GLU C O     1 
ATOM   3695  C  CB    . GLU C 2 20   ? 68.549  -28.167 83.774  1.00 131.84 ? 20   GLU C CB    1 
ATOM   3696  C  CG    . GLU C 2 20   ? 67.047  -28.352 83.538  1.00 134.21 ? 20   GLU C CG    1 
ATOM   3697  C  CD    . GLU C 2 20   ? 66.609  -29.809 83.495  1.00 139.41 ? 20   GLU C CD    1 
ATOM   3698  O  OE1   . GLU C 2 20   ? 67.356  -30.697 83.977  1.00 136.19 ? 20   GLU C OE1   1 
ATOM   3699  O  OE2   . GLU C 2 20   ? 65.503  -30.054 82.966  1.00 136.63 ? 20   GLU C OE2   1 
ATOM   3700  N  N     . ILE C 2 21   ? 67.514  -26.065 81.592  1.00 119.67 ? 21   ILE C N     1 
ATOM   3701  C  CA    . ILE C 2 21   ? 66.970  -26.006 80.237  1.00 122.48 ? 21   ILE C CA    1 
ATOM   3702  C  C     . ILE C 2 21   ? 67.858  -25.143 79.283  1.00 126.20 ? 21   ILE C C     1 
ATOM   3703  O  O     . ILE C 2 21   ? 67.689  -25.158 78.058  1.00 130.93 ? 21   ILE C O     1 
ATOM   3704  C  CB    . ILE C 2 21   ? 65.415  -25.674 80.244  1.00 115.76 ? 21   ILE C CB    1 
ATOM   3705  C  CG1   . ILE C 2 21   ? 64.810  -25.722 78.838  1.00 111.43 ? 21   ILE C CG1   1 
ATOM   3706  C  CG2   . ILE C 2 21   ? 65.123  -24.358 80.924  1.00 118.91 ? 21   ILE C CG2   1 
ATOM   3707  C  CD1   . ILE C 2 21   ? 63.510  -24.956 78.677  1.00 108.08 ? 21   ILE C CD1   1 
ATOM   3708  N  N     . GLN C 2 22   ? 68.840  -24.446 79.859  1.00 121.28 ? 22   GLN C N     1 
ATOM   3709  C  CA    . GLN C 2 22   ? 69.767  -23.568 79.130  1.00 116.25 ? 22   GLN C CA    1 
ATOM   3710  C  C     . GLN C 2 22   ? 71.186  -24.110 79.220  1.00 116.25 ? 22   GLN C C     1 
ATOM   3711  O  O     . GLN C 2 22   ? 71.879  -24.264 78.224  1.00 115.67 ? 22   GLN C O     1 
ATOM   3712  C  CB    . GLN C 2 22   ? 69.748  -22.152 79.701  1.00 119.32 ? 22   GLN C CB    1 
ATOM   3713  C  CG    . GLN C 2 22   ? 68.374  -21.532 79.822  1.00 117.18 ? 22   GLN C CG    1 
ATOM   3714  C  CD    . GLN C 2 22   ? 68.081  -20.581 78.697  1.00 116.74 ? 22   GLN C CD    1 
ATOM   3715  O  OE1   . GLN C 2 22   ? 68.967  -19.840 78.250  1.00 117.71 ? 22   GLN C OE1   1 
ATOM   3716  N  NE2   . GLN C 2 22   ? 66.841  -20.604 78.206  1.00 113.99 ? 22   GLN C NE2   1 
ATOM   3717  N  N     . VAL C 2 23   ? 71.627  -24.270 80.461  1.00 120.05 ? 23   VAL C N     1 
ATOM   3718  C  CA    . VAL C 2 23   ? 72.911  -24.833 80.846  1.00 120.31 ? 23   VAL C CA    1 
ATOM   3719  C  C     . VAL C 2 23   ? 73.233  -26.095 80.071  1.00 122.83 ? 23   VAL C C     1 
ATOM   3720  O  O     . VAL C 2 23   ? 74.323  -26.233 79.522  1.00 125.52 ? 23   VAL C O     1 
ATOM   3721  C  CB    . VAL C 2 23   ? 72.848  -25.202 82.367  1.00 124.11 ? 23   VAL C CB    1 
ATOM   3722  C  CG1   . VAL C 2 23   ? 73.809  -26.330 82.733  1.00 126.99 ? 23   VAL C CG1   1 
ATOM   3723  C  CG2   . VAL C 2 23   ? 73.063  -23.977 83.236  1.00 124.35 ? 23   VAL C CG2   1 
ATOM   3724  N  N     . GLU C 2 24   ? 72.275  -27.015 80.038  1.00 126.15 ? 24   GLU C N     1 
ATOM   3725  C  CA    . GLU C 2 24   ? 72.472  -28.335 79.445  1.00 130.16 ? 24   GLU C CA    1 
ATOM   3726  C  C     . GLU C 2 24   ? 72.334  -28.325 77.919  1.00 130.45 ? 24   GLU C C     1 
ATOM   3727  O  O     . GLU C 2 24   ? 73.082  -29.001 77.206  1.00 133.15 ? 24   GLU C O     1 
ATOM   3728  C  CB    . GLU C 2 24   ? 71.507  -29.346 80.081  1.00 126.85 ? 24   GLU C CB    1 
ATOM   3729  C  CG    . GLU C 2 24   ? 71.454  -30.700 79.402  1.00 133.77 ? 24   GLU C CG    1 
ATOM   3730  C  CD    . GLU C 2 24   ? 72.764  -31.453 79.489  1.00 144.83 ? 24   GLU C CD    1 
ATOM   3731  O  OE1   . GLU C 2 24   ? 73.416  -31.376 80.555  1.00 143.14 ? 24   GLU C OE1   1 
ATOM   3732  O  OE2   . GLU C 2 24   ? 73.139  -32.116 78.490  1.00 148.03 ? 24   GLU C OE2   1 
ATOM   3733  N  N     . SER C 2 25   ? 71.382  -27.535 77.432  1.00 127.04 ? 25   SER C N     1 
ATOM   3734  C  CA    . SER C 2 25   ? 71.046  -27.474 76.012  1.00 126.31 ? 25   SER C CA    1 
ATOM   3735  C  C     . SER C 2 25   ? 72.133  -26.832 75.145  1.00 126.12 ? 25   SER C C     1 
ATOM   3736  O  O     . SER C 2 25   ? 72.310  -27.184 73.979  1.00 126.09 ? 25   SER C O     1 
ATOM   3737  C  CB    . SER C 2 25   ? 69.727  -26.718 75.834  1.00 123.45 ? 25   SER C CB    1 
ATOM   3738  O  OG    . SER C 2 25   ? 69.441  -26.506 74.466  1.00 124.62 ? 25   SER C OG    1 
ATOM   3739  N  N     . TYR C 2 26   ? 72.828  -25.856 75.707  1.00 124.31 ? 26   TYR C N     1 
ATOM   3740  C  CA    . TYR C 2 26   ? 73.913  -25.201 75.006  1.00 118.91 ? 26   TYR C CA    1 
ATOM   3741  C  C     . TYR C 2 26   ? 75.204  -25.987 75.125  1.00 128.58 ? 26   TYR C C     1 
ATOM   3742  O  O     . TYR C 2 26   ? 76.085  -25.861 74.289  1.00 132.79 ? 26   TYR C O     1 
ATOM   3743  C  CB    . TYR C 2 26   ? 74.126  -23.796 75.549  1.00 117.62 ? 26   TYR C CB    1 
ATOM   3744  C  CG    . TYR C 2 26   ? 74.865  -22.895 74.599  1.00 116.28 ? 26   TYR C CG    1 
ATOM   3745  C  CD1   . TYR C 2 26   ? 74.379  -22.675 73.322  1.00 113.56 ? 26   TYR C CD1   1 
ATOM   3746  C  CD2   . TYR C 2 26   ? 76.036  -22.251 74.982  1.00 114.98 ? 26   TYR C CD2   1 
ATOM   3747  C  CE1   . TYR C 2 26   ? 75.033  -21.851 72.452  1.00 107.91 ? 26   TYR C CE1   1 
ATOM   3748  C  CE2   . TYR C 2 26   ? 76.693  -21.420 74.119  1.00 111.43 ? 26   TYR C CE2   1 
ATOM   3749  C  CZ    . TYR C 2 26   ? 76.185  -21.228 72.853  1.00 111.90 ? 26   TYR C CZ    1 
ATOM   3750  O  OH    . TYR C 2 26   ? 76.830  -20.403 71.969  1.00 119.61 ? 26   TYR C OH    1 
ATOM   3751  N  N     . ARG C 2 27   ? 75.338  -26.781 76.181  1.00 135.00 ? 27   ARG C N     1 
ATOM   3752  C  CA    . ARG C 2 27   ? 76.563  -27.550 76.357  1.00 142.03 ? 27   ARG C CA    1 
ATOM   3753  C  C     . ARG C 2 27   ? 76.524  -28.706 75.375  1.00 137.50 ? 27   ARG C C     1 
ATOM   3754  O  O     . ARG C 2 27   ? 77.539  -29.047 74.768  1.00 135.56 ? 27   ARG C O     1 
ATOM   3755  C  CB    . ARG C 2 27   ? 76.716  -28.047 77.796  1.00 145.76 ? 27   ARG C CB    1 
ATOM   3756  C  CG    . ARG C 2 27   ? 78.157  -28.352 78.180  1.00 155.82 ? 27   ARG C CG    1 
ATOM   3757  C  CD    . ARG C 2 27   ? 78.211  -28.962 79.559  1.00 161.95 ? 27   ARG C CD    1 
ATOM   3758  N  NE    . ARG C 2 27   ? 78.694  -30.337 79.519  1.00 172.82 ? 27   ARG C NE    1 
ATOM   3759  C  CZ    . ARG C 2 27   ? 77.937  -31.386 79.219  1.00 169.63 ? 27   ARG C CZ    1 
ATOM   3760  N  NH1   . ARG C 2 27   ? 76.654  -31.221 78.924  1.00 157.92 ? 27   ARG C NH1   1 
ATOM   3761  N  NH2   . ARG C 2 27   ? 78.469  -32.601 79.209  1.00 175.72 ? 27   ARG C NH2   1 
ATOM   3762  N  N     . ARG C 2 28   ? 75.333  -29.282 75.217  1.00 134.24 ? 28   ARG C N     1 
ATOM   3763  C  CA    . ARG C 2 28   ? 75.081  -30.337 74.239  1.00 136.91 ? 28   ARG C CA    1 
ATOM   3764  C  C     . ARG C 2 28   ? 75.308  -29.891 72.786  1.00 131.51 ? 28   ARG C C     1 
ATOM   3765  O  O     . ARG C 2 28   ? 75.749  -30.685 71.960  1.00 136.69 ? 28   ARG C O     1 
ATOM   3766  C  CB    . ARG C 2 28   ? 73.671  -30.949 74.426  1.00 141.94 ? 28   ARG C CB    1 
ATOM   3767  C  CG    . ARG C 2 28   ? 73.139  -31.770 73.223  1.00 144.19 ? 28   ARG C CG    1 
ATOM   3768  C  CD    . ARG C 2 28   ? 72.101  -32.838 73.615  1.00 151.10 ? 28   ARG C CD    1 
ATOM   3769  N  NE    . ARG C 2 28   ? 72.674  -33.944 74.391  1.00 159.44 ? 28   ARG C NE    1 
ATOM   3770  C  CZ    . ARG C 2 28   ? 73.051  -35.117 73.880  1.00 157.99 ? 28   ARG C CZ    1 
ATOM   3771  N  NH1   . ARG C 2 28   ? 72.921  -35.360 72.582  1.00 146.31 ? 28   ARG C NH1   1 
ATOM   3772  N  NH2   . ARG C 2 28   ? 73.561  -36.053 74.674  1.00 160.49 ? 28   ARG C NH2   1 
ATOM   3773  N  N     . ALA C 2 29   ? 75.027  -28.633 72.466  1.00 127.18 ? 29   ALA C N     1 
ATOM   3774  C  CA    . ALA C 2 29   ? 75.181  -28.190 71.083  1.00 127.48 ? 29   ALA C CA    1 
ATOM   3775  C  C     . ALA C 2 29   ? 76.649  -27.987 70.711  1.00 130.29 ? 29   ALA C C     1 
ATOM   3776  O  O     . ALA C 2 29   ? 77.056  -28.274 69.582  1.00 131.04 ? 29   ALA C O     1 
ATOM   3777  C  CB    . ALA C 2 29   ? 74.364  -26.929 70.811  1.00 123.37 ? 29   ALA C CB    1 
ATOM   3778  N  N     . LEU C 2 30   ? 77.430  -27.464 71.652  1.00 129.60 ? 30   LEU C N     1 
ATOM   3779  C  CA    . LEU C 2 30   ? 78.865  -27.275 71.440  1.00 129.96 ? 30   LEU C CA    1 
ATOM   3780  C  C     . LEU C 2 30   ? 79.739  -28.539 71.567  1.00 134.31 ? 30   LEU C C     1 
ATOM   3781  O  O     . LEU C 2 30   ? 80.444  -28.902 70.622  1.00 132.85 ? 30   LEU C O     1 
ATOM   3782  C  CB    . LEU C 2 30   ? 79.379  -26.178 72.368  1.00 125.35 ? 30   LEU C CB    1 
ATOM   3783  C  CG    . LEU C 2 30   ? 78.434  -24.979 72.416  1.00 117.62 ? 30   LEU C CG    1 
ATOM   3784  C  CD1   . LEU C 2 30   ? 78.946  -23.914 73.378  1.00 116.75 ? 30   LEU C CD1   1 
ATOM   3785  C  CD2   . LEU C 2 30   ? 78.182  -24.408 71.024  1.00 107.74 ? 30   LEU C CD2   1 
ATOM   3786  N  N     . GLN C 2 31   ? 79.637  -29.219 72.711  1.00 136.26 ? 31   GLN C N     1 
ATOM   3787  C  CA    . GLN C 2 31   ? 80.496  -30.358 73.064  1.00 139.94 ? 31   GLN C CA    1 
ATOM   3788  C  C     . GLN C 2 31   ? 81.965  -29.967 73.214  1.00 141.23 ? 31   GLN C C     1 
ATOM   3789  O  O     . GLN C 2 31   ? 82.843  -30.717 72.794  1.00 146.08 ? 31   GLN C O     1 
ATOM   3790  C  CB    . GLN C 2 31   ? 80.382  -31.505 72.039  1.00 137.97 ? 31   GLN C CB    1 
ATOM   3791  C  CG    . GLN C 2 31   ? 79.097  -32.308 72.077  1.00 127.18 ? 31   GLN C CG    1 
ATOM   3792  C  CD    . GLN C 2 31   ? 78.836  -33.002 70.767  1.00 129.38 ? 31   GLN C CD    1 
ATOM   3793  O  OE1   . GLN C 2 31   ? 78.556  -34.195 70.730  1.00 136.76 ? 31   GLN C OE1   1 
ATOM   3794  N  NE2   . GLN C 2 31   ? 78.930  -32.254 69.675  1.00 131.51 ? 31   GLN C NE2   1 
ATOM   3795  N  N     . ALA C 2 32   ? 82.243  -28.815 73.817  1.00 135.83 ? 32   ALA C N     1 
ATOM   3796  C  CA    . ALA C 2 32   ? 83.628  -28.351 73.921  1.00 140.05 ? 32   ALA C CA    1 
ATOM   3797  C  C     . ALA C 2 32   ? 84.488  -29.234 74.828  1.00 156.54 ? 32   ALA C C     1 
ATOM   3798  O  O     . ALA C 2 32   ? 85.717  -29.235 74.711  1.00 162.28 ? 32   ALA C O     1 
ATOM   3799  C  CB    . ALA C 2 32   ? 83.683  -26.908 74.378  1.00 134.47 ? 32   ALA C CB    1 
ATOM   3800  N  N     . ASP C 2 33   ? 83.834  -29.967 75.733  1.00 163.70 ? 33   ASP C N     1 
ATOM   3801  C  CA    . ASP C 2 33   ? 84.504  -30.883 76.675  1.00 171.26 ? 33   ASP C CA    1 
ATOM   3802  C  C     . ASP C 2 33   ? 84.891  -32.232 76.038  1.00 165.40 ? 33   ASP C C     1 
ATOM   3803  O  O     . ASP C 2 33   ? 85.957  -32.796 76.329  1.00 165.74 ? 33   ASP C O     1 
ATOM   3804  C  CB    . ASP C 2 33   ? 83.612  -31.155 77.905  1.00 178.46 ? 33   ASP C CB    1 
ATOM   3805  C  CG    . ASP C 2 33   ? 83.245  -29.891 78.678  1.00 180.43 ? 33   ASP C CG    1 
ATOM   3806  O  OD1   . ASP C 2 33   ? 84.140  -29.056 78.947  1.00 177.96 ? 33   ASP C OD1   1 
ATOM   3807  O  OD2   . ASP C 2 33   ? 82.050  -29.745 79.027  1.00 174.31 ? 33   ASP C OD2   1 
ATOM   3808  N  N     . VAL C 2 34   ? 84.001  -32.739 75.187  1.00 157.17 ? 34   VAL C N     1 
ATOM   3809  C  CA    . VAL C 2 34   ? 84.162  -34.027 74.523  1.00 151.49 ? 34   VAL C CA    1 
ATOM   3810  C  C     . VAL C 2 34   ? 85.326  -34.033 73.532  1.00 155.23 ? 34   VAL C C     1 
ATOM   3811  O  O     . VAL C 2 34   ? 85.413  -33.162 72.665  1.00 156.73 ? 34   VAL C O     1 
ATOM   3812  C  CB    . VAL C 2 34   ? 82.865  -34.411 73.769  1.00 146.20 ? 34   VAL C CB    1 
ATOM   3813  C  CG1   . VAL C 2 34   ? 83.118  -35.532 72.788  1.00 152.65 ? 34   VAL C CG1   1 
ATOM   3814  C  CG2   . VAL C 2 34   ? 81.775  -34.805 74.749  1.00 149.72 ? 34   VAL C CG2   1 
ATOM   3815  N  N     . PRO C 2 35   ? 86.236  -35.011 73.669  1.00 153.92 ? 35   PRO C N     1 
ATOM   3816  C  CA    . PRO C 2 35   ? 87.258  -35.291 72.656  1.00 152.88 ? 35   PRO C CA    1 
ATOM   3817  C  C     . PRO C 2 35   ? 86.648  -35.464 71.265  1.00 155.27 ? 35   PRO C C     1 
ATOM   3818  O  O     . PRO C 2 35   ? 85.713  -36.241 71.102  1.00 158.56 ? 35   PRO C O     1 
ATOM   3819  C  CB    . PRO C 2 35   ? 87.868  -36.618 73.136  1.00 153.92 ? 35   PRO C CB    1 
ATOM   3820  C  CG    . PRO C 2 35   ? 87.064  -37.044 74.354  1.00 150.34 ? 35   PRO C CG    1 
ATOM   3821  C  CD    . PRO C 2 35   ? 86.467  -35.794 74.891  1.00 154.00 ? 35   PRO C CD    1 
ATOM   3822  N  N     . PRO C 2 36   ? 87.203  -34.770 70.264  1.00 151.35 ? 36   PRO C N     1 
ATOM   3823  C  CA    . PRO C 2 36   ? 86.608  -34.565 68.940  1.00 151.85 ? 36   PRO C CA    1 
ATOM   3824  C  C     . PRO C 2 36   ? 86.009  -35.784 68.237  1.00 161.39 ? 36   PRO C C     1 
ATOM   3825  O  O     . PRO C 2 36   ? 85.043  -35.584 67.510  1.00 170.04 ? 36   PRO C O     1 
ATOM   3826  C  CB    . PRO C 2 36   ? 87.771  -34.005 68.132  1.00 152.13 ? 36   PRO C CB    1 
ATOM   3827  C  CG    . PRO C 2 36   ? 88.534  -33.225 69.134  1.00 154.60 ? 36   PRO C CG    1 
ATOM   3828  C  CD    . PRO C 2 36   ? 88.443  -33.994 70.421  1.00 154.68 ? 36   PRO C CD    1 
ATOM   3829  N  N     . GLU C 2 37   ? 86.529  -36.995 68.429  1.00 165.42 ? 37   GLU C N     1 
ATOM   3830  C  CA    . GLU C 2 37   ? 85.963  -38.156 67.721  1.00 174.76 ? 37   GLU C CA    1 
ATOM   3831  C  C     . GLU C 2 37   ? 84.855  -38.871 68.494  1.00 172.93 ? 37   GLU C C     1 
ATOM   3832  O  O     . GLU C 2 37   ? 84.251  -39.828 67.997  1.00 180.15 ? 37   GLU C O     1 
ATOM   3833  C  CB    . GLU C 2 37   ? 87.046  -39.156 67.306  1.00 180.92 ? 37   GLU C CB    1 
ATOM   3834  C  CG    . GLU C 2 37   ? 87.693  -39.888 68.457  1.00 178.67 ? 37   GLU C CG    1 
ATOM   3835  C  CD    . GLU C 2 37   ? 88.657  -39.009 69.213  1.00 173.13 ? 37   GLU C CD    1 
ATOM   3836  O  OE1   . GLU C 2 37   ? 89.065  -37.969 68.652  1.00 171.03 ? 37   GLU C OE1   1 
ATOM   3837  O  OE2   . GLU C 2 37   ? 89.000  -39.351 70.364  1.00 168.65 ? 37   GLU C OE2   1 
ATOM   3838  N  N     . LYS C 2 38   ? 84.609  -38.417 69.717  1.00 166.94 ? 38   LYS C N     1 
ATOM   3839  C  CA    . LYS C 2 38   ? 83.513  -38.942 70.516  1.00 169.10 ? 38   LYS C CA    1 
ATOM   3840  C  C     . LYS C 2 38   ? 82.281  -38.039 70.442  1.00 163.98 ? 38   LYS C C     1 
ATOM   3841  O  O     . LYS C 2 38   ? 81.242  -38.338 71.035  1.00 166.08 ? 38   LYS C O     1 
ATOM   3842  C  CB    . LYS C 2 38   ? 83.952  -39.165 71.963  1.00 164.24 ? 38   LYS C CB    1 
ATOM   3843  C  CG    . LYS C 2 38   ? 85.183  -40.057 72.108  1.00 163.93 ? 38   LYS C CG    1 
ATOM   3844  C  CD    . LYS C 2 38   ? 85.395  -40.453 73.549  1.00 146.84 ? 38   LYS C CD    1 
ATOM   3845  C  CE    . LYS C 2 38   ? 84.138  -41.112 74.070  1.00 159.28 ? 38   LYS C CE    1 
ATOM   3846  N  NZ    . LYS C 2 38   ? 84.145  -41.296 75.541  1.00 168.13 ? 38   LYS C NZ    1 
ATOM   3847  N  N     . ARG C 2 39   ? 82.404  -36.937 69.711  1.00 154.97 ? 39   ARG C N     1 
ATOM   3848  C  CA    . ARG C 2 39   ? 81.282  -36.033 69.507  1.00 152.73 ? 39   ARG C CA    1 
ATOM   3849  C  C     . ARG C 2 39   ? 80.160  -36.738 68.762  1.00 161.13 ? 39   ARG C C     1 
ATOM   3850  O  O     . ARG C 2 39   ? 80.383  -37.379 67.732  1.00 168.62 ? 39   ARG C O     1 
ATOM   3851  C  CB    . ARG C 2 39   ? 81.737  -34.781 68.771  1.00 148.42 ? 39   ARG C CB    1 
ATOM   3852  C  CG    . ARG C 2 39   ? 82.706  -33.988 69.601  1.00 144.16 ? 39   ARG C CG    1 
ATOM   3853  C  CD    . ARG C 2 39   ? 83.140  -32.689 68.977  1.00 136.11 ? 39   ARG C CD    1 
ATOM   3854  N  NE    . ARG C 2 39   ? 83.875  -31.931 69.980  1.00 136.94 ? 39   ARG C NE    1 
ATOM   3855  C  CZ    . ARG C 2 39   ? 84.709  -30.938 69.713  1.00 132.97 ? 39   ARG C CZ    1 
ATOM   3856  N  NH1   . ARG C 2 39   ? 84.922  -30.579 68.462  1.00 135.33 ? 39   ARG C NH1   1 
ATOM   3857  N  NH2   . ARG C 2 39   ? 85.341  -30.309 70.697  1.00 128.53 ? 39   ARG C NH2   1 
ATOM   3858  N  N     . GLU C 2 40   ? 78.948  -36.594 69.283  1.00 156.39 ? 40   GLU C N     1 
ATOM   3859  C  CA    . GLU C 2 40   ? 77.872  -37.520 68.968  1.00 162.16 ? 40   GLU C CA    1 
ATOM   3860  C  C     . GLU C 2 40   ? 76.990  -37.193 67.770  1.00 165.69 ? 40   GLU C C     1 
ATOM   3861  O  O     . GLU C 2 40   ? 75.972  -37.858 67.578  1.00 172.56 ? 40   GLU C O     1 
ATOM   3862  C  CB    . GLU C 2 40   ? 77.012  -37.773 70.195  1.00 160.35 ? 40   GLU C CB    1 
ATOM   3863  C  CG    . GLU C 2 40   ? 77.124  -39.183 70.710  1.00 178.11 ? 40   GLU C CG    1 
ATOM   3864  C  CD    . GLU C 2 40   ? 75.902  -39.590 71.500  1.00 195.96 ? 40   GLU C CD    1 
ATOM   3865  O  OE1   . GLU C 2 40   ? 74.936  -38.800 71.537  1.00 189.96 ? 40   GLU C OE1   1 
ATOM   3866  O  OE2   . GLU C 2 40   ? 75.896  -40.695 72.086  1.00 211.18 ? 40   GLU C OE2   1 
ATOM   3867  N  N     . ASN C 2 41   ? 77.356  -36.165 67.003  1.00 161.98 ? 41   ASN C N     1 
ATOM   3868  C  CA    . ASN C 2 41   ? 76.655  -35.804 65.753  1.00 164.26 ? 41   ASN C CA    1 
ATOM   3869  C  C     . ASN C 2 41   ? 75.378  -34.962 65.936  1.00 160.75 ? 41   ASN C C     1 
ATOM   3870  O  O     . ASN C 2 41   ? 74.683  -34.683 64.966  1.00 161.71 ? 41   ASN C O     1 
ATOM   3871  C  CB    . ASN C 2 41   ? 76.433  -37.023 64.819  1.00 179.68 ? 41   ASN C CB    1 
ATOM   3872  C  CG    . ASN C 2 41   ? 76.148  -36.630 63.356  1.00 180.06 ? 41   ASN C CG    1 
ATOM   3873  O  OD1   . ASN C 2 41   ? 76.356  -35.485 62.942  1.00 169.32 ? 41   ASN C OD1   1 
ATOM   3874  N  ND2   . ASN C 2 41   ? 75.677  -37.598 62.572  1.00 189.67 ? 41   ASN C ND2   1 
ATOM   3875  N  N     . VAL C 2 42   ? 75.029  -34.629 67.179  1.00 158.97 ? 42   VAL C N     1 
ATOM   3876  C  CA    . VAL C 2 42   ? 74.059  -33.549 67.442  1.00 149.79 ? 42   VAL C CA    1 
ATOM   3877  C  C     . VAL C 2 42   ? 74.661  -32.129 67.427  1.00 144.81 ? 42   VAL C C     1 
ATOM   3878  O  O     . VAL C 2 42   ? 75.859  -31.937 67.647  1.00 148.40 ? 42   VAL C O     1 
ATOM   3879  C  CB    . VAL C 2 42   ? 73.260  -33.750 68.762  1.00 145.19 ? 42   VAL C CB    1 
ATOM   3880  C  CG1   . VAL C 2 42   ? 72.300  -34.919 68.639  1.00 153.95 ? 42   VAL C CG1   1 
ATOM   3881  C  CG2   . VAL C 2 42   ? 74.190  -33.917 69.948  1.00 145.24 ? 42   VAL C CG2   1 
ATOM   3882  N  N     . GLY C 2 43   ? 73.818  -31.137 67.159  1.00 136.72 ? 43   GLY C N     1 
ATOM   3883  C  CA    . GLY C 2 43   ? 74.206  -29.746 67.309  1.00 133.46 ? 43   GLY C CA    1 
ATOM   3884  C  C     . GLY C 2 43   ? 75.274  -29.235 66.364  1.00 128.87 ? 43   GLY C C     1 
ATOM   3885  O  O     . GLY C 2 43   ? 75.133  -29.332 65.155  1.00 132.18 ? 43   GLY C O     1 
ATOM   3886  N  N     . ILE C 2 44   ? 76.338  -28.672 66.921  1.00 125.56 ? 44   ILE C N     1 
ATOM   3887  C  CA    . ILE C 2 44   ? 77.394  -28.095 66.108  1.00 127.83 ? 44   ILE C CA    1 
ATOM   3888  C  C     . ILE C 2 44   ? 78.078  -29.148 65.258  1.00 137.51 ? 44   ILE C C     1 
ATOM   3889  O  O     . ILE C 2 44   ? 78.417  -28.902 64.093  1.00 135.66 ? 44   ILE C O     1 
ATOM   3890  C  CB    . ILE C 2 44   ? 78.416  -27.356 66.968  1.00 125.77 ? 44   ILE C CB    1 
ATOM   3891  C  CG1   . ILE C 2 44   ? 77.933  -25.932 67.187  1.00 123.71 ? 44   ILE C CG1   1 
ATOM   3892  C  CG2   . ILE C 2 44   ? 79.770  -27.315 66.299  1.00 128.38 ? 44   ILE C CG2   1 
ATOM   3893  C  CD1   . ILE C 2 44   ? 77.566  -25.249 65.909  1.00 118.76 ? 44   ILE C CD1   1 
ATOM   3894  N  N     . GLN C 2 45   ? 78.259  -30.332 65.836  1.00 140.08 ? 45   GLN C N     1 
ATOM   3895  C  CA    . GLN C 2 45   ? 78.845  -31.443 65.096  1.00 140.72 ? 45   GLN C CA    1 
ATOM   3896  C  C     . GLN C 2 45   ? 77.977  -31.803 63.878  1.00 146.84 ? 45   GLN C C     1 
ATOM   3897  O  O     . GLN C 2 45   ? 78.505  -32.188 62.836  1.00 154.76 ? 45   GLN C O     1 
ATOM   3898  C  CB    . GLN C 2 45   ? 79.089  -32.644 66.021  1.00 138.31 ? 45   GLN C CB    1 
ATOM   3899  C  CG    . GLN C 2 45   ? 79.803  -33.833 65.383  1.00 151.01 ? 45   GLN C CG    1 
ATOM   3900  C  CD    . GLN C 2 45   ? 81.200  -33.519 64.837  1.00 146.94 ? 45   GLN C CD    1 
ATOM   3901  O  OE1   . GLN C 2 45   ? 81.988  -32.811 65.457  1.00 135.44 ? 45   GLN C OE1   1 
ATOM   3902  N  NE2   . GLN C 2 45   ? 81.510  -34.073 63.673  1.00 155.65 ? 45   GLN C NE2   1 
ATOM   3903  N  N     . ALA C 2 46   ? 76.661  -31.615 63.991  1.00 144.50 ? 46   ALA C N     1 
ATOM   3904  C  CA    . ALA C 2 46   ? 75.717  -31.973 62.921  1.00 142.51 ? 46   ALA C CA    1 
ATOM   3905  C  C     . ALA C 2 46   ? 75.722  -31.046 61.715  1.00 143.40 ? 46   ALA C C     1 
ATOM   3906  O  O     . ALA C 2 46   ? 75.483  -31.495 60.595  1.00 148.51 ? 46   ALA C O     1 
ATOM   3907  C  CB    . ALA C 2 46   ? 74.314  -32.057 63.467  1.00 146.20 ? 46   ALA C CB    1 
ATOM   3908  N  N     . ALA C 2 47   ? 75.956  -29.758 61.950  1.00 138.22 ? 47   ALA C N     1 
ATOM   3909  C  CA    . ALA C 2 47   ? 75.947  -28.770 60.879  1.00 137.22 ? 47   ALA C CA    1 
ATOM   3910  C  C     . ALA C 2 47   ? 77.100  -29.017 59.939  1.00 144.82 ? 47   ALA C C     1 
ATOM   3911  O  O     . ALA C 2 47   ? 76.954  -28.930 58.718  1.00 151.04 ? 47   ALA C O     1 
ATOM   3912  C  CB    . ALA C 2 47   ? 76.041  -27.383 61.445  1.00 134.73 ? 47   ALA C CB    1 
ATOM   3913  N  N     . PHE C 2 48   ? 78.255  -29.317 60.520  1.00 143.73 ? 48   PHE C N     1 
ATOM   3914  C  CA    . PHE C 2 48   ? 79.435  -29.639 59.740  1.00 142.68 ? 48   PHE C CA    1 
ATOM   3915  C  C     . PHE C 2 48   ? 79.209  -30.901 58.932  1.00 144.32 ? 48   PHE C C     1 
ATOM   3916  O  O     . PHE C 2 48   ? 79.406  -30.905 57.720  1.00 144.47 ? 48   PHE C O     1 
ATOM   3917  C  CB    . PHE C 2 48   ? 80.634  -29.806 60.656  1.00 141.77 ? 48   PHE C CB    1 
ATOM   3918  C  CG    . PHE C 2 48   ? 81.164  -28.509 61.191  1.00 144.95 ? 48   PHE C CG    1 
ATOM   3919  C  CD1   . PHE C 2 48   ? 81.204  -28.263 62.554  1.00 141.96 ? 48   PHE C CD1   1 
ATOM   3920  C  CD2   . PHE C 2 48   ? 81.613  -27.524 60.327  1.00 139.39 ? 48   PHE C CD2   1 
ATOM   3921  C  CE1   . PHE C 2 48   ? 81.700  -27.062 63.041  1.00 136.35 ? 48   PHE C CE1   1 
ATOM   3922  C  CE2   . PHE C 2 48   ? 82.106  -26.322 60.812  1.00 133.34 ? 48   PHE C CE2   1 
ATOM   3923  C  CZ    . PHE C 2 48   ? 82.150  -26.093 62.167  1.00 130.09 ? 48   PHE C CZ    1 
ATOM   3924  N  N     . ARG C 2 49   ? 78.778  -31.960 59.613  1.00 147.05 ? 49   ARG C N     1 
ATOM   3925  C  CA    . ARG C 2 49   ? 78.483  -33.240 58.981  1.00 151.51 ? 49   ARG C CA    1 
ATOM   3926  C  C     . ARG C 2 49   ? 77.438  -33.128 57.872  1.00 152.69 ? 49   ARG C C     1 
ATOM   3927  O  O     . ARG C 2 49   ? 77.481  -33.887 56.903  1.00 157.25 ? 49   ARG C O     1 
ATOM   3928  C  CB    . ARG C 2 49   ? 78.017  -34.253 60.022  1.00 163.02 ? 49   ARG C CB    1 
ATOM   3929  C  CG    . ARG C 2 49   ? 77.739  -35.638 59.460  1.00 181.59 ? 49   ARG C CG    1 
ATOM   3930  C  CD    . ARG C 2 49   ? 79.024  -36.448 59.301  1.00 201.34 ? 49   ARG C CD    1 
ATOM   3931  N  NE    . ARG C 2 49   ? 79.671  -36.680 60.595  1.00 202.19 ? 49   ARG C NE    1 
ATOM   3932  C  CZ    . ARG C 2 49   ? 79.460  -37.745 61.367  1.00 201.46 ? 49   ARG C CZ    1 
ATOM   3933  N  NH1   . ARG C 2 49   ? 78.639  -38.715 60.974  1.00 205.84 ? 49   ARG C NH1   1 
ATOM   3934  N  NH2   . ARG C 2 49   ? 80.097  -37.857 62.526  1.00 194.74 ? 49   ARG C NH2   1 
ATOM   3935  N  N     . GLU C 2 50   ? 76.492  -32.204 58.014  1.00 147.88 ? 50   GLU C N     1 
ATOM   3936  C  CA    . GLU C 2 50   ? 75.503  -31.988 56.958  1.00 148.50 ? 50   GLU C CA    1 
ATOM   3937  C  C     . GLU C 2 50   ? 76.020  -31.160 55.788  1.00 150.13 ? 50   GLU C C     1 
ATOM   3938  O  O     . GLU C 2 50   ? 75.860  -31.552 54.630  1.00 153.84 ? 50   GLU C O     1 
ATOM   3939  C  CB    . GLU C 2 50   ? 74.218  -31.374 57.509  1.00 150.96 ? 50   GLU C CB    1 
ATOM   3940  C  CG    . GLU C 2 50   ? 73.391  -32.341 58.334  1.00 159.72 ? 50   GLU C CG    1 
ATOM   3941  C  CD    . GLU C 2 50   ? 71.945  -31.904 58.468  1.00 166.44 ? 50   GLU C CD    1 
ATOM   3942  O  OE1   . GLU C 2 50   ? 71.445  -31.207 57.557  1.00 170.23 ? 50   GLU C OE1   1 
ATOM   3943  O  OE2   . GLU C 2 50   ? 71.308  -32.256 59.484  1.00 166.01 ? 50   GLU C OE2   1 
ATOM   3944  N  N     . THR C 2 51   ? 76.651  -30.027 56.085  1.00 146.69 ? 51   THR C N     1 
ATOM   3945  C  CA    . THR C 2 51   ? 77.099  -29.121 55.030  1.00 144.90 ? 51   THR C CA    1 
ATOM   3946  C  C     . THR C 2 51   ? 78.319  -29.673 54.257  1.00 148.60 ? 51   THR C C     1 
ATOM   3947  O  O     . THR C 2 51   ? 78.577  -29.253 53.127  1.00 151.39 ? 51   THR C O     1 
ATOM   3948  C  CB    . THR C 2 51   ? 77.336  -27.678 55.561  1.00 135.55 ? 51   THR C CB    1 
ATOM   3949  O  OG1   . THR C 2 51   ? 76.266  -27.303 56.436  1.00 133.18 ? 51   THR C OG1   1 
ATOM   3950  C  CG2   . THR C 2 51   ? 77.365  -26.696 54.427  1.00 136.56 ? 51   THR C CG2   1 
ATOM   3951  N  N     . PHE C 2 52   ? 79.035  -30.635 54.848  1.00 145.74 ? 52   PHE C N     1 
ATOM   3952  C  CA    . PHE C 2 52   ? 80.225  -31.241 54.224  1.00 140.48 ? 52   PHE C CA    1 
ATOM   3953  C  C     . PHE C 2 52   ? 80.092  -32.735 53.945  1.00 142.56 ? 52   PHE C C     1 
ATOM   3954  O  O     . PHE C 2 52   ? 79.511  -33.465 54.743  1.00 142.97 ? 52   PHE C O     1 
ATOM   3955  C  CB    . PHE C 2 52   ? 81.437  -31.063 55.122  1.00 135.97 ? 52   PHE C CB    1 
ATOM   3956  C  CG    . PHE C 2 52   ? 81.966  -29.666 55.162  1.00 140.37 ? 52   PHE C CG    1 
ATOM   3957  C  CD1   . PHE C 2 52   ? 83.069  -29.310 54.401  1.00 137.94 ? 52   PHE C CD1   1 
ATOM   3958  C  CD2   . PHE C 2 52   ? 81.386  -28.715 55.975  1.00 137.04 ? 52   PHE C CD2   1 
ATOM   3959  C  CE1   . PHE C 2 52   ? 83.572  -28.037 54.439  1.00 127.13 ? 52   PHE C CE1   1 
ATOM   3960  C  CE2   . PHE C 2 52   ? 81.889  -27.446 56.012  1.00 129.95 ? 52   PHE C CE2   1 
ATOM   3961  C  CZ    . PHE C 2 52   ? 82.986  -27.109 55.241  1.00 120.60 ? 52   PHE C CZ    1 
ATOM   3962  N  N     . PRO C 2 53   ? 80.701  -33.219 52.849  1.00 145.53 ? 53   PRO C N     1 
ATOM   3963  C  CA    . PRO C 2 53   ? 81.600  -32.557 51.897  1.00 144.75 ? 53   PRO C CA    1 
ATOM   3964  C  C     . PRO C 2 53   ? 80.930  -31.603 50.909  1.00 145.51 ? 53   PRO C C     1 
ATOM   3965  O  O     . PRO C 2 53   ? 79.727  -31.661 50.660  1.00 145.61 ? 53   PRO C O     1 
ATOM   3966  C  CB    . PRO C 2 53   ? 82.200  -33.730 51.133  1.00 145.02 ? 53   PRO C CB    1 
ATOM   3967  C  CG    . PRO C 2 53   ? 81.127  -34.735 51.137  1.00 145.33 ? 53   PRO C CG    1 
ATOM   3968  C  CD    . PRO C 2 53   ? 80.517  -34.637 52.503  1.00 146.61 ? 53   PRO C CD    1 
ATOM   3969  N  N     . ILE C 2 54   ? 81.753  -30.731 50.340  1.00 148.47 ? 54   ILE C N     1 
ATOM   3970  C  CA    . ILE C 2 54   ? 81.322  -29.729 49.380  1.00 157.65 ? 54   ILE C CA    1 
ATOM   3971  C  C     . ILE C 2 54   ? 81.708  -30.161 47.938  1.00 167.79 ? 54   ILE C C     1 
ATOM   3972  O  O     . ILE C 2 54   ? 82.874  -30.051 47.544  1.00 165.79 ? 54   ILE C O     1 
ATOM   3973  C  CB    . ILE C 2 54   ? 81.987  -28.372 49.740  1.00 152.28 ? 54   ILE C CB    1 
ATOM   3974  C  CG1   . ILE C 2 54   ? 81.534  -27.888 51.123  1.00 142.50 ? 54   ILE C CG1   1 
ATOM   3975  C  CG2   . ILE C 2 54   ? 81.692  -27.335 48.696  1.00 160.15 ? 54   ILE C CG2   1 
ATOM   3976  C  CD1   . ILE C 2 54   ? 82.154  -26.576 51.533  1.00 136.71 ? 54   ILE C CD1   1 
ATOM   3977  N  N     . GLU C 2 55   ? 80.715  -30.590 47.145  1.00 171.70 ? 55   GLU C N     1 
ATOM   3978  C  CA    . GLU C 2 55   ? 80.926  -31.327 45.877  1.00 170.42 ? 55   GLU C CA    1 
ATOM   3979  C  C     . GLU C 2 55   ? 81.221  -30.472 44.621  1.00 173.76 ? 55   GLU C C     1 
ATOM   3980  O  O     . GLU C 2 55   ? 81.463  -29.270 44.715  1.00 169.55 ? 55   GLU C O     1 
ATOM   3981  C  CB    . GLU C 2 55   ? 79.712  -32.228 45.600  1.00 167.86 ? 55   GLU C CB    1 
ATOM   3982  C  CG    . GLU C 2 55   ? 80.053  -33.642 45.164  1.00 167.32 ? 55   GLU C CG    1 
ATOM   3983  C  CD    . GLU C 2 55   ? 80.630  -34.457 46.295  1.00 162.30 ? 55   GLU C CD    1 
ATOM   3984  O  OE1   . GLU C 2 55   ? 80.237  -34.217 47.453  1.00 155.88 ? 55   GLU C OE1   1 
ATOM   3985  O  OE2   . GLU C 2 55   ? 81.484  -35.326 46.034  1.00 169.21 ? 55   GLU C OE2   1 
ATOM   3986  N  N     . GLU C 2 56   ? 81.207  -31.115 43.450  1.00 177.60 ? 56   GLU C N     1 
ATOM   3987  C  CA    . GLU C 2 56   ? 81.328  -30.423 42.163  1.00 174.14 ? 56   GLU C CA    1 
ATOM   3988  C  C     . GLU C 2 56   ? 80.424  -31.031 41.094  1.00 179.41 ? 56   GLU C C     1 
ATOM   3989  O  O     . GLU C 2 56   ? 80.776  -32.036 40.469  1.00 184.83 ? 56   GLU C O     1 
ATOM   3990  C  CB    . GLU C 2 56   ? 82.775  -30.434 41.668  1.00 171.37 ? 56   GLU C CB    1 
ATOM   3991  C  CG    . GLU C 2 56   ? 83.710  -29.501 42.414  1.00 169.77 ? 56   GLU C CG    1 
ATOM   3992  C  CD    . GLU C 2 56   ? 83.420  -28.033 42.157  1.00 171.20 ? 56   GLU C CD    1 
ATOM   3993  O  OE1   . GLU C 2 56   ? 84.319  -27.332 41.645  1.00 176.08 ? 56   GLU C OE1   1 
ATOM   3994  O  OE2   . GLU C 2 56   ? 82.306  -27.568 42.477  1.00 168.68 ? 56   GLU C OE2   1 
ATOM   3995  N  N     . LEU C 2 64   ? 87.055  -31.623 42.486  1.00 161.24 ? 64   LEU C N     1 
ATOM   3996  C  CA    . LEU C 2 64   ? 87.410  -31.023 43.771  1.00 159.90 ? 64   LEU C CA    1 
ATOM   3997  C  C     . LEU C 2 64   ? 86.372  -31.302 44.869  1.00 158.99 ? 64   LEU C C     1 
ATOM   3998  O  O     . LEU C 2 64   ? 85.186  -31.046 44.690  1.00 164.00 ? 64   LEU C O     1 
ATOM   3999  C  CB    . LEU C 2 64   ? 87.620  -29.517 43.612  1.00 152.33 ? 64   LEU C CB    1 
ATOM   4000  C  CG    . LEU C 2 64   ? 88.992  -29.084 43.111  1.00 148.98 ? 64   LEU C CG    1 
ATOM   4001  C  CD1   . LEU C 2 64   ? 89.025  -27.587 42.879  1.00 152.86 ? 64   LEU C CD1   1 
ATOM   4002  C  CD2   . LEU C 2 64   ? 90.039  -29.490 44.119  1.00 154.80 ? 64   LEU C CD2   1 
ATOM   4003  N  N     . VAL C 2 65   ? 86.828  -31.840 45.997  1.00 155.67 ? 65   VAL C N     1 
ATOM   4004  C  CA    . VAL C 2 65   ? 85.957  -32.150 47.131  1.00 150.36 ? 65   VAL C CA    1 
ATOM   4005  C  C     . VAL C 2 65   ? 86.578  -31.645 48.435  1.00 151.53 ? 65   VAL C C     1 
ATOM   4006  O  O     . VAL C 2 65   ? 87.605  -32.156 48.870  1.00 155.35 ? 65   VAL C O     1 
ATOM   4007  C  CB    . VAL C 2 65   ? 85.693  -33.690 47.232  1.00 149.87 ? 65   VAL C CB    1 
ATOM   4008  C  CG1   . VAL C 2 65   ? 85.290  -34.119 48.646  1.00 142.98 ? 65   VAL C CG1   1 
ATOM   4009  C  CG2   . VAL C 2 65   ? 84.648  -34.124 46.212  1.00 155.14 ? 65   VAL C CG2   1 
ATOM   4010  N  N     . LEU C 2 66   ? 85.949  -30.651 49.062  1.00 152.44 ? 66   LEU C N     1 
ATOM   4011  C  CA    . LEU C 2 66   ? 86.434  -30.097 50.332  1.00 147.01 ? 66   LEU C CA    1 
ATOM   4012  C  C     . LEU C 2 66   ? 85.687  -30.762 51.466  1.00 140.59 ? 66   LEU C C     1 
ATOM   4013  O  O     . LEU C 2 66   ? 84.472  -30.667 51.547  1.00 142.51 ? 66   LEU C O     1 
ATOM   4014  C  CB    . LEU C 2 66   ? 86.236  -28.575 50.389  1.00 143.99 ? 66   LEU C CB    1 
ATOM   4015  C  CG    . LEU C 2 66   ? 86.576  -27.811 51.678  1.00 134.24 ? 66   LEU C CG    1 
ATOM   4016  C  CD1   . LEU C 2 66   ? 88.043  -27.924 52.043  1.00 135.17 ? 66   LEU C CD1   1 
ATOM   4017  C  CD2   . LEU C 2 66   ? 86.190  -26.352 51.528  1.00 137.32 ? 66   LEU C CD2   1 
ATOM   4018  N  N     . ASP C 2 67   ? 86.413  -31.439 52.343  1.00 140.38 ? 67   ASP C N     1 
ATOM   4019  C  CA    . ASP C 2 67   ? 85.771  -32.315 53.304  1.00 144.41 ? 67   ASP C CA    1 
ATOM   4020  C  C     . ASP C 2 67   ? 86.057  -31.924 54.753  1.00 139.16 ? 67   ASP C C     1 
ATOM   4021  O  O     . ASP C 2 67   ? 87.152  -31.472 55.080  1.00 139.08 ? 67   ASP C O     1 
ATOM   4022  C  CB    . ASP C 2 67   ? 86.186  -33.758 53.027  1.00 148.20 ? 67   ASP C CB    1 
ATOM   4023  C  CG    . ASP C 2 67   ? 85.215  -34.757 53.597  1.00 154.67 ? 67   ASP C CG    1 
ATOM   4024  O  OD1   . ASP C 2 67   ? 84.160  -34.335 54.130  1.00 153.11 ? 67   ASP C OD1   1 
ATOM   4025  O  OD2   . ASP C 2 67   ? 85.511  -35.966 53.498  1.00 165.31 ? 67   ASP C OD2   1 
ATOM   4026  N  N     . PHE C 2 68   ? 85.061  -32.091 55.616  1.00 132.62 ? 68   PHE C N     1 
ATOM   4027  C  CA    . PHE C 2 68   ? 85.207  -31.720 57.019  1.00 133.35 ? 68   PHE C CA    1 
ATOM   4028  C  C     . PHE C 2 68   ? 85.717  -32.869 57.846  1.00 137.91 ? 68   PHE C C     1 
ATOM   4029  O  O     . PHE C 2 68   ? 85.245  -33.996 57.708  1.00 141.14 ? 68   PHE C O     1 
ATOM   4030  C  CB    . PHE C 2 68   ? 83.873  -31.257 57.592  1.00 140.47 ? 68   PHE C CB    1 
ATOM   4031  C  CG    . PHE C 2 68   ? 83.798  -31.291 59.104  1.00 140.53 ? 68   PHE C CG    1 
ATOM   4032  C  CD1   . PHE C 2 68   ? 84.424  -30.321 59.869  1.00 136.82 ? 68   PHE C CD1   1 
ATOM   4033  C  CD2   . PHE C 2 68   ? 83.066  -32.276 59.754  1.00 145.51 ? 68   PHE C CD2   1 
ATOM   4034  C  CE1   . PHE C 2 68   ? 84.342  -30.339 61.247  1.00 135.58 ? 68   PHE C CE1   1 
ATOM   4035  C  CE2   . PHE C 2 68   ? 82.981  -32.300 61.137  1.00 146.22 ? 68   PHE C CE2   1 
ATOM   4036  C  CZ    . PHE C 2 68   ? 83.623  -31.329 61.881  1.00 142.32 ? 68   PHE C CZ    1 
ATOM   4037  N  N     . LEU C 2 69   ? 86.669  -32.567 58.724  1.00 139.25 ? 69   LEU C N     1 
ATOM   4038  C  CA    . LEU C 2 69   ? 87.278  -33.575 59.591  1.00 143.95 ? 69   LEU C CA    1 
ATOM   4039  C  C     . LEU C 2 69   ? 86.836  -33.480 61.057  1.00 147.43 ? 69   LEU C C     1 
ATOM   4040  O  O     . LEU C 2 69   ? 86.157  -34.381 61.559  1.00 155.08 ? 69   LEU C O     1 
ATOM   4041  C  CB    . LEU C 2 69   ? 88.805  -33.524 59.502  1.00 143.33 ? 69   LEU C CB    1 
ATOM   4042  C  CG    . LEU C 2 69   ? 89.479  -33.998 58.213  1.00 145.72 ? 69   LEU C CG    1 
ATOM   4043  C  CD1   . LEU C 2 69   ? 90.965  -34.203 58.464  1.00 150.54 ? 69   LEU C CD1   1 
ATOM   4044  C  CD2   . LEU C 2 69   ? 88.842  -35.272 57.670  1.00 156.13 ? 69   LEU C CD2   1 
ATOM   4045  N  N     . GLU C 2 70   ? 87.233  -32.406 61.739  1.00 142.28 ? 70   GLU C N     1 
ATOM   4046  C  CA    . GLU C 2 70   ? 86.818  -32.160 63.123  1.00 143.62 ? 70   GLU C CA    1 
ATOM   4047  C  C     . GLU C 2 70   ? 86.823  -30.656 63.413  1.00 145.52 ? 70   GLU C C     1 
ATOM   4048  O  O     . GLU C 2 70   ? 87.431  -29.892 62.661  1.00 146.02 ? 70   GLU C O     1 
ATOM   4049  C  CB    . GLU C 2 70   ? 87.750  -32.873 64.099  1.00 144.40 ? 70   GLU C CB    1 
ATOM   4050  C  CG    . GLU C 2 70   ? 89.141  -32.257 64.174  1.00 153.14 ? 70   GLU C CG    1 
ATOM   4051  C  CD    . GLU C 2 70   ? 89.838  -32.516 65.507  1.00 164.80 ? 70   GLU C CD    1 
ATOM   4052  O  OE1   . GLU C 2 70   ? 89.536  -31.806 66.495  1.00 162.19 ? 70   GLU C OE1   1 
ATOM   4053  O  OE2   . GLU C 2 70   ? 90.692  -33.428 65.570  1.00 170.18 ? 70   GLU C OE2   1 
ATOM   4054  N  N     . TYR C 2 71   ? 86.164  -30.236 64.499  1.00 144.46 ? 71   TYR C N     1 
ATOM   4055  C  CA    . TYR C 2 71   ? 86.182  -28.827 64.943  1.00 136.77 ? 71   TYR C CA    1 
ATOM   4056  C  C     . TYR C 2 71   ? 86.736  -28.711 66.352  1.00 132.40 ? 71   TYR C C     1 
ATOM   4057  O  O     . TYR C 2 71   ? 86.878  -29.714 67.050  1.00 138.04 ? 71   TYR C O     1 
ATOM   4058  C  CB    . TYR C 2 71   ? 84.790  -28.195 64.909  1.00 134.60 ? 71   TYR C CB    1 
ATOM   4059  C  CG    . TYR C 2 71   ? 83.848  -28.658 66.007  1.00 137.84 ? 71   TYR C CG    1 
ATOM   4060  C  CD1   . TYR C 2 71   ? 83.662  -27.910 67.162  1.00 131.42 ? 71   TYR C CD1   1 
ATOM   4061  C  CD2   . TYR C 2 71   ? 83.127  -29.838 65.877  1.00 143.78 ? 71   TYR C CD2   1 
ATOM   4062  C  CE1   . TYR C 2 71   ? 82.786  -28.336 68.159  1.00 131.61 ? 71   TYR C CE1   1 
ATOM   4063  C  CE2   . TYR C 2 71   ? 82.253  -30.264 66.864  1.00 141.20 ? 71   TYR C CE2   1 
ATOM   4064  C  CZ    . TYR C 2 71   ? 82.087  -29.517 68.002  1.00 133.10 ? 71   TYR C CZ    1 
ATOM   4065  O  OH    . TYR C 2 71   ? 81.214  -29.969 68.963  1.00 129.82 ? 71   TYR C OH    1 
ATOM   4066  N  N     . ARG C 2 72   ? 87.072  -27.498 66.770  1.00 125.14 ? 72   ARG C N     1 
ATOM   4067  C  CA    . ARG C 2 72   ? 87.602  -27.334 68.116  1.00 133.28 ? 72   ARG C CA    1 
ATOM   4068  C  C     . ARG C 2 72   ? 87.341  -25.954 68.714  1.00 129.34 ? 72   ARG C C     1 
ATOM   4069  O  O     . ARG C 2 72   ? 87.160  -24.983 67.991  1.00 128.34 ? 72   ARG C O     1 
ATOM   4070  C  CB    . ARG C 2 72   ? 89.100  -27.660 68.143  1.00 138.77 ? 72   ARG C CB    1 
ATOM   4071  C  CG    . ARG C 2 72   ? 89.995  -26.580 67.556  1.00 135.51 ? 72   ARG C CG    1 
ATOM   4072  C  CD    . ARG C 2 72   ? 91.477  -26.903 67.746  1.00 131.98 ? 72   ARG C CD    1 
ATOM   4073  N  NE    . ARG C 2 72   ? 92.301  -25.701 67.639  1.00 131.33 ? 72   ARG C NE    1 
ATOM   4074  C  CZ    . ARG C 2 72   ? 92.613  -24.917 68.669  1.00 140.97 ? 72   ARG C CZ    1 
ATOM   4075  N  NH1   . ARG C 2 72   ? 92.179  -25.220 69.888  1.00 148.64 ? 72   ARG C NH1   1 
ATOM   4076  N  NH2   . ARG C 2 72   ? 93.360  -23.832 68.486  1.00 142.04 ? 72   ARG C NH2   1 
ATOM   4077  N  N     . LEU C 2 73   ? 87.333  -25.870 70.040  1.00 128.46 ? 73   LEU C N     1 
ATOM   4078  C  CA    . LEU C 2 73   ? 87.032  -24.611 70.708  1.00 129.96 ? 73   LEU C CA    1 
ATOM   4079  C  C     . LEU C 2 73   ? 88.122  -24.139 71.669  1.00 140.73 ? 73   LEU C C     1 
ATOM   4080  O  O     . LEU C 2 73   ? 88.435  -24.815 72.659  1.00 145.41 ? 73   LEU C O     1 
ATOM   4081  C  CB    . LEU C 2 73   ? 85.703  -24.719 71.444  1.00 131.33 ? 73   LEU C CB    1 
ATOM   4082  C  CG    . LEU C 2 73   ? 84.494  -24.975 70.546  1.00 124.51 ? 73   LEU C CG    1 
ATOM   4083  C  CD1   . LEU C 2 73   ? 83.237  -25.036 71.385  1.00 120.85 ? 73   LEU C CD1   1 
ATOM   4084  C  CD2   . LEU C 2 73   ? 84.370  -23.908 69.486  1.00 115.90 ? 73   LEU C CD2   1 
ATOM   4085  N  N     . GLY C 2 74   ? 88.673  -22.962 71.372  1.00 142.57 ? 74   GLY C N     1 
ATOM   4086  C  CA    . GLY C 2 74   ? 89.748  -22.372 72.152  1.00 142.42 ? 74   GLY C CA    1 
ATOM   4087  C  C     . GLY C 2 74   ? 89.235  -21.566 73.326  1.00 141.34 ? 74   GLY C C     1 
ATOM   4088  O  O     . GLY C 2 74   ? 88.044  -21.579 73.632  1.00 138.49 ? 74   GLY C O     1 
ATOM   4089  N  N     . GLU C 2 75   ? 90.148  -20.869 73.989  1.00 144.01 ? 75   GLU C N     1 
ATOM   4090  C  CA    . GLU C 2 75   ? 89.824  -20.140 75.207  1.00 143.73 ? 75   GLU C CA    1 
ATOM   4091  C  C     . GLU C 2 75   ? 89.373  -18.704 74.913  1.00 144.66 ? 75   GLU C C     1 
ATOM   4092  O  O     . GLU C 2 75   ? 89.769  -18.119 73.897  1.00 145.66 ? 75   GLU C O     1 
ATOM   4093  C  CB    . GLU C 2 75   ? 91.024  -20.153 76.170  1.00 145.96 ? 75   GLU C CB    1 
ATOM   4094  C  CG    . GLU C 2 75   ? 91.556  -21.547 76.513  1.00 153.01 ? 75   GLU C CG    1 
ATOM   4095  C  CD    . GLU C 2 75   ? 90.625  -22.352 77.409  1.00 159.42 ? 75   GLU C CD    1 
ATOM   4096  O  OE1   . GLU C 2 75   ? 90.603  -23.599 77.280  1.00 167.16 ? 75   GLU C OE1   1 
ATOM   4097  O  OE2   . GLU C 2 75   ? 89.929  -21.743 78.249  1.00 155.11 ? 75   GLU C OE2   1 
ATOM   4098  N  N     . PRO C 2 76   ? 88.543  -18.134 75.810  1.00 141.70 ? 76   PRO C N     1 
ATOM   4099  C  CA    . PRO C 2 76   ? 87.977  -16.784 75.703  1.00 140.92 ? 76   PRO C CA    1 
ATOM   4100  C  C     . PRO C 2 76   ? 89.021  -15.681 75.535  1.00 145.75 ? 76   PRO C C     1 
ATOM   4101  O  O     . PRO C 2 76   ? 90.006  -15.669 76.275  1.00 148.66 ? 76   PRO C O     1 
ATOM   4102  C  CB    . PRO C 2 76   ? 87.268  -16.605 77.047  1.00 135.88 ? 76   PRO C CB    1 
ATOM   4103  C  CG    . PRO C 2 76   ? 86.911  -17.956 77.457  1.00 132.10 ? 76   PRO C CG    1 
ATOM   4104  C  CD    . PRO C 2 76   ? 88.028  -18.832 77.000  1.00 138.30 ? 76   PRO C CD    1 
ATOM   4105  N  N     . PRO C 2 77   ? 88.801  -14.759 74.580  1.00 147.05 ? 77   PRO C N     1 
ATOM   4106  C  CA    . PRO C 2 77   ? 89.645  -13.581 74.382  1.00 152.65 ? 77   PRO C CA    1 
ATOM   4107  C  C     . PRO C 2 77   ? 89.793  -12.802 75.680  1.00 153.07 ? 77   PRO C C     1 
ATOM   4108  O  O     . PRO C 2 77   ? 90.876  -12.314 76.014  1.00 153.32 ? 77   PRO C O     1 
ATOM   4109  C  CB    . PRO C 2 77   ? 88.840  -12.752 73.376  1.00 152.37 ? 77   PRO C CB    1 
ATOM   4110  C  CG    . PRO C 2 77   ? 88.062  -13.739 72.624  1.00 147.11 ? 77   PRO C CG    1 
ATOM   4111  C  CD    . PRO C 2 77   ? 87.676  -14.770 73.634  1.00 144.79 ? 77   PRO C CD    1 
ATOM   4112  N  N     . PHE C 2 78   ? 88.695  -12.694 76.416  1.00 151.77 ? 78   PHE C N     1 
ATOM   4113  C  CA    . PHE C 2 78   ? 88.701  -11.959 77.668  1.00 153.30 ? 78   PHE C CA    1 
ATOM   4114  C  C     . PHE C 2 78   ? 87.818  -12.659 78.709  1.00 149.87 ? 78   PHE C C     1 
ATOM   4115  O  O     . PHE C 2 78   ? 86.842  -13.310 78.350  1.00 149.97 ? 78   PHE C O     1 
ATOM   4116  C  CB    . PHE C 2 78   ? 88.264  -10.518 77.404  1.00 153.13 ? 78   PHE C CB    1 
ATOM   4117  C  CG    . PHE C 2 78   ? 89.073  -9.837  76.339  1.00 152.30 ? 78   PHE C CG    1 
ATOM   4118  C  CD1   . PHE C 2 78   ? 88.556  -9.658  75.071  1.00 152.01 ? 78   PHE C CD1   1 
ATOM   4119  C  CD2   . PHE C 2 78   ? 90.365  -9.409  76.599  1.00 151.32 ? 78   PHE C CD2   1 
ATOM   4120  C  CE1   . PHE C 2 78   ? 89.298  -9.040  74.092  1.00 152.87 ? 78   PHE C CE1   1 
ATOM   4121  C  CE2   . PHE C 2 78   ? 91.112  -8.797  75.623  1.00 153.97 ? 78   PHE C CE2   1 
ATOM   4122  C  CZ    . PHE C 2 78   ? 90.579  -8.610  74.367  1.00 150.49 ? 78   PHE C CZ    1 
ATOM   4123  N  N     . PRO C 2 79   ? 88.170  -12.544 80.003  1.00 148.23 ? 79   PRO C N     1 
ATOM   4124  C  CA    . PRO C 2 79   ? 87.394  -13.219 81.046  1.00 149.78 ? 79   PRO C CA    1 
ATOM   4125  C  C     . PRO C 2 79   ? 86.044  -12.537 81.131  1.00 155.12 ? 79   PRO C C     1 
ATOM   4126  O  O     . PRO C 2 79   ? 85.922  -11.423 80.613  1.00 154.25 ? 79   PRO C O     1 
ATOM   4127  C  CB    . PRO C 2 79   ? 88.197  -12.927 82.307  1.00 152.85 ? 79   PRO C CB    1 
ATOM   4128  C  CG    . PRO C 2 79   ? 88.780  -11.575 82.039  1.00 153.92 ? 79   PRO C CG    1 
ATOM   4129  C  CD    . PRO C 2 79   ? 89.146  -11.601 80.579  1.00 153.11 ? 79   PRO C CD    1 
ATOM   4130  N  N     . GLN C 2 80   ? 85.061  -13.174 81.765  1.00 157.62 ? 80   GLN C N     1 
ATOM   4131  C  CA    . GLN C 2 80   ? 83.680  -12.684 81.724  1.00 154.72 ? 80   GLN C CA    1 
ATOM   4132  C  C     . GLN C 2 80   ? 83.528  -11.193 82.065  1.00 154.67 ? 80   GLN C C     1 
ATOM   4133  O  O     . GLN C 2 80   ? 82.949  -10.430 81.290  1.00 149.67 ? 80   GLN C O     1 
ATOM   4134  C  CB    . GLN C 2 80   ? 82.781  -13.519 82.638  1.00 152.84 ? 80   GLN C CB    1 
ATOM   4135  C  CG    . GLN C 2 80   ? 82.745  -15.005 82.340  1.00 146.22 ? 80   GLN C CG    1 
ATOM   4136  C  CD    . GLN C 2 80   ? 81.453  -15.634 82.824  1.00 149.85 ? 80   GLN C CD    1 
ATOM   4137  O  OE1   . GLN C 2 80   ? 80.380  -15.040 82.697  1.00 146.29 ? 80   GLN C OE1   1 
ATOM   4138  N  NE2   . GLN C 2 80   ? 81.548  -16.832 83.398  1.00 153.39 ? 80   GLN C NE2   1 
ATOM   4139  N  N     . ASP C 2 81   ? 84.066  -10.792 83.217  1.00 159.53 ? 81   ASP C N     1 
ATOM   4140  C  CA    . ASP C 2 81   ? 83.922  -9.424  83.723  1.00 159.08 ? 81   ASP C CA    1 
ATOM   4141  C  C     . ASP C 2 81   ? 84.425  -8.391  82.731  1.00 152.18 ? 81   ASP C C     1 
ATOM   4142  O  O     . ASP C 2 81   ? 83.740  -7.409  82.428  1.00 148.35 ? 81   ASP C O     1 
ATOM   4143  C  CB    . ASP C 2 81   ? 84.687  -9.254  85.040  1.00 163.24 ? 81   ASP C CB    1 
ATOM   4144  C  CG    . ASP C 2 81   ? 84.151  -10.131 86.149  1.00 165.73 ? 81   ASP C CG    1 
ATOM   4145  O  OD1   . ASP C 2 81   ? 82.957  -10.007 86.519  1.00 161.64 ? 81   ASP C OD1   1 
ATOM   4146  O  OD2   . ASP C 2 81   ? 84.939  -10.955 86.648  1.00 171.91 ? 81   ASP C OD2   1 
ATOM   4147  N  N     . GLU C 2 82   ? 85.634  -8.623  82.241  1.00 148.63 ? 82   GLU C N     1 
ATOM   4148  C  CA    . GLU C 2 82   ? 86.260  -7.703  81.325  1.00 146.38 ? 82   GLU C CA    1 
ATOM   4149  C  C     . GLU C 2 82   ? 85.329  -7.428  80.167  1.00 148.98 ? 82   GLU C C     1 
ATOM   4150  O  O     . GLU C 2 82   ? 85.195  -6.291  79.733  1.00 154.65 ? 82   GLU C O     1 
ATOM   4151  C  CB    . GLU C 2 82   ? 87.574  -8.274  80.816  1.00 146.99 ? 82   GLU C CB    1 
ATOM   4152  C  CG    . GLU C 2 82   ? 88.307  -7.328  79.904  1.00 152.70 ? 82   GLU C CG    1 
ATOM   4153  C  CD    . GLU C 2 82   ? 89.800  -7.511  79.983  1.00 158.57 ? 82   GLU C CD    1 
ATOM   4154  O  OE1   . GLU C 2 82   ? 90.248  -8.316  80.829  1.00 153.37 ? 82   GLU C OE1   1 
ATOM   4155  O  OE2   . GLU C 2 82   ? 90.521  -6.849  79.206  1.00 165.48 ? 82   GLU C OE2   1 
ATOM   4156  N  N     . CYS C 2 83   ? 84.657  -8.471  79.698  1.00 148.12 ? 83   CYS C N     1 
ATOM   4157  C  CA    . CYS C 2 83   ? 83.795  -8.366  78.527  1.00 146.60 ? 83   CYS C CA    1 
ATOM   4158  C  C     . CYS C 2 83   ? 82.631  -7.419  78.761  1.00 143.74 ? 83   CYS C C     1 
ATOM   4159  O  O     . CYS C 2 83   ? 82.176  -6.746  77.836  1.00 142.95 ? 83   CYS C O     1 
ATOM   4160  C  CB    . CYS C 2 83   ? 83.279  -9.745  78.124  1.00 143.86 ? 83   CYS C CB    1 
ATOM   4161  S  SG    . CYS C 2 83   ? 84.574  -10.864 77.541  1.00 153.55 ? 83   CYS C SG    1 
ATOM   4162  N  N     . ARG C 2 84   ? 82.160  -7.374  80.004  1.00 145.49 ? 84   ARG C N     1 
ATOM   4163  C  CA    . ARG C 2 84   ? 81.034  -6.524  80.375  1.00 147.26 ? 84   ARG C CA    1 
ATOM   4164  C  C     . ARG C 2 84   ? 81.420  -5.045  80.333  1.00 148.75 ? 84   ARG C C     1 
ATOM   4165  O  O     . ARG C 2 84   ? 80.790  -4.235  79.648  1.00 150.68 ? 84   ARG C O     1 
ATOM   4166  C  CB    . ARG C 2 84   ? 80.487  -6.920  81.763  1.00 145.41 ? 84   ARG C CB    1 
ATOM   4167  C  CG    . ARG C 2 84   ? 79.450  -8.073  81.764  1.00 142.09 ? 84   ARG C CG    1 
ATOM   4168  C  CD    . ARG C 2 84   ? 79.520  -8.953  83.039  1.00 142.98 ? 84   ARG C CD    1 
ATOM   4169  N  NE    . ARG C 2 84   ? 78.557  -10.067 83.035  1.00 147.63 ? 84   ARG C NE    1 
ATOM   4170  C  CZ    . ARG C 2 84   ? 78.590  -11.119 83.860  1.00 149.05 ? 84   ARG C CZ    1 
ATOM   4171  N  NH1   . ARG C 2 84   ? 79.545  -11.230 84.779  1.00 148.64 ? 84   ARG C NH1   1 
ATOM   4172  N  NH2   . ARG C 2 84   ? 77.662  -12.070 83.763  1.00 139.82 ? 84   ARG C NH2   1 
ATOM   4173  N  N     . GLU C 2 85   ? 82.475  -4.697  81.049  1.00 147.19 ? 85   GLU C N     1 
ATOM   4174  C  CA    . GLU C 2 85   ? 82.891  -3.311  81.123  1.00 148.70 ? 85   GLU C CA    1 
ATOM   4175  C  C     . GLU C 2 85   ? 83.319  -2.774  79.761  1.00 150.61 ? 85   GLU C C     1 
ATOM   4176  O  O     . GLU C 2 85   ? 83.068  -1.614  79.443  1.00 153.10 ? 85   GLU C O     1 
ATOM   4177  C  CB    . GLU C 2 85   ? 84.022  -3.185  82.128  1.00 151.99 ? 85   GLU C CB    1 
ATOM   4178  C  CG    . GLU C 2 85   ? 84.941  -2.028  81.887  1.00 160.51 ? 85   GLU C CG    1 
ATOM   4179  C  CD    . GLU C 2 85   ? 86.219  -2.188  82.661  1.00 169.65 ? 85   GLU C CD    1 
ATOM   4180  O  OE1   . GLU C 2 85   ? 86.126  -2.368  83.894  1.00 174.88 ? 85   GLU C OE1   1 
ATOM   4181  O  OE2   . GLU C 2 85   ? 87.307  -2.163  82.041  1.00 167.02 ? 85   GLU C OE2   1 
ATOM   4182  N  N     . LYS C 2 86   ? 83.931  -3.639  78.955  1.00 151.04 ? 86   LYS C N     1 
ATOM   4183  C  CA    . LYS C 2 86   ? 84.542  -3.257  77.682  1.00 148.64 ? 86   LYS C CA    1 
ATOM   4184  C  C     . LYS C 2 86   ? 83.627  -3.362  76.460  1.00 148.95 ? 86   LYS C C     1 
ATOM   4185  O  O     . LYS C 2 86   ? 84.090  -3.227  75.331  1.00 153.02 ? 86   LYS C O     1 
ATOM   4186  C  CB    . LYS C 2 86   ? 85.833  -4.043  77.451  1.00 151.79 ? 86   LYS C CB    1 
ATOM   4187  C  CG    . LYS C 2 86   ? 86.826  -3.901  78.589  1.00 158.81 ? 86   LYS C CG    1 
ATOM   4188  C  CD    . LYS C 2 86   ? 88.268  -4.038  78.122  1.00 168.27 ? 86   LYS C CD    1 
ATOM   4189  C  CE    . LYS C 2 86   ? 89.222  -3.753  79.276  1.00 169.77 ? 86   LYS C CE    1 
ATOM   4190  N  NZ    . LYS C 2 86   ? 90.609  -3.501  78.810  1.00 174.69 ? 86   LYS C NZ    1 
ATOM   4191  N  N     . ASP C 2 87   ? 82.346  -3.639  76.686  1.00 147.88 ? 87   ASP C N     1 
ATOM   4192  C  CA    . ASP C 2 87   ? 81.345  -3.644  75.614  1.00 146.32 ? 87   ASP C CA    1 
ATOM   4193  C  C     . ASP C 2 87   ? 81.629  -4.660  74.535  1.00 141.90 ? 87   ASP C C     1 
ATOM   4194  O  O     . ASP C 2 87   ? 81.263  -4.462  73.383  1.00 145.03 ? 87   ASP C O     1 
ATOM   4195  C  CB    . ASP C 2 87   ? 81.227  -2.276  74.940  1.00 149.33 ? 87   ASP C CB    1 
ATOM   4196  C  CG    . ASP C 2 87   ? 80.195  -1.391  75.587  1.00 152.67 ? 87   ASP C CG    1 
ATOM   4197  O  OD1   . ASP C 2 87   ? 79.464  -1.866  76.494  1.00 147.66 ? 87   ASP C OD1   1 
ATOM   4198  O  OD2   . ASP C 2 87   ? 80.118  -0.215  75.169  1.00 153.04 ? 87   ASP C OD2   1 
ATOM   4199  N  N     . LEU C 2 88   ? 82.288  -5.745  74.889  1.00 137.78 ? 88   LEU C N     1 
ATOM   4200  C  CA    . LEU C 2 88   ? 82.532  -6.767  73.898  1.00 141.07 ? 88   LEU C CA    1 
ATOM   4201  C  C     . LEU C 2 88   ? 81.977  -8.112  74.363  1.00 137.63 ? 88   LEU C C     1 
ATOM   4202  O  O     . LEU C 2 88   ? 81.668  -8.285  75.539  1.00 137.01 ? 88   LEU C O     1 
ATOM   4203  C  CB    . LEU C 2 88   ? 84.017  -6.825  73.520  1.00 148.25 ? 88   LEU C CB    1 
ATOM   4204  C  CG    . LEU C 2 88   ? 85.091  -6.807  74.612  1.00 150.81 ? 88   LEU C CG    1 
ATOM   4205  C  CD1   . LEU C 2 88   ? 85.438  -8.217  75.033  1.00 150.08 ? 88   LEU C CD1   1 
ATOM   4206  C  CD2   . LEU C 2 88   ? 86.336  -6.090  74.136  1.00 160.68 ? 88   LEU C CD2   1 
ATOM   4207  N  N     . THR C 2 89   ? 81.841  -9.044  73.424  1.00 133.14 ? 89   THR C N     1 
ATOM   4208  C  CA    . THR C 2 89   ? 81.139  -10.309 73.634  1.00 126.06 ? 89   THR C CA    1 
ATOM   4209  C  C     . THR C 2 89   ? 81.952  -11.391 74.332  1.00 131.37 ? 89   THR C C     1 
ATOM   4210  O  O     . THR C 2 89   ? 83.143  -11.564 74.050  1.00 133.27 ? 89   THR C O     1 
ATOM   4211  C  CB    . THR C 2 89   ? 80.693  -10.891 72.285  1.00 122.72 ? 89   THR C CB    1 
ATOM   4212  O  OG1   . THR C 2 89   ? 80.133  -9.852  71.478  1.00 129.11 ? 89   THR C OG1   1 
ATOM   4213  C  CG2   . THR C 2 89   ? 79.669  -11.981 72.477  1.00 123.13 ? 89   THR C CG2   1 
ATOM   4214  N  N     . TYR C 2 90   ? 81.289  -12.151 75.208  1.00 134.10 ? 90   TYR C N     1 
ATOM   4215  C  CA    . TYR C 2 90   ? 81.909  -13.316 75.831  1.00 133.78 ? 90   TYR C CA    1 
ATOM   4216  C  C     . TYR C 2 90   ? 81.765  -14.470 74.885  1.00 134.95 ? 90   TYR C C     1 
ATOM   4217  O  O     . TYR C 2 90   ? 80.640  -14.943 74.661  1.00 132.62 ? 90   TYR C O     1 
ATOM   4218  C  CB    . TYR C 2 90   ? 81.177  -13.718 77.101  1.00 133.53 ? 90   TYR C CB    1 
ATOM   4219  C  CG    . TYR C 2 90   ? 81.898  -14.796 77.879  1.00 136.65 ? 90   TYR C CG    1 
ATOM   4220  C  CD1   . TYR C 2 90   ? 83.196  -14.590 78.327  1.00 141.08 ? 90   TYR C CD1   1 
ATOM   4221  C  CD2   . TYR C 2 90   ? 81.288  -16.010 78.173  1.00 132.31 ? 90   TYR C CD2   1 
ATOM   4222  C  CE1   . TYR C 2 90   ? 83.868  -15.553 79.043  1.00 141.00 ? 90   TYR C CE1   1 
ATOM   4223  C  CE2   . TYR C 2 90   ? 81.961  -16.985 78.896  1.00 132.26 ? 90   TYR C CE2   1 
ATOM   4224  C  CZ    . TYR C 2 90   ? 83.254  -16.740 79.326  1.00 138.06 ? 90   TYR C CZ    1 
ATOM   4225  O  OH    . TYR C 2 90   ? 83.958  -17.671 80.045  1.00 144.62 ? 90   TYR C OH    1 
ATOM   4226  N  N     . GLN C 2 91   ? 82.907  -14.952 74.386  1.00 134.67 ? 91   GLN C N     1 
ATOM   4227  C  CA    . GLN C 2 91   ? 82.954  -15.892 73.267  1.00 130.09 ? 91   GLN C CA    1 
ATOM   4228  C  C     . GLN C 2 91   ? 84.263  -16.669 73.214  1.00 133.40 ? 91   GLN C C     1 
ATOM   4229  O  O     . GLN C 2 91   ? 85.208  -16.306 73.899  1.00 138.73 ? 91   GLN C O     1 
ATOM   4230  C  CB    . GLN C 2 91   ? 82.784  -15.123 71.975  1.00 125.38 ? 91   GLN C CB    1 
ATOM   4231  C  CG    . GLN C 2 91   ? 83.718  -13.982 71.854  1.00 121.28 ? 91   GLN C CG    1 
ATOM   4232  C  CD    . GLN C 2 91   ? 83.382  -13.176 70.660  1.00 123.20 ? 91   GLN C CD    1 
ATOM   4233  O  OE1   . GLN C 2 91   ? 82.260  -13.245 70.147  1.00 119.37 ? 91   GLN C OE1   1 
ATOM   4234  N  NE2   . GLN C 2 91   ? 84.348  -12.415 70.178  1.00 130.54 ? 91   GLN C NE2   1 
ATOM   4235  N  N     . ALA C 2 92   ? 84.311  -17.736 72.411  1.00 135.16 ? 92   ALA C N     1 
ATOM   4236  C  CA    . ALA C 2 92   ? 85.565  -18.468 72.138  1.00 138.70 ? 92   ALA C CA    1 
ATOM   4237  C  C     . ALA C 2 92   ? 85.851  -18.708 70.647  1.00 132.53 ? 92   ALA C C     1 
ATOM   4238  O  O     . ALA C 2 92   ? 84.938  -18.989 69.874  1.00 128.49 ? 92   ALA C O     1 
ATOM   4239  C  CB    . ALA C 2 92   ? 85.580  -19.791 72.882  1.00 140.10 ? 92   ALA C CB    1 
ATOM   4240  N  N     . PRO C 2 93   ? 87.130  -18.631 70.249  1.00 133.55 ? 93   PRO C N     1 
ATOM   4241  C  CA    . PRO C 2 93   ? 87.506  -18.938 68.864  1.00 132.87 ? 93   PRO C CA    1 
ATOM   4242  C  C     . PRO C 2 93   ? 87.109  -20.358 68.453  1.00 129.87 ? 93   PRO C C     1 
ATOM   4243  O  O     . PRO C 2 93   ? 87.337  -21.292 69.219  1.00 131.79 ? 93   PRO C O     1 
ATOM   4244  C  CB    . PRO C 2 93   ? 89.036  -18.820 68.887  1.00 138.96 ? 93   PRO C CB    1 
ATOM   4245  C  CG    . PRO C 2 93   ? 89.426  -18.962 70.345  1.00 141.37 ? 93   PRO C CG    1 
ATOM   4246  C  CD    . PRO C 2 93   ? 88.303  -18.304 71.079  1.00 139.52 ? 93   PRO C CD    1 
ATOM   4247  N  N     . LEU C 2 94   ? 86.513  -20.510 67.270  1.00 126.75 ? 94   LEU C N     1 
ATOM   4248  C  CA    . LEU C 2 94   ? 86.233  -21.831 66.693  1.00 125.06 ? 94   LEU C CA    1 
ATOM   4249  C  C     . LEU C 2 94   ? 87.054  -22.100 65.443  1.00 129.76 ? 94   LEU C C     1 
ATOM   4250  O  O     . LEU C 2 94   ? 86.842  -21.466 64.408  1.00 132.70 ? 94   LEU C O     1 
ATOM   4251  C  CB    . LEU C 2 94   ? 84.755  -21.998 66.319  1.00 118.34 ? 94   LEU C CB    1 
ATOM   4252  C  CG    . LEU C 2 94   ? 84.465  -23.150 65.332  1.00 114.07 ? 94   LEU C CG    1 
ATOM   4253  C  CD1   . LEU C 2 94   ? 84.744  -24.523 65.935  1.00 127.13 ? 94   LEU C CD1   1 
ATOM   4254  C  CD2   . LEU C 2 94   ? 83.059  -23.112 64.761  1.00 116.29 ? 94   LEU C CD2   1 
ATOM   4255  N  N     . TYR C 2 95   ? 87.980  -23.049 65.524  1.00 130.07 ? 95   TYR C N     1 
ATOM   4256  C  CA    . TYR C 2 95   ? 88.725  -23.458 64.344  1.00 126.57 ? 95   TYR C CA    1 
ATOM   4257  C  C     . TYR C 2 95   ? 88.166  -24.820 63.877  1.00 122.35 ? 95   TYR C C     1 
ATOM   4258  O  O     . TYR C 2 95   ? 87.765  -25.649 64.698  1.00 119.67 ? 95   TYR C O     1 
ATOM   4259  C  CB    . TYR C 2 95   ? 90.243  -23.508 64.623  1.00 129.71 ? 95   TYR C CB    1 
ATOM   4260  C  CG    . TYR C 2 95   ? 90.833  -22.432 65.558  1.00 131.06 ? 95   TYR C CG    1 
ATOM   4261  C  CD1   . TYR C 2 95   ? 90.741  -22.558 66.944  1.00 132.90 ? 95   TYR C CD1   1 
ATOM   4262  C  CD2   . TYR C 2 95   ? 91.531  -21.331 65.057  1.00 130.67 ? 95   TYR C CD2   1 
ATOM   4263  C  CE1   . TYR C 2 95   ? 91.286  -21.609 67.795  1.00 132.26 ? 95   TYR C CE1   1 
ATOM   4264  C  CE2   . TYR C 2 95   ? 92.084  -20.377 65.914  1.00 128.82 ? 95   TYR C CE2   1 
ATOM   4265  C  CZ    . TYR C 2 95   ? 91.953  -20.532 67.280  1.00 131.92 ? 95   TYR C CZ    1 
ATOM   4266  O  OH    . TYR C 2 95   ? 92.481  -19.620 68.160  1.00 140.66 ? 95   TYR C OH    1 
ATOM   4267  N  N     . ALA C 2 96   ? 88.105  -25.028 62.563  1.00 120.80 ? 96   ALA C N     1 
ATOM   4268  C  CA    . ALA C 2 96   ? 87.593  -26.271 61.996  1.00 119.17 ? 96   ALA C CA    1 
ATOM   4269  C  C     . ALA C 2 96   ? 88.560  -26.855 60.957  1.00 127.74 ? 96   ALA C C     1 
ATOM   4270  O  O     . ALA C 2 96   ? 89.016  -26.154 60.048  1.00 128.68 ? 96   ALA C O     1 
ATOM   4271  C  CB    . ALA C 2 96   ? 86.218  -26.043 61.386  1.00 111.92 ? 96   ALA C CB    1 
ATOM   4272  N  N     . ARG C 2 97   ? 88.884  -28.136 61.099  1.00 130.87 ? 97   ARG C N     1 
ATOM   4273  C  CA    . ARG C 2 97   ? 89.865  -28.758 60.225  1.00 132.04 ? 97   ARG C CA    1 
ATOM   4274  C  C     . ARG C 2 97   ? 89.257  -29.358 58.965  1.00 125.28 ? 97   ARG C C     1 
ATOM   4275  O  O     . ARG C 2 97   ? 88.456  -30.280 59.009  1.00 127.14 ? 97   ARG C O     1 
ATOM   4276  C  CB    . ARG C 2 97   ? 90.679  -29.806 60.984  1.00 138.77 ? 97   ARG C CB    1 
ATOM   4277  C  CG    . ARG C 2 97   ? 92.143  -29.840 60.555  1.00 149.15 ? 97   ARG C CG    1 
ATOM   4278  C  CD    . ARG C 2 97   ? 92.781  -31.198 60.750  1.00 159.90 ? 97   ARG C CD    1 
ATOM   4279  N  NE    . ARG C 2 97   ? 92.782  -31.616 62.150  1.00 176.29 ? 97   ARG C NE    1 
ATOM   4280  C  CZ    . ARG C 2 97   ? 93.053  -32.853 62.561  1.00 184.39 ? 97   ARG C CZ    1 
ATOM   4281  N  NH1   . ARG C 2 97   ? 93.341  -33.801 61.675  1.00 178.53 ? 97   ARG C NH1   1 
ATOM   4282  N  NH2   . ARG C 2 97   ? 93.028  -33.142 63.859  1.00 182.24 ? 97   ARG C NH2   1 
ATOM   4283  N  N     . LEU C 2 98   ? 89.672  -28.828 57.833  1.00 122.76 ? 98   LEU C N     1 
ATOM   4284  C  CA    . LEU C 2 98   ? 89.186  -29.301 56.560  1.00 131.54 ? 98   LEU C CA    1 
ATOM   4285  C  C     . LEU C 2 98   ? 90.319  -29.906 55.727  1.00 143.96 ? 98   LEU C C     1 
ATOM   4286  O  O     . LEU C 2 98   ? 91.497  -29.619 55.960  1.00 147.44 ? 98   LEU C O     1 
ATOM   4287  C  CB    . LEU C 2 98   ? 88.593  -28.123 55.807  1.00 134.33 ? 98   LEU C CB    1 
ATOM   4288  C  CG    . LEU C 2 98   ? 87.602  -27.300 56.614  1.00 122.52 ? 98   LEU C CG    1 
ATOM   4289  C  CD1   . LEU C 2 98   ? 87.090  -26.153 55.770  1.00 121.64 ? 98   LEU C CD1   1 
ATOM   4290  C  CD2   . LEU C 2 98   ? 86.467  -28.192 57.034  1.00 126.08 ? 98   LEU C CD2   1 
ATOM   4291  N  N     . GLN C 2 99   ? 89.969  -30.758 54.766  1.00 144.35 ? 99   GLN C N     1 
ATOM   4292  C  CA    . GLN C 2 99   ? 90.946  -31.238 53.791  1.00 145.59 ? 99   GLN C CA    1 
ATOM   4293  C  C     . GLN C 2 99   ? 90.404  -31.129 52.366  1.00 148.61 ? 99   GLN C C     1 
ATOM   4294  O  O     . GLN C 2 99   ? 89.392  -31.737 52.023  1.00 149.62 ? 99   GLN C O     1 
ATOM   4295  C  CB    . GLN C 2 99   ? 91.384  -32.673 54.095  1.00 145.86 ? 99   GLN C CB    1 
ATOM   4296  C  CG    . GLN C 2 99   ? 90.271  -33.698 54.039  1.00 146.00 ? 99   GLN C CG    1 
ATOM   4297  C  CD    . GLN C 2 99   ? 90.793  -35.092 53.825  1.00 153.03 ? 99   GLN C CD    1 
ATOM   4298  O  OE1   . GLN C 2 99   ? 91.948  -35.386 54.136  1.00 155.20 ? 99   GLN C OE1   1 
ATOM   4299  N  NE2   . GLN C 2 99   ? 89.947  -35.963 53.282  1.00 156.15 ? 99   GLN C NE2   1 
ATOM   4300  N  N     . LEU C 2 100  ? 91.076  -30.334 51.542  1.00 149.53 ? 100  LEU C N     1 
ATOM   4301  C  CA    . LEU C 2 100  ? 90.684  -30.186 50.153  1.00 146.04 ? 100  LEU C CA    1 
ATOM   4302  C  C     . LEU C 2 100  ? 91.201  -31.395 49.383  1.00 154.33 ? 100  LEU C C     1 
ATOM   4303  O  O     . LEU C 2 100  ? 92.396  -31.636 49.355  1.00 161.68 ? 100  LEU C O     1 
ATOM   4304  C  CB    . LEU C 2 100  ? 91.267  -28.888 49.601  1.00 142.93 ? 100  LEU C CB    1 
ATOM   4305  C  CG    . LEU C 2 100  ? 91.084  -28.572 48.122  1.00 145.32 ? 100  LEU C CG    1 
ATOM   4306  C  CD1   . LEU C 2 100  ? 89.663  -28.852 47.678  1.00 148.33 ? 100  LEU C CD1   1 
ATOM   4307  C  CD2   . LEU C 2 100  ? 91.448  -27.122 47.874  1.00 152.50 ? 100  LEU C CD2   1 
ATOM   4308  N  N     . ILE C 2 101  ? 90.303  -32.165 48.777  1.00 156.95 ? 101  ILE C N     1 
ATOM   4309  C  CA    . ILE C 2 101  ? 90.693  -33.318 47.961  1.00 158.47 ? 101  ILE C CA    1 
ATOM   4310  C  C     . ILE C 2 101  ? 90.587  -32.913 46.487  1.00 170.14 ? 101  ILE C C     1 
ATOM   4311  O  O     . ILE C 2 101  ? 89.763  -32.065 46.136  1.00 171.95 ? 101  ILE C O     1 
ATOM   4312  C  CB    . ILE C 2 101  ? 89.799  -34.555 48.245  1.00 155.04 ? 101  ILE C CB    1 
ATOM   4313  C  CG1   . ILE C 2 101  ? 89.881  -34.972 49.716  1.00 156.54 ? 101  ILE C CG1   1 
ATOM   4314  C  CG2   . ILE C 2 101  ? 90.192  -35.720 47.369  1.00 160.50 ? 101  ILE C CG2   1 
ATOM   4315  C  CD1   . ILE C 2 101  ? 88.788  -35.967 50.152  1.00 152.17 ? 101  ILE C CD1   1 
ATOM   4316  N  N     . HIS C 2 102  ? 91.448  -33.467 45.637  1.00 178.87 ? 102  HIS C N     1 
ATOM   4317  C  CA    . HIS C 2 102  ? 91.371  -33.232 44.195  1.00 186.07 ? 102  HIS C CA    1 
ATOM   4318  C  C     . HIS C 2 102  ? 90.590  -34.396 43.556  1.00 190.56 ? 102  HIS C C     1 
ATOM   4319  O  O     . HIS C 2 102  ? 90.816  -35.568 43.890  1.00 186.58 ? 102  HIS C O     1 
ATOM   4320  C  CB    . HIS C 2 102  ? 92.792  -33.117 43.615  1.00 191.67 ? 102  HIS C CB    1 
ATOM   4321  C  CG    . HIS C 2 102  ? 92.910  -32.215 42.425  1.00 196.56 ? 102  HIS C CG    1 
ATOM   4322  N  ND1   . HIS C 2 102  ? 94.137  -31.828 41.903  1.00 201.02 ? 102  HIS C ND1   1 
ATOM   4323  C  CD2   . HIS C 2 102  ? 91.979  -31.626 41.636  1.00 195.48 ? 102  HIS C CD2   1 
ATOM   4324  C  CE1   . HIS C 2 102  ? 93.948  -31.052 40.861  1.00 200.72 ? 102  HIS C CE1   1 
ATOM   4325  N  NE2   . HIS C 2 102  ? 92.645  -30.907 40.673  1.00 200.81 ? 102  HIS C NE2   1 
ATOM   4326  N  N     . LYS C 2 103  ? 89.653  -34.077 42.662  1.00 193.75 ? 103  LYS C N     1 
ATOM   4327  C  CA    . LYS C 2 103  ? 88.943  -35.119 41.925  1.00 199.01 ? 103  LYS C CA    1 
ATOM   4328  C  C     . LYS C 2 103  ? 89.901  -35.679 40.871  1.00 209.42 ? 103  LYS C C     1 
ATOM   4329  O  O     . LYS C 2 103  ? 90.394  -34.940 40.013  1.00 212.33 ? 103  LYS C O     1 
ATOM   4330  C  CB    . LYS C 2 103  ? 87.681  -34.569 41.234  1.00 190.24 ? 103  LYS C CB    1 
ATOM   4331  C  CG    . LYS C 2 103  ? 86.384  -34.717 42.019  1.00 174.50 ? 103  LYS C CG    1 
ATOM   4332  C  CD    . LYS C 2 103  ? 85.190  -34.724 41.085  1.00 165.27 ? 103  LYS C CD    1 
ATOM   4333  C  CE    . LYS C 2 103  ? 85.143  -36.010 40.286  1.00 155.59 ? 103  LYS C CE    1 
ATOM   4334  N  NZ    . LYS C 2 103  ? 84.017  -36.019 39.329  1.00 141.61 ? 103  LYS C NZ    1 
ATOM   4335  N  N     . ASP C 2 104  ? 90.168  -36.981 40.961  1.00 211.39 ? 104  ASP C N     1 
ATOM   4336  C  CA    . ASP C 2 104  ? 90.993  -37.727 39.997  1.00 212.92 ? 104  ASP C CA    1 
ATOM   4337  C  C     . ASP C 2 104  ? 92.525  -37.495 40.055  1.00 209.55 ? 104  ASP C C     1 
ATOM   4338  O  O     . ASP C 2 104  ? 93.285  -38.323 39.544  1.00 208.87 ? 104  ASP C O     1 
ATOM   4339  C  CB    . ASP C 2 104  ? 90.475  -37.560 38.552  1.00 212.30 ? 104  ASP C CB    1 
ATOM   4340  C  CG    . ASP C 2 104  ? 88.972  -37.789 38.426  1.00 213.38 ? 104  ASP C CG    1 
ATOM   4341  O  OD1   . ASP C 2 104  ? 88.337  -38.215 39.417  1.00 209.42 ? 104  ASP C OD1   1 
ATOM   4342  O  OD2   . ASP C 2 104  ? 88.426  -37.544 37.327  1.00 213.97 ? 104  ASP C OD2   1 
ATOM   4343  N  N     . THR C 2 105  ? 92.984  -36.411 40.686  1.00 205.78 ? 105  THR C N     1 
ATOM   4344  C  CA    . THR C 2 105  ? 94.424  -36.227 40.924  1.00 200.78 ? 105  THR C CA    1 
ATOM   4345  C  C     . THR C 2 105  ? 94.818  -37.039 42.147  1.00 202.89 ? 105  THR C C     1 
ATOM   4346  O  O     . THR C 2 105  ? 95.910  -37.612 42.205  1.00 199.42 ? 105  THR C O     1 
ATOM   4347  C  CB    . THR C 2 105  ? 94.827  -34.749 41.168  1.00 192.40 ? 105  THR C CB    1 
ATOM   4348  O  OG1   . THR C 2 105  ? 94.354  -33.923 40.101  1.00 190.02 ? 105  THR C OG1   1 
ATOM   4349  C  CG2   . THR C 2 105  ? 96.340  -34.589 41.285  1.00 179.91 ? 105  THR C CG2   1 
ATOM   4350  N  N     . GLY C 2 106  ? 93.905  -37.075 43.120  1.00 205.61 ? 106  GLY C N     1 
ATOM   4351  C  CA    . GLY C 2 106  ? 94.104  -37.764 44.385  1.00 202.99 ? 106  GLY C CA    1 
ATOM   4352  C  C     . GLY C 2 106  ? 94.693  -36.883 45.483  1.00 201.08 ? 106  GLY C C     1 
ATOM   4353  O  O     . GLY C 2 106  ? 94.506  -37.170 46.667  1.00 192.23 ? 106  GLY C O     1 
ATOM   4354  N  N     . LEU C 2 107  ? 95.375  -35.805 45.081  1.00 200.59 ? 107  LEU C N     1 
ATOM   4355  C  CA    . LEU C 2 107  ? 96.085  -34.884 45.987  1.00 188.48 ? 107  LEU C CA    1 
ATOM   4356  C  C     . LEU C 2 107  ? 95.230  -34.318 47.118  1.00 183.67 ? 107  LEU C C     1 
ATOM   4357  O  O     . LEU C 2 107  ? 94.080  -33.934 46.900  1.00 183.59 ? 107  LEU C O     1 
ATOM   4358  C  CB    . LEU C 2 107  ? 96.669  -33.708 45.189  1.00 183.26 ? 107  LEU C CB    1 
ATOM   4359  C  CG    . LEU C 2 107  ? 96.979  -32.427 45.971  1.00 176.48 ? 107  LEU C CG    1 
ATOM   4360  C  CD1   . LEU C 2 107  ? 98.312  -32.538 46.702  1.00 176.30 ? 107  LEU C CD1   1 
ATOM   4361  C  CD2   . LEU C 2 107  ? 96.941  -31.204 45.070  1.00 178.36 ? 107  LEU C CD2   1 
ATOM   4362  N  N     . ILE C 2 108  ? 95.790  -34.259 48.325  1.00 178.05 ? 108  ILE C N     1 
ATOM   4363  C  CA    . ILE C 2 108  ? 95.147  -33.497 49.396  1.00 174.35 ? 108  ILE C CA    1 
ATOM   4364  C  C     . ILE C 2 108  ? 96.043  -32.397 50.009  1.00 170.94 ? 108  ILE C C     1 
ATOM   4365  O  O     . ILE C 2 108  ? 97.276  -32.482 49.979  1.00 169.95 ? 108  ILE C O     1 
ATOM   4366  C  CB    . ILE C 2 108  ? 94.479  -34.402 50.493  1.00 170.72 ? 108  ILE C CB    1 
ATOM   4367  C  CG1   . ILE C 2 108  ? 95.506  -34.997 51.459  1.00 170.04 ? 108  ILE C CG1   1 
ATOM   4368  C  CG2   . ILE C 2 108  ? 93.616  -35.490 49.853  1.00 167.89 ? 108  ILE C CG2   1 
ATOM   4369  C  CD1   . ILE C 2 108  ? 94.897  -35.453 52.786  1.00 159.84 ? 108  ILE C CD1   1 
ATOM   4370  N  N     . LYS C 2 109  ? 95.396  -31.336 50.493  1.00 166.68 ? 109  LYS C N     1 
ATOM   4371  C  CA    . LYS C 2 109  ? 96.026  -30.305 51.316  1.00 164.65 ? 109  LYS C CA    1 
ATOM   4372  C  C     . LYS C 2 109  ? 95.088  -30.004 52.488  1.00 160.32 ? 109  LYS C C     1 
ATOM   4373  O  O     . LYS C 2 109  ? 93.966  -29.529 52.295  1.00 157.69 ? 109  LYS C O     1 
ATOM   4374  C  CB    . LYS C 2 109  ? 96.321  -29.038 50.501  1.00 163.72 ? 109  LYS C CB    1 
ATOM   4375  C  CG    . LYS C 2 109  ? 96.960  -27.888 51.291  1.00 163.83 ? 109  LYS C CG    1 
ATOM   4376  C  CD    . LYS C 2 109  ? 98.305  -28.277 51.901  1.00 165.27 ? 109  LYS C CD    1 
ATOM   4377  C  CE    . LYS C 2 109  ? 98.856  -27.180 52.813  1.00 162.59 ? 109  LYS C CE    1 
ATOM   4378  N  NZ    . LYS C 2 109  ? 97.917  -26.818 53.916  1.00 153.73 ? 109  LYS C NZ    1 
ATOM   4379  N  N     . GLU C 2 110  ? 95.561  -30.282 53.698  1.00 157.76 ? 110  GLU C N     1 
ATOM   4380  C  CA    . GLU C 2 110  ? 94.731  -30.233 54.892  1.00 148.43 ? 110  GLU C CA    1 
ATOM   4381  C  C     . GLU C 2 110  ? 95.239  -29.177 55.871  1.00 147.29 ? 110  GLU C C     1 
ATOM   4382  O  O     . GLU C 2 110  ? 96.343  -29.276 56.411  1.00 146.00 ? 110  GLU C O     1 
ATOM   4383  C  CB    . GLU C 2 110  ? 94.694  -31.619 55.530  1.00 150.54 ? 110  GLU C CB    1 
ATOM   4384  C  CG    . GLU C 2 110  ? 94.346  -31.655 56.996  1.00 153.33 ? 110  GLU C CG    1 
ATOM   4385  C  CD    . GLU C 2 110  ? 94.595  -33.025 57.598  1.00 156.35 ? 110  GLU C CD    1 
ATOM   4386  O  OE1   . GLU C 2 110  ? 94.657  -33.117 58.842  1.00 155.32 ? 110  GLU C OE1   1 
ATOM   4387  O  OE2   . GLU C 2 110  ? 94.732  -34.005 56.826  1.00 152.87 ? 110  GLU C OE2   1 
ATOM   4388  N  N     . ASP C 2 111  ? 94.405  -28.168 56.088  1.00 146.82 ? 111  ASP C N     1 
ATOM   4389  C  CA    . ASP C 2 111  ? 94.754  -26.968 56.840  1.00 146.99 ? 111  ASP C CA    1 
ATOM   4390  C  C     . ASP C 2 111  ? 93.647  -26.761 57.882  1.00 139.09 ? 111  ASP C C     1 
ATOM   4391  O  O     . ASP C 2 111  ? 92.542  -27.270 57.713  1.00 139.54 ? 111  ASP C O     1 
ATOM   4392  C  CB    . ASP C 2 111  ? 94.833  -25.794 55.847  1.00 145.55 ? 111  ASP C CB    1 
ATOM   4393  C  CG    . ASP C 2 111  ? 95.336  -24.495 56.468  1.00 147.05 ? 111  ASP C CG    1 
ATOM   4394  O  OD1   . ASP C 2 111  ? 95.424  -23.508 55.712  1.00 148.03 ? 111  ASP C OD1   1 
ATOM   4395  O  OD2   . ASP C 2 111  ? 95.637  -24.437 57.682  1.00 144.23 ? 111  ASP C OD2   1 
ATOM   4396  N  N     . GLU C 2 112  ? 93.933  -26.050 58.969  1.00 132.96 ? 112  GLU C N     1 
ATOM   4397  C  CA    . GLU C 2 112  ? 92.894  -25.753 59.953  1.00 127.90 ? 112  GLU C CA    1 
ATOM   4398  C  C     . GLU C 2 112  ? 92.380  -24.337 59.755  1.00 130.25 ? 112  GLU C C     1 
ATOM   4399  O  O     . GLU C 2 112  ? 93.125  -23.369 59.933  1.00 134.62 ? 112  GLU C O     1 
ATOM   4400  C  CB    . GLU C 2 112  ? 93.420  -25.912 61.378  1.00 129.84 ? 112  GLU C CB    1 
ATOM   4401  C  CG    . GLU C 2 112  ? 92.323  -25.933 62.444  1.00 130.10 ? 112  GLU C CG    1 
ATOM   4402  C  CD    . GLU C 2 112  ? 92.862  -26.022 63.869  1.00 127.89 ? 112  GLU C CD    1 
ATOM   4403  O  OE1   . GLU C 2 112  ? 93.430  -25.017 64.344  1.00 126.18 ? 112  GLU C OE1   1 
ATOM   4404  O  OE2   . GLU C 2 112  ? 92.711  -27.088 64.515  1.00 123.67 ? 112  GLU C OE2   1 
ATOM   4405  N  N     . VAL C 2 113  ? 91.110  -24.212 59.390  1.00 123.19 ? 113  VAL C N     1 
ATOM   4406  C  CA    . VAL C 2 113  ? 90.568  -22.906 59.056  1.00 124.30 ? 113  VAL C CA    1 
ATOM   4407  C  C     . VAL C 2 113  ? 89.962  -22.228 60.268  1.00 130.06 ? 113  VAL C C     1 
ATOM   4408  O  O     . VAL C 2 113  ? 89.295  -22.862 61.081  1.00 129.95 ? 113  VAL C O     1 
ATOM   4409  C  CB    . VAL C 2 113  ? 89.513  -23.007 57.970  1.00 121.83 ? 113  VAL C CB    1 
ATOM   4410  C  CG1   . VAL C 2 113  ? 89.683  -21.869 56.984  1.00 128.03 ? 113  VAL C CG1   1 
ATOM   4411  C  CG2   . VAL C 2 113  ? 89.621  -24.349 57.280  1.00 121.59 ? 113  VAL C CG2   1 
ATOM   4412  N  N     . PHE C 2 114  ? 90.194  -20.930 60.389  1.00 133.23 ? 114  PHE C N     1 
ATOM   4413  C  CA    . PHE C 2 114  ? 89.629  -20.177 61.492  1.00 128.39 ? 114  PHE C CA    1 
ATOM   4414  C  C     . PHE C 2 114  ? 88.274  -19.602 61.122  1.00 130.16 ? 114  PHE C C     1 
ATOM   4415  O  O     . PHE C 2 114  ? 88.161  -18.778 60.208  1.00 132.44 ? 114  PHE C O     1 
ATOM   4416  C  CB    . PHE C 2 114  ? 90.565  -19.058 61.904  1.00 135.97 ? 114  PHE C CB    1 
ATOM   4417  C  CG    . PHE C 2 114  ? 89.975  -18.131 62.911  1.00 137.46 ? 114  PHE C CG    1 
ATOM   4418  C  CD1   . PHE C 2 114  ? 89.888  -18.505 64.236  1.00 134.69 ? 114  PHE C CD1   1 
ATOM   4419  C  CD2   . PHE C 2 114  ? 89.509  -16.884 62.536  1.00 138.59 ? 114  PHE C CD2   1 
ATOM   4420  C  CE1   . PHE C 2 114  ? 89.351  -17.662 65.172  1.00 134.50 ? 114  PHE C CE1   1 
ATOM   4421  C  CE2   . PHE C 2 114  ? 88.972  -16.036 63.468  1.00 139.02 ? 114  PHE C CE2   1 
ATOM   4422  C  CZ    . PHE C 2 114  ? 88.893  -16.425 64.790  1.00 137.62 ? 114  PHE C CZ    1 
ATOM   4423  N  N     . LEU C 2 115  ? 87.257  -20.033 61.861  1.00 131.20 ? 115  LEU C N     1 
ATOM   4424  C  CA    . LEU C 2 115  ? 85.856  -19.695 61.584  1.00 132.58 ? 115  LEU C CA    1 
ATOM   4425  C  C     . LEU C 2 115  ? 85.277  -18.481 62.329  1.00 132.85 ? 115  LEU C C     1 
ATOM   4426  O  O     . LEU C 2 115  ? 84.074  -18.227 62.255  1.00 128.05 ? 115  LEU C O     1 
ATOM   4427  C  CB    . LEU C 2 115  ? 84.953  -20.912 61.797  1.00 120.90 ? 115  LEU C CB    1 
ATOM   4428  C  CG    . LEU C 2 115  ? 85.202  -22.051 60.822  1.00 112.91 ? 115  LEU C CG    1 
ATOM   4429  C  CD1   . LEU C 2 115  ? 84.015  -22.984 60.824  1.00 110.15 ? 115  LEU C CD1   1 
ATOM   4430  C  CD2   . LEU C 2 115  ? 85.460  -21.487 59.440  1.00 117.56 ? 115  LEU C CD2   1 
ATOM   4431  N  N     . GLY C 2 116  ? 86.113  -17.743 63.051  1.00 134.51 ? 116  GLY C N     1 
ATOM   4432  C  CA    . GLY C 2 116  ? 85.620  -16.598 63.799  1.00 139.49 ? 116  GLY C CA    1 
ATOM   4433  C  C     . GLY C 2 116  ? 85.395  -16.915 65.266  1.00 139.83 ? 116  GLY C C     1 
ATOM   4434  O  O     . GLY C 2 116  ? 86.000  -17.846 65.801  1.00 140.11 ? 116  GLY C O     1 
ATOM   4435  N  N     . HIS C 2 117  ? 84.554  -16.124 65.929  1.00 136.44 ? 117  HIS C N     1 
ATOM   4436  C  CA    . HIS C 2 117  ? 84.226  -16.369 67.332  1.00 132.34 ? 117  HIS C CA    1 
ATOM   4437  C  C     . HIS C 2 117  ? 82.758  -16.834 67.501  1.00 128.26 ? 117  HIS C C     1 
ATOM   4438  O  O     . HIS C 2 117  ? 81.890  -16.427 66.723  1.00 129.60 ? 117  HIS C O     1 
ATOM   4439  C  CB    . HIS C 2 117  ? 84.501  -15.105 68.162  1.00 134.69 ? 117  HIS C CB    1 
ATOM   4440  C  CG    . HIS C 2 117  ? 85.933  -14.656 68.149  1.00 136.26 ? 117  HIS C CG    1 
ATOM   4441  N  ND1   . HIS C 2 117  ? 86.871  -15.123 69.049  1.00 135.94 ? 117  HIS C ND1   1 
ATOM   4442  C  CD2   . HIS C 2 117  ? 86.582  -13.761 67.363  1.00 134.60 ? 117  HIS C CD2   1 
ATOM   4443  C  CE1   . HIS C 2 117  ? 88.035  -14.545 68.810  1.00 137.71 ? 117  HIS C CE1   1 
ATOM   4444  N  NE2   . HIS C 2 117  ? 87.888  -13.717 67.792  1.00 137.52 ? 117  HIS C NE2   1 
ATOM   4445  N  N     . ILE C 2 118  ? 82.504  -17.739 68.459  1.00 125.73 ? 118  ILE C N     1 
ATOM   4446  C  CA    . ILE C 2 118  ? 81.131  -18.092 68.920  1.00 127.18 ? 118  ILE C CA    1 
ATOM   4447  C  C     . ILE C 2 118  ? 80.788  -17.809 70.408  1.00 127.90 ? 118  ILE C C     1 
ATOM   4448  O  O     . ILE C 2 118  ? 81.482  -18.304 71.299  1.00 127.28 ? 118  ILE C O     1 
ATOM   4449  C  CB    . ILE C 2 118  ? 80.712  -19.533 68.563  1.00 118.03 ? 118  ILE C CB    1 
ATOM   4450  C  CG1   . ILE C 2 118  ? 80.408  -19.640 67.072  1.00 121.49 ? 118  ILE C CG1   1 
ATOM   4451  C  CG2   . ILE C 2 118  ? 79.456  -19.927 69.325  1.00 111.17 ? 118  ILE C CG2   1 
ATOM   4452  C  CD1   . ILE C 2 118  ? 79.857  -20.993 66.656  1.00 122.34 ? 118  ILE C CD1   1 
ATOM   4453  N  N     . PRO C 2 119  ? 79.725  -17.013 70.671  1.00 125.45 ? 119  PRO C N     1 
ATOM   4454  C  CA    . PRO C 2 119  ? 79.242  -16.621 72.006  1.00 126.00 ? 119  PRO C CA    1 
ATOM   4455  C  C     . PRO C 2 119  ? 79.046  -17.777 72.995  1.00 124.88 ? 119  PRO C C     1 
ATOM   4456  O  O     . PRO C 2 119  ? 78.533  -18.823 72.605  1.00 122.20 ? 119  PRO C O     1 
ATOM   4457  C  CB    . PRO C 2 119  ? 77.890  -15.977 71.703  1.00 123.70 ? 119  PRO C CB    1 
ATOM   4458  C  CG    . PRO C 2 119  ? 78.047  -15.436 70.350  1.00 123.10 ? 119  PRO C CG    1 
ATOM   4459  C  CD    . PRO C 2 119  ? 78.878  -16.437 69.614  1.00 125.09 ? 119  PRO C CD    1 
ATOM   4460  N  N     . LEU C 2 120  ? 79.428  -17.562 74.258  1.00 125.87 ? 120  LEU C N     1 
ATOM   4461  C  CA    . LEU C 2 120  ? 79.461  -18.621 75.269  1.00 122.93 ? 120  LEU C CA    1 
ATOM   4462  C  C     . LEU C 2 120  ? 78.515  -18.311 76.404  1.00 117.10 ? 120  LEU C C     1 
ATOM   4463  O  O     . LEU C 2 120  ? 78.362  -17.148 76.779  1.00 118.01 ? 120  LEU C O     1 
ATOM   4464  C  CB    . LEU C 2 120  ? 80.877  -18.810 75.835  1.00 127.26 ? 120  LEU C CB    1 
ATOM   4465  C  CG    . LEU C 2 120  ? 81.947  -19.487 74.974  1.00 117.44 ? 120  LEU C CG    1 
ATOM   4466  C  CD1   . LEU C 2 120  ? 83.321  -19.236 75.550  1.00 117.73 ? 120  LEU C CD1   1 
ATOM   4467  C  CD2   . LEU C 2 120  ? 81.680  -20.972 74.890  1.00 114.48 ? 120  LEU C CD2   1 
ATOM   4468  N  N     . MET C 2 121  ? 77.899  -19.360 76.949  1.00 114.84 ? 121  MET C N     1 
ATOM   4469  C  CA    . MET C 2 121  ? 76.919  -19.229 78.033  1.00 120.39 ? 121  MET C CA    1 
ATOM   4470  C  C     . MET C 2 121  ? 77.590  -19.205 79.389  1.00 120.80 ? 121  MET C C     1 
ATOM   4471  O  O     . MET C 2 121  ? 78.410  -20.067 79.670  1.00 124.12 ? 121  MET C O     1 
ATOM   4472  C  CB    . MET C 2 121  ? 75.913  -20.384 77.996  1.00 119.34 ? 121  MET C CB    1 
ATOM   4473  C  CG    . MET C 2 121  ? 75.093  -20.562 79.273  1.00 108.77 ? 121  MET C CG    1 
ATOM   4474  S  SD    . MET C 2 121  ? 73.812  -21.799 79.014  1.00 94.62  ? 121  MET C SD    1 
ATOM   4475  C  CE    . MET C 2 121  ? 72.726  -20.954 77.869  1.00 104.75 ? 121  MET C CE    1 
ATOM   4476  N  N     . THR C 2 122  ? 77.238  -18.242 80.242  1.00 119.72 ? 122  THR C N     1 
ATOM   4477  C  CA    . THR C 2 122  ? 77.920  -18.130 81.532  1.00 124.10 ? 122  THR C CA    1 
ATOM   4478  C  C     . THR C 2 122  ? 77.418  -19.184 82.501  1.00 121.74 ? 122  THR C C     1 
ATOM   4479  O  O     . THR C 2 122  ? 76.653  -20.078 82.114  1.00 117.60 ? 122  THR C O     1 
ATOM   4480  C  CB    . THR C 2 122  ? 77.820  -16.728 82.164  1.00 123.37 ? 122  THR C CB    1 
ATOM   4481  O  OG1   . THR C 2 122  ? 76.703  -16.672 83.057  1.00 126.37 ? 122  THR C OG1   1 
ATOM   4482  C  CG2   . THR C 2 122  ? 77.706  -15.649 81.083  1.00 120.88 ? 122  THR C CG2   1 
ATOM   4483  N  N     . GLU C 2 123  ? 77.864  -19.085 83.749  1.00 122.08 ? 123  GLU C N     1 
ATOM   4484  C  CA    . GLU C 2 123  ? 77.558  -20.107 84.729  1.00 125.28 ? 123  GLU C CA    1 
ATOM   4485  C  C     . GLU C 2 123  ? 76.059  -20.226 84.943  1.00 125.12 ? 123  GLU C C     1 
ATOM   4486  O  O     . GLU C 2 123  ? 75.547  -21.323 85.100  1.00 122.18 ? 123  GLU C O     1 
ATOM   4487  C  CB    . GLU C 2 123  ? 78.230  -19.784 86.048  1.00 134.49 ? 123  GLU C CB    1 
ATOM   4488  C  CG    . GLU C 2 123  ? 79.723  -19.587 85.962  1.00 147.80 ? 123  GLU C CG    1 
ATOM   4489  C  CD    . GLU C 2 123  ? 80.362  -19.585 87.343  1.00 170.17 ? 123  GLU C CD    1 
ATOM   4490  O  OE1   . GLU C 2 123  ? 79.805  -20.232 88.265  1.00 164.85 ? 123  GLU C OE1   1 
ATOM   4491  O  OE2   . GLU C 2 123  ? 81.413  -18.932 87.515  1.00 180.61 ? 123  GLU C OE2   1 
ATOM   4492  N  N     . ASP C 2 124  ? 75.357  -19.096 84.931  1.00 128.42 ? 124  ASP C N     1 
ATOM   4493  C  CA    . ASP C 2 124  ? 73.929  -19.068 85.267  1.00 126.91 ? 124  ASP C CA    1 
ATOM   4494  C  C     . ASP C 2 124  ? 72.972  -19.321 84.089  1.00 122.94 ? 124  ASP C C     1 
ATOM   4495  O  O     . ASP C 2 124  ? 71.758  -19.292 84.256  1.00 128.41 ? 124  ASP C O     1 
ATOM   4496  C  CB    . ASP C 2 124  ? 73.562  -17.749 85.957  1.00 126.69 ? 124  ASP C CB    1 
ATOM   4497  C  CG    . ASP C 2 124  ? 73.703  -16.550 85.036  1.00 124.90 ? 124  ASP C CG    1 
ATOM   4498  O  OD1   . ASP C 2 124  ? 74.792  -16.366 84.454  1.00 123.87 ? 124  ASP C OD1   1 
ATOM   4499  O  OD2   . ASP C 2 124  ? 72.718  -15.798 84.884  1.00 129.36 ? 124  ASP C OD2   1 
ATOM   4500  N  N     . GLY C 2 125  ? 73.505  -19.561 82.901  1.00 115.43 ? 125  GLY C N     1 
ATOM   4501  C  CA    . GLY C 2 125  ? 72.646  -19.840 81.773  1.00 112.81 ? 125  GLY C CA    1 
ATOM   4502  C  C     . GLY C 2 125  ? 72.343  -18.619 80.931  1.00 117.34 ? 125  GLY C C     1 
ATOM   4503  O  O     . GLY C 2 125  ? 71.434  -18.639 80.098  1.00 117.73 ? 125  GLY C O     1 
ATOM   4504  N  N     . SER C 2 126  ? 73.117  -17.556 81.129  1.00 120.74 ? 126  SER C N     1 
ATOM   4505  C  CA    . SER C 2 126  ? 72.918  -16.335 80.355  1.00 116.59 ? 126  SER C CA    1 
ATOM   4506  C  C     . SER C 2 126  ? 74.104  -16.109 79.447  1.00 108.29 ? 126  SER C C     1 
ATOM   4507  O  O     . SER C 2 126  ? 75.102  -16.805 79.550  1.00 109.11 ? 126  SER C O     1 
ATOM   4508  C  CB    . SER C 2 126  ? 72.757  -15.129 81.284  1.00 117.18 ? 126  SER C CB    1 
ATOM   4509  O  OG    . SER C 2 126  ? 73.967  -14.808 81.947  1.00 116.18 ? 126  SER C OG    1 
ATOM   4510  N  N     . PHE C 2 127  ? 74.016  -15.097 78.596  1.00 109.18 ? 127  PHE C N     1 
ATOM   4511  C  CA    . PHE C 2 127  ? 75.084  -14.802 77.641  1.00 117.49 ? 127  PHE C CA    1 
ATOM   4512  C  C     . PHE C 2 127  ? 75.584  -13.398 77.860  1.00 120.41 ? 127  PHE C C     1 
ATOM   4513  O  O     . PHE C 2 127  ? 74.994  -12.629 78.613  1.00 121.13 ? 127  PHE C O     1 
ATOM   4514  C  CB    . PHE C 2 127  ? 74.617  -14.913 76.185  1.00 111.89 ? 127  PHE C CB    1 
ATOM   4515  C  CG    . PHE C 2 127  ? 74.461  -16.320 75.700  1.00 111.61 ? 127  PHE C CG    1 
ATOM   4516  C  CD1   . PHE C 2 127  ? 73.207  -16.903 75.600  1.00 113.50 ? 127  PHE C CD1   1 
ATOM   4517  C  CD2   . PHE C 2 127  ? 75.562  -17.062 75.340  1.00 115.75 ? 127  PHE C CD2   1 
ATOM   4518  C  CE1   . PHE C 2 127  ? 73.050  -18.200 75.152  1.00 110.52 ? 127  PHE C CE1   1 
ATOM   4519  C  CE2   . PHE C 2 127  ? 75.413  -18.366 74.896  1.00 115.61 ? 127  PHE C CE2   1 
ATOM   4520  C  CZ    . PHE C 2 127  ? 74.150  -18.931 74.801  1.00 112.49 ? 127  PHE C CZ    1 
ATOM   4521  N  N     . ILE C 2 128  ? 76.703  -13.073 77.235  1.00 119.78 ? 128  ILE C N     1 
ATOM   4522  C  CA    . ILE C 2 128  ? 77.097  -11.685 77.170  1.00 120.84 ? 128  ILE C CA    1 
ATOM   4523  C  C     . ILE C 2 128  ? 77.146  -11.323 75.701  1.00 124.19 ? 128  ILE C C     1 
ATOM   4524  O  O     . ILE C 2 128  ? 77.458  -12.185 74.874  1.00 124.76 ? 128  ILE C O     1 
ATOM   4525  C  CB    . ILE C 2 128  ? 78.415  -11.453 77.896  1.00 123.94 ? 128  ILE C CB    1 
ATOM   4526  C  CG1   . ILE C 2 128  ? 78.277  -11.973 79.337  1.00 125.90 ? 128  ILE C CG1   1 
ATOM   4527  C  CG2   . ILE C 2 128  ? 78.766  -9.974  77.876  1.00 127.91 ? 128  ILE C CG2   1 
ATOM   4528  C  CD1   . ILE C 2 128  ? 79.572  -12.179 80.090  1.00 131.54 ? 128  ILE C CD1   1 
ATOM   4529  N  N     . ILE C 2 129  ? 76.771  -10.083 75.373  1.00 124.43 ? 129  ILE C N     1 
ATOM   4530  C  CA    . ILE C 2 129  ? 76.716  -9.659  73.977  1.00 128.15 ? 129  ILE C CA    1 
ATOM   4531  C  C     . ILE C 2 129  ? 77.589  -8.428  73.677  1.00 133.90 ? 129  ILE C C     1 
ATOM   4532  O  O     . ILE C 2 129  ? 78.689  -8.585  73.165  1.00 138.97 ? 129  ILE C O     1 
ATOM   4533  C  CB    . ILE C 2 129  ? 75.257  -9.499  73.507  1.00 123.19 ? 129  ILE C CB    1 
ATOM   4534  C  CG1   . ILE C 2 129  ? 74.608  -10.886 73.376  1.00 116.18 ? 129  ILE C CG1   1 
ATOM   4535  C  CG2   . ILE C 2 129  ? 75.171  -8.731  72.193  1.00 129.18 ? 129  ILE C CG2   1 
ATOM   4536  C  CD1   . ILE C 2 129  ? 75.462  -11.925 72.652  1.00 108.23 ? 129  ILE C CD1   1 
ATOM   4537  N  N     . ASN C 2 130  ? 77.164  -7.212  73.990  1.00 134.57 ? 130  ASN C N     1 
ATOM   4538  C  CA    . ASN C 2 130  ? 78.187  -6.196  74.171  1.00 138.39 ? 130  ASN C CA    1 
ATOM   4539  C  C     . ASN C 2 130  ? 77.988  -5.615  75.547  1.00 146.57 ? 130  ASN C C     1 
ATOM   4540  O  O     . ASN C 2 130  ? 77.208  -4.678  75.734  1.00 155.31 ? 130  ASN C O     1 
ATOM   4541  C  CB    . ASN C 2 130  ? 78.114  -5.110  73.088  1.00 143.21 ? 130  ASN C CB    1 
ATOM   4542  C  CG    . ASN C 2 130  ? 78.309  -5.668  71.683  1.00 149.06 ? 130  ASN C CG    1 
ATOM   4543  O  OD1   . ASN C 2 130  ? 77.620  -6.606  71.281  1.00 145.95 ? 130  ASN C OD1   1 
ATOM   4544  N  ND2   . ASN C 2 130  ? 79.256  -5.098  70.932  1.00 151.60 ? 130  ASN C ND2   1 
ATOM   4545  N  N     . GLY C 2 131  ? 78.760  -6.134  76.497  1.00 148.71 ? 131  GLY C N     1 
ATOM   4546  C  CA    . GLY C 2 131  ? 78.680  -5.730  77.893  1.00 153.27 ? 131  GLY C CA    1 
ATOM   4547  C  C     . GLY C 2 131  ? 77.318  -5.910  78.546  1.00 146.49 ? 131  GLY C C     1 
ATOM   4548  O  O     . GLY C 2 131  ? 77.117  -5.537  79.707  1.00 146.66 ? 131  GLY C O     1 
ATOM   4549  N  N     . ALA C 2 132  ? 76.391  -6.514  77.812  1.00 137.03 ? 132  ALA C N     1 
ATOM   4550  C  CA    . ALA C 2 132  ? 74.995  -6.484  78.200  1.00 132.29 ? 132  ALA C CA    1 
ATOM   4551  C  C     . ALA C 2 132  ? 74.487  -7.897  78.186  1.00 125.75 ? 132  ALA C C     1 
ATOM   4552  O  O     . ALA C 2 132  ? 74.438  -8.513  77.129  1.00 124.18 ? 132  ALA C O     1 
ATOM   4553  C  CB    . ALA C 2 132  ? 74.184  -5.612  77.224  1.00 130.10 ? 132  ALA C CB    1 
ATOM   4554  N  N     . ASP C 2 133  ? 74.118  -8.405  79.360  1.00 124.03 ? 133  ASP C N     1 
ATOM   4555  C  CA    . ASP C 2 133  ? 73.665  -9.786  79.500  1.00 120.87 ? 133  ASP C CA    1 
ATOM   4556  C  C     . ASP C 2 133  ? 72.388  -10.030 78.679  1.00 116.21 ? 133  ASP C C     1 
ATOM   4557  O  O     . ASP C 2 133  ? 71.508  -9.170  78.624  1.00 112.49 ? 133  ASP C O     1 
ATOM   4558  C  CB    . ASP C 2 133  ? 73.443  -10.159 80.982  1.00 128.02 ? 133  ASP C CB    1 
ATOM   4559  C  CG    . ASP C 2 133  ? 74.748  -10.243 81.792  1.00 133.51 ? 133  ASP C CG    1 
ATOM   4560  O  OD1   . ASP C 2 133  ? 74.966  -11.280 82.473  1.00 130.89 ? 133  ASP C OD1   1 
ATOM   4561  O  OD2   . ASP C 2 133  ? 75.528  -9.263  81.778  1.00 133.21 ? 133  ASP C OD2   1 
ATOM   4562  N  N     . ARG C 2 134  ? 72.316  -11.191 78.021  1.00 114.41 ? 134  ARG C N     1 
ATOM   4563  C  CA    . ARG C 2 134  ? 71.148  -11.612 77.237  1.00 109.10 ? 134  ARG C CA    1 
ATOM   4564  C  C     . ARG C 2 134  ? 70.809  -13.061 77.596  1.00 103.61 ? 134  ARG C C     1 
ATOM   4565  O  O     . ARG C 2 134  ? 71.688  -13.829 77.977  1.00 102.82 ? 134  ARG C O     1 
ATOM   4566  C  CB    . ARG C 2 134  ? 71.390  -11.489 75.710  1.00 112.46 ? 134  ARG C CB    1 
ATOM   4567  C  CG    . ARG C 2 134  ? 71.611  -10.056 75.157  1.00 113.31 ? 134  ARG C CG    1 
ATOM   4568  C  CD    . ARG C 2 134  ? 71.128  -9.865  73.708  1.00 106.55 ? 134  ARG C CD    1 
ATOM   4569  N  NE    . ARG C 2 134  ? 70.540  -8.532  73.522  1.00 118.63 ? 134  ARG C NE    1 
ATOM   4570  C  CZ    . ARG C 2 134  ? 69.319  -8.279  73.036  1.00 123.05 ? 134  ARG C CZ    1 
ATOM   4571  N  NH1   . ARG C 2 134  ? 68.526  -9.267  72.636  1.00 116.57 ? 134  ARG C NH1   1 
ATOM   4572  N  NH2   . ARG C 2 134  ? 68.889  -7.019  72.935  1.00 124.45 ? 134  ARG C NH2   1 
ATOM   4573  N  N     . VAL C 2 135  ? 69.533  -13.418 77.493  1.00 103.99 ? 135  VAL C N     1 
ATOM   4574  C  CA    . VAL C 2 135  ? 69.052  -14.776 77.747  1.00 103.04 ? 135  VAL C CA    1 
ATOM   4575  C  C     . VAL C 2 135  ? 68.477  -15.267 76.432  1.00 107.03 ? 135  VAL C C     1 
ATOM   4576  O  O     . VAL C 2 135  ? 67.763  -14.518 75.771  1.00 111.95 ? 135  VAL C O     1 
ATOM   4577  C  CB    . VAL C 2 135  ? 67.904  -14.761 78.799  1.00 103.49 ? 135  VAL C CB    1 
ATOM   4578  C  CG1   . VAL C 2 135  ? 66.924  -15.897 78.573  1.00 104.09 ? 135  VAL C CG1   1 
ATOM   4579  C  CG2   . VAL C 2 135  ? 68.443  -14.783 80.227  1.00 106.40 ? 135  VAL C CG2   1 
ATOM   4580  N  N     . ILE C 2 136  ? 68.778  -16.492 76.014  1.00 102.05 ? 136  ILE C N     1 
ATOM   4581  C  CA    . ILE C 2 136  ? 68.051  -17.024 74.860  1.00 106.52 ? 136  ILE C CA    1 
ATOM   4582  C  C     . ILE C 2 136  ? 66.808  -17.753 75.370  1.00 111.24 ? 136  ILE C C     1 
ATOM   4583  O  O     . ILE C 2 136  ? 66.891  -18.549 76.301  1.00 113.27 ? 136  ILE C O     1 
ATOM   4584  C  CB    . ILE C 2 136  ? 68.903  -17.948 73.973  1.00 104.81 ? 136  ILE C CB    1 
ATOM   4585  C  CG1   . ILE C 2 136  ? 70.162  -17.233 73.535  1.00 104.39 ? 136  ILE C CG1   1 
ATOM   4586  C  CG2   . ILE C 2 136  ? 68.132  -18.355 72.729  1.00 105.11 ? 136  ILE C CG2   1 
ATOM   4587  C  CD1   . ILE C 2 136  ? 69.868  -15.963 72.864  1.00 103.26 ? 136  ILE C CD1   1 
ATOM   4588  N  N     . VAL C 2 137  ? 65.649  -17.472 74.784  1.00 109.52 ? 137  VAL C N     1 
ATOM   4589  C  CA    . VAL C 2 137  ? 64.404  -18.002 75.327  1.00 106.44 ? 137  VAL C CA    1 
ATOM   4590  C  C     . VAL C 2 137  ? 63.804  -19.108 74.478  1.00 107.76 ? 137  VAL C C     1 
ATOM   4591  O  O     . VAL C 2 137  ? 63.552  -18.921 73.288  1.00 109.38 ? 137  VAL C O     1 
ATOM   4592  C  CB    . VAL C 2 137  ? 63.362  -16.899 75.521  1.00 111.01 ? 137  VAL C CB    1 
ATOM   4593  C  CG1   . VAL C 2 137  ? 62.014  -17.503 75.864  1.00 108.48 ? 137  VAL C CG1   1 
ATOM   4594  C  CG2   . VAL C 2 137  ? 63.819  -15.949 76.620  1.00 115.87 ? 137  VAL C CG2   1 
ATOM   4595  N  N     . SER C 2 138  ? 63.550  -20.247 75.118  1.00 110.04 ? 138  SER C N     1 
ATOM   4596  C  CA    . SER C 2 138  ? 63.054  -21.445 74.452  1.00 107.51 ? 138  SER C CA    1 
ATOM   4597  C  C     . SER C 2 138  ? 61.792  -21.132 73.661  1.00 105.00 ? 138  SER C C     1 
ATOM   4598  O  O     . SER C 2 138  ? 61.025  -20.264 74.044  1.00 110.34 ? 138  SER C O     1 
ATOM   4599  C  CB    . SER C 2 138  ? 62.769  -22.529 75.495  1.00 107.32 ? 138  SER C CB    1 
ATOM   4600  O  OG    . SER C 2 138  ? 63.252  -22.149 76.777  1.00 107.75 ? 138  SER C OG    1 
ATOM   4601  N  N     . GLN C 2 139  ? 61.584  -21.805 72.540  1.00 101.42 ? 139  GLN C N     1 
ATOM   4602  C  CA    . GLN C 2 139  ? 60.397  -21.536 71.745  1.00 105.28 ? 139  GLN C CA    1 
ATOM   4603  C  C     . GLN C 2 139  ? 59.546  -22.775 71.543  1.00 110.32 ? 139  GLN C C     1 
ATOM   4604  O  O     . GLN C 2 139  ? 60.056  -23.891 71.450  1.00 108.34 ? 139  GLN C O     1 
ATOM   4605  C  CB    . GLN C 2 139  ? 60.758  -20.945 70.386  1.00 108.93 ? 139  GLN C CB    1 
ATOM   4606  C  CG    . GLN C 2 139  ? 59.539  -20.631 69.526  1.00 113.96 ? 139  GLN C CG    1 
ATOM   4607  C  CD    . GLN C 2 139  ? 59.879  -20.363 68.079  1.00 121.55 ? 139  GLN C CD    1 
ATOM   4608  O  OE1   . GLN C 2 139  ? 60.967  -20.692 67.611  1.00 122.66 ? 139  GLN C OE1   1 
ATOM   4609  N  NE2   . GLN C 2 139  ? 58.942  -19.761 67.358  1.00 129.48 ? 139  GLN C NE2   1 
ATOM   4610  N  N     . ILE C 2 140  ? 58.237  -22.564 71.470  1.00 114.40 ? 140  ILE C N     1 
ATOM   4611  C  CA    . ILE C 2 140  ? 57.292  -23.648 71.240  1.00 116.37 ? 140  ILE C CA    1 
ATOM   4612  C  C     . ILE C 2 140  ? 56.626  -23.525 69.870  1.00 113.23 ? 140  ILE C C     1 
ATOM   4613  O  O     . ILE C 2 140  ? 56.352  -22.431 69.373  1.00 114.70 ? 140  ILE C O     1 
ATOM   4614  C  CB    . ILE C 2 140  ? 56.276  -23.774 72.407  1.00 109.33 ? 140  ILE C CB    1 
ATOM   4615  C  CG1   . ILE C 2 140  ? 55.019  -24.524 71.995  1.00 106.79 ? 140  ILE C CG1   1 
ATOM   4616  C  CG2   . ILE C 2 140  ? 55.876  -22.420 72.925  1.00 113.35 ? 140  ILE C CG2   1 
ATOM   4617  C  CD1   . ILE C 2 140  ? 54.030  -24.544 73.086  1.00 109.13 ? 140  ILE C CD1   1 
ATOM   4618  N  N     . HIS C 2 141  ? 56.426  -24.663 69.234  1.00 108.93 ? 141  HIS C N     1 
ATOM   4619  C  CA    . HIS C 2 141  ? 55.824  -24.674 67.930  1.00 117.27 ? 141  HIS C CA    1 
ATOM   4620  C  C     . HIS C 2 141  ? 55.252  -26.058 67.694  1.00 125.98 ? 141  HIS C C     1 
ATOM   4621  O  O     . HIS C 2 141  ? 55.547  -26.985 68.454  1.00 120.16 ? 141  HIS C O     1 
ATOM   4622  C  CB    . HIS C 2 141  ? 56.865  -24.311 66.871  1.00 122.25 ? 141  HIS C CB    1 
ATOM   4623  C  CG    . HIS C 2 141  ? 57.936  -25.343 66.688  1.00 123.06 ? 141  HIS C CG    1 
ATOM   4624  N  ND1   . HIS C 2 141  ? 58.397  -25.719 65.444  1.00 126.10 ? 141  HIS C ND1   1 
ATOM   4625  C  CD2   . HIS C 2 141  ? 58.639  -26.073 67.585  1.00 119.67 ? 141  HIS C CD2   1 
ATOM   4626  C  CE1   . HIS C 2 141  ? 59.331  -26.643 65.584  1.00 125.17 ? 141  HIS C CE1   1 
ATOM   4627  N  NE2   . HIS C 2 141  ? 59.495  -26.877 66.873  1.00 119.25 ? 141  HIS C NE2   1 
ATOM   4628  N  N     . ARG C 2 142  ? 54.398  -26.184 66.677  1.00 137.04 ? 142  ARG C N     1 
ATOM   4629  C  CA    . ARG C 2 142  ? 53.907  -27.486 66.241  1.00 130.27 ? 142  ARG C CA    1 
ATOM   4630  C  C     . ARG C 2 142  ? 55.088  -28.340 65.880  1.00 131.14 ? 142  ARG C C     1 
ATOM   4631  O  O     . ARG C 2 142  ? 55.900  -27.961 65.034  1.00 131.91 ? 142  ARG C O     1 
ATOM   4632  C  CB    . ARG C 2 142  ? 53.061  -27.356 64.990  1.00 136.83 ? 142  ARG C CB    1 
ATOM   4633  C  CG    . ARG C 2 142  ? 51.736  -26.728 65.194  1.00 146.40 ? 142  ARG C CG    1 
ATOM   4634  C  CD    . ARG C 2 142  ? 51.039  -26.657 63.862  1.00 157.63 ? 142  ARG C CD    1 
ATOM   4635  N  NE    . ARG C 2 142  ? 50.407  -27.919 63.498  1.00 153.03 ? 142  ARG C NE    1 
ATOM   4636  C  CZ    . ARG C 2 142  ? 49.670  -28.079 62.406  1.00 151.55 ? 142  ARG C CZ    1 
ATOM   4637  N  NH1   . ARG C 2 142  ? 49.497  -27.062 61.579  1.00 157.02 ? 142  ARG C NH1   1 
ATOM   4638  N  NH2   . ARG C 2 142  ? 49.119  -29.251 62.127  1.00 148.05 ? 142  ARG C NH2   1 
ATOM   4639  N  N     . SER C 2 143  ? 55.169  -29.506 66.500  1.00 130.19 ? 143  SER C N     1 
ATOM   4640  C  CA    . SER C 2 143  ? 56.267  -30.416 66.241  1.00 130.58 ? 143  SER C CA    1 
ATOM   4641  C  C     . SER C 2 143  ? 56.216  -30.935 64.823  1.00 132.88 ? 143  SER C C     1 
ATOM   4642  O  O     . SER C 2 143  ? 55.138  -31.204 64.305  1.00 135.37 ? 143  SER C O     1 
ATOM   4643  C  CB    . SER C 2 143  ? 56.205  -31.594 67.208  1.00 129.42 ? 143  SER C CB    1 
ATOM   4644  O  OG    . SER C 2 143  ? 56.751  -32.767 66.628  1.00 133.96 ? 143  SER C OG    1 
ATOM   4645  N  N     . PRO C 2 144  ? 57.389  -31.081 64.195  1.00 132.58 ? 144  PRO C N     1 
ATOM   4646  C  CA    . PRO C 2 144  ? 57.493  -31.817 62.936  1.00 139.35 ? 144  PRO C CA    1 
ATOM   4647  C  C     . PRO C 2 144  ? 56.810  -33.171 63.086  1.00 142.59 ? 144  PRO C C     1 
ATOM   4648  O  O     . PRO C 2 144  ? 56.813  -33.723 64.183  1.00 147.59 ? 144  PRO C O     1 
ATOM   4649  C  CB    . PRO C 2 144  ? 58.998  -32.014 62.789  1.00 143.49 ? 144  PRO C CB    1 
ATOM   4650  C  CG    . PRO C 2 144  ? 59.586  -30.835 63.459  1.00 140.82 ? 144  PRO C CG    1 
ATOM   4651  C  CD    . PRO C 2 144  ? 58.653  -30.420 64.558  1.00 132.20 ? 144  PRO C CD    1 
ATOM   4652  N  N     . GLY C 2 145  ? 56.211  -33.688 62.020  1.00 140.76 ? 145  GLY C N     1 
ATOM   4653  C  CA    . GLY C 2 145  ? 55.525  -34.964 62.106  1.00 139.95 ? 145  GLY C CA    1 
ATOM   4654  C  C     . GLY C 2 145  ? 54.400  -35.099 61.105  1.00 137.70 ? 145  GLY C C     1 
ATOM   4655  O  O     . GLY C 2 145  ? 54.346  -34.362 60.122  1.00 137.35 ? 145  GLY C O     1 
ATOM   4656  N  N     . VAL C 2 146  ? 53.505  -36.049 61.352  1.00 138.15 ? 146  VAL C N     1 
ATOM   4657  C  CA    . VAL C 2 146  ? 52.368  -36.278 60.467  1.00 142.16 ? 146  VAL C CA    1 
ATOM   4658  C  C     . VAL C 2 146  ? 51.054  -36.174 61.226  1.00 147.60 ? 146  VAL C C     1 
ATOM   4659  O  O     . VAL C 2 146  ? 50.769  -37.008 62.085  1.00 153.25 ? 146  VAL C O     1 
ATOM   4660  C  CB    . VAL C 2 146  ? 52.424  -37.676 59.829  1.00 145.41 ? 146  VAL C CB    1 
ATOM   4661  C  CG1   . VAL C 2 146  ? 51.182  -37.920 59.005  1.00 152.87 ? 146  VAL C CG1   1 
ATOM   4662  C  CG2   . VAL C 2 146  ? 53.640  -37.817 58.964  1.00 144.19 ? 146  VAL C CG2   1 
ATOM   4663  N  N     . TYR C 2 147  ? 50.241  -35.173 60.899  1.00 146.88 ? 147  TYR C N     1 
ATOM   4664  C  CA    . TYR C 2 147  ? 49.009  -34.931 61.652  1.00 153.24 ? 147  TYR C CA    1 
ATOM   4665  C  C     . TYR C 2 147  ? 47.765  -34.966 60.777  1.00 152.29 ? 147  TYR C C     1 
ATOM   4666  O  O     . TYR C 2 147  ? 47.792  -34.554 59.621  1.00 150.85 ? 147  TYR C O     1 
ATOM   4667  C  CB    . TYR C 2 147  ? 49.055  -33.576 62.375  1.00 156.17 ? 147  TYR C CB    1 
ATOM   4668  C  CG    . TYR C 2 147  ? 50.273  -33.328 63.251  1.00 151.17 ? 147  TYR C CG    1 
ATOM   4669  C  CD1   . TYR C 2 147  ? 51.432  -32.780 62.718  1.00 151.51 ? 147  TYR C CD1   1 
ATOM   4670  C  CD2   . TYR C 2 147  ? 50.251  -33.611 64.610  1.00 144.60 ? 147  TYR C CD2   1 
ATOM   4671  C  CE1   . TYR C 2 147  ? 52.538  -32.543 63.503  1.00 145.18 ? 147  TYR C CE1   1 
ATOM   4672  C  CE2   . TYR C 2 147  ? 51.359  -33.374 65.402  1.00 143.03 ? 147  TYR C CE2   1 
ATOM   4673  C  CZ    . TYR C 2 147  ? 52.499  -32.839 64.839  1.00 140.34 ? 147  TYR C CZ    1 
ATOM   4674  O  OH    . TYR C 2 147  ? 53.616  -32.592 65.603  1.00 139.09 ? 147  TYR C OH    1 
ATOM   4675  N  N     . PHE C 2 148  ? 46.664  -35.432 61.355  1.00 153.69 ? 148  PHE C N     1 
ATOM   4676  C  CA    . PHE C 2 148  ? 45.390  -35.454 60.655  1.00 158.31 ? 148  PHE C CA    1 
ATOM   4677  C  C     . PHE C 2 148  ? 44.348  -34.683 61.436  1.00 164.28 ? 148  PHE C C     1 
ATOM   4678  O  O     . PHE C 2 148  ? 44.070  -34.994 62.592  1.00 164.04 ? 148  PHE C O     1 
ATOM   4679  C  CB    . PHE C 2 148  ? 44.923  -36.883 60.448  1.00 156.78 ? 148  PHE C CB    1 
ATOM   4680  C  CG    . PHE C 2 148  ? 45.892  -37.711 59.696  1.00 155.39 ? 148  PHE C CG    1 
ATOM   4681  C  CD1   . PHE C 2 148  ? 46.990  -38.247 60.333  1.00 155.02 ? 148  PHE C CD1   1 
ATOM   4682  C  CD2   . PHE C 2 148  ? 45.716  -37.945 58.350  1.00 156.01 ? 148  PHE C CD2   1 
ATOM   4683  C  CE1   . PHE C 2 148  ? 47.887  -39.004 59.645  1.00 156.29 ? 148  PHE C CE1   1 
ATOM   4684  C  CE2   . PHE C 2 148  ? 46.613  -38.709 57.657  1.00 157.50 ? 148  PHE C CE2   1 
ATOM   4685  C  CZ    . PHE C 2 148  ? 47.701  -39.239 58.304  1.00 157.14 ? 148  PHE C CZ    1 
ATOM   4686  N  N     . THR C 2 149  ? 43.782  -33.673 60.787  1.00 166.22 ? 149  THR C N     1 
ATOM   4687  C  CA    . THR C 2 149  ? 42.792  -32.799 61.391  1.00 168.21 ? 149  THR C CA    1 
ATOM   4688  C  C     . THR C 2 149  ? 41.530  -32.857 60.534  1.00 172.84 ? 149  THR C C     1 
ATOM   4689  O  O     . THR C 2 149  ? 41.618  -33.063 59.329  1.00 176.79 ? 149  THR C O     1 
ATOM   4690  C  CB    . THR C 2 149  ? 43.326  -31.362 61.438  1.00 166.40 ? 149  THR C CB    1 
ATOM   4691  O  OG1   . THR C 2 149  ? 42.377  -30.483 60.827  1.00 170.43 ? 149  THR C OG1   1 
ATOM   4692  C  CG2   . THR C 2 149  ? 44.674  -31.262 60.698  1.00 153.33 ? 149  THR C CG2   1 
ATOM   4693  N  N     . PRO C 2 150  ? 40.347  -32.693 61.145  1.00 174.17 ? 150  PRO C N     1 
ATOM   4694  C  CA    . PRO C 2 150  ? 39.099  -32.809 60.375  1.00 180.32 ? 150  PRO C CA    1 
ATOM   4695  C  C     . PRO C 2 150  ? 38.943  -31.673 59.373  1.00 182.84 ? 150  PRO C C     1 
ATOM   4696  O  O     . PRO C 2 150  ? 39.104  -30.522 59.772  1.00 182.68 ? 150  PRO C O     1 
ATOM   4697  C  CB    . PRO C 2 150  ? 38.011  -32.703 61.452  1.00 180.39 ? 150  PRO C CB    1 
ATOM   4698  C  CG    . PRO C 2 150  ? 38.731  -32.920 62.765  1.00 175.61 ? 150  PRO C CG    1 
ATOM   4699  C  CD    . PRO C 2 150  ? 40.094  -32.373 62.556  1.00 171.22 ? 150  PRO C CD    1 
ATOM   4700  N  N     . ASP C 2 151  ? 38.632  -31.980 58.113  1.00 187.17 ? 151  ASP C N     1 
ATOM   4701  C  CA    . ASP C 2 151  ? 38.454  -30.935 57.100  1.00 191.62 ? 151  ASP C CA    1 
ATOM   4702  C  C     . ASP C 2 151  ? 37.321  -30.050 57.576  1.00 196.13 ? 151  ASP C C     1 
ATOM   4703  O  O     . ASP C 2 151  ? 36.215  -30.532 57.820  1.00 197.87 ? 151  ASP C O     1 
ATOM   4704  C  CB    . ASP C 2 151  ? 38.154  -31.524 55.704  1.00 193.41 ? 151  ASP C CB    1 
ATOM   4705  C  CG    . ASP C 2 151  ? 38.126  -30.460 54.581  1.00 192.00 ? 151  ASP C CG    1 
ATOM   4706  O  OD1   . ASP C 2 151  ? 38.627  -29.333 54.777  1.00 187.64 ? 151  ASP C OD1   1 
ATOM   4707  O  OD2   . ASP C 2 151  ? 37.610  -30.764 53.481  1.00 193.25 ? 151  ASP C OD2   1 
ATOM   4708  N  N     . PRO C 2 152  ? 37.609  -28.754 57.760  1.00 195.68 ? 152  PRO C N     1 
ATOM   4709  C  CA    . PRO C 2 152  ? 36.568  -27.801 58.146  1.00 190.56 ? 152  PRO C CA    1 
ATOM   4710  C  C     . PRO C 2 152  ? 35.506  -27.681 57.058  1.00 195.96 ? 152  PRO C C     1 
ATOM   4711  O  O     . PRO C 2 152  ? 34.396  -27.243 57.341  1.00 192.98 ? 152  PRO C O     1 
ATOM   4712  C  CB    . PRO C 2 152  ? 37.334  -26.484 58.316  1.00 185.46 ? 152  PRO C CB    1 
ATOM   4713  C  CG    . PRO C 2 152  ? 38.628  -26.680 57.584  1.00 189.26 ? 152  PRO C CG    1 
ATOM   4714  C  CD    . PRO C 2 152  ? 38.942  -28.130 57.699  1.00 191.23 ? 152  PRO C CD    1 
ATOM   4715  N  N     . ALA C 2 153  ? 35.840  -28.080 55.834  1.00 202.35 ? 153  ALA C N     1 
ATOM   4716  C  CA    . ALA C 2 153  ? 34.870  -28.073 54.743  1.00 205.65 ? 153  ALA C CA    1 
ATOM   4717  C  C     . ALA C 2 153  ? 33.697  -29.027 54.999  1.00 211.31 ? 153  ALA C C     1 
ATOM   4718  O  O     . ALA C 2 153  ? 32.544  -28.603 55.072  1.00 210.91 ? 153  ALA C O     1 
ATOM   4719  C  CB    . ALA C 2 153  ? 35.557  -28.404 53.417  1.00 202.97 ? 153  ALA C CB    1 
ATOM   4720  N  N     . ARG C 2 154  ? 33.995  -30.313 55.159  1.00 214.71 ? 154  ARG C N     1 
ATOM   4721  C  CA    . ARG C 2 154  ? 32.952  -31.329 55.293  1.00 215.42 ? 154  ARG C CA    1 
ATOM   4722  C  C     . ARG C 2 154  ? 33.227  -32.254 56.478  1.00 211.77 ? 154  ARG C C     1 
ATOM   4723  O  O     . ARG C 2 154  ? 34.379  -32.597 56.752  1.00 208.32 ? 154  ARG C O     1 
ATOM   4724  C  CB    . ARG C 2 154  ? 32.832  -32.126 53.992  1.00 218.93 ? 154  ARG C CB    1 
ATOM   4725  C  CG    . ARG C 2 154  ? 32.830  -31.261 52.732  1.00 219.99 ? 154  ARG C CG    1 
ATOM   4726  C  CD    . ARG C 2 154  ? 31.594  -30.399 52.602  1.00 227.14 ? 154  ARG C CD    1 
ATOM   4727  N  NE    . ARG C 2 154  ? 31.458  -29.825 51.261  1.00 230.53 ? 154  ARG C NE    1 
ATOM   4728  C  CZ    . ARG C 2 154  ? 32.012  -28.681 50.869  1.00 224.42 ? 154  ARG C CZ    1 
ATOM   4729  N  NH1   . ARG C 2 154  ? 32.758  -27.979 51.710  1.00 222.62 ? 154  ARG C NH1   1 
ATOM   4730  N  NH2   . ARG C 2 154  ? 31.822  -28.238 49.633  1.00 217.31 ? 154  ARG C NH2   1 
ATOM   4731  N  N     . PRO C 2 155  ? 32.164  -32.673 57.176  1.00 210.77 ? 155  PRO C N     1 
ATOM   4732  C  CA    . PRO C 2 155  ? 32.305  -33.355 58.467  1.00 215.13 ? 155  PRO C CA    1 
ATOM   4733  C  C     . PRO C 2 155  ? 33.121  -34.639 58.389  1.00 215.15 ? 155  PRO C C     1 
ATOM   4734  O  O     . PRO C 2 155  ? 34.068  -34.826 59.161  1.00 208.58 ? 155  PRO C O     1 
ATOM   4735  C  CB    . PRO C 2 155  ? 30.858  -33.718 58.824  1.00 216.56 ? 155  PRO C CB    1 
ATOM   4736  C  CG    . PRO C 2 155  ? 30.014  -32.826 58.000  1.00 213.97 ? 155  PRO C CG    1 
ATOM   4737  C  CD    . PRO C 2 155  ? 30.761  -32.595 56.740  1.00 210.07 ? 155  PRO C CD    1 
ATOM   4738  N  N     . GLY C 2 156  ? 32.777  -35.491 57.430  1.00 215.20 ? 156  GLY C N     1 
ATOM   4739  C  CA    . GLY C 2 156  ? 33.344  -36.823 57.356  1.00 211.79 ? 156  GLY C CA    1 
ATOM   4740  C  C     . GLY C 2 156  ? 34.626  -36.881 56.556  1.00 208.44 ? 156  GLY C C     1 
ATOM   4741  O  O     . GLY C 2 156  ? 35.142  -37.968 56.297  1.00 206.20 ? 156  GLY C O     1 
ATOM   4742  N  N     . ARG C 2 157  ? 35.141  -35.714 56.173  1.00 205.59 ? 157  ARG C N     1 
ATOM   4743  C  CA    . ARG C 2 157  ? 36.386  -35.634 55.412  1.00 199.23 ? 157  ARG C CA    1 
ATOM   4744  C  C     . ARG C 2 157  ? 37.504  -35.068 56.274  1.00 196.26 ? 157  ARG C C     1 
ATOM   4745  O  O     . ARG C 2 157  ? 37.248  -34.306 57.212  1.00 196.55 ? 157  ARG C O     1 
ATOM   4746  C  CB    . ARG C 2 157  ? 36.207  -34.797 54.147  1.00 199.23 ? 157  ARG C CB    1 
ATOM   4747  C  CG    . ARG C 2 157  ? 35.318  -35.461 53.132  1.00 201.42 ? 157  ARG C CG    1 
ATOM   4748  C  CD    . ARG C 2 157  ? 35.780  -36.886 52.899  1.00 203.49 ? 157  ARG C CD    1 
ATOM   4749  N  NE    . ARG C 2 157  ? 34.730  -37.721 52.326  1.00 208.46 ? 157  ARG C NE    1 
ATOM   4750  C  CZ    . ARG C 2 157  ? 34.607  -37.985 51.030  1.00 211.15 ? 157  ARG C CZ    1 
ATOM   4751  N  NH1   . ARG C 2 157  ? 35.474  -37.480 50.160  1.00 214.33 ? 157  ARG C NH1   1 
ATOM   4752  N  NH2   . ARG C 2 157  ? 33.618  -38.758 50.603  1.00 207.22 ? 157  ARG C NH2   1 
ATOM   4753  N  N     . TYR C 2 158  ? 38.737  -35.466 55.969  1.00 187.29 ? 158  TYR C N     1 
ATOM   4754  C  CA    . TYR C 2 158  ? 39.887  -35.085 56.782  1.00 182.35 ? 158  TYR C CA    1 
ATOM   4755  C  C     . TYR C 2 158  ? 41.050  -34.604 55.913  1.00 174.03 ? 158  TYR C C     1 
ATOM   4756  O  O     . TYR C 2 158  ? 41.264  -35.123 54.827  1.00 175.72 ? 158  TYR C O     1 
ATOM   4757  C  CB    . TYR C 2 158  ? 40.312  -36.257 57.685  1.00 182.40 ? 158  TYR C CB    1 
ATOM   4758  C  CG    . TYR C 2 158  ? 39.240  -36.659 58.679  1.00 186.18 ? 158  TYR C CG    1 
ATOM   4759  C  CD1   . TYR C 2 158  ? 39.255  -36.180 59.979  1.00 182.08 ? 158  TYR C CD1   1 
ATOM   4760  C  CD2   . TYR C 2 158  ? 38.198  -37.499 58.306  1.00 192.78 ? 158  TYR C CD2   1 
ATOM   4761  C  CE1   . TYR C 2 158  ? 38.269  -36.529 60.879  1.00 184.95 ? 158  TYR C CE1   1 
ATOM   4762  C  CE2   . TYR C 2 158  ? 37.207  -37.851 59.198  1.00 191.32 ? 158  TYR C CE2   1 
ATOM   4763  C  CZ    . TYR C 2 158  ? 37.249  -37.365 60.482  1.00 189.58 ? 158  TYR C CZ    1 
ATOM   4764  O  OH    . TYR C 2 158  ? 36.264  -37.716 61.372  1.00 191.28 ? 158  TYR C OH    1 
ATOM   4765  N  N     . ILE C 2 159  ? 41.780  -33.597 56.388  1.00 169.27 ? 159  ILE C N     1 
ATOM   4766  C  CA    . ILE C 2 159  ? 42.987  -33.125 55.713  1.00 157.99 ? 159  ILE C CA    1 
ATOM   4767  C  C     . ILE C 2 159  ? 44.216  -33.663 56.418  1.00 155.39 ? 159  ILE C C     1 
ATOM   4768  O  O     . ILE C 2 159  ? 44.358  -33.525 57.629  1.00 159.77 ? 159  ILE C O     1 
ATOM   4769  C  CB    . ILE C 2 159  ? 43.087  -31.580 55.696  1.00 160.73 ? 159  ILE C CB    1 
ATOM   4770  C  CG1   . ILE C 2 159  ? 42.379  -30.995 54.475  1.00 174.28 ? 159  ILE C CG1   1 
ATOM   4771  C  CG2   . ILE C 2 159  ? 44.536  -31.125 55.657  1.00 158.04 ? 159  ILE C CG2   1 
ATOM   4772  C  CD1   . ILE C 2 159  ? 42.775  -29.547 54.168  1.00 168.75 ? 159  ILE C CD1   1 
ATOM   4773  N  N     . ALA C 2 160  ? 45.109  -34.276 55.657  1.00 153.26 ? 160  ALA C N     1 
ATOM   4774  C  CA    . ALA C 2 160  ? 46.363  -34.754 56.208  1.00 152.71 ? 160  ALA C CA    1 
ATOM   4775  C  C     . ALA C 2 160  ? 47.428  -33.680 56.111  1.00 149.50 ? 160  ALA C C     1 
ATOM   4776  O  O     . ALA C 2 160  ? 47.559  -33.006 55.098  1.00 148.05 ? 160  ALA C O     1 
ATOM   4777  C  CB    . ALA C 2 160  ? 46.810  -35.991 55.483  1.00 157.44 ? 160  ALA C CB    1 
ATOM   4778  N  N     . SER C 2 161  ? 48.193  -33.527 57.180  1.00 151.95 ? 161  SER C N     1 
ATOM   4779  C  CA    . SER C 2 161  ? 49.232  -32.516 57.225  1.00 152.77 ? 161  SER C CA    1 
ATOM   4780  C  C     . SER C 2 161  ? 50.604  -33.165 57.506  1.00 153.35 ? 161  SER C C     1 
ATOM   4781  O  O     . SER C 2 161  ? 50.745  -33.932 58.464  1.00 152.72 ? 161  SER C O     1 
ATOM   4782  C  CB    . SER C 2 161  ? 48.877  -31.461 58.286  1.00 151.62 ? 161  SER C CB    1 
ATOM   4783  O  OG    . SER C 2 161  ? 47.605  -30.871 58.040  1.00 144.12 ? 161  SER C OG    1 
ATOM   4784  N  N     . ILE C 2 162  ? 51.593  -32.884 56.651  1.00 151.69 ? 162  ILE C N     1 
ATOM   4785  C  CA    . ILE C 2 162  ? 52.970  -33.363 56.836  1.00 148.93 ? 162  ILE C CA    1 
ATOM   4786  C  C     . ILE C 2 162  ? 53.941  -32.199 57.079  1.00 151.97 ? 162  ILE C C     1 
ATOM   4787  O  O     . ILE C 2 162  ? 54.291  -31.455 56.154  1.00 153.77 ? 162  ILE C O     1 
ATOM   4788  C  CB    . ILE C 2 162  ? 53.437  -34.178 55.605  1.00 150.58 ? 162  ILE C CB    1 
ATOM   4789  C  CG1   . ILE C 2 162  ? 52.757  -35.548 55.577  1.00 150.08 ? 162  ILE C CG1   1 
ATOM   4790  C  CG2   . ILE C 2 162  ? 54.953  -34.345 55.588  1.00 152.62 ? 162  ILE C CG2   1 
ATOM   4791  C  CD1   . ILE C 2 162  ? 53.223  -36.441 54.432  1.00 152.99 ? 162  ILE C CD1   1 
ATOM   4792  N  N     . ILE C 2 163  ? 54.393  -32.063 58.325  1.00 151.82 ? 163  ILE C N     1 
ATOM   4793  C  CA    . ILE C 2 163  ? 55.177  -30.896 58.742  1.00 156.98 ? 163  ILE C CA    1 
ATOM   4794  C  C     . ILE C 2 163  ? 56.637  -31.207 59.020  1.00 148.66 ? 163  ILE C C     1 
ATOM   4795  O  O     . ILE C 2 163  ? 56.945  -32.085 59.819  1.00 145.11 ? 163  ILE C O     1 
ATOM   4796  C  CB    . ILE C 2 163  ? 54.597  -30.208 60.000  1.00 159.43 ? 163  ILE C CB    1 
ATOM   4797  C  CG1   . ILE C 2 163  ? 53.146  -29.785 59.782  1.00 158.72 ? 163  ILE C CG1   1 
ATOM   4798  C  CG2   . ILE C 2 163  ? 55.434  -28.987 60.375  1.00 161.76 ? 163  ILE C CG2   1 
ATOM   4799  C  CD1   . ILE C 2 163  ? 52.556  -29.065 60.976  1.00 156.95 ? 163  ILE C CD1   1 
ATOM   4800  N  N     . PRO C 2 164  ? 57.537  -30.487 58.349  1.00 147.21 ? 164  PRO C N     1 
ATOM   4801  C  CA    . PRO C 2 164  ? 58.976  -30.615 58.533  1.00 150.43 ? 164  PRO C CA    1 
ATOM   4802  C  C     . PRO C 2 164  ? 59.493  -29.603 59.546  1.00 154.58 ? 164  PRO C C     1 
ATOM   4803  O  O     . PRO C 2 164  ? 58.721  -28.747 59.975  1.00 152.41 ? 164  PRO C O     1 
ATOM   4804  C  CB    . PRO C 2 164  ? 59.487  -30.211 57.168  1.00 161.09 ? 164  PRO C CB    1 
ATOM   4805  C  CG    . PRO C 2 164  ? 58.572  -29.079 56.807  1.00 159.69 ? 164  PRO C CG    1 
ATOM   4806  C  CD    . PRO C 2 164  ? 57.219  -29.471 57.333  1.00 156.08 ? 164  PRO C CD    1 
ATOM   4807  N  N     . LEU C 2 165  ? 60.785  -29.670 59.878  1.00 158.89 ? 165  LEU C N     1 
ATOM   4808  C  CA    . LEU C 2 165  ? 61.444  -28.611 60.643  1.00 161.37 ? 165  LEU C CA    1 
ATOM   4809  C  C     . LEU C 2 165  ? 61.292  -27.317 59.851  1.00 167.58 ? 165  LEU C C     1 
ATOM   4810  O  O     . LEU C 2 165  ? 61.586  -27.280 58.656  1.00 170.44 ? 165  LEU C O     1 
ATOM   4811  C  CB    . LEU C 2 165  ? 62.926  -28.917 60.885  1.00 158.62 ? 165  LEU C CB    1 
ATOM   4812  C  CG    . LEU C 2 165  ? 63.332  -29.743 62.111  1.00 153.49 ? 165  LEU C CG    1 
ATOM   4813  C  CD1   . LEU C 2 165  ? 64.826  -29.652 62.322  1.00 153.42 ? 165  LEU C CD1   1 
ATOM   4814  C  CD2   . LEU C 2 165  ? 62.622  -29.293 63.359  1.00 145.24 ? 165  LEU C CD2   1 
ATOM   4815  N  N     . PRO C 2 166  ? 60.864  -26.245 60.530  1.00 168.83 ? 166  PRO C N     1 
ATOM   4816  C  CA    . PRO C 2 166  ? 60.193  -25.072 59.951  1.00 173.68 ? 166  PRO C CA    1 
ATOM   4817  C  C     . PRO C 2 166  ? 60.798  -24.468 58.678  1.00 172.58 ? 166  PRO C C     1 
ATOM   4818  O  O     . PRO C 2 166  ? 60.031  -24.133 57.767  1.00 170.82 ? 166  PRO C O     1 
ATOM   4819  C  CB    . PRO C 2 166  ? 60.228  -24.046 61.101  1.00 174.26 ? 166  PRO C CB    1 
ATOM   4820  C  CG    . PRO C 2 166  ? 61.073  -24.665 62.194  1.00 163.71 ? 166  PRO C CG    1 
ATOM   4821  C  CD    . PRO C 2 166  ? 60.986  -26.133 61.992  1.00 164.72 ? 166  PRO C CD    1 
ATOM   4822  N  N     . LYS C 2 167  ? 62.118  -24.317 58.617  1.00 170.48 ? 167  LYS C N     1 
ATOM   4823  C  CA    . LYS C 2 167  ? 62.751  -23.740 57.431  1.00 175.91 ? 167  LYS C CA    1 
ATOM   4824  C  C     . LYS C 2 167  ? 63.299  -24.797 56.480  1.00 174.66 ? 167  LYS C C     1 
ATOM   4825  O  O     . LYS C 2 167  ? 63.810  -24.462 55.407  1.00 170.35 ? 167  LYS C O     1 
ATOM   4826  C  CB    . LYS C 2 167  ? 63.843  -22.726 57.808  1.00 185.08 ? 167  LYS C CB    1 
ATOM   4827  C  CG    . LYS C 2 167  ? 63.360  -21.268 57.880  1.00 195.64 ? 167  LYS C CG    1 
ATOM   4828  C  CD    . LYS C 2 167  ? 64.396  -20.319 58.509  1.00 200.12 ? 167  LYS C CD    1 
ATOM   4829  C  CE    . LYS C 2 167  ? 65.509  -19.928 57.539  1.00 195.12 ? 167  LYS C CE    1 
ATOM   4830  N  NZ    . LYS C 2 167  ? 66.515  -19.024 58.176  1.00 178.92 ? 167  LYS C NZ    1 
ATOM   4831  N  N     . ARG C 2 168  ? 63.189  -26.068 56.867  1.00 173.50 ? 168  ARG C N     1 
ATOM   4832  C  CA    . ARG C 2 168  ? 63.634  -27.152 55.997  1.00 172.93 ? 168  ARG C CA    1 
ATOM   4833  C  C     . ARG C 2 168  ? 62.438  -27.881 55.411  1.00 170.43 ? 168  ARG C C     1 
ATOM   4834  O  O     . ARG C 2 168  ? 61.841  -28.711 56.076  1.00 165.93 ? 168  ARG C O     1 
ATOM   4835  C  CB    . ARG C 2 168  ? 64.435  -28.170 56.808  1.00 171.10 ? 168  ARG C CB    1 
ATOM   4836  C  CG    . ARG C 2 168  ? 65.053  -27.635 58.099  1.00 176.43 ? 168  ARG C CG    1 
ATOM   4837  C  CD    . ARG C 2 168  ? 66.353  -26.847 57.851  1.00 187.18 ? 168  ARG C CD    1 
ATOM   4838  N  NE    . ARG C 2 168  ? 67.286  -27.528 56.945  1.00 184.38 ? 168  ARG C NE    1 
ATOM   4839  C  CZ    . ARG C 2 168  ? 68.134  -28.490 57.306  1.00 178.25 ? 168  ARG C CZ    1 
ATOM   4840  N  NH1   . ARG C 2 168  ? 68.177  -28.910 58.562  1.00 175.23 ? 168  ARG C NH1   1 
ATOM   4841  N  NH2   . ARG C 2 168  ? 68.938  -29.043 56.407  1.00 177.51 ? 168  ARG C NH2   1 
ATOM   4842  N  N     . GLY C 2 169  ? 62.134  -27.623 54.145  1.00 174.33 ? 169  GLY C N     1 
ATOM   4843  C  CA    . GLY C 2 169  ? 61.010  -28.264 53.492  1.00 170.52 ? 169  GLY C CA    1 
ATOM   4844  C  C     . GLY C 2 169  ? 59.668  -27.592 53.722  1.00 169.64 ? 169  GLY C C     1 
ATOM   4845  O  O     . GLY C 2 169  ? 59.427  -27.004 54.774  1.00 168.37 ? 169  GLY C O     1 
ATOM   4846  N  N     . PRO C 2 170  ? 58.781  -27.686 52.725  1.00 170.57 ? 170  PRO C N     1 
ATOM   4847  C  CA    . PRO C 2 170  ? 57.413  -27.153 52.692  1.00 174.56 ? 170  PRO C CA    1 
ATOM   4848  C  C     . PRO C 2 170  ? 56.374  -27.998 53.432  1.00 172.13 ? 170  PRO C C     1 
ATOM   4849  O  O     . PRO C 2 170  ? 56.587  -29.191 53.640  1.00 169.94 ? 170  PRO C O     1 
ATOM   4850  C  CB    . PRO C 2 170  ? 57.093  -27.131 51.199  1.00 173.87 ? 170  PRO C CB    1 
ATOM   4851  C  CG    . PRO C 2 170  ? 57.910  -28.219 50.638  1.00 170.02 ? 170  PRO C CG    1 
ATOM   4852  C  CD    . PRO C 2 170  ? 59.178  -28.253 51.426  1.00 169.30 ? 170  PRO C CD    1 
ATOM   4853  N  N     . TRP C 2 171  ? 55.260  -27.380 53.820  1.00 173.28 ? 171  TRP C N     1 
ATOM   4854  C  CA    . TRP C 2 171  ? 54.137  -28.111 54.406  1.00 170.85 ? 171  TRP C CA    1 
ATOM   4855  C  C     . TRP C 2 171  ? 53.360  -28.796 53.304  1.00 168.25 ? 171  TRP C C     1 
ATOM   4856  O  O     . TRP C 2 171  ? 53.359  -28.320 52.174  1.00 171.19 ? 171  TRP C O     1 
ATOM   4857  C  CB    . TRP C 2 171  ? 53.214  -27.171 55.174  1.00 174.38 ? 171  TRP C CB    1 
ATOM   4858  C  CG    . TRP C 2 171  ? 53.759  -26.807 56.500  1.00 177.83 ? 171  TRP C CG    1 
ATOM   4859  C  CD1   . TRP C 2 171  ? 55.074  -26.753 56.860  1.00 180.44 ? 171  TRP C CD1   1 
ATOM   4860  C  CD2   . TRP C 2 171  ? 53.010  -26.471 57.665  1.00 175.94 ? 171  TRP C CD2   1 
ATOM   4861  N  NE1   . TRP C 2 171  ? 55.191  -26.390 58.179  1.00 175.64 ? 171  TRP C NE1   1 
ATOM   4862  C  CE2   . TRP C 2 171  ? 53.932  -26.212 58.700  1.00 177.86 ? 171  TRP C CE2   1 
ATOM   4863  C  CE3   . TRP C 2 171  ? 51.645  -26.357 57.936  1.00 176.89 ? 171  TRP C CE3   1 
ATOM   4864  C  CZ2   . TRP C 2 171  ? 53.539  -25.848 59.985  1.00 178.25 ? 171  TRP C CZ2   1 
ATOM   4865  C  CZ3   . TRP C 2 171  ? 51.252  -25.994 59.212  1.00 181.60 ? 171  TRP C CZ3   1 
ATOM   4866  C  CH2   . TRP C 2 171  ? 52.196  -25.744 60.222  1.00 181.07 ? 171  TRP C CH2   1 
ATOM   4867  N  N     . ILE C 2 172  ? 52.710  -29.916 53.619  1.00 164.01 ? 172  ILE C N     1 
ATOM   4868  C  CA    . ILE C 2 172  ? 51.977  -30.691 52.609  1.00 159.74 ? 172  ILE C CA    1 
ATOM   4869  C  C     . ILE C 2 172  ? 50.587  -31.154 53.066  1.00 157.13 ? 172  ILE C C     1 
ATOM   4870  O  O     . ILE C 2 172  ? 50.461  -31.903 54.030  1.00 159.28 ? 172  ILE C O     1 
ATOM   4871  C  CB    . ILE C 2 172  ? 52.757  -31.958 52.186  1.00 158.92 ? 172  ILE C CB    1 
ATOM   4872  C  CG1   . ILE C 2 172  ? 54.255  -31.670 52.011  1.00 159.70 ? 172  ILE C CG1   1 
ATOM   4873  C  CG2   . ILE C 2 172  ? 52.148  -32.545 50.928  1.00 151.93 ? 172  ILE C CG2   1 
ATOM   4874  C  CD1   . ILE C 2 172  ? 55.138  -32.891 52.186  1.00 151.19 ? 172  ILE C CD1   1 
ATOM   4875  N  N     . ASP C 2 173  ? 49.546  -30.733 52.357  1.00 155.50 ? 173  ASP C N     1 
ATOM   4876  C  CA    . ASP C 2 173  ? 48.188  -31.158 52.680  1.00 151.87 ? 173  ASP C CA    1 
ATOM   4877  C  C     . ASP C 2 173  ? 47.678  -32.209 51.702  1.00 154.95 ? 173  ASP C C     1 
ATOM   4878  O  O     . ASP C 2 173  ? 47.834  -32.073 50.494  1.00 156.46 ? 173  ASP C O     1 
ATOM   4879  C  CB    . ASP C 2 173  ? 47.233  -29.968 52.693  1.00 153.17 ? 173  ASP C CB    1 
ATOM   4880  C  CG    . ASP C 2 173  ? 47.347  -29.143 53.952  1.00 152.83 ? 173  ASP C CG    1 
ATOM   4881  O  OD1   . ASP C 2 173  ? 48.403  -29.212 54.614  1.00 150.22 ? 173  ASP C OD1   1 
ATOM   4882  O  OD2   . ASP C 2 173  ? 46.377  -28.425 54.276  1.00 159.31 ? 173  ASP C OD2   1 
ATOM   4883  N  N     . LEU C 2 174  ? 47.078  -33.268 52.230  1.00 156.29 ? 174  LEU C N     1 
ATOM   4884  C  CA    . LEU C 2 174  ? 46.493  -34.305 51.392  1.00 155.95 ? 174  LEU C CA    1 
ATOM   4885  C  C     . LEU C 2 174  ? 44.987  -34.360 51.601  1.00 161.39 ? 174  LEU C C     1 
ATOM   4886  O  O     . LEU C 2 174  ? 44.513  -34.851 52.617  1.00 167.17 ? 174  LEU C O     1 
ATOM   4887  C  CB    . LEU C 2 174  ? 47.095  -35.661 51.743  1.00 146.34 ? 174  LEU C CB    1 
ATOM   4888  C  CG    . LEU C 2 174  ? 48.482  -36.060 51.241  1.00 138.33 ? 174  LEU C CG    1 
ATOM   4889  C  CD1   . LEU C 2 174  ? 49.533  -35.020 51.531  1.00 147.85 ? 174  LEU C CD1   1 
ATOM   4890  C  CD2   . LEU C 2 174  ? 48.863  -37.354 51.905  1.00 138.75 ? 174  LEU C CD2   1 
ATOM   4891  N  N     . GLU C 2 175  ? 44.230  -33.901 50.620  1.00 163.50 ? 175  GLU C N     1 
ATOM   4892  C  CA    . GLU C 2 175  ? 42.794  -33.809 50.784  1.00 169.02 ? 175  GLU C CA    1 
ATOM   4893  C  C     . GLU C 2 175  ? 42.143  -34.891 49.940  1.00 179.47 ? 175  GLU C C     1 
ATOM   4894  O  O     . GLU C 2 175  ? 42.697  -35.311 48.932  1.00 183.84 ? 175  GLU C O     1 
ATOM   4895  C  CB    . GLU C 2 175  ? 42.314  -32.421 50.365  1.00 174.01 ? 175  GLU C CB    1 
ATOM   4896  C  CG    . GLU C 2 175  ? 41.091  -31.910 51.116  1.00 183.33 ? 175  GLU C CG    1 
ATOM   4897  C  CD    . GLU C 2 175  ? 40.796  -30.446 50.811  1.00 187.56 ? 175  GLU C CD    1 
ATOM   4898  O  OE1   . GLU C 2 175  ? 41.551  -29.850 50.016  1.00 184.10 ? 175  GLU C OE1   1 
ATOM   4899  O  OE2   . GLU C 2 175  ? 39.817  -29.891 51.363  1.00 189.92 ? 175  GLU C OE2   1 
ATOM   4900  N  N     . VAL C 2 176  ? 40.991  -35.380 50.375  1.00 188.99 ? 176  VAL C N     1 
ATOM   4901  C  CA    . VAL C 2 176  ? 40.237  -36.368 49.606  1.00 199.13 ? 176  VAL C CA    1 
ATOM   4902  C  C     . VAL C 2 176  ? 39.332  -35.686 48.563  1.00 207.26 ? 176  VAL C C     1 
ATOM   4903  O  O     . VAL C 2 176  ? 39.470  -35.911 47.365  1.00 208.04 ? 176  VAL C O     1 
ATOM   4904  C  CB    . VAL C 2 176  ? 39.420  -37.321 50.523  1.00 198.02 ? 176  VAL C CB    1 
ATOM   4905  C  CG1   . VAL C 2 176  ? 38.721  -38.384 49.696  1.00 200.87 ? 176  VAL C CG1   1 
ATOM   4906  C  CG2   . VAL C 2 176  ? 40.325  -37.978 51.552  1.00 191.34 ? 176  VAL C CG2   1 
ATOM   4907  N  N     . GLU C 2 177  ? 38.416  -34.848 49.038  1.00 209.41 ? 177  GLU C N     1 
ATOM   4908  C  CA    . GLU C 2 177  ? 37.423  -34.154 48.213  1.00 209.95 ? 177  GLU C CA    1 
ATOM   4909  C  C     . GLU C 2 177  ? 38.030  -33.210 47.144  1.00 207.25 ? 177  GLU C C     1 
ATOM   4910  O  O     . GLU C 2 177  ? 39.252  -33.122 47.011  1.00 197.74 ? 177  GLU C O     1 
ATOM   4911  C  CB    . GLU C 2 177  ? 36.534  -33.353 49.166  1.00 213.88 ? 177  GLU C CB    1 
ATOM   4912  C  CG    . GLU C 2 177  ? 35.288  -34.061 49.616  1.00 216.06 ? 177  GLU C CG    1 
ATOM   4913  C  CD    . GLU C 2 177  ? 34.554  -33.262 50.659  1.00 215.56 ? 177  GLU C CD    1 
ATOM   4914  O  OE1   . GLU C 2 177  ? 35.155  -32.299 51.188  1.00 208.92 ? 177  GLU C OE1   1 
ATOM   4915  O  OE2   . GLU C 2 177  ? 33.385  -33.598 50.942  1.00 216.44 ? 177  GLU C OE2   1 
ATOM   4916  N  N     . PRO C 2 178  ? 37.186  -32.502 46.363  1.00 208.07 ? 178  PRO C N     1 
ATOM   4917  C  CA    . PRO C 2 178  ? 35.724  -32.549 46.175  1.00 209.35 ? 178  PRO C CA    1 
ATOM   4918  C  C     . PRO C 2 178  ? 35.232  -33.810 45.486  1.00 208.42 ? 178  PRO C C     1 
ATOM   4919  O  O     . PRO C 2 178  ? 34.271  -34.432 45.938  1.00 202.19 ? 178  PRO C O     1 
ATOM   4920  C  CB    . PRO C 2 178  ? 35.449  -31.338 45.282  1.00 211.81 ? 178  PRO C CB    1 
ATOM   4921  C  CG    . PRO C 2 178  ? 36.735  -31.089 44.569  1.00 209.49 ? 178  PRO C CG    1 
ATOM   4922  C  CD    . PRO C 2 178  ? 37.805  -31.437 45.553  1.00 204.02 ? 178  PRO C CD    1 
ATOM   4923  N  N     . ASN C 2 179  ? 35.927  -34.191 44.419  1.00 212.68 ? 179  ASN C N     1 
ATOM   4924  C  CA    . ASN C 2 179  ? 35.453  -35.213 43.493  1.00 213.11 ? 179  ASN C CA    1 
ATOM   4925  C  C     . ASN C 2 179  ? 35.978  -36.619 43.764  1.00 214.70 ? 179  ASN C C     1 
ATOM   4926  O  O     . ASN C 2 179  ? 35.714  -37.543 42.997  1.00 214.05 ? 179  ASN C O     1 
ATOM   4927  C  CB    . ASN C 2 179  ? 35.725  -34.797 42.039  1.00 210.64 ? 179  ASN C CB    1 
ATOM   4928  C  CG    . ASN C 2 179  ? 37.073  -34.124 41.860  1.00 204.34 ? 179  ASN C CG    1 
ATOM   4929  O  OD1   . ASN C 2 179  ? 37.997  -34.337 42.643  1.00 205.31 ? 179  ASN C OD1   1 
ATOM   4930  N  ND2   . ASN C 2 179  ? 37.189  -33.301 40.823  1.00 194.71 ? 179  ASN C ND2   1 
ATOM   4931  N  N     . GLY C 2 180  ? 36.731  -36.778 44.845  1.00 215.03 ? 180  GLY C N     1 
ATOM   4932  C  CA    . GLY C 2 180  ? 37.194  -38.094 45.237  1.00 212.90 ? 180  GLY C CA    1 
ATOM   4933  C  C     . GLY C 2 180  ? 38.647  -38.391 44.915  1.00 213.23 ? 180  GLY C C     1 
ATOM   4934  O  O     . GLY C 2 180  ? 39.157  -39.427 45.335  1.00 215.73 ? 180  GLY C O     1 
ATOM   4935  N  N     . VAL C 2 181  ? 39.314  -37.506 44.172  1.00 213.52 ? 181  VAL C N     1 
ATOM   4936  C  CA    . VAL C 2 181  ? 40.744  -37.684 43.866  1.00 215.18 ? 181  VAL C CA    1 
ATOM   4937  C  C     . VAL C 2 181  ? 41.649  -37.043 44.934  1.00 208.48 ? 181  VAL C C     1 
ATOM   4938  O  O     . VAL C 2 181  ? 41.322  -35.988 45.478  1.00 203.82 ? 181  VAL C O     1 
ATOM   4939  C  CB    . VAL C 2 181  ? 41.122  -37.185 42.427  1.00 210.51 ? 181  VAL C CB    1 
ATOM   4940  C  CG1   . VAL C 2 181  ? 40.928  -35.681 42.294  1.00 205.90 ? 181  VAL C CG1   1 
ATOM   4941  C  CG2   . VAL C 2 181  ? 42.558  -37.588 42.055  1.00 197.27 ? 181  VAL C CG2   1 
ATOM   4942  N  N     . VAL C 2 182  ? 42.778  -37.686 45.235  1.00 204.28 ? 182  VAL C N     1 
ATOM   4943  C  CA    . VAL C 2 182  ? 43.666  -37.208 46.291  1.00 192.25 ? 182  VAL C CA    1 
ATOM   4944  C  C     . VAL C 2 182  ? 44.469  -35.992 45.848  1.00 186.05 ? 182  VAL C C     1 
ATOM   4945  O  O     . VAL C 2 182  ? 45.270  -36.066 44.920  1.00 184.84 ? 182  VAL C O     1 
ATOM   4946  C  CB    . VAL C 2 182  ? 44.624  -38.317 46.747  1.00 189.75 ? 182  VAL C CB    1 
ATOM   4947  C  CG1   . VAL C 2 182  ? 43.922  -39.250 47.718  1.00 195.23 ? 182  VAL C CG1   1 
ATOM   4948  C  CG2   . VAL C 2 182  ? 45.153  -39.091 45.546  1.00 192.26 ? 182  VAL C CG2   1 
ATOM   4949  N  N     . SER C 2 183  ? 44.268  -34.877 46.543  1.00 184.51 ? 183  SER C N     1 
ATOM   4950  C  CA    . SER C 2 183  ? 44.870  -33.609 46.148  1.00 176.51 ? 183  SER C CA    1 
ATOM   4951  C  C     . SER C 2 183  ? 45.964  -33.199 47.113  1.00 169.76 ? 183  SER C C     1 
ATOM   4952  O  O     . SER C 2 183  ? 45.739  -33.073 48.315  1.00 172.45 ? 183  SER C O     1 
ATOM   4953  C  CB    . SER C 2 183  ? 43.812  -32.506 46.039  1.00 178.82 ? 183  SER C CB    1 
ATOM   4954  O  OG    . SER C 2 183  ? 43.144  -32.279 47.270  1.00 180.80 ? 183  SER C OG    1 
ATOM   4955  N  N     . MET C 2 184  ? 47.153  -32.988 46.572  1.00 167.05 ? 184  MET C N     1 
ATOM   4956  C  CA    . MET C 2 184  ? 48.314  -32.689 47.385  1.00 161.72 ? 184  MET C CA    1 
ATOM   4957  C  C     . MET C 2 184  ? 48.764  -31.256 47.146  1.00 166.09 ? 184  MET C C     1 
ATOM   4958  O  O     . MET C 2 184  ? 49.232  -30.923 46.062  1.00 171.26 ? 184  MET C O     1 
ATOM   4959  C  CB    . MET C 2 184  ? 49.439  -33.647 47.028  1.00 158.23 ? 184  MET C CB    1 
ATOM   4960  C  CG    . MET C 2 184  ? 50.359  -33.966 48.166  1.00 157.87 ? 184  MET C CG    1 
ATOM   4961  S  SD    . MET C 2 184  ? 51.984  -34.366 47.535  1.00 138.16 ? 184  MET C SD    1 
ATOM   4962  C  CE    . MET C 2 184  ? 52.504  -32.752 47.022  1.00 150.06 ? 184  MET C CE    1 
ATOM   4963  N  N     . LYS C 2 185  ? 48.615  -30.408 48.157  1.00 163.29 ? 185  LYS C N     1 
ATOM   4964  C  CA    . LYS C 2 185  ? 48.984  -28.999 48.048  1.00 159.78 ? 185  LYS C CA    1 
ATOM   4965  C  C     . LYS C 2 185  ? 50.444  -28.782 48.465  1.00 160.63 ? 185  LYS C C     1 
ATOM   4966  O  O     . LYS C 2 185  ? 50.823  -29.121 49.581  1.00 163.16 ? 185  LYS C O     1 
ATOM   4967  C  CB    . LYS C 2 185  ? 48.034  -28.154 48.911  1.00 156.68 ? 185  LYS C CB    1 
ATOM   4968  C  CG    . LYS C 2 185  ? 48.449  -26.710 49.129  1.00 156.40 ? 185  LYS C CG    1 
ATOM   4969  C  CD    . LYS C 2 185  ? 47.655  -26.067 50.258  1.00 145.80 ? 185  LYS C CD    1 
ATOM   4970  C  CE    . LYS C 2 185  ? 46.169  -26.062 49.952  1.00 143.58 ? 185  LYS C CE    1 
ATOM   4971  N  NZ    . LYS C 2 185  ? 45.371  -25.769 51.174  1.00 148.30 ? 185  LYS C NZ    1 
ATOM   4972  N  N     . VAL C 2 186  ? 51.264  -28.242 47.563  1.00 163.25 ? 186  VAL C N     1 
ATOM   4973  C  CA    . VAL C 2 186  ? 52.642  -27.855 47.894  1.00 164.89 ? 186  VAL C CA    1 
ATOM   4974  C  C     . VAL C 2 186  ? 53.075  -26.553 47.213  1.00 174.94 ? 186  VAL C C     1 
ATOM   4975  O  O     . VAL C 2 186  ? 52.827  -26.360 46.017  1.00 177.32 ? 186  VAL C O     1 
ATOM   4976  C  CB    . VAL C 2 186  ? 53.650  -28.968 47.571  1.00 155.15 ? 186  VAL C CB    1 
ATOM   4977  C  CG1   . VAL C 2 186  ? 55.037  -28.389 47.324  1.00 161.21 ? 186  VAL C CG1   1 
ATOM   4978  C  CG2   . VAL C 2 186  ? 53.711  -29.939 48.719  1.00 159.59 ? 186  VAL C CG2   1 
ATOM   4979  N  N     . ASN C 2 187  ? 53.727  -25.678 47.985  1.00 176.28 ? 187  ASN C N     1 
ATOM   4980  C  CA    . ASN C 2 187  ? 54.087  -24.338 47.537  1.00 173.78 ? 187  ASN C CA    1 
ATOM   4981  C  C     . ASN C 2 187  ? 52.821  -23.658 47.026  1.00 173.91 ? 187  ASN C C     1 
ATOM   4982  O  O     . ASN C 2 187  ? 52.843  -22.913 46.049  1.00 174.19 ? 187  ASN C O     1 
ATOM   4983  C  CB    . ASN C 2 187  ? 55.189  -24.379 46.464  1.00 176.62 ? 187  ASN C CB    1 
ATOM   4984  C  CG    . ASN C 2 187  ? 56.453  -25.103 46.935  1.00 174.02 ? 187  ASN C CG    1 
ATOM   4985  O  OD1   . ASN C 2 187  ? 57.006  -25.944 46.221  1.00 172.18 ? 187  ASN C OD1   1 
ATOM   4986  N  ND2   . ASN C 2 187  ? 56.914  -24.772 48.135  1.00 174.52 ? 187  ASN C ND2   1 
ATOM   4987  N  N     . LYS C 2 188  ? 51.717  -23.964 47.704  1.00 174.22 ? 188  LYS C N     1 
ATOM   4988  C  CA    . LYS C 2 188  ? 50.374  -23.482 47.376  1.00 175.36 ? 188  LYS C CA    1 
ATOM   4989  C  C     . LYS C 2 188  ? 49.901  -23.766 45.930  1.00 176.19 ? 188  LYS C C     1 
ATOM   4990  O  O     . LYS C 2 188  ? 49.297  -22.906 45.296  1.00 183.34 ? 188  LYS C O     1 
ATOM   4991  C  CB    . LYS C 2 188  ? 50.223  -22.002 47.776  1.00 176.71 ? 188  LYS C CB    1 
ATOM   4992  C  CG    . LYS C 2 188  ? 50.735  -21.708 49.194  1.00 174.75 ? 188  LYS C CG    1 
ATOM   4993  C  CD    . LYS C 2 188  ? 50.899  -20.222 49.468  1.00 174.28 ? 188  LYS C CD    1 
ATOM   4994  C  CE    . LYS C 2 188  ? 51.830  -19.968 50.655  1.00 180.79 ? 188  LYS C CE    1 
ATOM   4995  N  NZ    . LYS C 2 188  ? 53.284  -20.088 50.312  1.00 188.52 ? 188  LYS C NZ    1 
ATOM   4996  N  N     . ARG C 2 189  ? 50.167  -24.975 45.428  1.00 173.16 ? 189  ARG C N     1 
ATOM   4997  C  CA    . ARG C 2 189  ? 49.587  -25.448 44.159  1.00 174.26 ? 189  ARG C CA    1 
ATOM   4998  C  C     . ARG C 2 189  ? 48.966  -26.853 44.280  1.00 170.17 ? 189  ARG C C     1 
ATOM   4999  O  O     . ARG C 2 189  ? 49.650  -27.802 44.650  1.00 168.85 ? 189  ARG C O     1 
ATOM   5000  C  CB    . ARG C 2 189  ? 50.626  -25.437 43.030  1.00 175.98 ? 189  ARG C CB    1 
ATOM   5001  C  CG    . ARG C 2 189  ? 50.969  -24.058 42.504  1.00 179.82 ? 189  ARG C CG    1 
ATOM   5002  C  CD    . ARG C 2 189  ? 51.724  -24.127 41.187  1.00 188.97 ? 189  ARG C CD    1 
ATOM   5003  N  NE    . ARG C 2 189  ? 52.627  -22.988 41.050  1.00 203.91 ? 189  ARG C NE    1 
ATOM   5004  C  CZ    . ARG C 2 189  ? 53.251  -22.645 39.927  1.00 205.19 ? 189  ARG C CZ    1 
ATOM   5005  N  NH1   . ARG C 2 189  ? 53.071  -23.358 38.824  1.00 206.61 ? 189  ARG C NH1   1 
ATOM   5006  N  NH2   . ARG C 2 189  ? 54.061  -21.591 39.909  1.00 200.38 ? 189  ARG C NH2   1 
ATOM   5007  N  N     . LYS C 2 190  ? 47.678  -26.981 43.952  1.00 173.40 ? 190  LYS C N     1 
ATOM   5008  C  CA    . LYS C 2 190  ? 46.944  -28.253 44.069  1.00 173.48 ? 190  LYS C CA    1 
ATOM   5009  C  C     . LYS C 2 190  ? 46.958  -29.096 42.785  1.00 175.70 ? 190  LYS C C     1 
ATOM   5010  O  O     . LYS C 2 190  ? 46.593  -28.620 41.709  1.00 176.04 ? 190  LYS C O     1 
ATOM   5011  C  CB    . LYS C 2 190  ? 45.482  -28.020 44.502  1.00 167.33 ? 190  LYS C CB    1 
ATOM   5012  C  CG    . LYS C 2 190  ? 45.272  -27.661 45.968  1.00 163.62 ? 190  LYS C CG    1 
ATOM   5013  C  CD    . LYS C 2 190  ? 43.780  -27.662 46.343  1.00 167.17 ? 190  LYS C CD    1 
ATOM   5014  C  CE    . LYS C 2 190  ? 43.186  -29.077 46.347  1.00 168.26 ? 190  LYS C CE    1 
ATOM   5015  N  NZ    . LYS C 2 190  ? 41.783  -29.187 46.875  1.00 158.51 ? 190  LYS C NZ    1 
ATOM   5016  N  N     . PHE C 2 191  ? 47.372  -30.352 42.916  1.00 173.70 ? 191  PHE C N     1 
ATOM   5017  C  CA    . PHE C 2 191  ? 47.388  -31.300 41.804  1.00 175.40 ? 191  PHE C CA    1 
ATOM   5018  C  C     . PHE C 2 191  ? 47.003  -32.699 42.298  1.00 177.48 ? 191  PHE C C     1 
ATOM   5019  O  O     . PHE C 2 191  ? 47.002  -32.936 43.503  1.00 179.88 ? 191  PHE C O     1 
ATOM   5020  C  CB    . PHE C 2 191  ? 48.775  -31.333 41.187  1.00 177.29 ? 191  PHE C CB    1 
ATOM   5021  C  CG    . PHE C 2 191  ? 49.765  -32.097 41.992  1.00 174.30 ? 191  PHE C CG    1 
ATOM   5022  C  CD1   . PHE C 2 191  ? 50.196  -33.343 41.582  1.00 178.92 ? 191  PHE C CD1   1 
ATOM   5023  C  CD2   . PHE C 2 191  ? 50.257  -31.576 43.163  1.00 170.28 ? 191  PHE C CD2   1 
ATOM   5024  C  CE1   . PHE C 2 191  ? 51.104  -34.051 42.326  1.00 181.03 ? 191  PHE C CE1   1 
ATOM   5025  C  CE2   . PHE C 2 191  ? 51.162  -32.275 43.907  1.00 172.51 ? 191  PHE C CE2   1 
ATOM   5026  C  CZ    . PHE C 2 191  ? 51.590  -33.516 43.489  1.00 176.07 ? 191  PHE C CZ    1 
ATOM   5027  N  N     . PRO C 2 192  ? 46.643  -33.622 41.382  1.00 176.77 ? 192  PRO C N     1 
ATOM   5028  C  CA    . PRO C 2 192  ? 46.364  -34.984 41.848  1.00 180.50 ? 192  PRO C CA    1 
ATOM   5029  C  C     . PRO C 2 192  ? 47.597  -35.646 42.440  1.00 183.62 ? 192  PRO C C     1 
ATOM   5030  O  O     . PRO C 2 192  ? 48.614  -35.794 41.763  1.00 180.00 ? 192  PRO C O     1 
ATOM   5031  C  CB    . PRO C 2 192  ? 45.966  -35.714 40.565  1.00 186.99 ? 192  PRO C CB    1 
ATOM   5032  C  CG    . PRO C 2 192  ? 46.631  -34.950 39.484  1.00 186.44 ? 192  PRO C CG    1 
ATOM   5033  C  CD    . PRO C 2 192  ? 46.540  -33.523 39.919  1.00 182.49 ? 192  PRO C CD    1 
ATOM   5034  N  N     . LEU C 2 193  ? 47.456  -36.115 43.675  1.00 188.06 ? 193  LEU C N     1 
ATOM   5035  C  CA    . LEU C 2 193  ? 48.538  -36.738 44.422  1.00 186.50 ? 193  LEU C CA    1 
ATOM   5036  C  C     . LEU C 2 193  ? 48.985  -37.962 43.664  1.00 186.54 ? 193  LEU C C     1 
ATOM   5037  O  O     . LEU C 2 193  ? 50.144  -38.368 43.722  1.00 181.82 ? 193  LEU C O     1 
ATOM   5038  C  CB    . LEU C 2 193  ? 48.031  -37.135 45.809  1.00 179.47 ? 193  LEU C CB    1 
ATOM   5039  C  CG    . LEU C 2 193  ? 48.882  -38.067 46.658  1.00 172.12 ? 193  LEU C CG    1 
ATOM   5040  C  CD1   . LEU C 2 193  ? 50.201  -37.406 46.971  1.00 167.42 ? 193  LEU C CD1   1 
ATOM   5041  C  CD2   . LEU C 2 193  ? 48.128  -38.392 47.915  1.00 166.76 ? 193  LEU C CD2   1 
ATOM   5042  N  N     . VAL C 2 194  ? 48.031  -38.519 42.931  1.00 191.17 ? 194  VAL C N     1 
ATOM   5043  C  CA    . VAL C 2 194  ? 48.223  -39.717 42.151  1.00 193.45 ? 194  VAL C CA    1 
ATOM   5044  C  C     . VAL C 2 194  ? 49.498  -39.603 41.329  1.00 192.26 ? 194  VAL C C     1 
ATOM   5045  O  O     . VAL C 2 194  ? 50.373  -40.460 41.433  1.00 192.22 ? 194  VAL C O     1 
ATOM   5046  C  CB    . VAL C 2 194  ? 47.023  -39.924 41.210  1.00 199.89 ? 194  VAL C CB    1 
ATOM   5047  C  CG1   . VAL C 2 194  ? 46.972  -41.356 40.737  1.00 206.73 ? 194  VAL C CG1   1 
ATOM   5048  C  CG2   . VAL C 2 194  ? 45.717  -39.536 41.913  1.00 195.79 ? 194  VAL C CG2   1 
ATOM   5049  N  N     . LEU C 2 195  ? 49.629  -38.508 40.577  1.00 195.85 ? 195  LEU C N     1 
ATOM   5050  C  CA    . LEU C 2 195  ? 50.762  -38.302 39.662  1.00 201.26 ? 195  LEU C CA    1 
ATOM   5051  C  C     . LEU C 2 195  ? 52.116  -38.497 40.341  1.00 198.80 ? 195  LEU C C     1 
ATOM   5052  O  O     . LEU C 2 195  ? 53.090  -38.941 39.722  1.00 198.16 ? 195  LEU C O     1 
ATOM   5053  C  CB    . LEU C 2 195  ? 50.697  -36.903 39.029  1.00 203.88 ? 195  LEU C CB    1 
ATOM   5054  C  CG    . LEU C 2 195  ? 51.849  -36.464 38.107  1.00 206.39 ? 195  LEU C CG    1 
ATOM   5055  C  CD1   . LEU C 2 195  ? 52.003  -37.412 36.927  1.00 213.19 ? 195  LEU C CD1   1 
ATOM   5056  C  CD2   . LEU C 2 195  ? 51.667  -35.028 37.612  1.00 205.08 ? 195  LEU C CD2   1 
ATOM   5057  N  N     . LEU C 2 196  ? 52.163  -38.174 41.626  1.00 194.80 ? 196  LEU C N     1 
ATOM   5058  C  CA    . LEU C 2 196  ? 53.370  -38.362 42.402  1.00 192.43 ? 196  LEU C CA    1 
ATOM   5059  C  C     . LEU C 2 196  ? 53.679  -39.847 42.530  1.00 193.26 ? 196  LEU C C     1 
ATOM   5060  O  O     . LEU C 2 196  ? 54.798  -40.276 42.257  1.00 193.42 ? 196  LEU C O     1 
ATOM   5061  C  CB    . LEU C 2 196  ? 53.182  -37.764 43.785  1.00 186.47 ? 196  LEU C CB    1 
ATOM   5062  C  CG    . LEU C 2 196  ? 54.396  -37.194 44.508  1.00 175.54 ? 196  LEU C CG    1 
ATOM   5063  C  CD1   . LEU C 2 196  ? 53.970  -36.828 45.914  1.00 178.25 ? 196  LEU C CD1   1 
ATOM   5064  C  CD2   . LEU C 2 196  ? 55.573  -38.152 44.540  1.00 164.91 ? 196  LEU C CD2   1 
ATOM   5065  N  N     . LEU C 2 197  ? 52.677  -40.621 42.945  1.00 192.10 ? 197  LEU C N     1 
ATOM   5066  C  CA    . LEU C 2 197  ? 52.862  -42.038 43.238  1.00 190.07 ? 197  LEU C CA    1 
ATOM   5067  C  C     . LEU C 2 197  ? 53.582  -42.785 42.109  1.00 192.30 ? 197  LEU C C     1 
ATOM   5068  O  O     . LEU C 2 197  ? 54.402  -43.666 42.369  1.00 192.80 ? 197  LEU C O     1 
ATOM   5069  C  CB    . LEU C 2 197  ? 51.517  -42.696 43.578  1.00 184.60 ? 197  LEU C CB    1 
ATOM   5070  C  CG    . LEU C 2 197  ? 50.856  -42.221 44.874  1.00 175.64 ? 197  LEU C CG    1 
ATOM   5071  C  CD1   . LEU C 2 197  ? 49.418  -42.669 44.930  1.00 182.75 ? 197  LEU C CD1   1 
ATOM   5072  C  CD2   . LEU C 2 197  ? 51.613  -42.744 46.075  1.00 170.26 ? 197  LEU C CD2   1 
ATOM   5073  N  N     . ARG C 2 198  ? 53.302  -42.415 40.862  1.00 192.10 ? 198  ARG C N     1 
ATOM   5074  C  CA    . ARG C 2 198  ? 53.944  -43.084 39.736  1.00 196.69 ? 198  ARG C CA    1 
ATOM   5075  C  C     . ARG C 2 198  ? 55.441  -42.827 39.792  1.00 196.93 ? 198  ARG C C     1 
ATOM   5076  O  O     . ARG C 2 198  ? 56.233  -43.756 39.669  1.00 200.67 ? 198  ARG C O     1 
ATOM   5077  C  CB    . ARG C 2 198  ? 53.350  -42.649 38.384  1.00 205.04 ? 198  ARG C CB    1 
ATOM   5078  C  CG    . ARG C 2 198  ? 53.907  -43.406 37.144  1.00 219.91 ? 198  ARG C CG    1 
ATOM   5079  C  CD    . ARG C 2 198  ? 53.252  -44.792 36.883  1.00 225.84 ? 198  ARG C CD    1 
ATOM   5080  N  NE    . ARG C 2 198  ? 54.055  -45.638 35.983  1.00 229.74 ? 198  ARG C NE    1 
ATOM   5081  C  CZ    . ARG C 2 198  ? 53.725  -46.870 35.591  1.00 230.24 ? 198  ARG C CZ    1 
ATOM   5082  N  NH1   . ARG C 2 198  ? 54.528  -47.555 34.780  1.00 222.82 ? 198  ARG C NH1   1 
ATOM   5083  N  NH2   . ARG C 2 198  ? 52.588  -47.419 36.001  1.00 232.28 ? 198  ARG C NH2   1 
ATOM   5084  N  N     . VAL C 2 199  ? 55.827  -41.574 40.015  1.00 194.71 ? 199  VAL C N     1 
ATOM   5085  C  CA    . VAL C 2 199  ? 57.239  -41.208 40.107  1.00 194.94 ? 199  VAL C CA    1 
ATOM   5086  C  C     . VAL C 2 199  ? 57.962  -42.025 41.199  1.00 195.56 ? 199  VAL C C     1 
ATOM   5087  O  O     . VAL C 2 199  ? 59.172  -42.255 41.121  1.00 195.19 ? 199  VAL C O     1 
ATOM   5088  C  CB    . VAL C 2 199  ? 57.397  -39.676 40.354  1.00 186.81 ? 199  VAL C CB    1 
ATOM   5089  C  CG1   . VAL C 2 199  ? 58.850  -39.247 40.254  1.00 180.06 ? 199  VAL C CG1   1 
ATOM   5090  C  CG2   . VAL C 2 199  ? 56.546  -38.885 39.370  1.00 188.73 ? 199  VAL C CG2   1 
ATOM   5091  N  N     . LEU C 2 200  ? 57.195  -42.501 42.181  1.00 195.47 ? 200  LEU C N     1 
ATOM   5092  C  CA    . LEU C 2 200  ? 57.726  -43.164 43.375  1.00 194.39 ? 200  LEU C CA    1 
ATOM   5093  C  C     . LEU C 2 200  ? 57.984  -44.663 43.237  1.00 196.02 ? 200  LEU C C     1 
ATOM   5094  O  O     . LEU C 2 200  ? 58.330  -45.335 44.218  1.00 198.26 ? 200  LEU C O     1 
ATOM   5095  C  CB    . LEU C 2 200  ? 56.792  -42.925 44.570  1.00 187.65 ? 200  LEU C CB    1 
ATOM   5096  C  CG    . LEU C 2 200  ? 56.852  -41.570 45.274  1.00 173.96 ? 200  LEU C CG    1 
ATOM   5097  C  CD1   . LEU C 2 200  ? 55.599  -41.368 46.083  1.00 174.93 ? 200  LEU C CD1   1 
ATOM   5098  C  CD2   . LEU C 2 200  ? 58.067  -41.504 46.170  1.00 175.93 ? 200  LEU C CD2   1 
ATOM   5099  N  N     . GLY C 2 201  ? 57.798  -45.199 42.040  1.00 196.07 ? 201  GLY C N     1 
ATOM   5100  C  CA    . GLY C 2 201  ? 57.927  -46.629 41.866  1.00 197.86 ? 201  GLY C CA    1 
ATOM   5101  C  C     . GLY C 2 201  ? 56.686  -47.304 42.406  1.00 196.90 ? 201  GLY C C     1 
ATOM   5102  O  O     . GLY C 2 201  ? 56.766  -48.298 43.139  1.00 198.05 ? 201  GLY C O     1 
ATOM   5103  N  N     . TYR C 2 202  ? 55.536  -46.736 42.051  1.00 193.26 ? 202  TYR C N     1 
ATOM   5104  C  CA    . TYR C 2 202  ? 54.249  -47.355 42.318  1.00 196.98 ? 202  TYR C CA    1 
ATOM   5105  C  C     . TYR C 2 202  ? 53.508  -47.538 41.017  1.00 198.60 ? 202  TYR C C     1 
ATOM   5106  O  O     . TYR C 2 202  ? 53.510  -46.659 40.158  1.00 196.24 ? 202  TYR C O     1 
ATOM   5107  C  CB    . TYR C 2 202  ? 53.407  -46.513 43.270  1.00 195.09 ? 202  TYR C CB    1 
ATOM   5108  C  CG    . TYR C 2 202  ? 53.893  -46.571 44.687  1.00 193.05 ? 202  TYR C CG    1 
ATOM   5109  C  CD1   . TYR C 2 202  ? 54.498  -47.721 45.182  1.00 197.03 ? 202  TYR C CD1   1 
ATOM   5110  C  CD2   . TYR C 2 202  ? 53.769  -45.476 45.526  1.00 190.10 ? 202  TYR C CD2   1 
ATOM   5111  C  CE1   . TYR C 2 202  ? 54.957  -47.781 46.474  1.00 196.68 ? 202  TYR C CE1   1 
ATOM   5112  C  CE2   . TYR C 2 202  ? 54.225  -45.522 46.821  1.00 188.90 ? 202  TYR C CE2   1 
ATOM   5113  C  CZ    . TYR C 2 202  ? 54.818  -46.677 47.290  1.00 192.06 ? 202  TYR C CZ    1 
ATOM   5114  O  OH    . TYR C 2 202  ? 55.274  -46.726 48.587  1.00 190.45 ? 202  TYR C OH    1 
ATOM   5115  N  N     . ASP C 2 203  ? 52.884  -48.698 40.877  1.00 205.75 ? 203  ASP C N     1 
ATOM   5116  C  CA    . ASP C 2 203  ? 52.088  -49.003 39.705  1.00 215.28 ? 203  ASP C CA    1 
ATOM   5117  C  C     . ASP C 2 203  ? 50.705  -49.432 40.162  1.00 220.61 ? 203  ASP C C     1 
ATOM   5118  O  O     . ASP C 2 203  ? 50.514  -49.758 41.331  1.00 225.03 ? 203  ASP C O     1 
ATOM   5119  C  CB    . ASP C 2 203  ? 52.744  -50.114 38.894  1.00 222.84 ? 203  ASP C CB    1 
ATOM   5120  C  CG    . ASP C 2 203  ? 52.090  -50.310 37.544  1.00 227.58 ? 203  ASP C CG    1 
ATOM   5121  O  OD1   . ASP C 2 203  ? 52.155  -51.437 37.019  1.00 231.79 ? 203  ASP C OD1   1 
ATOM   5122  O  OD2   . ASP C 2 203  ? 51.505  -49.338 37.013  1.00 229.31 ? 203  ASP C OD2   1 
ATOM   5123  N  N     . GLN C 2 204  ? 49.752  -49.442 39.234  1.00 219.94 ? 204  GLN C N     1 
ATOM   5124  C  CA    . GLN C 2 204  ? 48.342  -49.686 39.539  1.00 220.45 ? 204  GLN C CA    1 
ATOM   5125  C  C     . GLN C 2 204  ? 48.074  -50.952 40.366  1.00 221.99 ? 204  GLN C C     1 
ATOM   5126  O  O     . GLN C 2 204  ? 47.070  -51.042 41.081  1.00 216.63 ? 204  GLN C O     1 
ATOM   5127  C  CB    . GLN C 2 204  ? 47.556  -49.743 38.237  1.00 215.65 ? 204  GLN C CB    1 
ATOM   5128  C  CG    . GLN C 2 204  ? 46.108  -49.395 38.388  1.00 213.11 ? 204  GLN C CG    1 
ATOM   5129  C  CD    . GLN C 2 204  ? 45.650  -48.475 37.292  1.00 214.95 ? 204  GLN C CD    1 
ATOM   5130  O  OE1   . GLN C 2 204  ? 46.462  -47.954 36.526  1.00 213.08 ? 204  GLN C OE1   1 
ATOM   5131  N  NE2   . GLN C 2 204  ? 44.346  -48.267 37.205  1.00 218.66 ? 204  GLN C NE2   1 
ATOM   5132  N  N     . GLU C 2 205  ? 48.963  -51.933 40.237  1.00 226.49 ? 205  GLU C N     1 
ATOM   5133  C  CA    . GLU C 2 205  ? 48.874  -53.176 41.001  1.00 230.02 ? 205  GLU C CA    1 
ATOM   5134  C  C     . GLU C 2 205  ? 49.359  -53.086 42.456  1.00 228.57 ? 205  GLU C C     1 
ATOM   5135  O  O     . GLU C 2 205  ? 48.622  -53.459 43.367  1.00 231.27 ? 205  GLU C O     1 
ATOM   5136  C  CB    . GLU C 2 205  ? 49.625  -54.294 40.271  1.00 233.75 ? 205  GLU C CB    1 
ATOM   5137  C  CG    . GLU C 2 205  ? 49.605  -55.648 40.970  1.00 238.95 ? 205  GLU C CG    1 
ATOM   5138  C  CD    . GLU C 2 205  ? 48.326  -56.428 40.721  1.00 243.11 ? 205  GLU C CD    1 
ATOM   5139  O  OE1   . GLU C 2 205  ? 47.523  -56.016 39.853  1.00 239.77 ? 205  GLU C OE1   1 
ATOM   5140  O  OE2   . GLU C 2 205  ? 48.131  -57.460 41.399  1.00 245.19 ? 205  GLU C OE2   1 
ATOM   5141  N  N     . THR C 2 206  ? 50.577  -52.579 42.675  1.00 225.01 ? 206  THR C N     1 
ATOM   5142  C  CA    . THR C 2 206  ? 51.152  -52.511 44.025  1.00 221.11 ? 206  THR C CA    1 
ATOM   5143  C  C     . THR C 2 206  ? 50.260  -51.663 44.938  1.00 224.26 ? 206  THR C C     1 
ATOM   5144  O  O     . THR C 2 206  ? 50.263  -51.848 46.155  1.00 227.68 ? 206  THR C O     1 
ATOM   5145  C  CB    . THR C 2 206  ? 52.624  -51.979 44.030  1.00 205.32 ? 206  THR C CB    1 
ATOM   5146  O  OG1   . THR C 2 206  ? 53.406  -52.704 43.082  1.00 201.39 ? 206  THR C OG1   1 
ATOM   5147  C  CG2   . THR C 2 206  ? 53.279  -52.149 45.391  1.00 199.68 ? 206  THR C CG2   1 
ATOM   5148  N  N     . LEU C 2 207  ? 49.483  -50.756 44.335  1.00 223.84 ? 207  LEU C N     1 
ATOM   5149  C  CA    . LEU C 2 207  ? 48.555  -49.875 45.066  1.00 224.95 ? 207  LEU C CA    1 
ATOM   5150  C  C     . LEU C 2 207  ? 47.216  -50.535 45.461  1.00 226.20 ? 207  LEU C C     1 
ATOM   5151  O  O     . LEU C 2 207  ? 46.718  -50.324 46.570  1.00 224.31 ? 207  LEU C O     1 
ATOM   5152  C  CB    . LEU C 2 207  ? 48.301  -48.555 44.306  1.00 219.67 ? 207  LEU C CB    1 
ATOM   5153  C  CG    . LEU C 2 207  ? 49.400  -47.497 44.068  1.00 208.31 ? 207  LEU C CG    1 
ATOM   5154  C  CD1   . LEU C 2 207  ? 48.815  -46.263 43.394  1.00 193.31 ? 207  LEU C CD1   1 
ATOM   5155  C  CD2   . LEU C 2 207  ? 50.138  -47.088 45.339  1.00 202.71 ? 207  LEU C CD2   1 
ATOM   5156  N  N     . ALA C 2 208  ? 46.630  -51.321 44.562  1.00 224.94 ? 208  ALA C N     1 
ATOM   5157  C  CA    . ALA C 2 208  ? 45.402  -52.041 44.888  1.00 221.95 ? 208  ALA C CA    1 
ATOM   5158  C  C     . ALA C 2 208  ? 45.610  -53.062 46.019  1.00 225.77 ? 208  ALA C C     1 
ATOM   5159  O  O     . ALA C 2 208  ? 44.662  -53.396 46.725  1.00 221.56 ? 208  ALA C O     1 
ATOM   5160  C  CB    . ALA C 2 208  ? 44.827  -52.712 43.648  1.00 215.76 ? 208  ALA C CB    1 
ATOM   5161  N  N     . ARG C 2 209  ? 46.839  -53.560 46.181  1.00 232.27 ? 209  ARG C N     1 
ATOM   5162  C  CA    . ARG C 2 209  ? 47.164  -54.531 47.243  1.00 236.03 ? 209  ARG C CA    1 
ATOM   5163  C  C     . ARG C 2 209  ? 46.915  -54.040 48.680  1.00 238.89 ? 209  ARG C C     1 
ATOM   5164  O  O     . ARG C 2 209  ? 45.979  -54.487 49.352  1.00 240.51 ? 209  ARG C O     1 
ATOM   5165  C  CB    . ARG C 2 209  ? 48.630  -55.009 47.152  1.00 233.96 ? 209  ARG C CB    1 
ATOM   5166  C  CG    . ARG C 2 209  ? 49.157  -55.386 45.773  1.00 231.45 ? 209  ARG C CG    1 
ATOM   5167  C  CD    . ARG C 2 209  ? 48.227  -56.324 45.026  1.00 234.80 ? 209  ARG C CD    1 
ATOM   5168  N  NE    . ARG C 2 209  ? 48.156  -57.662 45.606  1.00 239.75 ? 209  ARG C NE    1 
ATOM   5169  C  CZ    . ARG C 2 209  ? 48.780  -58.725 45.109  1.00 238.15 ? 209  ARG C CZ    1 
ATOM   5170  N  NH1   . ARG C 2 209  ? 49.536  -58.608 44.027  1.00 232.70 ? 209  ARG C NH1   1 
ATOM   5171  N  NH2   . ARG C 2 209  ? 48.646  -59.906 45.697  1.00 238.55 ? 209  ARG C NH2   1 
ATOM   5172  N  N     . GLU C 2 210  ? 47.775  -53.131 49.144  1.00 237.71 ? 210  GLU C N     1 
ATOM   5173  C  CA    . GLU C 2 210  ? 47.739  -52.661 50.529  1.00 233.49 ? 210  GLU C CA    1 
ATOM   5174  C  C     . GLU C 2 210  ? 46.665  -51.604 50.725  1.00 229.12 ? 210  GLU C C     1 
ATOM   5175  O  O     . GLU C 2 210  ? 45.943  -51.622 51.721  1.00 228.63 ? 210  GLU C O     1 
ATOM   5176  C  CB    . GLU C 2 210  ? 49.101  -52.102 50.967  1.00 227.48 ? 210  GLU C CB    1 
ATOM   5177  C  CG    . GLU C 2 210  ? 50.178  -53.152 51.247  1.00 226.99 ? 210  GLU C CG    1 
ATOM   5178  C  CD    . GLU C 2 210  ? 51.015  -53.497 50.021  1.00 227.70 ? 210  GLU C CD    1 
ATOM   5179  O  OE1   . GLU C 2 210  ? 50.632  -53.100 48.904  1.00 226.85 ? 210  GLU C OE1   1 
ATOM   5180  O  OE2   . GLU C 2 210  ? 52.062  -54.162 50.169  1.00 225.91 ? 210  GLU C OE2   1 
ATOM   5181  N  N     . LEU C 2 211  ? 46.578  -50.679 49.773  1.00 224.41 ? 211  LEU C N     1 
ATOM   5182  C  CA    . LEU C 2 211  ? 45.633  -49.565 49.842  1.00 225.21 ? 211  LEU C CA    1 
ATOM   5183  C  C     . LEU C 2 211  ? 44.220  -49.884 49.340  1.00 227.15 ? 211  LEU C C     1 
ATOM   5184  O  O     . LEU C 2 211  ? 43.256  -49.230 49.737  1.00 221.91 ? 211  LEU C O     1 
ATOM   5185  C  CB    . LEU C 2 211  ? 46.197  -48.374 49.061  1.00 220.27 ? 211  LEU C CB    1 
ATOM   5186  C  CG    . LEU C 2 211  ? 45.665  -46.954 49.286  1.00 214.59 ? 211  LEU C CG    1 
ATOM   5187  C  CD1   . LEU C 2 211  ? 46.755  -45.969 48.927  1.00 206.95 ? 211  LEU C CD1   1 
ATOM   5188  C  CD2   . LEU C 2 211  ? 44.419  -46.643 48.473  1.00 212.86 ? 211  LEU C CD2   1 
ATOM   5189  N  N     . GLY C 2 212  ? 44.097  -50.893 48.483  1.00 229.73 ? 212  GLY C N     1 
ATOM   5190  C  CA    . GLY C 2 212  ? 42.837  -51.159 47.807  1.00 226.33 ? 212  GLY C CA    1 
ATOM   5191  C  C     . GLY C 2 212  ? 41.691  -51.507 48.734  1.00 223.17 ? 212  GLY C C     1 
ATOM   5192  O  O     . GLY C 2 212  ? 40.524  -51.307 48.393  1.00 222.56 ? 212  GLY C O     1 
ATOM   5193  N  N     . ALA C 2 213  ? 42.036  -52.000 49.919  1.00 222.68 ? 213  ALA C N     1 
ATOM   5194  C  CA    . ALA C 2 213  ? 41.070  -52.540 50.868  1.00 222.73 ? 213  ALA C CA    1 
ATOM   5195  C  C     . ALA C 2 213  ? 39.885  -51.611 51.188  1.00 226.77 ? 213  ALA C C     1 
ATOM   5196  O  O     . ALA C 2 213  ? 38.783  -52.079 51.476  1.00 229.12 ? 213  ALA C O     1 
ATOM   5197  C  CB    . ALA C 2 213  ? 41.785  -52.968 52.148  1.00 218.84 ? 213  ALA C CB    1 
ATOM   5198  N  N     . TYR C 2 214  ? 40.096  -50.301 51.106  1.00 224.38 ? 214  TYR C N     1 
ATOM   5199  C  CA    . TYR C 2 214  ? 39.067  -49.355 51.524  1.00 216.97 ? 214  TYR C CA    1 
ATOM   5200  C  C     . TYR C 2 214  ? 38.184  -48.999 50.342  1.00 217.86 ? 214  TYR C C     1 
ATOM   5201  O  O     . TYR C 2 214  ? 38.624  -48.364 49.392  1.00 218.66 ? 214  TYR C O     1 
ATOM   5202  C  CB    . TYR C 2 214  ? 39.704  -48.102 52.124  1.00 207.77 ? 214  TYR C CB    1 
ATOM   5203  C  CG    . TYR C 2 214  ? 40.813  -48.408 53.112  1.00 208.42 ? 214  TYR C CG    1 
ATOM   5204  C  CD1   . TYR C 2 214  ? 40.570  -48.438 54.478  1.00 204.00 ? 214  TYR C CD1   1 
ATOM   5205  C  CD2   . TYR C 2 214  ? 42.108  -48.671 52.676  1.00 216.83 ? 214  TYR C CD2   1 
ATOM   5206  C  CE1   . TYR C 2 214  ? 41.589  -48.719 55.385  1.00 202.97 ? 214  TYR C CE1   1 
ATOM   5207  C  CE2   . TYR C 2 214  ? 43.130  -48.957 53.575  1.00 213.60 ? 214  TYR C CE2   1 
ATOM   5208  C  CZ    . TYR C 2 214  ? 42.866  -48.977 54.927  1.00 202.77 ? 214  TYR C CZ    1 
ATOM   5209  O  OH    . TYR C 2 214  ? 43.884  -49.257 55.817  1.00 191.73 ? 214  TYR C OH    1 
ATOM   5210  N  N     . GLY C 2 215  ? 36.928  -49.418 50.409  1.00 217.26 ? 215  GLY C N     1 
ATOM   5211  C  CA    . GLY C 2 215  ? 36.014  -49.238 49.299  1.00 223.02 ? 215  GLY C CA    1 
ATOM   5212  C  C     . GLY C 2 215  ? 35.604  -47.796 49.064  1.00 225.41 ? 215  GLY C C     1 
ATOM   5213  O  O     . GLY C 2 215  ? 35.654  -46.974 49.976  1.00 223.91 ? 215  GLY C O     1 
ATOM   5214  N  N     . GLU C 2 216  ? 35.216  -47.501 47.824  1.00 227.29 ? 216  GLU C N     1 
ATOM   5215  C  CA    . GLU C 2 216  ? 34.694  -46.193 47.406  1.00 227.41 ? 216  GLU C CA    1 
ATOM   5216  C  C     . GLU C 2 216  ? 35.673  -45.047 47.629  1.00 228.52 ? 216  GLU C C     1 
ATOM   5217  O  O     . GLU C 2 216  ? 35.283  -43.882 47.634  1.00 231.55 ? 216  GLU C O     1 
ATOM   5218  C  CB    . GLU C 2 216  ? 33.397  -45.873 48.154  1.00 225.67 ? 216  GLU C CB    1 
ATOM   5219  C  CG    . GLU C 2 216  ? 32.395  -47.002 48.179  1.00 226.72 ? 216  GLU C CG    1 
ATOM   5220  C  CD    . GLU C 2 216  ? 31.725  -47.209 46.842  1.00 229.34 ? 216  GLU C CD    1 
ATOM   5221  O  OE1   . GLU C 2 216  ? 31.772  -46.280 46.007  1.00 225.78 ? 216  GLU C OE1   1 
ATOM   5222  O  OE2   . GLU C 2 216  ? 31.151  -48.298 46.627  1.00 229.68 ? 216  GLU C OE2   1 
ATOM   5223  N  N     . LEU C 2 217  ? 36.948  -45.380 47.770  1.00 226.92 ? 217  LEU C N     1 
ATOM   5224  C  CA    . LEU C 2 217  ? 37.966  -44.390 48.078  1.00 222.20 ? 217  LEU C CA    1 
ATOM   5225  C  C     . LEU C 2 217  ? 39.107  -44.562 47.112  1.00 217.28 ? 217  LEU C C     1 
ATOM   5226  O  O     . LEU C 2 217  ? 39.403  -43.668 46.325  1.00 214.96 ? 217  LEU C O     1 
ATOM   5227  C  CB    . LEU C 2 217  ? 38.465  -44.552 49.509  1.00 221.36 ? 217  LEU C CB    1 
ATOM   5228  C  CG    . LEU C 2 217  ? 37.452  -44.244 50.602  1.00 219.40 ? 217  LEU C CG    1 
ATOM   5229  C  CD1   . LEU C 2 217  ? 37.992  -44.702 51.941  1.00 211.96 ? 217  LEU C CD1   1 
ATOM   5230  C  CD2   . LEU C 2 217  ? 37.118  -42.758 50.619  1.00 213.87 ? 217  LEU C CD2   1 
ATOM   5231  N  N     . VAL C 2 218  ? 39.735  -45.731 47.184  1.00 217.88 ? 218  VAL C N     1 
ATOM   5232  C  CA    . VAL C 2 218  ? 40.827  -46.095 46.300  1.00 217.47 ? 218  VAL C CA    1 
ATOM   5233  C  C     . VAL C 2 218  ? 40.432  -45.812 44.858  1.00 222.98 ? 218  VAL C C     1 
ATOM   5234  O  O     . VAL C 2 218  ? 41.274  -45.453 44.040  1.00 223.26 ? 218  VAL C O     1 
ATOM   5235  C  CB    . VAL C 2 218  ? 41.165  -47.586 46.437  1.00 216.40 ? 218  VAL C CB    1 
ATOM   5236  C  CG1   . VAL C 2 218  ? 42.503  -47.888 45.786  1.00 217.19 ? 218  VAL C CG1   1 
ATOM   5237  C  CG2   . VAL C 2 218  ? 41.184  -47.977 47.888  1.00 211.76 ? 218  VAL C CG2   1 
ATOM   5238  N  N     . GLN C 2 219  ? 39.141  -45.958 44.561  1.00 227.85 ? 219  GLN C N     1 
ATOM   5239  C  CA    . GLN C 2 219  ? 38.596  -45.659 43.235  1.00 230.38 ? 219  GLN C CA    1 
ATOM   5240  C  C     . GLN C 2 219  ? 38.819  -44.217 42.789  1.00 225.67 ? 219  GLN C C     1 
ATOM   5241  O  O     . GLN C 2 219  ? 38.971  -43.947 41.599  1.00 224.31 ? 219  GLN C O     1 
ATOM   5242  C  CB    . GLN C 2 219  ? 37.103  -45.994 43.166  1.00 230.76 ? 219  GLN C CB    1 
ATOM   5243  C  CG    . GLN C 2 219  ? 36.813  -47.427 42.749  1.00 234.38 ? 219  GLN C CG    1 
ATOM   5244  C  CD    . GLN C 2 219  ? 37.190  -48.442 43.815  1.00 234.95 ? 219  GLN C CD    1 
ATOM   5245  O  OE1   . GLN C 2 219  ? 37.244  -48.124 45.007  1.00 231.05 ? 219  GLN C OE1   1 
ATOM   5246  N  NE2   . GLN C 2 219  ? 37.450  -49.675 43.390  1.00 236.53 ? 219  GLN C NE2   1 
ATOM   5247  N  N     . GLY C 2 220  ? 38.828  -43.292 43.738  1.00 223.21 ? 220  GLY C N     1 
ATOM   5248  C  CA    . GLY C 2 220  ? 39.090  -41.908 43.406  1.00 221.48 ? 220  GLY C CA    1 
ATOM   5249  C  C     . GLY C 2 220  ? 40.531  -41.687 42.983  1.00 220.62 ? 220  GLY C C     1 
ATOM   5250  O  O     . GLY C 2 220  ? 40.831  -40.792 42.199  1.00 222.50 ? 220  GLY C O     1 
ATOM   5251  N  N     . LEU C 2 221  ? 41.429  -42.512 43.505  1.00 220.89 ? 221  LEU C N     1 
ATOM   5252  C  CA    . LEU C 2 221  ? 42.858  -42.327 43.282  1.00 218.55 ? 221  LEU C CA    1 
ATOM   5253  C  C     . LEU C 2 221  ? 43.289  -42.794 41.888  1.00 220.24 ? 221  LEU C C     1 
ATOM   5254  O  O     . LEU C 2 221  ? 43.989  -42.075 41.180  1.00 217.45 ? 221  LEU C O     1 
ATOM   5255  C  CB    . LEU C 2 221  ? 43.651  -43.044 44.385  1.00 217.54 ? 221  LEU C CB    1 
ATOM   5256  C  CG    . LEU C 2 221  ? 45.069  -42.591 44.743  1.00 208.30 ? 221  LEU C CG    1 
ATOM   5257  C  CD1   . LEU C 2 221  ? 45.393  -42.969 46.182  1.00 197.06 ? 221  LEU C CD1   1 
ATOM   5258  C  CD2   . LEU C 2 221  ? 46.085  -43.201 43.797  1.00 211.18 ? 221  LEU C CD2   1 
ATOM   5259  N  N     . MET C 2 222  ? 42.825  -43.973 41.479  1.00 222.82 ? 222  MET C N     1 
ATOM   5260  C  CA    . MET C 2 222  ? 43.294  -44.609 40.246  1.00 222.45 ? 222  MET C CA    1 
ATOM   5261  C  C     . MET C 2 222  ? 42.512  -44.127 39.019  1.00 228.11 ? 222  MET C C     1 
ATOM   5262  O  O     . MET C 2 222  ? 42.693  -44.656 37.923  1.00 230.36 ? 222  MET C O     1 
ATOM   5263  C  CB    . MET C 2 222  ? 43.234  -46.148 40.348  1.00 222.59 ? 222  MET C CB    1 
ATOM   5264  C  CG    . MET C 2 222  ? 44.050  -46.773 41.503  1.00 226.48 ? 222  MET C CG    1 
ATOM   5265  S  SD    . MET C 2 222  ? 44.247  -48.586 41.441  1.00 222.76 ? 222  MET C SD    1 
ATOM   5266  C  CE    . MET C 2 222  ? 44.888  -48.941 43.080  1.00 212.71 ? 222  MET C CE    1 
ATOM   5267  N  N     . ASP C 2 223  ? 41.648  -43.127 39.217  1.00 231.65 ? 223  ASP C N     1 
ATOM   5268  C  CA    . ASP C 2 223  ? 40.771  -42.582 38.166  1.00 235.68 ? 223  ASP C CA    1 
ATOM   5269  C  C     . ASP C 2 223  ? 41.518  -42.331 36.855  1.00 238.60 ? 223  ASP C C     1 
ATOM   5270  O  O     . ASP C 2 223  ? 41.003  -42.616 35.775  1.00 241.37 ? 223  ASP C O     1 
ATOM   5271  C  CB    . ASP C 2 223  ? 40.099  -41.279 38.649  1.00 236.81 ? 223  ASP C CB    1 
ATOM   5272  C  CG    . ASP C 2 223  ? 38.845  -40.908 37.845  1.00 234.86 ? 223  ASP C CG    1 
ATOM   5273  O  OD1   . ASP C 2 223  ? 38.661  -41.425 36.726  1.00 238.54 ? 223  ASP C OD1   1 
ATOM   5274  O  OD2   . ASP C 2 223  ? 38.038  -40.085 38.336  1.00 228.84 ? 223  ASP C OD2   1 
ATOM   5275  N  N     . GLU C 2 224  ? 42.739  -41.818 36.948  1.00 237.50 ? 224  GLU C N     1 
ATOM   5276  C  CA    . GLU C 2 224  ? 43.532  -41.597 35.751  1.00 239.17 ? 224  GLU C CA    1 
ATOM   5277  C  C     . GLU C 2 224  ? 44.412  -42.807 35.471  1.00 242.97 ? 224  GLU C C     1 
ATOM   5278  O  O     . GLU C 2 224  ? 45.385  -43.061 36.182  1.00 242.14 ? 224  GLU C O     1 
ATOM   5279  C  CB    . GLU C 2 224  ? 44.409  -40.359 35.921  1.00 237.69 ? 224  GLU C CB    1 
ATOM   5280  C  CG    . GLU C 2 224  ? 43.649  -39.049 36.013  1.00 237.95 ? 224  GLU C CG    1 
ATOM   5281  C  CD    . GLU C 2 224  ? 43.377  -38.433 34.656  1.00 239.08 ? 224  GLU C CD    1 
ATOM   5282  O  OE1   . GLU C 2 224  ? 42.937  -39.166 33.747  1.00 240.23 ? 224  GLU C OE1   1 
ATOM   5283  O  OE2   . GLU C 2 224  ? 43.613  -37.217 34.495  1.00 237.11 ? 224  GLU C OE2   1 
ATOM   5284  N  N     . SER C 2 225  ? 44.066  -43.547 34.422  1.00 244.24 ? 225  SER C N     1 
ATOM   5285  C  CA    . SER C 2 225  ? 44.901  -44.640 33.951  1.00 240.21 ? 225  SER C CA    1 
ATOM   5286  C  C     . SER C 2 225  ? 46.014  -44.014 33.136  1.00 240.84 ? 225  SER C C     1 
ATOM   5287  O  O     . SER C 2 225  ? 47.134  -44.524 33.091  1.00 239.35 ? 225  SER C O     1 
ATOM   5288  C  CB    . SER C 2 225  ? 44.096  -45.608 33.084  1.00 237.97 ? 225  SER C CB    1 
ATOM   5289  O  OG    . SER C 2 225  ? 42.976  -46.124 33.783  1.00 234.60 ? 225  SER C OG    1 
ATOM   5290  N  N     . VAL C 2 226  ? 45.689  -42.885 32.508  1.00 240.88 ? 226  VAL C N     1 
ATOM   5291  C  CA    . VAL C 2 226  ? 46.620  -42.145 31.663  1.00 239.35 ? 226  VAL C CA    1 
ATOM   5292  C  C     . VAL C 2 226  ? 47.821  -41.673 32.480  1.00 239.00 ? 226  VAL C C     1 
ATOM   5293  O  O     . VAL C 2 226  ? 48.897  -41.406 31.944  1.00 239.42 ? 226  VAL C O     1 
ATOM   5294  C  CB    . VAL C 2 226  ? 45.917  -40.949 30.988  1.00 232.17 ? 226  VAL C CB    1 
ATOM   5295  C  CG1   . VAL C 2 226  ? 45.467  -39.947 32.026  1.00 235.27 ? 226  VAL C CG1   1 
ATOM   5296  C  CG2   . VAL C 2 226  ? 46.823  -40.292 29.967  1.00 233.12 ? 226  VAL C CG2   1 
ATOM   5297  N  N     . PHE C 2 227  ? 47.638  -41.598 33.792  1.00 237.88 ? 227  PHE C N     1 
ATOM   5298  C  CA    . PHE C 2 227  ? 48.723  -41.224 34.681  1.00 238.21 ? 227  PHE C CA    1 
ATOM   5299  C  C     . PHE C 2 227  ? 49.538  -42.456 35.103  1.00 235.71 ? 227  PHE C C     1 
ATOM   5300  O  O     . PHE C 2 227  ? 50.628  -42.325 35.654  1.00 234.72 ? 227  PHE C O     1 
ATOM   5301  C  CB    . PHE C 2 227  ? 48.185  -40.456 35.900  1.00 241.17 ? 227  PHE C CB    1 
ATOM   5302  C  CG    . PHE C 2 227  ? 47.632  -39.076 35.574  1.00 246.36 ? 227  PHE C CG    1 
ATOM   5303  C  CD1   . PHE C 2 227  ? 47.721  -38.548 34.288  1.00 247.60 ? 227  PHE C CD1   1 
ATOM   5304  C  CD2   . PHE C 2 227  ? 47.038  -38.299 36.563  1.00 240.33 ? 227  PHE C CD2   1 
ATOM   5305  C  CE1   . PHE C 2 227  ? 47.215  -37.278 33.991  1.00 240.47 ? 227  PHE C CE1   1 
ATOM   5306  C  CE2   . PHE C 2 227  ? 46.530  -37.029 36.273  1.00 242.04 ? 227  PHE C CE2   1 
ATOM   5307  C  CZ    . PHE C 2 227  ? 46.622  -36.520 34.985  1.00 237.96 ? 227  PHE C CZ    1 
ATOM   5308  N  N     . ALA C 2 228  ? 49.032  -43.645 34.784  1.00 233.90 ? 228  ALA C N     1 
ATOM   5309  C  CA    . ALA C 2 228  ? 49.654  -44.907 35.196  1.00 228.87 ? 228  ALA C CA    1 
ATOM   5310  C  C     . ALA C 2 228  ? 50.717  -45.359 34.201  1.00 230.22 ? 228  ALA C C     1 
ATOM   5311  O  O     . ALA C 2 228  ? 51.163  -46.504 34.243  1.00 229.78 ? 228  ALA C O     1 
ATOM   5312  C  CB    . ALA C 2 228  ? 48.607  -45.998 35.396  1.00 221.93 ? 228  ALA C CB    1 
ATOM   5313  N  N     . MET C 2 229  ? 51.068  -44.470 33.271  1.00 232.62 ? 229  MET C N     1 
ATOM   5314  C  CA    . MET C 2 229  ? 51.922  -44.804 32.126  1.00 231.61 ? 229  MET C CA    1 
ATOM   5315  C  C     . MET C 2 229  ? 53.441  -44.988 32.318  1.00 230.18 ? 229  MET C C     1 
ATOM   5316  O  O     . MET C 2 229  ? 53.978  -45.982 31.835  1.00 233.80 ? 229  MET C O     1 
ATOM   5317  C  CB    . MET C 2 229  ? 51.632  -43.862 30.958  1.00 229.30 ? 229  MET C CB    1 
ATOM   5318  C  CG    . MET C 2 229  ? 50.253  -44.097 30.374  1.00 234.16 ? 229  MET C CG    1 
ATOM   5319  S  SD    . MET C 2 229  ? 49.932  -43.153 28.883  1.00 260.59 ? 229  MET C SD    1 
ATOM   5320  C  CE    . MET C 2 229  ? 48.271  -43.689 28.471  1.00 244.53 ? 229  MET C CE    1 
ATOM   5321  N  N     . ARG C 2 230  ? 54.127  -44.089 33.028  1.00 223.95 ? 230  ARG C N     1 
ATOM   5322  C  CA    . ARG C 2 230  ? 55.596  -44.188 33.142  1.00 220.21 ? 230  ARG C CA    1 
ATOM   5323  C  C     . ARG C 2 230  ? 56.226  -43.193 34.119  1.00 213.87 ? 230  ARG C C     1 
ATOM   5324  O  O     . ARG C 2 230  ? 55.779  -42.052 34.214  1.00 211.61 ? 230  ARG C O     1 
ATOM   5325  C  CB    . ARG C 2 230  ? 56.266  -44.028 31.765  1.00 220.13 ? 230  ARG C CB    1 
ATOM   5326  C  CG    . ARG C 2 230  ? 56.970  -45.293 31.265  1.00 221.50 ? 230  ARG C CG    1 
ATOM   5327  C  CD    . ARG C 2 230  ? 57.747  -45.068 29.970  1.00 221.26 ? 230  ARG C CD    1 
ATOM   5328  N  NE    . ARG C 2 230  ? 59.182  -44.913 30.201  1.00 217.00 ? 230  ARG C NE    1 
ATOM   5329  C  CZ    . ARG C 2 230  ? 60.105  -44.975 29.245  1.00 207.91 ? 230  ARG C CZ    1 
ATOM   5330  N  NH1   . ARG C 2 230  ? 59.749  -45.193 27.986  1.00 204.75 ? 230  ARG C NH1   1 
ATOM   5331  N  NH2   . ARG C 2 230  ? 61.385  -44.824 29.549  1.00 197.92 ? 230  ARG C NH2   1 
ATOM   5332  N  N     . PRO C 2 231  ? 57.276  -43.637 34.848  1.00 210.63 ? 231  PRO C N     1 
ATOM   5333  C  CA    . PRO C 2 231  ? 57.916  -42.856 35.915  1.00 203.66 ? 231  PRO C CA    1 
ATOM   5334  C  C     . PRO C 2 231  ? 58.636  -41.616 35.415  1.00 202.75 ? 231  PRO C C     1 
ATOM   5335  O  O     . PRO C 2 231  ? 58.601  -40.580 36.065  1.00 200.68 ? 231  PRO C O     1 
ATOM   5336  C  CB    . PRO C 2 231  ? 58.941  -43.836 36.496  1.00 198.81 ? 231  PRO C CB    1 
ATOM   5337  C  CG    . PRO C 2 231  ? 59.259  -44.749 35.376  1.00 201.88 ? 231  PRO C CG    1 
ATOM   5338  C  CD    . PRO C 2 231  ? 57.957  -44.931 34.651  1.00 210.71 ? 231  PRO C CD    1 
ATOM   5339  N  N     . GLU C 2 232  ? 59.301  -41.730 34.278  1.00 204.77 ? 232  GLU C N     1 
ATOM   5340  C  CA    . GLU C 2 232  ? 60.155  -40.657 33.804  1.00 204.64 ? 232  GLU C CA    1 
ATOM   5341  C  C     . GLU C 2 232  ? 59.462  -39.692 32.856  1.00 205.17 ? 232  GLU C C     1 
ATOM   5342  O  O     . GLU C 2 232  ? 60.027  -38.662 32.475  1.00 203.08 ? 232  GLU C O     1 
ATOM   5343  C  CB    . GLU C 2 232  ? 61.375  -41.262 33.153  1.00 206.23 ? 232  GLU C CB    1 
ATOM   5344  C  CG    . GLU C 2 232  ? 61.978  -42.348 33.994  1.00 204.71 ? 232  GLU C CG    1 
ATOM   5345  C  CD    . GLU C 2 232  ? 63.259  -42.850 33.403  1.00 208.41 ? 232  GLU C CD    1 
ATOM   5346  O  OE1   . GLU C 2 232  ? 63.336  -42.944 32.163  1.00 214.84 ? 232  GLU C OE1   1 
ATOM   5347  O  OE2   . GLU C 2 232  ? 64.197  -43.132 34.171  1.00 211.24 ? 232  GLU C OE2   1 
ATOM   5348  N  N     . GLU C 2 233  ? 58.261  -40.062 32.432  1.00 209.13 ? 233  GLU C N     1 
ATOM   5349  C  CA    . GLU C 2 233  ? 57.341  -39.116 31.814  1.00 209.78 ? 233  GLU C CA    1 
ATOM   5350  C  C     . GLU C 2 233  ? 56.561  -38.335 32.870  1.00 207.61 ? 233  GLU C C     1 
ATOM   5351  O  O     . GLU C 2 233  ? 56.359  -37.132 32.746  1.00 207.18 ? 233  GLU C O     1 
ATOM   5352  C  CB    . GLU C 2 233  ? 56.365  -39.831 30.884  1.00 214.72 ? 233  GLU C CB    1 
ATOM   5353  C  CG    . GLU C 2 233  ? 57.010  -40.505 29.700  1.00 215.91 ? 233  GLU C CG    1 
ATOM   5354  C  CD    . GLU C 2 233  ? 55.984  -41.113 28.775  1.00 219.14 ? 233  GLU C CD    1 
ATOM   5355  O  OE1   . GLU C 2 233  ? 54.783  -40.808 28.946  1.00 217.42 ? 233  GLU C OE1   1 
ATOM   5356  O  OE2   . GLU C 2 233  ? 56.375  -41.896 27.884  1.00 221.61 ? 233  GLU C OE2   1 
ATOM   5357  N  N     . ALA C 2 234  ? 56.113  -39.036 33.904  1.00 204.33 ? 234  ALA C N     1 
ATOM   5358  C  CA    . ALA C 2 234  ? 55.326  -38.414 34.954  1.00 196.75 ? 234  ALA C CA    1 
ATOM   5359  C  C     . ALA C 2 234  ? 56.183  -37.437 35.750  1.00 196.04 ? 234  ALA C C     1 
ATOM   5360  O  O     . ALA C 2 234  ? 55.681  -36.449 36.270  1.00 198.18 ? 234  ALA C O     1 
ATOM   5361  C  CB    . ALA C 2 234  ? 54.734  -39.466 35.859  1.00 200.40 ? 234  ALA C CB    1 
ATOM   5362  N  N     . LEU C 2 235  ? 57.480  -37.712 35.832  1.00 194.61 ? 235  LEU C N     1 
ATOM   5363  C  CA    . LEU C 2 235  ? 58.411  -36.827 36.526  1.00 192.92 ? 235  LEU C CA    1 
ATOM   5364  C  C     . LEU C 2 235  ? 58.521  -35.495 35.797  1.00 194.90 ? 235  LEU C C     1 
ATOM   5365  O  O     . LEU C 2 235  ? 58.523  -34.427 36.411  1.00 191.68 ? 235  LEU C O     1 
ATOM   5366  C  CB    . LEU C 2 235  ? 59.790  -37.477 36.617  1.00 190.62 ? 235  LEU C CB    1 
ATOM   5367  C  CG    . LEU C 2 235  ? 60.856  -36.671 37.355  1.00 186.00 ? 235  LEU C CG    1 
ATOM   5368  C  CD1   . LEU C 2 235  ? 60.416  -36.381 38.772  1.00 190.38 ? 235  LEU C CD1   1 
ATOM   5369  C  CD2   . LEU C 2 235  ? 62.162  -37.421 37.365  1.00 182.83 ? 235  LEU C CD2   1 
ATOM   5370  N  N     . ILE C 2 236  ? 58.623  -35.574 34.476  1.00 202.05 ? 236  ILE C N     1 
ATOM   5371  C  CA    . ILE C 2 236  ? 58.671  -34.391 33.620  1.00 206.68 ? 236  ILE C CA    1 
ATOM   5372  C  C     . ILE C 2 236  ? 57.330  -33.621 33.682  1.00 204.86 ? 236  ILE C C     1 
ATOM   5373  O  O     . ILE C 2 236  ? 57.307  -32.404 33.909  1.00 202.92 ? 236  ILE C O     1 
ATOM   5374  C  CB    . ILE C 2 236  ? 59.102  -34.770 32.146  1.00 208.42 ? 236  ILE C CB    1 
ATOM   5375  C  CG1   . ILE C 2 236  ? 60.615  -35.043 32.061  1.00 197.70 ? 236  ILE C CG1   1 
ATOM   5376  C  CG2   . ILE C 2 236  ? 58.701  -33.693 31.146  1.00 209.28 ? 236  ILE C CG2   1 
ATOM   5377  C  CD1   . ILE C 2 236  ? 61.110  -35.356 30.672  1.00 190.96 ? 236  ILE C CD1   1 
ATOM   5378  N  N     . ARG C 2 237  ? 56.225  -34.351 33.519  1.00 205.83 ? 237  ARG C N     1 
ATOM   5379  C  CA    . ARG C 2 237  ? 54.870  -33.784 33.544  1.00 205.78 ? 237  ARG C CA    1 
ATOM   5380  C  C     . ARG C 2 237  ? 54.596  -32.980 34.802  1.00 206.58 ? 237  ARG C C     1 
ATOM   5381  O  O     . ARG C 2 237  ? 53.972  -31.916 34.759  1.00 209.03 ? 237  ARG C O     1 
ATOM   5382  C  CB    . ARG C 2 237  ? 53.831  -34.905 33.444  1.00 205.62 ? 237  ARG C CB    1 
ATOM   5383  C  CG    . ARG C 2 237  ? 52.464  -34.574 34.051  1.00 202.82 ? 237  ARG C CG    1 
ATOM   5384  C  CD    . ARG C 2 237  ? 51.685  -33.565 33.219  1.00 199.15 ? 237  ARG C CD    1 
ATOM   5385  N  NE    . ARG C 2 237  ? 50.249  -33.731 33.402  1.00 196.50 ? 237  ARG C NE    1 
ATOM   5386  C  CZ    . ARG C 2 237  ? 49.328  -33.191 32.614  1.00 195.20 ? 237  ARG C CZ    1 
ATOM   5387  N  NH1   . ARG C 2 237  ? 48.044  -33.405 32.855  1.00 195.94 ? 237  ARG C NH1   1 
ATOM   5388  N  NH2   . ARG C 2 237  ? 49.691  -32.441 31.583  1.00 190.53 ? 237  ARG C NH2   1 
ATOM   5389  N  N     . LEU C 2 238  ? 55.059  -33.512 35.923  1.00 204.35 ? 238  LEU C N     1 
ATOM   5390  C  CA    . LEU C 2 238  ? 54.851  -32.889 37.211  1.00 200.91 ? 238  LEU C CA    1 
ATOM   5391  C  C     . LEU C 2 238  ? 55.719  -31.654 37.338  1.00 201.18 ? 238  LEU C C     1 
ATOM   5392  O  O     . LEU C 2 238  ? 55.264  -30.620 37.831  1.00 203.88 ? 238  LEU C O     1 
ATOM   5393  C  CB    . LEU C 2 238  ? 55.189  -33.884 38.312  1.00 198.22 ? 238  LEU C CB    1 
ATOM   5394  C  CG    . LEU C 2 238  ? 55.137  -33.388 39.749  1.00 194.00 ? 238  LEU C CG    1 
ATOM   5395  C  CD1   . LEU C 2 238  ? 53.835  -32.651 40.033  1.00 190.44 ? 238  LEU C CD1   1 
ATOM   5396  C  CD2   . LEU C 2 238  ? 55.292  -34.586 40.656  1.00 191.39 ? 238  LEU C CD2   1 
ATOM   5397  N  N     . PHE C 2 239  ? 56.967  -31.760 36.884  1.00 195.73 ? 239  PHE C N     1 
ATOM   5398  C  CA    . PHE C 2 239  ? 57.906  -30.660 37.041  1.00 192.63 ? 239  PHE C CA    1 
ATOM   5399  C  C     . PHE C 2 239  ? 57.357  -29.419 36.378  1.00 196.31 ? 239  PHE C C     1 
ATOM   5400  O  O     . PHE C 2 239  ? 57.601  -28.301 36.825  1.00 199.13 ? 239  PHE C O     1 
ATOM   5401  C  CB    . PHE C 2 239  ? 59.272  -30.983 36.447  1.00 186.50 ? 239  PHE C CB    1 
ATOM   5402  C  CG    . PHE C 2 239  ? 60.195  -29.809 36.431  1.00 185.62 ? 239  PHE C CG    1 
ATOM   5403  C  CD1   . PHE C 2 239  ? 60.182  -28.915 35.374  1.00 192.18 ? 239  PHE C CD1   1 
ATOM   5404  C  CD2   . PHE C 2 239  ? 61.053  -29.577 37.484  1.00 186.80 ? 239  PHE C CD2   1 
ATOM   5405  C  CE1   . PHE C 2 239  ? 61.004  -27.825 35.367  1.00 196.79 ? 239  PHE C CE1   1 
ATOM   5406  C  CE2   . PHE C 2 239  ? 61.885  -28.489 37.477  1.00 189.70 ? 239  PHE C CE2   1 
ATOM   5407  C  CZ    . PHE C 2 239  ? 61.863  -27.615 36.416  1.00 195.35 ? 239  PHE C CZ    1 
ATOM   5408  N  N     . THR C 2 240  ? 56.621  -29.624 35.298  1.00 197.86 ? 240  THR C N     1 
ATOM   5409  C  CA    . THR C 2 240  ? 56.050  -28.517 34.560  1.00 202.73 ? 240  THR C CA    1 
ATOM   5410  C  C     . THR C 2 240  ? 54.709  -28.058 35.161  1.00 204.05 ? 240  THR C C     1 
ATOM   5411  O  O     . THR C 2 240  ? 54.195  -26.999 34.811  1.00 206.23 ? 240  THR C O     1 
ATOM   5412  C  CB    . THR C 2 240  ? 55.947  -28.858 33.056  1.00 204.63 ? 240  THR C CB    1 
ATOM   5413  O  OG1   . THR C 2 240  ? 55.421  -30.182 32.900  1.00 205.27 ? 240  THR C OG1   1 
ATOM   5414  C  CG2   . THR C 2 240  ? 57.331  -28.801 32.407  1.00 196.39 ? 240  THR C CG2   1 
ATOM   5415  N  N     . LEU C 2 241  ? 54.152  -28.852 36.072  1.00 204.09 ? 241  LEU C N     1 
ATOM   5416  C  CA    . LEU C 2 241  ? 52.942  -28.464 36.799  1.00 201.44 ? 241  LEU C CA    1 
ATOM   5417  C  C     . LEU C 2 241  ? 53.264  -27.549 37.956  1.00 200.46 ? 241  LEU C C     1 
ATOM   5418  O  O     . LEU C 2 241  ? 52.400  -26.823 38.456  1.00 193.79 ? 241  LEU C O     1 
ATOM   5419  C  CB    . LEU C 2 241  ? 52.233  -29.694 37.328  1.00 197.92 ? 241  LEU C CB    1 
ATOM   5420  C  CG    . LEU C 2 241  ? 51.322  -30.273 36.265  1.00 202.78 ? 241  LEU C CG    1 
ATOM   5421  C  CD1   . LEU C 2 241  ? 50.752  -31.596 36.726  1.00 199.79 ? 241  LEU C CD1   1 
ATOM   5422  C  CD2   . LEU C 2 241  ? 50.230  -29.257 35.962  1.00 199.60 ? 241  LEU C CD2   1 
ATOM   5423  N  N     . LEU C 2 242  ? 54.509  -27.656 38.410  1.00 205.61 ? 242  LEU C N     1 
ATOM   5424  C  CA    . LEU C 2 242  ? 55.064  -26.828 39.478  1.00 210.51 ? 242  LEU C CA    1 
ATOM   5425  C  C     . LEU C 2 242  ? 55.610  -25.462 39.054  1.00 212.77 ? 242  LEU C C     1 
ATOM   5426  O  O     . LEU C 2 242  ? 55.436  -24.469 39.765  1.00 212.16 ? 242  LEU C O     1 
ATOM   5427  C  CB    . LEU C 2 242  ? 56.134  -27.606 40.243  1.00 207.71 ? 242  LEU C CB    1 
ATOM   5428  C  CG    . LEU C 2 242  ? 55.602  -28.181 41.551  1.00 202.48 ? 242  LEU C CG    1 
ATOM   5429  C  CD1   . LEU C 2 242  ? 55.223  -27.044 42.490  1.00 195.91 ? 242  LEU C CD1   1 
ATOM   5430  C  CD2   . LEU C 2 242  ? 54.410  -29.090 41.282  1.00 197.59 ? 242  LEU C CD2   1 
ATOM   5431  N  N     . ARG C 2 243  ? 56.313  -25.409 37.928  1.00 209.54 ? 243  ARG C N     1 
ATOM   5432  C  CA    . ARG C 2 243  ? 56.763  -24.113 37.446  1.00 207.60 ? 243  ARG C CA    1 
ATOM   5433  C  C     . ARG C 2 243  ? 56.552  -23.923 35.959  1.00 204.90 ? 243  ARG C C     1 
ATOM   5434  O  O     . ARG C 2 243  ? 56.870  -24.795 35.149  1.00 203.94 ? 243  ARG C O     1 
ATOM   5435  C  CB    . ARG C 2 243  ? 58.234  -23.894 37.788  1.00 204.18 ? 243  ARG C CB    1 
ATOM   5436  C  CG    . ARG C 2 243  ? 59.168  -24.916 37.183  1.00 204.17 ? 243  ARG C CG    1 
ATOM   5437  C  CD    . ARG C 2 243  ? 60.588  -24.642 37.600  1.00 202.46 ? 243  ARG C CD    1 
ATOM   5438  N  NE    . ARG C 2 243  ? 60.652  -24.230 38.994  1.00 195.95 ? 243  ARG C NE    1 
ATOM   5439  C  CZ    . ARG C 2 243  ? 60.952  -23.000 39.385  1.00 194.28 ? 243  ARG C CZ    1 
ATOM   5440  N  NH1   . ARG C 2 243  ? 60.981  -22.706 40.676  1.00 197.80 ? 243  ARG C NH1   1 
ATOM   5441  N  NH2   . ARG C 2 243  ? 61.224  -22.065 38.483  1.00 188.20 ? 243  ARG C NH2   1 
ATOM   5442  N  N     . PRO C 2 244  ? 56.056  -22.742 35.597  1.00 203.65 ? 244  PRO C N     1 
ATOM   5443  C  CA    . PRO C 2 244  ? 55.820  -22.416 34.199  1.00 209.09 ? 244  PRO C CA    1 
ATOM   5444  C  C     . PRO C 2 244  ? 57.136  -22.094 33.523  1.00 216.32 ? 244  PRO C C     1 
ATOM   5445  O  O     . PRO C 2 244  ? 58.123  -21.800 34.207  1.00 208.57 ? 244  PRO C O     1 
ATOM   5446  C  CB    . PRO C 2 244  ? 54.951  -21.155 34.276  1.00 208.48 ? 244  PRO C CB    1 
ATOM   5447  C  CG    . PRO C 2 244  ? 54.412  -21.127 35.660  1.00 206.59 ? 244  PRO C CG    1 
ATOM   5448  C  CD    . PRO C 2 244  ? 55.483  -21.731 36.497  1.00 205.22 ? 244  PRO C CD    1 
ATOM   5449  N  N     . GLY C 2 245  ? 57.151  -22.214 32.197  1.00 223.42 ? 245  GLY C N     1 
ATOM   5450  C  CA    . GLY C 2 245  ? 58.179  -21.623 31.356  1.00 215.96 ? 245  GLY C CA    1 
ATOM   5451  C  C     . GLY C 2 245  ? 59.545  -22.263 31.441  1.00 210.91 ? 245  GLY C C     1 
ATOM   5452  O  O     . GLY C 2 245  ? 60.426  -21.963 30.629  1.00 200.62 ? 245  GLY C O     1 
ATOM   5453  N  N     . ASP C 2 246  ? 59.708  -23.157 32.412  1.00 215.38 ? 246  ASP C N     1 
ATOM   5454  C  CA    . ASP C 2 246  ? 60.977  -23.830 32.639  1.00 216.40 ? 246  ASP C CA    1 
ATOM   5455  C  C     . ASP C 2 246  ? 60.946  -25.172 31.930  1.00 217.61 ? 246  ASP C C     1 
ATOM   5456  O  O     . ASP C 2 246  ? 60.173  -26.064 32.313  1.00 210.97 ? 246  ASP C O     1 
ATOM   5457  C  CB    . ASP C 2 246  ? 61.231  -24.029 34.133  1.00 207.95 ? 246  ASP C CB    1 
ATOM   5458  C  CG    . ASP C 2 246  ? 62.708  -24.191 34.458  1.00 202.50 ? 246  ASP C CG    1 
ATOM   5459  O  OD1   . ASP C 2 246  ? 63.529  -24.321 33.521  1.00 201.86 ? 246  ASP C OD1   1 
ATOM   5460  O  OD2   . ASP C 2 246  ? 63.047  -24.175 35.658  1.00 196.79 ? 246  ASP C OD2   1 
ATOM   5461  N  N     . PRO C 2 247  ? 61.775  -25.308 30.876  1.00 219.98 ? 247  PRO C N     1 
ATOM   5462  C  CA    . PRO C 2 247  ? 61.874  -26.517 30.053  1.00 215.45 ? 247  PRO C CA    1 
ATOM   5463  C  C     . PRO C 2 247  ? 62.286  -27.687 30.916  1.00 210.33 ? 247  PRO C C     1 
ATOM   5464  O  O     . PRO C 2 247  ? 63.247  -27.558 31.678  1.00 207.89 ? 247  PRO C O     1 
ATOM   5465  C  CB    . PRO C 2 247  ? 62.997  -26.181 29.063  1.00 211.28 ? 247  PRO C CB    1 
ATOM   5466  C  CG    . PRO C 2 247  ? 63.015  -24.692 29.002  1.00 206.00 ? 247  PRO C CG    1 
ATOM   5467  C  CD    . PRO C 2 247  ? 62.695  -24.258 30.403  1.00 207.97 ? 247  PRO C CD    1 
ATOM   5468  N  N     . PRO C 2 248  ? 61.573  -28.815 30.796  1.00 205.09 ? 248  PRO C N     1 
ATOM   5469  C  CA    . PRO C 2 248  ? 61.799  -29.958 31.679  1.00 206.15 ? 248  PRO C CA    1 
ATOM   5470  C  C     . PRO C 2 248  ? 63.272  -30.358 31.761  1.00 208.35 ? 248  PRO C C     1 
ATOM   5471  O  O     . PRO C 2 248  ? 63.802  -30.519 32.855  1.00 209.19 ? 248  PRO C O     1 
ATOM   5472  C  CB    . PRO C 2 248  ? 60.990  -31.060 31.000  1.00 204.73 ? 248  PRO C CB    1 
ATOM   5473  C  CG    . PRO C 2 248  ? 59.847  -30.331 30.372  1.00 199.30 ? 248  PRO C CG    1 
ATOM   5474  C  CD    . PRO C 2 248  ? 60.416  -29.022 29.906  1.00 203.26 ? 248  PRO C CD    1 
ATOM   5475  N  N     . LYS C 2 249  ? 63.923  -30.501 30.613  1.00 216.53 ? 249  LYS C N     1 
ATOM   5476  C  CA    . LYS C 2 249  ? 65.363  -30.812 30.508  1.00 226.53 ? 249  LYS C CA    1 
ATOM   5477  C  C     . LYS C 2 249  ? 65.747  -32.182 31.111  1.00 231.15 ? 249  LYS C C     1 
ATOM   5478  O  O     . LYS C 2 249  ? 66.852  -32.684 30.864  1.00 235.17 ? 249  LYS C O     1 
ATOM   5479  C  CB    . LYS C 2 249  ? 66.256  -29.666 31.057  1.00 220.19 ? 249  LYS C CB    1 
ATOM   5480  C  CG    . LYS C 2 249  ? 67.766  -29.728 30.671  1.00 216.86 ? 249  LYS C CG    1 
ATOM   5481  C  CD    . LYS C 2 249  ? 68.016  -29.553 29.166  1.00 212.00 ? 249  LYS C CD    1 
ATOM   5482  C  CE    . LYS C 2 249  ? 69.487  -29.745 28.797  1.00 205.84 ? 249  LYS C CE    1 
ATOM   5483  N  NZ    . LYS C 2 249  ? 69.993  -31.123 29.060  1.00 203.79 ? 249  LYS C NZ    1 
ATOM   5484  N  N     . ARG C 2 250  ? 64.837  -32.774 31.893  1.00 224.34 ? 250  ARG C N     1 
ATOM   5485  C  CA    . ARG C 2 250  ? 65.005  -34.108 32.496  1.00 224.56 ? 250  ARG C CA    1 
ATOM   5486  C  C     . ARG C 2 250  ? 66.161  -34.161 33.527  1.00 225.89 ? 250  ARG C C     1 
ATOM   5487  O  O     . ARG C 2 250  ? 66.214  -35.055 34.378  1.00 222.64 ? 250  ARG C O     1 
ATOM   5488  C  CB    . ARG C 2 250  ? 65.115  -35.187 31.392  1.00 228.43 ? 250  ARG C CB    1 
ATOM   5489  C  CG    . ARG C 2 250  ? 65.829  -36.497 31.745  1.00 226.54 ? 250  ARG C CG    1 
ATOM   5490  C  CD    . ARG C 2 250  ? 65.025  -37.384 32.693  1.00 222.10 ? 250  ARG C CD    1 
ATOM   5491  N  NE    . ARG C 2 250  ? 65.716  -38.635 33.014  1.00 218.08 ? 250  ARG C NE    1 
ATOM   5492  C  CZ    . ARG C 2 250  ? 66.769  -38.736 33.824  1.00 210.95 ? 250  ARG C CZ    1 
ATOM   5493  N  NH1   . ARG C 2 250  ? 67.283  -37.656 34.397  1.00 209.45 ? 250  ARG C NH1   1 
ATOM   5494  N  NH2   . ARG C 2 250  ? 67.318  -39.920 34.056  1.00 206.30 ? 250  ARG C NH2   1 
ATOM   5495  N  N     . ASP C 2 251  ? 67.058  -33.174 33.470  1.00 229.65 ? 251  ASP C N     1 
ATOM   5496  C  CA    . ASP C 2 251  ? 68.040  -32.929 34.526  1.00 224.28 ? 251  ASP C CA    1 
ATOM   5497  C  C     . ASP C 2 251  ? 67.400  -32.066 35.619  1.00 215.88 ? 251  ASP C C     1 
ATOM   5498  O  O     . ASP C 2 251  ? 67.550  -32.328 36.817  1.00 206.27 ? 251  ASP C O     1 
ATOM   5499  C  CB    . ASP C 2 251  ? 69.291  -32.223 33.967  1.00 225.22 ? 251  ASP C CB    1 
ATOM   5500  C  CG    . ASP C 2 251  ? 69.912  -32.949 32.774  1.00 226.17 ? 251  ASP C CG    1 
ATOM   5501  O  OD1   . ASP C 2 251  ? 69.466  -34.069 32.450  1.00 227.87 ? 251  ASP C OD1   1 
ATOM   5502  O  OD2   . ASP C 2 251  ? 70.864  -32.400 32.171  1.00 225.01 ? 251  ASP C OD2   1 
ATOM   5503  N  N     . LYS C 2 252  ? 66.675  -31.038 35.169  1.00 216.17 ? 252  LYS C N     1 
ATOM   5504  C  CA    . LYS C 2 252  ? 66.057  -30.033 36.034  1.00 206.24 ? 252  LYS C CA    1 
ATOM   5505  C  C     . LYS C 2 252  ? 64.848  -30.605 36.788  1.00 200.65 ? 252  LYS C C     1 
ATOM   5506  O  O     . LYS C 2 252  ? 64.429  -30.065 37.812  1.00 196.83 ? 252  LYS C O     1 
ATOM   5507  C  CB    . LYS C 2 252  ? 65.633  -28.797 35.211  1.00 203.83 ? 252  LYS C CB    1 
ATOM   5508  C  CG    . LYS C 2 252  ? 66.752  -28.077 34.420  1.00 197.32 ? 252  LYS C CG    1 
ATOM   5509  C  CD    . LYS C 2 252  ? 66.236  -26.778 33.766  1.00 191.05 ? 252  LYS C CD    1 
ATOM   5510  C  CE    . LYS C 2 252  ? 67.366  -25.798 33.438  1.00 178.49 ? 252  LYS C CE    1 
ATOM   5511  N  NZ    . LYS C 2 252  ? 66.876  -24.432 33.072  1.00 163.95 ? 252  LYS C NZ    1 
ATOM   5512  N  N     . ALA C 2 253  ? 64.287  -31.692 36.265  1.00 203.61 ? 253  ALA C N     1 
ATOM   5513  C  CA    . ALA C 2 253  ? 63.153  -32.354 36.899  1.00 196.83 ? 253  ALA C CA    1 
ATOM   5514  C  C     . ALA C 2 253  ? 63.591  -33.070 38.157  1.00 192.94 ? 253  ALA C C     1 
ATOM   5515  O  O     . ALA C 2 253  ? 63.018  -32.857 39.219  1.00 194.17 ? 253  ALA C O     1 
ATOM   5516  C  CB    . ALA C 2 253  ? 62.498  -33.331 35.945  1.00 202.76 ? 253  ALA C CB    1 
ATOM   5517  N  N     . VAL C 2 254  ? 64.614  -33.912 38.029  1.00 194.30 ? 254  VAL C N     1 
ATOM   5518  C  CA    . VAL C 2 254  ? 65.130  -34.690 39.153  1.00 194.11 ? 254  VAL C CA    1 
ATOM   5519  C  C     . VAL C 2 254  ? 65.763  -33.824 40.245  1.00 196.07 ? 254  VAL C C     1 
ATOM   5520  O  O     . VAL C 2 254  ? 65.572  -34.070 41.437  1.00 192.46 ? 254  VAL C O     1 
ATOM   5521  C  CB    . VAL C 2 254  ? 66.167  -35.719 38.684  1.00 190.39 ? 254  VAL C CB    1 
ATOM   5522  C  CG1   . VAL C 2 254  ? 66.671  -36.535 39.861  1.00 188.21 ? 254  VAL C CG1   1 
ATOM   5523  C  CG2   . VAL C 2 254  ? 65.565  -36.617 37.630  1.00 191.75 ? 254  VAL C CG2   1 
ATOM   5524  N  N     . ALA C 2 255  ? 66.516  -32.809 39.837  1.00 198.21 ? 255  ALA C N     1 
ATOM   5525  C  CA    . ALA C 2 255  ? 67.176  -31.926 40.793  1.00 188.87 ? 255  ALA C CA    1 
ATOM   5526  C  C     . ALA C 2 255  ? 66.198  -31.046 41.583  1.00 184.79 ? 255  ALA C C     1 
ATOM   5527  O  O     . ALA C 2 255  ? 66.479  -30.681 42.723  1.00 179.87 ? 255  ALA C O     1 
ATOM   5528  C  CB    . ALA C 2 255  ? 68.224  -31.077 40.098  1.00 187.39 ? 255  ALA C CB    1 
ATOM   5529  N  N     . TYR C 2 256  ? 65.064  -30.695 40.979  1.00 188.84 ? 256  TYR C N     1 
ATOM   5530  C  CA    . TYR C 2 256  ? 64.040  -29.913 41.674  1.00 188.30 ? 256  TYR C CA    1 
ATOM   5531  C  C     . TYR C 2 256  ? 63.157  -30.777 42.560  1.00 184.59 ? 256  TYR C C     1 
ATOM   5532  O  O     . TYR C 2 256  ? 62.621  -30.307 43.566  1.00 184.89 ? 256  TYR C O     1 
ATOM   5533  C  CB    . TYR C 2 256  ? 63.153  -29.134 40.700  1.00 192.33 ? 256  TYR C CB    1 
ATOM   5534  C  CG    . TYR C 2 256  ? 62.107  -28.295 41.409  1.00 194.21 ? 256  TYR C CG    1 
ATOM   5535  C  CD1   . TYR C 2 256  ? 62.404  -27.012 41.858  1.00 197.28 ? 256  TYR C CD1   1 
ATOM   5536  C  CD2   . TYR C 2 256  ? 60.830  -28.793 41.648  1.00 188.45 ? 256  TYR C CD2   1 
ATOM   5537  C  CE1   . TYR C 2 256  ? 61.459  -26.250 42.512  1.00 198.51 ? 256  TYR C CE1   1 
ATOM   5538  C  CE2   . TYR C 2 256  ? 59.882  -28.041 42.304  1.00 190.88 ? 256  TYR C CE2   1 
ATOM   5539  C  CZ    . TYR C 2 256  ? 60.199  -26.770 42.733  1.00 199.72 ? 256  TYR C CZ    1 
ATOM   5540  O  OH    . TYR C 2 256  ? 59.252  -26.014 43.387  1.00 204.73 ? 256  TYR C OH    1 
ATOM   5541  N  N     . VAL C 2 257  ? 62.978  -32.029 42.156  1.00 183.25 ? 257  VAL C N     1 
ATOM   5542  C  CA    . VAL C 2 257  ? 62.159  -32.971 42.905  1.00 181.57 ? 257  VAL C CA    1 
ATOM   5543  C  C     . VAL C 2 257  ? 62.899  -33.537 44.117  1.00 182.68 ? 257  VAL C C     1 
ATOM   5544  O  O     . VAL C 2 257  ? 62.364  -33.553 45.225  1.00 181.21 ? 257  VAL C O     1 
ATOM   5545  C  CB    . VAL C 2 257  ? 61.654  -34.105 42.000  1.00 177.98 ? 257  VAL C CB    1 
ATOM   5546  C  CG1   . VAL C 2 257  ? 61.217  -35.277 42.818  1.00 171.70 ? 257  VAL C CG1   1 
ATOM   5547  C  CG2   . VAL C 2 257  ? 60.511  -33.614 41.143  1.00 179.29 ? 257  VAL C CG2   1 
ATOM   5548  N  N     . TYR C 2 258  ? 64.134  -33.981 43.904  1.00 184.42 ? 258  TYR C N     1 
ATOM   5549  C  CA    . TYR C 2 258  ? 64.989  -34.455 44.993  1.00 184.08 ? 258  TYR C CA    1 
ATOM   5550  C  C     . TYR C 2 258  ? 65.220  -33.340 46.030  1.00 185.68 ? 258  TYR C C     1 
ATOM   5551  O  O     . TYR C 2 258  ? 65.101  -33.569 47.235  1.00 183.66 ? 258  TYR C O     1 
ATOM   5552  C  CB    . TYR C 2 258  ? 66.315  -34.989 44.424  1.00 185.22 ? 258  TYR C CB    1 
ATOM   5553  C  CG    . TYR C 2 258  ? 67.371  -35.448 45.425  1.00 184.98 ? 258  TYR C CG    1 
ATOM   5554  C  CD1   . TYR C 2 258  ? 68.375  -34.584 45.857  1.00 183.45 ? 258  TYR C CD1   1 
ATOM   5555  C  CD2   . TYR C 2 258  ? 67.400  -36.754 45.890  1.00 184.88 ? 258  TYR C CD2   1 
ATOM   5556  C  CE1   . TYR C 2 258  ? 69.353  -35.003 46.751  1.00 179.98 ? 258  TYR C CE1   1 
ATOM   5557  C  CE2   . TYR C 2 258  ? 68.370  -37.174 46.792  1.00 183.67 ? 258  TYR C CE2   1 
ATOM   5558  C  CZ    . TYR C 2 258  ? 69.345  -36.300 47.212  1.00 178.62 ? 258  TYR C CZ    1 
ATOM   5559  O  OH    . TYR C 2 258  ? 70.307  -36.723 48.100  1.00 168.80 ? 258  TYR C OH    1 
ATOM   5560  N  N     . GLY C 2 259  ? 65.515  -32.131 45.555  1.00 187.87 ? 259  GLY C N     1 
ATOM   5561  C  CA    . GLY C 2 259  ? 65.785  -31.000 46.431  1.00 186.23 ? 259  GLY C CA    1 
ATOM   5562  C  C     . GLY C 2 259  ? 64.556  -30.498 47.163  1.00 183.46 ? 259  GLY C C     1 
ATOM   5563  O  O     . GLY C 2 259  ? 64.651  -29.739 48.127  1.00 184.23 ? 259  GLY C O     1 
ATOM   5564  N  N     . LEU C 2 260  ? 63.392  -30.895 46.670  1.00 178.56 ? 260  LEU C N     1 
ATOM   5565  C  CA    . LEU C 2 260  ? 62.148  -30.657 47.375  1.00 177.56 ? 260  LEU C CA    1 
ATOM   5566  C  C     . LEU C 2 260  ? 61.854  -31.720 48.445  1.00 175.68 ? 260  LEU C C     1 
ATOM   5567  O  O     . LEU C 2 260  ? 61.344  -31.394 49.517  1.00 174.43 ? 260  LEU C O     1 
ATOM   5568  C  CB    . LEU C 2 260  ? 60.990  -30.536 46.385  1.00 176.90 ? 260  LEU C CB    1 
ATOM   5569  C  CG    . LEU C 2 260  ? 59.786  -29.731 46.869  1.00 181.57 ? 260  LEU C CG    1 
ATOM   5570  C  CD1   . LEU C 2 260  ? 60.238  -28.459 47.570  1.00 191.00 ? 260  LEU C CD1   1 
ATOM   5571  C  CD2   . LEU C 2 260  ? 58.863  -29.387 45.712  1.00 183.10 ? 260  LEU C CD2   1 
ATOM   5572  N  N     . ILE C 2 261  ? 62.164  -32.983 48.146  1.00 174.68 ? 261  ILE C N     1 
ATOM   5573  C  CA    . ILE C 2 261  ? 61.797  -34.120 49.013  1.00 169.49 ? 261  ILE C CA    1 
ATOM   5574  C  C     . ILE C 2 261  ? 62.967  -34.903 49.601  1.00 174.73 ? 261  ILE C C     1 
ATOM   5575  O  O     . ILE C 2 261  ? 63.064  -35.069 50.818  1.00 178.83 ? 261  ILE C O     1 
ATOM   5576  C  CB    . ILE C 2 261  ? 60.845  -35.126 48.333  1.00 156.62 ? 261  ILE C CB    1 
ATOM   5577  C  CG1   . ILE C 2 261  ? 59.419  -34.606 48.358  1.00 153.79 ? 261  ILE C CG1   1 
ATOM   5578  C  CG2   . ILE C 2 261  ? 60.817  -36.431 49.096  1.00 156.58 ? 261  ILE C CG2   1 
ATOM   5579  C  CD1   . ILE C 2 261  ? 59.189  -33.399 47.496  1.00 160.41 ? 261  ILE C CD1   1 
ATOM   5580  N  N     . ALA C 2 262  ? 63.808  -35.446 48.728  1.00 175.28 ? 262  ALA C N     1 
ATOM   5581  C  CA    . ALA C 2 262  ? 64.795  -36.435 49.144  1.00 176.52 ? 262  ALA C CA    1 
ATOM   5582  C  C     . ALA C 2 262  ? 66.145  -35.916 49.677  1.00 175.68 ? 262  ALA C C     1 
ATOM   5583  O  O     . ALA C 2 262  ? 66.932  -36.692 50.218  1.00 175.95 ? 262  ALA C O     1 
ATOM   5584  C  CB    . ALA C 2 262  ? 64.993  -37.488 48.060  1.00 184.03 ? 262  ALA C CB    1 
ATOM   5585  N  N     . ASP C 2 263  ? 66.403  -34.617 49.559  1.00 173.97 ? 263  ASP C N     1 
ATOM   5586  C  CA    . ASP C 2 263  ? 67.669  -34.056 50.030  1.00 173.37 ? 263  ASP C CA    1 
ATOM   5587  C  C     . ASP C 2 263  ? 67.610  -33.813 51.531  1.00 172.15 ? 263  ASP C C     1 
ATOM   5588  O  O     . ASP C 2 263  ? 66.914  -32.906 51.977  1.00 174.58 ? 263  ASP C O     1 
ATOM   5589  C  CB    . ASP C 2 263  ? 67.956  -32.731 49.308  1.00 177.52 ? 263  ASP C CB    1 
ATOM   5590  C  CG    . ASP C 2 263  ? 69.408  -32.287 49.434  1.00 176.37 ? 263  ASP C CG    1 
ATOM   5591  O  OD1   . ASP C 2 263  ? 70.145  -32.902 50.228  1.00 177.22 ? 263  ASP C OD1   1 
ATOM   5592  O  OD2   . ASP C 2 263  ? 69.814  -31.326 48.740  1.00 170.39 ? 263  ASP C OD2   1 
ATOM   5593  N  N     . PRO C 2 264  ? 68.365  -34.598 52.323  1.00 172.42 ? 264  PRO C N     1 
ATOM   5594  C  CA    . PRO C 2 264  ? 68.363  -34.385 53.775  1.00 170.92 ? 264  PRO C CA    1 
ATOM   5595  C  C     . PRO C 2 264  ? 68.946  -33.021 54.116  1.00 170.11 ? 264  PRO C C     1 
ATOM   5596  O  O     . PRO C 2 264  ? 68.793  -32.554 55.243  1.00 167.12 ? 264  PRO C O     1 
ATOM   5597  C  CB    . PRO C 2 264  ? 69.249  -35.514 54.305  1.00 167.35 ? 264  PRO C CB    1 
ATOM   5598  C  CG    . PRO C 2 264  ? 70.104  -35.887 53.165  1.00 170.21 ? 264  PRO C CG    1 
ATOM   5599  C  CD    . PRO C 2 264  ? 69.275  -35.685 51.935  1.00 172.28 ? 264  PRO C CD    1 
ATOM   5600  N  N     . ARG C 2 265  ? 69.615  -32.403 53.143  1.00 171.69 ? 265  ARG C N     1 
ATOM   5601  C  CA    . ARG C 2 265  ? 70.072  -31.022 53.258  1.00 172.92 ? 265  ARG C CA    1 
ATOM   5602  C  C     . ARG C 2 265  ? 68.912  -30.014 53.206  1.00 176.96 ? 265  ARG C C     1 
ATOM   5603  O  O     . ARG C 2 265  ? 68.728  -29.240 54.139  1.00 180.40 ? 265  ARG C O     1 
ATOM   5604  C  CB    . ARG C 2 265  ? 71.112  -30.702 52.171  1.00 172.47 ? 265  ARG C CB    1 
ATOM   5605  C  CG    . ARG C 2 265  ? 72.340  -31.629 52.176  1.00 175.47 ? 265  ARG C CG    1 
ATOM   5606  C  CD    . ARG C 2 265  ? 73.169  -31.542 50.877  1.00 173.36 ? 265  ARG C CD    1 
ATOM   5607  N  NE    . ARG C 2 265  ? 74.466  -30.873 51.049  1.00 171.49 ? 265  ARG C NE    1 
ATOM   5608  C  CZ    . ARG C 2 265  ? 75.623  -31.490 51.303  1.00 162.51 ? 265  ARG C CZ    1 
ATOM   5609  N  NH1   . ARG C 2 265  ? 75.676  -32.810 51.426  1.00 152.44 ? 265  ARG C NH1   1 
ATOM   5610  N  NH2   . ARG C 2 265  ? 76.737  -30.780 51.438  1.00 157.22 ? 265  ARG C NH2   1 
ATOM   5611  N  N     . ARG C 2 266  ? 68.110  -30.038 52.143  1.00 176.74 ? 266  ARG C N     1 
ATOM   5612  C  CA    . ARG C 2 266  ? 67.033  -29.049 51.991  1.00 174.69 ? 266  ARG C CA    1 
ATOM   5613  C  C     . ARG C 2 266  ? 65.784  -29.364 52.795  1.00 170.23 ? 266  ARG C C     1 
ATOM   5614  O  O     . ARG C 2 266  ? 65.135  -28.464 53.322  1.00 167.81 ? 266  ARG C O     1 
ATOM   5615  C  CB    . ARG C 2 266  ? 66.645  -28.870 50.526  1.00 179.98 ? 266  ARG C CB    1 
ATOM   5616  C  CG    . ARG C 2 266  ? 67.688  -28.156 49.703  1.00 190.34 ? 266  ARG C CG    1 
ATOM   5617  C  CD    . ARG C 2 266  ? 67.176  -27.878 48.310  1.00 197.82 ? 266  ARG C CD    1 
ATOM   5618  N  NE    . ARG C 2 266  ? 68.221  -27.330 47.454  1.00 207.13 ? 266  ARG C NE    1 
ATOM   5619  C  CZ    . ARG C 2 266  ? 68.077  -27.107 46.152  1.00 213.91 ? 266  ARG C CZ    1 
ATOM   5620  N  NH1   . ARG C 2 266  ? 69.085  -26.607 45.448  1.00 219.44 ? 266  ARG C NH1   1 
ATOM   5621  N  NH2   . ARG C 2 266  ? 66.926  -27.385 45.555  1.00 211.30 ? 266  ARG C NH2   1 
ATOM   5622  N  N     . TYR C 2 267  ? 65.432  -30.644 52.846  1.00 170.92 ? 267  TYR C N     1 
ATOM   5623  C  CA    . TYR C 2 267  ? 64.244  -31.094 53.556  1.00 166.47 ? 267  TYR C CA    1 
ATOM   5624  C  C     . TYR C 2 267  ? 64.575  -32.018 54.706  1.00 160.21 ? 267  TYR C C     1 
ATOM   5625  O  O     . TYR C 2 267  ? 64.918  -33.181 54.511  1.00 157.71 ? 267  TYR C O     1 
ATOM   5626  C  CB    . TYR C 2 267  ? 63.308  -31.828 52.611  1.00 166.95 ? 267  TYR C CB    1 
ATOM   5627  C  CG    . TYR C 2 267  ? 62.070  -32.326 53.305  1.00 158.75 ? 267  TYR C CG    1 
ATOM   5628  C  CD1   . TYR C 2 267  ? 60.944  -31.535 53.376  1.00 155.72 ? 267  TYR C CD1   1 
ATOM   5629  C  CD2   . TYR C 2 267  ? 62.031  -33.579 53.893  1.00 156.12 ? 267  TYR C CD2   1 
ATOM   5630  C  CE1   . TYR C 2 267  ? 59.817  -31.962 54.008  1.00 153.82 ? 267  TYR C CE1   1 
ATOM   5631  C  CE2   . TYR C 2 267  ? 60.914  -34.016 54.535  1.00 157.20 ? 267  TYR C CE2   1 
ATOM   5632  C  CZ    . TYR C 2 267  ? 59.799  -33.204 54.586  1.00 151.85 ? 267  TYR C CZ    1 
ATOM   5633  O  OH    . TYR C 2 267  ? 58.656  -33.626 55.217  1.00 149.09 ? 267  TYR C OH    1 
ATOM   5634  N  N     . ASP C 2 268  ? 64.395  -31.525 55.915  1.00 161.64 ? 268  ASP C N     1 
ATOM   5635  C  CA    . ASP C 2 268  ? 64.766  -32.312 57.066  1.00 165.78 ? 268  ASP C CA    1 
ATOM   5636  C  C     . ASP C 2 268  ? 63.631  -32.318 58.073  1.00 162.22 ? 268  ASP C C     1 
ATOM   5637  O  O     . ASP C 2 268  ? 63.257  -31.272 58.602  1.00 163.42 ? 268  ASP C O     1 
ATOM   5638  C  CB    . ASP C 2 268  ? 66.033  -31.732 57.692  1.00 171.49 ? 268  ASP C CB    1 
ATOM   5639  C  CG    . ASP C 2 268  ? 66.717  -32.702 58.625  1.00 169.50 ? 268  ASP C CG    1 
ATOM   5640  O  OD1   . ASP C 2 268  ? 66.742  -33.910 58.308  1.00 172.96 ? 268  ASP C OD1   1 
ATOM   5641  O  OD2   . ASP C 2 268  ? 67.232  -32.255 59.670  1.00 162.31 ? 268  ASP C OD2   1 
ATOM   5642  N  N     . LEU C 2 269  ? 63.079  -33.501 58.323  1.00 160.03 ? 269  LEU C N     1 
ATOM   5643  C  CA    . LEU C 2 269  ? 62.056  -33.675 59.344  1.00 157.25 ? 269  LEU C CA    1 
ATOM   5644  C  C     . LEU C 2 269  ? 62.714  -33.419 60.679  1.00 160.48 ? 269  LEU C C     1 
ATOM   5645  O  O     . LEU C 2 269  ? 63.937  -33.512 60.791  1.00 166.89 ? 269  LEU C O     1 
ATOM   5646  C  CB    . LEU C 2 269  ? 61.546  -35.111 59.325  1.00 153.48 ? 269  LEU C CB    1 
ATOM   5647  C  CG    . LEU C 2 269  ? 60.047  -35.351 59.262  1.00 139.93 ? 269  LEU C CG    1 
ATOM   5648  C  CD1   . LEU C 2 269  ? 59.445  -34.484 58.192  1.00 139.20 ? 269  LEU C CD1   1 
ATOM   5649  C  CD2   . LEU C 2 269  ? 59.816  -36.796 58.944  1.00 135.07 ? 269  LEU C CD2   1 
ATOM   5650  N  N     . GLY C 2 270  ? 61.923  -33.088 61.692  1.00 156.71 ? 270  GLY C N     1 
ATOM   5651  C  CA    . GLY C 2 270  ? 62.455  -33.051 63.039  1.00 157.94 ? 270  GLY C CA    1 
ATOM   5652  C  C     . GLY C 2 270  ? 63.010  -34.432 63.329  1.00 162.29 ? 270  GLY C C     1 
ATOM   5653  O  O     . GLY C 2 270  ? 62.493  -35.427 62.812  1.00 160.78 ? 270  GLY C O     1 
ATOM   5654  N  N     . GLU C 2 271  ? 64.078  -34.502 64.120  1.00 163.01 ? 271  GLU C N     1 
ATOM   5655  C  CA    . GLU C 2 271  ? 64.555  -35.788 64.613  1.00 162.72 ? 271  GLU C CA    1 
ATOM   5656  C  C     . GLU C 2 271  ? 63.454  -36.291 65.522  1.00 157.65 ? 271  GLU C C     1 
ATOM   5657  O  O     . GLU C 2 271  ? 63.252  -37.494 65.718  1.00 151.65 ? 271  GLU C O     1 
ATOM   5658  C  CB    . GLU C 2 271  ? 65.842  -35.614 65.402  1.00 164.98 ? 271  GLU C CB    1 
ATOM   5659  C  CG    . GLU C 2 271  ? 66.294  -36.870 66.113  1.00 166.25 ? 271  GLU C CG    1 
ATOM   5660  C  CD    . GLU C 2 271  ? 66.725  -37.955 65.154  1.00 176.53 ? 271  GLU C CD    1 
ATOM   5661  O  OE1   . GLU C 2 271  ? 67.505  -37.661 64.217  1.00 174.13 ? 271  GLU C OE1   1 
ATOM   5662  O  OE2   . GLU C 2 271  ? 66.278  -39.107 65.343  1.00 186.49 ? 271  GLU C OE2   1 
ATOM   5663  N  N     . ALA C 2 272  ? 62.758  -35.316 66.086  1.00 156.52 ? 272  ALA C N     1 
ATOM   5664  C  CA    . ALA C 2 272  ? 61.481  -35.519 66.721  1.00 155.73 ? 272  ALA C CA    1 
ATOM   5665  C  C     . ALA C 2 272  ? 60.470  -36.010 65.698  1.00 159.52 ? 272  ALA C C     1 
ATOM   5666  O  O     . ALA C 2 272  ? 59.927  -37.109 65.823  1.00 160.39 ? 272  ALA C O     1 
ATOM   5667  C  CB    . ALA C 2 272  ? 61.018  -34.202 67.301  1.00 151.51 ? 272  ALA C CB    1 
ATOM   5668  N  N     . GLY C 2 273  ? 60.254  -35.190 64.671  1.00 160.44 ? 273  GLY C N     1 
ATOM   5669  C  CA    . GLY C 2 273  ? 59.279  -35.467 63.632  1.00 157.21 ? 273  GLY C CA    1 
ATOM   5670  C  C     . GLY C 2 273  ? 59.453  -36.847 63.046  1.00 159.94 ? 273  GLY C C     1 
ATOM   5671  O  O     . GLY C 2 273  ? 58.473  -37.521 62.714  1.00 156.31 ? 273  GLY C O     1 
ATOM   5672  N  N     . ARG C 2 274  ? 60.712  -37.263 62.937  1.00 162.88 ? 274  ARG C N     1 
ATOM   5673  C  CA    . ARG C 2 274  ? 61.041  -38.618 62.537  1.00 165.18 ? 274  ARG C CA    1 
ATOM   5674  C  C     . ARG C 2 274  ? 60.275  -39.624 63.391  1.00 168.42 ? 274  ARG C C     1 
ATOM   5675  O  O     . ARG C 2 274  ? 59.510  -40.433 62.871  1.00 168.94 ? 274  ARG C O     1 
ATOM   5676  C  CB    . ARG C 2 274  ? 62.543  -38.862 62.671  1.00 166.71 ? 274  ARG C CB    1 
ATOM   5677  C  CG    . ARG C 2 274  ? 62.976  -40.284 62.358  1.00 168.12 ? 274  ARG C CG    1 
ATOM   5678  C  CD    . ARG C 2 274  ? 64.083  -40.704 63.293  1.00 172.64 ? 274  ARG C CD    1 
ATOM   5679  N  NE    . ARG C 2 274  ? 64.772  -41.897 62.831  1.00 173.40 ? 274  ARG C NE    1 
ATOM   5680  C  CZ    . ARG C 2 274  ? 65.653  -41.902 61.840  1.00 178.52 ? 274  ARG C CZ    1 
ATOM   5681  N  NH1   . ARG C 2 274  ? 65.935  -40.776 61.194  1.00 172.09 ? 274  ARG C NH1   1 
ATOM   5682  N  NH2   . ARG C 2 274  ? 66.244  -43.034 61.487  1.00 188.51 ? 274  ARG C NH2   1 
ATOM   5683  N  N     . TYR C 2 275  ? 60.439  -39.552 64.705  1.00 166.25 ? 275  TYR C N     1 
ATOM   5684  C  CA    . TYR C 2 275  ? 59.774  -40.521 65.562  1.00 167.65 ? 275  TYR C CA    1 
ATOM   5685  C  C     . TYR C 2 275  ? 58.244  -40.398 65.534  1.00 166.94 ? 275  TYR C C     1 
ATOM   5686  O  O     . TYR C 2 275  ? 57.537  -41.405 65.485  1.00 167.15 ? 275  TYR C O     1 
ATOM   5687  C  CB    . TYR C 2 275  ? 60.285  -40.427 66.994  1.00 172.59 ? 275  TYR C CB    1 
ATOM   5688  C  CG    . TYR C 2 275  ? 59.323  -41.041 67.981  1.00 185.94 ? 275  TYR C CG    1 
ATOM   5689  C  CD1   . TYR C 2 275  ? 59.310  -42.414 68.210  1.00 192.21 ? 275  TYR C CD1   1 
ATOM   5690  C  CD2   . TYR C 2 275  ? 58.406  -40.251 68.673  1.00 187.30 ? 275  TYR C CD2   1 
ATOM   5691  C  CE1   . TYR C 2 275  ? 58.412  -42.986 69.114  1.00 196.39 ? 275  TYR C CE1   1 
ATOM   5692  C  CE2   . TYR C 2 275  ? 57.504  -40.812 69.575  1.00 193.83 ? 275  TYR C CE2   1 
ATOM   5693  C  CZ    . TYR C 2 275  ? 57.511  -42.178 69.794  1.00 198.62 ? 275  TYR C CZ    1 
ATOM   5694  O  OH    . TYR C 2 275  ? 56.615  -42.730 70.693  1.00 196.90 ? 275  TYR C OH    1 
ATOM   5695  N  N     . LYS C 2 276  ? 57.745  -39.166 65.573  1.00 164.31 ? 276  LYS C N     1 
ATOM   5696  C  CA    . LYS C 2 276  ? 56.307  -38.906 65.638  1.00 159.98 ? 276  LYS C CA    1 
ATOM   5697  C  C     . LYS C 2 276  ? 55.522  -39.647 64.569  1.00 157.36 ? 276  LYS C C     1 
ATOM   5698  O  O     . LYS C 2 276  ? 54.457  -40.188 64.837  1.00 153.50 ? 276  LYS C O     1 
ATOM   5699  C  CB    . LYS C 2 276  ? 56.027  -37.407 65.532  1.00 157.18 ? 276  LYS C CB    1 
ATOM   5700  C  CG    . LYS C 2 276  ? 55.905  -36.703 66.871  1.00 149.82 ? 276  LYS C CG    1 
ATOM   5701  C  CD    . LYS C 2 276  ? 54.729  -37.236 67.676  1.00 147.70 ? 276  LYS C CD    1 
ATOM   5702  C  CE    . LYS C 2 276  ? 53.409  -36.589 67.267  1.00 142.01 ? 276  LYS C CE    1 
ATOM   5703  N  NZ    . LYS C 2 276  ? 52.948  -36.950 65.896  1.00 143.69 ? 276  LYS C NZ    1 
ATOM   5704  N  N     . ALA C 2 277  ? 56.052  -39.664 63.356  1.00 156.63 ? 277  ALA C N     1 
ATOM   5705  C  CA    . ALA C 2 277  ? 55.391  -40.343 62.258  1.00 154.12 ? 277  ALA C CA    1 
ATOM   5706  C  C     . ALA C 2 277  ? 55.635  -41.853 62.253  1.00 158.11 ? 277  ALA C C     1 
ATOM   5707  O  O     . ALA C 2 277  ? 54.797  -42.612 61.776  1.00 159.64 ? 277  ALA C O     1 
ATOM   5708  C  CB    . ALA C 2 277  ? 55.816  -39.739 60.957  1.00 144.14 ? 277  ALA C CB    1 
ATOM   5709  N  N     . GLU C 2 278  ? 56.782  -42.286 62.772  1.00 161.04 ? 278  GLU C N     1 
ATOM   5710  C  CA    . GLU C 2 278  ? 57.099  -43.716 62.832  1.00 163.65 ? 278  GLU C CA    1 
ATOM   5711  C  C     . GLU C 2 278  ? 56.116  -44.408 63.753  1.00 163.33 ? 278  GLU C C     1 
ATOM   5712  O  O     . GLU C 2 278  ? 55.705  -45.547 63.518  1.00 158.77 ? 278  GLU C O     1 
ATOM   5713  C  CB    . GLU C 2 278  ? 58.531  -43.951 63.335  1.00 166.68 ? 278  GLU C CB    1 
ATOM   5714  C  CG    . GLU C 2 278  ? 59.603  -43.924 62.243  1.00 173.85 ? 278  GLU C CG    1 
ATOM   5715  C  CD    . GLU C 2 278  ? 61.010  -44.167 62.773  1.00 176.29 ? 278  GLU C CD    1 
ATOM   5716  O  OE1   . GLU C 2 278  ? 61.156  -44.390 63.990  1.00 175.88 ? 278  GLU C OE1   1 
ATOM   5717  O  OE2   . GLU C 2 278  ? 61.972  -44.134 61.972  1.00 175.41 ? 278  GLU C OE2   1 
ATOM   5718  N  N     . GLU C 2 279  ? 55.764  -43.697 64.818  1.00 164.59 ? 279  GLU C N     1 
ATOM   5719  C  CA    . GLU C 2 279  ? 54.810  -44.166 65.805  1.00 165.85 ? 279  GLU C CA    1 
ATOM   5720  C  C     . GLU C 2 279  ? 53.382  -43.943 65.348  1.00 165.89 ? 279  GLU C C     1 
ATOM   5721  O  O     . GLU C 2 279  ? 52.480  -44.700 65.703  1.00 167.78 ? 279  GLU C O     1 
ATOM   5722  C  CB    . GLU C 2 279  ? 55.029  -43.431 67.123  1.00 171.55 ? 279  GLU C CB    1 
ATOM   5723  C  CG    . GLU C 2 279  ? 54.359  -44.090 68.305  1.00 176.42 ? 279  GLU C CG    1 
ATOM   5724  C  CD    . GLU C 2 279  ? 54.980  -45.429 68.626  1.00 181.89 ? 279  GLU C CD    1 
ATOM   5725  O  OE1   . GLU C 2 279  ? 54.291  -46.269 69.240  1.00 188.95 ? 279  GLU C OE1   1 
ATOM   5726  O  OE2   . GLU C 2 279  ? 56.160  -45.639 68.265  1.00 176.89 ? 279  GLU C OE2   1 
ATOM   5727  N  N     . LYS C 2 280  ? 53.175  -42.874 64.588  1.00 162.83 ? 280  LYS C N     1 
ATOM   5728  C  CA    . LYS C 2 280  ? 51.835  -42.496 64.162  1.00 164.57 ? 280  LYS C CA    1 
ATOM   5729  C  C     . LYS C 2 280  ? 51.271  -43.469 63.121  1.00 168.11 ? 280  LYS C C     1 
ATOM   5730  O  O     . LYS C 2 280  ? 50.212  -44.057 63.341  1.00 167.55 ? 280  LYS C O     1 
ATOM   5731  C  CB    . LYS C 2 280  ? 51.838  -41.048 63.648  1.00 164.33 ? 280  LYS C CB    1 
ATOM   5732  C  CG    . LYS C 2 280  ? 50.523  -40.535 63.071  1.00 168.93 ? 280  LYS C CG    1 
ATOM   5733  C  CD    . LYS C 2 280  ? 49.452  -40.257 64.121  1.00 169.63 ? 280  LYS C CD    1 
ATOM   5734  C  CE    . LYS C 2 280  ? 48.183  -39.724 63.454  1.00 168.23 ? 280  LYS C CE    1 
ATOM   5735  N  NZ    . LYS C 2 280  ? 47.074  -39.460 64.411  1.00 165.90 ? 280  LYS C NZ    1 
ATOM   5736  N  N     . LEU C 2 281  ? 52.001  -43.659 62.018  1.00 171.28 ? 281  LEU C N     1 
ATOM   5737  C  CA    . LEU C 2 281  ? 51.573  -44.518 60.904  1.00 169.72 ? 281  LEU C CA    1 
ATOM   5738  C  C     . LEU C 2 281  ? 52.145  -45.915 61.029  1.00 172.78 ? 281  LEU C C     1 
ATOM   5739  O  O     . LEU C 2 281  ? 51.955  -46.744 60.136  1.00 174.59 ? 281  LEU C O     1 
ATOM   5740  C  CB    . LEU C 2 281  ? 52.062  -43.959 59.576  1.00 166.24 ? 281  LEU C CB    1 
ATOM   5741  C  CG    . LEU C 2 281  ? 52.199  -42.451 59.530  1.00 161.75 ? 281  LEU C CG    1 
ATOM   5742  C  CD1   . LEU C 2 281  ? 53.377  -42.076 58.663  1.00 158.00 ? 281  LEU C CD1   1 
ATOM   5743  C  CD2   . LEU C 2 281  ? 50.913  -41.881 58.997  1.00 164.54 ? 281  LEU C CD2   1 
ATOM   5744  N  N     . GLY C 2 282  ? 52.878  -46.153 62.113  1.00 172.66 ? 282  GLY C N     1 
ATOM   5745  C  CA    . GLY C 2 282  ? 53.472  -47.449 62.375  1.00 172.72 ? 282  GLY C CA    1 
ATOM   5746  C  C     . GLY C 2 282  ? 54.373  -47.924 61.256  1.00 171.91 ? 282  GLY C C     1 
ATOM   5747  O  O     . GLY C 2 282  ? 54.168  -48.991 60.680  1.00 178.36 ? 282  GLY C O     1 
ATOM   5748  N  N     . ILE C 2 283  ? 55.359  -47.114 60.911  1.00 168.75 ? 283  ILE C N     1 
ATOM   5749  C  CA    . ILE C 2 283  ? 56.339  -47.540 59.931  1.00 172.17 ? 283  ILE C CA    1 
ATOM   5750  C  C     . ILE C 2 283  ? 57.721  -47.218 60.466  1.00 177.35 ? 283  ILE C C     1 
ATOM   5751  O  O     . ILE C 2 283  ? 57.850  -46.689 61.572  1.00 178.04 ? 283  ILE C O     1 
ATOM   5752  C  CB    . ILE C 2 283  ? 56.097  -46.890 58.555  1.00 167.59 ? 283  ILE C CB    1 
ATOM   5753  C  CG1   . ILE C 2 283  ? 56.272  -45.372 58.635  1.00 164.97 ? 283  ILE C CG1   1 
ATOM   5754  C  CG2   . ILE C 2 283  ? 54.716  -47.256 58.056  1.00 161.88 ? 283  ILE C CG2   1 
ATOM   5755  C  CD1   . ILE C 2 283  ? 56.313  -44.681 57.298  1.00 157.82 ? 283  ILE C CD1   1 
ATOM   5756  N  N     . ARG C 2 284  ? 58.750  -47.566 59.706  1.00 174.72 ? 284  ARG C N     1 
ATOM   5757  C  CA    . ARG C 2 284  ? 60.107  -47.226 60.090  1.00 177.68 ? 284  ARG C CA    1 
ATOM   5758  C  C     . ARG C 2 284  ? 60.681  -46.314 59.023  1.00 180.66 ? 284  ARG C C     1 
ATOM   5759  O  O     . ARG C 2 284  ? 60.533  -46.577 57.826  1.00 182.39 ? 284  ARG C O     1 
ATOM   5760  C  CB    . ARG C 2 284  ? 60.979  -48.480 60.248  1.00 183.25 ? 284  ARG C CB    1 
ATOM   5761  C  CG    . ARG C 2 284  ? 60.861  -49.219 61.591  1.00 185.77 ? 284  ARG C CG    1 
ATOM   5762  C  CD    . ARG C 2 284  ? 61.730  -48.599 62.696  1.00 191.77 ? 284  ARG C CD    1 
ATOM   5763  N  NE    . ARG C 2 284  ? 63.162  -48.573 62.380  1.00 193.29 ? 284  ARG C NE    1 
ATOM   5764  C  CZ    . ARG C 2 284  ? 63.886  -47.460 62.249  1.00 190.37 ? 284  ARG C CZ    1 
ATOM   5765  N  NH1   . ARG C 2 284  ? 65.180  -47.532 61.961  1.00 193.51 ? 284  ARG C NH1   1 
ATOM   5766  N  NH2   . ARG C 2 284  ? 63.322  -46.269 62.409  1.00 182.04 ? 284  ARG C NH2   1 
ATOM   5767  N  N     . LEU C 2 285  ? 61.316  -45.232 59.459  1.00 182.38 ? 285  LEU C N     1 
ATOM   5768  C  CA    . LEU C 2 285  ? 62.001  -44.330 58.542  1.00 184.03 ? 285  LEU C CA    1 
ATOM   5769  C  C     . LEU C 2 285  ? 63.496  -44.632 58.524  1.00 184.23 ? 285  LEU C C     1 
ATOM   5770  O  O     . LEU C 2 285  ? 64.077  -44.988 59.552  1.00 187.44 ? 285  LEU C O     1 
ATOM   5771  C  CB    . LEU C 2 285  ? 61.759  -42.869 58.935  1.00 174.89 ? 285  LEU C CB    1 
ATOM   5772  C  CG    . LEU C 2 285  ? 60.536  -42.166 58.336  1.00 169.50 ? 285  LEU C CG    1 
ATOM   5773  C  CD1   . LEU C 2 285  ? 60.970  -41.022 57.423  1.00 170.27 ? 285  LEU C CD1   1 
ATOM   5774  C  CD2   . LEU C 2 285  ? 59.632  -43.143 57.590  1.00 171.19 ? 285  LEU C CD2   1 
ATOM   5775  N  N     . SER C 2 286  ? 64.111  -44.511 57.353  1.00 179.14 ? 286  SER C N     1 
ATOM   5776  C  CA    . SER C 2 286  ? 65.554  -44.664 57.241  1.00 180.90 ? 286  SER C CA    1 
ATOM   5777  C  C     . SER C 2 286  ? 66.280  -43.396 57.691  1.00 180.44 ? 286  SER C C     1 
ATOM   5778  O  O     . SER C 2 286  ? 67.345  -43.452 58.308  1.00 178.62 ? 286  SER C O     1 
ATOM   5779  C  CB    . SER C 2 286  ? 65.942  -45.021 55.805  1.00 186.82 ? 286  SER C CB    1 
ATOM   5780  O  OG    . SER C 2 286  ? 65.210  -44.248 54.867  1.00 187.17 ? 286  SER C OG    1 
ATOM   5781  N  N     . GLY C 2 287  ? 65.675  -42.253 57.401  1.00 177.09 ? 287  GLY C N     1 
ATOM   5782  C  CA    . GLY C 2 287  ? 66.286  -40.972 57.678  1.00 170.71 ? 287  GLY C CA    1 
ATOM   5783  C  C     . GLY C 2 287  ? 65.163  -39.990 57.873  1.00 170.44 ? 287  GLY C C     1 
ATOM   5784  O  O     . GLY C 2 287  ? 63.999  -40.369 57.914  1.00 173.19 ? 287  GLY C O     1 
ATOM   5785  N  N     . ARG C 2 288  ? 65.495  -38.719 57.990  1.00 167.84 ? 288  ARG C N     1 
ATOM   5786  C  CA    . ARG C 2 288  ? 64.469  -37.722 58.220  1.00 167.46 ? 288  ARG C CA    1 
ATOM   5787  C  C     . ARG C 2 288  ? 63.876  -37.236 56.907  1.00 166.65 ? 288  ARG C C     1 
ATOM   5788  O  O     . ARG C 2 288  ? 63.122  -36.271 56.854  1.00 164.09 ? 288  ARG C O     1 
ATOM   5789  C  CB    . ARG C 2 288  ? 65.036  -36.582 59.038  1.00 171.73 ? 288  ARG C CB    1 
ATOM   5790  C  CG    . ARG C 2 288  ? 65.381  -37.013 60.449  1.00 173.71 ? 288  ARG C CG    1 
ATOM   5791  C  CD    . ARG C 2 288  ? 66.069  -35.891 61.181  1.00 173.68 ? 288  ARG C CD    1 
ATOM   5792  N  NE    . ARG C 2 288  ? 67.180  -35.408 60.380  1.00 178.78 ? 288  ARG C NE    1 
ATOM   5793  C  CZ    . ARG C 2 288  ? 68.341  -36.042 60.285  1.00 183.95 ? 288  ARG C CZ    1 
ATOM   5794  N  NH1   . ARG C 2 288  ? 68.532  -37.171 60.959  1.00 183.29 ? 288  ARG C NH1   1 
ATOM   5795  N  NH2   . ARG C 2 288  ? 69.309  -35.548 59.525  1.00 187.14 ? 288  ARG C NH2   1 
ATOM   5796  N  N     . THR C 2 289  ? 64.270  -37.901 55.835  1.00 176.12 ? 289  THR C N     1 
ATOM   5797  C  CA    . THR C 2 289  ? 63.728  -37.628 54.522  1.00 170.32 ? 289  THR C CA    1 
ATOM   5798  C  C     . THR C 2 289  ? 62.338  -38.220 54.357  1.00 165.96 ? 289  THR C C     1 
ATOM   5799  O  O     . THR C 2 289  ? 61.978  -39.180 55.037  1.00 164.18 ? 289  THR C O     1 
ATOM   5800  C  CB    . THR C 2 289  ? 64.615  -38.249 53.451  1.00 170.74 ? 289  THR C CB    1 
ATOM   5801  O  OG1   . THR C 2 289  ? 65.972  -38.312 53.910  1.00 172.07 ? 289  THR C OG1   1 
ATOM   5802  C  CG2   . THR C 2 289  ? 64.568  -37.410 52.264  1.00 169.76 ? 289  THR C CG2   1 
ATOM   5803  N  N     . LEU C 2 290  ? 61.556  -37.650 53.449  1.00 161.82 ? 290  LEU C N     1 
ATOM   5804  C  CA    . LEU C 2 290  ? 60.284  -38.259 53.088  1.00 163.48 ? 290  LEU C CA    1 
ATOM   5805  C  C     . LEU C 2 290  ? 60.499  -39.463 52.190  1.00 169.01 ? 290  LEU C C     1 
ATOM   5806  O  O     . LEU C 2 290  ? 59.965  -40.543 52.440  1.00 167.10 ? 290  LEU C O     1 
ATOM   5807  C  CB    . LEU C 2 290  ? 59.376  -37.263 52.379  1.00 159.50 ? 290  LEU C CB    1 
ATOM   5808  C  CG    . LEU C 2 290  ? 58.737  -36.185 53.252  1.00 161.51 ? 290  LEU C CG    1 
ATOM   5809  C  CD1   . LEU C 2 290  ? 57.657  -35.438 52.511  1.00 159.97 ? 290  LEU C CD1   1 
ATOM   5810  C  CD2   . LEU C 2 290  ? 58.176  -36.745 54.536  1.00 160.32 ? 290  LEU C CD2   1 
ATOM   5811  N  N     . ALA C 2 291  ? 61.292  -39.265 51.143  1.00 176.11 ? 291  ALA C N     1 
ATOM   5812  C  CA    . ALA C 2 291  ? 61.569  -40.320 50.178  1.00 177.27 ? 291  ALA C CA    1 
ATOM   5813  C  C     . ALA C 2 291  ? 63.070  -40.558 50.012  1.00 180.66 ? 291  ALA C C     1 
ATOM   5814  O  O     . ALA C 2 291  ? 63.892  -39.880 50.627  1.00 175.84 ? 291  ALA C O     1 
ATOM   5815  C  CB    . ALA C 2 291  ? 60.935  -39.985 48.844  1.00 167.98 ? 291  ALA C CB    1 
ATOM   5816  N  N     . ARG C 2 292  ? 63.417  -41.533 49.179  1.00 188.21 ? 292  ARG C N     1 
ATOM   5817  C  CA    . ARG C 2 292  ? 64.811  -41.901 48.946  1.00 196.10 ? 292  ARG C CA    1 
ATOM   5818  C  C     . ARG C 2 292  ? 65.167  -41.832 47.466  1.00 201.28 ? 292  ARG C C     1 
ATOM   5819  O  O     . ARG C 2 292  ? 64.331  -42.081 46.596  1.00 199.48 ? 292  ARG C O     1 
ATOM   5820  C  CB    . ARG C 2 292  ? 65.103  -43.312 49.468  1.00 197.06 ? 292  ARG C CB    1 
ATOM   5821  C  CG    . ARG C 2 292  ? 65.457  -43.406 50.941  1.00 188.13 ? 292  ARG C CG    1 
ATOM   5822  C  CD    . ARG C 2 292  ? 65.508  -44.865 51.369  1.00 185.49 ? 292  ARG C CD    1 
ATOM   5823  N  NE    . ARG C 2 292  ? 64.275  -45.566 51.012  1.00 187.12 ? 292  ARG C NE    1 
ATOM   5824  C  CZ    . ARG C 2 292  ? 64.070  -46.868 51.189  1.00 187.66 ? 292  ARG C CZ    1 
ATOM   5825  N  NH1   . ARG C 2 292  ? 65.020  -47.622 51.721  1.00 191.33 ? 292  ARG C NH1   1 
ATOM   5826  N  NH2   . ARG C 2 292  ? 62.916  -47.419 50.833  1.00 182.79 ? 292  ARG C NH2   1 
ATOM   5827  N  N     . PHE C 2 293  ? 66.427  -41.509 47.203  1.00 204.46 ? 293  PHE C N     1 
ATOM   5828  C  CA    . PHE C 2 293  ? 66.959  -41.381 45.853  1.00 205.94 ? 293  PHE C CA    1 
ATOM   5829  C  C     . PHE C 2 293  ? 67.544  -42.703 45.356  1.00 215.22 ? 293  PHE C C     1 
ATOM   5830  O  O     . PHE C 2 293  ? 68.221  -42.717 44.328  1.00 223.69 ? 293  PHE C O     1 
ATOM   5831  C  CB    . PHE C 2 293  ? 68.025  -40.282 45.799  1.00 203.37 ? 293  PHE C CB    1 
ATOM   5832  C  CG    . PHE C 2 293  ? 68.324  -39.768 44.406  1.00 206.26 ? 293  PHE C CG    1 
ATOM   5833  C  CD1   . PHE C 2 293  ? 67.512  -40.097 43.329  1.00 204.11 ? 293  PHE C CD1   1 
ATOM   5834  C  CD2   . PHE C 2 293  ? 69.431  -38.962 44.178  1.00 203.75 ? 293  PHE C CD2   1 
ATOM   5835  C  CE1   . PHE C 2 293  ? 67.797  -39.635 42.063  1.00 198.73 ? 293  PHE C CE1   1 
ATOM   5836  C  CE2   . PHE C 2 293  ? 69.715  -38.493 42.915  1.00 201.63 ? 293  PHE C CE2   1 
ATOM   5837  C  CZ    . PHE C 2 293  ? 68.898  -38.829 41.858  1.00 201.41 ? 293  PHE C CZ    1 
ATOM   5838  N  N     . GLU C 2 294  ? 67.309  -43.798 46.086  1.00 214.01 ? 294  GLU C N     1 
ATOM   5839  C  CA    . GLU C 2 294  ? 68.076  -45.039 45.900  1.00 218.79 ? 294  GLU C CA    1 
ATOM   5840  C  C     . GLU C 2 294  ? 68.186  -45.474 44.438  1.00 228.69 ? 294  GLU C C     1 
ATOM   5841  O  O     . GLU C 2 294  ? 67.181  -45.729 43.775  1.00 227.42 ? 294  GLU C O     1 
ATOM   5842  C  CB    . GLU C 2 294  ? 67.426  -46.172 46.687  1.00 208.59 ? 294  GLU C CB    1 
ATOM   5843  C  CG    . GLU C 2 294  ? 67.731  -46.166 48.157  1.00 203.43 ? 294  GLU C CG    1 
ATOM   5844  C  CD    . GLU C 2 294  ? 67.665  -47.553 48.730  1.00 202.86 ? 294  GLU C CD    1 
ATOM   5845  O  OE1   . GLU C 2 294  ? 67.271  -48.475 47.984  1.00 203.57 ? 294  GLU C OE1   1 
ATOM   5846  O  OE2   . GLU C 2 294  ? 68.014  -47.722 49.915  1.00 200.66 ? 294  GLU C OE2   1 
ATOM   5847  N  N     . ASP C 2 295  ? 69.431  -45.639 43.989  1.00 233.49 ? 295  ASP C N     1 
ATOM   5848  C  CA    . ASP C 2 295  ? 69.791  -45.574 42.569  1.00 226.84 ? 295  ASP C CA    1 
ATOM   5849  C  C     . ASP C 2 295  ? 69.024  -46.507 41.638  1.00 222.72 ? 295  ASP C C     1 
ATOM   5850  O  O     . ASP C 2 295  ? 68.908  -47.706 41.896  1.00 220.83 ? 295  ASP C O     1 
ATOM   5851  C  CB    . ASP C 2 295  ? 71.303  -45.761 42.395  1.00 229.99 ? 295  ASP C CB    1 
ATOM   5852  C  CG    . ASP C 2 295  ? 71.840  -46.958 43.165  1.00 233.23 ? 295  ASP C CG    1 
ATOM   5853  O  OD1   . ASP C 2 295  ? 71.182  -47.402 44.130  1.00 228.97 ? 295  ASP C OD1   1 
ATOM   5854  O  OD2   . ASP C 2 295  ? 72.929  -47.450 42.808  1.00 237.55 ? 295  ASP C OD2   1 
ATOM   5855  N  N     . GLY C 2 296  ? 68.485  -45.935 40.565  1.00 220.86 ? 296  GLY C N     1 
ATOM   5856  C  CA    . GLY C 2 296  ? 68.480  -44.493 40.379  1.00 216.23 ? 296  GLY C CA    1 
ATOM   5857  C  C     . GLY C 2 296  ? 67.095  -43.921 40.613  1.00 214.11 ? 296  GLY C C     1 
ATOM   5858  O  O     . GLY C 2 296  ? 66.913  -42.704 40.671  1.00 207.18 ? 296  GLY C O     1 
ATOM   5859  N  N     . GLU C 2 297  ? 66.121  -44.822 40.756  1.00 218.54 ? 297  GLU C N     1 
ATOM   5860  C  CA    . GLU C 2 297  ? 64.705  -44.472 40.923  1.00 218.51 ? 297  GLU C CA    1 
ATOM   5861  C  C     . GLU C 2 297  ? 64.403  -43.827 42.286  1.00 217.79 ? 297  GLU C C     1 
ATOM   5862  O  O     . GLU C 2 297  ? 65.153  -44.004 43.245  1.00 219.47 ? 297  GLU C O     1 
ATOM   5863  C  CB    . GLU C 2 297  ? 63.809  -45.717 40.713  1.00 214.56 ? 297  GLU C CB    1 
ATOM   5864  C  CG    . GLU C 2 297  ? 64.069  -46.881 41.693  1.00 209.08 ? 297  GLU C CG    1 
ATOM   5865  C  CD    . GLU C 2 297  ? 63.084  -48.040 41.551  1.00 198.05 ? 297  GLU C CD    1 
ATOM   5866  O  OE1   . GLU C 2 297  ? 63.320  -49.100 42.173  1.00 195.04 ? 297  GLU C OE1   1 
ATOM   5867  O  OE2   . GLU C 2 297  ? 62.076  -47.890 40.827  1.00 191.46 ? 297  GLU C OE2   1 
ATOM   5868  N  N     . PHE C 2 298  ? 63.306  -43.078 42.371  1.00 210.47 ? 298  PHE C N     1 
ATOM   5869  C  CA    . PHE C 2 298  ? 62.865  -42.527 43.647  1.00 200.43 ? 298  PHE C CA    1 
ATOM   5870  C  C     . PHE C 2 298  ? 62.064  -43.606 44.391  1.00 199.77 ? 298  PHE C C     1 
ATOM   5871  O  O     . PHE C 2 298  ? 61.048  -44.086 43.882  1.00 197.29 ? 298  PHE C O     1 
ATOM   5872  C  CB    . PHE C 2 298  ? 62.018  -41.266 43.419  1.00 194.93 ? 298  PHE C CB    1 
ATOM   5873  C  CG    . PHE C 2 298  ? 62.822  -39.977 43.296  1.00 194.71 ? 298  PHE C CG    1 
ATOM   5874  C  CD1   . PHE C 2 298  ? 62.485  -39.018 42.343  1.00 187.18 ? 298  PHE C CD1   1 
ATOM   5875  C  CD2   . PHE C 2 298  ? 63.885  -39.708 44.153  1.00 195.83 ? 298  PHE C CD2   1 
ATOM   5876  C  CE1   . PHE C 2 298  ? 63.211  -37.833 42.233  1.00 184.63 ? 298  PHE C CE1   1 
ATOM   5877  C  CE2   . PHE C 2 298  ? 64.608  -38.517 44.051  1.00 188.60 ? 298  PHE C CE2   1 
ATOM   5878  C  CZ    . PHE C 2 298  ? 64.267  -37.581 43.090  1.00 184.80 ? 298  PHE C CZ    1 
ATOM   5879  N  N     . LYS C 2 299  ? 62.534  -44.001 45.577  1.00 200.08 ? 299  LYS C N     1 
ATOM   5880  C  CA    . LYS C 2 299  ? 61.852  -45.017 46.392  1.00 200.11 ? 299  LYS C CA    1 
ATOM   5881  C  C     . LYS C 2 299  ? 61.130  -44.383 47.583  1.00 196.96 ? 299  LYS C C     1 
ATOM   5882  O  O     . LYS C 2 299  ? 61.677  -43.505 48.254  1.00 196.32 ? 299  LYS C O     1 
ATOM   5883  C  CB    . LYS C 2 299  ? 62.829  -46.098 46.887  1.00 202.52 ? 299  LYS C CB    1 
ATOM   5884  C  CG    . LYS C 2 299  ? 63.192  -47.162 45.854  1.00 206.57 ? 299  LYS C CG    1 
ATOM   5885  C  CD    . LYS C 2 299  ? 63.817  -48.395 46.500  1.00 206.22 ? 299  LYS C CD    1 
ATOM   5886  C  CE    . LYS C 2 299  ? 64.317  -49.370 45.448  1.00 203.83 ? 299  LYS C CE    1 
ATOM   5887  N  NZ    . LYS C 2 299  ? 65.398  -48.759 44.625  1.00 206.15 ? 299  LYS C NZ    1 
ATOM   5888  N  N     . ASP C 2 300  ? 59.903  -44.833 47.839  1.00 194.85 ? 300  ASP C N     1 
ATOM   5889  C  CA    . ASP C 2 300  ? 59.049  -44.229 48.869  1.00 188.02 ? 300  ASP C CA    1 
ATOM   5890  C  C     . ASP C 2 300  ? 59.252  -44.725 50.309  1.00 184.54 ? 300  ASP C C     1 
ATOM   5891  O  O     . ASP C 2 300  ? 59.641  -45.869 50.548  1.00 187.62 ? 300  ASP C O     1 
ATOM   5892  C  CB    . ASP C 2 300  ? 57.570  -44.339 48.488  1.00 185.56 ? 300  ASP C CB    1 
ATOM   5893  C  CG    . ASP C 2 300  ? 56.662  -43.586 49.451  1.00 179.20 ? 300  ASP C CG    1 
ATOM   5894  O  OD1   . ASP C 2 300  ? 57.147  -42.654 50.132  1.00 176.91 ? 300  ASP C OD1   1 
ATOM   5895  O  OD2   . ASP C 2 300  ? 55.465  -43.925 49.531  1.00 178.19 ? 300  ASP C OD2   1 
ATOM   5896  N  N     . GLU C 2 301  ? 59.005  -43.829 51.260  1.00 180.45 ? 301  GLU C N     1 
ATOM   5897  C  CA    . GLU C 2 301  ? 58.925  -44.186 52.670  1.00 178.54 ? 301  GLU C CA    1 
ATOM   5898  C  C     . GLU C 2 301  ? 57.669  -43.643 53.358  1.00 177.03 ? 301  GLU C C     1 
ATOM   5899  O  O     . GLU C 2 301  ? 56.857  -44.397 53.895  1.00 175.59 ? 301  GLU C O     1 
ATOM   5900  C  CB    . GLU C 2 301  ? 60.174  -43.730 53.403  1.00 174.07 ? 301  GLU C CB    1 
ATOM   5901  C  CG    . GLU C 2 301  ? 61.328  -44.649 53.202  1.00 174.28 ? 301  GLU C CG    1 
ATOM   5902  C  CD    . GLU C 2 301  ? 62.456  -44.297 54.109  1.00 177.87 ? 301  GLU C CD    1 
ATOM   5903  O  OE1   . GLU C 2 301  ? 62.650  -43.090 54.377  1.00 173.87 ? 301  GLU C OE1   1 
ATOM   5904  O  OE2   . GLU C 2 301  ? 63.139  -45.230 54.569  1.00 181.56 ? 301  GLU C OE2   1 
ATOM   5905  N  N     . VAL C 2 302  ? 57.546  -42.321 53.366  1.00 175.21 ? 302  VAL C N     1 
ATOM   5906  C  CA    . VAL C 2 302  ? 56.519  -41.620 54.137  1.00 171.48 ? 302  VAL C CA    1 
ATOM   5907  C  C     . VAL C 2 302  ? 55.115  -41.611 53.526  1.00 168.28 ? 302  VAL C C     1 
ATOM   5908  O  O     . VAL C 2 302  ? 54.113  -41.703 54.241  1.00 168.04 ? 302  VAL C O     1 
ATOM   5909  C  CB    . VAL C 2 302  ? 56.956  -40.166 54.374  1.00 168.13 ? 302  VAL C CB    1 
ATOM   5910  C  CG1   . VAL C 2 302  ? 55.832  -39.345 55.006  1.00 159.00 ? 302  VAL C CG1   1 
ATOM   5911  C  CG2   . VAL C 2 302  ? 58.215  -40.148 55.223  1.00 169.19 ? 302  VAL C CG2   1 
ATOM   5912  N  N     . PHE C 2 303  ? 55.053  -41.514 52.205  1.00 164.38 ? 303  PHE C N     1 
ATOM   5913  C  CA    . PHE C 2 303  ? 53.818  -41.147 51.520  1.00 160.26 ? 303  PHE C CA    1 
ATOM   5914  C  C     . PHE C 2 303  ? 52.677  -42.158 51.561  1.00 167.02 ? 303  PHE C C     1 
ATOM   5915  O  O     . PHE C 2 303  ? 51.520  -41.786 51.736  1.00 168.26 ? 303  PHE C O     1 
ATOM   5916  C  CB    . PHE C 2 303  ? 54.124  -40.719 50.090  1.00 153.25 ? 303  PHE C CB    1 
ATOM   5917  C  CG    . PHE C 2 303  ? 54.789  -39.392 50.013  1.00 150.22 ? 303  PHE C CG    1 
ATOM   5918  C  CD1   . PHE C 2 303  ? 56.124  -39.258 50.345  1.00 154.30 ? 303  PHE C CD1   1 
ATOM   5919  C  CD2   . PHE C 2 303  ? 54.075  -38.270 49.645  1.00 143.02 ? 303  PHE C CD2   1 
ATOM   5920  C  CE1   . PHE C 2 303  ? 56.737  -38.039 50.296  1.00 151.53 ? 303  PHE C CE1   1 
ATOM   5921  C  CE2   . PHE C 2 303  ? 54.681  -37.047 49.595  1.00 141.78 ? 303  PHE C CE2   1 
ATOM   5922  C  CZ    . PHE C 2 303  ? 56.016  -36.931 49.921  1.00 147.13 ? 303  PHE C CZ    1 
ATOM   5923  N  N     . LEU C 2 304  ? 52.987  -43.432 51.395  1.00 170.45 ? 304  LEU C N     1 
ATOM   5924  C  CA    . LEU C 2 304  ? 51.935  -44.436 51.417  1.00 168.34 ? 304  LEU C CA    1 
ATOM   5925  C  C     . LEU C 2 304  ? 51.281  -44.634 52.795  1.00 167.52 ? 304  LEU C C     1 
ATOM   5926  O  O     . LEU C 2 304  ? 50.057  -44.701 52.876  1.00 170.73 ? 304  LEU C O     1 
ATOM   5927  C  CB    . LEU C 2 304  ? 52.419  -45.756 50.811  1.00 172.41 ? 304  LEU C CB    1 
ATOM   5928  C  CG    . LEU C 2 304  ? 51.331  -46.684 50.272  1.00 176.05 ? 304  LEU C CG    1 
ATOM   5929  C  CD1   . LEU C 2 304  ? 50.433  -45.969 49.266  1.00 175.89 ? 304  LEU C CD1   1 
ATOM   5930  C  CD2   . LEU C 2 304  ? 51.966  -47.920 49.655  1.00 181.48 ? 304  LEU C CD2   1 
ATOM   5931  N  N     . PRO C 2 305  ? 52.081  -44.735 53.877  1.00 166.92 ? 305  PRO C N     1 
ATOM   5932  C  CA    . PRO C 2 305  ? 51.470  -44.876 55.207  1.00 171.37 ? 305  PRO C CA    1 
ATOM   5933  C  C     . PRO C 2 305  ? 50.761  -43.629 55.766  1.00 174.36 ? 305  PRO C C     1 
ATOM   5934  O  O     . PRO C 2 305  ? 50.016  -43.778 56.741  1.00 176.41 ? 305  PRO C O     1 
ATOM   5935  C  CB    . PRO C 2 305  ? 52.656  -45.267 56.099  1.00 171.62 ? 305  PRO C CB    1 
ATOM   5936  C  CG    . PRO C 2 305  ? 53.670  -45.793 55.160  1.00 170.42 ? 305  PRO C CG    1 
ATOM   5937  C  CD    . PRO C 2 305  ? 53.535  -44.953 53.949  1.00 167.79 ? 305  PRO C CD    1 
ATOM   5938  N  N     . THR C 2 306  ? 51.015  -42.438 55.217  1.00 171.42 ? 306  THR C N     1 
ATOM   5939  C  CA    . THR C 2 306  ? 50.203  -41.265 55.562  1.00 166.10 ? 306  THR C CA    1 
ATOM   5940  C  C     . THR C 2 306  ? 48.900  -41.267 54.754  1.00 168.09 ? 306  THR C C     1 
ATOM   5941  O  O     . THR C 2 306  ? 47.865  -40.796 55.226  1.00 167.04 ? 306  THR C O     1 
ATOM   5942  C  CB    . THR C 2 306  ? 50.953  -39.915 55.378  1.00 155.80 ? 306  THR C CB    1 
ATOM   5943  O  OG1   . THR C 2 306  ? 51.195  -39.676 53.993  1.00 155.87 ? 306  THR C OG1   1 
ATOM   5944  C  CG2   . THR C 2 306  ? 52.277  -39.916 56.111  1.00 154.39 ? 306  THR C CG2   1 
ATOM   5945  N  N     . LEU C 2 307  ? 48.967  -41.821 53.544  1.00 170.63 ? 307  LEU C N     1 
ATOM   5946  C  CA    . LEU C 2 307  ? 47.811  -41.970 52.658  1.00 170.20 ? 307  LEU C CA    1 
ATOM   5947  C  C     . LEU C 2 307  ? 46.889  -43.100 53.123  1.00 176.83 ? 307  LEU C C     1 
ATOM   5948  O  O     . LEU C 2 307  ? 45.668  -42.979 53.077  1.00 181.38 ? 307  LEU C O     1 
ATOM   5949  C  CB    . LEU C 2 307  ? 48.283  -42.227 51.224  1.00 168.84 ? 307  LEU C CB    1 
ATOM   5950  C  CG    . LEU C 2 307  ? 47.243  -42.525 50.141  1.00 175.76 ? 307  LEU C CG    1 
ATOM   5951  C  CD1   . LEU C 2 307  ? 46.138  -41.484 50.138  1.00 177.53 ? 307  LEU C CD1   1 
ATOM   5952  C  CD2   . LEU C 2 307  ? 47.911  -42.600 48.775  1.00 177.75 ? 307  LEU C CD2   1 
ATOM   5953  N  N     . ARG C 2 308  ? 47.484  -44.202 53.563  1.00 174.02 ? 308  ARG C N     1 
ATOM   5954  C  CA    . ARG C 2 308  ? 46.739  -45.293 54.172  1.00 173.49 ? 308  ARG C CA    1 
ATOM   5955  C  C     . ARG C 2 308  ? 46.048  -44.812 55.457  1.00 180.92 ? 308  ARG C C     1 
ATOM   5956  O  O     . ARG C 2 308  ? 44.925  -45.215 55.750  1.00 185.55 ? 308  ARG C O     1 
ATOM   5957  C  CB    . ARG C 2 308  ? 47.685  -46.472 54.452  1.00 175.82 ? 308  ARG C CB    1 
ATOM   5958  C  CG    . ARG C 2 308  ? 47.040  -47.758 54.990  1.00 185.48 ? 308  ARG C CG    1 
ATOM   5959  C  CD    . ARG C 2 308  ? 47.089  -47.840 56.518  1.00 188.27 ? 308  ARG C CD    1 
ATOM   5960  N  NE    . ARG C 2 308  ? 48.319  -47.276 57.079  1.00 187.98 ? 308  ARG C NE    1 
ATOM   5961  C  CZ    . ARG C 2 308  ? 48.482  -46.976 58.366  1.00 184.18 ? 308  ARG C CZ    1 
ATOM   5962  N  NH1   . ARG C 2 308  ? 47.494  -47.192 59.225  1.00 180.48 ? 308  ARG C NH1   1 
ATOM   5963  N  NH2   . ARG C 2 308  ? 49.628  -46.458 58.795  1.00 178.73 ? 308  ARG C NH2   1 
ATOM   5964  N  N     . TYR C 2 309  ? 46.719  -43.945 56.216  1.00 177.69 ? 309  TYR C N     1 
ATOM   5965  C  CA    . TYR C 2 309  ? 46.177  -43.456 57.482  1.00 173.11 ? 309  TYR C CA    1 
ATOM   5966  C  C     . TYR C 2 309  ? 45.026  -42.504 57.227  1.00 175.75 ? 309  TYR C C     1 
ATOM   5967  O  O     . TYR C 2 309  ? 43.999  -42.578 57.898  1.00 180.13 ? 309  TYR C O     1 
ATOM   5968  C  CB    . TYR C 2 309  ? 47.251  -42.744 58.309  1.00 170.30 ? 309  TYR C CB    1 
ATOM   5969  C  CG    . TYR C 2 309  ? 46.995  -42.708 59.813  1.00 173.88 ? 309  TYR C CG    1 
ATOM   5970  C  CD1   . TYR C 2 309  ? 47.790  -43.441 60.684  1.00 175.28 ? 309  TYR C CD1   1 
ATOM   5971  C  CD2   . TYR C 2 309  ? 45.972  -41.934 60.365  1.00 171.66 ? 309  TYR C CD2   1 
ATOM   5972  C  CE1   . TYR C 2 309  ? 47.576  -43.413 62.061  1.00 174.36 ? 309  TYR C CE1   1 
ATOM   5973  C  CE2   . TYR C 2 309  ? 45.751  -41.902 61.751  1.00 165.79 ? 309  TYR C CE2   1 
ATOM   5974  C  CZ    . TYR C 2 309  ? 46.561  -42.647 62.590  1.00 167.89 ? 309  TYR C CZ    1 
ATOM   5975  O  OH    . TYR C 2 309  ? 46.377  -42.642 63.957  1.00 164.59 ? 309  TYR C OH    1 
ATOM   5976  N  N     . LEU C 2 310  ? 45.204  -41.597 56.270  1.00 176.07 ? 310  LEU C N     1 
ATOM   5977  C  CA    . LEU C 2 310  ? 44.135  -40.671 55.894  1.00 181.56 ? 310  LEU C CA    1 
ATOM   5978  C  C     . LEU C 2 310  ? 42.893  -41.425 55.432  1.00 190.41 ? 310  LEU C C     1 
ATOM   5979  O  O     . LEU C 2 310  ? 41.785  -41.152 55.902  1.00 193.57 ? 310  LEU C O     1 
ATOM   5980  C  CB    . LEU C 2 310  ? 44.583  -39.711 54.785  1.00 178.41 ? 310  LEU C CB    1 
ATOM   5981  C  CG    . LEU C 2 310  ? 43.440  -38.933 54.117  1.00 174.68 ? 310  LEU C CG    1 
ATOM   5982  C  CD1   . LEU C 2 310  ? 42.829  -37.932 55.092  1.00 175.24 ? 310  LEU C CD1   1 
ATOM   5983  C  CD2   . LEU C 2 310  ? 43.877  -38.249 52.820  1.00 166.51 ? 310  LEU C CD2   1 
ATOM   5984  N  N     . PHE C 2 311  ? 43.086  -42.369 54.509  1.00 193.24 ? 311  PHE C N     1 
ATOM   5985  C  CA    . PHE C 2 311  ? 41.977  -43.124 53.913  1.00 196.55 ? 311  PHE C CA    1 
ATOM   5986  C  C     . PHE C 2 311  ? 41.219  -43.956 54.955  1.00 197.15 ? 311  PHE C C     1 
ATOM   5987  O  O     . PHE C 2 311  ? 40.010  -44.172 54.833  1.00 200.25 ? 311  PHE C O     1 
ATOM   5988  C  CB    . PHE C 2 311  ? 42.461  -44.014 52.754  1.00 197.39 ? 311  PHE C CB    1 
ATOM   5989  C  CG    . PHE C 2 311  ? 42.370  -43.363 51.386  1.00 199.55 ? 311  PHE C CG    1 
ATOM   5990  C  CD1   . PHE C 2 311  ? 41.510  -42.301 51.146  1.00 199.68 ? 311  PHE C CD1   1 
ATOM   5991  C  CD2   . PHE C 2 311  ? 43.144  -43.835 50.336  1.00 201.59 ? 311  PHE C CD2   1 
ATOM   5992  C  CE1   . PHE C 2 311  ? 41.437  -41.721 49.890  1.00 202.91 ? 311  PHE C CE1   1 
ATOM   5993  C  CE2   . PHE C 2 311  ? 43.075  -43.260 49.082  1.00 202.07 ? 311  PHE C CE2   1 
ATOM   5994  C  CZ    . PHE C 2 311  ? 42.222  -42.204 48.860  1.00 204.00 ? 311  PHE C CZ    1 
ATOM   5995  N  N     . ALA C 2 312  ? 41.929  -44.410 55.984  1.00 193.55 ? 312  ALA C N     1 
ATOM   5996  C  CA    . ALA C 2 312  ? 41.297  -45.170 57.054  1.00 189.27 ? 312  ALA C CA    1 
ATOM   5997  C  C     . ALA C 2 312  ? 40.608  -44.254 58.069  1.00 185.52 ? 312  ALA C C     1 
ATOM   5998  O  O     . ALA C 2 312  ? 39.742  -44.694 58.819  1.00 185.68 ? 312  ALA C O     1 
ATOM   5999  C  CB    . ALA C 2 312  ? 42.305  -46.071 57.727  1.00 185.81 ? 312  ALA C CB    1 
ATOM   6000  N  N     . LEU C 2 313  ? 41.002  -42.984 58.098  1.00 184.27 ? 313  LEU C N     1 
ATOM   6001  C  CA    . LEU C 2 313  ? 40.317  -41.999 58.927  1.00 184.35 ? 313  LEU C CA    1 
ATOM   6002  C  C     . LEU C 2 313  ? 39.060  -41.448 58.253  1.00 187.43 ? 313  LEU C C     1 
ATOM   6003  O  O     . LEU C 2 313  ? 38.092  -41.109 58.932  1.00 187.35 ? 313  LEU C O     1 
ATOM   6004  C  CB    . LEU C 2 313  ? 41.256  -40.856 59.323  1.00 185.97 ? 313  LEU C CB    1 
ATOM   6005  C  CG    . LEU C 2 313  ? 40.690  -39.812 60.297  1.00 187.32 ? 313  LEU C CG    1 
ATOM   6006  C  CD1   . LEU C 2 313  ? 40.324  -40.443 61.639  1.00 185.03 ? 313  LEU C CD1   1 
ATOM   6007  C  CD2   . LEU C 2 313  ? 41.667  -38.657 60.489  1.00 181.35 ? 313  LEU C CD2   1 
ATOM   6008  N  N     . THR C 2 314  ? 39.079  -41.350 56.923  1.00 190.45 ? 314  THR C N     1 
ATOM   6009  C  CA    . THR C 2 314  ? 37.960  -40.755 56.182  1.00 194.72 ? 314  THR C CA    1 
ATOM   6010  C  C     . THR C 2 314  ? 36.663  -41.545 56.366  1.00 196.52 ? 314  THR C C     1 
ATOM   6011  O  O     . THR C 2 314  ? 35.664  -41.005 56.852  1.00 199.79 ? 314  THR C O     1 
ATOM   6012  C  CB    . THR C 2 314  ? 38.282  -40.561 54.675  1.00 193.44 ? 314  THR C CB    1 
ATOM   6013  O  OG1   . THR C 2 314  ? 39.157  -39.437 54.508  1.00 187.97 ? 314  THR C OG1   1 
ATOM   6014  C  CG2   . THR C 2 314  ? 37.013  -40.300 53.881  1.00 199.02 ? 314  THR C CG2   1 
ATOM   6015  N  N     . ALA C 2 315  ? 36.677  -42.820 55.989  1.00 191.94 ? 315  ALA C N     1 
ATOM   6016  C  CA    . ALA C 2 315  ? 35.608  -43.726 56.385  1.00 190.46 ? 315  ALA C CA    1 
ATOM   6017  C  C     . ALA C 2 315  ? 36.074  -44.310 57.701  1.00 190.62 ? 315  ALA C C     1 
ATOM   6018  O  O     . ALA C 2 315  ? 37.198  -44.800 57.793  1.00 190.35 ? 315  ALA C O     1 
ATOM   6019  C  CB    . ALA C 2 315  ? 35.406  -44.814 55.355  1.00 187.08 ? 315  ALA C CB    1 
ATOM   6020  N  N     . GLY C 2 316  ? 35.231  -44.240 58.725  1.00 189.01 ? 316  GLY C N     1 
ATOM   6021  C  CA    . GLY C 2 316  ? 35.686  -44.547 60.069  1.00 186.98 ? 316  GLY C CA    1 
ATOM   6022  C  C     . GLY C 2 316  ? 36.182  -45.965 60.260  1.00 186.04 ? 316  GLY C C     1 
ATOM   6023  O  O     . GLY C 2 316  ? 35.430  -46.931 60.130  1.00 186.59 ? 316  GLY C O     1 
ATOM   6024  N  N     . VAL C 2 317  ? 37.455  -46.070 60.624  1.00 185.57 ? 317  VAL C N     1 
ATOM   6025  C  CA    . VAL C 2 317  ? 38.076  -47.344 60.927  1.00 183.33 ? 317  VAL C CA    1 
ATOM   6026  C  C     . VAL C 2 317  ? 38.660  -47.199 62.314  1.00 184.58 ? 317  VAL C C     1 
ATOM   6027  O  O     . VAL C 2 317  ? 39.299  -46.194 62.616  1.00 188.53 ? 317  VAL C O     1 
ATOM   6028  C  CB    . VAL C 2 317  ? 39.225  -47.630 59.946  1.00 180.19 ? 317  VAL C CB    1 
ATOM   6029  C  CG1   . VAL C 2 317  ? 40.015  -48.844 60.375  1.00 182.55 ? 317  VAL C CG1   1 
ATOM   6030  C  CG2   . VAL C 2 317  ? 38.689  -47.813 58.541  1.00 179.39 ? 317  VAL C CG2   1 
ATOM   6031  N  N     . PRO C 2 318  ? 38.472  -48.215 63.157  1.00 182.22 ? 318  PRO C N     1 
ATOM   6032  C  CA    . PRO C 2 318  ? 38.904  -48.145 64.556  1.00 187.78 ? 318  PRO C CA    1 
ATOM   6033  C  C     . PRO C 2 318  ? 40.422  -48.208 64.722  1.00 188.44 ? 318  PRO C C     1 
ATOM   6034  O  O     . PRO C 2 318  ? 41.061  -49.085 64.145  1.00 186.42 ? 318  PRO C O     1 
ATOM   6035  C  CB    . PRO C 2 318  ? 38.243  -49.374 65.178  1.00 188.70 ? 318  PRO C CB    1 
ATOM   6036  C  CG    . PRO C 2 318  ? 37.094  -49.680 64.259  1.00 187.35 ? 318  PRO C CG    1 
ATOM   6037  C  CD    . PRO C 2 318  ? 37.611  -49.376 62.904  1.00 179.94 ? 318  PRO C CD    1 
ATOM   6038  N  N     . GLY C 2 319  ? 40.975  -47.311 65.537  1.00 188.62 ? 319  GLY C N     1 
ATOM   6039  C  CA    . GLY C 2 319  ? 42.413  -47.224 65.737  1.00 185.51 ? 319  GLY C CA    1 
ATOM   6040  C  C     . GLY C 2 319  ? 43.036  -46.028 65.037  1.00 183.67 ? 319  GLY C C     1 
ATOM   6041  O  O     . GLY C 2 319  ? 44.241  -45.784 65.164  1.00 179.53 ? 319  GLY C O     1 
ATOM   6042  N  N     . HIS C 2 320  ? 42.203  -45.279 64.312  1.00 185.43 ? 320  HIS C N     1 
ATOM   6043  C  CA    . HIS C 2 320  ? 42.658  -44.143 63.505  1.00 183.64 ? 320  HIS C CA    1 
ATOM   6044  C  C     . HIS C 2 320  ? 42.292  -42.762 64.065  1.00 181.60 ? 320  HIS C C     1 
ATOM   6045  O  O     . HIS C 2 320  ? 41.119  -42.367 64.116  1.00 172.65 ? 320  HIS C O     1 
ATOM   6046  C  CB    . HIS C 2 320  ? 42.186  -44.288 62.061  1.00 181.33 ? 320  HIS C CB    1 
ATOM   6047  C  CG    . HIS C 2 320  ? 42.854  -45.405 61.332  1.00 177.58 ? 320  HIS C CG    1 
ATOM   6048  N  ND1   . HIS C 2 320  ? 42.362  -46.691 61.327  1.00 175.38 ? 320  HIS C ND1   1 
ATOM   6049  C  CD2   . HIS C 2 320  ? 43.998  -45.437 60.606  1.00 178.72 ? 320  HIS C CD2   1 
ATOM   6050  C  CE1   . HIS C 2 320  ? 43.165  -47.463 60.618  1.00 180.29 ? 320  HIS C CE1   1 
ATOM   6051  N  NE2   . HIS C 2 320  ? 44.165  -46.728 60.171  1.00 180.41 ? 320  HIS C NE2   1 
ATOM   6052  N  N     . GLU C 2 321  ? 43.343  -42.029 64.429  1.00 184.59 ? 321  GLU C N     1 
ATOM   6053  C  CA    . GLU C 2 321  ? 43.274  -40.834 65.265  1.00 178.48 ? 321  GLU C CA    1 
ATOM   6054  C  C     . GLU C 2 321  ? 43.262  -39.518 64.496  1.00 173.89 ? 321  GLU C C     1 
ATOM   6055  O  O     . GLU C 2 321  ? 44.006  -39.347 63.527  1.00 176.19 ? 321  GLU C O     1 
ATOM   6056  C  CB    . GLU C 2 321  ? 44.501  -40.804 66.195  1.00 172.71 ? 321  GLU C CB    1 
ATOM   6057  C  CG    . GLU C 2 321  ? 44.592  -41.933 67.196  1.00 170.40 ? 321  GLU C CG    1 
ATOM   6058  C  CD    . GLU C 2 321  ? 43.673  -41.720 68.375  1.00 172.38 ? 321  GLU C CD    1 
ATOM   6059  O  OE1   . GLU C 2 321  ? 42.738  -40.900 68.271  1.00 167.99 ? 321  GLU C OE1   1 
ATOM   6060  O  OE2   . GLU C 2 321  ? 43.891  -42.368 69.416  1.00 179.63 ? 321  GLU C OE2   1 
ATOM   6061  N  N     . VAL C 2 322  ? 42.410  -38.592 64.925  1.00 163.91 ? 322  VAL C N     1 
ATOM   6062  C  CA    . VAL C 2 322  ? 42.642  -37.179 64.668  1.00 153.28 ? 322  VAL C CA    1 
ATOM   6063  C  C     . VAL C 2 322  ? 43.608  -36.684 65.751  1.00 151.76 ? 322  VAL C C     1 
ATOM   6064  O  O     . VAL C 2 322  ? 43.713  -37.295 66.812  1.00 153.65 ? 322  VAL C O     1 
ATOM   6065  C  CB    . VAL C 2 322  ? 41.337  -36.409 64.679  1.00 150.55 ? 322  VAL C CB    1 
ATOM   6066  C  CG1   . VAL C 2 322  ? 41.545  -35.013 64.154  1.00 151.76 ? 322  VAL C CG1   1 
ATOM   6067  C  CG2   . VAL C 2 322  ? 40.311  -37.148 63.840  1.00 159.51 ? 322  VAL C CG2   1 
ATOM   6068  N  N     . ASP C 2 323  ? 44.345  -35.612 65.497  1.00 147.65 ? 323  ASP C N     1 
ATOM   6069  C  CA    . ASP C 2 323  ? 45.302  -35.158 66.502  1.00 144.05 ? 323  ASP C CA    1 
ATOM   6070  C  C     . ASP C 2 323  ? 45.038  -33.758 67.025  1.00 145.24 ? 323  ASP C C     1 
ATOM   6071  O  O     . ASP C 2 323  ? 44.367  -32.954 66.373  1.00 145.28 ? 323  ASP C O     1 
ATOM   6072  C  CB    . ASP C 2 323  ? 46.715  -35.289 65.976  1.00 143.25 ? 323  ASP C CB    1 
ATOM   6073  C  CG    . ASP C 2 323  ? 47.060  -36.702 65.682  1.00 148.57 ? 323  ASP C CG    1 
ATOM   6074  O  OD1   . ASP C 2 323  ? 46.948  -37.523 66.617  1.00 149.08 ? 323  ASP C OD1   1 
ATOM   6075  O  OD2   . ASP C 2 323  ? 47.397  -36.990 64.515  1.00 147.48 ? 323  ASP C OD2   1 
ATOM   6076  N  N     . ASP C 2 324  ? 45.560  -33.475 68.214  1.00 137.22 ? 324  ASP C N     1 
ATOM   6077  C  CA    . ASP C 2 324  ? 45.166  -32.267 68.921  1.00 133.38 ? 324  ASP C CA    1 
ATOM   6078  C  C     . ASP C 2 324  ? 45.815  -30.974 68.430  1.00 135.81 ? 324  ASP C C     1 
ATOM   6079  O  O     . ASP C 2 324  ? 45.130  -29.982 68.193  1.00 142.62 ? 324  ASP C O     1 
ATOM   6080  C  CB    . ASP C 2 324  ? 45.404  -32.432 70.414  1.00 129.40 ? 324  ASP C CB    1 
ATOM   6081  C  CG    . ASP C 2 324  ? 44.361  -31.710 71.248  1.00 135.20 ? 324  ASP C CG    1 
ATOM   6082  O  OD1   . ASP C 2 324  ? 43.948  -30.595 70.859  1.00 139.11 ? 324  ASP C OD1   1 
ATOM   6083  O  OD2   . ASP C 2 324  ? 43.941  -32.256 72.292  1.00 137.99 ? 324  ASP C OD2   1 
ATOM   6084  N  N     . ILE C 2 325  ? 47.133  -30.988 68.296  1.00 132.82 ? 325  ILE C N     1 
ATOM   6085  C  CA    . ILE C 2 325  ? 47.922  -29.813 67.914  1.00 133.14 ? 325  ILE C CA    1 
ATOM   6086  C  C     . ILE C 2 325  ? 48.030  -28.795 69.048  1.00 133.38 ? 325  ILE C C     1 
ATOM   6087  O  O     . ILE C 2 325  ? 48.908  -27.952 69.041  1.00 139.85 ? 325  ILE C O     1 
ATOM   6088  C  CB    . ILE C 2 325  ? 47.425  -29.126 66.612  1.00 132.91 ? 325  ILE C CB    1 
ATOM   6089  C  CG1   . ILE C 2 325  ? 47.203  -30.158 65.521  1.00 141.28 ? 325  ILE C CG1   1 
ATOM   6090  C  CG2   . ILE C 2 325  ? 48.423  -28.107 66.100  1.00 141.31 ? 325  ILE C CG2   1 
ATOM   6091  C  CD1   . ILE C 2 325  ? 46.907  -29.538 64.187  1.00 151.68 ? 325  ILE C CD1   1 
ATOM   6092  N  N     . ASP C 2 326  ? 47.162  -28.863 70.041  1.00 129.83 ? 326  ASP C N     1 
ATOM   6093  C  CA    . ASP C 2 326  ? 47.447  -28.133 71.266  1.00 132.29 ? 326  ASP C CA    1 
ATOM   6094  C  C     . ASP C 2 326  ? 48.017  -29.075 72.324  1.00 132.91 ? 326  ASP C C     1 
ATOM   6095  O  O     . ASP C 2 326  ? 48.429  -28.633 73.405  1.00 132.89 ? 326  ASP C O     1 
ATOM   6096  C  CB    . ASP C 2 326  ? 46.201  -27.429 71.787  1.00 139.13 ? 326  ASP C CB    1 
ATOM   6097  C  CG    . ASP C 2 326  ? 45.817  -26.235 70.951  1.00 141.42 ? 326  ASP C CG    1 
ATOM   6098  O  OD1   . ASP C 2 326  ? 46.731  -25.543 70.457  1.00 138.59 ? 326  ASP C OD1   1 
ATOM   6099  O  OD2   . ASP C 2 326  ? 44.601  -25.987 70.791  1.00 147.02 ? 326  ASP C OD2   1 
ATOM   6100  N  N     . HIS C 2 327  ? 48.046  -30.370 71.998  1.00 129.60 ? 327  HIS C N     1 
ATOM   6101  C  CA    . HIS C 2 327  ? 48.560  -31.399 72.897  1.00 122.66 ? 327  HIS C CA    1 
ATOM   6102  C  C     . HIS C 2 327  ? 50.028  -31.119 73.075  1.00 122.25 ? 327  HIS C C     1 
ATOM   6103  O  O     . HIS C 2 327  ? 50.671  -30.640 72.149  1.00 126.15 ? 327  HIS C O     1 
ATOM   6104  C  CB    . HIS C 2 327  ? 48.381  -32.780 72.280  1.00 121.48 ? 327  HIS C CB    1 
ATOM   6105  C  CG    . HIS C 2 327  ? 48.236  -33.884 73.283  1.00 119.30 ? 327  HIS C CG    1 
ATOM   6106  N  ND1   . HIS C 2 327  ? 49.283  -34.332 74.058  1.00 117.74 ? 327  HIS C ND1   1 
ATOM   6107  C  CD2   . HIS C 2 327  ? 47.167  -34.650 73.615  1.00 115.67 ? 327  HIS C CD2   1 
ATOM   6108  C  CE1   . HIS C 2 327  ? 48.862  -35.316 74.835  1.00 117.10 ? 327  HIS C CE1   1 
ATOM   6109  N  NE2   . HIS C 2 327  ? 47.584  -35.530 74.583  1.00 111.06 ? 327  HIS C NE2   1 
ATOM   6110  N  N     . LEU C 2 328  ? 50.571  -31.414 74.250  1.00 121.33 ? 328  LEU C N     1 
ATOM   6111  C  CA    . LEU C 2 328  ? 51.975  -31.102 74.525  1.00 121.00 ? 328  LEU C CA    1 
ATOM   6112  C  C     . LEU C 2 328  ? 52.868  -32.272 74.106  1.00 123.92 ? 328  LEU C C     1 
ATOM   6113  O  O     . LEU C 2 328  ? 54.055  -32.335 74.468  1.00 120.58 ? 328  LEU C O     1 
ATOM   6114  C  CB    . LEU C 2 328  ? 52.214  -30.640 75.962  1.00 112.01 ? 328  LEU C CB    1 
ATOM   6115  C  CG    . LEU C 2 328  ? 51.576  -29.299 76.364  1.00 110.98 ? 328  LEU C CG    1 
ATOM   6116  C  CD1   . LEU C 2 328  ? 52.358  -28.731 77.513  1.00 114.29 ? 328  LEU C CD1   1 
ATOM   6117  C  CD2   . LEU C 2 328  ? 51.487  -28.277 75.235  1.00 109.11 ? 328  LEU C CD2   1 
ATOM   6118  N  N     . GLY C 2 329  ? 52.246  -33.226 73.404  1.00 122.96 ? 329  GLY C N     1 
ATOM   6119  C  CA    . GLY C 2 329  ? 52.952  -34.174 72.559  1.00 122.50 ? 329  GLY C CA    1 
ATOM   6120  C  C     . GLY C 2 329  ? 53.002  -33.772 71.084  1.00 125.81 ? 329  GLY C C     1 
ATOM   6121  O  O     . GLY C 2 329  ? 53.857  -34.242 70.341  1.00 129.34 ? 329  GLY C O     1 
ATOM   6122  N  N     . ASN C 2 330  ? 52.079  -32.912 70.650  1.00 126.72 ? 330  ASN C N     1 
ATOM   6123  C  CA    . ASN C 2 330  ? 52.072  -32.384 69.276  1.00 124.04 ? 330  ASN C CA    1 
ATOM   6124  C  C     . ASN C 2 330  ? 52.705  -30.982 69.134  1.00 122.96 ? 330  ASN C C     1 
ATOM   6125  O  O     . ASN C 2 330  ? 52.720  -30.405 68.042  1.00 120.15 ? 330  ASN C O     1 
ATOM   6126  C  CB    . ASN C 2 330  ? 50.650  -32.398 68.693  1.00 128.83 ? 330  ASN C CB    1 
ATOM   6127  C  CG    . ASN C 2 330  ? 50.069  -33.816 68.561  1.00 135.72 ? 330  ASN C CG    1 
ATOM   6128  O  OD1   . ASN C 2 330  ? 50.779  -34.771 68.228  1.00 138.56 ? 330  ASN C OD1   1 
ATOM   6129  N  ND2   . ASN C 2 330  ? 48.762  -33.945 68.804  1.00 134.74 ? 330  ASN C ND2   1 
ATOM   6130  N  N     . ARG C 2 331  ? 53.182  -30.437 70.256  1.00 123.62 ? 331  ARG C N     1 
ATOM   6131  C  CA    . ARG C 2 331  ? 53.871  -29.143 70.331  1.00 118.56 ? 331  ARG C CA    1 
ATOM   6132  C  C     . ARG C 2 331  ? 55.205  -29.401 71.024  1.00 110.60 ? 331  ARG C C     1 
ATOM   6133  O  O     . ARG C 2 331  ? 55.303  -30.293 71.860  1.00 109.03 ? 331  ARG C O     1 
ATOM   6134  C  CB    . ARG C 2 331  ? 53.058  -28.119 71.156  1.00 117.80 ? 331  ARG C CB    1 
ATOM   6135  C  CG    . ARG C 2 331  ? 51.703  -27.657 70.572  1.00 122.34 ? 331  ARG C CG    1 
ATOM   6136  C  CD    . ARG C 2 331  ? 50.920  -26.701 71.501  1.00 122.08 ? 331  ARG C CD    1 
ATOM   6137  N  NE    . ARG C 2 331  ? 51.386  -25.309 71.459  1.00 125.94 ? 331  ARG C NE    1 
ATOM   6138  C  CZ    . ARG C 2 331  ? 50.878  -24.311 72.188  1.00 128.25 ? 331  ARG C CZ    1 
ATOM   6139  N  NH1   . ARG C 2 331  ? 49.876  -24.540 73.032  1.00 130.34 ? 331  ARG C NH1   1 
ATOM   6140  N  NH2   . ARG C 2 331  ? 51.383  -23.083 72.083  1.00 116.73 ? 331  ARG C NH2   1 
ATOM   6141  N  N     . ARG C 2 332  ? 56.233  -28.631 70.700  1.00 110.32 ? 332  ARG C N     1 
ATOM   6142  C  CA    . ARG C 2 332  ? 57.553  -28.933 71.245  1.00 110.73 ? 332  ARG C CA    1 
ATOM   6143  C  C     . ARG C 2 332  ? 58.421  -27.725 71.561  1.00 110.02 ? 332  ARG C C     1 
ATOM   6144  O  O     . ARG C 2 332  ? 58.213  -26.639 71.036  1.00 114.07 ? 332  ARG C O     1 
ATOM   6145  C  CB    . ARG C 2 332  ? 58.310  -29.849 70.290  1.00 116.24 ? 332  ARG C CB    1 
ATOM   6146  C  CG    . ARG C 2 332  ? 58.579  -29.238 68.939  1.00 119.27 ? 332  ARG C CG    1 
ATOM   6147  C  CD    . ARG C 2 332  ? 59.302  -30.208 68.046  1.00 121.20 ? 332  ARG C CD    1 
ATOM   6148  N  NE    . ARG C 2 332  ? 60.605  -30.562 68.583  1.00 125.65 ? 332  ARG C NE    1 
ATOM   6149  C  CZ    . ARG C 2 332  ? 61.716  -29.910 68.278  1.00 127.27 ? 332  ARG C CZ    1 
ATOM   6150  N  NH1   . ARG C 2 332  ? 61.647  -28.881 67.449  1.00 127.13 ? 332  ARG C NH1   1 
ATOM   6151  N  NH2   . ARG C 2 332  ? 62.881  -30.277 68.797  1.00 126.23 ? 332  ARG C NH2   1 
ATOM   6152  N  N     . ILE C 2 333  ? 59.422  -27.936 72.402  1.00 108.33 ? 333  ILE C N     1 
ATOM   6153  C  CA    . ILE C 2 333  ? 60.305  -26.856 72.825  1.00 111.62 ? 333  ILE C CA    1 
ATOM   6154  C  C     . ILE C 2 333  ? 61.650  -26.823 72.096  1.00 117.72 ? 333  ILE C C     1 
ATOM   6155  O  O     . ILE C 2 333  ? 62.442  -27.771 72.158  1.00 120.05 ? 333  ILE C O     1 
ATOM   6156  C  CB    . ILE C 2 333  ? 60.563  -26.925 74.339  1.00 110.85 ? 333  ILE C CB    1 
ATOM   6157  C  CG1   . ILE C 2 333  ? 59.249  -26.820 75.081  1.00 105.31 ? 333  ILE C CG1   1 
ATOM   6158  C  CG2   . ILE C 2 333  ? 61.467  -25.798 74.796  1.00 110.36 ? 333  ILE C CG2   1 
ATOM   6159  C  CD1   . ILE C 2 333  ? 58.490  -25.591 74.722  1.00 108.98 ? 333  ILE C CD1   1 
ATOM   6160  N  N     . ARG C 2 334  ? 61.909  -25.713 71.415  1.00 115.15 ? 334  ARG C N     1 
ATOM   6161  C  CA    . ARG C 2 334  ? 63.211  -25.467 70.812  1.00 117.94 ? 334  ARG C CA    1 
ATOM   6162  C  C     . ARG C 2 334  ? 64.022  -24.577 71.768  1.00 119.56 ? 334  ARG C C     1 
ATOM   6163  O  O     . ARG C 2 334  ? 63.631  -23.439 72.022  1.00 121.38 ? 334  ARG C O     1 
ATOM   6164  C  CB    . ARG C 2 334  ? 63.025  -24.779 69.453  1.00 118.60 ? 334  ARG C CB    1 
ATOM   6165  C  CG    . ARG C 2 334  ? 62.098  -25.526 68.485  1.00 120.64 ? 334  ARG C CG    1 
ATOM   6166  C  CD    . ARG C 2 334  ? 61.792  -24.718 67.224  1.00 121.33 ? 334  ARG C CD    1 
ATOM   6167  N  NE    . ARG C 2 334  ? 62.975  -24.081 66.653  1.00 124.08 ? 334  ARG C NE    1 
ATOM   6168  C  CZ    . ARG C 2 334  ? 62.940  -23.204 65.654  1.00 131.88 ? 334  ARG C CZ    1 
ATOM   6169  N  NH1   . ARG C 2 334  ? 61.778  -22.864 65.110  1.00 136.46 ? 334  ARG C NH1   1 
ATOM   6170  N  NH2   . ARG C 2 334  ? 64.065  -22.661 65.201  1.00 131.91 ? 334  ARG C NH2   1 
ATOM   6171  N  N     . THR C 2 335  ? 65.131  -25.088 72.309  1.00 118.98 ? 335  THR C N     1 
ATOM   6172  C  CA    . THR C 2 335  ? 65.878  -24.381 73.362  1.00 115.69 ? 335  THR C CA    1 
ATOM   6173  C  C     . THR C 2 335  ? 67.041  -23.565 72.830  1.00 115.74 ? 335  THR C C     1 
ATOM   6174  O  O     . THR C 2 335  ? 67.233  -23.480 71.627  1.00 116.39 ? 335  THR C O     1 
ATOM   6175  C  CB    . THR C 2 335  ? 66.471  -25.356 74.367  1.00 117.94 ? 335  THR C CB    1 
ATOM   6176  O  OG1   . THR C 2 335  ? 67.497  -26.118 73.722  1.00 120.54 ? 335  THR C OG1   1 
ATOM   6177  C  CG2   . THR C 2 335  ? 65.399  -26.290 74.894  1.00 122.43 ? 335  THR C CG2   1 
ATOM   6178  N  N     . VAL C 2 336  ? 67.835  -22.995 73.736  1.00 114.61 ? 336  VAL C N     1 
ATOM   6179  C  CA    . VAL C 2 336  ? 68.943  -22.122 73.345  1.00 111.40 ? 336  VAL C CA    1 
ATOM   6180  C  C     . VAL C 2 336  ? 69.916  -22.843 72.455  1.00 115.36 ? 336  VAL C C     1 
ATOM   6181  O  O     . VAL C 2 336  ? 70.506  -22.237 71.577  1.00 115.05 ? 336  VAL C O     1 
ATOM   6182  C  CB    . VAL C 2 336  ? 69.680  -21.537 74.562  1.00 108.71 ? 336  VAL C CB    1 
ATOM   6183  C  CG1   . VAL C 2 336  ? 68.735  -21.455 75.679  1.00 115.66 ? 336  VAL C CG1   1 
ATOM   6184  C  CG2   . VAL C 2 336  ? 70.847  -22.400 74.991  1.00 108.93 ? 336  VAL C CG2   1 
ATOM   6185  N  N     . GLY C 2 337  ? 70.046  -24.149 72.669  1.00 123.06 ? 337  GLY C N     1 
ATOM   6186  C  CA    . GLY C 2 337  ? 71.034  -24.961 71.981  1.00 122.09 ? 337  GLY C CA    1 
ATOM   6187  C  C     . GLY C 2 337  ? 70.613  -25.281 70.569  1.00 118.89 ? 337  GLY C C     1 
ATOM   6188  O  O     . GLY C 2 337  ? 71.436  -25.276 69.653  1.00 117.20 ? 337  GLY C O     1 
ATOM   6189  N  N     . GLU C 2 338  ? 69.326  -25.566 70.396  1.00 115.46 ? 338  GLU C N     1 
ATOM   6190  C  CA    . GLU C 2 338  ? 68.796  -25.833 69.069  1.00 117.42 ? 338  GLU C CA    1 
ATOM   6191  C  C     . GLU C 2 338  ? 68.618  -24.538 68.285  1.00 123.40 ? 338  GLU C C     1 
ATOM   6192  O  O     . GLU C 2 338  ? 68.784  -24.521 67.067  1.00 127.73 ? 338  GLU C O     1 
ATOM   6193  C  CB    . GLU C 2 338  ? 67.462  -26.578 69.136  1.00 118.99 ? 338  GLU C CB    1 
ATOM   6194  C  CG    . GLU C 2 338  ? 66.907  -26.949 67.757  1.00 126.01 ? 338  GLU C CG    1 
ATOM   6195  C  CD    . GLU C 2 338  ? 65.414  -27.278 67.762  1.00 136.45 ? 338  GLU C CD    1 
ATOM   6196  O  OE1   . GLU C 2 338  ? 64.898  -27.788 68.797  1.00 131.92 ? 338  GLU C OE1   1 
ATOM   6197  O  OE2   . GLU C 2 338  ? 64.765  -27.023 66.715  1.00 136.58 ? 338  GLU C OE2   1 
ATOM   6198  N  N     . LEU C 2 339  ? 68.282  -23.454 68.982  1.00 122.95 ? 339  LEU C N     1 
ATOM   6199  C  CA    . LEU C 2 339  ? 67.952  -22.191 68.318  1.00 120.40 ? 339  LEU C CA    1 
ATOM   6200  C  C     . LEU C 2 339  ? 69.168  -21.565 67.674  1.00 120.30 ? 339  LEU C C     1 
ATOM   6201  O  O     . LEU C 2 339  ? 69.058  -20.880 66.659  1.00 126.11 ? 339  LEU C O     1 
ATOM   6202  C  CB    . LEU C 2 339  ? 67.347  -21.193 69.303  1.00 117.47 ? 339  LEU C CB    1 
ATOM   6203  C  CG    . LEU C 2 339  ? 65.929  -21.465 69.794  1.00 114.48 ? 339  LEU C CG    1 
ATOM   6204  C  CD1   . LEU C 2 339  ? 65.514  -20.320 70.690  1.00 113.85 ? 339  LEU C CD1   1 
ATOM   6205  C  CD2   . LEU C 2 339  ? 64.959  -21.668 68.635  1.00 116.10 ? 339  LEU C CD2   1 
ATOM   6206  N  N     . MET C 2 340  ? 70.323  -21.783 68.290  1.00 116.41 ? 340  MET C N     1 
ATOM   6207  C  CA    . MET C 2 340  ? 71.574  -21.253 67.775  1.00 117.23 ? 340  MET C CA    1 
ATOM   6208  C  C     . MET C 2 340  ? 72.116  -22.134 66.656  1.00 121.10 ? 340  MET C C     1 
ATOM   6209  O  O     . MET C 2 340  ? 72.630  -21.629 65.656  1.00 123.44 ? 340  MET C O     1 
ATOM   6210  C  CB    . MET C 2 340  ? 72.588  -21.113 68.909  1.00 117.46 ? 340  MET C CB    1 
ATOM   6211  C  CG    . MET C 2 340  ? 73.997  -20.819 68.464  1.00 114.71 ? 340  MET C CG    1 
ATOM   6212  S  SD    . MET C 2 340  ? 74.915  -22.325 68.139  1.00 113.06 ? 340  MET C SD    1 
ATOM   6213  C  CE    . MET C 2 340  ? 76.145  -21.708 67.014  1.00 120.43 ? 340  MET C CE    1 
ATOM   6214  N  N     . THR C 2 341  ? 72.008  -23.450 66.845  1.00 119.60 ? 341  THR C N     1 
ATOM   6215  C  CA    . THR C 2 341  ? 72.444  -24.428 65.849  1.00 118.62 ? 341  THR C CA    1 
ATOM   6216  C  C     . THR C 2 341  ? 71.767  -24.154 64.525  1.00 119.66 ? 341  THR C C     1 
ATOM   6217  O  O     . THR C 2 341  ? 72.368  -24.305 63.467  1.00 123.94 ? 341  THR C O     1 
ATOM   6218  C  CB    . THR C 2 341  ? 72.138  -25.874 66.287  1.00 120.41 ? 341  THR C CB    1 
ATOM   6219  O  OG1   . THR C 2 341  ? 73.166  -26.331 67.171  1.00 122.79 ? 341  THR C OG1   1 
ATOM   6220  C  CG2   . THR C 2 341  ? 72.069  -26.815 65.092  1.00 122.45 ? 341  THR C CG2   1 
ATOM   6221  N  N     . ASP C 2 342  ? 70.515  -23.732 64.580  1.00 118.45 ? 342  ASP C N     1 
ATOM   6222  C  CA    . ASP C 2 342  ? 69.824  -23.388 63.358  1.00 120.42 ? 342  ASP C CA    1 
ATOM   6223  C  C     . ASP C 2 342  ? 70.498  -22.233 62.646  1.00 123.07 ? 342  ASP C C     1 
ATOM   6224  O  O     . ASP C 2 342  ? 70.971  -22.396 61.523  1.00 129.07 ? 342  ASP C O     1 
ATOM   6225  C  CB    . ASP C 2 342  ? 68.355  -23.089 63.626  1.00 125.64 ? 342  ASP C CB    1 
ATOM   6226  C  CG    . ASP C 2 342  ? 67.507  -24.335 63.582  1.00 138.75 ? 342  ASP C CG    1 
ATOM   6227  O  OD1   . ASP C 2 342  ? 68.036  -25.414 63.928  1.00 139.64 ? 342  ASP C OD1   1 
ATOM   6228  O  OD2   . ASP C 2 342  ? 66.326  -24.246 63.186  1.00 151.38 ? 342  ASP C OD2   1 
ATOM   6229  N  N     . GLN C 2 343  ? 70.595  -21.086 63.307  1.00 118.22 ? 343  GLN C N     1 
ATOM   6230  C  CA    . GLN C 2 343  ? 71.205  -19.926 62.678  1.00 118.86 ? 343  GLN C CA    1 
ATOM   6231  C  C     . GLN C 2 343  ? 72.622  -20.251 62.237  1.00 122.10 ? 343  GLN C C     1 
ATOM   6232  O  O     . GLN C 2 343  ? 73.131  -19.664 61.286  1.00 124.42 ? 343  GLN C O     1 
ATOM   6233  C  CB    . GLN C 2 343  ? 71.177  -18.720 63.604  1.00 121.05 ? 343  GLN C CB    1 
ATOM   6234  C  CG    . GLN C 2 343  ? 69.831  -18.011 63.618  1.00 127.18 ? 343  GLN C CG    1 
ATOM   6235  C  CD    . GLN C 2 343  ? 69.553  -17.248 62.333  1.00 132.19 ? 343  GLN C CD    1 
ATOM   6236  O  OE1   . GLN C 2 343  ? 70.387  -16.465 61.865  1.00 128.49 ? 343  GLN C OE1   1 
ATOM   6237  N  NE2   . GLN C 2 343  ? 68.373  -17.473 61.754  1.00 138.01 ? 343  GLN C NE2   1 
ATOM   6238  N  N     . PHE C 2 344  ? 73.239  -21.214 62.918  1.00 122.37 ? 344  PHE C N     1 
ATOM   6239  C  CA    . PHE C 2 344  ? 74.541  -21.739 62.519  1.00 122.22 ? 344  PHE C CA    1 
ATOM   6240  C  C     . PHE C 2 344  ? 74.426  -22.643 61.299  1.00 125.68 ? 344  PHE C C     1 
ATOM   6241  O  O     . PHE C 2 344  ? 75.371  -22.755 60.529  1.00 130.09 ? 344  PHE C O     1 
ATOM   6242  C  CB    . PHE C 2 344  ? 75.207  -22.503 63.668  1.00 118.30 ? 344  PHE C CB    1 
ATOM   6243  C  CG    . PHE C 2 344  ? 76.620  -22.965 63.370  1.00 118.60 ? 344  PHE C CG    1 
ATOM   6244  C  CD1   . PHE C 2 344  ? 76.860  -24.150 62.695  1.00 123.25 ? 344  PHE C CD1   1 
ATOM   6245  C  CD2   . PHE C 2 344  ? 77.705  -22.226 63.798  1.00 122.21 ? 344  PHE C CD2   1 
ATOM   6246  C  CE1   . PHE C 2 344  ? 78.144  -24.570 62.436  1.00 125.76 ? 344  PHE C CE1   1 
ATOM   6247  C  CE2   . PHE C 2 344  ? 78.995  -22.643 63.547  1.00 119.60 ? 344  PHE C CE2   1 
ATOM   6248  C  CZ    . PHE C 2 344  ? 79.213  -23.815 62.867  1.00 126.26 ? 344  PHE C CZ    1 
ATOM   6249  N  N     . ARG C 2 345  ? 73.298  -23.316 61.116  1.00 124.73 ? 345  ARG C N     1 
ATOM   6250  C  CA    . ARG C 2 345  ? 73.198  -24.181 59.952  1.00 126.57 ? 345  ARG C CA    1 
ATOM   6251  C  C     . ARG C 2 345  ? 72.983  -23.316 58.732  1.00 131.62 ? 345  ARG C C     1 
ATOM   6252  O  O     . ARG C 2 345  ? 73.365  -23.685 57.622  1.00 141.19 ? 345  ARG C O     1 
ATOM   6253  C  CB    . ARG C 2 345  ? 72.084  -25.209 60.079  1.00 130.04 ? 345  ARG C CB    1 
ATOM   6254  C  CG    . ARG C 2 345  ? 71.906  -26.037 58.822  1.00 140.40 ? 345  ARG C CG    1 
ATOM   6255  C  CD    . ARG C 2 345  ? 70.830  -27.072 58.992  1.00 154.61 ? 345  ARG C CD    1 
ATOM   6256  N  NE    . ARG C 2 345  ? 71.325  -28.235 59.723  1.00 157.78 ? 345  ARG C NE    1 
ATOM   6257  C  CZ    . ARG C 2 345  ? 71.158  -28.438 61.027  1.00 153.43 ? 345  ARG C CZ    1 
ATOM   6258  N  NH1   . ARG C 2 345  ? 70.494  -27.560 61.765  1.00 150.75 ? 345  ARG C NH1   1 
ATOM   6259  N  NH2   . ARG C 2 345  ? 71.650  -29.530 61.595  1.00 150.99 ? 345  ARG C NH2   1 
ATOM   6260  N  N     . VAL C 2 346  ? 72.384  -22.150 58.939  1.00 125.57 ? 346  VAL C N     1 
ATOM   6261  C  CA    . VAL C 2 346  ? 72.173  -21.230 57.831  1.00 131.37 ? 346  VAL C CA    1 
ATOM   6262  C  C     . VAL C 2 346  ? 73.425  -20.408 57.500  1.00 132.10 ? 346  VAL C C     1 
ATOM   6263  O  O     . VAL C 2 346  ? 73.699  -20.115 56.337  1.00 138.03 ? 346  VAL C O     1 
ATOM   6264  C  CB    . VAL C 2 346  ? 70.936  -20.347 58.053  1.00 137.51 ? 346  VAL C CB    1 
ATOM   6265  C  CG1   . VAL C 2 346  ? 70.677  -19.476 56.834  1.00 148.82 ? 346  VAL C CG1   1 
ATOM   6266  C  CG2   . VAL C 2 346  ? 69.723  -21.228 58.324  1.00 137.94 ? 346  VAL C CG2   1 
ATOM   6267  N  N     . GLY C 2 347  ? 74.197  -20.057 58.517  1.00 126.55 ? 347  GLY C N     1 
ATOM   6268  C  CA    . GLY C 2 347  ? 75.445  -19.357 58.289  1.00 129.41 ? 347  GLY C CA    1 
ATOM   6269  C  C     . GLY C 2 347  ? 76.493  -20.233 57.631  1.00 134.48 ? 347  GLY C C     1 
ATOM   6270  O  O     . GLY C 2 347  ? 77.431  -19.730 57.018  1.00 141.07 ? 347  GLY C O     1 
ATOM   6271  N  N     . LEU C 2 348  ? 76.341  -21.546 57.779  1.00 133.88 ? 348  LEU C N     1 
ATOM   6272  C  CA    . LEU C 2 348  ? 77.301  -22.512 57.254  1.00 132.76 ? 348  LEU C CA    1 
ATOM   6273  C  C     . LEU C 2 348  ? 77.072  -22.778 55.781  1.00 135.73 ? 348  LEU C C     1 
ATOM   6274  O  O     . LEU C 2 348  ? 78.013  -22.793 54.999  1.00 142.54 ? 348  LEU C O     1 
ATOM   6275  C  CB    . LEU C 2 348  ? 77.209  -23.830 58.032  1.00 131.37 ? 348  LEU C CB    1 
ATOM   6276  C  CG    . LEU C 2 348  ? 78.456  -24.697 58.167  1.00 127.94 ? 348  LEU C CG    1 
ATOM   6277  C  CD1   . LEU C 2 348  ? 79.596  -23.902 58.768  1.00 124.55 ? 348  LEU C CD1   1 
ATOM   6278  C  CD2   . LEU C 2 348  ? 78.141  -25.883 59.035  1.00 128.06 ? 348  LEU C CD2   1 
ATOM   6279  N  N     . ALA C 2 349  ? 75.818  -22.971 55.394  1.00 134.40 ? 349  ALA C N     1 
ATOM   6280  C  CA    . ALA C 2 349  ? 75.525  -23.351 54.019  1.00 141.51 ? 349  ALA C CA    1 
ATOM   6281  C  C     . ALA C 2 349  ? 75.672  -22.179 53.051  1.00 147.12 ? 349  ALA C C     1 
ATOM   6282  O  O     . ALA C 2 349  ? 75.718  -22.374 51.834  1.00 151.85 ? 349  ALA C O     1 
ATOM   6283  C  CB    . ALA C 2 349  ? 74.145  -23.975 53.917  1.00 141.92 ? 349  ALA C CB    1 
ATOM   6284  N  N     . ARG C 2 350  ? 75.744  -20.966 53.594  1.00 144.58 ? 350  ARG C N     1 
ATOM   6285  C  CA    . ARG C 2 350  ? 76.086  -19.800 52.787  1.00 147.96 ? 350  ARG C CA    1 
ATOM   6286  C  C     . ARG C 2 350  ? 77.579  -19.768 52.559  1.00 152.46 ? 350  ARG C C     1 
ATOM   6287  O  O     . ARG C 2 350  ? 78.053  -19.345 51.509  1.00 160.56 ? 350  ARG C O     1 
ATOM   6288  C  CB    . ARG C 2 350  ? 75.668  -18.501 53.463  1.00 142.92 ? 350  ARG C CB    1 
ATOM   6289  C  CG    . ARG C 2 350  ? 74.192  -18.249 53.421  1.00 148.63 ? 350  ARG C CG    1 
ATOM   6290  C  CD    . ARG C 2 350  ? 73.896  -16.808 53.743  1.00 154.84 ? 350  ARG C CD    1 
ATOM   6291  N  NE    . ARG C 2 350  ? 72.602  -16.674 54.402  1.00 152.84 ? 350  ARG C NE    1 
ATOM   6292  C  CZ    . ARG C 2 350  ? 72.437  -16.320 55.673  1.00 142.65 ? 350  ARG C CZ    1 
ATOM   6293  N  NH1   . ARG C 2 350  ? 73.481  -16.038 56.449  1.00 132.34 ? 350  ARG C NH1   1 
ATOM   6294  N  NH2   . ARG C 2 350  ? 71.213  -16.235 56.162  1.00 148.22 ? 350  ARG C NH2   1 
ATOM   6295  N  N     . LEU C 2 351  ? 78.321  -20.209 53.562  1.00 150.22 ? 351  LEU C N     1 
ATOM   6296  C  CA    . LEU C 2 351  ? 79.769  -20.243 53.470  1.00 151.15 ? 351  LEU C CA    1 
ATOM   6297  C  C     . LEU C 2 351  ? 80.175  -21.307 52.460  1.00 151.65 ? 351  LEU C C     1 
ATOM   6298  O  O     . LEU C 2 351  ? 81.181  -21.153 51.764  1.00 153.71 ? 351  LEU C O     1 
ATOM   6299  C  CB    . LEU C 2 351  ? 80.369  -20.517 54.848  1.00 149.90 ? 351  LEU C CB    1 
ATOM   6300  C  CG    . LEU C 2 351  ? 81.882  -20.497 55.042  1.00 148.91 ? 351  LEU C CG    1 
ATOM   6301  C  CD1   . LEU C 2 351  ? 82.237  -20.005 56.442  1.00 145.94 ? 351  LEU C CD1   1 
ATOM   6302  C  CD2   . LEU C 2 351  ? 82.420  -21.886 54.840  1.00 145.38 ? 351  LEU C CD2   1 
ATOM   6303  N  N     . ALA C 2 352  ? 79.373  -22.371 52.379  1.00 151.41 ? 352  ALA C N     1 
ATOM   6304  C  CA    . ALA C 2 352  ? 79.596  -23.475 51.436  1.00 156.16 ? 352  ALA C CA    1 
ATOM   6305  C  C     . ALA C 2 352  ? 79.245  -23.062 50.015  1.00 161.44 ? 352  ALA C C     1 
ATOM   6306  O  O     . ALA C 2 352  ? 79.846  -23.526 49.042  1.00 164.44 ? 352  ALA C O     1 
ATOM   6307  C  CB    . ALA C 2 352  ? 78.785  -24.697 51.838  1.00 149.81 ? 352  ALA C CB    1 
ATOM   6308  N  N     . ARG C 2 353  ? 78.246  -22.201 49.911  1.00 159.39 ? 353  ARG C N     1 
ATOM   6309  C  CA    . ARG C 2 353  ? 77.917  -21.552 48.661  1.00 157.84 ? 353  ARG C CA    1 
ATOM   6310  C  C     . ARG C 2 353  ? 79.135  -20.757 48.171  1.00 163.06 ? 353  ARG C C     1 
ATOM   6311  O  O     . ARG C 2 353  ? 79.493  -20.828 46.999  1.00 165.12 ? 353  ARG C O     1 
ATOM   6312  C  CB    . ARG C 2 353  ? 76.727  -20.631 48.891  1.00 162.98 ? 353  ARG C CB    1 
ATOM   6313  C  CG    . ARG C 2 353  ? 75.936  -20.291 47.659  1.00 177.42 ? 353  ARG C CG    1 
ATOM   6314  C  CD    . ARG C 2 353  ? 74.677  -19.524 48.038  1.00 190.62 ? 353  ARG C CD    1 
ATOM   6315  N  NE    . ARG C 2 353  ? 73.957  -19.053 46.859  1.00 208.39 ? 353  ARG C NE    1 
ATOM   6316  C  CZ    . ARG C 2 353  ? 72.830  -19.589 46.397  1.00 202.32 ? 353  ARG C CZ    1 
ATOM   6317  N  NH1   . ARG C 2 353  ? 72.264  -20.614 47.022  1.00 195.05 ? 353  ARG C NH1   1 
ATOM   6318  N  NH2   . ARG C 2 353  ? 72.262  -19.084 45.311  1.00 200.57 ? 353  ARG C NH2   1 
ATOM   6319  N  N     . GLY C 2 354  ? 79.783  -20.026 49.081  1.00 164.87 ? 354  GLY C N     1 
ATOM   6320  C  CA    . GLY C 2 354  ? 80.958  -19.225 48.759  1.00 161.88 ? 354  GLY C CA    1 
ATOM   6321  C  C     . GLY C 2 354  ? 82.160  -20.080 48.414  1.00 157.55 ? 354  GLY C C     1 
ATOM   6322  O  O     . GLY C 2 354  ? 83.098  -19.633 47.759  1.00 156.03 ? 354  GLY C O     1 
ATOM   6323  N  N     . VAL C 2 355  ? 82.133  -21.321 48.880  1.00 156.78 ? 355  VAL C N     1 
ATOM   6324  C  CA    . VAL C 2 355  ? 83.141  -22.290 48.503  1.00 155.49 ? 355  VAL C CA    1 
ATOM   6325  C  C     . VAL C 2 355  ? 82.965  -22.703 47.036  1.00 160.87 ? 355  VAL C C     1 
ATOM   6326  O  O     . VAL C 2 355  ? 83.890  -22.552 46.236  1.00 165.73 ? 355  VAL C O     1 
ATOM   6327  C  CB    . VAL C 2 355  ? 83.126  -23.520 49.448  1.00 145.01 ? 355  VAL C CB    1 
ATOM   6328  C  CG1   . VAL C 2 355  ? 83.860  -24.669 48.838  1.00 145.87 ? 355  VAL C CG1   1 
ATOM   6329  C  CG2   . VAL C 2 355  ? 83.756  -23.171 50.772  1.00 144.39 ? 355  VAL C CG2   1 
ATOM   6330  N  N     . ARG C 2 356  ? 81.774  -23.176 46.669  1.00 157.84 ? 356  ARG C N     1 
ATOM   6331  C  CA    . ARG C 2 356  ? 81.533  -23.685 45.311  1.00 155.96 ? 356  ARG C CA    1 
ATOM   6332  C  C     . ARG C 2 356  ? 81.664  -22.641 44.209  1.00 159.46 ? 356  ARG C C     1 
ATOM   6333  O  O     . ARG C 2 356  ? 81.840  -22.991 43.046  1.00 158.56 ? 356  ARG C O     1 
ATOM   6334  C  CB    . ARG C 2 356  ? 80.162  -24.341 45.199  1.00 151.65 ? 356  ARG C CB    1 
ATOM   6335  C  CG    . ARG C 2 356  ? 80.105  -25.741 45.740  1.00 154.83 ? 356  ARG C CG    1 
ATOM   6336  C  CD    . ARG C 2 356  ? 78.668  -26.202 45.841  1.00 160.88 ? 356  ARG C CD    1 
ATOM   6337  N  NE    . ARG C 2 356  ? 78.542  -27.502 46.500  1.00 171.66 ? 356  ARG C NE    1 
ATOM   6338  C  CZ    . ARG C 2 356  ? 78.291  -27.673 47.798  1.00 173.57 ? 356  ARG C CZ    1 
ATOM   6339  N  NH1   . ARG C 2 356  ? 78.138  -26.621 48.595  1.00 171.21 ? 356  ARG C NH1   1 
ATOM   6340  N  NH2   . ARG C 2 356  ? 78.192  -28.901 48.305  1.00 166.16 ? 356  ARG C NH2   1 
ATOM   6341  N  N     . GLU C 2 357  ? 81.549  -21.367 44.571  1.00 163.92 ? 357  GLU C N     1 
ATOM   6342  C  CA    . GLU C 2 357  ? 81.740  -20.279 43.617  1.00 166.79 ? 357  GLU C CA    1 
ATOM   6343  C  C     . GLU C 2 357  ? 83.234  -20.053 43.395  1.00 170.29 ? 357  GLU C C     1 
ATOM   6344  O  O     . GLU C 2 357  ? 83.673  -19.728 42.290  1.00 171.72 ? 357  GLU C O     1 
ATOM   6345  C  CB    . GLU C 2 357  ? 81.061  -18.996 44.113  1.00 167.79 ? 357  GLU C CB    1 
ATOM   6346  C  CG    . GLU C 2 357  ? 81.235  -17.781 43.198  1.00 171.38 ? 357  GLU C CG    1 
ATOM   6347  C  CD    . GLU C 2 357  ? 81.826  -16.576 43.925  1.00 175.15 ? 357  GLU C CD    1 
ATOM   6348  O  OE1   . GLU C 2 357  ? 81.702  -16.511 45.168  1.00 175.01 ? 357  GLU C OE1   1 
ATOM   6349  O  OE2   . GLU C 2 357  ? 82.420  -15.697 43.260  1.00 169.53 ? 357  GLU C OE2   1 
ATOM   6350  N  N     . ARG C 2 358  ? 84.018  -20.237 44.450  1.00 168.37 ? 358  ARG C N     1 
ATOM   6351  C  CA    . ARG C 2 358  ? 85.459  -20.078 44.340  1.00 166.09 ? 358  ARG C CA    1 
ATOM   6352  C  C     . ARG C 2 358  ? 86.175  -21.393 44.083  1.00 163.11 ? 358  ARG C C     1 
ATOM   6353  O  O     . ARG C 2 358  ? 87.386  -21.408 43.913  1.00 165.45 ? 358  ARG C O     1 
ATOM   6354  C  CB    . ARG C 2 358  ? 86.022  -19.394 45.578  1.00 165.38 ? 358  ARG C CB    1 
ATOM   6355  C  CG    . ARG C 2 358  ? 85.812  -17.898 45.566  1.00 168.13 ? 358  ARG C CG    1 
ATOM   6356  C  CD    . ARG C 2 358  ? 86.070  -17.320 46.930  1.00 168.10 ? 358  ARG C CD    1 
ATOM   6357  N  NE    . ARG C 2 358  ? 85.080  -17.771 47.900  1.00 164.76 ? 358  ARG C NE    1 
ATOM   6358  C  CZ    . ARG C 2 358  ? 84.981  -17.280 49.129  1.00 166.39 ? 358  ARG C CZ    1 
ATOM   6359  N  NH1   . ARG C 2 358  ? 85.821  -16.330 49.516  1.00 166.54 ? 358  ARG C NH1   1 
ATOM   6360  N  NH2   . ARG C 2 358  ? 84.047  -17.732 49.965  1.00 165.20 ? 358  ARG C NH2   1 
ATOM   6361  N  N     . MET C 2 359  ? 85.431  -22.493 44.042  1.00 161.21 ? 359  MET C N     1 
ATOM   6362  C  CA    . MET C 2 359  ? 86.012  -23.779 43.673  1.00 160.44 ? 359  MET C CA    1 
ATOM   6363  C  C     . MET C 2 359  ? 86.174  -23.890 42.169  1.00 166.14 ? 359  MET C C     1 
ATOM   6364  O  O     . MET C 2 359  ? 86.730  -24.856 41.655  1.00 172.52 ? 359  MET C O     1 
ATOM   6365  C  CB    . MET C 2 359  ? 85.163  -24.939 44.186  1.00 159.02 ? 359  MET C CB    1 
ATOM   6366  C  CG    . MET C 2 359  ? 85.464  -25.317 45.624  1.00 159.79 ? 359  MET C CG    1 
ATOM   6367  S  SD    . MET C 2 359  ? 85.493  -27.094 45.950  1.00 155.80 ? 359  MET C SD    1 
ATOM   6368  C  CE    . MET C 2 359  ? 83.792  -27.530 45.650  1.00 158.40 ? 359  MET C CE    1 
ATOM   6369  N  N     . LEU C 2 360  ? 85.670  -22.897 41.458  1.00 164.22 ? 360  LEU C N     1 
ATOM   6370  C  CA    . LEU C 2 360  ? 85.729  -22.918 40.016  1.00 163.22 ? 360  LEU C CA    1 
ATOM   6371  C  C     . LEU C 2 360  ? 86.803  -21.930 39.601  1.00 170.72 ? 360  LEU C C     1 
ATOM   6372  O  O     . LEU C 2 360  ? 87.922  -22.302 39.241  1.00 178.39 ? 360  LEU C O     1 
ATOM   6373  C  CB    . LEU C 2 360  ? 84.378  -22.487 39.454  1.00 159.43 ? 360  LEU C CB    1 
ATOM   6374  C  CG    . LEU C 2 360  ? 83.148  -23.402 39.556  1.00 154.79 ? 360  LEU C CG    1 
ATOM   6375  C  CD1   . LEU C 2 360  ? 83.183  -24.388 40.712  1.00 152.73 ? 360  LEU C CD1   1 
ATOM   6376  C  CD2   . LEU C 2 360  ? 81.868  -22.580 39.603  1.00 156.17 ? 360  LEU C CD2   1 
ATOM   6377  N  N     . MET C 2 361  ? 86.448  -20.658 39.721  1.00 172.00 ? 361  MET C N     1 
ATOM   6378  C  CA    . MET C 2 361  ? 87.276  -19.533 39.312  1.00 179.69 ? 361  MET C CA    1 
ATOM   6379  C  C     . MET C 2 361  ? 88.535  -19.360 40.166  1.00 194.31 ? 361  MET C C     1 
ATOM   6380  O  O     . MET C 2 361  ? 88.641  -19.940 41.247  1.00 194.82 ? 361  MET C O     1 
ATOM   6381  C  CB    . MET C 2 361  ? 86.436  -18.265 39.364  1.00 177.82 ? 361  MET C CB    1 
ATOM   6382  C  CG    . MET C 2 361  ? 84.993  -18.517 38.997  1.00 172.46 ? 361  MET C CG    1 
ATOM   6383  S  SD    . MET C 2 361  ? 83.990  -17.112 39.457  1.00 179.58 ? 361  MET C SD    1 
ATOM   6384  C  CE    . MET C 2 361  ? 84.462  -16.947 41.180  1.00 175.89 ? 361  MET C CE    1 
ATOM   6385  N  N     . GLY C 2 362  ? 89.487  -18.574 39.655  1.00 204.11 ? 362  GLY C N     1 
ATOM   6386  C  CA    . GLY C 2 362  ? 90.739  -18.272 40.342  1.00 210.49 ? 362  GLY C CA    1 
ATOM   6387  C  C     . GLY C 2 362  ? 91.873  -19.136 39.832  1.00 216.00 ? 362  GLY C C     1 
ATOM   6388  O  O     . GLY C 2 362  ? 91.786  -19.665 38.716  1.00 217.81 ? 362  GLY C O     1 
ATOM   6389  N  N     . SER C 2 363  ? 92.951  -19.258 40.606  1.00 215.50 ? 363  SER C N     1 
ATOM   6390  C  CA    . SER C 2 363  ? 93.838  -20.375 40.364  1.00 214.98 ? 363  SER C CA    1 
ATOM   6391  C  C     . SER C 2 363  ? 92.852  -21.503 40.552  1.00 221.03 ? 363  SER C C     1 
ATOM   6392  O  O     . SER C 2 363  ? 92.206  -21.598 41.597  1.00 219.30 ? 363  SER C O     1 
ATOM   6393  C  CB    . SER C 2 363  ? 94.925  -20.478 41.435  1.00 206.38 ? 363  SER C CB    1 
ATOM   6394  O  OG    . SER C 2 363  ? 95.930  -19.502 41.264  1.00 199.28 ? 363  SER C OG    1 
ATOM   6395  N  N     . GLU C 2 364  ? 92.681  -22.324 39.528  1.00 226.69 ? 364  GLU C N     1 
ATOM   6396  C  CA    . GLU C 2 364  ? 91.841  -23.504 39.650  1.00 231.43 ? 364  GLU C CA    1 
ATOM   6397  C  C     . GLU C 2 364  ? 92.674  -24.612 40.296  1.00 230.49 ? 364  GLU C C     1 
ATOM   6398  O  O     . GLU C 2 364  ? 92.137  -25.558 40.884  1.00 222.84 ? 364  GLU C O     1 
ATOM   6399  C  CB    . GLU C 2 364  ? 91.299  -23.905 38.277  1.00 238.08 ? 364  GLU C CB    1 
ATOM   6400  C  CG    . GLU C 2 364  ? 92.285  -23.647 37.141  1.00 242.79 ? 364  GLU C CG    1 
ATOM   6401  C  CD    . GLU C 2 364  ? 91.701  -23.923 35.767  1.00 248.49 ? 364  GLU C CD    1 
ATOM   6402  O  OE1   . GLU C 2 364  ? 90.628  -23.366 35.444  1.00 237.75 ? 364  GLU C OE1   1 
ATOM   6403  O  OE2   . GLU C 2 364  ? 92.324  -24.699 35.008  1.00 256.39 ? 364  GLU C OE2   1 
ATOM   6404  N  N     . ASP C 2 365  ? 93.992  -24.490 40.119  1.00 231.20 ? 365  ASP C N     1 
ATOM   6405  C  CA    . ASP C 2 365  ? 95.002  -25.362 40.733  1.00 225.44 ? 365  ASP C CA    1 
ATOM   6406  C  C     . ASP C 2 365  ? 95.497  -25.021 42.166  1.00 224.08 ? 365  ASP C C     1 
ATOM   6407  O  O     . ASP C 2 365  ? 95.680  -25.936 42.970  1.00 223.52 ? 365  ASP C O     1 
ATOM   6408  C  CB    . ASP C 2 365  ? 96.185  -25.555 39.770  1.00 225.90 ? 365  ASP C CB    1 
ATOM   6409  C  CG    . ASP C 2 365  ? 96.759  -26.967 39.809  1.00 218.32 ? 365  ASP C CG    1 
ATOM   6410  O  OD1   . ASP C 2 365  ? 96.011  -27.933 40.094  1.00 212.35 ? 365  ASP C OD1   1 
ATOM   6411  O  OD2   . ASP C 2 365  ? 97.971  -27.102 39.542  1.00 210.02 ? 365  ASP C OD2   1 
ATOM   6412  N  N     . SER C 2 366  ? 95.729  -23.742 42.495  1.00 218.84 ? 366  SER C N     1 
ATOM   6413  C  CA    . SER C 2 366  ? 96.288  -23.423 43.825  1.00 205.72 ? 366  SER C CA    1 
ATOM   6414  C  C     . SER C 2 366  ? 95.225  -22.952 44.809  1.00 198.06 ? 366  SER C C     1 
ATOM   6415  O  O     . SER C 2 366  ? 94.840  -21.779 44.822  1.00 199.24 ? 366  SER C O     1 
ATOM   6416  C  CB    . SER C 2 366  ? 97.343  -22.314 43.723  1.00 201.65 ? 366  SER C CB    1 
ATOM   6417  O  OG    . SER C 2 366  ? 97.821  -22.158 42.397  1.00 204.58 ? 366  SER C OG    1 
ATOM   6418  N  N     . LEU C 2 367  ? 94.816  -23.862 45.686  1.00 188.27 ? 367  LEU C N     1 
ATOM   6419  C  CA    . LEU C 2 367  ? 93.786  -23.574 46.663  1.00 179.73 ? 367  LEU C CA    1 
ATOM   6420  C  C     . LEU C 2 367  ? 94.149  -24.239 47.977  1.00 175.30 ? 367  LEU C C     1 
ATOM   6421  O  O     . LEU C 2 367  ? 94.223  -25.463 48.047  1.00 170.27 ? 367  LEU C O     1 
ATOM   6422  C  CB    . LEU C 2 367  ? 92.444  -24.148 46.191  1.00 175.87 ? 367  LEU C CB    1 
ATOM   6423  C  CG    . LEU C 2 367  ? 91.897  -23.783 44.810  1.00 175.78 ? 367  LEU C CG    1 
ATOM   6424  C  CD1   . LEU C 2 367  ? 90.612  -24.547 44.524  1.00 163.26 ? 367  LEU C CD1   1 
ATOM   6425  C  CD2   . LEU C 2 367  ? 91.674  -22.290 44.719  1.00 174.24 ? 367  LEU C CD2   1 
ATOM   6426  N  N     . THR C 2 368  ? 94.319  -23.463 49.039  1.00 173.24 ? 368  THR C N     1 
ATOM   6427  C  CA    . THR C 2 368  ? 94.423  -24.082 50.348  1.00 167.77 ? 368  THR C CA    1 
ATOM   6428  C  C     . THR C 2 368  ? 92.987  -24.290 50.786  1.00 163.58 ? 368  THR C C     1 
ATOM   6429  O  O     . THR C 2 368  ? 92.058  -23.882 50.089  1.00 161.42 ? 368  THR C O     1 
ATOM   6430  C  CB    . THR C 2 368  ? 95.164  -23.187 51.391  1.00 169.37 ? 368  THR C CB    1 
ATOM   6431  O  OG1   . THR C 2 368  ? 95.066  -21.807 51.019  1.00 169.23 ? 368  THR C OG1   1 
ATOM   6432  C  CG2   . THR C 2 368  ? 96.635  -23.567 51.509  1.00 164.57 ? 368  THR C CG2   1 
ATOM   6433  N  N     . PRO C 2 369  ? 92.786  -24.945 51.931  1.00 160.79 ? 369  PRO C N     1 
ATOM   6434  C  CA    . PRO C 2 369  ? 91.475  -24.754 52.547  1.00 156.28 ? 369  PRO C CA    1 
ATOM   6435  C  C     . PRO C 2 369  ? 91.380  -23.335 53.108  1.00 157.02 ? 369  PRO C C     1 
ATOM   6436  O  O     . PRO C 2 369  ? 90.287  -22.795 53.194  1.00 157.70 ? 369  PRO C O     1 
ATOM   6437  C  CB    . PRO C 2 369  ? 91.467  -25.782 53.675  1.00 146.67 ? 369  PRO C CB    1 
ATOM   6438  C  CG    . PRO C 2 369  ? 92.405  -26.837 53.212  1.00 151.37 ? 369  PRO C CG    1 
ATOM   6439  C  CD    . PRO C 2 369  ? 93.488  -26.117 52.474  1.00 156.84 ? 369  PRO C CD    1 
ATOM   6440  N  N     . ALA C 2 370  ? 92.517  -22.739 53.465  1.00 162.02 ? 370  ALA C N     1 
ATOM   6441  C  CA    . ALA C 2 370  ? 92.551  -21.402 54.072  1.00 164.49 ? 370  ALA C CA    1 
ATOM   6442  C  C     . ALA C 2 370  ? 92.036  -20.299 53.149  1.00 163.89 ? 370  ALA C C     1 
ATOM   6443  O  O     . ALA C 2 370  ? 91.414  -19.323 53.598  1.00 159.41 ? 370  ALA C O     1 
ATOM   6444  C  CB    . ALA C 2 370  ? 93.972  -21.070 54.533  1.00 167.55 ? 370  ALA C CB    1 
ATOM   6445  N  N     . LYS C 2 371  ? 92.337  -20.450 51.864  1.00 163.42 ? 371  LYS C N     1 
ATOM   6446  C  CA    . LYS C 2 371  ? 92.001  -19.448 50.863  1.00 164.94 ? 371  LYS C CA    1 
ATOM   6447  C  C     . LYS C 2 371  ? 90.651  -19.741 50.198  1.00 157.87 ? 371  LYS C C     1 
ATOM   6448  O  O     . LYS C 2 371  ? 90.099  -18.909 49.472  1.00 153.87 ? 371  LYS C O     1 
ATOM   6449  C  CB    . LYS C 2 371  ? 93.141  -19.343 49.838  1.00 170.51 ? 371  LYS C CB    1 
ATOM   6450  C  CG    . LYS C 2 371  ? 94.453  -18.778 50.428  1.00 175.86 ? 371  LYS C CG    1 
ATOM   6451  C  CD    . LYS C 2 371  ? 95.615  -18.808 49.428  1.00 182.01 ? 371  LYS C CD    1 
ATOM   6452  C  CE    . LYS C 2 371  ? 96.795  -17.954 49.902  1.00 180.86 ? 371  LYS C CE    1 
ATOM   6453  N  NZ    . LYS C 2 371  ? 96.463  -16.497 49.970  1.00 176.63 ? 371  LYS C NZ    1 
ATOM   6454  N  N     . LEU C 2 372  ? 90.119  -20.924 50.485  1.00 154.99 ? 372  LEU C N     1 
ATOM   6455  C  CA    . LEU C 2 372  ? 88.855  -21.388 49.922  1.00 153.55 ? 372  LEU C CA    1 
ATOM   6456  C  C     . LEU C 2 372  ? 87.661  -21.105 50.860  1.00 151.81 ? 372  LEU C C     1 
ATOM   6457  O  O     . LEU C 2 372  ? 86.528  -21.508 50.584  1.00 148.27 ? 372  LEU C O     1 
ATOM   6458  C  CB    . LEU C 2 372  ? 88.974  -22.884 49.605  1.00 150.39 ? 372  LEU C CB    1 
ATOM   6459  C  CG    . LEU C 2 372  ? 88.026  -23.558 48.614  1.00 147.48 ? 372  LEU C CG    1 
ATOM   6460  C  CD1   . LEU C 2 372  ? 87.803  -22.687 47.394  1.00 153.32 ? 372  LEU C CD1   1 
ATOM   6461  C  CD2   . LEU C 2 372  ? 88.577  -24.912 48.205  1.00 144.30 ? 372  LEU C CD2   1 
ATOM   6462  N  N     . VAL C 2 373  ? 87.921  -20.411 51.967  1.00 152.73 ? 373  VAL C N     1 
ATOM   6463  C  CA    . VAL C 2 373  ? 86.903  -20.192 53.002  1.00 147.71 ? 373  VAL C CA    1 
ATOM   6464  C  C     . VAL C 2 373  ? 86.788  -18.754 53.530  1.00 147.35 ? 373  VAL C C     1 
ATOM   6465  O  O     . VAL C 2 373  ? 87.787  -18.128 53.911  1.00 142.90 ? 373  VAL C O     1 
ATOM   6466  C  CB    . VAL C 2 373  ? 87.105  -21.159 54.195  1.00 147.07 ? 373  VAL C CB    1 
ATOM   6467  C  CG1   . VAL C 2 373  ? 86.522  -20.585 55.488  1.00 140.23 ? 373  VAL C CG1   1 
ATOM   6468  C  CG2   . VAL C 2 373  ? 86.502  -22.522 53.874  1.00 145.04 ? 373  VAL C CG2   1 
ATOM   6469  N  N     . ASN C 2 374  ? 85.553  -18.252 53.554  1.00 145.31 ? 374  ASN C N     1 
ATOM   6470  C  CA    . ASN C 2 374  ? 85.248  -16.939 54.101  1.00 143.83 ? 374  ASN C CA    1 
ATOM   6471  C  C     . ASN C 2 374  ? 84.178  -17.000 55.192  1.00 149.38 ? 374  ASN C C     1 
ATOM   6472  O  O     . ASN C 2 374  ? 83.110  -17.555 54.965  1.00 150.33 ? 374  ASN C O     1 
ATOM   6473  C  CB    . ASN C 2 374  ? 84.790  -16.006 52.987  1.00 144.22 ? 374  ASN C CB    1 
ATOM   6474  C  CG    . ASN C 2 374  ? 85.362  -14.617 53.132  1.00 152.22 ? 374  ASN C CG    1 
ATOM   6475  O  OD1   . ASN C 2 374  ? 85.329  -14.035 54.212  1.00 151.71 ? 374  ASN C OD1   1 
ATOM   6476  N  ND2   . ASN C 2 374  ? 85.917  -14.084 52.047  1.00 160.47 ? 374  ASN C ND2   1 
ATOM   6477  N  N     . SER C 2 375  ? 84.463  -16.402 56.355  1.00 152.29 ? 375  SER C N     1 
ATOM   6478  C  CA    . SER C 2 375  ? 83.593  -16.472 57.539  1.00 139.03 ? 375  SER C CA    1 
ATOM   6479  C  C     . SER C 2 375  ? 82.443  -15.465 57.590  1.00 140.98 ? 375  SER C C     1 
ATOM   6480  O  O     . SER C 2 375  ? 81.531  -15.633 58.388  1.00 141.35 ? 375  SER C O     1 
ATOM   6481  C  CB    . SER C 2 375  ? 84.418  -16.295 58.813  1.00 131.97 ? 375  SER C CB    1 
ATOM   6482  O  OG    . SER C 2 375  ? 85.515  -17.179 58.832  1.00 131.55 ? 375  SER C OG    1 
ATOM   6483  N  N     . ARG C 2 376  ? 82.487  -14.424 56.758  1.00 143.91 ? 376  ARG C N     1 
ATOM   6484  C  CA    . ARG C 2 376  ? 81.462  -13.363 56.767  1.00 141.11 ? 376  ARG C CA    1 
ATOM   6485  C  C     . ARG C 2 376  ? 79.990  -13.815 56.754  1.00 142.62 ? 376  ARG C C     1 
ATOM   6486  O  O     . ARG C 2 376  ? 79.171  -13.192 57.428  1.00 145.68 ? 376  ARG C O     1 
ATOM   6487  C  CB    . ARG C 2 376  ? 81.673  -12.334 55.646  1.00 144.77 ? 376  ARG C CB    1 
ATOM   6488  C  CG    . ARG C 2 376  ? 83.061  -11.728 55.537  1.00 156.64 ? 376  ARG C CG    1 
ATOM   6489  C  CD    . ARG C 2 376  ? 83.651  -11.328 56.884  1.00 161.08 ? 376  ARG C CD    1 
ATOM   6490  N  NE    . ARG C 2 376  ? 84.924  -10.630 56.702  1.00 167.32 ? 376  ARG C NE    1 
ATOM   6491  C  CZ    . ARG C 2 376  ? 85.800  -10.385 57.672  1.00 164.80 ? 376  ARG C CZ    1 
ATOM   6492  N  NH1   . ARG C 2 376  ? 85.554  -10.786 58.914  1.00 158.84 ? 376  ARG C NH1   1 
ATOM   6493  N  NH2   . ARG C 2 376  ? 86.927  -9.740  57.394  1.00 163.93 ? 376  ARG C NH2   1 
ATOM   6494  N  N     . PRO C 2 377  ? 79.637  -14.854 55.960  1.00 139.71 ? 377  PRO C N     1 
ATOM   6495  C  CA    . PRO C 2 377  ? 78.260  -15.360 55.988  1.00 137.66 ? 377  PRO C CA    1 
ATOM   6496  C  C     . PRO C 2 377  ? 77.946  -16.050 57.286  1.00 137.65 ? 377  PRO C C     1 
ATOM   6497  O  O     . PRO C 2 377  ? 76.808  -15.981 57.728  1.00 138.10 ? 377  PRO C O     1 
ATOM   6498  C  CB    . PRO C 2 377  ? 78.239  -16.406 54.877  1.00 136.28 ? 377  PRO C CB    1 
ATOM   6499  C  CG    . PRO C 2 377  ? 79.320  -16.032 53.990  1.00 144.64 ? 377  PRO C CG    1 
ATOM   6500  C  CD    . PRO C 2 377  ? 80.396  -15.488 54.875  1.00 145.69 ? 377  PRO C CD    1 
ATOM   6501  N  N     . LEU C 2 378  ? 78.929  -16.743 57.855  1.00 136.38 ? 378  LEU C N     1 
ATOM   6502  C  CA    . LEU C 2 378  ? 78.751  -17.427 59.133  1.00 134.97 ? 378  LEU C CA    1 
ATOM   6503  C  C     . LEU C 2 378  ? 78.856  -16.478 60.324  1.00 133.75 ? 378  LEU C C     1 
ATOM   6504  O  O     . LEU C 2 378  ? 78.013  -16.519 61.215  1.00 133.07 ? 378  LEU C O     1 
ATOM   6505  C  CB    . LEU C 2 378  ? 79.744  -18.580 59.280  1.00 135.14 ? 378  LEU C CB    1 
ATOM   6506  C  CG    . LEU C 2 378  ? 79.629  -19.450 60.535  1.00 122.69 ? 378  LEU C CG    1 
ATOM   6507  C  CD1   . LEU C 2 378  ? 78.188  -19.817 60.770  1.00 121.40 ? 378  LEU C CD1   1 
ATOM   6508  C  CD2   . LEU C 2 378  ? 80.488  -20.703 60.410  1.00 117.74 ? 378  LEU C CD2   1 
ATOM   6509  N  N     . GLU C 2 379  ? 79.879  -15.627 60.335  1.00 135.04 ? 379  GLU C N     1 
ATOM   6510  C  CA    . GLU C 2 379  ? 80.056  -14.668 61.418  1.00 137.25 ? 379  GLU C CA    1 
ATOM   6511  C  C     . GLU C 2 379  ? 78.811  -13.812 61.581  1.00 143.34 ? 379  GLU C C     1 
ATOM   6512  O  O     . GLU C 2 379  ? 78.169  -13.824 62.635  1.00 142.74 ? 379  GLU C O     1 
ATOM   6513  C  CB    . GLU C 2 379  ? 81.249  -13.749 61.144  1.00 143.72 ? 379  GLU C CB    1 
ATOM   6514  C  CG    . GLU C 2 379  ? 82.595  -14.305 61.564  1.00 151.61 ? 379  GLU C CG    1 
ATOM   6515  C  CD    . GLU C 2 379  ? 83.644  -13.217 61.776  1.00 159.93 ? 379  GLU C CD    1 
ATOM   6516  O  OE1   . GLU C 2 379  ? 84.625  -13.184 61.001  1.00 162.65 ? 379  GLU C OE1   1 
ATOM   6517  O  OE2   . GLU C 2 379  ? 83.491  -12.402 62.718  1.00 155.44 ? 379  GLU C OE2   1 
ATOM   6518  N  N     . ALA C 2 380  ? 78.456  -13.095 60.518  1.00 145.40 ? 380  ALA C N     1 
ATOM   6519  C  CA    . ALA C 2 380  ? 77.287  -12.220 60.532  1.00 147.62 ? 380  ALA C CA    1 
ATOM   6520  C  C     . ALA C 2 380  ? 75.985  -12.967 60.869  1.00 142.08 ? 380  ALA C C     1 
ATOM   6521  O  O     . ALA C 2 380  ? 75.048  -12.382 61.422  1.00 140.26 ? 380  ALA C O     1 
ATOM   6522  C  CB    . ALA C 2 380  ? 77.165  -11.477 59.201  1.00 146.89 ? 380  ALA C CB    1 
ATOM   6523  N  N     . ALA C 2 381  ? 75.948  -14.260 60.547  1.00 137.93 ? 381  ALA C N     1 
ATOM   6524  C  CA    . ALA C 2 381  ? 74.747  -15.072 60.703  1.00 128.48 ? 381  ALA C CA    1 
ATOM   6525  C  C     . ALA C 2 381  ? 74.495  -15.433 62.134  1.00 119.13 ? 381  ALA C C     1 
ATOM   6526  O  O     . ALA C 2 381  ? 73.349  -15.589 62.532  1.00 119.34 ? 381  ALA C O     1 
ATOM   6527  C  CB    . ALA C 2 381  ? 74.854  -16.325 59.908  1.00 133.55 ? 381  ALA C CB    1 
ATOM   6528  N  N     . ILE C 2 382  ? 75.561  -15.626 62.896  1.00 119.89 ? 382  ILE C N     1 
ATOM   6529  C  CA    . ILE C 2 382  ? 75.405  -15.831 64.328  1.00 126.24 ? 382  ILE C CA    1 
ATOM   6530  C  C     . ILE C 2 382  ? 75.237  -14.516 65.082  1.00 131.13 ? 382  ILE C C     1 
ATOM   6531  O  O     . ILE C 2 382  ? 74.394  -14.433 65.989  1.00 124.15 ? 382  ILE C O     1 
ATOM   6532  C  CB    . ILE C 2 382  ? 76.556  -16.622 64.942  1.00 119.80 ? 382  ILE C CB    1 
ATOM   6533  C  CG1   . ILE C 2 382  ? 76.739  -17.943 64.216  1.00 122.89 ? 382  ILE C CG1   1 
ATOM   6534  C  CG2   . ILE C 2 382  ? 76.266  -16.932 66.382  1.00 114.96 ? 382  ILE C CG2   1 
ATOM   6535  C  CD1   . ILE C 2 382  ? 77.923  -18.711 64.705  1.00 124.10 ? 382  ILE C CD1   1 
ATOM   6536  N  N     . ARG C 2 383  ? 76.024  -13.495 64.713  1.00 132.77 ? 383  ARG C N     1 
ATOM   6537  C  CA    . ARG C 2 383  ? 75.928  -12.183 65.370  1.00 132.64 ? 383  ARG C CA    1 
ATOM   6538  C  C     . ARG C 2 383  ? 74.497  -11.688 65.252  1.00 133.43 ? 383  ARG C C     1 
ATOM   6539  O  O     . ARG C 2 383  ? 73.991  -10.996 66.128  1.00 129.61 ? 383  ARG C O     1 
ATOM   6540  C  CB    . ARG C 2 383  ? 76.898  -11.154 64.783  1.00 133.27 ? 383  ARG C CB    1 
ATOM   6541  C  CG    . ARG C 2 383  ? 76.923  -9.828  65.548  1.00 136.46 ? 383  ARG C CG    1 
ATOM   6542  C  CD    . ARG C 2 383  ? 77.907  -8.849  64.933  1.00 141.45 ? 383  ARG C CD    1 
ATOM   6543  N  NE    . ARG C 2 383  ? 77.972  -8.998  63.477  1.00 150.82 ? 383  ARG C NE    1 
ATOM   6544  C  CZ    . ARG C 2 383  ? 79.062  -9.359  62.794  1.00 154.77 ? 383  ARG C CZ    1 
ATOM   6545  N  NH1   . ARG C 2 383  ? 80.205  -9.599  63.427  1.00 148.71 ? 383  ARG C NH1   1 
ATOM   6546  N  NH2   . ARG C 2 383  ? 79.016  -9.476  61.468  1.00 152.92 ? 383  ARG C NH2   1 
ATOM   6547  N  N     . GLU C 2 384  ? 73.849  -12.105 64.169  1.00 136.21 ? 384  GLU C N     1 
ATOM   6548  C  CA    . GLU C 2 384  ? 72.434  -11.864 63.922  1.00 134.43 ? 384  GLU C CA    1 
ATOM   6549  C  C     . GLU C 2 384  ? 71.536  -12.450 65.003  1.00 128.10 ? 384  GLU C C     1 
ATOM   6550  O  O     . GLU C 2 384  ? 70.769  -11.730 65.661  1.00 127.49 ? 384  GLU C O     1 
ATOM   6551  C  CB    . GLU C 2 384  ? 72.059  -12.499 62.581  1.00 134.71 ? 384  GLU C CB    1 
ATOM   6552  C  CG    . GLU C 2 384  ? 71.077  -11.694 61.800  1.00 138.32 ? 384  GLU C CG    1 
ATOM   6553  C  CD    . GLU C 2 384  ? 71.521  -10.260 61.670  1.00 144.10 ? 384  GLU C CD    1 
ATOM   6554  O  OE1   . GLU C 2 384  ? 72.707  -10.035 61.314  1.00 138.38 ? 384  GLU C OE1   1 
ATOM   6555  O  OE2   . GLU C 2 384  ? 70.682  -9.366  61.939  1.00 148.32 ? 384  GLU C OE2   1 
ATOM   6556  N  N     . PHE C 2 385  ? 71.641  -13.763 65.173  1.00 121.83 ? 385  PHE C N     1 
ATOM   6557  C  CA    . PHE C 2 385  ? 70.800  -14.467 66.115  1.00 118.24 ? 385  PHE C CA    1 
ATOM   6558  C  C     . PHE C 2 385  ? 70.947  -13.874 67.488  1.00 115.60 ? 385  PHE C C     1 
ATOM   6559  O  O     . PHE C 2 385  ? 69.978  -13.529 68.128  1.00 112.70 ? 385  PHE C O     1 
ATOM   6560  C  CB    . PHE C 2 385  ? 71.167  -15.938 66.195  1.00 116.43 ? 385  PHE C CB    1 
ATOM   6561  C  CG    . PHE C 2 385  ? 70.384  -16.684 67.229  1.00 114.92 ? 385  PHE C CG    1 
ATOM   6562  C  CD1   . PHE C 2 385  ? 69.038  -16.954 67.038  1.00 114.89 ? 385  PHE C CD1   1 
ATOM   6563  C  CD2   . PHE C 2 385  ? 70.981  -17.095 68.399  1.00 112.84 ? 385  PHE C CD2   1 
ATOM   6564  C  CE1   . PHE C 2 385  ? 68.309  -17.635 67.991  1.00 111.65 ? 385  PHE C CE1   1 
ATOM   6565  C  CE2   . PHE C 2 385  ? 70.257  -17.778 69.353  1.00 113.03 ? 385  PHE C CE2   1 
ATOM   6566  C  CZ    . PHE C 2 385  ? 68.918  -18.048 69.149  1.00 110.94 ? 385  PHE C CZ    1 
ATOM   6567  N  N     . PHE C 2 386  ? 72.173  -13.737 67.944  1.00 114.37 ? 386  PHE C N     1 
ATOM   6568  C  CA    . PHE C 2 386  ? 72.368  -13.212 69.272  1.00 112.29 ? 386  PHE C CA    1 
ATOM   6569  C  C     . PHE C 2 386  ? 72.005  -11.762 69.384  1.00 114.28 ? 386  PHE C C     1 
ATOM   6570  O  O     . PHE C 2 386  ? 71.268  -11.388 70.280  1.00 117.89 ? 386  PHE C O     1 
ATOM   6571  C  CB    . PHE C 2 386  ? 73.785  -13.444 69.724  1.00 114.82 ? 386  PHE C CB    1 
ATOM   6572  C  CG    . PHE C 2 386  ? 74.015  -14.831 70.132  1.00 112.62 ? 386  PHE C CG    1 
ATOM   6573  C  CD1   . PHE C 2 386  ? 74.023  -15.834 69.192  1.00 112.23 ? 386  PHE C CD1   1 
ATOM   6574  C  CD2   . PHE C 2 386  ? 74.150  -15.153 71.454  1.00 111.53 ? 386  PHE C CD2   1 
ATOM   6575  C  CE1   . PHE C 2 386  ? 74.199  -17.127 69.560  1.00 113.01 ? 386  PHE C CE1   1 
ATOM   6576  C  CE2   . PHE C 2 386  ? 74.325  -16.446 71.828  1.00 114.67 ? 386  PHE C CE2   1 
ATOM   6577  C  CZ    . PHE C 2 386  ? 74.352  -17.440 70.878  1.00 113.21 ? 386  PHE C CZ    1 
ATOM   6578  N  N     . SER C 2 387  ? 72.498  -10.946 68.466  1.00 115.68 ? 387  SER C N     1 
ATOM   6579  C  CA    . SER C 2 387  ? 72.357  -9.503  68.615  1.00 121.18 ? 387  SER C CA    1 
ATOM   6580  C  C     . SER C 2 387  ? 70.969  -8.964  68.252  1.00 121.73 ? 387  SER C C     1 
ATOM   6581  O  O     . SER C 2 387  ? 70.315  -8.293  69.051  1.00 119.25 ? 387  SER C O     1 
ATOM   6582  C  CB    . SER C 2 387  ? 73.471  -8.744  67.893  1.00 129.41 ? 387  SER C CB    1 
ATOM   6583  O  OG    . SER C 2 387  ? 73.495  -7.393  68.302  1.00 138.20 ? 387  SER C OG    1 
ATOM   6584  N  N     . ARG C 2 388  ? 70.544  -9.198  67.025  1.00 123.27 ? 388  ARG C N     1 
ATOM   6585  C  CA    . ARG C 2 388  ? 69.337  -8.554  66.558  1.00 124.67 ? 388  ARG C CA    1 
ATOM   6586  C  C     . ARG C 2 388  ? 68.061  -9.385  66.686  1.00 123.08 ? 388  ARG C C     1 
ATOM   6587  O  O     . ARG C 2 388  ? 66.996  -8.932  66.282  1.00 126.80 ? 388  ARG C O     1 
ATOM   6588  C  CB    . ARG C 2 388  ? 69.569  -7.977  65.157  1.00 127.04 ? 388  ARG C CB    1 
ATOM   6589  C  CG    . ARG C 2 388  ? 70.545  -6.790  65.228  1.00 132.25 ? 388  ARG C CG    1 
ATOM   6590  C  CD    . ARG C 2 388  ? 71.400  -6.552  63.968  1.00 145.42 ? 388  ARG C CD    1 
ATOM   6591  N  NE    . ARG C 2 388  ? 72.601  -7.403  63.832  1.00 151.38 ? 388  ARG C NE    1 
ATOM   6592  C  CZ    . ARG C 2 388  ? 73.841  -7.093  64.237  1.00 148.05 ? 388  ARG C CZ    1 
ATOM   6593  N  NH1   . ARG C 2 388  ? 74.099  -5.946  64.855  1.00 148.93 ? 388  ARG C NH1   1 
ATOM   6594  N  NH2   . ARG C 2 388  ? 74.837  -7.950  64.033  1.00 144.20 ? 388  ARG C NH2   1 
ATOM   6595  N  N     . SER C 2 389  ? 68.150  -10.577 67.277  1.00 121.53 ? 389  SER C N     1 
ATOM   6596  C  CA    . SER C 2 389  ? 66.948  -11.425 67.438  1.00 126.11 ? 389  SER C CA    1 
ATOM   6597  C  C     . SER C 2 389  ? 65.906  -11.107 68.522  1.00 126.29 ? 389  SER C C     1 
ATOM   6598  O  O     . SER C 2 389  ? 66.143  -10.358 69.493  1.00 118.10 ? 389  SER C O     1 
ATOM   6599  C  CB    . SER C 2 389  ? 67.256  -12.921 67.488  1.00 119.27 ? 389  SER C CB    1 
ATOM   6600  O  OG    . SER C 2 389  ? 66.058  -13.658 67.692  1.00 113.05 ? 389  SER C OG    1 
ATOM   6601  N  N     . GLN C 2 390  ? 64.737  -11.708 68.299  1.00 127.93 ? 390  GLN C N     1 
ATOM   6602  C  CA    . GLN C 2 390  ? 63.602  -11.616 69.197  1.00 131.59 ? 390  GLN C CA    1 
ATOM   6603  C  C     . GLN C 2 390  ? 63.702  -12.562 70.383  1.00 124.78 ? 390  GLN C C     1 
ATOM   6604  O  O     . GLN C 2 390  ? 63.344  -12.193 71.502  1.00 125.34 ? 390  GLN C O     1 
ATOM   6605  C  CB    . GLN C 2 390  ? 62.296  -11.906 68.459  1.00 140.43 ? 390  GLN C CB    1 
ATOM   6606  C  CG    . GLN C 2 390  ? 61.140  -12.070 69.435  1.00 142.39 ? 390  GLN C CG    1 
ATOM   6607  C  CD    . GLN C 2 390  ? 59.784  -12.078 68.788  1.00 145.40 ? 390  GLN C CD    1 
ATOM   6608  O  OE1   . GLN C 2 390  ? 59.657  -12.167 67.564  1.00 145.79 ? 390  GLN C OE1   1 
ATOM   6609  N  NE2   . GLN C 2 390  ? 58.747  -11.980 69.615  1.00 140.93 ? 390  GLN C NE2   1 
ATOM   6610  N  N     . LEU C 2 391  ? 64.156  -13.789 70.139  1.00 119.27 ? 391  LEU C N     1 
ATOM   6611  C  CA    . LEU C 2 391  ? 64.254  -14.774 71.214  1.00 113.50 ? 391  LEU C CA    1 
ATOM   6612  C  C     . LEU C 2 391  ? 65.509  -14.542 72.023  1.00 113.53 ? 391  LEU C C     1 
ATOM   6613  O  O     . LEU C 2 391  ? 65.667  -15.096 73.107  1.00 112.10 ? 391  LEU C O     1 
ATOM   6614  C  CB    . LEU C 2 391  ? 64.214  -16.207 70.685  1.00 106.86 ? 391  LEU C CB    1 
ATOM   6615  C  CG    . LEU C 2 391  ? 62.848  -16.701 70.217  1.00 107.45 ? 391  LEU C CG    1 
ATOM   6616  C  CD1   . LEU C 2 391  ? 62.855  -18.198 70.090  1.00 102.04 ? 391  LEU C CD1   1 
ATOM   6617  C  CD2   . LEU C 2 391  ? 61.759  -16.255 71.171  1.00 116.94 ? 391  LEU C CD2   1 
ATOM   6618  N  N     . SER C 2 392  ? 66.404  -13.713 71.495  1.00 114.54 ? 392  SER C N     1 
ATOM   6619  C  CA    . SER C 2 392  ? 67.541  -13.270 72.282  1.00 112.78 ? 392  SER C CA    1 
ATOM   6620  C  C     . SER C 2 392  ? 67.148  -11.964 72.911  1.00 116.62 ? 392  SER C C     1 
ATOM   6621  O  O     . SER C 2 392  ? 67.077  -10.915 72.244  1.00 116.23 ? 392  SER C O     1 
ATOM   6622  C  CB    . SER C 2 392  ? 68.775  -13.052 71.421  1.00 118.23 ? 392  SER C CB    1 
ATOM   6623  O  OG    . SER C 2 392  ? 69.846  -12.571 72.220  1.00 116.35 ? 392  SER C OG    1 
ATOM   6624  N  N     . GLN C 2 393  ? 66.938  -12.035 74.216  1.00 114.66 ? 393  GLN C N     1 
ATOM   6625  C  CA    . GLN C 2 393  ? 66.268  -10.981 74.934  1.00 114.26 ? 393  GLN C CA    1 
ATOM   6626  C  C     . GLN C 2 393  ? 67.230  -10.417 75.942  1.00 113.87 ? 393  GLN C C     1 
ATOM   6627  O  O     . GLN C 2 393  ? 68.012  -11.156 76.542  1.00 111.08 ? 393  GLN C O     1 
ATOM   6628  C  CB    . GLN C 2 393  ? 65.044  -11.550 75.646  1.00 115.75 ? 393  GLN C CB    1 
ATOM   6629  C  CG    . GLN C 2 393  ? 64.103  -12.328 74.745  1.00 114.17 ? 393  GLN C CG    1 
ATOM   6630  C  CD    . GLN C 2 393  ? 62.758  -12.536 75.389  1.00 119.47 ? 393  GLN C CD    1 
ATOM   6631  O  OE1   . GLN C 2 393  ? 62.656  -12.623 76.616  1.00 119.70 ? 393  GLN C OE1   1 
ATOM   6632  N  NE2   . GLN C 2 393  ? 61.708  -12.598 74.570  1.00 123.45 ? 393  GLN C NE2   1 
ATOM   6633  N  N     . PHE C 2 394  ? 67.174  -9.101  76.104  1.00 117.39 ? 394  PHE C N     1 
ATOM   6634  C  CA    . PHE C 2 394  ? 67.928  -8.396  77.128  1.00 119.91 ? 394  PHE C CA    1 
ATOM   6635  C  C     . PHE C 2 394  ? 67.560  -9.073  78.463  1.00 121.21 ? 394  PHE C C     1 
ATOM   6636  O  O     . PHE C 2 394  ? 66.375  -9.205  78.817  1.00 118.13 ? 394  PHE C O     1 
ATOM   6637  C  CB    . PHE C 2 394  ? 67.497  -6.924  77.081  1.00 125.01 ? 394  PHE C CB    1 
ATOM   6638  C  CG    . PHE C 2 394  ? 68.432  -5.955  77.763  1.00 124.66 ? 394  PHE C CG    1 
ATOM   6639  C  CD1   . PHE C 2 394  ? 69.247  -5.128  77.008  1.00 133.66 ? 394  PHE C CD1   1 
ATOM   6640  C  CD2   . PHE C 2 394  ? 68.430  -5.808  79.146  1.00 121.15 ? 394  PHE C CD2   1 
ATOM   6641  C  CE1   . PHE C 2 394  ? 70.078  -4.206  77.630  1.00 146.90 ? 394  PHE C CE1   1 
ATOM   6642  C  CE2   . PHE C 2 394  ? 69.247  -4.894  79.764  1.00 119.13 ? 394  PHE C CE2   1 
ATOM   6643  C  CZ    . PHE C 2 394  ? 70.076  -4.099  79.020  1.00 131.42 ? 394  PHE C CZ    1 
ATOM   6644  N  N     . LYS C 2 395  ? 68.576  -9.535  79.187  1.00 120.80 ? 395  LYS C N     1 
ATOM   6645  C  CA    . LYS C 2 395  ? 68.343  -10.349 80.378  1.00 115.91 ? 395  LYS C CA    1 
ATOM   6646  C  C     . LYS C 2 395  ? 67.694  -9.530  81.465  1.00 115.22 ? 395  LYS C C     1 
ATOM   6647  O  O     . LYS C 2 395  ? 68.189  -8.471  81.857  1.00 114.62 ? 395  LYS C O     1 
ATOM   6648  C  CB    . LYS C 2 395  ? 69.655  -10.930 80.902  1.00 116.27 ? 395  LYS C CB    1 
ATOM   6649  C  CG    . LYS C 2 395  ? 69.494  -11.906 82.052  1.00 114.70 ? 395  LYS C CG    1 
ATOM   6650  C  CD    . LYS C 2 395  ? 70.849  -12.250 82.606  1.00 114.11 ? 395  LYS C CD    1 
ATOM   6651  C  CE    . LYS C 2 395  ? 70.763  -13.289 83.676  1.00 117.87 ? 395  LYS C CE    1 
ATOM   6652  N  NZ    . LYS C 2 395  ? 72.089  -13.352 84.326  1.00 127.76 ? 395  LYS C NZ    1 
ATOM   6653  N  N     . ASP C 2 396  ? 66.586  -10.025 81.979  1.00 114.71 ? 396  ASP C N     1 
ATOM   6654  C  CA    . ASP C 2 396  ? 65.951  -9.302  83.047  1.00 117.30 ? 396  ASP C CA    1 
ATOM   6655  C  C     . ASP C 2 396  ? 66.509  -9.895  84.335  1.00 115.62 ? 396  ASP C C     1 
ATOM   6656  O  O     . ASP C 2 396  ? 66.018  -10.894 84.844  1.00 115.22 ? 396  ASP C O     1 
ATOM   6657  C  CB    . ASP C 2 396  ? 64.434  -9.510  82.879  1.00 118.46 ? 396  ASP C CB    1 
ATOM   6658  C  CG    . ASP C 2 396  ? 63.645  -9.389  84.169  1.00 120.68 ? 396  ASP C CG    1 
ATOM   6659  O  OD1   . ASP C 2 396  ? 63.986  -8.545  85.020  1.00 123.31 ? 396  ASP C OD1   1 
ATOM   6660  O  OD2   . ASP C 2 396  ? 62.651  -10.137 84.310  1.00 124.24 ? 396  ASP C OD2   1 
ATOM   6661  N  N     . GLU C 2 397  ? 67.521  -9.237  84.888  1.00 113.81 ? 397  GLU C N     1 
ATOM   6662  C  CA    . GLU C 2 397  ? 67.884  -9.509  86.253  1.00 112.25 ? 397  GLU C CA    1 
ATOM   6663  C  C     . GLU C 2 397  ? 67.633  -8.193  86.948  1.00 117.20 ? 397  GLU C C     1 
ATOM   6664  O  O     . GLU C 2 397  ? 68.470  -7.298  86.922  1.00 122.12 ? 397  GLU C O     1 
ATOM   6665  C  CB    . GLU C 2 397  ? 69.362  -9.926  86.364  1.00 114.17 ? 397  GLU C CB    1 
ATOM   6666  C  CG    . GLU C 2 397  ? 70.340  -9.225  85.394  1.00 121.37 ? 397  GLU C CG    1 
ATOM   6667  C  CD    . GLU C 2 397  ? 71.826  -9.522  85.685  1.00 124.57 ? 397  GLU C CD    1 
ATOM   6668  O  OE1   . GLU C 2 397  ? 72.139  -10.616 86.207  1.00 123.89 ? 397  GLU C OE1   1 
ATOM   6669  O  OE2   . GLU C 2 397  ? 72.686  -8.658  85.390  1.00 120.37 ? 397  GLU C OE2   1 
ATOM   6670  N  N     . THR C 2 398  ? 66.479  -8.077  87.587  1.00 114.79 ? 398  THR C N     1 
ATOM   6671  C  CA    . THR C 2 398  ? 66.221  -6.969  88.474  1.00 110.70 ? 398  THR C CA    1 
ATOM   6672  C  C     . THR C 2 398  ? 66.849  -7.490  89.729  1.00 112.94 ? 398  THR C C     1 
ATOM   6673  O  O     . THR C 2 398  ? 67.451  -6.768  90.507  1.00 113.81 ? 398  THR C O     1 
ATOM   6674  C  CB    . THR C 2 398  ? 64.722  -6.778  88.702  1.00 111.48 ? 398  THR C CB    1 
ATOM   6675  O  OG1   . THR C 2 398  ? 64.025  -6.875  87.456  1.00 114.73 ? 398  THR C OG1   1 
ATOM   6676  C  CG2   . THR C 2 398  ? 64.447  -5.428  89.306  1.00 114.69 ? 398  THR C CG2   1 
ATOM   6677  N  N     . ASN C 2 399  ? 66.791  -8.808  89.836  1.00 113.84 ? 399  ASN C N     1 
ATOM   6678  C  CA    . ASN C 2 399  ? 66.978  -9.523  91.075  1.00 113.53 ? 399  ASN C CA    1 
ATOM   6679  C  C     . ASN C 2 399  ? 67.050  -10.987 90.702  1.00 109.35 ? 399  ASN C C     1 
ATOM   6680  O  O     . ASN C 2 399  ? 66.544  -11.371 89.658  1.00 111.22 ? 399  ASN C O     1 
ATOM   6681  C  CB    . ASN C 2 399  ? 65.816  -9.235  92.052  1.00 110.61 ? 399  ASN C CB    1 
ATOM   6682  C  CG    . ASN C 2 399  ? 64.482  -9.832  91.614  1.00 106.59 ? 399  ASN C CG    1 
ATOM   6683  O  OD1   . ASN C 2 399  ? 64.361  -11.021 91.335  1.00 106.71 ? 399  ASN C OD1   1 
ATOM   6684  N  ND2   . ASN C 2 399  ? 63.465  -8.995  91.578  1.00 106.14 ? 399  ASN C ND2   1 
ATOM   6685  N  N     . PRO C 2 400  ? 67.706  -11.799 91.537  1.00 106.98 ? 400  PRO C N     1 
ATOM   6686  C  CA    . PRO C 2 400  ? 68.004  -13.194 91.220  1.00 108.97 ? 400  PRO C CA    1 
ATOM   6687  C  C     . PRO C 2 400  ? 66.835  -13.986 90.632  1.00 110.75 ? 400  PRO C C     1 
ATOM   6688  O  O     . PRO C 2 400  ? 67.068  -14.747 89.695  1.00 112.31 ? 400  PRO C O     1 
ATOM   6689  C  CB    . PRO C 2 400  ? 68.391  -13.766 92.576  1.00 118.34 ? 400  PRO C CB    1 
ATOM   6690  C  CG    . PRO C 2 400  ? 69.012  -12.609 93.305  1.00 117.89 ? 400  PRO C CG    1 
ATOM   6691  C  CD    . PRO C 2 400  ? 68.358  -11.366 92.787  1.00 113.88 ? 400  PRO C CD    1 
ATOM   6692  N  N     . LEU C 2 401  ? 65.617  -13.812 91.140  1.00 107.82 ? 401  LEU C N     1 
ATOM   6693  C  CA    . LEU C 2 401  ? 64.469  -14.528 90.578  1.00 108.74 ? 401  LEU C CA    1 
ATOM   6694  C  C     . LEU C 2 401  ? 64.111  -14.054 89.158  1.00 117.13 ? 401  LEU C C     1 
ATOM   6695  O  O     . LEU C 2 401  ? 63.741  -14.864 88.298  1.00 117.40 ? 401  LEU C O     1 
ATOM   6696  C  CB    . LEU C 2 401  ? 63.249  -14.450 91.502  1.00 103.18 ? 401  LEU C CB    1 
ATOM   6697  C  CG    . LEU C 2 401  ? 61.978  -15.198 91.067  1.00 106.15 ? 401  LEU C CG    1 
ATOM   6698  C  CD1   . LEU C 2 401  ? 62.205  -16.687 90.893  1.00 107.99 ? 401  LEU C CD1   1 
ATOM   6699  C  CD2   . LEU C 2 401  ? 60.835  -14.973 92.036  1.00 109.61 ? 401  LEU C CD2   1 
ATOM   6700  N  N     . SER C 2 402  ? 64.228  -12.751 88.913  1.00 117.15 ? 402  SER C N     1 
ATOM   6701  C  CA    . SER C 2 402  ? 63.922  -12.197 87.601  1.00 111.91 ? 402  SER C CA    1 
ATOM   6702  C  C     . SER C 2 402  ? 64.735  -12.955 86.588  1.00 107.91 ? 402  SER C C     1 
ATOM   6703  O  O     . SER C 2 402  ? 64.181  -13.575 85.681  1.00 108.50 ? 402  SER C O     1 
ATOM   6704  C  CB    . SER C 2 402  ? 64.321  -10.723 87.525  1.00 114.63 ? 402  SER C CB    1 
ATOM   6705  O  OG    . SER C 2 402  ? 63.962  -10.017 88.698  1.00 117.52 ? 402  SER C OG    1 
ATOM   6706  N  N     . SER C 2 403  ? 66.050  -12.928 86.796  1.00 107.30 ? 403  SER C N     1 
ATOM   6707  C  CA    . SER C 2 403  ? 67.010  -13.551 85.900  1.00 114.39 ? 403  SER C CA    1 
ATOM   6708  C  C     . SER C 2 403  ? 66.820  -15.064 85.742  1.00 118.16 ? 403  SER C C     1 
ATOM   6709  O  O     . SER C 2 403  ? 67.094  -15.604 84.670  1.00 122.04 ? 403  SER C O     1 
ATOM   6710  C  CB    . SER C 2 403  ? 68.449  -13.198 86.306  1.00 112.97 ? 403  SER C CB    1 
ATOM   6711  O  OG    . SER C 2 403  ? 69.088  -14.269 86.974  1.00 118.54 ? 403  SER C OG    1 
ATOM   6712  N  N     . LEU C 2 404  ? 66.361  -15.753 86.785  1.00 114.80 ? 404  LEU C N     1 
ATOM   6713  C  CA    . LEU C 2 404  ? 66.035  -17.177 86.639  1.00 117.06 ? 404  LEU C CA    1 
ATOM   6714  C  C     . LEU C 2 404  ? 64.810  -17.398 85.754  1.00 112.25 ? 404  LEU C C     1 
ATOM   6715  O  O     . LEU C 2 404  ? 64.885  -18.047 84.705  1.00 108.10 ? 404  LEU C O     1 
ATOM   6716  C  CB    . LEU C 2 404  ? 65.800  -17.842 88.002  1.00 118.90 ? 404  LEU C CB    1 
ATOM   6717  C  CG    . LEU C 2 404  ? 65.561  -19.359 88.002  1.00 112.83 ? 404  LEU C CG    1 
ATOM   6718  C  CD1   . LEU C 2 404  ? 66.861  -20.124 87.946  1.00 123.60 ? 404  LEU C CD1   1 
ATOM   6719  C  CD2   . LEU C 2 404  ? 64.804  -19.779 89.218  1.00 108.55 ? 404  LEU C CD2   1 
ATOM   6720  N  N     . ARG C 2 405  ? 63.693  -16.817 86.168  1.00 109.31 ? 405  ARG C N     1 
ATOM   6721  C  CA    . ARG C 2 405  ? 62.445  -17.012 85.467  1.00 109.26 ? 405  ARG C CA    1 
ATOM   6722  C  C     . ARG C 2 405  ? 62.610  -16.714 83.993  1.00 112.31 ? 405  ARG C C     1 
ATOM   6723  O  O     . ARG C 2 405  ? 62.028  -17.388 83.144  1.00 113.16 ? 405  ARG C O     1 
ATOM   6724  C  CB    . ARG C 2 405  ? 61.381  -16.089 86.017  1.00 106.95 ? 405  ARG C CB    1 
ATOM   6725  C  CG    . ARG C 2 405  ? 60.027  -16.414 85.471  1.00 109.64 ? 405  ARG C CG    1 
ATOM   6726  C  CD    . ARG C 2 405  ? 59.139  -15.254 85.636  1.00 107.14 ? 405  ARG C CD    1 
ATOM   6727  N  NE    . ARG C 2 405  ? 59.474  -14.168 84.744  1.00 111.09 ? 405  ARG C NE    1 
ATOM   6728  C  CZ    . ARG C 2 405  ? 58.593  -13.258 84.367  1.00 121.72 ? 405  ARG C CZ    1 
ATOM   6729  N  NH1   . ARG C 2 405  ? 57.350  -13.343 84.820  1.00 116.79 ? 405  ARG C NH1   1 
ATOM   6730  N  NH2   . ARG C 2 405  ? 58.949  -12.278 83.542  1.00 128.50 ? 405  ARG C NH2   1 
ATOM   6731  N  N     . HIS C 2 406  ? 63.427  -15.707 83.704  1.00 110.20 ? 406  HIS C N     1 
ATOM   6732  C  CA    . HIS C 2 406  ? 63.657  -15.260 82.351  1.00 105.80 ? 406  HIS C CA    1 
ATOM   6733  C  C     . HIS C 2 406  ? 64.154  -16.386 81.480  1.00 107.08 ? 406  HIS C C     1 
ATOM   6734  O  O     . HIS C 2 406  ? 63.896  -16.398 80.275  1.00 106.87 ? 406  HIS C O     1 
ATOM   6735  C  CB    . HIS C 2 406  ? 64.688  -14.162 82.338  1.00 105.49 ? 406  HIS C CB    1 
ATOM   6736  C  CG    . HIS C 2 406  ? 64.681  -13.380 81.075  1.00 108.17 ? 406  HIS C CG    1 
ATOM   6737  N  ND1   . HIS C 2 406  ? 65.700  -12.530 80.711  1.00 109.77 ? 406  HIS C ND1   1 
ATOM   6738  C  CD2   . HIS C 2 406  ? 63.761  -13.320 80.084  1.00 110.38 ? 406  HIS C CD2   1 
ATOM   6739  C  CE1   . HIS C 2 406  ? 65.406  -11.973 79.551  1.00 112.69 ? 406  HIS C CE1   1 
ATOM   6740  N  NE2   . HIS C 2 406  ? 64.237  -12.436 79.148  1.00 113.85 ? 406  HIS C NE2   1 
ATOM   6741  N  N     . LYS C 2 407  ? 64.879  -17.317 82.101  1.00 107.05 ? 407  LYS C N     1 
ATOM   6742  C  CA    . LYS C 2 407  ? 65.446  -18.484 81.418  1.00 109.65 ? 407  LYS C CA    1 
ATOM   6743  C  C     . LYS C 2 407  ? 64.390  -19.556 81.178  1.00 110.14 ? 407  LYS C C     1 
ATOM   6744  O  O     . LYS C 2 407  ? 64.363  -20.224 80.137  1.00 107.25 ? 407  LYS C O     1 
ATOM   6745  C  CB    . LYS C 2 407  ? 66.629  -19.041 82.218  1.00 105.83 ? 407  LYS C CB    1 
ATOM   6746  C  CG    . LYS C 2 407  ? 67.822  -18.094 82.222  1.00 110.20 ? 407  LYS C CG    1 
ATOM   6747  C  CD    . LYS C 2 407  ? 68.853  -18.458 83.258  1.00 113.49 ? 407  LYS C CD    1 
ATOM   6748  C  CE    . LYS C 2 407  ? 69.600  -17.217 83.723  1.00 115.74 ? 407  LYS C CE    1 
ATOM   6749  N  NZ    . LYS C 2 407  ? 69.952  -17.310 85.174  1.00 120.51 ? 407  LYS C NZ    1 
ATOM   6750  N  N     . ARG C 2 408  ? 63.509  -19.678 82.161  1.00 109.49 ? 408  ARG C N     1 
ATOM   6751  C  CA    . ARG C 2 408  ? 62.383  -20.602 82.158  1.00 106.07 ? 408  ARG C CA    1 
ATOM   6752  C  C     . ARG C 2 408  ? 61.112  -19.964 81.585  1.00 107.89 ? 408  ARG C C     1 
ATOM   6753  O  O     . ARG C 2 408  ? 60.012  -20.418 81.861  1.00 108.76 ? 408  ARG C O     1 
ATOM   6754  C  CB    . ARG C 2 408  ? 62.177  -21.190 83.546  1.00 101.82 ? 408  ARG C CB    1 
ATOM   6755  C  CG    . ARG C 2 408  ? 63.501  -21.446 84.228  1.00 100.95 ? 408  ARG C CG    1 
ATOM   6756  C  CD    . ARG C 2 408  ? 63.321  -21.920 85.629  1.00 104.14 ? 408  ARG C CD    1 
ATOM   6757  N  NE    . ARG C 2 408  ? 63.054  -23.347 85.671  1.00 106.86 ? 408  ARG C NE    1 
ATOM   6758  C  CZ    . ARG C 2 408  ? 61.839  -23.877 85.693  1.00 109.12 ? 408  ARG C CZ    1 
ATOM   6759  N  NH1   . ARG C 2 408  ? 60.767  -23.092 85.669  1.00 108.92 ? 408  ARG C NH1   1 
ATOM   6760  N  NH2   . ARG C 2 408  ? 61.699  -25.194 85.741  1.00 108.64 ? 408  ARG C NH2   1 
ATOM   6761  N  N     . ARG C 2 409  ? 61.270  -18.823 80.920  1.00 110.98 ? 409  ARG C N     1 
ATOM   6762  C  CA    . ARG C 2 409  ? 60.224  -18.229 80.084  1.00 111.97 ? 409  ARG C CA    1 
ATOM   6763  C  C     . ARG C 2 409  ? 60.146  -19.018 78.742  1.00 113.30 ? 409  ARG C C     1 
ATOM   6764  O  O     . ARG C 2 409  ? 61.187  -19.468 78.233  1.00 105.29 ? 409  ARG C O     1 
ATOM   6765  C  CB    . ARG C 2 409  ? 60.578  -16.750 79.850  1.00 111.52 ? 409  ARG C CB    1 
ATOM   6766  C  CG    . ARG C 2 409  ? 59.415  -15.743 79.811  1.00 111.53 ? 409  ARG C CG    1 
ATOM   6767  C  CD    . ARG C 2 409  ? 58.439  -15.856 80.977  1.00 112.21 ? 409  ARG C CD    1 
ATOM   6768  N  NE    . ARG C 2 409  ? 57.600  -14.657 81.118  1.00 117.79 ? 409  ARG C NE    1 
ATOM   6769  C  CZ    . ARG C 2 409  ? 56.495  -14.591 81.863  1.00 118.84 ? 409  ARG C CZ    1 
ATOM   6770  N  NH1   . ARG C 2 409  ? 55.788  -13.461 81.945  1.00 113.04 ? 409  ARG C NH1   1 
ATOM   6771  N  NH2   . ARG C 2 409  ? 56.095  -15.664 82.526  1.00 113.68 ? 409  ARG C NH2   1 
ATOM   6772  N  N     . ILE C 2 410  ? 58.927  -19.209 78.202  1.00 113.54 ? 410  ILE C N     1 
ATOM   6773  C  CA    . ILE C 2 410  ? 58.682  -19.960 76.939  1.00 109.66 ? 410  ILE C CA    1 
ATOM   6774  C  C     . ILE C 2 410  ? 57.759  -19.271 75.921  1.00 109.95 ? 410  ILE C C     1 
ATOM   6775  O  O     . ILE C 2 410  ? 56.577  -19.061 76.203  1.00 112.13 ? 410  ILE C O     1 
ATOM   6776  C  CB    . ILE C 2 410  ? 57.955  -21.283 77.172  1.00 103.25 ? 410  ILE C CB    1 
ATOM   6777  C  CG1   . ILE C 2 410  ? 58.718  -22.200 78.100  1.00 105.56 ? 410  ILE C CG1   1 
ATOM   6778  C  CG2   . ILE C 2 410  ? 57.743  -21.996 75.848  1.00 100.12 ? 410  ILE C CG2   1 
ATOM   6779  C  CD1   . ILE C 2 410  ? 57.918  -23.420 78.424  1.00 106.83 ? 410  ILE C CD1   1 
ATOM   6780  N  N     . SER C 2 411  ? 58.270  -19.010 74.719  1.00 107.22 ? 411  SER C N     1 
ATOM   6781  C  CA    . SER C 2 411  ? 57.584  -18.190 73.712  1.00 113.52 ? 411  SER C CA    1 
ATOM   6782  C  C     . SER C 2 411  ? 56.948  -19.053 72.617  1.00 114.94 ? 411  SER C C     1 
ATOM   6783  O  O     . SER C 2 411  ? 57.596  -19.972 72.123  1.00 112.52 ? 411  SER C O     1 
ATOM   6784  C  CB    . SER C 2 411  ? 58.619  -17.234 73.072  1.00 116.06 ? 411  SER C CB    1 
ATOM   6785  O  OG    . SER C 2 411  ? 58.077  -15.997 72.619  1.00 113.82 ? 411  SER C OG    1 
ATOM   6786  N  N     . ALA C 2 412  ? 55.692  -18.785 72.245  1.00 117.92 ? 412  ALA C N     1 
ATOM   6787  C  CA    . ALA C 2 412  ? 55.129  -19.341 70.995  1.00 120.03 ? 412  ALA C CA    1 
ATOM   6788  C  C     . ALA C 2 412  ? 55.346  -18.312 69.888  1.00 128.24 ? 412  ALA C C     1 
ATOM   6789  O  O     . ALA C 2 412  ? 55.035  -18.525 68.705  1.00 128.42 ? 412  ALA C O     1 
ATOM   6790  C  CB    . ALA C 2 412  ? 53.656  -19.679 71.155  1.00 115.22 ? 412  ALA C CB    1 
ATOM   6791  N  N     . LEU C 2 413  ? 55.828  -17.163 70.355  1.00 133.12 ? 413  LEU C N     1 
ATOM   6792  C  CA    . LEU C 2 413  ? 56.327  -16.039 69.571  1.00 131.92 ? 413  LEU C CA    1 
ATOM   6793  C  C     . LEU C 2 413  ? 57.737  -16.185 69.029  1.00 133.60 ? 413  LEU C C     1 
ATOM   6794  O  O     . LEU C 2 413  ? 58.547  -16.972 69.514  1.00 128.86 ? 413  LEU C O     1 
ATOM   6795  C  CB    . LEU C 2 413  ? 56.273  -14.766 70.408  1.00 131.26 ? 413  LEU C CB    1 
ATOM   6796  C  CG    . LEU C 2 413  ? 54.865  -14.254 70.642  1.00 138.04 ? 413  LEU C CG    1 
ATOM   6797  C  CD1   . LEU C 2 413  ? 54.901  -13.133 71.651  1.00 139.47 ? 413  LEU C CD1   1 
ATOM   6798  C  CD2   . LEU C 2 413  ? 54.259  -13.790 69.324  1.00 149.47 ? 413  LEU C CD2   1 
ATOM   6799  N  N     . GLY C 2 414  ? 58.036  -15.359 68.042  1.00 141.73 ? 414  GLY C N     1 
ATOM   6800  C  CA    . GLY C 2 414  ? 59.374  -15.275 67.508  1.00 138.94 ? 414  GLY C CA    1 
ATOM   6801  C  C     . GLY C 2 414  ? 59.372  -15.858 66.126  1.00 140.81 ? 414  GLY C C     1 
ATOM   6802  O  O     . GLY C 2 414  ? 58.524  -16.700 65.813  1.00 138.59 ? 414  GLY C O     1 
ATOM   6803  N  N     . PRO C 2 415  ? 60.314  -15.397 65.285  1.00 144.83 ? 415  PRO C N     1 
ATOM   6804  C  CA    . PRO C 2 415  ? 60.392  -15.895 63.909  1.00 143.48 ? 415  PRO C CA    1 
ATOM   6805  C  C     . PRO C 2 415  ? 60.503  -17.419 63.925  1.00 139.07 ? 415  PRO C C     1 
ATOM   6806  O  O     . PRO C 2 415  ? 61.265  -17.975 64.717  1.00 135.91 ? 415  PRO C O     1 
ATOM   6807  C  CB    . PRO C 2 415  ? 61.667  -15.230 63.371  1.00 145.74 ? 415  PRO C CB    1 
ATOM   6808  C  CG    . PRO C 2 415  ? 61.807  -13.962 64.195  1.00 144.66 ? 415  PRO C CG    1 
ATOM   6809  C  CD    . PRO C 2 415  ? 61.321  -14.349 65.565  1.00 142.47 ? 415  PRO C CD    1 
ATOM   6810  N  N     . GLY C 2 416  ? 59.722  -18.086 63.084  1.00 140.68 ? 416  GLY C N     1 
ATOM   6811  C  CA    . GLY C 2 416  ? 59.648  -19.536 63.112  1.00 140.21 ? 416  GLY C CA    1 
ATOM   6812  C  C     . GLY C 2 416  ? 58.369  -20.000 63.774  1.00 140.07 ? 416  GLY C C     1 
ATOM   6813  O  O     . GLY C 2 416  ? 58.227  -21.179 64.115  1.00 136.15 ? 416  GLY C O     1 
ATOM   6814  N  N     . GLY C 2 417  ? 57.436  -19.063 63.942  1.00 141.96 ? 417  GLY C N     1 
ATOM   6815  C  CA    . GLY C 2 417  ? 56.254  -19.276 64.756  1.00 146.74 ? 417  GLY C CA    1 
ATOM   6816  C  C     . GLY C 2 417  ? 55.274  -18.128 64.640  1.00 149.58 ? 417  GLY C C     1 
ATOM   6817  O  O     . GLY C 2 417  ? 55.296  -17.378 63.669  1.00 154.15 ? 417  GLY C O     1 
ATOM   6818  N  N     . LEU C 2 418  ? 54.410  -18.006 65.640  1.00 147.59 ? 418  LEU C N     1 
ATOM   6819  C  CA    . LEU C 2 418  ? 53.282  -17.077 65.617  1.00 155.50 ? 418  LEU C CA    1 
ATOM   6820  C  C     . LEU C 2 418  ? 53.628  -15.601 65.870  1.00 161.72 ? 418  LEU C C     1 
ATOM   6821  O  O     . LEU C 2 418  ? 54.602  -15.295 66.569  1.00 152.13 ? 418  LEU C O     1 
ATOM   6822  C  CB    . LEU C 2 418  ? 52.251  -17.525 66.657  1.00 152.58 ? 418  LEU C CB    1 
ATOM   6823  C  CG    . LEU C 2 418  ? 51.213  -18.595 66.313  1.00 151.19 ? 418  LEU C CG    1 
ATOM   6824  C  CD1   . LEU C 2 418  ? 51.641  -19.416 65.117  1.00 168.82 ? 418  LEU C CD1   1 
ATOM   6825  C  CD2   . LEU C 2 418  ? 50.985  -19.488 67.516  1.00 146.18 ? 418  LEU C CD2   1 
ATOM   6826  N  N     . THR C 2 419  ? 52.824  -14.707 65.272  1.00 169.44 ? 419  THR C N     1 
ATOM   6827  C  CA    . THR C 2 419  ? 52.729  -13.279 65.638  1.00 169.73 ? 419  THR C CA    1 
ATOM   6828  C  C     . THR C 2 419  ? 51.533  -13.112 66.580  1.00 167.27 ? 419  THR C C     1 
ATOM   6829  O  O     . THR C 2 419  ? 50.977  -14.107 67.033  1.00 164.45 ? 419  THR C O     1 
ATOM   6830  C  CB    . THR C 2 419  ? 52.518  -12.345 64.420  1.00 169.87 ? 419  THR C CB    1 
ATOM   6831  O  OG1   . THR C 2 419  ? 53.058  -12.944 63.233  1.00 170.55 ? 419  THR C OG1   1 
ATOM   6832  C  CG2   . THR C 2 419  ? 53.172  -10.976 64.666  1.00 166.52 ? 419  THR C CG2   1 
ATOM   6833  N  N     . ARG C 2 420  ? 51.140  -11.875 66.890  1.00 168.18 ? 420  ARG C N     1 
ATOM   6834  C  CA    . ARG C 2 420  ? 50.029  -11.640 67.830  1.00 167.53 ? 420  ARG C CA    1 
ATOM   6835  C  C     . ARG C 2 420  ? 48.615  -11.756 67.267  1.00 174.43 ? 420  ARG C C     1 
ATOM   6836  O  O     . ARG C 2 420  ? 47.706  -12.258 67.939  1.00 165.77 ? 420  ARG C O     1 
ATOM   6837  C  CB    . ARG C 2 420  ? 50.164  -10.297 68.523  1.00 161.00 ? 420  ARG C CB    1 
ATOM   6838  C  CG    . ARG C 2 420  ? 49.904  -10.403 70.008  1.00 149.70 ? 420  ARG C CG    1 
ATOM   6839  C  CD    . ARG C 2 420  ? 50.976  -9.704  70.825  1.00 147.40 ? 420  ARG C CD    1 
ATOM   6840  N  NE    . ARG C 2 420  ? 52.326  -10.134 70.475  1.00 152.90 ? 420  ARG C NE    1 
ATOM   6841  C  CZ    . ARG C 2 420  ? 53.087  -9.542  69.554  1.00 165.92 ? 420  ARG C CZ    1 
ATOM   6842  N  NH1   . ARG C 2 420  ? 52.623  -8.498  68.876  1.00 168.56 ? 420  ARG C NH1   1 
ATOM   6843  N  NH2   . ARG C 2 420  ? 54.307  -10.004 69.294  1.00 166.34 ? 420  ARG C NH2   1 
ATOM   6844  N  N     . GLU C 2 421  ? 48.428  -11.243 66.057  1.00 179.11 ? 421  GLU C N     1 
ATOM   6845  C  CA    . GLU C 2 421  ? 47.166  -11.373 65.340  1.00 181.23 ? 421  GLU C CA    1 
ATOM   6846  C  C     . GLU C 2 421  ? 46.863  -12.853 65.022  1.00 183.02 ? 421  GLU C C     1 
ATOM   6847  O  O     . GLU C 2 421  ? 45.708  -13.244 64.824  1.00 183.21 ? 421  GLU C O     1 
ATOM   6848  C  CB    . GLU C 2 421  ? 47.215  -10.541 64.049  1.00 184.90 ? 421  GLU C CB    1 
ATOM   6849  C  CG    . GLU C 2 421  ? 48.086  -11.140 62.914  1.00 188.54 ? 421  GLU C CG    1 
ATOM   6850  C  CD    . GLU C 2 421  ? 49.509  -10.563 62.830  1.00 186.04 ? 421  GLU C CD    1 
ATOM   6851  O  OE1   . GLU C 2 421  ? 50.176  -10.780 61.792  1.00 180.98 ? 421  GLU C OE1   1 
ATOM   6852  O  OE2   . GLU C 2 421  ? 49.965  -9.903  63.792  1.00 188.81 ? 421  GLU C OE2   1 
ATOM   6853  N  N     . ARG C 2 422  ? 47.914  -13.669 65.000  1.00 181.94 ? 422  ARG C N     1 
ATOM   6854  C  CA    . ARG C 2 422  ? 47.833  -15.047 64.525  1.00 180.21 ? 422  ARG C CA    1 
ATOM   6855  C  C     . ARG C 2 422  ? 47.306  -16.049 65.564  1.00 172.07 ? 422  ARG C C     1 
ATOM   6856  O  O     . ARG C 2 422  ? 46.840  -17.130 65.196  1.00 178.00 ? 422  ARG C O     1 
ATOM   6857  C  CB    . ARG C 2 422  ? 49.200  -15.496 63.966  1.00 179.75 ? 422  ARG C CB    1 
ATOM   6858  C  CG    . ARG C 2 422  ? 49.800  -14.508 62.945  1.00 183.80 ? 422  ARG C CG    1 
ATOM   6859  C  CD    . ARG C 2 422  ? 50.466  -15.177 61.730  1.00 189.70 ? 422  ARG C CD    1 
ATOM   6860  N  NE    . ARG C 2 422  ? 51.812  -15.685 62.002  1.00 188.84 ? 422  ARG C NE    1 
ATOM   6861  C  CZ    . ARG C 2 422  ? 52.701  -16.002 61.060  1.00 193.08 ? 422  ARG C CZ    1 
ATOM   6862  N  NH1   . ARG C 2 422  ? 53.902  -16.460 61.399  1.00 190.40 ? 422  ARG C NH1   1 
ATOM   6863  N  NH2   . ARG C 2 422  ? 52.395  -15.860 59.776  1.00 200.65 ? 422  ARG C NH2   1 
ATOM   6864  N  N     . ALA C 2 423  ? 47.354  -15.691 66.848  1.00 165.89 ? 423  ALA C N     1 
ATOM   6865  C  CA    . ALA C 2 423  ? 47.063  -16.664 67.911  1.00 164.79 ? 423  ALA C CA    1 
ATOM   6866  C  C     . ALA C 2 423  ? 45.622  -16.654 68.427  1.00 162.37 ? 423  ALA C C     1 
ATOM   6867  O  O     . ALA C 2 423  ? 45.228  -15.748 69.179  1.00 159.23 ? 423  ALA C O     1 
ATOM   6868  C  CB    . ALA C 2 423  ? 48.030  -16.477 69.086  1.00 151.52 ? 423  ALA C CB    1 
ATOM   6869  N  N     . GLY C 2 424  ? 44.871  -17.709 68.099  1.00 160.00 ? 424  GLY C N     1 
ATOM   6870  C  CA    . GLY C 2 424  ? 43.469  -17.801 68.471  1.00 152.51 ? 424  GLY C CA    1 
ATOM   6871  C  C     . GLY C 2 424  ? 43.361  -18.059 69.951  1.00 145.34 ? 424  GLY C C     1 
ATOM   6872  O  O     . GLY C 2 424  ? 44.323  -17.879 70.689  1.00 143.93 ? 424  GLY C O     1 
ATOM   6873  N  N     . PHE C 2 425  ? 42.194  -18.470 70.411  1.00 143.22 ? 425  PHE C N     1 
ATOM   6874  C  CA    . PHE C 2 425  ? 42.100  -18.891 71.800  1.00 149.13 ? 425  PHE C CA    1 
ATOM   6875  C  C     . PHE C 2 425  ? 42.883  -20.195 72.017  1.00 143.06 ? 425  PHE C C     1 
ATOM   6876  O  O     . PHE C 2 425  ? 43.280  -20.527 73.139  1.00 139.29 ? 425  PHE C O     1 
ATOM   6877  C  CB    . PHE C 2 425  ? 40.639  -19.078 72.205  1.00 152.33 ? 425  PHE C CB    1 
ATOM   6878  C  CG    . PHE C 2 425  ? 39.939  -17.803 72.593  1.00 151.10 ? 425  PHE C CG    1 
ATOM   6879  C  CD1   . PHE C 2 425  ? 39.365  -17.665 73.859  1.00 145.30 ? 425  PHE C CD1   1 
ATOM   6880  C  CD2   . PHE C 2 425  ? 39.851  -16.747 71.700  1.00 149.87 ? 425  PHE C CD2   1 
ATOM   6881  C  CE1   . PHE C 2 425  ? 38.708  -16.501 74.230  1.00 142.34 ? 425  PHE C CE1   1 
ATOM   6882  C  CE2   . PHE C 2 425  ? 39.198  -15.581 72.061  1.00 153.60 ? 425  PHE C CE2   1 
ATOM   6883  C  CZ    . PHE C 2 425  ? 38.622  -15.456 73.332  1.00 146.94 ? 425  PHE C CZ    1 
ATOM   6884  N  N     . ASP C 2 426  ? 43.105  -20.919 70.928  1.00 141.36 ? 426  ASP C N     1 
ATOM   6885  C  CA    . ASP C 2 426  ? 43.701  -22.244 70.983  1.00 142.01 ? 426  ASP C CA    1 
ATOM   6886  C  C     . ASP C 2 426  ? 45.029  -22.261 71.708  1.00 137.94 ? 426  ASP C C     1 
ATOM   6887  O  O     . ASP C 2 426  ? 45.175  -22.871 72.768  1.00 134.72 ? 426  ASP C O     1 
ATOM   6888  C  CB    . ASP C 2 426  ? 43.921  -22.757 69.566  1.00 150.18 ? 426  ASP C CB    1 
ATOM   6889  C  CG    . ASP C 2 426  ? 42.625  -23.031 68.845  1.00 153.80 ? 426  ASP C CG    1 
ATOM   6890  O  OD1   . ASP C 2 426  ? 41.646  -23.416 69.520  1.00 153.06 ? 426  ASP C OD1   1 
ATOM   6891  O  OD2   . ASP C 2 426  ? 42.581  -22.869 67.607  1.00 158.70 ? 426  ASP C OD2   1 
ATOM   6892  N  N     . VAL C 2 427  ? 45.991  -21.581 71.103  1.00 135.30 ? 427  VAL C N     1 
ATOM   6893  C  CA    . VAL C 2 427  ? 47.373  -21.597 71.534  1.00 133.12 ? 427  VAL C CA    1 
ATOM   6894  C  C     . VAL C 2 427  ? 47.529  -21.014 72.925  1.00 130.42 ? 427  VAL C C     1 
ATOM   6895  O  O     . VAL C 2 427  ? 48.436  -21.394 73.668  1.00 129.09 ? 427  VAL C O     1 
ATOM   6896  C  CB    . VAL C 2 427  ? 48.211  -20.772 70.568  1.00 135.01 ? 427  VAL C CB    1 
ATOM   6897  C  CG1   . VAL C 2 427  ? 49.445  -21.538 70.166  1.00 143.73 ? 427  VAL C CG1   1 
ATOM   6898  C  CG2   . VAL C 2 427  ? 47.382  -20.428 69.344  1.00 142.20 ? 427  VAL C CG2   1 
ATOM   6899  N  N     . ARG C 2 428  ? 46.637  -20.087 73.263  1.00 128.97 ? 428  ARG C N     1 
ATOM   6900  C  CA    . ARG C 2 428  ? 46.686  -19.381 74.537  1.00 122.80 ? 428  ARG C CA    1 
ATOM   6901  C  C     . ARG C 2 428  ? 46.117  -20.224 75.667  1.00 122.77 ? 428  ARG C C     1 
ATOM   6902  O  O     . ARG C 2 428  ? 46.630  -20.214 76.786  1.00 118.53 ? 428  ARG C O     1 
ATOM   6903  C  CB    . ARG C 2 428  ? 45.919  -18.069 74.420  1.00 117.44 ? 428  ARG C CB    1 
ATOM   6904  C  CG    . ARG C 2 428  ? 46.250  -17.320 73.151  1.00 122.92 ? 428  ARG C CG    1 
ATOM   6905  C  CD    . ARG C 2 428  ? 45.507  -16.014 73.071  1.00 122.15 ? 428  ARG C CD    1 
ATOM   6906  N  NE    . ARG C 2 428  ? 46.384  -14.882 73.342  1.00 114.91 ? 428  ARG C NE    1 
ATOM   6907  C  CZ    . ARG C 2 428  ? 46.705  -13.960 72.443  1.00 115.33 ? 428  ARG C CZ    1 
ATOM   6908  N  NH1   . ARG C 2 428  ? 46.213  -14.029 71.213  1.00 119.52 ? 428  ARG C NH1   1 
ATOM   6909  N  NH2   . ARG C 2 428  ? 47.511  -12.963 72.782  1.00 109.71 ? 428  ARG C NH2   1 
ATOM   6910  N  N     . ASP C 2 429  ? 45.083  -20.988 75.339  1.00 123.36 ? 429  ASP C N     1 
ATOM   6911  C  CA    . ASP C 2 429  ? 44.319  -21.753 76.308  1.00 119.73 ? 429  ASP C CA    1 
ATOM   6912  C  C     . ASP C 2 429  ? 45.239  -22.625 77.140  1.00 118.56 ? 429  ASP C C     1 
ATOM   6913  O  O     . ASP C 2 429  ? 46.288  -23.040 76.672  1.00 119.54 ? 429  ASP C O     1 
ATOM   6914  C  CB    . ASP C 2 429  ? 43.336  -22.649 75.564  1.00 123.62 ? 429  ASP C CB    1 
ATOM   6915  C  CG    . ASP C 2 429  ? 41.915  -22.496 76.053  1.00 130.43 ? 429  ASP C CG    1 
ATOM   6916  O  OD1   . ASP C 2 429  ? 41.666  -22.660 77.270  1.00 130.17 ? 429  ASP C OD1   1 
ATOM   6917  O  OD2   . ASP C 2 429  ? 41.040  -22.218 75.207  1.00 134.64 ? 429  ASP C OD2   1 
ATOM   6918  N  N     . VAL C 2 430  ? 44.877  -22.854 78.394  1.00 122.79 ? 430  VAL C N     1 
ATOM   6919  C  CA    . VAL C 2 430  ? 45.557  -23.866 79.187  1.00 122.17 ? 430  VAL C CA    1 
ATOM   6920  C  C     . VAL C 2 430  ? 44.982  -25.218 78.791  1.00 122.56 ? 430  VAL C C     1 
ATOM   6921  O  O     . VAL C 2 430  ? 43.781  -25.443 78.894  1.00 131.68 ? 430  VAL C O     1 
ATOM   6922  C  CB    . VAL C 2 430  ? 45.432  -23.609 80.705  1.00 118.92 ? 430  VAL C CB    1 
ATOM   6923  C  CG1   . VAL C 2 430  ? 45.395  -24.911 81.470  1.00 116.49 ? 430  VAL C CG1   1 
ATOM   6924  C  CG2   . VAL C 2 430  ? 46.610  -22.780 81.183  1.00 118.27 ? 430  VAL C CG2   1 
ATOM   6925  N  N     . HIS C 2 431  ? 45.851  -26.100 78.311  1.00 119.54 ? 431  HIS C N     1 
ATOM   6926  C  CA    . HIS C 2 431  ? 45.451  -27.388 77.760  1.00 121.48 ? 431  HIS C CA    1 
ATOM   6927  C  C     . HIS C 2 431  ? 45.857  -28.517 78.707  1.00 122.54 ? 431  HIS C C     1 
ATOM   6928  O  O     . HIS C 2 431  ? 46.924  -28.454 79.302  1.00 126.02 ? 431  HIS C O     1 
ATOM   6929  C  CB    . HIS C 2 431  ? 46.126  -27.567 76.406  1.00 127.22 ? 431  HIS C CB    1 
ATOM   6930  C  CG    . HIS C 2 431  ? 45.729  -28.818 75.689  1.00 128.10 ? 431  HIS C CG    1 
ATOM   6931  N  ND1   . HIS C 2 431  ? 46.431  -29.998 75.806  1.00 122.85 ? 431  HIS C ND1   1 
ATOM   6932  C  CD2   . HIS C 2 431  ? 44.713  -29.066 74.828  1.00 129.64 ? 431  HIS C CD2   1 
ATOM   6933  C  CE1   . HIS C 2 431  ? 45.861  -30.921 75.053  1.00 124.69 ? 431  HIS C CE1   1 
ATOM   6934  N  NE2   . HIS C 2 431  ? 44.817  -30.382 74.448  1.00 127.84 ? 431  HIS C NE2   1 
ATOM   6935  N  N     . ARG C 2 432  ? 45.054  -29.577 78.791  1.00 123.56 ? 432  ARG C N     1 
ATOM   6936  C  CA    . ARG C 2 432  ? 45.067  -30.507 79.949  1.00 131.70 ? 432  ARG C CA    1 
ATOM   6937  C  C     . ARG C 2 432  ? 46.417  -31.174 80.281  1.00 124.78 ? 432  ARG C C     1 
ATOM   6938  O  O     . ARG C 2 432  ? 46.602  -31.825 81.334  1.00 117.61 ? 432  ARG C O     1 
ATOM   6939  C  CB    . ARG C 2 432  ? 43.979  -31.580 79.772  1.00 134.97 ? 432  ARG C CB    1 
ATOM   6940  C  CG    . ARG C 2 432  ? 43.733  -32.032 78.327  1.00 131.77 ? 432  ARG C CG    1 
ATOM   6941  C  CD    . ARG C 2 432  ? 42.896  -33.310 78.288  1.00 133.81 ? 432  ARG C CD    1 
ATOM   6942  N  NE    . ARG C 2 432  ? 43.375  -34.266 77.294  1.00 128.97 ? 432  ARG C NE    1 
ATOM   6943  C  CZ    . ARG C 2 432  ? 44.458  -35.024 77.446  1.00 129.06 ? 432  ARG C CZ    1 
ATOM   6944  N  NH1   . ARG C 2 432  ? 45.197  -34.941 78.550  1.00 122.53 ? 432  ARG C NH1   1 
ATOM   6945  N  NH2   . ARG C 2 432  ? 44.808  -35.861 76.484  1.00 135.48 ? 432  ARG C NH2   1 
ATOM   6946  N  N     . THR C 2 433  ? 47.326  -31.024 79.333  1.00 119.59 ? 433  THR C N     1 
ATOM   6947  C  CA    . THR C 2 433  ? 48.663  -31.551 79.411  1.00 119.28 ? 433  THR C CA    1 
ATOM   6948  C  C     . THR C 2 433  ? 49.706  -30.492 79.810  1.00 117.79 ? 433  THR C C     1 
ATOM   6949  O  O     . THR C 2 433  ? 50.902  -30.781 79.882  1.00 115.34 ? 433  THR C O     1 
ATOM   6950  C  CB    . THR C 2 433  ? 48.988  -32.206 78.082  1.00 119.68 ? 433  THR C CB    1 
ATOM   6951  O  OG1   . THR C 2 433  ? 48.291  -31.491 77.053  1.00 117.33 ? 433  THR C OG1   1 
ATOM   6952  C  CG2   . THR C 2 433  ? 48.491  -33.659 78.092  1.00 120.97 ? 433  THR C CG2   1 
ATOM   6953  N  N     . HIS C 2 434  ? 49.251  -29.261 80.050  1.00 120.89 ? 434  HIS C N     1 
ATOM   6954  C  CA    . HIS C 2 434  ? 50.080  -28.234 80.692  1.00 117.13 ? 434  HIS C CA    1 
ATOM   6955  C  C     . HIS C 2 434  ? 50.263  -28.649 82.163  1.00 117.98 ? 434  HIS C C     1 
ATOM   6956  O  O     . HIS C 2 434  ? 51.019  -28.020 82.906  1.00 116.53 ? 434  HIS C O     1 
ATOM   6957  C  CB    . HIS C 2 434  ? 49.415  -26.837 80.661  1.00 116.26 ? 434  HIS C CB    1 
ATOM   6958  C  CG    . HIS C 2 434  ? 49.466  -26.123 79.336  1.00 111.88 ? 434  HIS C CG    1 
ATOM   6959  N  ND1   . HIS C 2 434  ? 49.268  -26.754 78.125  1.00 112.83 ? 434  HIS C ND1   1 
ATOM   6960  C  CD2   . HIS C 2 434  ? 49.641  -24.811 79.050  1.00 109.06 ? 434  HIS C CD2   1 
ATOM   6961  C  CE1   . HIS C 2 434  ? 49.346  -25.869 77.147  1.00 111.77 ? 434  HIS C CE1   1 
ATOM   6962  N  NE2   . HIS C 2 434  ? 49.571  -24.682 77.682  1.00 114.17 ? 434  HIS C NE2   1 
ATOM   6963  N  N     . TYR C 2 435  ? 49.532  -29.682 82.584  1.00 117.27 ? 435  TYR C N     1 
ATOM   6964  C  CA    . TYR C 2 435  ? 49.677  -30.254 83.912  1.00 113.50 ? 435  TYR C CA    1 
ATOM   6965  C  C     . TYR C 2 435  ? 51.099  -30.732 84.048  1.00 114.29 ? 435  TYR C C     1 
ATOM   6966  O  O     . TYR C 2 435  ? 51.562  -31.518 83.241  1.00 118.60 ? 435  TYR C O     1 
ATOM   6967  C  CB    . TYR C 2 435  ? 48.742  -31.455 84.062  1.00 117.23 ? 435  TYR C CB    1 
ATOM   6968  C  CG    . TYR C 2 435  ? 48.624  -32.011 85.474  1.00 124.20 ? 435  TYR C CG    1 
ATOM   6969  C  CD1   . TYR C 2 435  ? 47.768  -31.431 86.407  1.00 129.26 ? 435  TYR C CD1   1 
ATOM   6970  C  CD2   . TYR C 2 435  ? 49.345  -33.130 85.870  1.00 128.62 ? 435  TYR C CD2   1 
ATOM   6971  C  CE1   . TYR C 2 435  ? 47.644  -31.944 87.702  1.00 127.14 ? 435  TYR C CE1   1 
ATOM   6972  C  CE2   . TYR C 2 435  ? 49.223  -33.653 87.170  1.00 131.56 ? 435  TYR C CE2   1 
ATOM   6973  C  CZ    . TYR C 2 435  ? 48.371  -33.053 88.079  1.00 130.38 ? 435  TYR C CZ    1 
ATOM   6974  O  OH    . TYR C 2 435  ? 48.244  -33.555 89.366  1.00 130.32 ? 435  TYR C OH    1 
ATOM   6975  N  N     . GLY C 2 436  ? 51.803  -30.251 85.061  1.00 116.34 ? 436  GLY C N     1 
ATOM   6976  C  CA    . GLY C 2 436  ? 53.159  -30.710 85.351  1.00 115.34 ? 436  GLY C CA    1 
ATOM   6977  C  C     . GLY C 2 436  ? 54.259  -30.183 84.454  1.00 104.53 ? 436  GLY C C     1 
ATOM   6978  O  O     . GLY C 2 436  ? 55.439  -30.336 84.753  1.00 97.28  ? 436  GLY C O     1 
ATOM   6979  N  N     . ARG C 2 437  ? 53.848  -29.532 83.371  1.00 110.77 ? 437  ARG C N     1 
ATOM   6980  C  CA    . ARG C 2 437  ? 54.726  -29.158 82.265  1.00 112.46 ? 437  ARG C CA    1 
ATOM   6981  C  C     . ARG C 2 437  ? 54.871  -27.639 82.103  1.00 113.88 ? 437  ARG C C     1 
ATOM   6982  O  O     . ARG C 2 437  ? 55.974  -27.110 82.179  1.00 116.13 ? 437  ARG C O     1 
ATOM   6983  C  CB    . ARG C 2 437  ? 54.257  -29.828 80.967  1.00 109.80 ? 437  ARG C CB    1 
ATOM   6984  C  CG    . ARG C 2 437  ? 54.378  -31.344 81.017  1.00 110.09 ? 437  ARG C CG    1 
ATOM   6985  C  CD    . ARG C 2 437  ? 53.731  -32.040 79.832  1.00 109.85 ? 437  ARG C CD    1 
ATOM   6986  N  NE    . ARG C 2 437  ? 53.947  -33.485 79.877  1.00 116.11 ? 437  ARG C NE    1 
ATOM   6987  C  CZ    . ARG C 2 437  ? 53.208  -34.336 80.588  1.00 120.21 ? 437  ARG C CZ    1 
ATOM   6988  N  NH1   . ARG C 2 437  ? 52.197  -33.891 81.311  1.00 124.50 ? 437  ARG C NH1   1 
ATOM   6989  N  NH2   . ARG C 2 437  ? 53.471  -35.637 80.580  1.00 121.03 ? 437  ARG C NH2   1 
ATOM   6990  N  N     . ILE C 2 438  ? 53.769  -26.942 81.860  1.00 109.81 ? 438  ILE C N     1 
ATOM   6991  C  CA    . ILE C 2 438  ? 53.810  -25.494 81.732  1.00 105.37 ? 438  ILE C CA    1 
ATOM   6992  C  C     . ILE C 2 438  ? 53.047  -24.906 82.902  1.00 105.65 ? 438  ILE C C     1 
ATOM   6993  O  O     . ILE C 2 438  ? 52.250  -25.599 83.526  1.00 106.78 ? 438  ILE C O     1 
ATOM   6994  C  CB    . ILE C 2 438  ? 53.230  -25.061 80.373  1.00 104.57 ? 438  ILE C CB    1 
ATOM   6995  C  CG1   . ILE C 2 438  ? 54.181  -25.506 79.269  1.00 99.50  ? 438  ILE C CG1   1 
ATOM   6996  C  CG2   . ILE C 2 438  ? 53.028  -23.557 80.277  1.00 108.61 ? 438  ILE C CG2   1 
ATOM   6997  C  CD1   . ILE C 2 438  ? 53.667  -25.258 77.883  1.00 101.05 ? 438  ILE C CD1   1 
ATOM   6998  N  N     . CYS C 2 439  ? 53.340  -23.660 83.258  1.00 105.11 ? 439  CYS C N     1 
ATOM   6999  C  CA    . CYS C 2 439  ? 52.542  -22.990 84.264  1.00 104.76 ? 439  CYS C CA    1 
ATOM   7000  C  C     . CYS C 2 439  ? 51.271  -22.428 83.660  1.00 106.23 ? 439  CYS C C     1 
ATOM   7001  O  O     . CYS C 2 439  ? 51.310  -21.851 82.570  1.00 105.28 ? 439  CYS C O     1 
ATOM   7002  C  CB    . CYS C 2 439  ? 53.318  -21.884 84.954  1.00 104.66 ? 439  CYS C CB    1 
ATOM   7003  S  SG    . CYS C 2 439  ? 52.595  -21.478 86.552  1.00 101.53 ? 439  CYS C SG    1 
ATOM   7004  N  N     . PRO C 2 440  ? 50.130  -22.688 84.331  1.00 110.55 ? 440  PRO C N     1 
ATOM   7005  C  CA    . PRO C 2 440  ? 48.791  -22.091 84.211  1.00 112.01 ? 440  PRO C CA    1 
ATOM   7006  C  C     . PRO C 2 440  ? 48.686  -20.696 84.848  1.00 109.43 ? 440  PRO C C     1 
ATOM   7007  O  O     . PRO C 2 440  ? 47.816  -19.875 84.505  1.00 107.86 ? 440  PRO C O     1 
ATOM   7008  C  CB    . PRO C 2 440  ? 47.894  -23.068 84.993  1.00 111.07 ? 440  PRO C CB    1 
ATOM   7009  C  CG    . PRO C 2 440  ? 48.776  -24.190 85.445  1.00 112.55 ? 440  PRO C CG    1 
ATOM   7010  C  CD    . PRO C 2 440  ? 50.165  -23.661 85.433  1.00 111.25 ? 440  PRO C CD    1 
ATOM   7011  N  N     . VAL C 2 441  ? 49.518  -20.473 85.854  1.00 102.54 ? 441  VAL C N     1 
ATOM   7012  C  CA    . VAL C 2 441  ? 49.529  -19.197 86.534  1.00 100.61 ? 441  VAL C CA    1 
ATOM   7013  C  C     . VAL C 2 441  ? 50.357  -18.134 85.855  1.00 104.46 ? 441  VAL C C     1 
ATOM   7014  O  O     . VAL C 2 441  ? 49.866  -17.042 85.567  1.00 105.20 ? 441  VAL C O     1 
ATOM   7015  C  CB    . VAL C 2 441  ? 50.133  -19.366 87.897  1.00 104.28 ? 441  VAL C CB    1 
ATOM   7016  C  CG1   . VAL C 2 441  ? 49.822  -18.155 88.765  1.00 112.36 ? 441  VAL C CG1   1 
ATOM   7017  C  CG2   . VAL C 2 441  ? 49.607  -20.646 88.492  1.00 107.21 ? 441  VAL C CG2   1 
ATOM   7018  N  N     . GLU C 2 442  ? 51.611  -18.462 85.557  1.00 108.14 ? 442  GLU C N     1 
ATOM   7019  C  CA    . GLU C 2 442  ? 52.536  -17.411 85.179  1.00 109.92 ? 442  GLU C CA    1 
ATOM   7020  C  C     . GLU C 2 442  ? 52.549  -17.263 83.676  1.00 109.52 ? 442  GLU C C     1 
ATOM   7021  O  O     . GLU C 2 442  ? 53.209  -18.004 82.932  1.00 103.62 ? 442  GLU C O     1 
ATOM   7022  C  CB    . GLU C 2 442  ? 53.929  -17.717 85.719  1.00 110.95 ? 442  GLU C CB    1 
ATOM   7023  C  CG    . GLU C 2 442  ? 54.998  -16.799 85.214  1.00 111.35 ? 442  GLU C CG    1 
ATOM   7024  C  CD    . GLU C 2 442  ? 56.155  -16.693 86.168  1.00 111.57 ? 442  GLU C CD    1 
ATOM   7025  O  OE1   . GLU C 2 442  ? 56.742  -17.736 86.542  1.00 110.85 ? 442  GLU C OE1   1 
ATOM   7026  O  OE2   . GLU C 2 442  ? 56.457  -15.549 86.556  1.00 110.67 ? 442  GLU C OE2   1 
ATOM   7027  N  N     . THR C 2 443  ? 51.843  -16.217 83.278  1.00 112.48 ? 443  THR C N     1 
ATOM   7028  C  CA    . THR C 2 443  ? 51.584  -15.867 81.903  1.00 116.81 ? 443  THR C CA    1 
ATOM   7029  C  C     . THR C 2 443  ? 51.487  -14.347 81.996  1.00 116.97 ? 443  THR C C     1 
ATOM   7030  O  O     . THR C 2 443  ? 51.118  -13.815 83.044  1.00 114.10 ? 443  THR C O     1 
ATOM   7031  C  CB    . THR C 2 443  ? 50.268  -16.547 81.390  1.00 110.10 ? 443  THR C CB    1 
ATOM   7032  O  OG1   . THR C 2 443  ? 50.053  -16.278 79.996  1.00 108.30 ? 443  THR C OG1   1 
ATOM   7033  C  CG2   . THR C 2 443  ? 49.069  -16.089 82.178  1.00 106.69 ? 443  THR C CG2   1 
ATOM   7034  N  N     . PRO C 2 444  ? 51.885  -13.637 80.940  1.00 116.47 ? 444  PRO C N     1 
ATOM   7035  C  CA    . PRO C 2 444  ? 51.664  -12.198 80.927  1.00 114.45 ? 444  PRO C CA    1 
ATOM   7036  C  C     . PRO C 2 444  ? 50.188  -11.932 80.835  1.00 112.88 ? 444  PRO C C     1 
ATOM   7037  O  O     . PRO C 2 444  ? 49.499  -12.560 80.034  1.00 107.41 ? 444  PRO C O     1 
ATOM   7038  C  CB    . PRO C 2 444  ? 52.310  -11.759 79.618  1.00 118.05 ? 444  PRO C CB    1 
ATOM   7039  C  CG    . PRO C 2 444  ? 53.289  -12.797 79.322  1.00 121.41 ? 444  PRO C CG    1 
ATOM   7040  C  CD    . PRO C 2 444  ? 52.710  -14.072 79.810  1.00 116.84 ? 444  PRO C CD    1 
ATOM   7041  N  N     . GLU C 2 445  ? 49.716  -11.017 81.672  1.00 121.00 ? 445  GLU C N     1 
ATOM   7042  C  CA    . GLU C 2 445  ? 48.353  -10.501 81.600  1.00 121.09 ? 445  GLU C CA    1 
ATOM   7043  C  C     . GLU C 2 445  ? 48.322  -9.415  80.542  1.00 124.20 ? 445  GLU C C     1 
ATOM   7044  O  O     . GLU C 2 445  ? 49.327  -8.736  80.299  1.00 129.03 ? 445  GLU C O     1 
ATOM   7045  C  CB    . GLU C 2 445  ? 47.885  -9.971  82.969  1.00 123.59 ? 445  GLU C CB    1 
ATOM   7046  C  CG    . GLU C 2 445  ? 47.878  -8.448  83.152  1.00 127.00 ? 445  GLU C CG    1 
ATOM   7047  C  CD    . GLU C 2 445  ? 48.030  -8.030  84.625  1.00 137.96 ? 445  GLU C CD    1 
ATOM   7048  O  OE1   . GLU C 2 445  ? 47.405  -7.021  85.044  1.00 140.91 ? 445  GLU C OE1   1 
ATOM   7049  O  OE2   . GLU C 2 445  ? 48.792  -8.705  85.364  1.00 139.28 ? 445  GLU C OE2   1 
ATOM   7050  N  N     . GLY C 2 446  ? 47.183  -9.260  79.886  1.00 121.04 ? 446  GLY C N     1 
ATOM   7051  C  CA    . GLY C 2 446  ? 47.114  -8.334  78.775  1.00 123.58 ? 446  GLY C CA    1 
ATOM   7052  C  C     . GLY C 2 446  ? 47.488  -9.004  77.470  1.00 111.84 ? 446  GLY C C     1 
ATOM   7053  O  O     . GLY C 2 446  ? 47.328  -10.209 77.326  1.00 117.89 ? 446  GLY C O     1 
ATOM   7054  N  N     . ALA C 2 447  ? 48.019  -8.230  76.535  1.00 101.86 ? 447  ALA C N     1 
ATOM   7055  C  CA    . ALA C 2 447  ? 48.074  -8.649  75.138  1.00 105.89 ? 447  ALA C CA    1 
ATOM   7056  C  C     . ALA C 2 447  ? 48.803  -9.982  74.815  1.00 109.75 ? 447  ALA C C     1 
ATOM   7057  O  O     . ALA C 2 447  ? 48.600  -10.583 73.748  1.00 106.93 ? 447  ALA C O     1 
ATOM   7058  C  CB    . ALA C 2 447  ? 48.619  -7.514  74.300  1.00 115.78 ? 447  ALA C CB    1 
ATOM   7059  N  N     . ASN C 2 448  ? 49.646  -10.442 75.728  1.00 110.65 ? 448  ASN C N     1 
ATOM   7060  C  CA    . ASN C 2 448  ? 50.453  -11.620 75.456  1.00 109.06 ? 448  ASN C CA    1 
ATOM   7061  C  C     . ASN C 2 448  ? 49.912  -12.910 75.977  1.00 108.16 ? 448  ASN C C     1 
ATOM   7062  O  O     . ASN C 2 448  ? 50.583  -13.933 75.902  1.00 109.03 ? 448  ASN C O     1 
ATOM   7063  C  CB    . ASN C 2 448  ? 51.848  -11.441 76.012  1.00 112.33 ? 448  ASN C CB    1 
ATOM   7064  C  CG    . ASN C 2 448  ? 52.793  -10.889 74.989  1.00 121.16 ? 448  ASN C CG    1 
ATOM   7065  O  OD1   . ASN C 2 448  ? 52.612  -11.088 73.780  1.00 122.24 ? 448  ASN C OD1   1 
ATOM   7066  N  ND2   . ASN C 2 448  ? 53.807  -10.180 75.456  1.00 123.50 ? 448  ASN C ND2   1 
ATOM   7067  N  N     . ILE C 2 449  ? 48.715  -12.861 76.531  1.00 107.87 ? 449  ILE C N     1 
ATOM   7068  C  CA    . ILE C 2 449  ? 48.300  -13.921 77.417  1.00 108.08 ? 449  ILE C CA    1 
ATOM   7069  C  C     . ILE C 2 449  ? 48.232  -15.288 76.745  1.00 113.49 ? 449  ILE C C     1 
ATOM   7070  O  O     . ILE C 2 449  ? 47.626  -15.444 75.678  1.00 112.25 ? 449  ILE C O     1 
ATOM   7071  C  CB    . ILE C 2 449  ? 47.011  -13.576 78.148  1.00 102.13 ? 449  ILE C CB    1 
ATOM   7072  C  CG1   . ILE C 2 449  ? 46.799  -14.576 79.268  1.00 107.24 ? 449  ILE C CG1   1 
ATOM   7073  C  CG2   . ILE C 2 449  ? 45.841  -13.522 77.195  1.00 101.42 ? 449  ILE C CG2   1 
ATOM   7074  C  CD1   . ILE C 2 449  ? 45.640  -14.245 80.144  1.00 118.10 ? 449  ILE C CD1   1 
ATOM   7075  N  N     . GLY C 2 450  ? 48.914  -16.256 77.364  1.00 113.62 ? 450  GLY C N     1 
ATOM   7076  C  CA    . GLY C 2 450  ? 48.954  -17.626 76.883  1.00 114.06 ? 450  GLY C CA    1 
ATOM   7077  C  C     . GLY C 2 450  ? 49.962  -17.891 75.777  1.00 115.45 ? 450  GLY C C     1 
ATOM   7078  O  O     . GLY C 2 450  ? 49.880  -18.908 75.090  1.00 120.65 ? 450  GLY C O     1 
ATOM   7079  N  N     . LEU C 2 451  ? 50.906  -16.972 75.597  1.00 113.85 ? 451  LEU C N     1 
ATOM   7080  C  CA    . LEU C 2 451  ? 51.918  -17.067 74.536  1.00 116.67 ? 451  LEU C CA    1 
ATOM   7081  C  C     . LEU C 2 451  ? 53.330  -17.205 75.118  1.00 115.86 ? 451  LEU C C     1 
ATOM   7082  O  O     . LEU C 2 451  ? 54.102  -18.099 74.740  1.00 108.69 ? 451  LEU C O     1 
ATOM   7083  C  CB    . LEU C 2 451  ? 51.813  -15.896 73.566  1.00 110.30 ? 451  LEU C CB    1 
ATOM   7084  C  CG    . LEU C 2 451  ? 50.468  -15.710 72.862  1.00 107.18 ? 451  LEU C CG    1 
ATOM   7085  C  CD1   . LEU C 2 451  ? 50.600  -14.539 71.927  1.00 120.52 ? 451  LEU C CD1   1 
ATOM   7086  C  CD2   . LEU C 2 451  ? 49.988  -16.946 72.107  1.00 104.91 ? 451  LEU C CD2   1 
ATOM   7087  N  N     . ILE C 2 452  ? 53.681  -16.233 75.950  1.00 114.06 ? 452  ILE C N     1 
ATOM   7088  C  CA    . ILE C 2 452  ? 54.786  -16.360 76.884  1.00 107.82 ? 452  ILE C CA    1 
ATOM   7089  C  C     . ILE C 2 452  ? 54.262  -17.106 78.127  1.00 112.69 ? 452  ILE C C     1 
ATOM   7090  O  O     . ILE C 2 452  ? 53.196  -16.767 78.644  1.00 110.86 ? 452  ILE C O     1 
ATOM   7091  C  CB    . ILE C 2 452  ? 55.271  -14.972 77.301  1.00 98.48  ? 452  ILE C CB    1 
ATOM   7092  C  CG1   . ILE C 2 452  ? 55.380  -14.060 76.084  1.00 100.35 ? 452  ILE C CG1   1 
ATOM   7093  C  CG2   . ILE C 2 452  ? 56.559  -15.046 78.048  1.00 99.10  ? 452  ILE C CG2   1 
ATOM   7094  C  CD1   . ILE C 2 452  ? 56.036  -14.691 74.882  1.00 108.34 ? 452  ILE C CD1   1 
ATOM   7095  N  N     . THR C 2 453  ? 54.974  -18.139 78.583  1.00 112.76 ? 453  THR C N     1 
ATOM   7096  C  CA    . THR C 2 453  ? 54.622  -18.841 79.824  1.00 110.72 ? 453  THR C CA    1 
ATOM   7097  C  C     . THR C 2 453  ? 55.884  -19.309 80.503  1.00 111.12 ? 453  THR C C     1 
ATOM   7098  O  O     . THR C 2 453  ? 56.942  -19.375 79.878  1.00 102.98 ? 453  THR C O     1 
ATOM   7099  C  CB    . THR C 2 453  ? 53.797  -20.121 79.587  1.00 103.54 ? 453  THR C CB    1 
ATOM   7100  O  OG1   . THR C 2 453  ? 54.328  -20.830 78.467  1.00 98.98  ? 453  THR C OG1   1 
ATOM   7101  C  CG2   . THR C 2 453  ? 52.351  -19.805 79.332  1.00 108.55 ? 453  THR C CG2   1 
ATOM   7102  N  N     . SER C 2 454  ? 55.771  -19.650 81.781  1.00 113.27 ? 454  SER C N     1 
ATOM   7103  C  CA    . SER C 2 454  ? 56.873  -20.330 82.444  1.00 113.40 ? 454  SER C CA    1 
ATOM   7104  C  C     . SER C 2 454  ? 56.691  -21.853 82.458  1.00 107.31 ? 454  SER C C     1 
ATOM   7105  O  O     . SER C 2 454  ? 55.581  -22.372 82.557  1.00 105.09 ? 454  SER C O     1 
ATOM   7106  C  CB    . SER C 2 454  ? 57.155  -19.762 83.847  1.00 109.10 ? 454  SER C CB    1 
ATOM   7107  O  OG    . SER C 2 454  ? 58.163  -18.756 83.808  1.00 108.74 ? 454  SER C OG    1 
ATOM   7108  N  N     . LEU C 2 455  ? 57.814  -22.543 82.304  1.00 105.30 ? 455  LEU C N     1 
ATOM   7109  C  CA    . LEU C 2 455  ? 57.912  -23.987 82.435  1.00 103.53 ? 455  LEU C CA    1 
ATOM   7110  C  C     . LEU C 2 455  ? 57.572  -24.350 83.858  1.00 107.14 ? 455  LEU C C     1 
ATOM   7111  O  O     . LEU C 2 455  ? 57.817  -23.564 84.766  1.00 112.22 ? 455  LEU C O     1 
ATOM   7112  C  CB    . LEU C 2 455  ? 59.355  -24.424 82.144  1.00 103.78 ? 455  LEU C CB    1 
ATOM   7113  C  CG    . LEU C 2 455  ? 59.844  -25.870 82.295  1.00 104.84 ? 455  LEU C CG    1 
ATOM   7114  C  CD1   . LEU C 2 455  ? 59.332  -26.754 81.177  1.00 103.85 ? 455  LEU C CD1   1 
ATOM   7115  C  CD2   . LEU C 2 455  ? 61.368  -25.919 82.329  1.00 105.74 ? 455  LEU C CD2   1 
ATOM   7116  N  N     . ALA C 2 456  ? 57.023  -25.541 84.056  1.00 107.01 ? 456  ALA C N     1 
ATOM   7117  C  CA    . ALA C 2 456  ? 56.702  -26.025 85.392  1.00 109.25 ? 456  ALA C CA    1 
ATOM   7118  C  C     . ALA C 2 456  ? 57.961  -26.300 86.216  1.00 111.80 ? 456  ALA C C     1 
ATOM   7119  O  O     . ALA C 2 456  ? 59.061  -26.376 85.679  1.00 111.35 ? 456  ALA C O     1 
ATOM   7120  C  CB    . ALA C 2 456  ? 55.820  -27.259 85.321  1.00 109.13 ? 456  ALA C CB    1 
ATOM   7121  N  N     . ALA C 2 457  ? 57.788  -26.408 87.530  1.00 114.03 ? 457  ALA C N     1 
ATOM   7122  C  CA    . ALA C 2 457  ? 58.894  -26.631 88.449  1.00 113.32 ? 457  ALA C CA    1 
ATOM   7123  C  C     . ALA C 2 457  ? 59.654  -27.948 88.194  1.00 115.75 ? 457  ALA C C     1 
ATOM   7124  O  O     . ALA C 2 457  ? 60.846  -27.949 87.860  1.00 112.18 ? 457  ALA C O     1 
ATOM   7125  C  CB    . ALA C 2 457  ? 58.368  -26.584 89.877  1.00 106.03 ? 457  ALA C CB    1 
ATOM   7126  N  N     . TYR C 2 458  ? 58.951  -29.067 88.307  1.00 115.62 ? 458  TYR C N     1 
ATOM   7127  C  CA    . TYR C 2 458  ? 59.588  -30.367 88.176  1.00 117.11 ? 458  TYR C CA    1 
ATOM   7128  C  C     . TYR C 2 458  ? 59.781  -30.769 86.732  1.00 120.97 ? 458  TYR C C     1 
ATOM   7129  O  O     . TYR C 2 458  ? 60.399  -31.798 86.442  1.00 123.51 ? 458  TYR C O     1 
ATOM   7130  C  CB    . TYR C 2 458  ? 58.760  -31.429 88.880  1.00 114.77 ? 458  TYR C CB    1 
ATOM   7131  C  CG    . TYR C 2 458  ? 59.101  -31.567 90.332  1.00 117.82 ? 458  TYR C CG    1 
ATOM   7132  C  CD1   . TYR C 2 458  ? 58.146  -31.357 91.309  1.00 118.93 ? 458  TYR C CD1   1 
ATOM   7133  C  CD2   . TYR C 2 458  ? 60.385  -31.898 90.730  1.00 124.03 ? 458  TYR C CD2   1 
ATOM   7134  C  CE1   . TYR C 2 458  ? 58.454  -31.483 92.641  1.00 117.64 ? 458  TYR C CE1   1 
ATOM   7135  C  CE2   . TYR C 2 458  ? 60.701  -32.027 92.060  1.00 126.06 ? 458  TYR C CE2   1 
ATOM   7136  C  CZ    . TYR C 2 458  ? 59.731  -31.816 93.008  1.00 122.04 ? 458  TYR C CZ    1 
ATOM   7137  O  OH    . TYR C 2 458  ? 60.038  -31.935 94.338  1.00 136.43 ? 458  TYR C OH    1 
ATOM   7138  N  N     . ALA C 2 459  ? 59.243  -29.957 85.830  1.00 120.84 ? 459  ALA C N     1 
ATOM   7139  C  CA    . ALA C 2 459  ? 59.241  -30.290 84.415  1.00 116.91 ? 459  ALA C CA    1 
ATOM   7140  C  C     . ALA C 2 459  ? 60.629  -30.191 83.806  1.00 116.84 ? 459  ALA C C     1 
ATOM   7141  O  O     . ALA C 2 459  ? 61.459  -29.371 84.211  1.00 116.88 ? 459  ALA C O     1 
ATOM   7142  C  CB    . ALA C 2 459  ? 58.255  -29.428 83.653  1.00 113.12 ? 459  ALA C CB    1 
ATOM   7143  N  N     . ARG C 2 460  ? 60.866  -31.055 82.832  1.00 116.69 ? 460  ARG C N     1 
ATOM   7144  C  CA    . ARG C 2 460  ? 62.144  -31.134 82.161  1.00 119.94 ? 460  ARG C CA    1 
ATOM   7145  C  C     . ARG C 2 460  ? 61.883  -31.292 80.667  1.00 117.33 ? 460  ARG C C     1 
ATOM   7146  O  O     . ARG C 2 460  ? 60.865  -31.861 80.264  1.00 114.02 ? 460  ARG C O     1 
ATOM   7147  C  CB    . ARG C 2 460  ? 62.954  -32.311 82.720  1.00 125.38 ? 460  ARG C CB    1 
ATOM   7148  C  CG    . ARG C 2 460  ? 63.405  -32.119 84.180  1.00 130.47 ? 460  ARG C CG    1 
ATOM   7149  C  CD    . ARG C 2 460  ? 63.992  -33.392 84.821  1.00 138.75 ? 460  ARG C CD    1 
ATOM   7150  N  NE    . ARG C 2 460  ? 65.262  -33.834 84.229  1.00 149.05 ? 460  ARG C NE    1 
ATOM   7151  C  CZ    . ARG C 2 460  ? 66.374  -34.089 84.920  1.00 150.71 ? 460  ARG C CZ    1 
ATOM   7152  N  NH1   . ARG C 2 460  ? 66.395  -33.948 86.242  1.00 148.85 ? 460  ARG C NH1   1 
ATOM   7153  N  NH2   . ARG C 2 460  ? 67.471  -34.490 84.288  1.00 150.98 ? 460  ARG C NH2   1 
ATOM   7154  N  N     . VAL C 2 461  ? 62.787  -30.760 79.851  1.00 113.01 ? 461  VAL C N     1 
ATOM   7155  C  CA    . VAL C 2 461  ? 62.660  -30.861 78.412  1.00 111.76 ? 461  VAL C CA    1 
ATOM   7156  C  C     . VAL C 2 461  ? 63.602  -31.935 77.901  1.00 124.01 ? 461  VAL C C     1 
ATOM   7157  O  O     . VAL C 2 461  ? 64.811  -31.819 78.080  1.00 133.09 ? 461  VAL C O     1 
ATOM   7158  C  CB    . VAL C 2 461  ? 63.054  -29.558 77.745  1.00 109.36 ? 461  VAL C CB    1 
ATOM   7159  C  CG1   . VAL C 2 461  ? 62.882  -29.678 76.248  1.00 121.50 ? 461  VAL C CG1   1 
ATOM   7160  C  CG2   . VAL C 2 461  ? 62.211  -28.430 78.276  1.00 113.38 ? 461  VAL C CG2   1 
ATOM   7161  N  N     . ASP C 2 462  ? 63.062  -32.976 77.268  1.00 123.94 ? 462  ASP C N     1 
ATOM   7162  C  CA    . ASP C 2 462  ? 63.872  -34.114 76.819  1.00 128.25 ? 462  ASP C CA    1 
ATOM   7163  C  C     . ASP C 2 462  ? 64.498  -33.883 75.444  1.00 139.91 ? 462  ASP C C     1 
ATOM   7164  O  O     . ASP C 2 462  ? 64.368  -32.799 74.878  1.00 142.38 ? 462  ASP C O     1 
ATOM   7165  C  CB    . ASP C 2 462  ? 63.045  -35.400 76.813  1.00 134.57 ? 462  ASP C CB    1 
ATOM   7166  C  CG    . ASP C 2 462  ? 62.031  -35.449 75.671  1.00 139.45 ? 462  ASP C CG    1 
ATOM   7167  O  OD1   . ASP C 2 462  ? 61.746  -34.393 75.057  1.00 134.49 ? 462  ASP C OD1   1 
ATOM   7168  O  OD2   . ASP C 2 462  ? 61.502  -36.551 75.395  1.00 137.84 ? 462  ASP C OD2   1 
ATOM   7169  N  N     . GLU C 2 463  ? 65.147  -34.917 74.902  1.00 147.06 ? 463  GLU C N     1 
ATOM   7170  C  CA    . GLU C 2 463  ? 65.929  -34.811 73.656  1.00 149.76 ? 463  GLU C CA    1 
ATOM   7171  C  C     . GLU C 2 463  ? 65.127  -34.399 72.411  1.00 145.41 ? 463  GLU C C     1 
ATOM   7172  O  O     . GLU C 2 463  ? 65.660  -33.736 71.514  1.00 140.37 ? 463  GLU C O     1 
ATOM   7173  C  CB    . GLU C 2 463  ? 66.699  -36.115 73.382  1.00 151.99 ? 463  GLU C CB    1 
ATOM   7174  C  CG    . GLU C 2 463  ? 67.896  -36.366 74.303  1.00 159.29 ? 463  GLU C CG    1 
ATOM   7175  C  CD    . GLU C 2 463  ? 67.826  -37.716 75.015  1.00 173.12 ? 463  GLU C CD    1 
ATOM   7176  O  OE1   . GLU C 2 463  ? 66.810  -38.425 74.851  1.00 167.51 ? 463  GLU C OE1   1 
ATOM   7177  O  OE2   . GLU C 2 463  ? 68.786  -38.067 75.742  1.00 181.96 ? 463  GLU C OE2   1 
ATOM   7178  N  N     . LEU C 2 464  ? 63.856  -34.791 72.362  1.00 143.42 ? 464  LEU C N     1 
ATOM   7179  C  CA    . LEU C 2 464  ? 62.983  -34.472 71.229  1.00 142.53 ? 464  LEU C CA    1 
ATOM   7180  C  C     . LEU C 2 464  ? 62.284  -33.119 71.407  1.00 139.57 ? 464  LEU C C     1 
ATOM   7181  O  O     . LEU C 2 464  ? 61.548  -32.654 70.529  1.00 134.33 ? 464  LEU C O     1 
ATOM   7182  C  CB    . LEU C 2 464  ? 61.937  -35.572 71.027  1.00 138.76 ? 464  LEU C CB    1 
ATOM   7183  C  CG    . LEU C 2 464  ? 62.399  -36.954 70.565  1.00 133.87 ? 464  LEU C CG    1 
ATOM   7184  C  CD1   . LEU C 2 464  ? 63.374  -36.820 69.411  1.00 141.31 ? 464  LEU C CD1   1 
ATOM   7185  C  CD2   . LEU C 2 464  ? 63.023  -37.711 71.719  1.00 137.28 ? 464  LEU C CD2   1 
ATOM   7186  N  N     . GLY C 2 465  ? 62.518  -32.496 72.557  1.00 137.49 ? 465  GLY C N     1 
ATOM   7187  C  CA    . GLY C 2 465  ? 62.029  -31.158 72.809  1.00 128.96 ? 465  GLY C CA    1 
ATOM   7188  C  C     . GLY C 2 465  ? 60.571  -31.161 73.184  1.00 127.43 ? 465  GLY C C     1 
ATOM   7189  O  O     . GLY C 2 465  ? 59.864  -30.194 72.901  1.00 126.19 ? 465  GLY C O     1 
ATOM   7190  N  N     . PHE C 2 466  ? 60.136  -32.255 73.815  1.00 131.88 ? 466  PHE C N     1 
ATOM   7191  C  CA    . PHE C 2 466  ? 58.796  -32.384 74.412  1.00 131.69 ? 466  PHE C CA    1 
ATOM   7192  C  C     . PHE C 2 466  ? 58.963  -32.237 75.936  1.00 129.59 ? 466  PHE C C     1 
ATOM   7193  O  O     . PHE C 2 466  ? 60.015  -32.609 76.468  1.00 131.03 ? 466  PHE C O     1 
ATOM   7194  C  CB    . PHE C 2 466  ? 58.202  -33.765 74.092  1.00 129.39 ? 466  PHE C CB    1 
ATOM   7195  C  CG    . PHE C 2 466  ? 57.808  -33.964 72.643  1.00 127.37 ? 466  PHE C CG    1 
ATOM   7196  C  CD1   . PHE C 2 466  ? 58.120  -35.147 71.990  1.00 124.77 ? 466  PHE C CD1   1 
ATOM   7197  C  CD2   . PHE C 2 466  ? 57.099  -32.998 71.949  1.00 127.57 ? 466  PHE C CD2   1 
ATOM   7198  C  CE1   . PHE C 2 466  ? 57.758  -35.357 70.673  1.00 123.14 ? 466  PHE C CE1   1 
ATOM   7199  C  CE2   . PHE C 2 466  ? 56.739  -33.207 70.623  1.00 126.12 ? 466  PHE C CE2   1 
ATOM   7200  C  CZ    . PHE C 2 466  ? 57.070  -34.390 69.989  1.00 123.55 ? 466  PHE C CZ    1 
ATOM   7201  N  N     . ILE C 2 467  ? 57.975  -31.686 76.649  1.00 121.93 ? 467  ILE C N     1 
ATOM   7202  C  CA    . ILE C 2 467  ? 58.149  -31.527 78.101  1.00 119.06 ? 467  ILE C CA    1 
ATOM   7203  C  C     . ILE C 2 467  ? 57.716  -32.766 78.897  1.00 116.81 ? 467  ILE C C     1 
ATOM   7204  O  O     . ILE C 2 467  ? 56.708  -33.408 78.594  1.00 115.68 ? 467  ILE C O     1 
ATOM   7205  C  CB    . ILE C 2 467  ? 57.451  -30.267 78.670  1.00 113.64 ? 467  ILE C CB    1 
ATOM   7206  C  CG1   . ILE C 2 467  ? 57.761  -29.039 77.839  1.00 104.73 ? 467  ILE C CG1   1 
ATOM   7207  C  CG2   . ILE C 2 467  ? 57.906  -29.997 80.092  1.00 113.20 ? 467  ILE C CG2   1 
ATOM   7208  C  CD1   . ILE C 2 467  ? 57.245  -27.793 78.477  1.00 101.61 ? 467  ILE C CD1   1 
ATOM   7209  N  N     . ARG C 2 468  ? 58.496  -33.095 79.918  1.00 114.87 ? 468  ARG C N     1 
ATOM   7210  C  CA    . ARG C 2 468  ? 58.173  -34.217 80.778  1.00 119.78 ? 468  ARG C CA    1 
ATOM   7211  C  C     . ARG C 2 468  ? 58.046  -33.826 82.248  1.00 118.61 ? 468  ARG C C     1 
ATOM   7212  O  O     . ARG C 2 468  ? 58.737  -32.931 82.734  1.00 117.62 ? 468  ARG C O     1 
ATOM   7213  C  CB    . ARG C 2 468  ? 59.214  -35.321 80.618  1.00 125.09 ? 468  ARG C CB    1 
ATOM   7214  C  CG    . ARG C 2 468  ? 59.291  -35.890 79.208  1.00 127.66 ? 468  ARG C CG    1 
ATOM   7215  C  CD    . ARG C 2 468  ? 60.505  -36.806 79.040  1.00 133.58 ? 468  ARG C CD    1 
ATOM   7216  N  NE    . ARG C 2 468  ? 60.180  -38.214 79.249  1.00 136.39 ? 468  ARG C NE    1 
ATOM   7217  C  CZ    . ARG C 2 468  ? 60.140  -39.116 78.274  1.00 141.11 ? 468  ARG C CZ    1 
ATOM   7218  N  NH1   . ARG C 2 468  ? 60.419  -38.746 77.029  1.00 142.13 ? 468  ARG C NH1   1 
ATOM   7219  N  NH2   . ARG C 2 468  ? 59.831  -40.383 78.543  1.00 140.03 ? 468  ARG C NH2   1 
ATOM   7220  N  N     . THR C 2 469  ? 57.155  -34.523 82.941  1.00 116.36 ? 469  THR C N     1 
ATOM   7221  C  CA    . THR C 2 469  ? 56.888  -34.301 84.347  1.00 115.80 ? 469  THR C CA    1 
ATOM   7222  C  C     . THR C 2 469  ? 57.105  -35.629 85.035  1.00 117.81 ? 469  THR C C     1 
ATOM   7223  O  O     . THR C 2 469  ? 56.851  -36.667 84.442  1.00 119.90 ? 469  THR C O     1 
ATOM   7224  C  CB    . THR C 2 469  ? 55.430  -33.868 84.565  1.00 119.76 ? 469  THR C CB    1 
ATOM   7225  O  OG1   . THR C 2 469  ? 55.144  -33.838 85.965  1.00 125.61 ? 469  THR C OG1   1 
ATOM   7226  C  CG2   . THR C 2 469  ? 54.463  -34.839 83.892  1.00 116.14 ? 469  THR C CG2   1 
ATOM   7227  N  N     . PRO C 2 470  ? 57.615  -35.614 86.271  1.00 119.57 ? 470  PRO C N     1 
ATOM   7228  C  CA    . PRO C 2 470  ? 57.816  -36.856 87.025  1.00 120.27 ? 470  PRO C CA    1 
ATOM   7229  C  C     . PRO C 2 470  ? 56.537  -37.423 87.644  1.00 119.66 ? 470  PRO C C     1 
ATOM   7230  O  O     . PRO C 2 470  ? 55.689  -36.658 88.079  1.00 119.02 ? 470  PRO C O     1 
ATOM   7231  C  CB    . PRO C 2 470  ? 58.812  -36.446 88.109  1.00 119.23 ? 470  PRO C CB    1 
ATOM   7232  C  CG    . PRO C 2 470  ? 58.600  -35.010 88.280  1.00 121.36 ? 470  PRO C CG    1 
ATOM   7233  C  CD    . PRO C 2 470  ? 58.191  -34.451 86.957  1.00 120.86 ? 470  PRO C CD    1 
ATOM   7234  N  N     . TYR C 2 471  ? 56.421  -38.750 87.686  1.00 123.27 ? 471  TYR C N     1 
ATOM   7235  C  CA    . TYR C 2 471  ? 55.363  -39.431 88.431  1.00 125.54 ? 471  TYR C CA    1 
ATOM   7236  C  C     . TYR C 2 471  ? 55.934  -40.612 89.193  1.00 128.94 ? 471  TYR C C     1 
ATOM   7237  O  O     . TYR C 2 471  ? 56.999  -41.131 88.857  1.00 129.07 ? 471  TYR C O     1 
ATOM   7238  C  CB    . TYR C 2 471  ? 54.259  -39.945 87.516  1.00 122.27 ? 471  TYR C CB    1 
ATOM   7239  C  CG    . TYR C 2 471  ? 53.418  -38.867 86.903  1.00 124.01 ? 471  TYR C CG    1 
ATOM   7240  C  CD1   . TYR C 2 471  ? 53.451  -38.641 85.543  1.00 126.19 ? 471  TYR C CD1   1 
ATOM   7241  C  CD2   . TYR C 2 471  ? 52.587  -38.070 87.682  1.00 127.52 ? 471  TYR C CD2   1 
ATOM   7242  C  CE1   . TYR C 2 471  ? 52.684  -37.656 84.966  1.00 127.72 ? 471  TYR C CE1   1 
ATOM   7243  C  CE2   . TYR C 2 471  ? 51.817  -37.074 87.108  1.00 125.85 ? 471  TYR C CE2   1 
ATOM   7244  C  CZ    . TYR C 2 471  ? 51.874  -36.878 85.746  1.00 124.67 ? 471  TYR C CZ    1 
ATOM   7245  O  OH    . TYR C 2 471  ? 51.127  -35.906 85.142  1.00 122.21 ? 471  TYR C OH    1 
ATOM   7246  N  N     . ARG C 2 472  ? 55.216  -41.052 90.214  1.00 127.72 ? 472  ARG C N     1 
ATOM   7247  C  CA    . ARG C 2 472  ? 55.655  -42.210 90.957  1.00 129.79 ? 472  ARG C CA    1 
ATOM   7248  C  C     . ARG C 2 472  ? 55.027  -43.478 90.451  1.00 133.50 ? 472  ARG C C     1 
ATOM   7249  O  O     . ARG C 2 472  ? 53.821  -43.543 90.282  1.00 132.04 ? 472  ARG C O     1 
ATOM   7250  C  CB    . ARG C 2 472  ? 55.340  -42.031 92.421  1.00 125.47 ? 472  ARG C CB    1 
ATOM   7251  C  CG    . ARG C 2 472  ? 56.390  -41.226 93.070  1.00 130.46 ? 472  ARG C CG    1 
ATOM   7252  C  CD    . ARG C 2 472  ? 56.425  -41.527 94.507  1.00 134.69 ? 472  ARG C CD    1 
ATOM   7253  N  NE    . ARG C 2 472  ? 55.651  -40.542 95.224  1.00 135.67 ? 472  ARG C NE    1 
ATOM   7254  C  CZ    . ARG C 2 472  ? 55.544  -40.521 96.537  1.00 144.00 ? 472  ARG C CZ    1 
ATOM   7255  N  NH1   . ARG C 2 472  ? 56.164  -41.446 97.260  1.00 148.23 ? 472  ARG C NH1   1 
ATOM   7256  N  NH2   . ARG C 2 472  ? 54.817  -39.582 97.115  1.00 144.97 ? 472  ARG C NH2   1 
ATOM   7257  N  N     . ARG C 2 473  ? 55.841  -44.493 90.202  1.00 135.58 ? 473  ARG C N     1 
ATOM   7258  C  CA    . ARG C 2 473  ? 55.257  -45.772 89.881  1.00 136.92 ? 473  ARG C CA    1 
ATOM   7259  C  C     . ARG C 2 473  ? 54.607  -46.314 91.125  1.00 141.42 ? 473  ARG C C     1 
ATOM   7260  O  O     . ARG C 2 473  ? 55.224  -46.377 92.188  1.00 143.15 ? 473  ARG C O     1 
ATOM   7261  C  CB    . ARG C 2 473  ? 56.279  -46.774 89.386  1.00 139.03 ? 473  ARG C CB    1 
ATOM   7262  C  CG    . ARG C 2 473  ? 55.687  -48.174 89.296  1.00 141.05 ? 473  ARG C CG    1 
ATOM   7263  C  CD    . ARG C 2 473  ? 55.778  -48.717 87.895  1.00 140.54 ? 473  ARG C CD    1 
ATOM   7264  N  NE    . ARG C 2 473  ? 57.147  -48.589 87.420  1.00 143.15 ? 473  ARG C NE    1 
ATOM   7265  C  CZ    . ARG C 2 473  ? 57.482  -48.381 86.155  1.00 140.85 ? 473  ARG C CZ    1 
ATOM   7266  N  NH1   . ARG C 2 473  ? 56.537  -48.286 85.227  1.00 138.99 ? 473  ARG C NH1   1 
ATOM   7267  N  NH2   . ARG C 2 473  ? 58.762  -48.267 85.822  1.00 136.70 ? 473  ARG C NH2   1 
ATOM   7268  N  N     . VAL C 2 474  ? 53.345  -46.686 90.984  1.00 141.59 ? 474  VAL C N     1 
ATOM   7269  C  CA    . VAL C 2 474  ? 52.618  -47.352 92.043  1.00 144.49 ? 474  VAL C CA    1 
ATOM   7270  C  C     . VAL C 2 474  ? 52.334  -48.762 91.547  1.00 154.83 ? 474  VAL C C     1 
ATOM   7271  O  O     . VAL C 2 474  ? 51.721  -48.924 90.491  1.00 156.01 ? 474  VAL C O     1 
ATOM   7272  C  CB    . VAL C 2 474  ? 51.294  -46.621 92.338  1.00 139.18 ? 474  VAL C CB    1 
ATOM   7273  C  CG1   . VAL C 2 474  ? 50.615  -47.200 93.554  1.00 142.88 ? 474  VAL C CG1   1 
ATOM   7274  C  CG2   . VAL C 2 474  ? 51.551  -45.147 92.548  1.00 143.11 ? 474  VAL C CG2   1 
ATOM   7275  N  N     . VAL C 2 475  ? 52.818  -49.776 92.273  1.00 161.43 ? 475  VAL C N     1 
ATOM   7276  C  CA    . VAL C 2 475  ? 52.499  -51.183 91.976  1.00 159.93 ? 475  VAL C CA    1 
ATOM   7277  C  C     . VAL C 2 475  ? 51.804  -51.822 93.185  1.00 157.39 ? 475  VAL C C     1 
ATOM   7278  O  O     . VAL C 2 475  ? 52.284  -51.709 94.321  1.00 155.83 ? 475  VAL C O     1 
ATOM   7279  C  CB    . VAL C 2 475  ? 53.753  -52.020 91.566  1.00 154.93 ? 475  VAL C CB    1 
ATOM   7280  C  CG1   . VAL C 2 475  ? 53.364  -53.463 91.266  1.00 158.48 ? 475  VAL C CG1   1 
ATOM   7281  C  CG2   . VAL C 2 475  ? 54.445  -51.413 90.354  1.00 150.65 ? 475  VAL C CG2   1 
ATOM   7282  N  N     . GLY C 2 476  ? 50.682  -52.496 92.939  1.00 153.63 ? 476  GLY C N     1 
ATOM   7283  C  CA    . GLY C 2 476  ? 49.848  -53.008 94.013  1.00 152.96 ? 476  GLY C CA    1 
ATOM   7284  C  C     . GLY C 2 476  ? 49.116  -51.895 94.732  1.00 151.83 ? 476  GLY C C     1 
ATOM   7285  O  O     . GLY C 2 476  ? 48.400  -51.113 94.110  1.00 152.06 ? 476  GLY C O     1 
ATOM   7286  N  N     . GLY C 2 477  ? 49.252  -51.845 96.049  1.00 151.77 ? 477  GLY C N     1 
ATOM   7287  C  CA    . GLY C 2 477  ? 48.780  -50.697 96.791  1.00 154.11 ? 477  GLY C CA    1 
ATOM   7288  C  C     . GLY C 2 477  ? 49.971  -49.818 97.102  1.00 157.76 ? 477  GLY C C     1 
ATOM   7289  O  O     . GLY C 2 477  ? 49.824  -48.659 97.467  1.00 160.37 ? 477  GLY C O     1 
ATOM   7290  N  N     . VAL C 2 478  ? 51.163  -50.379 96.939  1.00 153.52 ? 478  VAL C N     1 
ATOM   7291  C  CA    . VAL C 2 478  ? 52.388  -49.715 97.363  1.00 151.99 ? 478  VAL C CA    1 
ATOM   7292  C  C     . VAL C 2 478  ? 52.845  -48.691 96.333  1.00 152.62 ? 478  VAL C C     1 
ATOM   7293  O  O     . VAL C 2 478  ? 52.621  -48.875 95.146  1.00 153.59 ? 478  VAL C O     1 
ATOM   7294  C  CB    . VAL C 2 478  ? 53.497  -50.744 97.584  1.00 156.08 ? 478  VAL C CB    1 
ATOM   7295  C  CG1   . VAL C 2 478  ? 54.554  -50.180 98.504  1.00 161.32 ? 478  VAL C CG1   1 
ATOM   7296  C  CG2   . VAL C 2 478  ? 52.909  -52.018 98.179  1.00 160.01 ? 478  VAL C CG2   1 
ATOM   7297  N  N     . VAL C 2 479  ? 53.481  -47.613 96.779  1.00 153.05 ? 479  VAL C N     1 
ATOM   7298  C  CA    . VAL C 2 479  ? 54.009  -46.621 95.844  1.00 151.56 ? 479  VAL C CA    1 
ATOM   7299  C  C     . VAL C 2 479  ? 55.532  -46.676 95.755  1.00 152.37 ? 479  VAL C C     1 
ATOM   7300  O  O     . VAL C 2 479  ? 56.217  -46.303 96.709  1.00 155.31 ? 479  VAL C O     1 
ATOM   7301  C  CB    . VAL C 2 479  ? 53.599  -45.204 96.251  1.00 147.95 ? 479  VAL C CB    1 
ATOM   7302  C  CG1   . VAL C 2 479  ? 54.163  -44.195 95.259  1.00 143.19 ? 479  VAL C CG1   1 
ATOM   7303  C  CG2   . VAL C 2 479  ? 52.084  -45.102 96.344  1.00 147.94 ? 479  VAL C CG2   1 
ATOM   7304  N  N     . THR C 2 480  ? 56.066  -47.119 94.614  1.00 147.95 ? 480  THR C N     1 
ATOM   7305  C  CA    . THR C 2 480  ? 57.519  -47.229 94.481  1.00 151.72 ? 480  THR C CA    1 
ATOM   7306  C  C     . THR C 2 480  ? 58.094  -45.841 94.596  1.00 149.52 ? 480  THR C C     1 
ATOM   7307  O  O     . THR C 2 480  ? 57.414  -44.852 94.323  1.00 149.39 ? 480  THR C O     1 
ATOM   7308  C  CB    . THR C 2 480  ? 58.002  -47.828 93.127  1.00 152.87 ? 480  THR C CB    1 
ATOM   7309  O  OG1   . THR C 2 480  ? 57.092  -48.831 92.668  1.00 153.56 ? 480  THR C OG1   1 
ATOM   7310  C  CG2   . THR C 2 480  ? 59.403  -48.447 93.273  1.00 149.01 ? 480  THR C CG2   1 
ATOM   7311  N  N     . ASP C 2 481  ? 59.344  -45.765 95.018  1.00 147.34 ? 481  ASP C N     1 
ATOM   7312  C  CA    . ASP C 2 481  ? 59.977  -44.477 95.164  1.00 149.30 ? 481  ASP C CA    1 
ATOM   7313  C  C     . ASP C 2 481  ? 60.686  -44.082 93.873  1.00 147.09 ? 481  ASP C C     1 
ATOM   7314  O  O     . ASP C 2 481  ? 61.373  -43.066 93.811  1.00 149.09 ? 481  ASP C O     1 
ATOM   7315  C  CB    . ASP C 2 481  ? 60.869  -44.446 96.408  1.00 156.25 ? 481  ASP C CB    1 
ATOM   7316  C  CG    . ASP C 2 481  ? 60.060  -44.541 97.703  1.00 160.14 ? 481  ASP C CG    1 
ATOM   7317  O  OD1   . ASP C 2 481  ? 58.834  -44.285 97.666  1.00 155.19 ? 481  ASP C OD1   1 
ATOM   7318  O  OD2   . ASP C 2 481  ? 60.647  -44.870 98.756  1.00 164.47 ? 481  ASP C OD2   1 
ATOM   7319  N  N     . GLU C 2 482  ? 60.494  -44.888 92.835  1.00 141.07 ? 482  GLU C N     1 
ATOM   7320  C  CA    . GLU C 2 482  ? 61.039  -44.570 91.524  1.00 141.83 ? 482  GLU C CA    1 
ATOM   7321  C  C     . GLU C 2 482  ? 60.192  -43.544 90.767  1.00 137.14 ? 482  GLU C C     1 
ATOM   7322  O  O     . GLU C 2 482  ? 58.984  -43.726 90.585  1.00 130.57 ? 482  GLU C O     1 
ATOM   7323  C  CB    . GLU C 2 482  ? 61.194  -45.836 90.686  1.00 146.68 ? 482  GLU C CB    1 
ATOM   7324  C  CG    . GLU C 2 482  ? 59.878  -46.492 90.311  1.00 147.17 ? 482  GLU C CG    1 
ATOM   7325  C  CD    . GLU C 2 482  ? 60.045  -47.697 89.407  1.00 153.24 ? 482  GLU C CD    1 
ATOM   7326  O  OE1   . GLU C 2 482  ? 60.897  -47.668 88.489  1.00 146.81 ? 482  GLU C OE1   1 
ATOM   7327  O  OE2   . GLU C 2 482  ? 59.310  -48.683 89.624  1.00 158.23 ? 482  GLU C OE2   1 
ATOM   7328  N  N     . VAL C 2 483  ? 60.844  -42.469 90.325  1.00 141.80 ? 483  VAL C N     1 
ATOM   7329  C  CA    . VAL C 2 483  ? 60.192  -41.424 89.527  1.00 137.09 ? 483  VAL C CA    1 
ATOM   7330  C  C     . VAL C 2 483  ? 60.322  -41.642 88.018  1.00 132.52 ? 483  VAL C C     1 
ATOM   7331  O  O     . VAL C 2 483  ? 61.415  -41.587 87.442  1.00 129.38 ? 483  VAL C O     1 
ATOM   7332  C  CB    . VAL C 2 483  ? 60.692  -39.997 89.876  1.00 134.44 ? 483  VAL C CB    1 
ATOM   7333  C  CG1   . VAL C 2 483  ? 60.117  -39.552 91.209  1.00 128.03 ? 483  VAL C CG1   1 
ATOM   7334  C  CG2   . VAL C 2 483  ? 62.226  -39.935 89.876  1.00 137.65 ? 483  VAL C CG2   1 
ATOM   7335  N  N     . VAL C 2 484  ? 59.177  -41.872 87.390  1.00 127.38 ? 484  VAL C N     1 
ATOM   7336  C  CA    . VAL C 2 484  ? 59.077  -42.101 85.957  1.00 123.87 ? 484  VAL C CA    1 
ATOM   7337  C  C     . VAL C 2 484  ? 58.856  -40.772 85.258  1.00 123.25 ? 484  VAL C C     1 
ATOM   7338  O  O     . VAL C 2 484  ? 57.813  -40.169 85.459  1.00 128.77 ? 484  VAL C O     1 
ATOM   7339  C  CB    . VAL C 2 484  ? 57.819  -42.947 85.674  1.00 127.15 ? 484  VAL C CB    1 
ATOM   7340  C  CG1   . VAL C 2 484  ? 57.586  -43.135 84.172  1.00 123.90 ? 484  VAL C CG1   1 
ATOM   7341  C  CG2   . VAL C 2 484  ? 57.895  -44.276 86.408  1.00 133.83 ? 484  VAL C CG2   1 
ATOM   7342  N  N     . TYR C 2 485  ? 59.790  -40.303 84.428  1.00 116.85 ? 485  TYR C N     1 
ATOM   7343  C  CA    . TYR C 2 485  ? 59.566  -39.028 83.729  1.00 115.74 ? 485  TYR C CA    1 
ATOM   7344  C  C     . TYR C 2 485  ? 58.815  -39.255 82.417  1.00 122.67 ? 485  TYR C C     1 
ATOM   7345  O  O     . TYR C 2 485  ? 59.334  -39.904 81.513  1.00 127.04 ? 485  TYR C O     1 
ATOM   7346  C  CB    . TYR C 2 485  ? 60.875  -38.290 83.476  1.00 111.44 ? 485  TYR C CB    1 
ATOM   7347  C  CG    . TYR C 2 485  ? 61.310  -37.371 84.599  1.00 118.34 ? 485  TYR C CG    1 
ATOM   7348  C  CD1   . TYR C 2 485  ? 62.274  -37.769 85.525  1.00 123.31 ? 485  TYR C CD1   1 
ATOM   7349  C  CD2   . TYR C 2 485  ? 60.766  -36.099 84.733  1.00 120.98 ? 485  TYR C CD2   1 
ATOM   7350  C  CE1   . TYR C 2 485  ? 62.679  -36.918 86.561  1.00 129.28 ? 485  TYR C CE1   1 
ATOM   7351  C  CE2   . TYR C 2 485  ? 61.165  -35.242 85.761  1.00 124.20 ? 485  TYR C CE2   1 
ATOM   7352  C  CZ    . TYR C 2 485  ? 62.114  -35.652 86.673  1.00 128.50 ? 485  TYR C CZ    1 
ATOM   7353  O  OH    . TYR C 2 485  ? 62.495  -34.791 87.684  1.00 125.19 ? 485  TYR C OH    1 
ATOM   7354  N  N     . MET C 2 486  ? 57.601  -38.704 82.313  1.00 123.59 ? 486  MET C N     1 
ATOM   7355  C  CA    . MET C 2 486  ? 56.677  -39.031 81.212  1.00 123.28 ? 486  MET C CA    1 
ATOM   7356  C  C     . MET C 2 486  ? 56.428  -37.934 80.204  1.00 122.12 ? 486  MET C C     1 
ATOM   7357  O  O     . MET C 2 486  ? 56.182  -36.792 80.567  1.00 123.46 ? 486  MET C O     1 
ATOM   7358  C  CB    . MET C 2 486  ? 55.313  -39.442 81.753  1.00 120.03 ? 486  MET C CB    1 
ATOM   7359  C  CG    . MET C 2 486  ? 55.267  -40.830 82.287  1.00 124.20 ? 486  MET C CG    1 
ATOM   7360  S  SD    . MET C 2 486  ? 53.603  -41.239 82.795  1.00 124.84 ? 486  MET C SD    1 
ATOM   7361  C  CE    . MET C 2 486  ? 53.997  -42.559 83.925  1.00 129.77 ? 486  MET C CE    1 
ATOM   7362  N  N     . THR C 2 487  ? 56.422  -38.314 78.934  1.00 120.81 ? 487  THR C N     1 
ATOM   7363  C  CA    . THR C 2 487  ? 56.046  -37.410 77.868  1.00 117.55 ? 487  THR C CA    1 
ATOM   7364  C  C     . THR C 2 487  ? 54.589  -37.047 78.051  1.00 121.52 ? 487  THR C C     1 
ATOM   7365  O  O     . THR C 2 487  ? 53.856  -37.725 78.772  1.00 124.21 ? 487  THR C O     1 
ATOM   7366  C  CB    . THR C 2 487  ? 56.164  -38.075 76.506  1.00 118.59 ? 487  THR C CB    1 
ATOM   7367  O  OG1   . THR C 2 487  ? 54.876  -38.095 75.885  1.00 116.77 ? 487  THR C OG1   1 
ATOM   7368  C  CG2   . THR C 2 487  ? 56.672  -39.497 76.649  1.00 121.29 ? 487  THR C CG2   1 
ATOM   7369  N  N     . ALA C 2 488  ? 54.174  -35.960 77.416  1.00 119.88 ? 488  ALA C N     1 
ATOM   7370  C  CA    . ALA C 2 488  ? 52.802  -35.481 77.536  1.00 122.79 ? 488  ALA C CA    1 
ATOM   7371  C  C     . ALA C 2 488  ? 51.804  -36.539 77.097  1.00 120.43 ? 488  ALA C C     1 
ATOM   7372  O  O     . ALA C 2 488  ? 50.696  -36.635 77.629  1.00 112.42 ? 488  ALA C O     1 
ATOM   7373  C  CB    . ALA C 2 488  ? 52.628  -34.218 76.742  1.00 122.10 ? 488  ALA C CB    1 
ATOM   7374  N  N     . THR C 2 489  ? 52.228  -37.327 76.116  1.00 125.22 ? 489  THR C N     1 
ATOM   7375  C  CA    . THR C 2 489  ? 51.416  -38.385 75.537  1.00 127.64 ? 489  THR C CA    1 
ATOM   7376  C  C     . THR C 2 489  ? 51.417  -39.643 76.393  1.00 131.51 ? 489  THR C C     1 
ATOM   7377  O  O     . THR C 2 489  ? 50.381  -40.264 76.608  1.00 136.81 ? 489  THR C O     1 
ATOM   7378  C  CB    . THR C 2 489  ? 51.915  -38.757 74.125  1.00 123.76 ? 489  THR C CB    1 
ATOM   7379  O  OG1   . THR C 2 489  ? 51.630  -37.690 73.207  1.00 122.72 ? 489  THR C OG1   1 
ATOM   7380  C  CG2   . THR C 2 489  ? 51.240  -40.034 73.645  1.00 119.30 ? 489  THR C CG2   1 
ATOM   7381  N  N     . GLU C 2 490  ? 52.581  -40.028 76.891  1.00 130.85 ? 490  GLU C N     1 
ATOM   7382  C  CA    . GLU C 2 490  ? 52.660  -41.282 77.621  1.00 131.37 ? 490  GLU C CA    1 
ATOM   7383  C  C     . GLU C 2 490  ? 52.060  -41.149 79.021  1.00 128.11 ? 490  GLU C C     1 
ATOM   7384  O  O     . GLU C 2 490  ? 51.819  -42.140 79.683  1.00 134.12 ? 490  GLU C O     1 
ATOM   7385  C  CB    . GLU C 2 490  ? 54.095  -41.802 77.648  1.00 134.64 ? 490  GLU C CB    1 
ATOM   7386  C  CG    . GLU C 2 490  ? 54.288  -43.163 78.271  1.00 135.35 ? 490  GLU C CG    1 
ATOM   7387  C  CD    . GLU C 2 490  ? 55.552  -43.191 79.095  1.00 141.79 ? 490  GLU C CD    1 
ATOM   7388  O  OE1   . GLU C 2 490  ? 56.505  -42.459 78.735  1.00 140.96 ? 490  GLU C OE1   1 
ATOM   7389  O  OE2   . GLU C 2 490  ? 55.589  -43.912 80.114  1.00 142.54 ? 490  GLU C OE2   1 
ATOM   7390  N  N     . GLU C 2 491  ? 51.793  -39.928 79.465  1.00 123.62 ? 491  GLU C N     1 
ATOM   7391  C  CA    . GLU C 2 491  ? 51.003  -39.738 80.675  1.00 125.87 ? 491  GLU C CA    1 
ATOM   7392  C  C     . GLU C 2 491  ? 49.566  -40.215 80.422  1.00 128.43 ? 491  GLU C C     1 
ATOM   7393  O  O     . GLU C 2 491  ? 48.858  -40.648 81.341  1.00 129.08 ? 491  GLU C O     1 
ATOM   7394  C  CB    . GLU C 2 491  ? 51.006  -38.259 81.081  1.00 130.20 ? 491  GLU C CB    1 
ATOM   7395  C  CG    . GLU C 2 491  ? 49.706  -37.774 81.759  1.00 135.80 ? 491  GLU C CG    1 
ATOM   7396  C  CD    . GLU C 2 491  ? 49.494  -36.268 81.633  1.00 135.28 ? 491  GLU C CD    1 
ATOM   7397  O  OE1   . GLU C 2 491  ? 48.322  -35.788 81.641  1.00 131.11 ? 491  GLU C OE1   1 
ATOM   7398  O  OE2   . GLU C 2 491  ? 50.521  -35.569 81.523  1.00 132.02 ? 491  GLU C OE2   1 
ATOM   7399  N  N     . ASP C 2 492  ? 49.148  -40.137 79.161  1.00 128.83 ? 492  ASP C N     1 
ATOM   7400  C  CA    . ASP C 2 492  ? 47.764  -40.408 78.773  1.00 131.87 ? 492  ASP C CA    1 
ATOM   7401  C  C     . ASP C 2 492  ? 47.377  -41.880 78.883  1.00 134.96 ? 492  ASP C C     1 
ATOM   7402  O  O     . ASP C 2 492  ? 46.197  -42.220 78.880  1.00 140.96 ? 492  ASP C O     1 
ATOM   7403  C  CB    . ASP C 2 492  ? 47.486  -39.931 77.340  1.00 129.85 ? 492  ASP C CB    1 
ATOM   7404  C  CG    . ASP C 2 492  ? 47.196  -38.439 77.247  1.00 129.76 ? 492  ASP C CG    1 
ATOM   7405  O  OD1   . ASP C 2 492  ? 46.128  -38.098 76.701  1.00 129.06 ? 492  ASP C OD1   1 
ATOM   7406  O  OD2   . ASP C 2 492  ? 48.031  -37.610 77.682  1.00 129.95 ? 492  ASP C OD2   1 
ATOM   7407  N  N     . ARG C 2 493  ? 48.361  -42.761 78.962  1.00 134.60 ? 493  ARG C N     1 
ATOM   7408  C  CA    . ARG C 2 493  ? 48.070  -44.187 78.968  1.00 137.34 ? 493  ARG C CA    1 
ATOM   7409  C  C     . ARG C 2 493  ? 47.701  -44.686 80.363  1.00 139.46 ? 493  ARG C C     1 
ATOM   7410  O  O     . ARG C 2 493  ? 47.173  -45.789 80.510  1.00 143.44 ? 493  ARG C O     1 
ATOM   7411  C  CB    . ARG C 2 493  ? 49.263  -44.976 78.417  1.00 145.43 ? 493  ARG C CB    1 
ATOM   7412  C  CG    . ARG C 2 493  ? 49.752  -44.533 77.035  1.00 148.34 ? 493  ARG C CG    1 
ATOM   7413  C  CD    . ARG C 2 493  ? 50.933  -45.367 76.568  1.00 151.39 ? 493  ARG C CD    1 
ATOM   7414  N  NE    . ARG C 2 493  ? 50.635  -46.789 76.666  1.00 151.97 ? 493  ARG C NE    1 
ATOM   7415  C  CZ    . ARG C 2 493  ? 51.500  -47.758 76.399  1.00 162.73 ? 493  ARG C CZ    1 
ATOM   7416  N  NH1   . ARG C 2 493  ? 52.737  -47.466 76.007  1.00 166.04 ? 493  ARG C NH1   1 
ATOM   7417  N  NH2   . ARG C 2 493  ? 51.116  -49.021 76.530  1.00 170.23 ? 493  ARG C NH2   1 
ATOM   7418  N  N     . TYR C 2 494  ? 47.963  -43.869 81.383  1.00 140.60 ? 494  TYR C N     1 
ATOM   7419  C  CA    . TYR C 2 494  ? 47.838  -44.322 82.771  1.00 138.40 ? 494  TYR C CA    1 
ATOM   7420  C  C     . TYR C 2 494  ? 46.883  -43.507 83.609  1.00 132.73 ? 494  TYR C C     1 
ATOM   7421  O  O     . TYR C 2 494  ? 46.474  -42.406 83.243  1.00 130.06 ? 494  TYR C O     1 
ATOM   7422  C  CB    . TYR C 2 494  ? 49.197  -44.352 83.479  1.00 137.42 ? 494  TYR C CB    1 
ATOM   7423  C  CG    . TYR C 2 494  ? 50.294  -44.875 82.599  1.00 138.49 ? 494  TYR C CG    1 
ATOM   7424  C  CD1   . TYR C 2 494  ? 50.197  -46.127 82.006  1.00 142.66 ? 494  TYR C CD1   1 
ATOM   7425  C  CD2   . TYR C 2 494  ? 51.413  -44.112 82.335  1.00 140.05 ? 494  TYR C CD2   1 
ATOM   7426  C  CE1   . TYR C 2 494  ? 51.192  -46.606 81.178  1.00 146.47 ? 494  TYR C CE1   1 
ATOM   7427  C  CE2   . TYR C 2 494  ? 52.419  -44.584 81.516  1.00 146.28 ? 494  TYR C CE2   1 
ATOM   7428  C  CZ    . TYR C 2 494  ? 52.303  -45.831 80.934  1.00 148.79 ? 494  TYR C CZ    1 
ATOM   7429  O  OH    . TYR C 2 494  ? 53.298  -46.311 80.104  1.00 154.49 ? 494  TYR C OH    1 
ATOM   7430  N  N     . THR C 2 495  ? 46.534  -44.101 84.742  1.00 133.42 ? 495  THR C N     1 
ATOM   7431  C  CA    . THR C 2 495  ? 45.752  -43.464 85.779  1.00 135.57 ? 495  THR C CA    1 
ATOM   7432  C  C     . THR C 2 495  ? 46.697  -42.946 86.864  1.00 134.37 ? 495  THR C C     1 
ATOM   7433  O  O     . THR C 2 495  ? 47.475  -43.708 87.434  1.00 133.12 ? 495  THR C O     1 
ATOM   7434  C  CB    . THR C 2 495  ? 44.800  -44.473 86.379  1.00 131.11 ? 495  THR C CB    1 
ATOM   7435  O  OG1   . THR C 2 495  ? 44.330  -45.331 85.337  1.00 132.33 ? 495  THR C OG1   1 
ATOM   7436  C  CG2   . THR C 2 495  ? 43.632  -43.773 87.015  1.00 132.95 ? 495  THR C CG2   1 
ATOM   7437  N  N     . ILE C 2 496  ? 46.634  -41.644 87.127  1.00 133.03 ? 496  ILE C N     1 
ATOM   7438  C  CA    . ILE C 2 496  ? 47.613  -40.964 87.969  1.00 130.17 ? 496  ILE C CA    1 
ATOM   7439  C  C     . ILE C 2 496  ? 47.016  -40.214 89.168  1.00 130.89 ? 496  ILE C C     1 
ATOM   7440  O  O     . ILE C 2 496  ? 46.398  -39.162 89.005  1.00 131.60 ? 496  ILE C O     1 
ATOM   7441  C  CB    . ILE C 2 496  ? 48.390  -39.952 87.114  1.00 130.35 ? 496  ILE C CB    1 
ATOM   7442  C  CG1   . ILE C 2 496  ? 49.180  -40.686 86.028  1.00 129.05 ? 496  ILE C CG1   1 
ATOM   7443  C  CG2   . ILE C 2 496  ? 49.276  -39.079 87.984  1.00 128.91 ? 496  ILE C CG2   1 
ATOM   7444  C  CD1   . ILE C 2 496  ? 49.472  -39.838 84.813  1.00 129.00 ? 496  ILE C CD1   1 
ATOM   7445  N  N     . ALA C 2 497  ? 47.257  -40.717 90.375  1.00 130.07 ? 497  ALA C N     1 
ATOM   7446  C  CA    . ALA C 2 497  ? 46.685  -40.118 91.578  1.00 126.54 ? 497  ALA C CA    1 
ATOM   7447  C  C     . ALA C 2 497  ? 47.340  -38.803 91.917  1.00 131.13 ? 497  ALA C C     1 
ATOM   7448  O  O     . ALA C 2 497  ? 48.419  -38.489 91.404  1.00 131.24 ? 497  ALA C O     1 
ATOM   7449  C  CB    . ALA C 2 497  ? 46.789  -41.056 92.753  1.00 126.90 ? 497  ALA C CB    1 
ATOM   7450  N  N     . GLN C 2 498  ? 46.649  -38.030 92.757  1.00 134.78 ? 498  GLN C N     1 
ATOM   7451  C  CA    . GLN C 2 498  ? 47.188  -36.799 93.345  1.00 140.63 ? 498  GLN C CA    1 
ATOM   7452  C  C     . GLN C 2 498  ? 48.166  -37.124 94.472  1.00 145.69 ? 498  GLN C C     1 
ATOM   7453  O  O     . GLN C 2 498  ? 48.067  -38.191 95.084  1.00 152.04 ? 498  GLN C O     1 
ATOM   7454  C  CB    . GLN C 2 498  ? 46.066  -35.916 93.911  1.00 137.25 ? 498  GLN C CB    1 
ATOM   7455  C  CG    . GLN C 2 498  ? 45.094  -35.372 92.900  1.00 126.47 ? 498  GLN C CG    1 
ATOM   7456  C  CD    . GLN C 2 498  ? 45.768  -34.590 91.815  1.00 127.61 ? 498  GLN C CD    1 
ATOM   7457  O  OE1   . GLN C 2 498  ? 45.278  -34.551 90.688  1.00 122.00 ? 498  GLN C OE1   1 
ATOM   7458  N  NE2   . GLN C 2 498  ? 46.898  -33.949 92.139  1.00 132.27 ? 498  GLN C NE2   1 
ATOM   7459  N  N     . ALA C 2 499  ? 49.093  -36.207 94.758  1.00 141.19 ? 499  ALA C N     1 
ATOM   7460  C  CA    . ALA C 2 499  ? 50.062  -36.407 95.848  1.00 143.09 ? 499  ALA C CA    1 
ATOM   7461  C  C     . ALA C 2 499  ? 49.417  -36.267 97.236  1.00 149.35 ? 499  ALA C C     1 
ATOM   7462  O  O     . ALA C 2 499  ? 49.950  -36.756 98.249  1.00 146.20 ? 499  ALA C O     1 
ATOM   7463  C  CB    . ALA C 2 499  ? 51.228  -35.455 95.706  1.00 139.50 ? 499  ALA C CB    1 
ATOM   7464  N  N     . ASN C 2 500  ? 48.266  -35.597 97.260  1.00 153.49 ? 500  ASN C N     1 
ATOM   7465  C  CA    . ASN C 2 500  ? 47.498  -35.395 98.480  1.00 149.04 ? 500  ASN C CA    1 
ATOM   7466  C  C     . ASN C 2 500  ? 46.901  -36.684 99.007  1.00 147.11 ? 500  ASN C C     1 
ATOM   7467  O  O     . ASN C 2 500  ? 46.588  -36.751 100.182 1.00 150.55 ? 500  ASN C O     1 
ATOM   7468  C  CB    . ASN C 2 500  ? 46.372  -34.369 98.275  1.00 148.96 ? 500  ASN C CB    1 
ATOM   7469  C  CG    . ASN C 2 500  ? 46.884  -33.013 97.800  1.00 156.77 ? 500  ASN C CG    1 
ATOM   7470  O  OD1   . ASN C 2 500  ? 46.206  -32.309 97.048  1.00 146.76 ? 500  ASN C OD1   1 
ATOM   7471  N  ND2   . ASN C 2 500  ? 48.083  -32.642 98.240  1.00 156.91 ? 500  ASN C ND2   1 
ATOM   7472  N  N     . THR C 2 501  ? 46.741  -37.695 98.149  1.00 149.64 ? 501  THR C N     1 
ATOM   7473  C  CA    . THR C 2 501  ? 46.131  -38.974 98.552  1.00 154.32 ? 501  THR C CA    1 
ATOM   7474  C  C     . THR C 2 501  ? 46.895  -39.653 99.710  1.00 159.73 ? 501  THR C C     1 
ATOM   7475  O  O     . THR C 2 501  ? 48.132  -39.592 99.765  1.00 163.20 ? 501  THR C O     1 
ATOM   7476  C  CB    . THR C 2 501  ? 45.921  -39.936 97.340  1.00 145.33 ? 501  THR C CB    1 
ATOM   7477  O  OG1   . THR C 2 501  ? 47.172  -40.178 96.695  1.00 146.15 ? 501  THR C OG1   1 
ATOM   7478  C  CG2   . THR C 2 501  ? 44.967  -39.321 96.335  1.00 139.27 ? 501  THR C CG2   1 
ATOM   7479  N  N     . PRO C 2 502  ? 46.150  -40.281 100.649 1.00 153.38 ? 502  PRO C N     1 
ATOM   7480  C  CA    . PRO C 2 502  ? 46.674  -40.652 101.970 1.00 158.23 ? 502  PRO C CA    1 
ATOM   7481  C  C     . PRO C 2 502  ? 47.613  -41.847 101.935 1.00 164.80 ? 502  PRO C C     1 
ATOM   7482  O  O     . PRO C 2 502  ? 47.406  -42.759 101.144 1.00 166.06 ? 502  PRO C O     1 
ATOM   7483  C  CB    . PRO C 2 502  ? 45.406  -41.017 102.762 1.00 160.53 ? 502  PRO C CB    1 
ATOM   7484  C  CG    . PRO C 2 502  ? 44.245  -40.579 101.909 1.00 154.68 ? 502  PRO C CG    1 
ATOM   7485  C  CD    . PRO C 2 502  ? 44.741  -40.676 100.511 1.00 147.75 ? 502  PRO C CD    1 
ATOM   7486  N  N     . LEU C 2 503  ? 48.628  -41.852 102.791 1.00 168.04 ? 503  LEU C N     1 
ATOM   7487  C  CA    . LEU C 2 503  ? 49.598  -42.943 102.791 1.00 171.62 ? 503  LEU C CA    1 
ATOM   7488  C  C     . LEU C 2 503  ? 49.969  -43.402 104.202 1.00 177.35 ? 503  LEU C C     1 
ATOM   7489  O  O     . LEU C 2 503  ? 50.158  -42.581 105.101 1.00 186.86 ? 503  LEU C O     1 
ATOM   7490  C  CB    . LEU C 2 503  ? 50.863  -42.531 102.020 1.00 169.30 ? 503  LEU C CB    1 
ATOM   7491  C  CG    . LEU C 2 503  ? 50.683  -42.100 100.559 1.00 166.71 ? 503  LEU C CG    1 
ATOM   7492  C  CD1   . LEU C 2 503  ? 51.785  -41.137 100.134 1.00 167.82 ? 503  LEU C CD1   1 
ATOM   7493  C  CD2   . LEU C 2 503  ? 50.629  -43.310 99.634  1.00 161.24 ? 503  LEU C CD2   1 
ATOM   7494  N  N     . GLU C 2 504  ? 50.064  -44.714 104.394 1.00 171.45 ? 504  GLU C N     1 
ATOM   7495  C  CA    . GLU C 2 504  ? 50.664  -45.270 105.602 1.00 169.21 ? 504  GLU C CA    1 
ATOM   7496  C  C     . GLU C 2 504  ? 51.897  -46.085 105.209 1.00 172.22 ? 504  GLU C C     1 
ATOM   7497  O  O     . GLU C 2 504  ? 51.776  -47.134 104.584 1.00 173.81 ? 504  GLU C O     1 
ATOM   7498  C  CB    . GLU C 2 504  ? 49.651  -46.122 106.370 1.00 166.22 ? 504  GLU C CB    1 
ATOM   7499  C  CG    . GLU C 2 504  ? 48.609  -46.807 105.493 1.00 168.11 ? 504  GLU C CG    1 
ATOM   7500  C  CD    . GLU C 2 504  ? 47.587  -47.586 106.304 1.00 171.08 ? 504  GLU C CD    1 
ATOM   7501  O  OE1   . GLU C 2 504  ? 47.571  -47.412 107.540 1.00 173.66 ? 504  GLU C OE1   1 
ATOM   7502  O  OE2   . GLU C 2 504  ? 46.807  -48.370 105.713 1.00 165.97 ? 504  GLU C OE2   1 
ATOM   7503  N  N     . GLY C 2 505  ? 53.083  -45.610 105.583 1.00 175.45 ? 505  GLY C N     1 
ATOM   7504  C  CA    . GLY C 2 505  ? 54.316  -46.186 105.074 1.00 171.16 ? 505  GLY C CA    1 
ATOM   7505  C  C     . GLY C 2 505  ? 54.381  -45.899 103.588 1.00 167.34 ? 505  GLY C C     1 
ATOM   7506  O  O     . GLY C 2 505  ? 54.324  -44.744 103.177 1.00 170.30 ? 505  GLY C O     1 
ATOM   7507  N  N     . ASN C 2 506  ? 54.512  -46.940 102.776 1.00 160.01 ? 506  ASN C N     1 
ATOM   7508  C  CA    . ASN C 2 506  ? 54.433  -46.777 101.327 1.00 160.87 ? 506  ASN C CA    1 
ATOM   7509  C  C     . ASN C 2 506  ? 53.064  -47.121 100.736 1.00 156.85 ? 506  ASN C C     1 
ATOM   7510  O  O     . ASN C 2 506  ? 52.880  -47.074 99.522  1.00 153.00 ? 506  ASN C O     1 
ATOM   7511  C  CB    . ASN C 2 506  ? 55.540  -47.569 100.623 1.00 163.36 ? 506  ASN C CB    1 
ATOM   7512  C  CG    . ASN C 2 506  ? 56.814  -46.760 100.438 1.00 165.03 ? 506  ASN C CG    1 
ATOM   7513  O  OD1   . ASN C 2 506  ? 57.103  -45.844 101.210 1.00 171.31 ? 506  ASN C OD1   1 
ATOM   7514  N  ND2   . ASN C 2 506  ? 57.580  -47.093 99.405  1.00 155.91 ? 506  ASN C ND2   1 
ATOM   7515  N  N     . ARG C 2 507  ? 52.116  -47.461 101.605 1.00 163.31 ? 507  ARG C N     1 
ATOM   7516  C  CA    . ARG C 2 507  ? 50.817  -48.041 101.212 1.00 168.24 ? 507  ARG C CA    1 
ATOM   7517  C  C     . ARG C 2 507  ? 49.710  -47.017 100.907 1.00 168.04 ? 507  ARG C C     1 
ATOM   7518  O  O     . ARG C 2 507  ? 49.644  -45.963 101.544 1.00 170.32 ? 507  ARG C O     1 
ATOM   7519  C  CB    . ARG C 2 507  ? 50.343  -49.012 102.309 1.00 173.78 ? 507  ARG C CB    1 
ATOM   7520  C  CG    . ARG C 2 507  ? 48.926  -49.576 102.156 1.00 171.91 ? 507  ARG C CG    1 
ATOM   7521  C  CD    . ARG C 2 507  ? 48.916  -50.872 101.371 1.00 171.23 ? 507  ARG C CD    1 
ATOM   7522  N  NE    . ARG C 2 507  ? 49.518  -51.982 102.105 1.00 176.90 ? 507  ARG C NE    1 
ATOM   7523  C  CZ    . ARG C 2 507  ? 50.106  -53.026 101.526 1.00 183.36 ? 507  ARG C CZ    1 
ATOM   7524  N  NH1   . ARG C 2 507  ? 50.182  -53.099 100.201 1.00 177.37 ? 507  ARG C NH1   1 
ATOM   7525  N  NH2   . ARG C 2 507  ? 50.625  -53.994 102.271 1.00 189.12 ? 507  ARG C NH2   1 
ATOM   7526  N  N     . ILE C 2 508  ? 48.846  -47.327 99.935  1.00 164.63 ? 508  ILE C N     1 
ATOM   7527  C  CA    . ILE C 2 508  ? 47.680  -46.479 99.671  1.00 168.40 ? 508  ILE C CA    1 
ATOM   7528  C  C     . ILE C 2 508  ? 46.682  -46.616 100.815 1.00 170.95 ? 508  ILE C C     1 
ATOM   7529  O  O     . ILE C 2 508  ? 46.167  -47.702 101.083 1.00 175.11 ? 508  ILE C O     1 
ATOM   7530  C  CB    . ILE C 2 508  ? 46.972  -46.834 98.343  1.00 165.33 ? 508  ILE C CB    1 
ATOM   7531  C  CG1   . ILE C 2 508  ? 47.842  -46.445 97.152  1.00 164.48 ? 508  ILE C CG1   1 
ATOM   7532  C  CG2   . ILE C 2 508  ? 45.639  -46.110 98.236  1.00 161.02 ? 508  ILE C CG2   1 
ATOM   7533  C  CD1   . ILE C 2 508  ? 48.369  -45.029 97.216  1.00 162.58 ? 508  ILE C CD1   1 
ATOM   7534  N  N     . ALA C 2 509  ? 46.393  -45.497 101.466 1.00 170.55 ? 509  ALA C N     1 
ATOM   7535  C  CA    . ALA C 2 509  ? 45.655  -45.510 102.722 1.00 172.52 ? 509  ALA C CA    1 
ATOM   7536  C  C     . ALA C 2 509  ? 44.150  -45.209 102.628 1.00 174.26 ? 509  ALA C C     1 
ATOM   7537  O  O     . ALA C 2 509  ? 43.462  -45.183 103.648 1.00 181.99 ? 509  ALA C O     1 
ATOM   7538  C  CB    . ALA C 2 509  ? 46.337  -44.582 103.729 1.00 171.91 ? 509  ALA C CB    1 
ATOM   7539  N  N     . ALA C 2 510  ? 43.633  -44.982 101.426 1.00 168.42 ? 510  ALA C N     1 
ATOM   7540  C  CA    . ALA C 2 510  ? 42.217  -44.643 101.290 1.00 165.41 ? 510  ALA C CA    1 
ATOM   7541  C  C     . ALA C 2 510  ? 41.481  -45.669 100.451 1.00 165.95 ? 510  ALA C C     1 
ATOM   7542  O  O     . ALA C 2 510  ? 42.099  -46.444 99.720  1.00 160.09 ? 510  ALA C O     1 
ATOM   7543  C  CB    . ALA C 2 510  ? 42.026  -43.233 100.721 1.00 163.87 ? 510  ALA C CB    1 
ATOM   7544  N  N     . GLU C 2 511  ? 40.157  -45.676 100.597 1.00 175.76 ? 511  GLU C N     1 
ATOM   7545  C  CA    . GLU C 2 511  ? 39.259  -46.605 99.905  1.00 177.39 ? 511  GLU C CA    1 
ATOM   7546  C  C     . GLU C 2 511  ? 38.974  -46.114 98.489  1.00 171.38 ? 511  GLU C C     1 
ATOM   7547  O  O     . GLU C 2 511  ? 38.530  -46.870 97.617  1.00 162.72 ? 511  GLU C O     1 
ATOM   7548  C  CB    . GLU C 2 511  ? 37.949  -46.706 100.682 1.00 180.24 ? 511  GLU C CB    1 
ATOM   7549  C  CG    . GLU C 2 511  ? 37.375  -45.338 101.035 1.00 180.36 ? 511  GLU C CG    1 
ATOM   7550  C  CD    . GLU C 2 511  ? 36.028  -45.415 101.710 1.00 188.25 ? 511  GLU C CD    1 
ATOM   7551  O  OE1   . GLU C 2 511  ? 35.772  -46.411 102.424 1.00 194.65 ? 511  GLU C OE1   1 
ATOM   7552  O  OE2   . GLU C 2 511  ? 35.229  -44.472 101.521 1.00 185.14 ? 511  GLU C OE2   1 
ATOM   7553  N  N     . ARG C 2 512  ? 39.216  -44.823 98.296  1.00 171.03 ? 512  ARG C N     1 
ATOM   7554  C  CA    . ARG C 2 512  ? 39.138  -44.173 97.002  1.00 163.94 ? 512  ARG C CA    1 
ATOM   7555  C  C     . ARG C 2 512  ? 40.242  -43.109 96.962  1.00 164.19 ? 512  ARG C C     1 
ATOM   7556  O  O     . ARG C 2 512  ? 40.444  -42.388 97.947  1.00 164.92 ? 512  ARG C O     1 
ATOM   7557  C  CB    . ARG C 2 512  ? 37.756  -43.539 96.828  1.00 163.84 ? 512  ARG C CB    1 
ATOM   7558  C  CG    . ARG C 2 512  ? 37.255  -42.799 98.071  1.00 172.93 ? 512  ARG C CG    1 
ATOM   7559  C  CD    . ARG C 2 512  ? 35.909  -42.137 97.825  1.00 174.14 ? 512  ARG C CD    1 
ATOM   7560  N  NE    . ARG C 2 512  ? 34.914  -43.100 97.361  1.00 177.79 ? 512  ARG C NE    1 
ATOM   7561  C  CZ    . ARG C 2 512  ? 33.930  -42.807 96.516  1.00 177.68 ? 512  ARG C CZ    1 
ATOM   7562  N  NH1   . ARG C 2 512  ? 33.809  -41.575 96.040  1.00 171.41 ? 512  ARG C NH1   1 
ATOM   7563  N  NH2   . ARG C 2 512  ? 33.072  -43.748 96.143  1.00 175.91 ? 512  ARG C NH2   1 
ATOM   7564  N  N     . VAL C 2 513  ? 40.972  -43.032 95.848  1.00 155.78 ? 513  VAL C N     1 
ATOM   7565  C  CA    . VAL C 2 513  ? 41.947  -41.962 95.641  1.00 147.18 ? 513  VAL C CA    1 
ATOM   7566  C  C     . VAL C 2 513  ? 41.518  -41.141 94.440  1.00 142.51 ? 513  VAL C C     1 
ATOM   7567  O  O     . VAL C 2 513  ? 40.784  -41.623 93.580  1.00 142.88 ? 513  VAL C O     1 
ATOM   7568  C  CB    . VAL C 2 513  ? 43.373  -42.485 95.363  1.00 146.10 ? 513  VAL C CB    1 
ATOM   7569  C  CG1   . VAL C 2 513  ? 43.867  -43.381 96.488  1.00 150.49 ? 513  VAL C CG1   1 
ATOM   7570  C  CG2   . VAL C 2 513  ? 43.417  -43.202 94.037  1.00 141.59 ? 513  VAL C CG2   1 
ATOM   7571  N  N     . VAL C 2 514  ? 41.971  -39.898 94.376  1.00 140.08 ? 514  VAL C N     1 
ATOM   7572  C  CA    . VAL C 2 514  ? 41.630  -39.052 93.243  1.00 135.88 ? 514  VAL C CA    1 
ATOM   7573  C  C     . VAL C 2 514  ? 42.697  -39.115 92.165  1.00 134.27 ? 514  VAL C C     1 
ATOM   7574  O  O     . VAL C 2 514  ? 43.885  -38.921 92.427  1.00 136.03 ? 514  VAL C O     1 
ATOM   7575  C  CB    . VAL C 2 514  ? 41.449  -37.599 93.651  1.00 140.24 ? 514  VAL C CB    1 
ATOM   7576  C  CG1   . VAL C 2 514  ? 41.020  -36.782 92.451  1.00 147.86 ? 514  VAL C CG1   1 
ATOM   7577  C  CG2   . VAL C 2 514  ? 40.423  -37.488 94.745  1.00 138.41 ? 514  VAL C CG2   1 
ATOM   7578  N  N     . ALA C 2 515  ? 42.266  -39.387 90.945  1.00 129.92 ? 515  ALA C N     1 
ATOM   7579  C  CA    . ALA C 2 515  ? 43.205  -39.586 89.860  1.00 135.32 ? 515  ALA C CA    1 
ATOM   7580  C  C     . ALA C 2 515  ? 42.668  -39.095 88.527  1.00 135.61 ? 515  ALA C C     1 
ATOM   7581  O  O     . ALA C 2 515  ? 41.493  -38.762 88.395  1.00 138.21 ? 515  ALA C O     1 
ATOM   7582  C  CB    . ALA C 2 515  ? 43.617  -41.042 89.776  1.00 139.68 ? 515  ALA C CB    1 
ATOM   7583  N  N     . ARG C 2 516  ? 43.552  -39.037 87.545  1.00 130.68 ? 516  ARG C N     1 
ATOM   7584  C  CA    . ARG C 2 516  ? 43.200  -38.526 86.244  1.00 132.99 ? 516  ARG C CA    1 
ATOM   7585  C  C     . ARG C 2 516  ? 43.573  -39.542 85.172  1.00 140.16 ? 516  ARG C C     1 
ATOM   7586  O  O     . ARG C 2 516  ? 44.688  -40.059 85.168  1.00 144.26 ? 516  ARG C O     1 
ATOM   7587  C  CB    . ARG C 2 516  ? 43.962  -37.217 86.007  1.00 141.13 ? 516  ARG C CB    1 
ATOM   7588  C  CG    . ARG C 2 516  ? 44.478  -36.554 87.298  1.00 137.79 ? 516  ARG C CG    1 
ATOM   7589  C  CD    . ARG C 2 516  ? 45.461  -35.412 87.048  1.00 133.88 ? 516  ARG C CD    1 
ATOM   7590  N  NE    . ARG C 2 516  ? 46.778  -35.881 86.627  1.00 131.06 ? 516  ARG C NE    1 
ATOM   7591  C  CZ    . ARG C 2 516  ? 47.275  -35.733 85.402  1.00 133.98 ? 516  ARG C CZ    1 
ATOM   7592  N  NH1   . ARG C 2 516  ? 46.581  -35.109 84.448  1.00 130.38 ? 516  ARG C NH1   1 
ATOM   7593  N  NH2   . ARG C 2 516  ? 48.483  -36.208 85.137  1.00 135.98 ? 516  ARG C NH2   1 
ATOM   7594  N  N     . ARG C 2 517  ? 42.643  -39.847 84.271  1.00 145.09 ? 517  ARG C N     1 
ATOM   7595  C  CA    . ARG C 2 517  ? 42.992  -40.570 83.045  1.00 147.28 ? 517  ARG C CA    1 
ATOM   7596  C  C     . ARG C 2 517  ? 42.902  -39.601 81.882  1.00 144.01 ? 517  ARG C C     1 
ATOM   7597  O  O     . ARG C 2 517  ? 41.827  -39.063 81.591  1.00 142.04 ? 517  ARG C O     1 
ATOM   7598  C  CB    . ARG C 2 517  ? 42.078  -41.776 82.798  1.00 148.50 ? 517  ARG C CB    1 
ATOM   7599  C  CG    . ARG C 2 517  ? 42.429  -43.040 83.599  1.00 151.35 ? 517  ARG C CG    1 
ATOM   7600  C  CD    . ARG C 2 517  ? 41.142  -43.773 83.999  1.00 161.87 ? 517  ARG C CD    1 
ATOM   7601  N  NE    . ARG C 2 517  ? 41.344  -45.107 84.573  1.00 164.24 ? 517  ARG C NE    1 
ATOM   7602  C  CZ    . ARG C 2 517  ? 40.353  -45.902 84.979  1.00 163.88 ? 517  ARG C CZ    1 
ATOM   7603  N  NH1   . ARG C 2 517  ? 39.093  -45.492 84.882  1.00 165.42 ? 517  ARG C NH1   1 
ATOM   7604  N  NH2   . ARG C 2 517  ? 40.620  -47.105 85.483  1.00 156.17 ? 517  ARG C NH2   1 
ATOM   7605  N  N     . LYS C 2 518  ? 44.037  -39.374 81.230  1.00 142.53 ? 518  LYS C N     1 
ATOM   7606  C  CA    . LYS C 2 518  ? 44.110  -38.414 80.133  1.00 147.66 ? 518  LYS C CA    1 
ATOM   7607  C  C     . LYS C 2 518  ? 43.643  -37.040 80.626  1.00 148.90 ? 518  LYS C C     1 
ATOM   7608  O  O     . LYS C 2 518  ? 42.867  -36.350 79.960  1.00 149.85 ? 518  LYS C O     1 
ATOM   7609  C  CB    . LYS C 2 518  ? 43.278  -38.875 78.915  1.00 147.11 ? 518  LYS C CB    1 
ATOM   7610  C  CG    . LYS C 2 518  ? 43.759  -40.163 78.192  1.00 146.63 ? 518  LYS C CG    1 
ATOM   7611  C  CD    . LYS C 2 518  ? 42.688  -40.727 77.224  1.00 145.02 ? 518  LYS C CD    1 
ATOM   7612  C  CE    . LYS C 2 518  ? 42.889  -42.217 76.905  1.00 136.38 ? 518  LYS C CE    1 
ATOM   7613  N  NZ    . LYS C 2 518  ? 41.688  -42.789 76.230  1.00 134.19 ? 518  LYS C NZ    1 
ATOM   7614  N  N     . GLY C 2 519  ? 44.090  -36.673 81.822  1.00 145.78 ? 519  GLY C N     1 
ATOM   7615  C  CA    . GLY C 2 519  ? 43.778  -35.378 82.385  1.00 140.86 ? 519  GLY C CA    1 
ATOM   7616  C  C     . GLY C 2 519  ? 42.340  -35.227 82.858  1.00 146.68 ? 519  GLY C C     1 
ATOM   7617  O  O     . GLY C 2 519  ? 42.055  -34.285 83.581  1.00 157.34 ? 519  GLY C O     1 
ATOM   7618  N  N     . GLU C 2 520  ? 41.439  -36.144 82.501  1.00 140.36 ? 520  GLU C N     1 
ATOM   7619  C  CA    . GLU C 2 520  ? 40.041  -36.024 82.939  1.00 143.59 ? 520  GLU C CA    1 
ATOM   7620  C  C     . GLU C 2 520  ? 39.850  -36.618 84.345  1.00 145.07 ? 520  GLU C C     1 
ATOM   7621  O  O     . GLU C 2 520  ? 40.216  -37.769 84.580  1.00 144.71 ? 520  GLU C O     1 
ATOM   7622  C  CB    . GLU C 2 520  ? 39.089  -36.676 81.927  1.00 147.00 ? 520  GLU C CB    1 
ATOM   7623  C  CG    . GLU C 2 520  ? 37.595  -36.651 82.323  1.00 157.14 ? 520  GLU C CG    1 
ATOM   7624  C  CD    . GLU C 2 520  ? 36.798  -35.508 81.674  1.00 168.21 ? 520  GLU C CD    1 
ATOM   7625  O  OE1   . GLU C 2 520  ? 35.633  -35.267 82.084  1.00 163.87 ? 520  GLU C OE1   1 
ATOM   7626  O  OE2   . GLU C 2 520  ? 37.329  -34.859 80.746  1.00 173.71 ? 520  GLU C OE2   1 
ATOM   7627  N  N     . PRO C 2 521  ? 39.276  -35.838 85.286  1.00 142.25 ? 521  PRO C N     1 
ATOM   7628  C  CA    . PRO C 2 521  ? 39.255  -36.227 86.705  1.00 137.70 ? 521  PRO C CA    1 
ATOM   7629  C  C     . PRO C 2 521  ? 38.341  -37.414 86.994  1.00 139.81 ? 521  PRO C C     1 
ATOM   7630  O  O     . PRO C 2 521  ? 37.212  -37.444 86.506  1.00 142.15 ? 521  PRO C O     1 
ATOM   7631  C  CB    . PRO C 2 521  ? 38.708  -34.981 87.389  1.00 129.55 ? 521  PRO C CB    1 
ATOM   7632  C  CG    . PRO C 2 521  ? 37.788  -34.403 86.371  1.00 138.30 ? 521  PRO C CG    1 
ATOM   7633  C  CD    . PRO C 2 521  ? 38.474  -34.626 85.051  1.00 144.40 ? 521  PRO C CD    1 
ATOM   7634  N  N     . VAL C 2 522  ? 38.826  -38.378 87.773  1.00 138.60 ? 522  VAL C N     1 
ATOM   7635  C  CA    . VAL C 2 522  ? 38.040  -39.571 88.078  1.00 138.35 ? 522  VAL C CA    1 
ATOM   7636  C  C     . VAL C 2 522  ? 38.437  -40.254 89.409  1.00 138.84 ? 522  VAL C C     1 
ATOM   7637  O  O     . VAL C 2 522  ? 39.594  -40.191 89.825  1.00 137.38 ? 522  VAL C O     1 
ATOM   7638  C  CB    . VAL C 2 522  ? 38.080  -40.553 86.882  1.00 143.73 ? 522  VAL C CB    1 
ATOM   7639  C  CG1   . VAL C 2 522  ? 39.410  -41.271 86.825  1.00 147.88 ? 522  VAL C CG1   1 
ATOM   7640  C  CG2   . VAL C 2 522  ? 36.924  -41.533 86.938  1.00 150.64 ? 522  VAL C CG2   1 
ATOM   7641  N  N     . ILE C 2 523  ? 37.465  -40.883 90.077  1.00 144.15 ? 523  ILE C N     1 
ATOM   7642  C  CA    . ILE C 2 523  ? 37.688  -41.551 91.367  1.00 143.86 ? 523  ILE C CA    1 
ATOM   7643  C  C     . ILE C 2 523  ? 37.952  -43.038 91.199  1.00 146.50 ? 523  ILE C C     1 
ATOM   7644  O  O     . ILE C 2 523  ? 37.219  -43.742 90.506  1.00 147.70 ? 523  ILE C O     1 
ATOM   7645  C  CB    . ILE C 2 523  ? 36.506  -41.378 92.327  1.00 142.40 ? 523  ILE C CB    1 
ATOM   7646  C  CG1   . ILE C 2 523  ? 36.361  -39.915 92.704  1.00 145.89 ? 523  ILE C CG1   1 
ATOM   7647  C  CG2   . ILE C 2 523  ? 36.727  -42.188 93.586  1.00 151.22 ? 523  ILE C CG2   1 
ATOM   7648  C  CD1   . ILE C 2 523  ? 37.642  -39.311 93.219  1.00 142.75 ? 523  ILE C CD1   1 
ATOM   7649  N  N     . VAL C 2 524  ? 39.000  -43.516 91.859  1.00 149.11 ? 524  VAL C N     1 
ATOM   7650  C  CA    . VAL C 2 524  ? 39.605  -44.791 91.509  1.00 150.01 ? 524  VAL C CA    1 
ATOM   7651  C  C     . VAL C 2 524  ? 40.022  -45.621 92.747  1.00 154.30 ? 524  VAL C C     1 
ATOM   7652  O  O     . VAL C 2 524  ? 40.424  -45.056 93.770  1.00 156.38 ? 524  VAL C O     1 
ATOM   7653  C  CB    . VAL C 2 524  ? 40.815  -44.509 90.585  1.00 148.02 ? 524  VAL C CB    1 
ATOM   7654  C  CG1   . VAL C 2 524  ? 41.613  -45.754 90.326  1.00 152.98 ? 524  VAL C CG1   1 
ATOM   7655  C  CG2   . VAL C 2 524  ? 40.352  -43.882 89.266  1.00 144.65 ? 524  VAL C CG2   1 
ATOM   7656  N  N     . SER C 2 525  ? 39.902  -46.950 92.653  1.00 150.50 ? 525  SER C N     1 
ATOM   7657  C  CA    . SER C 2 525  ? 40.286  -47.871 93.732  1.00 149.93 ? 525  SER C CA    1 
ATOM   7658  C  C     . SER C 2 525  ? 41.804  -47.893 93.893  1.00 149.35 ? 525  SER C C     1 
ATOM   7659  O  O     . SER C 2 525  ? 42.521  -47.663 92.925  1.00 152.30 ? 525  SER C O     1 
ATOM   7660  C  CB    . SER C 2 525  ? 39.812  -49.297 93.407  1.00 153.82 ? 525  SER C CB    1 
ATOM   7661  O  OG    . SER C 2 525  ? 38.509  -49.335 92.844  1.00 156.06 ? 525  SER C OG    1 
ATOM   7662  N  N     . PRO C 2 526  ? 42.312  -48.222 95.095  1.00 146.82 ? 526  PRO C N     1 
ATOM   7663  C  CA    . PRO C 2 526  ? 43.770  -48.317 95.269  1.00 146.26 ? 526  PRO C CA    1 
ATOM   7664  C  C     . PRO C 2 526  ? 44.398  -49.359 94.337  1.00 147.00 ? 526  PRO C C     1 
ATOM   7665  O  O     . PRO C 2 526  ? 45.618  -49.393 94.171  1.00 142.64 ? 526  PRO C O     1 
ATOM   7666  C  CB    . PRO C 2 526  ? 43.924  -48.776 96.719  1.00 151.44 ? 526  PRO C CB    1 
ATOM   7667  C  CG    . PRO C 2 526  ? 42.635  -48.471 97.369  1.00 156.02 ? 526  PRO C CG    1 
ATOM   7668  C  CD    . PRO C 2 526  ? 41.588  -48.592 96.321  1.00 151.41 ? 526  PRO C CD    1 
ATOM   7669  N  N     . GLU C 2 527  ? 43.551  -50.213 93.763  1.00 152.27 ? 527  GLU C N     1 
ATOM   7670  C  CA    . GLU C 2 527  ? 43.960  -51.266 92.837  1.00 146.72 ? 527  GLU C CA    1 
ATOM   7671  C  C     . GLU C 2 527  ? 44.190  -50.775 91.416  1.00 142.57 ? 527  GLU C C     1 
ATOM   7672  O  O     . GLU C 2 527  ? 45.003  -51.346 90.706  1.00 149.74 ? 527  GLU C O     1 
ATOM   7673  C  CB    . GLU C 2 527  ? 42.939  -52.417 92.824  1.00 145.89 ? 527  GLU C CB    1 
ATOM   7674  C  CG    . GLU C 2 527  ? 43.080  -53.421 93.980  1.00 149.09 ? 527  GLU C CG    1 
ATOM   7675  C  CD    . GLU C 2 527  ? 42.189  -53.109 95.191  1.00 156.77 ? 527  GLU C CD    1 
ATOM   7676  O  OE1   . GLU C 2 527  ? 41.325  -52.209 95.106  1.00 160.65 ? 527  GLU C OE1   1 
ATOM   7677  O  OE2   . GLU C 2 527  ? 42.350  -53.774 96.239  1.00 158.08 ? 527  GLU C OE2   1 
ATOM   7678  N  N     . GLU C 2 528  ? 43.475  -49.735 90.994  1.00 138.71 ? 528  GLU C N     1 
ATOM   7679  C  CA    . GLU C 2 528  ? 43.584  -49.251 89.612  1.00 137.75 ? 528  GLU C CA    1 
ATOM   7680  C  C     . GLU C 2 528  ? 44.599  -48.126 89.383  1.00 137.52 ? 528  GLU C C     1 
ATOM   7681  O  O     . GLU C 2 528  ? 44.617  -47.530 88.301  1.00 135.54 ? 528  GLU C O     1 
ATOM   7682  C  CB    . GLU C 2 528  ? 42.229  -48.899 88.984  1.00 135.48 ? 528  GLU C CB    1 
ATOM   7683  C  CG    . GLU C 2 528  ? 41.005  -49.176 89.835  1.00 142.78 ? 528  GLU C CG    1 
ATOM   7684  C  CD    . GLU C 2 528  ? 39.733  -48.688 89.159  1.00 143.90 ? 528  GLU C CD    1 
ATOM   7685  O  OE1   . GLU C 2 528  ? 38.735  -48.393 89.855  1.00 138.81 ? 528  GLU C OE1   1 
ATOM   7686  O  OE2   . GLU C 2 528  ? 39.741  -48.599 87.914  1.00 144.18 ? 528  GLU C OE2   1 
ATOM   7687  N  N     . VAL C 2 529  ? 45.417  -47.831 90.397  1.00 136.47 ? 529  VAL C N     1 
ATOM   7688  C  CA    . VAL C 2 529  ? 46.378  -46.720 90.340  1.00 137.27 ? 529  VAL C CA    1 
ATOM   7689  C  C     . VAL C 2 529  ? 47.764  -47.100 89.789  1.00 141.09 ? 529  VAL C C     1 
ATOM   7690  O  O     . VAL C 2 529  ? 48.548  -47.779 90.460  1.00 142.31 ? 529  VAL C O     1 
ATOM   7691  C  CB    . VAL C 2 529  ? 46.575  -46.137 91.755  1.00 133.76 ? 529  VAL C CB    1 
ATOM   7692  C  CG1   . VAL C 2 529  ? 47.810  -45.242 91.837  1.00 133.22 ? 529  VAL C CG1   1 
ATOM   7693  C  CG2   . VAL C 2 529  ? 45.346  -45.382 92.170  1.00 136.40 ? 529  VAL C CG2   1 
ATOM   7694  N  N     . GLU C 2 530  ? 48.061  -46.635 88.571  1.00 138.88 ? 530  GLU C N     1 
ATOM   7695  C  CA    . GLU C 2 530  ? 49.304  -46.981 87.875  1.00 134.78 ? 530  GLU C CA    1 
ATOM   7696  C  C     . GLU C 2 530  ? 50.478  -46.112 88.298  1.00 135.95 ? 530  GLU C C     1 
ATOM   7697  O  O     . GLU C 2 530  ? 51.602  -46.596 88.441  1.00 134.96 ? 530  GLU C O     1 
ATOM   7698  C  CB    . GLU C 2 530  ? 49.103  -46.922 86.365  1.00 135.01 ? 530  GLU C CB    1 
ATOM   7699  C  CG    . GLU C 2 530  ? 47.669  -47.207 85.947  1.00 138.93 ? 530  GLU C CG    1 
ATOM   7700  C  CD    . GLU C 2 530  ? 47.559  -47.764 84.539  1.00 146.47 ? 530  GLU C CD    1 
ATOM   7701  O  OE1   . GLU C 2 530  ? 46.575  -47.431 83.844  1.00 145.56 ? 530  GLU C OE1   1 
ATOM   7702  O  OE2   . GLU C 2 530  ? 48.446  -48.547 84.130  1.00 147.48 ? 530  GLU C OE2   1 
ATOM   7703  N  N     . PHE C 2 531  ? 50.207  -44.819 88.463  1.00 137.52 ? 531  PHE C N     1 
ATOM   7704  C  CA    . PHE C 2 531  ? 51.199  -43.869 88.958  1.00 134.05 ? 531  PHE C CA    1 
ATOM   7705  C  C     . PHE C 2 531  ? 50.585  -42.840 89.902  1.00 131.45 ? 531  PHE C C     1 
ATOM   7706  O  O     . PHE C 2 531  ? 49.374  -42.786 90.069  1.00 132.42 ? 531  PHE C O     1 
ATOM   7707  C  CB    . PHE C 2 531  ? 51.864  -43.142 87.795  1.00 131.01 ? 531  PHE C CB    1 
ATOM   7708  C  CG    . PHE C 2 531  ? 52.587  -44.050 86.857  1.00 134.54 ? 531  PHE C CG    1 
ATOM   7709  C  CD1   . PHE C 2 531  ? 51.927  -44.646 85.797  1.00 134.41 ? 531  PHE C CD1   1 
ATOM   7710  C  CD2   . PHE C 2 531  ? 53.928  -44.314 87.037  1.00 135.47 ? 531  PHE C CD2   1 
ATOM   7711  C  CE1   . PHE C 2 531  ? 52.592  -45.490 84.947  1.00 137.58 ? 531  PHE C CE1   1 
ATOM   7712  C  CE2   . PHE C 2 531  ? 54.598  -45.155 86.179  1.00 137.69 ? 531  PHE C CE2   1 
ATOM   7713  C  CZ    . PHE C 2 531  ? 53.929  -45.741 85.130  1.00 139.61 ? 531  PHE C CZ    1 
ATOM   7714  N  N     . MET C 2 532  ? 51.423  -41.995 90.488  1.00 129.53 ? 532  MET C N     1 
ATOM   7715  C  CA    . MET C 2 532  ? 50.948  -40.972 91.411  1.00 128.40 ? 532  MET C CA    1 
ATOM   7716  C  C     . MET C 2 532  ? 51.845  -39.742 91.305  1.00 127.99 ? 532  MET C C     1 
ATOM   7717  O  O     . MET C 2 532  ? 53.057  -39.863 91.092  1.00 126.87 ? 532  MET C O     1 
ATOM   7718  C  CB    . MET C 2 532  ? 50.929  -41.530 92.834  1.00 126.24 ? 532  MET C CB    1 
ATOM   7719  C  CG    . MET C 2 532  ? 50.562  -40.554 93.942  1.00 130.66 ? 532  MET C CG    1 
ATOM   7720  S  SD    . MET C 2 532  ? 50.719  -41.358 95.566  1.00 136.32 ? 532  MET C SD    1 
ATOM   7721  C  CE    . MET C 2 532  ? 50.552  -39.995 96.715  1.00 146.47 ? 532  MET C CE    1 
ATOM   7722  N  N     . ASP C 2 533  ? 51.244  -38.567 91.463  1.00 124.84 ? 533  ASP C N     1 
ATOM   7723  C  CA    . ASP C 2 533  ? 51.967  -37.313 91.386  1.00 124.99 ? 533  ASP C CA    1 
ATOM   7724  C  C     . ASP C 2 533  ? 53.156  -37.354 92.323  1.00 128.34 ? 533  ASP C C     1 
ATOM   7725  O  O     . ASP C 2 533  ? 53.129  -38.023 93.353  1.00 132.43 ? 533  ASP C O     1 
ATOM   7726  C  CB    . ASP C 2 533  ? 51.072  -36.164 91.823  1.00 128.77 ? 533  ASP C CB    1 
ATOM   7727  C  CG    . ASP C 2 533  ? 50.025  -35.826 90.810  1.00 128.29 ? 533  ASP C CG    1 
ATOM   7728  O  OD1   . ASP C 2 533  ? 49.816  -36.624 89.862  1.00 121.16 ? 533  ASP C OD1   1 
ATOM   7729  O  OD2   . ASP C 2 533  ? 49.408  -34.752 90.985  1.00 129.07 ? 533  ASP C OD2   1 
ATOM   7730  N  N     . VAL C 2 534  ? 54.215  -36.660 91.940  1.00 125.53 ? 534  VAL C N     1 
ATOM   7731  C  CA    . VAL C 2 534  ? 55.419  -36.588 92.748  1.00 126.81 ? 534  VAL C CA    1 
ATOM   7732  C  C     . VAL C 2 534  ? 55.262  -35.646 93.938  1.00 130.87 ? 534  VAL C C     1 
ATOM   7733  O  O     . VAL C 2 534  ? 55.731  -35.944 95.047  1.00 131.72 ? 534  VAL C O     1 
ATOM   7734  C  CB    . VAL C 2 534  ? 56.583  -36.139 91.891  1.00 122.84 ? 534  VAL C CB    1 
ATOM   7735  C  CG1   . VAL C 2 534  ? 57.771  -35.792 92.755  1.00 131.52 ? 534  VAL C CG1   1 
ATOM   7736  C  CG2   . VAL C 2 534  ? 56.933  -37.232 90.926  1.00 125.64 ? 534  VAL C CG2   1 
ATOM   7737  N  N     . SER C 2 535  ? 54.544  -34.548 93.694  1.00 130.72 ? 535  SER C N     1 
ATOM   7738  C  CA    . SER C 2 535  ? 54.277  -33.473 94.656  1.00 135.12 ? 535  SER C CA    1 
ATOM   7739  C  C     . SER C 2 535  ? 53.301  -32.562 93.937  1.00 131.78 ? 535  SER C C     1 
ATOM   7740  O  O     . SER C 2 535  ? 53.198  -32.637 92.718  1.00 128.93 ? 535  SER C O     1 
ATOM   7741  C  CB    . SER C 2 535  ? 55.555  -32.692 95.000  1.00 133.82 ? 535  SER C CB    1 
ATOM   7742  O  OG    . SER C 2 535  ? 55.309  -31.628 95.914  1.00 134.22 ? 535  SER C OG    1 
ATOM   7743  N  N     . PRO C 2 536  ? 52.529  -31.747 94.682  1.00 136.38 ? 536  PRO C N     1 
ATOM   7744  C  CA    . PRO C 2 536  ? 51.672  -30.798 93.961  1.00 132.78 ? 536  PRO C CA    1 
ATOM   7745  C  C     . PRO C 2 536  ? 52.496  -29.668 93.356  1.00 127.26 ? 536  PRO C C     1 
ATOM   7746  O  O     . PRO C 2 536  ? 51.997  -28.969 92.476  1.00 122.17 ? 536  PRO C O     1 
ATOM   7747  C  CB    . PRO C 2 536  ? 50.713  -30.277 95.040  1.00 131.61 ? 536  PRO C CB    1 
ATOM   7748  C  CG    . PRO C 2 536  ? 50.819  -31.268 96.175  1.00 138.59 ? 536  PRO C CG    1 
ATOM   7749  C  CD    . PRO C 2 536  ? 52.239  -31.758 96.128  1.00 137.15 ? 536  PRO C CD    1 
ATOM   7750  N  N     . LYS C 2 537  ? 53.732  -29.501 93.830  1.00 125.98 ? 537  LYS C N     1 
ATOM   7751  C  CA    . LYS C 2 537  ? 54.621  -28.440 93.354  1.00 122.29 ? 537  LYS C CA    1 
ATOM   7752  C  C     . LYS C 2 537  ? 54.929  -28.526 91.860  1.00 123.11 ? 537  LYS C C     1 
ATOM   7753  O  O     . LYS C 2 537  ? 55.384  -27.546 91.263  1.00 122.75 ? 537  LYS C O     1 
ATOM   7754  C  CB    . LYS C 2 537  ? 55.934  -28.428 94.144  1.00 115.53 ? 537  LYS C CB    1 
ATOM   7755  C  CG    . LYS C 2 537  ? 55.783  -28.085 95.599  1.00 121.03 ? 537  LYS C CG    1 
ATOM   7756  C  CD    . LYS C 2 537  ? 57.081  -28.339 96.314  1.00 125.12 ? 537  LYS C CD    1 
ATOM   7757  C  CE    . LYS C 2 537  ? 56.887  -28.390 97.812  1.00 131.20 ? 537  LYS C CE    1 
ATOM   7758  N  NZ    . LYS C 2 537  ? 58.147  -28.804 98.487  1.00 136.48 ? 537  LYS C NZ    1 
ATOM   7759  N  N     . GLN C 2 538  ? 54.682  -29.688 91.256  1.00 124.50 ? 538  GLN C N     1 
ATOM   7760  C  CA    . GLN C 2 538  ? 55.109  -29.931 89.872  1.00 123.69 ? 538  GLN C CA    1 
ATOM   7761  C  C     . GLN C 2 538  ? 54.254  -29.197 88.859  1.00 120.88 ? 538  GLN C C     1 
ATOM   7762  O  O     . GLN C 2 538  ? 54.628  -29.128 87.685  1.00 122.77 ? 538  GLN C O     1 
ATOM   7763  C  CB    . GLN C 2 538  ? 55.166  -31.435 89.535  1.00 121.98 ? 538  GLN C CB    1 
ATOM   7764  C  CG    . GLN C 2 538  ? 53.811  -32.113 89.364  1.00 121.86 ? 538  GLN C CG    1 
ATOM   7765  C  CD    . GLN C 2 538  ? 53.871  -33.616 89.589  1.00 122.77 ? 538  GLN C CD    1 
ATOM   7766  O  OE1   . GLN C 2 538  ? 52.913  -34.226 90.075  1.00 122.86 ? 538  GLN C OE1   1 
ATOM   7767  N  NE2   . GLN C 2 538  ? 55.002  -34.218 89.239  1.00 123.38 ? 538  GLN C NE2   1 
ATOM   7768  N  N     . VAL C 2 539  ? 53.114  -28.669 89.310  1.00 117.09 ? 539  VAL C N     1 
ATOM   7769  C  CA    . VAL C 2 539  ? 52.156  -27.985 88.427  1.00 122.18 ? 539  VAL C CA    1 
ATOM   7770  C  C     . VAL C 2 539  ? 52.446  -26.498 88.094  1.00 121.58 ? 539  VAL C C     1 
ATOM   7771  O  O     . VAL C 2 539  ? 52.050  -25.996 87.029  1.00 120.28 ? 539  VAL C O     1 
ATOM   7772  C  CB    . VAL C 2 539  ? 50.712  -28.149 88.952  1.00 117.48 ? 539  VAL C CB    1 
ATOM   7773  C  CG1   . VAL C 2 539  ? 49.708  -28.016 87.802  1.00 117.07 ? 539  VAL C CG1   1 
ATOM   7774  C  CG2   . VAL C 2 539  ? 50.573  -29.493 89.649  1.00 115.45 ? 539  VAL C CG2   1 
ATOM   7775  N  N     . PHE C 2 540  ? 53.127  -25.801 88.999  1.00 114.53 ? 540  PHE C N     1 
ATOM   7776  C  CA    . PHE C 2 540  ? 53.221  -24.353 88.909  1.00 109.13 ? 540  PHE C CA    1 
ATOM   7777  C  C     . PHE C 2 540  ? 54.636  -23.892 88.679  1.00 109.44 ? 540  PHE C C     1 
ATOM   7778  O  O     . PHE C 2 540  ? 55.589  -24.551 89.119  1.00 109.07 ? 540  PHE C O     1 
ATOM   7779  C  CB    . PHE C 2 540  ? 52.712  -23.715 90.196  1.00 111.46 ? 540  PHE C CB    1 
ATOM   7780  C  CG    . PHE C 2 540  ? 51.358  -24.198 90.621  1.00 115.45 ? 540  PHE C CG    1 
ATOM   7781  C  CD1   . PHE C 2 540  ? 51.041  -24.285 91.968  1.00 116.86 ? 540  PHE C CD1   1 
ATOM   7782  C  CD2   . PHE C 2 540  ? 50.392  -24.556 89.682  1.00 115.84 ? 540  PHE C CD2   1 
ATOM   7783  C  CE1   . PHE C 2 540  ? 49.792  -24.730 92.377  1.00 117.02 ? 540  PHE C CE1   1 
ATOM   7784  C  CE2   . PHE C 2 540  ? 49.139  -25.007 90.084  1.00 116.15 ? 540  PHE C CE2   1 
ATOM   7785  C  CZ    . PHE C 2 540  ? 48.838  -25.091 91.436  1.00 115.94 ? 540  PHE C CZ    1 
ATOM   7786  N  N     . SER C 2 541  ? 54.770  -22.721 88.053  1.00 109.31 ? 541  SER C N     1 
ATOM   7787  C  CA    . SER C 2 541  ? 56.090  -22.177 87.749  1.00 113.06 ? 541  SER C CA    1 
ATOM   7788  C  C     . SER C 2 541  ? 56.825  -21.947 89.051  1.00 116.22 ? 541  SER C C     1 
ATOM   7789  O  O     . SER C 2 541  ? 56.218  -21.927 90.123  1.00 113.13 ? 541  SER C O     1 
ATOM   7790  C  CB    . SER C 2 541  ? 56.028  -20.872 86.934  1.00 110.04 ? 541  SER C CB    1 
ATOM   7791  O  OG    . SER C 2 541  ? 56.040  -19.709 87.750  1.00 110.87 ? 541  SER C OG    1 
ATOM   7792  N  N     . VAL C 2 542  ? 58.142  -21.847 88.956  1.00 117.96 ? 542  VAL C N     1 
ATOM   7793  C  CA    . VAL C 2 542  ? 58.954  -21.545 90.116  1.00 114.86 ? 542  VAL C CA    1 
ATOM   7794  C  C     . VAL C 2 542  ? 58.354  -20.366 90.885  1.00 115.33 ? 542  VAL C C     1 
ATOM   7795  O  O     . VAL C 2 542  ? 58.114  -20.458 92.092  1.00 111.92 ? 542  VAL C O     1 
ATOM   7796  C  CB    . VAL C 2 542  ? 60.365  -21.190 89.674  1.00 109.27 ? 542  VAL C CB    1 
ATOM   7797  C  CG1   . VAL C 2 542  ? 61.259  -20.963 90.883  1.00 104.43 ? 542  VAL C CG1   1 
ATOM   7798  C  CG2   . VAL C 2 542  ? 60.909  -22.287 88.783  1.00 106.15 ? 542  VAL C CG2   1 
ATOM   7799  N  N     . ASN C 2 543  ? 58.071  -19.283 90.163  1.00 115.22 ? 543  ASN C N     1 
ATOM   7800  C  CA    . ASN C 2 543  ? 57.490  -18.085 90.745  1.00 109.03 ? 543  ASN C CA    1 
ATOM   7801  C  C     . ASN C 2 543  ? 56.220  -18.343 91.504  1.00 107.10 ? 543  ASN C C     1 
ATOM   7802  O  O     . ASN C 2 543  ? 56.083  -17.926 92.652  1.00 106.44 ? 543  ASN C O     1 
ATOM   7803  C  CB    . ASN C 2 543  ? 57.221  -17.058 89.664  1.00 106.39 ? 543  ASN C CB    1 
ATOM   7804  C  CG    . ASN C 2 543  ? 58.411  -16.217 89.396  1.00 106.00 ? 543  ASN C CG    1 
ATOM   7805  O  OD1   . ASN C 2 543  ? 59.393  -16.692 88.843  1.00 108.05 ? 543  ASN C OD1   1 
ATOM   7806  N  ND2   . ASN C 2 543  ? 58.355  -14.959 89.811  1.00 105.53 ? 543  ASN C ND2   1 
ATOM   7807  N  N     . THR C 2 544  ? 55.292  -19.029 90.852  1.00 105.46 ? 544  THR C N     1 
ATOM   7808  C  CA    . THR C 2 544  ? 54.010  -19.328 91.457  1.00 107.75 ? 544  THR C CA    1 
ATOM   7809  C  C     . THR C 2 544  ? 54.151  -20.125 92.747  1.00 115.04 ? 544  THR C C     1 
ATOM   7810  O  O     . THR C 2 544  ? 53.288  -20.059 93.626  1.00 112.30 ? 544  THR C O     1 
ATOM   7811  C  CB    . THR C 2 544  ? 53.122  -20.082 90.484  1.00 102.57 ? 544  THR C CB    1 
ATOM   7812  O  OG1   . THR C 2 544  ? 53.110  -19.389 89.231  1.00 101.20 ? 544  THR C OG1   1 
ATOM   7813  C  CG2   . THR C 2 544  ? 51.734  -20.159 91.040  1.00 100.73 ? 544  THR C CG2   1 
ATOM   7814  N  N     . ASN C 2 545  ? 55.265  -20.846 92.867  1.00 118.59 ? 545  ASN C N     1 
ATOM   7815  C  CA    . ASN C 2 545  ? 55.531  -21.699 94.030  1.00 118.58 ? 545  ASN C CA    1 
ATOM   7816  C  C     . ASN C 2 545  ? 56.064  -20.950 95.263  1.00 116.62 ? 545  ASN C C     1 
ATOM   7817  O  O     . ASN C 2 545  ? 56.220  -21.540 96.338  1.00 113.12 ? 545  ASN C O     1 
ATOM   7818  C  CB    . ASN C 2 545  ? 56.479  -22.842 93.650  1.00 114.93 ? 545  ASN C CB    1 
ATOM   7819  C  CG    . ASN C 2 545  ? 55.777  -24.182 93.573  1.00 115.29 ? 545  ASN C CG    1 
ATOM   7820  O  OD1   . ASN C 2 545  ? 55.530  -24.828 94.593  1.00 114.89 ? 545  ASN C OD1   1 
ATOM   7821  N  ND2   . ASN C 2 545  ? 55.467  -24.616 92.358  1.00 115.52 ? 545  ASN C ND2   1 
ATOM   7822  N  N     . LEU C 2 546  ? 56.340  -19.658 95.097  1.00 114.26 ? 546  LEU C N     1 
ATOM   7823  C  CA    . LEU C 2 546  ? 56.826  -18.823 96.185  1.00 111.32 ? 546  LEU C CA    1 
ATOM   7824  C  C     . LEU C 2 546  ? 55.672  -18.193 96.933  1.00 112.65 ? 546  LEU C C     1 
ATOM   7825  O  O     . LEU C 2 546  ? 55.890  -17.435 97.884  1.00 113.79 ? 546  LEU C O     1 
ATOM   7826  C  CB    . LEU C 2 546  ? 57.718  -17.714 95.643  1.00 111.98 ? 546  LEU C CB    1 
ATOM   7827  C  CG    . LEU C 2 546  ? 59.026  -18.162 95.009  1.00 109.88 ? 546  LEU C CG    1 
ATOM   7828  C  CD1   . LEU C 2 546  ? 59.932  -16.964 94.763  1.00 108.71 ? 546  LEU C CD1   1 
ATOM   7829  C  CD2   . LEU C 2 546  ? 59.692  -19.175 95.915  1.00 110.89 ? 546  LEU C CD2   1 
ATOM   7830  N  N     . ILE C 2 547  ? 54.455  -18.500 96.481  1.00 108.67 ? 547  ILE C N     1 
ATOM   7831  C  CA    . ILE C 2 547  ? 53.226  -17.965 97.062  1.00 108.52 ? 547  ILE C CA    1 
ATOM   7832  C  C     . ILE C 2 547  ? 52.606  -18.912 98.095  1.00 109.64 ? 547  ILE C C     1 
ATOM   7833  O  O     . ILE C 2 547  ? 52.036  -19.940 97.733  1.00 107.94 ? 547  ILE C O     1 
ATOM   7834  C  CB    . ILE C 2 547  ? 52.152  -17.751 95.991  1.00 105.79 ? 547  ILE C CB    1 
ATOM   7835  C  CG1   . ILE C 2 547  ? 52.656  -16.875 94.850  1.00 102.82 ? 547  ILE C CG1   1 
ATOM   7836  C  CG2   . ILE C 2 547  ? 50.911  -17.147 96.614  1.00 106.36 ? 547  ILE C CG2   1 
ATOM   7837  C  CD1   . ILE C 2 547  ? 51.615  -16.674 93.771  1.00 100.85 ? 547  ILE C CD1   1 
ATOM   7838  N  N     . PRO C 2 548  ? 52.686  -18.555 99.386  1.00 108.09 ? 548  PRO C N     1 
ATOM   7839  C  CA    . PRO C 2 548  ? 52.145  -19.398 100.455 1.00 108.51 ? 548  PRO C CA    1 
ATOM   7840  C  C     . PRO C 2 548  ? 50.632  -19.290 100.500 1.00 106.28 ? 548  PRO C C     1 
ATOM   7841  O  O     . PRO C 2 548  ? 50.124  -18.251 100.095 1.00 102.55 ? 548  PRO C O     1 
ATOM   7842  C  CB    . PRO C 2 548  ? 52.758  -18.784 101.708 1.00 106.74 ? 548  PRO C CB    1 
ATOM   7843  C  CG    . PRO C 2 548  ? 52.936  -17.371 101.364 1.00 105.01 ? 548  PRO C CG    1 
ATOM   7844  C  CD    . PRO C 2 548  ? 53.233  -17.294 99.906  1.00 104.92 ? 548  PRO C CD    1 
ATOM   7845  N  N     . PHE C 2 549  ? 49.925  -20.344 100.908 1.00 104.85 ? 549  PHE C N     1 
ATOM   7846  C  CA    . PHE C 2 549  ? 48.477  -20.245 101.048 1.00 104.26 ? 549  PHE C CA    1 
ATOM   7847  C  C     . PHE C 2 549  ? 47.798  -20.058 99.722  1.00 107.50 ? 549  PHE C C     1 
ATOM   7848  O  O     . PHE C 2 549  ? 46.611  -19.761 99.668  1.00 109.12 ? 549  PHE C O     1 
ATOM   7849  C  CB    . PHE C 2 549  ? 48.054  -19.180 102.041 1.00 105.57 ? 549  PHE C CB    1 
ATOM   7850  C  CG    . PHE C 2 549  ? 48.349  -19.553 103.443 1.00 115.97 ? 549  PHE C CG    1 
ATOM   7851  C  CD1   . PHE C 2 549  ? 47.662  -20.605 104.043 1.00 119.83 ? 549  PHE C CD1   1 
ATOM   7852  C  CD2   . PHE C 2 549  ? 49.341  -18.886 104.162 1.00 115.87 ? 549  PHE C CD2   1 
ATOM   7853  C  CE1   . PHE C 2 549  ? 47.939  -20.976 105.352 1.00 123.28 ? 549  PHE C CE1   1 
ATOM   7854  C  CE2   . PHE C 2 549  ? 49.635  -19.242 105.481 1.00 114.90 ? 549  PHE C CE2   1 
ATOM   7855  C  CZ    . PHE C 2 549  ? 48.931  -20.291 106.078 1.00 122.98 ? 549  PHE C CZ    1 
ATOM   7856  N  N     . LEU C 2 550  ? 48.596  -20.142 98.665  1.00 107.46 ? 550  LEU C N     1 
ATOM   7857  C  CA    . LEU C 2 550  ? 48.133  -20.054 97.295  1.00 102.45 ? 550  LEU C CA    1 
ATOM   7858  C  C     . LEU C 2 550  ? 46.906  -20.930 97.034  1.00 105.40 ? 550  LEU C C     1 
ATOM   7859  O  O     . LEU C 2 550  ? 46.124  -20.642 96.138  1.00 103.55 ? 550  LEU C O     1 
ATOM   7860  C  CB    . LEU C 2 550  ? 49.266  -20.479 96.362  1.00 99.69  ? 550  LEU C CB    1 
ATOM   7861  C  CG    . LEU C 2 550  ? 48.897  -20.823 94.921  1.00 103.62 ? 550  LEU C CG    1 
ATOM   7862  C  CD1   . LEU C 2 550  ? 48.475  -19.582 94.174  1.00 108.25 ? 550  LEU C CD1   1 
ATOM   7863  C  CD2   . LEU C 2 550  ? 50.055  -21.468 94.214  1.00 109.76 ? 550  LEU C CD2   1 
ATOM   7864  N  N     . GLU C 2 551  ? 46.722  -21.993 97.814  1.00 108.63 ? 551  GLU C N     1 
ATOM   7865  C  CA    . GLU C 2 551  ? 45.526  -22.812 97.669  1.00 105.51 ? 551  GLU C CA    1 
ATOM   7866  C  C     . GLU C 2 551  ? 44.269  -21.996 97.984  1.00 110.19 ? 551  GLU C C     1 
ATOM   7867  O  O     . GLU C 2 551  ? 43.168  -22.400 97.620  1.00 111.80 ? 551  GLU C O     1 
ATOM   7868  C  CB    . GLU C 2 551  ? 45.597  -24.103 98.498  1.00 105.70 ? 551  GLU C CB    1 
ATOM   7869  C  CG    . GLU C 2 551  ? 45.399  -23.976 99.993  1.00 114.22 ? 551  GLU C CG    1 
ATOM   7870  C  CD    . GLU C 2 551  ? 46.698  -24.108 100.778 1.00 123.91 ? 551  GLU C CD    1 
ATOM   7871  O  OE1   . GLU C 2 551  ? 46.649  -24.447 101.988 1.00 132.32 ? 551  GLU C OE1   1 
ATOM   7872  O  OE2   . GLU C 2 551  ? 47.772  -23.862 100.190 1.00 121.49 ? 551  GLU C OE2   1 
ATOM   7873  N  N     . HIS C 2 552  ? 44.441  -20.862 98.674  1.00 114.49 ? 552  HIS C N     1 
ATOM   7874  C  CA    . HIS C 2 552  ? 43.346  -19.906 98.968  1.00 111.95 ? 552  HIS C CA    1 
ATOM   7875  C  C     . HIS C 2 552  ? 43.177  -18.692 98.021  1.00 105.89 ? 552  HIS C C     1 
ATOM   7876  O  O     . HIS C 2 552  ? 42.155  -18.008 98.059  1.00 102.68 ? 552  HIS C O     1 
ATOM   7877  C  CB    . HIS C 2 552  ? 43.471  -19.389 100.411 1.00 105.94 ? 552  HIS C CB    1 
ATOM   7878  C  CG    . HIS C 2 552  ? 43.595  -20.476 101.431 1.00 110.00 ? 552  HIS C CG    1 
ATOM   7879  N  ND1   . HIS C 2 552  ? 42.522  -21.236 101.839 1.00 111.55 ? 552  HIS C ND1   1 
ATOM   7880  C  CD2   . HIS C 2 552  ? 44.668  -20.943 102.114 1.00 113.45 ? 552  HIS C CD2   1 
ATOM   7881  C  CE1   . HIS C 2 552  ? 42.927  -22.122 102.732 1.00 115.07 ? 552  HIS C CE1   1 
ATOM   7882  N  NE2   . HIS C 2 552  ? 44.224  -21.965 102.917 1.00 113.60 ? 552  HIS C NE2   1 
ATOM   7883  N  N     . ASP C 2 553  ? 44.158  -18.436 97.164  1.00 104.40 ? 553  ASP C N     1 
ATOM   7884  C  CA    . ASP C 2 553  ? 44.141  -17.234 96.334  1.00 101.65 ? 553  ASP C CA    1 
ATOM   7885  C  C     . ASP C 2 553  ? 43.481  -17.546 94.995  1.00 102.53 ? 553  ASP C C     1 
ATOM   7886  O  O     . ASP C 2 553  ? 43.754  -18.587 94.404  1.00 100.54 ? 553  ASP C O     1 
ATOM   7887  C  CB    . ASP C 2 553  ? 45.570  -16.713 96.091  1.00 103.17 ? 553  ASP C CB    1 
ATOM   7888  C  CG    . ASP C 2 553  ? 46.226  -16.138 97.344  1.00 99.55  ? 553  ASP C CG    1 
ATOM   7889  O  OD1   . ASP C 2 553  ? 47.468  -16.226 97.485  1.00 96.13  ? 553  ASP C OD1   1 
ATOM   7890  O  OD2   . ASP C 2 553  ? 45.498  -15.578 98.184  1.00 100.41 ? 553  ASP C OD2   1 
ATOM   7891  N  N     . ASP C 2 554  ? 42.625  -16.651 94.504  1.00 107.81 ? 554  ASP C N     1 
ATOM   7892  C  CA    . ASP C 2 554  ? 42.008  -16.844 93.179  1.00 112.17 ? 554  ASP C CA    1 
ATOM   7893  C  C     . ASP C 2 554  ? 43.087  -16.837 92.103  1.00 107.82 ? 554  ASP C C     1 
ATOM   7894  O  O     . ASP C 2 554  ? 44.152  -16.253 92.295  1.00 107.56 ? 554  ASP C O     1 
ATOM   7895  C  CB    . ASP C 2 554  ? 40.903  -15.801 92.890  1.00 110.67 ? 554  ASP C CB    1 
ATOM   7896  C  CG    . ASP C 2 554  ? 40.555  -15.684 91.395  1.00 112.63 ? 554  ASP C CG    1 
ATOM   7897  O  OD1   . ASP C 2 554  ? 39.967  -16.624 90.803  1.00 112.68 ? 554  ASP C OD1   1 
ATOM   7898  O  OD2   . ASP C 2 554  ? 40.868  -14.624 90.813  1.00 113.50 ? 554  ASP C OD2   1 
ATOM   7899  N  N     . ALA C 2 555  ? 42.815  -17.510 90.991  1.00 105.18 ? 555  ALA C N     1 
ATOM   7900  C  CA    . ALA C 2 555  ? 43.762  -17.608 89.888  1.00 110.28 ? 555  ALA C CA    1 
ATOM   7901  C  C     . ALA C 2 555  ? 44.316  -16.253 89.362  1.00 111.61 ? 555  ALA C C     1 
ATOM   7902  O  O     . ALA C 2 555  ? 45.535  -16.035 89.306  1.00 108.89 ? 555  ALA C O     1 
ATOM   7903  C  CB    . ALA C 2 555  ? 43.139  -18.433 88.753  1.00 112.82 ? 555  ALA C CB    1 
ATOM   7904  N  N     . ASN C 2 556  ? 43.421  -15.345 88.993  1.00 114.26 ? 556  ASN C N     1 
ATOM   7905  C  CA    . ASN C 2 556  ? 43.826  -14.087 88.372  1.00 113.68 ? 556  ASN C CA    1 
ATOM   7906  C  C     . ASN C 2 556  ? 44.754  -13.230 89.225  1.00 111.34 ? 556  ASN C C     1 
ATOM   7907  O  O     . ASN C 2 556  ? 45.566  -12.474 88.696  1.00 111.59 ? 556  ASN C O     1 
ATOM   7908  C  CB    . ASN C 2 556  ? 42.596  -13.283 87.949  1.00 118.16 ? 556  ASN C CB    1 
ATOM   7909  C  CG    . ASN C 2 556  ? 41.810  -13.967 86.846  1.00 124.47 ? 556  ASN C CG    1 
ATOM   7910  O  OD1   . ASN C 2 556  ? 42.039  -13.717 85.659  1.00 131.47 ? 556  ASN C OD1   1 
ATOM   7911  N  ND2   . ASN C 2 556  ? 40.878  -14.840 87.231  1.00 124.51 ? 556  ASN C ND2   1 
ATOM   7912  N  N     . ARG C 2 557  ? 44.627  -13.332 90.540  1.00 106.44 ? 557  ARG C N     1 
ATOM   7913  C  CA    . ARG C 2 557  ? 45.498  -12.578 91.412  1.00 102.97 ? 557  ARG C CA    1 
ATOM   7914  C  C     . ARG C 2 557  ? 46.850  -13.262 91.581  1.00 104.93 ? 557  ARG C C     1 
ATOM   7915  O  O     . ARG C 2 557  ? 47.882  -12.583 91.674  1.00 102.11 ? 557  ARG C O     1 
ATOM   7916  C  CB    . ARG C 2 557  ? 44.817  -12.306 92.745  1.00 100.00 ? 557  ARG C CB    1 
ATOM   7917  C  CG    . ARG C 2 557  ? 44.751  -10.823 93.067  1.00 104.46 ? 557  ARG C CG    1 
ATOM   7918  C  CD    . ARG C 2 557  ? 44.230  -9.978  91.902  1.00 108.56 ? 557  ARG C CD    1 
ATOM   7919  N  NE    . ARG C 2 557  ? 44.754  -8.608  91.950  1.00 109.74 ? 557  ARG C NE    1 
ATOM   7920  C  CZ    . ARG C 2 557  ? 44.087  -7.519  91.566  1.00 114.94 ? 557  ARG C CZ    1 
ATOM   7921  N  NH1   . ARG C 2 557  ? 42.847  -7.627  91.092  1.00 113.79 ? 557  ARG C NH1   1 
ATOM   7922  N  NH2   . ARG C 2 557  ? 44.662  -6.316  91.662  1.00 111.10 ? 557  ARG C NH2   1 
ATOM   7923  N  N     . ALA C 2 558  ? 46.845  -14.600 91.600  1.00 106.23 ? 558  ALA C N     1 
ATOM   7924  C  CA    . ALA C 2 558  ? 48.084  -15.387 91.714  1.00 105.80 ? 558  ALA C CA    1 
ATOM   7925  C  C     . ALA C 2 558  ? 49.020  -15.108 90.545  1.00 107.97 ? 558  ALA C C     1 
ATOM   7926  O  O     . ALA C 2 558  ? 50.243  -15.155 90.692  1.00 108.27 ? 558  ALA C O     1 
ATOM   7927  C  CB    . ALA C 2 558  ? 47.796  -16.886 91.820  1.00 92.46  ? 558  ALA C CB    1 
ATOM   7928  N  N     . LEU C 2 559  ? 48.433  -14.828 89.385  1.00 104.22 ? 559  LEU C N     1 
ATOM   7929  C  CA    . LEU C 2 559  ? 49.181  -14.424 88.208  1.00 102.92 ? 559  LEU C CA    1 
ATOM   7930  C  C     . LEU C 2 559  ? 49.971  -13.156 88.467  1.00 108.79 ? 559  LEU C C     1 
ATOM   7931  O  O     . LEU C 2 559  ? 51.033  -12.947 87.889  1.00 109.98 ? 559  LEU C O     1 
ATOM   7932  C  CB    . LEU C 2 559  ? 48.220  -14.166 87.064  1.00 103.73 ? 559  LEU C CB    1 
ATOM   7933  C  CG    . LEU C 2 559  ? 48.787  -13.836 85.688  1.00 109.99 ? 559  LEU C CG    1 
ATOM   7934  C  CD1   . LEU C 2 559  ? 47.712  -14.196 84.693  1.00 114.48 ? 559  LEU C CD1   1 
ATOM   7935  C  CD2   . LEU C 2 559  ? 49.189  -12.363 85.525  1.00 113.08 ? 559  LEU C CD2   1 
ATOM   7936  N  N     . MET C 2 560  ? 49.428  -12.270 89.284  1.00 107.60 ? 560  MET C N     1 
ATOM   7937  C  CA    . MET C 2 560  ? 50.192  -11.107 89.672  1.00 106.42 ? 560  MET C CA    1 
ATOM   7938  C  C     . MET C 2 560  ? 51.151  -11.474 90.786  1.00 107.72 ? 560  MET C C     1 
ATOM   7939  O  O     . MET C 2 560  ? 52.243  -10.938 90.860  1.00 107.46 ? 560  MET C O     1 
ATOM   7940  C  CB    . MET C 2 560  ? 49.281  -9.979  90.094  1.00 108.79 ? 560  MET C CB    1 
ATOM   7941  C  CG    . MET C 2 560  ? 48.691  -9.248  88.928  1.00 111.99 ? 560  MET C CG    1 
ATOM   7942  S  SD    . MET C 2 560  ? 46.939  -8.949  89.199  1.00 113.81 ? 560  MET C SD    1 
ATOM   7943  C  CE    . MET C 2 560  ? 46.745  -7.454  88.234  1.00 115.41 ? 560  MET C CE    1 
ATOM   7944  N  N     . GLY C 2 561  ? 50.749  -12.394 91.653  1.00 103.80 ? 561  GLY C N     1 
ATOM   7945  C  CA    . GLY C 2 561  ? 51.678  -12.905 92.644  1.00 107.25 ? 561  GLY C CA    1 
ATOM   7946  C  C     . GLY C 2 561  ? 52.981  -13.387 92.010  1.00 108.10 ? 561  GLY C C     1 
ATOM   7947  O  O     . GLY C 2 561  ? 54.069  -12.924 92.369  1.00 106.38 ? 561  GLY C O     1 
ATOM   7948  N  N     . SER C 2 562  ? 52.868  -14.302 91.052  1.00 106.00 ? 562  SER C N     1 
ATOM   7949  C  CA    . SER C 2 562  ? 54.025  -14.772 90.308  1.00 106.27 ? 562  SER C CA    1 
ATOM   7950  C  C     . SER C 2 562  ? 54.742  -13.615 89.641  1.00 112.05 ? 562  SER C C     1 
ATOM   7951  O  O     . SER C 2 562  ? 55.812  -13.198 90.093  1.00 112.31 ? 562  SER C O     1 
ATOM   7952  C  CB    . SER C 2 562  ? 53.589  -15.736 89.208  1.00 107.00 ? 562  SER C CB    1 
ATOM   7953  O  OG    . SER C 2 562  ? 53.271  -17.006 89.721  1.00 106.75 ? 562  SER C OG    1 
ATOM   7954  N  N     . ASN C 2 563  ? 54.112  -13.080 88.591  1.00 113.66 ? 563  ASN C N     1 
ATOM   7955  C  CA    . ASN C 2 563  ? 54.697  -12.038 87.751  1.00 112.01 ? 563  ASN C CA    1 
ATOM   7956  C  C     . ASN C 2 563  ? 55.288  -10.893 88.573  1.00 112.66 ? 563  ASN C C     1 
ATOM   7957  O  O     . ASN C 2 563  ? 56.305  -10.325 88.190  1.00 112.13 ? 563  ASN C O     1 
ATOM   7958  C  CB    . ASN C 2 563  ? 53.659  -11.471 86.766  1.00 113.16 ? 563  ASN C CB    1 
ATOM   7959  C  CG    . ASN C 2 563  ? 53.774  -12.063 85.358  1.00 120.51 ? 563  ASN C CG    1 
ATOM   7960  O  OD1   . ASN C 2 563  ? 54.634  -11.661 84.553  1.00 121.03 ? 563  ASN C OD1   1 
ATOM   7961  N  ND2   . ASN C 2 563  ? 52.878  -12.994 85.041  1.00 117.55 ? 563  ASN C ND2   1 
ATOM   7962  N  N     . MET C 2 564  ? 54.676  -10.557 89.707  1.00 109.93 ? 564  MET C N     1 
ATOM   7963  C  CA    . MET C 2 564  ? 55.163  -9.403  90.452  1.00 106.25 ? 564  MET C CA    1 
ATOM   7964  C  C     . MET C 2 564  ? 56.375  -9.688  91.303  1.00 108.71 ? 564  MET C C     1 
ATOM   7965  O  O     . MET C 2 564  ? 57.118  -8.777  91.627  1.00 112.09 ? 564  MET C O     1 
ATOM   7966  C  CB    . MET C 2 564  ? 54.066  -8.713  91.254  1.00 99.06  ? 564  MET C CB    1 
ATOM   7967  C  CG    . MET C 2 564  ? 53.028  -8.098  90.337  1.00 106.05 ? 564  MET C CG    1 
ATOM   7968  S  SD    . MET C 2 564  ? 52.225  -6.660  91.020  1.00 104.20 ? 564  MET C SD    1 
ATOM   7969  C  CE    . MET C 2 564  ? 51.561  -7.390  92.504  1.00 107.07 ? 564  MET C CE    1 
ATOM   7970  N  N     . GLN C 2 565  ? 56.605  -10.946 91.641  1.00 110.00 ? 565  GLN C N     1 
ATOM   7971  C  CA    . GLN C 2 565  ? 57.848  -11.287 92.318  1.00 110.29 ? 565  GLN C CA    1 
ATOM   7972  C  C     . GLN C 2 565  ? 59.067  -11.038 91.404  1.00 113.40 ? 565  GLN C C     1 
ATOM   7973  O  O     . GLN C 2 565  ? 60.128  -10.620 91.868  1.00 113.90 ? 565  GLN C O     1 
ATOM   7974  C  CB    . GLN C 2 565  ? 57.791  -12.718 92.856  1.00 108.00 ? 565  GLN C CB    1 
ATOM   7975  C  CG    . GLN C 2 565  ? 57.009  -12.823 94.145  1.00 107.93 ? 565  GLN C CG    1 
ATOM   7976  C  CD    . GLN C 2 565  ? 56.657  -14.244 94.514  1.00 110.70 ? 565  GLN C CD    1 
ATOM   7977  O  OE1   . GLN C 2 565  ? 56.808  -14.648 95.671  1.00 110.98 ? 565  GLN C OE1   1 
ATOM   7978  N  NE2   . GLN C 2 565  ? 56.171  -15.010 93.540  1.00 108.21 ? 565  GLN C NE2   1 
ATOM   7979  N  N     . THR C 2 566  ? 58.902  -11.253 90.101  1.00 109.52 ? 566  THR C N     1 
ATOM   7980  C  CA    . THR C 2 566  ? 59.965  -10.967 89.132  1.00 112.58 ? 566  THR C CA    1 
ATOM   7981  C  C     . THR C 2 566  ? 60.418  -9.511  89.238  1.00 114.15 ? 566  THR C C     1 
ATOM   7982  O  O     . THR C 2 566  ? 61.523  -9.156  88.826  1.00 114.51 ? 566  THR C O     1 
ATOM   7983  C  CB    . THR C 2 566  ? 59.473  -11.201 87.673  1.00 121.21 ? 566  THR C CB    1 
ATOM   7984  O  OG1   . THR C 2 566  ? 58.886  -12.506 87.550  1.00 119.30 ? 566  THR C OG1   1 
ATOM   7985  C  CG2   . THR C 2 566  ? 60.611  -11.046 86.661  1.00 117.60 ? 566  THR C CG2   1 
ATOM   7986  N  N     . GLN C 2 567  ? 59.538  -8.667  89.769  1.00 113.73 ? 567  GLN C N     1 
ATOM   7987  C  CA    . GLN C 2 567  ? 59.746  -7.222  89.781  1.00 114.98 ? 567  GLN C CA    1 
ATOM   7988  C  C     . GLN C 2 567  ? 60.421  -6.641  91.022  1.00 110.12 ? 567  GLN C C     1 
ATOM   7989  O  O     . GLN C 2 567  ? 60.856  -5.484  91.014  1.00 108.99 ? 567  GLN C O     1 
ATOM   7990  C  CB    . GLN C 2 567  ? 58.399  -6.526  89.623  1.00 114.04 ? 567  GLN C CB    1 
ATOM   7991  C  CG    . GLN C 2 567  ? 57.566  -7.009  88.464  1.00 114.69 ? 567  GLN C CG    1 
ATOM   7992  C  CD    . GLN C 2 567  ? 56.289  -6.208  88.317  1.00 117.61 ? 567  GLN C CD    1 
ATOM   7993  O  OE1   . GLN C 2 567  ? 56.227  -5.033  88.679  1.00 116.66 ? 567  GLN C OE1   1 
ATOM   7994  N  NE2   . GLN C 2 567  ? 55.255  -6.845  87.791  1.00 127.90 ? 567  GLN C NE2   1 
ATOM   7995  N  N     . ALA C 2 568  ? 60.509  -7.429  92.084  1.00 110.78 ? 568  ALA C N     1 
ATOM   7996  C  CA    . ALA C 2 568  ? 60.906  -6.866  93.369  1.00 112.69 ? 568  ALA C CA    1 
ATOM   7997  C  C     . ALA C 2 568  ? 62.336  -6.361  93.362  1.00 112.74 ? 568  ALA C C     1 
ATOM   7998  O  O     . ALA C 2 568  ? 63.254  -7.016  92.859  1.00 110.19 ? 568  ALA C O     1 
ATOM   7999  C  CB    . ALA C 2 568  ? 60.678  -7.854  94.511  1.00 113.05 ? 568  ALA C CB    1 
ATOM   8000  N  N     . VAL C 2 569  ? 62.500  -5.175  93.925  1.00 111.40 ? 569  VAL C N     1 
ATOM   8001  C  CA    . VAL C 2 569  ? 63.784  -4.522  93.969  1.00 110.51 ? 569  VAL C CA    1 
ATOM   8002  C  C     . VAL C 2 569  ? 64.520  -4.974  95.226  1.00 114.19 ? 569  VAL C C     1 
ATOM   8003  O  O     . VAL C 2 569  ? 63.933  -4.983  96.316  1.00 109.44 ? 569  VAL C O     1 
ATOM   8004  C  CB    . VAL C 2 569  ? 63.591  -3.006  93.894  1.00 102.13 ? 569  VAL C CB    1 
ATOM   8005  C  CG1   . VAL C 2 569  ? 64.762  -2.275  94.488  1.00 104.66 ? 569  VAL C CG1   1 
ATOM   8006  C  CG2   . VAL C 2 569  ? 63.358  -2.616  92.449  1.00 100.07 ? 569  VAL C CG2   1 
ATOM   8007  N  N     . PRO C 2 570  ? 65.796  -5.408  95.064  1.00 115.31 ? 570  PRO C N     1 
ATOM   8008  C  CA    . PRO C 2 570  ? 66.659  -5.904  96.147  1.00 113.61 ? 570  PRO C CA    1 
ATOM   8009  C  C     . PRO C 2 570  ? 66.932  -4.835  97.199  1.00 119.08 ? 570  PRO C C     1 
ATOM   8010  O  O     . PRO C 2 570  ? 67.500  -3.772  96.872  1.00 115.90 ? 570  PRO C O     1 
ATOM   8011  C  CB    . PRO C 2 570  ? 67.971  -6.224  95.424  1.00 108.45 ? 570  PRO C CB    1 
ATOM   8012  C  CG    . PRO C 2 570  ? 67.602  -6.433  94.027  1.00 104.44 ? 570  PRO C CG    1 
ATOM   8013  C  CD    . PRO C 2 570  ? 66.457  -5.523  93.753  1.00 108.77 ? 570  PRO C CD    1 
ATOM   8014  N  N     . LEU C 2 571  ? 66.619  -5.151  98.456  1.00 116.51 ? 571  LEU C N     1 
ATOM   8015  C  CA    . LEU C 2 571  ? 66.603  -4.137  99.508  1.00 115.35 ? 571  LEU C CA    1 
ATOM   8016  C  C     . LEU C 2 571  ? 67.880  -4.230  100.322 1.00 118.32 ? 571  LEU C C     1 
ATOM   8017  O  O     . LEU C 2 571  ? 68.447  -5.316  100.448 1.00 123.22 ? 571  LEU C O     1 
ATOM   8018  C  CB    . LEU C 2 571  ? 65.372  -4.303  100.399 1.00 108.77 ? 571  LEU C CB    1 
ATOM   8019  C  CG    . LEU C 2 571  ? 64.068  -4.404  99.614  1.00 103.52 ? 571  LEU C CG    1 
ATOM   8020  C  CD1   . LEU C 2 571  ? 62.957  -4.853  100.509 1.00 105.89 ? 571  LEU C CD1   1 
ATOM   8021  C  CD2   . LEU C 2 571  ? 63.735  -3.071  99.012  1.00 105.52 ? 571  LEU C CD2   1 
ATOM   8022  N  N     . ILE C 2 572  ? 68.359  -3.097  100.835 1.00 117.94 ? 572  ILE C N     1 
ATOM   8023  C  CA    . ILE C 2 572  ? 69.601  -3.097  101.611 1.00 118.65 ? 572  ILE C CA    1 
ATOM   8024  C  C     . ILE C 2 572  ? 69.460  -3.836  102.940 1.00 116.11 ? 572  ILE C C     1 
ATOM   8025  O  O     . ILE C 2 572  ? 70.410  -4.485  103.379 1.00 115.53 ? 572  ILE C O     1 
ATOM   8026  C  CB    . ILE C 2 572  ? 70.204  -1.684  101.809 1.00 115.78 ? 572  ILE C CB    1 
ATOM   8027  C  CG1   . ILE C 2 572  ? 69.385  -0.881  102.818 1.00 122.08 ? 572  ILE C CG1   1 
ATOM   8028  C  CG2   . ILE C 2 572  ? 70.314  -0.972  100.484 1.00 107.84 ? 572  ILE C CG2   1 
ATOM   8029  C  CD1   . ILE C 2 572  ? 69.925  0.497   103.062 1.00 122.54 ? 572  ILE C CD1   1 
ATOM   8030  N  N     . ARG C 2 573  ? 68.302  -3.737  103.592 1.00 109.88 ? 573  ARG C N     1 
ATOM   8031  C  CA    . ARG C 2 573  ? 67.993  -4.729  104.609 1.00 112.33 ? 573  ARG C CA    1 
ATOM   8032  C  C     . ARG C 2 573  ? 66.798  -5.532  104.146 1.00 116.45 ? 573  ARG C C     1 
ATOM   8033  O  O     . ARG C 2 573  ? 65.668  -5.121  104.371 1.00 119.51 ? 573  ARG C O     1 
ATOM   8034  C  CB    . ARG C 2 573  ? 67.647  -4.043  105.925 1.00 116.02 ? 573  ARG C CB    1 
ATOM   8035  C  CG    . ARG C 2 573  ? 68.762  -3.192  106.481 1.00 116.96 ? 573  ARG C CG    1 
ATOM   8036  C  CD    . ARG C 2 573  ? 68.426  -2.646  107.844 1.00 114.66 ? 573  ARG C CD    1 
ATOM   8037  N  NE    . ARG C 2 573  ? 68.149  -3.690  108.818 1.00 121.20 ? 573  ARG C NE    1 
ATOM   8038  C  CZ    . ARG C 2 573  ? 67.370  -3.515  109.883 1.00 143.32 ? 573  ARG C CZ    1 
ATOM   8039  N  NH1   . ARG C 2 573  ? 66.803  -2.334  110.103 1.00 137.87 ? 573  ARG C NH1   1 
ATOM   8040  N  NH2   . ARG C 2 573  ? 67.150  -4.518  110.728 1.00 160.08 ? 573  ARG C NH2   1 
ATOM   8041  N  N     . ALA C 2 574  ? 67.036  -6.725  103.605 1.00 115.43 ? 574  ALA C N     1 
ATOM   8042  C  CA    . ALA C 2 574  ? 65.975  -7.462  102.923 1.00 109.99 ? 574  ALA C CA    1 
ATOM   8043  C  C     . ALA C 2 574  ? 65.673  -8.630  103.785 1.00 112.29 ? 574  ALA C C     1 
ATOM   8044  O  O     . ALA C 2 574  ? 66.526  -9.065  104.547 1.00 119.02 ? 574  ALA C O     1 
ATOM   8045  C  CB    . ALA C 2 574  ? 66.400  -7.924  101.518 1.00 103.27 ? 574  ALA C CB    1 
ATOM   8046  N  N     . GLN C 2 575  ? 64.444  -9.113  103.706 1.00 113.05 ? 575  GLN C N     1 
ATOM   8047  C  CA    . GLN C 2 575  ? 64.045  -10.239 104.533 1.00 119.97 ? 575  GLN C CA    1 
ATOM   8048  C  C     . GLN C 2 575  ? 63.366  -11.310 103.713 1.00 119.88 ? 575  GLN C C     1 
ATOM   8049  O  O     . GLN C 2 575  ? 62.693  -11.017 102.728 1.00 117.63 ? 575  GLN C O     1 
ATOM   8050  C  CB    . GLN C 2 575  ? 63.111  -9.798  105.655 1.00 114.89 ? 575  GLN C CB    1 
ATOM   8051  C  CG    . GLN C 2 575  ? 63.651  -8.710  106.536 1.00 113.96 ? 575  GLN C CG    1 
ATOM   8052  C  CD    . GLN C 2 575  ? 62.620  -8.257  107.525 1.00 117.80 ? 575  GLN C CD    1 
ATOM   8053  O  OE1   . GLN C 2 575  ? 62.071  -7.165  107.401 1.00 116.54 ? 575  GLN C OE1   1 
ATOM   8054  N  NE2   . GLN C 2 575  ? 62.330  -9.104  108.512 1.00 123.59 ? 575  GLN C NE2   1 
ATOM   8055  N  N     . ALA C 2 576  ? 63.590  -12.558 104.101 1.00 119.54 ? 576  ALA C N     1 
ATOM   8056  C  CA    . ALA C 2 576  ? 62.841  -13.661 103.538 1.00 118.17 ? 576  ALA C CA    1 
ATOM   8057  C  C     . ALA C 2 576  ? 61.608  -13.791 104.400 1.00 116.87 ? 576  ALA C C     1 
ATOM   8058  O  O     . ALA C 2 576  ? 61.698  -13.641 105.619 1.00 118.07 ? 576  ALA C O     1 
ATOM   8059  C  CB    . ALA C 2 576  ? 63.650  -14.930 103.573 1.00 118.85 ? 576  ALA C CB    1 
ATOM   8060  N  N     . PRO C 2 577  ? 60.454  -14.068 103.773 1.00 113.57 ? 577  PRO C N     1 
ATOM   8061  C  CA    . PRO C 2 577  ? 59.128  -14.074 104.402 1.00 117.03 ? 577  PRO C CA    1 
ATOM   8062  C  C     . PRO C 2 577  ? 59.017  -14.916 105.684 1.00 122.61 ? 577  PRO C C     1 
ATOM   8063  O  O     . PRO C 2 577  ? 59.569  -16.011 105.740 1.00 127.06 ? 577  PRO C O     1 
ATOM   8064  C  CB    . PRO C 2 577  ? 58.229  -14.656 103.303 1.00 112.85 ? 577  PRO C CB    1 
ATOM   8065  C  CG    . PRO C 2 577  ? 59.146  -15.300 102.344 1.00 111.68 ? 577  PRO C CG    1 
ATOM   8066  C  CD    . PRO C 2 577  ? 60.369  -14.458 102.361 1.00 112.58 ? 577  PRO C CD    1 
ATOM   8067  N  N     . VAL C 2 578  ? 58.308  -14.408 106.692 1.00 118.82 ? 578  VAL C N     1 
ATOM   8068  C  CA    . VAL C 2 578  ? 58.077  -15.162 107.918 1.00 120.67 ? 578  VAL C CA    1 
ATOM   8069  C  C     . VAL C 2 578  ? 57.174  -16.356 107.630 1.00 123.34 ? 578  VAL C C     1 
ATOM   8070  O  O     . VAL C 2 578  ? 57.072  -17.280 108.442 1.00 124.78 ? 578  VAL C O     1 
ATOM   8071  C  CB    . VAL C 2 578  ? 57.409  -14.296 108.998 1.00 125.95 ? 578  VAL C CB    1 
ATOM   8072  C  CG1   . VAL C 2 578  ? 58.390  -13.271 109.552 1.00 125.12 ? 578  VAL C CG1   1 
ATOM   8073  C  CG2   . VAL C 2 578  ? 56.167  -13.621 108.433 1.00 125.67 ? 578  VAL C CG2   1 
ATOM   8074  N  N     . VAL C 2 579  ? 56.504  -16.305 106.477 1.00 122.49 ? 579  VAL C N     1 
ATOM   8075  C  CA    . VAL C 2 579  ? 55.676  -17.398 105.967 1.00 118.81 ? 579  VAL C CA    1 
ATOM   8076  C  C     . VAL C 2 579  ? 56.217  -17.847 104.618 1.00 116.85 ? 579  VAL C C     1 
ATOM   8077  O  O     . VAL C 2 579  ? 56.148  -17.106 103.642 1.00 121.06 ? 579  VAL C O     1 
ATOM   8078  C  CB    . VAL C 2 579  ? 54.239  -16.934 105.724 1.00 114.26 ? 579  VAL C CB    1 
ATOM   8079  C  CG1   . VAL C 2 579  ? 53.321  -18.137 105.464 1.00 104.82 ? 579  VAL C CG1   1 
ATOM   8080  C  CG2   . VAL C 2 579  ? 53.747  -16.065 106.881 1.00 115.10 ? 579  VAL C CG2   1 
ATOM   8081  N  N     . MET C 2 580  ? 56.742  -19.060 104.551 1.00 113.74 ? 580  MET C N     1 
ATOM   8082  C  CA    . MET C 2 580  ? 57.416  -19.513 103.345 1.00 114.49 ? 580  MET C CA    1 
ATOM   8083  C  C     . MET C 2 580  ? 56.783  -20.779 102.797 1.00 119.71 ? 580  MET C C     1 
ATOM   8084  O  O     . MET C 2 580  ? 56.100  -21.495 103.525 1.00 122.68 ? 580  MET C O     1 
ATOM   8085  C  CB    . MET C 2 580  ? 58.874  -19.799 103.661 1.00 115.14 ? 580  MET C CB    1 
ATOM   8086  C  CG    . MET C 2 580  ? 59.738  -18.584 103.847 1.00 115.14 ? 580  MET C CG    1 
ATOM   8087  S  SD    . MET C 2 580  ? 61.375  -19.140 104.346 1.00 115.14 ? 580  MET C SD    1 
ATOM   8088  C  CE    . MET C 2 580  ? 60.961  -19.900 105.920 1.00 120.12 ? 580  MET C CE    1 
ATOM   8089  N  N     . THR C 2 581  ? 56.996  -21.052 101.513 1.00 121.10 ? 581  THR C N     1 
ATOM   8090  C  CA    . THR C 2 581  ? 56.608  -22.344 100.935 1.00 124.25 ? 581  THR C CA    1 
ATOM   8091  C  C     . THR C 2 581  ? 57.778  -23.340 100.841 1.00 128.02 ? 581  THR C C     1 
ATOM   8092  O  O     . THR C 2 581  ? 57.629  -24.442 100.300 1.00 128.16 ? 581  THR C O     1 
ATOM   8093  C  CB    . THR C 2 581  ? 55.904  -22.191 99.565  1.00 123.63 ? 581  THR C CB    1 
ATOM   8094  O  OG1   . THR C 2 581  ? 56.838  -22.425 98.500  1.00 121.08 ? 581  THR C OG1   1 
ATOM   8095  C  CG2   . THR C 2 581  ? 55.294  -20.809 99.434  1.00 119.62 ? 581  THR C CG2   1 
ATOM   8096  N  N     . GLY C 2 582  ? 58.939  -22.934 101.352 1.00 126.48 ? 582  GLY C N     1 
ATOM   8097  C  CA    . GLY C 2 582  ? 60.075  -23.825 101.507 1.00 125.86 ? 582  GLY C CA    1 
ATOM   8098  C  C     . GLY C 2 582  ? 61.102  -23.806 100.389 1.00 131.60 ? 582  GLY C C     1 
ATOM   8099  O  O     . GLY C 2 582  ? 62.262  -24.174 100.612 1.00 136.99 ? 582  GLY C O     1 
ATOM   8100  N  N     . LEU C 2 583  ? 60.691  -23.372 99.197  1.00 127.95 ? 583  LEU C N     1 
ATOM   8101  C  CA    . LEU C 2 583  ? 61.594  -23.282 98.041  1.00 123.90 ? 583  LEU C CA    1 
ATOM   8102  C  C     . LEU C 2 583  ? 62.578  -22.122 98.149  1.00 127.31 ? 583  LEU C C     1 
ATOM   8103  O  O     . LEU C 2 583  ? 63.634  -22.135 97.516  1.00 127.21 ? 583  LEU C O     1 
ATOM   8104  C  CB    . LEU C 2 583  ? 60.809  -23.098 96.746  1.00 113.31 ? 583  LEU C CB    1 
ATOM   8105  C  CG    . LEU C 2 583  ? 60.092  -24.261 96.085  1.00 108.14 ? 583  LEU C CG    1 
ATOM   8106  C  CD1   . LEU C 2 583  ? 58.903  -24.742 96.911  1.00 117.99 ? 583  LEU C CD1   1 
ATOM   8107  C  CD2   . LEU C 2 583  ? 59.657  -23.794 94.718  1.00 104.75 ? 583  LEU C CD2   1 
ATOM   8108  N  N     . GLU C 2 584  ? 62.230  -21.121 98.951  1.00 123.97 ? 584  GLU C N     1 
ATOM   8109  C  CA    . GLU C 2 584  ? 62.966  -19.867 98.977  1.00 118.71 ? 584  GLU C CA    1 
ATOM   8110  C  C     . GLU C 2 584  ? 64.469  -20.019 99.261  1.00 125.44 ? 584  GLU C C     1 
ATOM   8111  O  O     . GLU C 2 584  ? 65.250  -19.117 98.962  1.00 126.75 ? 584  GLU C O     1 
ATOM   8112  C  CB    . GLU C 2 584  ? 62.308  -18.900 99.961  1.00 116.43 ? 584  GLU C CB    1 
ATOM   8113  C  CG    . GLU C 2 584  ? 61.395  -19.582 100.961 1.00 119.49 ? 584  GLU C CG    1 
ATOM   8114  C  CD    . GLU C 2 584  ? 59.912  -19.574 100.566 1.00 123.22 ? 584  GLU C CD    1 
ATOM   8115  O  OE1   . GLU C 2 584  ? 59.347  -18.510 100.219 1.00 121.54 ? 584  GLU C OE1   1 
ATOM   8116  O  OE2   . GLU C 2 584  ? 59.289  -20.647 100.639 1.00 125.38 ? 584  GLU C OE2   1 
ATOM   8117  N  N     . GLU C 2 585  ? 64.875  -21.160 99.815  1.00 127.72 ? 585  GLU C N     1 
ATOM   8118  C  CA    . GLU C 2 585  ? 66.286  -21.414 100.126 1.00 129.37 ? 585  GLU C CA    1 
ATOM   8119  C  C     . GLU C 2 585  ? 67.093  -21.868 98.914  1.00 128.42 ? 585  GLU C C     1 
ATOM   8120  O  O     . GLU C 2 585  ? 68.239  -21.446 98.716  1.00 128.33 ? 585  GLU C O     1 
ATOM   8121  C  CB    . GLU C 2 585  ? 66.409  -22.455 101.250 1.00 135.28 ? 585  GLU C CB    1 
ATOM   8122  C  CG    . GLU C 2 585  ? 67.790  -22.498 101.936 1.00 141.97 ? 585  GLU C CG    1 
ATOM   8123  C  CD    . GLU C 2 585  ? 67.707  -22.881 103.419 1.00 144.85 ? 585  GLU C CD    1 
ATOM   8124  O  OE1   . GLU C 2 585  ? 66.670  -23.460 103.818 1.00 146.22 ? 585  GLU C OE1   1 
ATOM   8125  O  OE2   . GLU C 2 585  ? 68.663  -22.596 104.186 1.00 139.96 ? 585  GLU C OE2   1 
ATOM   8126  N  N     . ARG C 2 586  ? 66.483  -22.753 98.130  1.00 129.21 ? 586  ARG C N     1 
ATOM   8127  C  CA    . ARG C 2 586  ? 67.111  -23.369 96.965  1.00 129.52 ? 586  ARG C CA    1 
ATOM   8128  C  C     . ARG C 2 586  ? 67.012  -22.510 95.700  1.00 127.65 ? 586  ARG C C     1 
ATOM   8129  O  O     . ARG C 2 586  ? 67.778  -22.696 94.763  1.00 129.68 ? 586  ARG C O     1 
ATOM   8130  C  CB    . ARG C 2 586  ? 66.528  -24.772 96.754  1.00 129.60 ? 586  ARG C CB    1 
ATOM   8131  C  CG    . ARG C 2 586  ? 66.821  -25.427 95.422  1.00 131.13 ? 586  ARG C CG    1 
ATOM   8132  C  CD    . ARG C 2 586  ? 67.793  -26.593 95.527  1.00 134.24 ? 586  ARG C CD    1 
ATOM   8133  N  NE    . ARG C 2 586  ? 67.992  -27.160 94.200  1.00 128.48 ? 586  ARG C NE    1 
ATOM   8134  C  CZ    . ARG C 2 586  ? 67.264  -28.148 93.705  1.00 125.05 ? 586  ARG C CZ    1 
ATOM   8135  N  NH1   . ARG C 2 586  ? 66.310  -28.704 94.445  1.00 126.43 ? 586  ARG C NH1   1 
ATOM   8136  N  NH2   . ARG C 2 586  ? 67.503  -28.586 92.480  1.00 122.14 ? 586  ARG C NH2   1 
ATOM   8137  N  N     . VAL C 2 587  ? 66.078  -21.565 95.672  1.00 125.12 ? 587  VAL C N     1 
ATOM   8138  C  CA    . VAL C 2 587  ? 66.014  -20.615 94.562  1.00 122.56 ? 587  VAL C CA    1 
ATOM   8139  C  C     . VAL C 2 587  ? 67.221  -19.667 94.597  1.00 127.96 ? 587  VAL C C     1 
ATOM   8140  O  O     . VAL C 2 587  ? 67.744  -19.252 93.556  1.00 126.77 ? 587  VAL C O     1 
ATOM   8141  C  CB    . VAL C 2 587  ? 64.695  -19.827 94.567  1.00 112.22 ? 587  VAL C CB    1 
ATOM   8142  C  CG1   . VAL C 2 587  ? 64.667  -18.847 93.436  1.00 111.76 ? 587  VAL C CG1   1 
ATOM   8143  C  CG2   . VAL C 2 587  ? 63.533  -20.772 94.434  1.00 112.24 ? 587  VAL C CG2   1 
ATOM   8144  N  N     . VAL C 2 588  ? 67.675  -19.354 95.805  1.00 129.31 ? 588  VAL C N     1 
ATOM   8145  C  CA    . VAL C 2 588  ? 68.903  -18.594 95.991  1.00 130.35 ? 588  VAL C CA    1 
ATOM   8146  C  C     . VAL C 2 588  ? 70.067  -19.396 95.430  1.00 132.84 ? 588  VAL C C     1 
ATOM   8147  O  O     . VAL C 2 588  ? 71.011  -18.847 94.865  1.00 135.20 ? 588  VAL C O     1 
ATOM   8148  C  CB    . VAL C 2 588  ? 69.125  -18.290 97.478  1.00 128.38 ? 588  VAL C CB    1 
ATOM   8149  C  CG1   . VAL C 2 588  ? 70.344  -17.406 97.686  1.00 133.27 ? 588  VAL C CG1   1 
ATOM   8150  C  CG2   . VAL C 2 588  ? 67.890  -17.620 98.031  1.00 123.76 ? 588  VAL C CG2   1 
ATOM   8151  N  N     . ARG C 2 589  ? 69.960  -20.712 95.552  1.00 132.05 ? 589  ARG C N     1 
ATOM   8152  C  CA    . ARG C 2 589  ? 70.990  -21.615 95.084  1.00 133.25 ? 589  ARG C CA    1 
ATOM   8153  C  C     . ARG C 2 589  ? 71.000  -21.690 93.565  1.00 133.71 ? 589  ARG C C     1 
ATOM   8154  O  O     . ARG C 2 589  ? 71.919  -21.163 92.937  1.00 137.00 ? 589  ARG C O     1 
ATOM   8155  C  CB    . ARG C 2 589  ? 70.739  -23.005 95.653  1.00 138.59 ? 589  ARG C CB    1 
ATOM   8156  C  CG    . ARG C 2 589  ? 71.577  -24.104 95.028  1.00 144.89 ? 589  ARG C CG    1 
ATOM   8157  C  CD    . ARG C 2 589  ? 72.911  -24.198 95.715  1.00 153.23 ? 589  ARG C CD    1 
ATOM   8158  N  NE    . ARG C 2 589  ? 72.761  -24.084 97.163  1.00 154.36 ? 589  ARG C NE    1 
ATOM   8159  C  CZ    . ARG C 2 589  ? 72.299  -25.044 97.958  1.00 159.62 ? 589  ARG C CZ    1 
ATOM   8160  N  NH1   . ARG C 2 589  ? 71.916  -26.211 97.453  1.00 161.82 ? 589  ARG C NH1   1 
ATOM   8161  N  NH2   . ARG C 2 589  ? 72.211  -24.830 99.264  1.00 166.41 ? 589  ARG C NH2   1 
ATOM   8162  N  N     . ASP C 2 590  ? 69.960  -22.299 92.986  1.00 131.37 ? 590  ASP C N     1 
ATOM   8163  C  CA    . ASP C 2 590  ? 69.921  -22.644 91.557  1.00 132.19 ? 590  ASP C CA    1 
ATOM   8164  C  C     . ASP C 2 590  ? 70.290  -21.487 90.609  1.00 139.10 ? 590  ASP C C     1 
ATOM   8165  O  O     . ASP C 2 590  ? 71.179  -21.637 89.758  1.00 140.94 ? 590  ASP C O     1 
ATOM   8166  C  CB    . ASP C 2 590  ? 68.573  -23.281 91.174  1.00 125.04 ? 590  ASP C CB    1 
ATOM   8167  C  CG    . ASP C 2 590  ? 68.538  -24.804 91.399  1.00 128.03 ? 590  ASP C CG    1 
ATOM   8168  O  OD1   . ASP C 2 590  ? 69.483  -25.375 91.990  1.00 130.83 ? 590  ASP C OD1   1 
ATOM   8169  O  OD2   . ASP C 2 590  ? 67.543  -25.435 90.980  1.00 122.95 ? 590  ASP C OD2   1 
ATOM   8170  N  N     . SER C 2 591  ? 69.637  -20.337 90.739  1.00 139.22 ? 591  SER C N     1 
ATOM   8171  C  CA    . SER C 2 591  ? 70.194  -19.155 90.088  1.00 140.45 ? 591  SER C CA    1 
ATOM   8172  C  C     . SER C 2 591  ? 71.172  -18.593 91.076  1.00 132.96 ? 591  SER C C     1 
ATOM   8173  O  O     . SER C 2 591  ? 70.789  -18.256 92.200  1.00 128.72 ? 591  SER C O     1 
ATOM   8174  C  CB    . SER C 2 591  ? 69.139  -18.104 89.740  1.00 136.95 ? 591  SER C CB    1 
ATOM   8175  O  OG    . SER C 2 591  ? 69.594  -17.256 88.682  1.00 132.63 ? 591  SER C OG    1 
ATOM   8176  N  N     . LEU C 2 592  ? 72.432  -18.511 90.669  1.00 128.36 ? 592  LEU C N     1 
ATOM   8177  C  CA    . LEU C 2 592  ? 73.454  -18.088 91.592  1.00 131.19 ? 592  LEU C CA    1 
ATOM   8178  C  C     . LEU C 2 592  ? 73.052  -16.759 92.175  1.00 135.10 ? 592  LEU C C     1 
ATOM   8179  O  O     . LEU C 2 592  ? 72.822  -15.784 91.473  1.00 132.01 ? 592  LEU C O     1 
ATOM   8180  C  CB    . LEU C 2 592  ? 74.790  -17.943 90.875  1.00 128.09 ? 592  LEU C CB    1 
ATOM   8181  C  CG    . LEU C 2 592  ? 75.310  -19.243 90.283  1.00 126.47 ? 592  LEU C CG    1 
ATOM   8182  C  CD1   . LEU C 2 592  ? 76.777  -19.114 89.918  1.00 123.20 ? 592  LEU C CD1   1 
ATOM   8183  C  CD2   . LEU C 2 592  ? 75.092  -20.354 91.289  1.00 133.60 ? 592  LEU C CD2   1 
ATOM   8184  N  N     . ALA C 2 593  ? 72.938  -16.758 93.489  1.00 144.72 ? 593  ALA C N     1 
ATOM   8185  C  CA    . ALA C 2 593  ? 72.735  -15.551 94.261  1.00 147.51 ? 593  ALA C CA    1 
ATOM   8186  C  C     . ALA C 2 593  ? 73.782  -15.644 95.349  1.00 153.11 ? 593  ALA C C     1 
ATOM   8187  O  O     . ALA C 2 593  ? 74.748  -14.875 95.380  1.00 156.00 ? 593  ALA C O     1 
ATOM   8188  C  CB    . ALA C 2 593  ? 71.331  -15.518 94.861  1.00 136.79 ? 593  ALA C CB    1 
ATOM   8189  N  N     . ALA C 2 594  ? 73.600  -16.638 96.210  1.00 149.09 ? 594  ALA C N     1 
ATOM   8190  C  CA    . ALA C 2 594  ? 74.544  -16.942 97.275  1.00 146.56 ? 594  ALA C CA    1 
ATOM   8191  C  C     . ALA C 2 594  ? 75.847  -17.608 96.806  1.00 145.05 ? 594  ALA C C     1 
ATOM   8192  O  O     . ALA C 2 594  ? 75.962  -18.114 95.679  1.00 139.84 ? 594  ALA C O     1 
ATOM   8193  C  CB    . ALA C 2 594  ? 73.870  -17.787 98.339  1.00 143.88 ? 594  ALA C CB    1 
ATOM   8194  N  N     . LEU C 2 595  ? 76.831  -17.562 97.697  1.00 141.68 ? 595  LEU C N     1 
ATOM   8195  C  CA    . LEU C 2 595  ? 78.107  -18.222 97.509  1.00 141.63 ? 595  LEU C CA    1 
ATOM   8196  C  C     . LEU C 2 595  ? 78.210  -19.418 98.462  1.00 143.39 ? 595  LEU C C     1 
ATOM   8197  O  O     . LEU C 2 595  ? 77.678  -19.379 99.566  1.00 144.00 ? 595  LEU C O     1 
ATOM   8198  C  CB    . LEU C 2 595  ? 79.222  -17.230 97.806  1.00 135.21 ? 595  LEU C CB    1 
ATOM   8199  C  CG    . LEU C 2 595  ? 80.359  -17.237 96.798  1.00 132.00 ? 595  LEU C CG    1 
ATOM   8200  C  CD1   . LEU C 2 595  ? 79.830  -16.760 95.461  1.00 134.84 ? 595  LEU C CD1   1 
ATOM   8201  C  CD2   . LEU C 2 595  ? 81.497  -16.374 97.292  1.00 128.04 ? 595  LEU C CD2   1 
ATOM   8202  N  N     . TYR C 2 596  ? 78.906  -20.472 98.051  1.00 142.46 ? 596  TYR C N     1 
ATOM   8203  C  CA    . TYR C 2 596  ? 78.908  -21.714 98.816  1.00 143.97 ? 596  TYR C CA    1 
ATOM   8204  C  C     . TYR C 2 596  ? 80.313  -22.293 99.054  1.00 151.41 ? 596  TYR C C     1 
ATOM   8205  O  O     . TYR C 2 596  ? 81.287  -21.831 98.466  1.00 155.03 ? 596  TYR C O     1 
ATOM   8206  C  CB    . TYR C 2 596  ? 78.002  -22.732 98.119  1.00 147.74 ? 596  TYR C CB    1 
ATOM   8207  C  CG    . TYR C 2 596  ? 76.539  -22.331 98.123  1.00 150.31 ? 596  TYR C CG    1 
ATOM   8208  C  CD1   . TYR C 2 596  ? 76.010  -21.510 97.130  1.00 155.16 ? 596  TYR C CD1   1 
ATOM   8209  C  CD2   . TYR C 2 596  ? 75.684  -22.772 99.123  1.00 152.99 ? 596  TYR C CD2   1 
ATOM   8210  C  CE1   . TYR C 2 596  ? 74.657  -21.138 97.140  1.00 156.22 ? 596  TYR C CE1   1 
ATOM   8211  C  CE2   . TYR C 2 596  ? 74.338  -22.406 99.146  1.00 153.12 ? 596  TYR C CE2   1 
ATOM   8212  C  CZ    . TYR C 2 596  ? 73.827  -21.587 98.157  1.00 151.31 ? 596  TYR C CZ    1 
ATOM   8213  O  OH    . TYR C 2 596  ? 72.489  -21.236 98.181  1.00 142.18 ? 596  TYR C OH    1 
ATOM   8214  N  N     . ALA C 2 597  ? 80.415  -23.285 99.937  1.00 153.38 ? 597  ALA C N     1 
ATOM   8215  C  CA    . ALA C 2 597  ? 81.680  -23.979 100.197 1.00 157.00 ? 597  ALA C CA    1 
ATOM   8216  C  C     . ALA C 2 597  ? 81.792  -25.273 99.375  1.00 164.95 ? 597  ALA C C     1 
ATOM   8217  O  O     . ALA C 2 597  ? 80.870  -26.084 99.367  1.00 167.59 ? 597  ALA C O     1 
ATOM   8218  C  CB    . ALA C 2 597  ? 81.815  -24.278 101.683 1.00 156.15 ? 597  ALA C CB    1 
ATOM   8219  N  N     . GLU C 2 598  ? 82.917  -25.464 98.689  1.00 168.22 ? 598  GLU C N     1 
ATOM   8220  C  CA    . GLU C 2 598  ? 83.057  -26.563 97.722  1.00 175.41 ? 598  GLU C CA    1 
ATOM   8221  C  C     . GLU C 2 598  ? 83.371  -27.941 98.305  1.00 179.56 ? 598  GLU C C     1 
ATOM   8222  O  O     . GLU C 2 598  ? 83.010  -28.970 97.729  1.00 179.56 ? 598  GLU C O     1 
ATOM   8223  C  CB    . GLU C 2 598  ? 84.106  -26.222 96.662  1.00 176.87 ? 598  GLU C CB    1 
ATOM   8224  C  CG    . GLU C 2 598  ? 83.775  -24.999 95.826  1.00 172.46 ? 598  GLU C CG    1 
ATOM   8225  C  CD    . GLU C 2 598  ? 84.436  -25.056 94.471  1.00 167.33 ? 598  GLU C CD    1 
ATOM   8226  O  OE1   . GLU C 2 598  ? 85.217  -26.007 94.256  1.00 172.70 ? 598  GLU C OE1   1 
ATOM   8227  O  OE2   . GLU C 2 598  ? 84.175  -24.170 93.626  1.00 159.85 ? 598  GLU C OE2   1 
ATOM   8228  N  N     . GLU C 2 599  ? 84.078  -27.955 99.425  1.00 181.65 ? 599  GLU C N     1 
ATOM   8229  C  CA    . GLU C 2 599  ? 84.394  -29.197 100.112 1.00 186.27 ? 599  GLU C CA    1 
ATOM   8230  C  C     . GLU C 2 599  ? 84.361  -28.871 101.593 1.00 181.86 ? 599  GLU C C     1 
ATOM   8231  O  O     . GLU C 2 599  ? 84.465  -27.699 101.956 1.00 177.16 ? 599  GLU C O     1 
ATOM   8232  C  CB    . GLU C 2 599  ? 85.781  -29.708 99.689  1.00 192.32 ? 599  GLU C CB    1 
ATOM   8233  C  CG    . GLU C 2 599  ? 86.032  -31.188 99.969  1.00 192.99 ? 599  GLU C CG    1 
ATOM   8234  C  CD    . GLU C 2 599  ? 84.958  -32.085 99.369  1.00 196.14 ? 599  GLU C CD    1 
ATOM   8235  O  OE1   . GLU C 2 599  ? 84.414  -31.747 98.291  1.00 193.71 ? 599  GLU C OE1   1 
ATOM   8236  O  OE2   . GLU C 2 599  ? 84.655  -33.129 99.982  1.00 194.74 ? 599  GLU C OE2   1 
ATOM   8237  N  N     . ASP C 2 600  ? 84.200  -29.885 102.442 1.00 182.37 ? 600  ASP C N     1 
ATOM   8238  C  CA    . ASP C 2 600  ? 84.262  -29.673 103.885 1.00 181.62 ? 600  ASP C CA    1 
ATOM   8239  C  C     . ASP C 2 600  ? 85.554  -28.909 104.145 1.00 180.72 ? 600  ASP C C     1 
ATOM   8240  O  O     . ASP C 2 600  ? 86.563  -29.181 103.502 1.00 189.21 ? 600  ASP C O     1 
ATOM   8241  C  CB    . ASP C 2 600  ? 84.295  -31.006 104.640 1.00 186.46 ? 600  ASP C CB    1 
ATOM   8242  C  CG    . ASP C 2 600  ? 83.142  -31.928 104.278 1.00 184.78 ? 600  ASP C CG    1 
ATOM   8243  O  OD1   . ASP C 2 600  ? 82.088  -31.864 104.949 1.00 180.40 ? 600  ASP C OD1   1 
ATOM   8244  O  OD2   . ASP C 2 600  ? 83.302  -32.737 103.339 1.00 184.67 ? 600  ASP C OD2   1 
ATOM   8245  N  N     . GLY C 2 601  ? 85.533  -27.926 105.037 1.00 171.51 ? 601  GLY C N     1 
ATOM   8246  C  CA    . GLY C 2 601  ? 86.709  -27.094 105.209 1.00 169.92 ? 601  GLY C CA    1 
ATOM   8247  C  C     . GLY C 2 601  ? 86.676  -26.148 106.386 1.00 161.65 ? 601  GLY C C     1 
ATOM   8248  O  O     . GLY C 2 601  ? 85.862  -26.293 107.294 1.00 162.05 ? 601  GLY C O     1 
ATOM   8249  N  N     . GLU C 2 602  ? 87.582  -25.178 106.368 1.00 156.90 ? 602  GLU C N     1 
ATOM   8250  C  CA    . GLU C 2 602  ? 87.660  -24.194 107.431 1.00 154.60 ? 602  GLU C CA    1 
ATOM   8251  C  C     . GLU C 2 602  ? 87.995  -22.811 106.884 1.00 156.82 ? 602  GLU C C     1 
ATOM   8252  O  O     . GLU C 2 602  ? 88.873  -22.664 106.040 1.00 158.45 ? 602  GLU C O     1 
ATOM   8253  C  CB    . GLU C 2 602  ? 88.701  -24.616 108.460 1.00 157.41 ? 602  GLU C CB    1 
ATOM   8254  C  CG    . GLU C 2 602  ? 88.482  -23.996 109.820 1.00 165.66 ? 602  GLU C CG    1 
ATOM   8255  C  CD    . GLU C 2 602  ? 89.700  -24.088 110.709 1.00 173.66 ? 602  GLU C CD    1 
ATOM   8256  O  OE1   . GLU C 2 602  ? 89.578  -24.590 111.845 1.00 177.20 ? 602  GLU C OE1   1 
ATOM   8257  O  OE2   . GLU C 2 602  ? 90.781  -23.643 110.271 1.00 182.73 ? 602  GLU C OE2   1 
ATOM   8258  N  N     . VAL C 2 603  ? 87.292  -21.796 107.375 1.00 157.20 ? 603  VAL C N     1 
ATOM   8259  C  CA    . VAL C 2 603  ? 87.485  -20.426 106.905 1.00 155.34 ? 603  VAL C CA    1 
ATOM   8260  C  C     . VAL C 2 603  ? 88.783  -19.807 107.456 1.00 153.69 ? 603  VAL C C     1 
ATOM   8261  O  O     . VAL C 2 603  ? 89.117  -19.971 108.626 1.00 155.55 ? 603  VAL C O     1 
ATOM   8262  C  CB    . VAL C 2 603  ? 86.255  -19.542 107.242 1.00 145.09 ? 603  VAL C CB    1 
ATOM   8263  C  CG1   . VAL C 2 603  ? 86.492  -18.116 106.803 1.00 148.26 ? 603  VAL C CG1   1 
ATOM   8264  C  CG2   . VAL C 2 603  ? 84.997  -20.101 106.585 1.00 135.22 ? 603  VAL C CG2   1 
ATOM   8265  N  N     . ALA C 2 604  ? 89.518  -19.109 106.599 1.00 150.09 ? 604  ALA C N     1 
ATOM   8266  C  CA    . ALA C 2 604  ? 90.775  -18.492 106.995 1.00 149.11 ? 604  ALA C CA    1 
ATOM   8267  C  C     . ALA C 2 604  ? 90.662  -16.970 107.053 1.00 150.32 ? 604  ALA C C     1 
ATOM   8268  O  O     . ALA C 2 604  ? 90.826  -16.366 108.108 1.00 153.04 ? 604  ALA C O     1 
ATOM   8269  C  CB    . ALA C 2 604  ? 91.880  -18.909 106.053 1.00 154.09 ? 604  ALA C CB    1 
ATOM   8270  N  N     . LYS C 2 605  ? 90.378  -16.353 105.914 1.00 147.24 ? 605  LYS C N     1 
ATOM   8271  C  CA    . LYS C 2 605  ? 90.276  -14.902 105.837 1.00 148.92 ? 605  LYS C CA    1 
ATOM   8272  C  C     . LYS C 2 605  ? 88.803  -14.440 105.789 1.00 150.20 ? 605  LYS C C     1 
ATOM   8273  O  O     . LYS C 2 605  ? 87.934  -15.184 105.342 1.00 147.24 ? 605  LYS C O     1 
ATOM   8274  C  CB    . LYS C 2 605  ? 91.060  -14.365 104.625 1.00 148.10 ? 605  LYS C CB    1 
ATOM   8275  C  CG    . LYS C 2 605  ? 92.602  -14.245 104.773 1.00 148.12 ? 605  LYS C CG    1 
ATOM   8276  C  CD    . LYS C 2 605  ? 93.245  -13.772 103.425 1.00 158.61 ? 605  LYS C CD    1 
ATOM   8277  C  CE    . LYS C 2 605  ? 94.648  -13.119 103.534 1.00 155.46 ? 605  LYS C CE    1 
ATOM   8278  N  NZ    . LYS C 2 605  ? 95.161  -12.596 102.209 1.00 129.52 ? 605  LYS C NZ    1 
ATOM   8279  N  N     . VAL C 2 606  ? 88.524  -13.241 106.307 1.00 151.16 ? 606  VAL C N     1 
ATOM   8280  C  CA    . VAL C 2 606  ? 87.208  -12.595 106.175 1.00 146.57 ? 606  VAL C CA    1 
ATOM   8281  C  C     . VAL C 2 606  ? 87.335  -11.109 105.808 1.00 149.98 ? 606  VAL C C     1 
ATOM   8282  O  O     . VAL C 2 606  ? 88.051  -10.349 106.471 1.00 150.45 ? 606  VAL C O     1 
ATOM   8283  C  CB    . VAL C 2 606  ? 86.317  -12.804 107.437 1.00 147.15 ? 606  VAL C CB    1 
ATOM   8284  C  CG1   . VAL C 2 606  ? 85.553  -11.538 107.820 1.00 139.28 ? 606  VAL C CG1   1 
ATOM   8285  C  CG2   . VAL C 2 606  ? 85.358  -13.943 107.200 1.00 147.40 ? 606  VAL C CG2   1 
ATOM   8286  N  N     . ASP C 2 607  ? 86.667  -10.728 104.718 1.00 145.04 ? 607  ASP C N     1 
ATOM   8287  C  CA    . ASP C 2 607  ? 86.680  -9.364  104.191 1.00 141.23 ? 607  ASP C CA    1 
ATOM   8288  C  C     . ASP C 2 607  ? 85.283  -9.052  103.705 1.00 137.22 ? 607  ASP C C     1 
ATOM   8289  O  O     . ASP C 2 607  ? 84.440  -9.941  103.612 1.00 137.27 ? 607  ASP C O     1 
ATOM   8290  C  CB    . ASP C 2 607  ? 87.610  -9.264  102.978 1.00 140.80 ? 607  ASP C CB    1 
ATOM   8291  C  CG    . ASP C 2 607  ? 88.649  -8.171  103.104 1.00 141.84 ? 607  ASP C CG    1 
ATOM   8292  O  OD1   . ASP C 2 607  ? 89.111  -7.925  104.237 1.00 145.72 ? 607  ASP C OD1   1 
ATOM   8293  O  OD2   . ASP C 2 607  ? 89.012  -7.572  102.062 1.00 135.59 ? 607  ASP C OD2   1 
ATOM   8294  N  N     . GLY C 2 608  ? 85.032  -7.790  103.391 1.00 137.58 ? 608  GLY C N     1 
ATOM   8295  C  CA    . GLY C 2 608  ? 83.905  -7.463  102.542 1.00 138.78 ? 608  GLY C CA    1 
ATOM   8296  C  C     . GLY C 2 608  ? 84.278  -7.790  101.101 1.00 138.16 ? 608  GLY C C     1 
ATOM   8297  O  O     . GLY C 2 608  ? 83.433  -8.167  100.292 1.00 136.47 ? 608  GLY C O     1 
ATOM   8298  N  N     . ASN C 2 609  ? 85.564  -7.644  100.789 1.00 137.64 ? 609  ASN C N     1 
ATOM   8299  C  CA    . ASN C 2 609  ? 86.090  -7.830  99.437  1.00 134.20 ? 609  ASN C CA    1 
ATOM   8300  C  C     . ASN C 2 609  ? 86.396  -9.267  98.995  1.00 132.09 ? 609  ASN C C     1 
ATOM   8301  O  O     . ASN C 2 609  ? 86.357  -9.573  97.803  1.00 130.36 ? 609  ASN C O     1 
ATOM   8302  C  CB    . ASN C 2 609  ? 87.318  -6.941  99.248  1.00 131.34 ? 609  ASN C CB    1 
ATOM   8303  C  CG    . ASN C 2 609  ? 86.952  -5.482  99.150  1.00 124.49 ? 609  ASN C CG    1 
ATOM   8304  O  OD1   . ASN C 2 609  ? 85.928  -5.137  98.569  1.00 121.37 ? 609  ASN C OD1   1 
ATOM   8305  N  ND2   . ASN C 2 609  ? 87.781  -4.618  99.711  1.00 125.71 ? 609  ASN C ND2   1 
ATOM   8306  N  N     . ARG C 2 610  ? 86.735  -10.129 99.950  1.00 130.98 ? 610  ARG C N     1 
ATOM   8307  C  CA    . ARG C 2 610  ? 87.081  -11.515 99.653  1.00 130.43 ? 610  ARG C CA    1 
ATOM   8308  C  C     . ARG C 2 610  ? 86.935  -12.404 100.865 1.00 132.22 ? 610  ARG C C     1 
ATOM   8309  O  O     . ARG C 2 610  ? 86.991  -11.939 101.991 1.00 135.84 ? 610  ARG C O     1 
ATOM   8310  C  CB    . ARG C 2 610  ? 88.529  -11.612 99.203  1.00 138.87 ? 610  ARG C CB    1 
ATOM   8311  C  CG    . ARG C 2 610  ? 89.523  -11.143 100.258 1.00 144.66 ? 610  ARG C CG    1 
ATOM   8312  C  CD    . ARG C 2 610  ? 90.173  -12.263 101.069 1.00 136.86 ? 610  ARG C CD    1 
ATOM   8313  N  NE    . ARG C 2 610  ? 91.210  -11.689 101.918 1.00 141.23 ? 610  ARG C NE    1 
ATOM   8314  C  CZ    . ARG C 2 610  ? 91.004  -11.242 103.153 1.00 145.22 ? 610  ARG C CZ    1 
ATOM   8315  N  NH1   . ARG C 2 610  ? 89.804  -11.342 103.698 1.00 146.45 ? 610  ARG C NH1   1 
ATOM   8316  N  NH2   . ARG C 2 610  ? 92.001  -10.714 103.855 1.00 148.15 ? 610  ARG C NH2   1 
ATOM   8317  N  N     . ILE C 2 611  ? 86.803  -13.702 100.627 1.00 135.79 ? 611  ILE C N     1 
ATOM   8318  C  CA    . ILE C 2 611  ? 86.738  -14.695 101.701 1.00 142.86 ? 611  ILE C CA    1 
ATOM   8319  C  C     . ILE C 2 611  ? 87.643  -15.855 101.317 1.00 146.30 ? 611  ILE C C     1 
ATOM   8320  O  O     . ILE C 2 611  ? 87.490  -16.406 100.229 1.00 149.74 ? 611  ILE C O     1 
ATOM   8321  C  CB    . ILE C 2 611  ? 85.308  -15.274 101.882 1.00 142.29 ? 611  ILE C CB    1 
ATOM   8322  C  CG1   . ILE C 2 611  ? 84.316  -14.203 102.345 1.00 141.00 ? 611  ILE C CG1   1 
ATOM   8323  C  CG2   . ILE C 2 611  ? 85.323  -16.428 102.866 1.00 142.07 ? 611  ILE C CG2   1 
ATOM   8324  C  CD1   . ILE C 2 611  ? 82.883  -14.684 102.359 1.00 129.23 ? 611  ILE C CD1   1 
ATOM   8325  N  N     . VAL C 2 612  ? 88.582  -16.231 102.184 1.00 148.95 ? 612  VAL C N     1 
ATOM   8326  C  CA    . VAL C 2 612  ? 89.500  -17.329 101.861 1.00 151.03 ? 612  VAL C CA    1 
ATOM   8327  C  C     . VAL C 2 612  ? 89.302  -18.556 102.753 1.00 156.88 ? 612  VAL C C     1 
ATOM   8328  O  O     . VAL C 2 612  ? 89.203  -18.433 103.979 1.00 156.44 ? 612  VAL C O     1 
ATOM   8329  C  CB    . VAL C 2 612  ? 90.969  -16.885 101.903 1.00 146.17 ? 612  VAL C CB    1 
ATOM   8330  C  CG1   . VAL C 2 612  ? 91.865  -18.029 101.477 1.00 147.77 ? 612  VAL C CG1   1 
ATOM   8331  C  CG2   . VAL C 2 612  ? 91.171  -15.691 100.997 1.00 144.28 ? 612  VAL C CG2   1 
ATOM   8332  N  N     . VAL C 2 613  ? 89.246  -19.732 102.120 1.00 161.00 ? 613  VAL C N     1 
ATOM   8333  C  CA    . VAL C 2 613  ? 88.937  -20.991 102.797 1.00 159.07 ? 613  VAL C CA    1 
ATOM   8334  C  C     . VAL C 2 613  ? 90.039  -22.018 102.605 1.00 164.68 ? 613  VAL C C     1 
ATOM   8335  O  O     . VAL C 2 613  ? 90.625  -22.117 101.526 1.00 166.94 ? 613  VAL C O     1 
ATOM   8336  C  CB    . VAL C 2 613  ? 87.645  -21.620 102.243 1.00 152.88 ? 613  VAL C CB    1 
ATOM   8337  C  CG1   . VAL C 2 613  ? 87.268  -22.848 103.049 1.00 159.94 ? 613  VAL C CG1   1 
ATOM   8338  C  CG2   . VAL C 2 613  ? 86.522  -20.618 102.256 1.00 150.50 ? 613  VAL C CG2   1 
ATOM   8339  N  N     . ARG C 2 614  ? 90.312  -22.786 103.655 1.00 168.72 ? 614  ARG C N     1 
ATOM   8340  C  CA    . ARG C 2 614  ? 91.224  -23.918 103.561 1.00 174.10 ? 614  ARG C CA    1 
ATOM   8341  C  C     . ARG C 2 614  ? 90.444  -25.230 103.637 1.00 172.20 ? 614  ARG C C     1 
ATOM   8342  O  O     . ARG C 2 614  ? 89.679  -25.462 104.573 1.00 171.63 ? 614  ARG C O     1 
ATOM   8343  C  CB    . ARG C 2 614  ? 92.268  -23.849 104.669 1.00 175.59 ? 614  ARG C CB    1 
ATOM   8344  C  CG    . ARG C 2 614  ? 93.358  -24.877 104.547 1.00 176.47 ? 614  ARG C CG    1 
ATOM   8345  C  CD    . ARG C 2 614  ? 94.405  -24.635 105.605 1.00 181.93 ? 614  ARG C CD    1 
ATOM   8346  N  NE    . ARG C 2 614  ? 94.967  -23.290 105.522 1.00 186.11 ? 614  ARG C NE    1 
ATOM   8347  C  CZ    . ARG C 2 614  ? 95.982  -22.952 104.731 1.00 191.60 ? 614  ARG C CZ    1 
ATOM   8348  N  NH1   . ARG C 2 614  ? 96.433  -21.705 104.728 1.00 196.22 ? 614  ARG C NH1   1 
ATOM   8349  N  NH2   . ARG C 2 614  ? 96.546  -23.859 103.942 1.00 187.73 ? 614  ARG C NH2   1 
ATOM   8350  N  N     . TYR C 2 615  ? 90.638  -26.082 102.640 1.00 175.82 ? 615  TYR C N     1 
ATOM   8351  C  CA    . TYR C 2 615  ? 89.879  -27.320 102.531 1.00 182.41 ? 615  TYR C CA    1 
ATOM   8352  C  C     . TYR C 2 615  ? 90.531  -28.518 103.216 1.00 193.83 ? 615  TYR C C     1 
ATOM   8353  O  O     . TYR C 2 615  ? 91.517  -28.378 103.954 1.00 190.26 ? 615  TYR C O     1 
ATOM   8354  C  CB    . TYR C 2 615  ? 89.633  -27.657 101.060 1.00 184.71 ? 615  TYR C CB    1 
ATOM   8355  C  CG    . TYR C 2 615  ? 88.549  -26.827 100.442 1.00 180.29 ? 615  TYR C CG    1 
ATOM   8356  C  CD1   . TYR C 2 615  ? 88.670  -26.337 99.153  1.00 180.09 ? 615  TYR C CD1   1 
ATOM   8357  C  CD2   . TYR C 2 615  ? 87.398  -26.537 101.152 1.00 179.91 ? 615  TYR C CD2   1 
ATOM   8358  C  CE1   . TYR C 2 615  ? 87.671  -25.571 98.589  1.00 179.82 ? 615  TYR C CE1   1 
ATOM   8359  C  CE2   . TYR C 2 615  ? 86.397  -25.778 100.602 1.00 178.81 ? 615  TYR C CE2   1 
ATOM   8360  C  CZ    . TYR C 2 615  ? 86.536  -25.297 99.322  1.00 178.19 ? 615  TYR C CZ    1 
ATOM   8361  O  OH    . TYR C 2 615  ? 85.529  -24.539 98.785  1.00 171.38 ? 615  TYR C OH    1 
ATOM   8362  N  N     . GLU C 2 616  ? 89.945  -29.691 102.961 1.00 198.23 ? 616  GLU C N     1 
ATOM   8363  C  CA    . GLU C 2 616  ? 90.474  -30.980 103.396 1.00 197.55 ? 616  GLU C CA    1 
ATOM   8364  C  C     . GLU C 2 616  ? 91.823  -31.185 102.744 1.00 198.91 ? 616  GLU C C     1 
ATOM   8365  O  O     . GLU C 2 616  ? 92.770  -31.698 103.358 1.00 196.17 ? 616  GLU C O     1 
ATOM   8366  C  CB    . GLU C 2 616  ? 89.539  -32.103 102.942 1.00 193.84 ? 616  GLU C CB    1 
ATOM   8367  C  CG    . GLU C 2 616  ? 88.140  -32.018 103.521 1.00 197.97 ? 616  GLU C CG    1 
ATOM   8368  C  CD    . GLU C 2 616  ? 88.120  -32.253 105.022 1.00 210.09 ? 616  GLU C CD    1 
ATOM   8369  O  OE1   . GLU C 2 616  ? 89.148  -32.703 105.571 1.00 220.00 ? 616  GLU C OE1   1 
ATOM   8370  O  OE2   . GLU C 2 616  ? 87.077  -31.991 105.658 1.00 207.67 ? 616  GLU C OE2   1 
ATOM   8371  N  N     . ASP C 2 617  ? 91.876  -30.771 101.479 1.00 203.43 ? 617  ASP C N     1 
ATOM   8372  C  CA    . ASP C 2 617  ? 93.058  -30.853 100.637 1.00 200.42 ? 617  ASP C CA    1 
ATOM   8373  C  C     . ASP C 2 617  ? 94.269  -30.182 101.292 1.00 195.41 ? 617  ASP C C     1 
ATOM   8374  O  O     . ASP C 2 617  ? 95.397  -30.644 101.150 1.00 193.91 ? 617  ASP C O     1 
ATOM   8375  C  CB    . ASP C 2 617  ? 92.773  -30.196 99.275  1.00 194.51 ? 617  ASP C CB    1 
ATOM   8376  C  CG    . ASP C 2 617  ? 91.286  -30.211 98.894  1.00 196.67 ? 617  ASP C CG    1 
ATOM   8377  O  OD1   . ASP C 2 617  ? 90.425  -30.558 99.735  1.00 199.56 ? 617  ASP C OD1   1 
ATOM   8378  O  OD2   . ASP C 2 617  ? 90.982  -29.850 97.738  1.00 194.26 ? 617  ASP C OD2   1 
ATOM   8379  N  N     . GLY C 2 618  ? 94.018  -29.102 102.024 1.00 192.29 ? 618  GLY C N     1 
ATOM   8380  C  CA    . GLY C 2 618  ? 95.077  -28.252 102.525 1.00 186.05 ? 618  GLY C CA    1 
ATOM   8381  C  C     . GLY C 2 618  ? 95.198  -27.035 101.625 1.00 182.28 ? 618  GLY C C     1 
ATOM   8382  O  O     . GLY C 2 618  ? 95.759  -26.012 102.021 1.00 181.60 ? 618  GLY C O     1 
ATOM   8383  N  N     . ARG C 2 619  ? 94.661  -27.144 100.410 1.00 178.85 ? 619  ARG C N     1 
ATOM   8384  C  CA    . ARG C 2 619  ? 94.722  -26.047 99.450  1.00 177.07 ? 619  ARG C CA    1 
ATOM   8385  C  C     . ARG C 2 619  ? 93.984  -24.817 99.966  1.00 173.15 ? 619  ARG C C     1 
ATOM   8386  O  O     . ARG C 2 619  ? 92.828  -24.892 100.374 1.00 174.57 ? 619  ARG C O     1 
ATOM   8387  C  CB    . ARG C 2 619  ? 94.178  -26.472 98.080  1.00 177.62 ? 619  ARG C CB    1 
ATOM   8388  C  CG    . ARG C 2 619  ? 92.744  -26.932 98.098  1.00 184.10 ? 619  ARG C CG    1 
ATOM   8389  C  CD    . ARG C 2 619  ? 92.169  -27.074 96.710  1.00 188.00 ? 619  ARG C CD    1 
ATOM   8390  N  NE    . ARG C 2 619  ? 90.781  -27.520 96.785  1.00 196.38 ? 619  ARG C NE    1 
ATOM   8391  C  CZ    . ARG C 2 619  ? 89.946  -27.570 95.754  1.00 196.13 ? 619  ARG C CZ    1 
ATOM   8392  N  NH1   . ARG C 2 619  ? 88.697  -27.992 95.933  1.00 191.02 ? 619  ARG C NH1   1 
ATOM   8393  N  NH2   . ARG C 2 619  ? 90.358  -27.196 94.548  1.00 189.84 ? 619  ARG C NH2   1 
ATOM   8394  N  N     . LEU C 2 620  ? 94.669  -23.684 99.961  1.00 168.85 ? 620  LEU C N     1 
ATOM   8395  C  CA    . LEU C 2 620  ? 94.060  -22.454 100.414 1.00 168.32 ? 620  LEU C CA    1 
ATOM   8396  C  C     . LEU C 2 620  ? 93.307  -21.875 99.219  1.00 168.68 ? 620  LEU C C     1 
ATOM   8397  O  O     . LEU C 2 620  ? 93.920  -21.468 98.229  1.00 170.30 ? 620  LEU C O     1 
ATOM   8398  C  CB    . LEU C 2 620  ? 95.153  -21.500 100.901 1.00 170.06 ? 620  LEU C CB    1 
ATOM   8399  C  CG    . LEU C 2 620  ? 94.741  -20.284 101.728 1.00 166.79 ? 620  LEU C CG    1 
ATOM   8400  C  CD1   . LEU C 2 620  ? 93.914  -20.716 102.927 1.00 165.44 ? 620  LEU C CD1   1 
ATOM   8401  C  CD2   . LEU C 2 620  ? 95.962  -19.475 102.164 1.00 158.37 ? 620  LEU C CD2   1 
ATOM   8402  N  N     . VAL C 2 621  ? 91.980  -21.814 99.331  1.00 165.74 ? 621  VAL C N     1 
ATOM   8403  C  CA    . VAL C 2 621  ? 91.107  -21.461 98.212  1.00 155.98 ? 621  VAL C CA    1 
ATOM   8404  C  C     . VAL C 2 621  ? 90.494  -20.075 98.389  1.00 148.69 ? 621  VAL C C     1 
ATOM   8405  O  O     . VAL C 2 621  ? 89.827  -19.815 99.383  1.00 147.84 ? 621  VAL C O     1 
ATOM   8406  C  CB    . VAL C 2 621  ? 89.968  -22.485 98.075  1.00 153.09 ? 621  VAL C CB    1 
ATOM   8407  C  CG1   . VAL C 2 621  ? 88.969  -22.019 97.052  1.00 153.02 ? 621  VAL C CG1   1 
ATOM   8408  C  CG2   . VAL C 2 621  ? 90.520  -23.849 97.709  1.00 163.09 ? 621  VAL C CG2   1 
ATOM   8409  N  N     . GLU C 2 622  ? 90.717  -19.181 97.432  1.00 144.18 ? 622  GLU C N     1 
ATOM   8410  C  CA    . GLU C 2 622  ? 90.167  -17.832 97.547  1.00 142.39 ? 622  GLU C CA    1 
ATOM   8411  C  C     . GLU C 2 622  ? 88.899  -17.614 96.723  1.00 142.19 ? 622  GLU C C     1 
ATOM   8412  O  O     . GLU C 2 622  ? 88.831  -17.981 95.550  1.00 141.70 ? 622  GLU C O     1 
ATOM   8413  C  CB    . GLU C 2 622  ? 91.215  -16.748 97.225  1.00 144.80 ? 622  GLU C CB    1 
ATOM   8414  C  CG    . GLU C 2 622  ? 90.601  -15.404 96.781  1.00 144.49 ? 622  GLU C CG    1 
ATOM   8415  C  CD    . GLU C 2 622  ? 91.355  -14.166 97.274  1.00 142.36 ? 622  GLU C CD    1 
ATOM   8416  O  OE1   . GLU C 2 622  ? 92.151  -14.289 98.227  1.00 148.55 ? 622  GLU C OE1   1 
ATOM   8417  O  OE2   . GLU C 2 622  ? 91.140  -13.066 96.707  1.00 134.31 ? 622  GLU C OE2   1 
ATOM   8418  N  N     . TYR C 2 623  ? 87.894  -17.026 97.367  1.00 142.27 ? 623  TYR C N     1 
ATOM   8419  C  CA    . TYR C 2 623  ? 86.681  -16.571 96.698  1.00 139.33 ? 623  TYR C CA    1 
ATOM   8420  C  C     . TYR C 2 623  ? 86.585  -15.053 96.791  1.00 134.71 ? 623  TYR C C     1 
ATOM   8421  O  O     . TYR C 2 623  ? 86.322  -14.533 97.870  1.00 132.45 ? 623  TYR C O     1 
ATOM   8422  C  CB    . TYR C 2 623  ? 85.449  -17.147 97.397  1.00 138.92 ? 623  TYR C CB    1 
ATOM   8423  C  CG    . TYR C 2 623  ? 85.382  -18.656 97.496  1.00 143.13 ? 623  TYR C CG    1 
ATOM   8424  C  CD1   . TYR C 2 623  ? 85.371  -19.452 96.357  1.00 153.45 ? 623  TYR C CD1   1 
ATOM   8425  C  CD2   . TYR C 2 623  ? 85.284  -19.283 98.729  1.00 143.52 ? 623  TYR C CD2   1 
ATOM   8426  C  CE1   . TYR C 2 623  ? 85.290  -20.833 96.450  1.00 158.14 ? 623  TYR C CE1   1 
ATOM   8427  C  CE2   . TYR C 2 623  ? 85.207  -20.660 98.829  1.00 147.61 ? 623  TYR C CE2   1 
ATOM   8428  C  CZ    . TYR C 2 623  ? 85.206  -21.428 97.689  1.00 154.81 ? 623  TYR C CZ    1 
ATOM   8429  O  OH    . TYR C 2 623  ? 85.127  -22.798 97.781  1.00 157.54 ? 623  TYR C OH    1 
ATOM   8430  N  N     . PRO C 2 624  ? 86.804  -14.324 95.680  1.00 135.84 ? 624  PRO C N     1 
ATOM   8431  C  CA    . PRO C 2 624  ? 86.527  -12.900 95.871  1.00 137.18 ? 624  PRO C CA    1 
ATOM   8432  C  C     . PRO C 2 624  ? 85.031  -12.635 95.862  1.00 138.41 ? 624  PRO C C     1 
ATOM   8433  O  O     . PRO C 2 624  ? 84.244  -13.424 95.323  1.00 128.29 ? 624  PRO C O     1 
ATOM   8434  C  CB    . PRO C 2 624  ? 87.213  -12.226 94.671  1.00 128.95 ? 624  PRO C CB    1 
ATOM   8435  C  CG    . PRO C 2 624  ? 88.242  -13.188 94.240  1.00 136.13 ? 624  PRO C CG    1 
ATOM   8436  C  CD    . PRO C 2 624  ? 87.626  -14.552 94.482  1.00 142.99 ? 624  PRO C CD    1 
ATOM   8437  N  N     . LEU C 2 625  ? 84.650  -11.528 96.486  1.00 140.93 ? 625  LEU C N     1 
ATOM   8438  C  CA    . LEU C 2 625  ? 83.266  -11.118 96.532  1.00 132.82 ? 625  LEU C CA    1 
ATOM   8439  C  C     . LEU C 2 625  ? 83.017  -9.970  95.559  1.00 139.67 ? 625  LEU C C     1 
ATOM   8440  O  O     . LEU C 2 625  ? 83.761  -8.973  95.524  1.00 135.37 ? 625  LEU C O     1 
ATOM   8441  C  CB    . LEU C 2 625  ? 82.873  -10.736 97.959  1.00 129.22 ? 625  LEU C CB    1 
ATOM   8442  C  CG    . LEU C 2 625  ? 82.737  -11.945 98.879  1.00 124.35 ? 625  LEU C CG    1 
ATOM   8443  C  CD1   . LEU C 2 625  ? 82.127  -11.575 100.220 1.00 125.13 ? 625  LEU C CD1   1 
ATOM   8444  C  CD2   . LEU C 2 625  ? 81.903  -12.991 98.185  1.00 123.78 ? 625  LEU C CD2   1 
ATOM   8445  N  N     . ARG C 2 626  ? 81.981  -10.152 94.743  1.00 142.67 ? 626  ARG C N     1 
ATOM   8446  C  CA    . ARG C 2 626  ? 81.475  -9.112  93.863  1.00 142.54 ? 626  ARG C CA    1 
ATOM   8447  C  C     . ARG C 2 626  ? 80.794  -8.080  94.752  1.00 141.79 ? 626  ARG C C     1 
ATOM   8448  O  O     . ARG C 2 626  ? 79.887  -8.413  95.523  1.00 139.41 ? 626  ARG C O     1 
ATOM   8449  C  CB    . ARG C 2 626  ? 80.500  -9.730  92.848  1.00 142.43 ? 626  ARG C CB    1 
ATOM   8450  C  CG    . ARG C 2 626  ? 79.150  -9.036  92.712  1.00 146.85 ? 626  ARG C CG    1 
ATOM   8451  C  CD    . ARG C 2 626  ? 78.274  -9.686  91.649  1.00 149.34 ? 626  ARG C CD    1 
ATOM   8452  N  NE    . ARG C 2 626  ? 78.957  -9.728  90.359  1.00 156.70 ? 626  ARG C NE    1 
ATOM   8453  C  CZ    . ARG C 2 626  ? 79.262  -10.851 89.720  1.00 156.01 ? 626  ARG C CZ    1 
ATOM   8454  N  NH1   . ARG C 2 626  ? 79.892  -10.817 88.547  1.00 151.92 ? 626  ARG C NH1   1 
ATOM   8455  N  NH2   . ARG C 2 626  ? 78.924  -12.012 90.260  1.00 155.96 ? 626  ARG C NH2   1 
ATOM   8456  N  N     . ARG C 2 627  ? 81.243  -6.832  94.674  1.00 141.19 ? 627  ARG C N     1 
ATOM   8457  C  CA    . ARG C 2 627  ? 80.706  -5.795  95.556  1.00 141.79 ? 627  ARG C CA    1 
ATOM   8458  C  C     . ARG C 2 627  ? 80.079  -4.621  94.814  1.00 144.99 ? 627  ARG C C     1 
ATOM   8459  O  O     . ARG C 2 627  ? 80.773  -3.895  94.108  1.00 146.48 ? 627  ARG C O     1 
ATOM   8460  C  CB    . ARG C 2 627  ? 81.789  -5.263  96.492  1.00 138.57 ? 627  ARG C CB    1 
ATOM   8461  C  CG    . ARG C 2 627  ? 81.857  -5.970  97.828  1.00 138.49 ? 627  ARG C CG    1 
ATOM   8462  C  CD    . ARG C 2 627  ? 80.486  -6.152  98.468  1.00 132.14 ? 627  ARG C CD    1 
ATOM   8463  N  NE    . ARG C 2 627  ? 80.632  -6.620  99.842  1.00 131.34 ? 627  ARG C NE    1 
ATOM   8464  C  CZ    . ARG C 2 627  ? 79.661  -6.612  100.748 1.00 133.81 ? 627  ARG C CZ    1 
ATOM   8465  N  NH1   . ARG C 2 627  ? 78.461  -6.160  100.423 1.00 135.65 ? 627  ARG C NH1   1 
ATOM   8466  N  NH2   . ARG C 2 627  ? 79.895  -7.044  101.982 1.00 131.61 ? 627  ARG C NH2   1 
ATOM   8467  N  N     . PHE C 2 628  ? 78.769  -4.443  94.989  1.00 141.45 ? 628  PHE C N     1 
ATOM   8468  C  CA    . PHE C 2 628  ? 78.055  -3.241  94.548  1.00 134.95 ? 628  PHE C CA    1 
ATOM   8469  C  C     . PHE C 2 628  ? 78.008  -3.060  93.021  1.00 133.18 ? 628  PHE C C     1 
ATOM   8470  O  O     . PHE C 2 628  ? 78.033  -1.932  92.542  1.00 131.54 ? 628  PHE C O     1 
ATOM   8471  C  CB    . PHE C 2 628  ? 78.666  -1.985  95.201  1.00 132.93 ? 628  PHE C CB    1 
ATOM   8472  C  CG    . PHE C 2 628  ? 78.577  -1.956  96.716  1.00 133.84 ? 628  PHE C CG    1 
ATOM   8473  C  CD1   . PHE C 2 628  ? 78.242  -0.781  97.368  1.00 132.23 ? 628  PHE C CD1   1 
ATOM   8474  C  CD2   . PHE C 2 628  ? 78.839  -3.089  97.487  1.00 133.33 ? 628  PHE C CD2   1 
ATOM   8475  C  CE1   . PHE C 2 628  ? 78.164  -0.737  98.749  1.00 134.14 ? 628  PHE C CE1   1 
ATOM   8476  C  CE2   . PHE C 2 628  ? 78.760  -3.053  98.864  1.00 133.69 ? 628  PHE C CE2   1 
ATOM   8477  C  CZ    . PHE C 2 628  ? 78.424  -1.875  99.498  1.00 135.14 ? 628  PHE C CZ    1 
ATOM   8478  N  N     . TYR C 2 629  ? 77.927  -4.168  92.275  1.00 141.84 ? 629  TYR C N     1 
ATOM   8479  C  CA    . TYR C 2 629  ? 77.931  -4.185  90.791  1.00 145.48 ? 629  TYR C CA    1 
ATOM   8480  C  C     . TYR C 2 629  ? 76.541  -3.886  90.165  1.00 141.38 ? 629  TYR C C     1 
ATOM   8481  O  O     . TYR C 2 629  ? 75.523  -4.422  90.622  1.00 137.04 ? 629  TYR C O     1 
ATOM   8482  C  CB    . TYR C 2 629  ? 78.434  -5.554  90.261  1.00 148.70 ? 629  TYR C CB    1 
ATOM   8483  C  CG    . TYR C 2 629  ? 79.954  -5.814  90.185  1.00 151.94 ? 629  TYR C CG    1 
ATOM   8484  C  CD1   . TYR C 2 629  ? 80.475  -6.618  89.174  1.00 157.28 ? 629  TYR C CD1   1 
ATOM   8485  C  CD2   . TYR C 2 629  ? 80.849  -5.302  91.127  1.00 149.00 ? 629  TYR C CD2   1 
ATOM   8486  C  CE1   . TYR C 2 629  ? 81.843  -6.884  89.077  1.00 163.87 ? 629  TYR C CE1   1 
ATOM   8487  C  CE2   . TYR C 2 629  ? 82.232  -5.566  91.037  1.00 155.77 ? 629  TYR C CE2   1 
ATOM   8488  C  CZ    . TYR C 2 629  ? 82.720  -6.359  90.006  1.00 161.75 ? 629  TYR C CZ    1 
ATOM   8489  O  OH    . TYR C 2 629  ? 84.074  -6.634  89.889  1.00 154.12 ? 629  TYR C OH    1 
ATOM   8490  N  N     . ARG C 2 630  ? 76.505  -3.053  89.116  1.00 137.04 ? 630  ARG C N     1 
ATOM   8491  C  CA    . ARG C 2 630  ? 75.247  -2.657  88.457  1.00 124.56 ? 630  ARG C CA    1 
ATOM   8492  C  C     . ARG C 2 630  ? 74.717  -3.748  87.543  1.00 127.26 ? 630  ARG C C     1 
ATOM   8493  O  O     . ARG C 2 630  ? 75.485  -4.388  86.824  1.00 132.55 ? 630  ARG C O     1 
ATOM   8494  C  CB    . ARG C 2 630  ? 75.416  -1.364  87.648  1.00 118.90 ? 630  ARG C CB    1 
ATOM   8495  C  CG    . ARG C 2 630  ? 74.245  -1.065  86.724  1.00 114.49 ? 630  ARG C CG    1 
ATOM   8496  C  CD    . ARG C 2 630  ? 74.395  0.245   85.988  1.00 116.44 ? 630  ARG C CD    1 
ATOM   8497  N  NE    . ARG C 2 630  ? 73.109  0.681   85.456  1.00 119.59 ? 630  ARG C NE    1 
ATOM   8498  C  CZ    . ARG C 2 630  ? 72.692  0.439   84.219  1.00 120.54 ? 630  ARG C CZ    1 
ATOM   8499  N  NH1   . ARG C 2 630  ? 73.467  -0.231  83.377  1.00 113.36 ? 630  ARG C NH1   1 
ATOM   8500  N  NH2   . ARG C 2 630  ? 71.503  0.873   83.823  1.00 124.81 ? 630  ARG C NH2   1 
ATOM   8501  N  N     . SER C 2 631  ? 73.402  -3.947  87.555  1.00 126.00 ? 631  SER C N     1 
ATOM   8502  C  CA    . SER C 2 631  ? 72.789  -4.959  86.705  1.00 124.89 ? 631  SER C CA    1 
ATOM   8503  C  C     . SER C 2 631  ? 71.984  -4.281  85.627  1.00 122.18 ? 631  SER C C     1 
ATOM   8504  O  O     . SER C 2 631  ? 71.848  -3.061  85.609  1.00 123.85 ? 631  SER C O     1 
ATOM   8505  C  CB    . SER C 2 631  ? 71.848  -5.850  87.504  1.00 125.72 ? 631  SER C CB    1 
ATOM   8506  O  OG    . SER C 2 631  ? 70.530  -5.329  87.450  1.00 126.78 ? 631  SER C OG    1 
ATOM   8507  N  N     . ASN C 2 632  ? 71.409  -5.092  84.755  1.00 122.14 ? 632  ASN C N     1 
ATOM   8508  C  CA    . ASN C 2 632  ? 70.786  -4.592  83.540  1.00 126.20 ? 632  ASN C CA    1 
ATOM   8509  C  C     . ASN C 2 632  ? 69.720  -3.514  83.773  1.00 121.74 ? 632  ASN C C     1 
ATOM   8510  O  O     . ASN C 2 632  ? 69.535  -2.594  82.964  1.00 119.90 ? 632  ASN C O     1 
ATOM   8511  C  CB    . ASN C 2 632  ? 70.239  -5.770  82.735  1.00 125.31 ? 632  ASN C CB    1 
ATOM   8512  C  CG    . ASN C 2 632  ? 71.343  -6.631  82.148  1.00 123.58 ? 632  ASN C CG    1 
ATOM   8513  O  OD1   . ASN C 2 632  ? 72.312  -6.976  82.831  1.00 124.01 ? 632  ASN C OD1   1 
ATOM   8514  N  ND2   . ASN C 2 632  ? 71.214  -6.964  80.870  1.00 122.50 ? 632  ASN C ND2   1 
ATOM   8515  N  N     . GLN C 2 633  ? 69.030  -3.625  84.895  1.00 118.65 ? 633  GLN C N     1 
ATOM   8516  C  CA    . GLN C 2 633  ? 67.983  -2.678  85.213  1.00 123.55 ? 633  GLN C CA    1 
ATOM   8517  C  C     . GLN C 2 633  ? 68.504  -1.587  86.172  1.00 124.52 ? 633  GLN C C     1 
ATOM   8518  O  O     . GLN C 2 633  ? 67.804  -0.621  86.508  1.00 128.27 ? 633  GLN C O     1 
ATOM   8519  C  CB    . GLN C 2 633  ? 66.780  -3.435  85.788  1.00 120.96 ? 633  GLN C CB    1 
ATOM   8520  C  CG    . GLN C 2 633  ? 66.790  -4.941  85.512  1.00 115.31 ? 633  GLN C CG    1 
ATOM   8521  C  CD    . GLN C 2 633  ? 66.727  -5.290  84.038  1.00 116.44 ? 633  GLN C CD    1 
ATOM   8522  O  OE1   . GLN C 2 633  ? 67.322  -6.275  83.594  1.00 112.68 ? 633  GLN C OE1   1 
ATOM   8523  N  NE2   . GLN C 2 633  ? 65.998  -4.489  83.273  1.00 120.52 ? 633  GLN C NE2   1 
ATOM   8524  N  N     . GLY C 2 634  ? 69.752  -1.735  86.592  1.00 117.74 ? 634  GLY C N     1 
ATOM   8525  C  CA    . GLY C 2 634  ? 70.348  -0.769  87.483  1.00 116.07 ? 634  GLY C CA    1 
ATOM   8526  C  C     . GLY C 2 634  ? 70.141  -1.117  88.941  1.00 118.37 ? 634  GLY C C     1 
ATOM   8527  O  O     . GLY C 2 634  ? 70.409  -0.295  89.803  1.00 122.53 ? 634  GLY C O     1 
ATOM   8528  N  N     . THR C 2 635  ? 69.647  -2.317  89.231  1.00 116.35 ? 635  THR C N     1 
ATOM   8529  C  CA    . THR C 2 635  ? 69.593  -2.772  90.620  1.00 118.58 ? 635  THR C CA    1 
ATOM   8530  C  C     . THR C 2 635  ? 70.961  -3.283  91.016  1.00 128.46 ? 635  THR C C     1 
ATOM   8531  O  O     . THR C 2 635  ? 71.730  -3.729  90.168  1.00 129.91 ? 635  THR C O     1 
ATOM   8532  C  CB    . THR C 2 635  ? 68.557  -3.883  90.860  1.00 115.44 ? 635  THR C CB    1 
ATOM   8533  O  OG1   . THR C 2 635  ? 69.127  -5.167  90.573  1.00 116.96 ? 635  THR C OG1   1 
ATOM   8534  C  CG2   . THR C 2 635  ? 67.370  -3.675  89.990  1.00 119.49 ? 635  THR C CG2   1 
ATOM   8535  N  N     . ALA C 2 636  ? 71.255  -3.239  92.311  1.00 132.43 ? 636  ALA C N     1 
ATOM   8536  C  CA    . ALA C 2 636  ? 72.608  -3.497  92.801  1.00 128.31 ? 636  ALA C CA    1 
ATOM   8537  C  C     . ALA C 2 636  ? 72.878  -4.931  93.241  1.00 129.63 ? 636  ALA C C     1 
ATOM   8538  O  O     . ALA C 2 636  ? 72.258  -5.438  94.180  1.00 129.51 ? 636  ALA C O     1 
ATOM   8539  C  CB    . ALA C 2 636  ? 72.940  -2.541  93.927  1.00 129.21 ? 636  ALA C CB    1 
ATOM   8540  N  N     . LEU C 2 637  ? 73.828  -5.569  92.568  1.00 133.35 ? 637  LEU C N     1 
ATOM   8541  C  CA    . LEU C 2 637  ? 74.307  -6.877  92.991  1.00 140.88 ? 637  LEU C CA    1 
ATOM   8542  C  C     . LEU C 2 637  ? 75.508  -6.701  93.919  1.00 139.38 ? 637  LEU C C     1 
ATOM   8543  O  O     . LEU C 2 637  ? 76.526  -6.169  93.507  1.00 142.07 ? 637  LEU C O     1 
ATOM   8544  C  CB    . LEU C 2 637  ? 74.711  -7.731  91.779  1.00 134.77 ? 637  LEU C CB    1 
ATOM   8545  C  CG    . LEU C 2 637  ? 73.718  -7.874  90.621  1.00 134.25 ? 637  LEU C CG    1 
ATOM   8546  C  CD1   . LEU C 2 637  ? 74.101  -9.074  89.762  1.00 131.11 ? 637  LEU C CD1   1 
ATOM   8547  C  CD2   . LEU C 2 637  ? 72.260  -7.971  91.111  1.00 136.65 ? 637  LEU C CD2   1 
ATOM   8548  N  N     . ASP C 2 638  ? 75.386  -7.115  95.176  1.00 136.84 ? 638  ASP C N     1 
ATOM   8549  C  CA    . ASP C 2 638  ? 76.557  -7.239  96.040  1.00 133.20 ? 638  ASP C CA    1 
ATOM   8550  C  C     . ASP C 2 638  ? 76.412  -8.485  96.901  1.00 140.93 ? 638  ASP C C     1 
ATOM   8551  O  O     . ASP C 2 638  ? 75.335  -8.777  97.421  1.00 142.69 ? 638  ASP C O     1 
ATOM   8552  C  CB    . ASP C 2 638  ? 76.788  -5.990  96.903  1.00 133.35 ? 638  ASP C CB    1 
ATOM   8553  C  CG    . ASP C 2 638  ? 75.898  -5.947  98.142  1.00 143.43 ? 638  ASP C CG    1 
ATOM   8554  O  OD1   . ASP C 2 638  ? 74.657  -6.063  98.013  1.00 146.27 ? 638  ASP C OD1   1 
ATOM   8555  O  OD2   . ASP C 2 638  ? 76.446  -5.795  99.256  1.00 139.67 ? 638  ASP C OD2   1 
ATOM   8556  N  N     . GLN C 2 639  ? 77.488  -9.246  97.022  1.00 141.21 ? 639  GLN C N     1 
ATOM   8557  C  CA    . GLN C 2 639  ? 77.469  -10.405 97.888  1.00 135.43 ? 639  GLN C CA    1 
ATOM   8558  C  C     . GLN C 2 639  ? 78.117  -10.033 99.196  1.00 130.63 ? 639  GLN C C     1 
ATOM   8559  O  O     . GLN C 2 639  ? 79.185  -9.427  99.226  1.00 129.00 ? 639  GLN C O     1 
ATOM   8560  C  CB    . GLN C 2 639  ? 78.194  -11.567 97.237  1.00 132.66 ? 639  GLN C CB    1 
ATOM   8561  C  CG    . GLN C 2 639  ? 77.482  -12.113 96.029  1.00 132.78 ? 639  GLN C CG    1 
ATOM   8562  C  CD    . GLN C 2 639  ? 78.388  -12.987 95.209  1.00 135.42 ? 639  GLN C CD    1 
ATOM   8563  O  OE1   . GLN C 2 639  ? 79.509  -12.594 94.883  1.00 135.90 ? 639  GLN C OE1   1 
ATOM   8564  N  NE2   . GLN C 2 639  ? 77.924  -14.190 94.886  1.00 134.23 ? 639  GLN C NE2   1 
ATOM   8565  N  N     . ARG C 2 640  ? 77.490  -10.439 100.285 1.00 129.08 ? 640  ARG C N     1 
ATOM   8566  C  CA    . ARG C 2 640  ? 77.874  -9.921  101.570 1.00 133.09 ? 640  ARG C CA    1 
ATOM   8567  C  C     . ARG C 2 640  ? 78.503  -11.151 102.213 1.00 132.19 ? 640  ARG C C     1 
ATOM   8568  O  O     . ARG C 2 640  ? 78.056  -12.256 101.946 1.00 131.49 ? 640  ARG C O     1 
ATOM   8569  C  CB    . ARG C 2 640  ? 76.601  -9.456  102.316 1.00 131.79 ? 640  ARG C CB    1 
ATOM   8570  C  CG    . ARG C 2 640  ? 75.689  -8.447  101.538 1.00 122.12 ? 640  ARG C CG    1 
ATOM   8571  C  CD    . ARG C 2 640  ? 74.826  -7.593  102.497 1.00 125.74 ? 640  ARG C CD    1 
ATOM   8572  N  NE    . ARG C 2 640  ? 74.703  -6.164  102.141 1.00 128.22 ? 640  ARG C NE    1 
ATOM   8573  C  CZ    . ARG C 2 640  ? 74.248  -5.221  102.977 1.00 115.69 ? 640  ARG C CZ    1 
ATOM   8574  N  NH1   . ARG C 2 640  ? 73.887  -5.559  104.204 1.00 111.97 ? 640  ARG C NH1   1 
ATOM   8575  N  NH2   . ARG C 2 640  ? 74.152  -3.946  102.611 1.00 98.02  ? 640  ARG C NH2   1 
ATOM   8576  N  N     . PRO C 2 641  ? 79.594  -10.988 102.991 1.00 133.98 ? 641  PRO C N     1 
ATOM   8577  C  CA    . PRO C 2 641  ? 80.130  -12.192 103.643 1.00 133.18 ? 641  PRO C CA    1 
ATOM   8578  C  C     . PRO C 2 641  ? 79.216  -12.687 104.772 1.00 135.65 ? 641  PRO C C     1 
ATOM   8579  O  O     . PRO C 2 641  ? 78.865  -11.879 105.636 1.00 136.85 ? 641  PRO C O     1 
ATOM   8580  C  CB    . PRO C 2 641  ? 81.477  -11.714 104.203 1.00 130.01 ? 641  PRO C CB    1 
ATOM   8581  C  CG    . PRO C 2 641  ? 81.335  -10.241 104.344 1.00 131.20 ? 641  PRO C CG    1 
ATOM   8582  C  CD    . PRO C 2 641  ? 80.446  -9.808  103.222 1.00 133.45 ? 641  PRO C CD    1 
ATOM   8583  N  N     . ARG C 2 642  ? 78.833  -13.967 104.770 1.00 134.54 ? 642  ARG C N     1 
ATOM   8584  C  CA    . ARG C 2 642  ? 78.009  -14.522 105.862 1.00 133.32 ? 642  ARG C CA    1 
ATOM   8585  C  C     . ARG C 2 642  ? 78.695  -15.401 106.932 1.00 129.43 ? 642  ARG C C     1 
ATOM   8586  O  O     . ARG C 2 642  ? 78.027  -15.883 107.844 1.00 126.17 ? 642  ARG C O     1 
ATOM   8587  C  CB    . ARG C 2 642  ? 76.705  -15.157 105.343 1.00 134.31 ? 642  ARG C CB    1 
ATOM   8588  C  CG    . ARG C 2 642  ? 75.652  -14.155 104.791 1.00 134.65 ? 642  ARG C CG    1 
ATOM   8589  C  CD    . ARG C 2 642  ? 75.249  -13.048 105.788 1.00 138.13 ? 642  ARG C CD    1 
ATOM   8590  N  NE    . ARG C 2 642  ? 74.192  -12.163 105.278 1.00 140.57 ? 642  ARG C NE    1 
ATOM   8591  C  CZ    . ARG C 2 642  ? 74.280  -10.833 105.202 1.00 142.00 ? 642  ARG C CZ    1 
ATOM   8592  N  NH1   . ARG C 2 642  ? 75.380  -10.206 105.607 1.00 135.83 ? 642  ARG C NH1   1 
ATOM   8593  N  NH2   . ARG C 2 642  ? 73.264  -10.124 104.719 1.00 140.69 ? 642  ARG C NH2   1 
ATOM   8594  N  N     . VAL C 2 643  ? 80.010  -15.595 106.827 1.00 131.94 ? 643  VAL C N     1 
ATOM   8595  C  CA    . VAL C 2 643  ? 80.778  -16.416 107.782 1.00 137.90 ? 643  VAL C CA    1 
ATOM   8596  C  C     . VAL C 2 643  ? 81.883  -15.593 108.466 1.00 141.63 ? 643  VAL C C     1 
ATOM   8597  O  O     . VAL C 2 643  ? 82.191  -14.497 108.010 1.00 146.04 ? 643  VAL C O     1 
ATOM   8598  C  CB    . VAL C 2 643  ? 81.448  -17.640 107.099 1.00 141.02 ? 643  VAL C CB    1 
ATOM   8599  C  CG1   . VAL C 2 643  ? 80.419  -18.697 106.728 1.00 140.58 ? 643  VAL C CG1   1 
ATOM   8600  C  CG2   . VAL C 2 643  ? 82.245  -17.213 105.880 1.00 142.12 ? 643  VAL C CG2   1 
ATOM   8601  N  N     . VAL C 2 644  ? 82.476  -16.097 109.554 1.00 141.45 ? 644  VAL C N     1 
ATOM   8602  C  CA    . VAL C 2 644  ? 83.552  -15.347 110.236 1.00 151.20 ? 644  VAL C CA    1 
ATOM   8603  C  C     . VAL C 2 644  ? 84.882  -16.101 110.312 1.00 152.66 ? 644  VAL C C     1 
ATOM   8604  O  O     . VAL C 2 644  ? 84.931  -17.318 110.115 1.00 148.16 ? 644  VAL C O     1 
ATOM   8605  C  CB    . VAL C 2 644  ? 83.165  -14.858 111.668 1.00 158.89 ? 644  VAL C CB    1 
ATOM   8606  C  CG1   . VAL C 2 644  ? 83.470  -15.932 112.715 1.00 156.81 ? 644  VAL C CG1   1 
ATOM   8607  C  CG2   . VAL C 2 644  ? 83.897  -13.537 112.021 1.00 156.74 ? 644  VAL C CG2   1 
ATOM   8608  N  N     . VAL C 2 645  ? 85.946  -15.353 110.612 1.00 157.93 ? 645  VAL C N     1 
ATOM   8609  C  CA    . VAL C 2 645  ? 87.315  -15.850 110.602 1.00 156.38 ? 645  VAL C CA    1 
ATOM   8610  C  C     . VAL C 2 645  ? 87.391  -17.119 111.448 1.00 150.59 ? 645  VAL C C     1 
ATOM   8611  O  O     . VAL C 2 645  ? 86.999  -17.124 112.610 1.00 152.56 ? 645  VAL C O     1 
ATOM   8612  C  CB    . VAL C 2 645  ? 88.268  -14.770 111.187 1.00 158.21 ? 645  VAL C CB    1 
ATOM   8613  C  CG1   . VAL C 2 645  ? 89.633  -14.821 110.518 1.00 145.89 ? 645  VAL C CG1   1 
ATOM   8614  C  CG2   . VAL C 2 645  ? 87.634  -13.359 111.059 1.00 154.08 ? 645  VAL C CG2   1 
ATOM   8615  N  N     . GLY C 2 646  ? 87.868  -18.202 110.847 1.00 146.94 ? 646  GLY C N     1 
ATOM   8616  C  CA    . GLY C 2 646  ? 87.994  -19.470 111.546 1.00 148.70 ? 646  GLY C CA    1 
ATOM   8617  C  C     . GLY C 2 646  ? 86.733  -20.298 111.758 1.00 148.04 ? 646  GLY C C     1 
ATOM   8618  O  O     . GLY C 2 646  ? 86.686  -21.137 112.653 1.00 149.33 ? 646  GLY C O     1 
ATOM   8619  N  N     . GLN C 2 647  ? 85.712  -20.085 110.938 1.00 147.55 ? 647  GLN C N     1 
ATOM   8620  C  CA    . GLN C 2 647  ? 84.486  -20.871 111.050 1.00 147.01 ? 647  GLN C CA    1 
ATOM   8621  C  C     . GLN C 2 647  ? 84.505  -22.136 110.184 1.00 152.75 ? 647  GLN C C     1 
ATOM   8622  O  O     . GLN C 2 647  ? 84.777  -22.064 108.986 1.00 155.60 ? 647  GLN C O     1 
ATOM   8623  C  CB    . GLN C 2 647  ? 83.278  -20.013 110.675 1.00 148.30 ? 647  GLN C CB    1 
ATOM   8624  C  CG    . GLN C 2 647  ? 82.038  -20.824 110.318 1.00 150.46 ? 647  GLN C CG    1 
ATOM   8625  C  CD    . GLN C 2 647  ? 80.844  -19.956 109.985 1.00 141.68 ? 647  GLN C CD    1 
ATOM   8626  O  OE1   . GLN C 2 647  ? 80.909  -18.733 110.092 1.00 138.53 ? 647  GLN C OE1   1 
ATOM   8627  N  NE2   . GLN C 2 647  ? 79.744  -20.585 109.578 1.00 138.90 ? 647  GLN C NE2   1 
ATOM   8628  N  N     . ARG C 2 648  ? 84.201  -23.286 110.785 1.00 154.72 ? 648  ARG C N     1 
ATOM   8629  C  CA    . ARG C 2 648  ? 84.182  -24.559 110.056 1.00 160.71 ? 648  ARG C CA    1 
ATOM   8630  C  C     . ARG C 2 648  ? 82.919  -24.758 109.214 1.00 160.16 ? 648  ARG C C     1 
ATOM   8631  O  O     . ARG C 2 648  ? 81.804  -24.582 109.703 1.00 158.60 ? 648  ARG C O     1 
ATOM   8632  C  CB    . ARG C 2 648  ? 84.350  -25.743 111.013 1.00 168.98 ? 648  ARG C CB    1 
ATOM   8633  C  CG    . ARG C 2 648  ? 85.780  -26.033 111.442 1.00 170.10 ? 648  ARG C CG    1 
ATOM   8634  C  CD    . ARG C 2 648  ? 85.889  -27.454 111.965 1.00 178.89 ? 648  ARG C CD    1 
ATOM   8635  N  NE    . ARG C 2 648  ? 87.141  -27.699 112.674 1.00 188.11 ? 648  ARG C NE    1 
ATOM   8636  C  CZ    . ARG C 2 648  ? 88.246  -28.165 112.103 1.00 190.29 ? 648  ARG C CZ    1 
ATOM   8637  N  NH1   . ARG C 2 648  ? 88.261  -28.434 110.804 1.00 182.52 ? 648  ARG C NH1   1 
ATOM   8638  N  NH2   . ARG C 2 648  ? 89.338  -28.361 112.832 1.00 196.58 ? 648  ARG C NH2   1 
ATOM   8639  N  N     . VAL C 2 649  ? 83.104  -25.142 107.952 1.00 161.76 ? 649  VAL C N     1 
ATOM   8640  C  CA    . VAL C 2 649  ? 81.989  -25.353 107.029 1.00 165.06 ? 649  VAL C CA    1 
ATOM   8641  C  C     . VAL C 2 649  ? 82.089  -26.687 106.277 1.00 169.26 ? 649  VAL C C     1 
ATOM   8642  O  O     . VAL C 2 649  ? 83.134  -27.010 105.716 1.00 172.24 ? 649  VAL C O     1 
ATOM   8643  C  CB    . VAL C 2 649  ? 81.874  -24.191 106.006 1.00 166.14 ? 649  VAL C CB    1 
ATOM   8644  C  CG1   . VAL C 2 649  ? 81.333  -22.935 106.670 1.00 165.30 ? 649  VAL C CG1   1 
ATOM   8645  C  CG2   . VAL C 2 649  ? 83.216  -23.899 105.365 1.00 162.85 ? 649  VAL C CG2   1 
ATOM   8646  N  N     . ARG C 2 650  ? 81.008  -27.470 106.302 1.00 175.98 ? 650  ARG C N     1 
ATOM   8647  C  CA    . ARG C 2 650  ? 80.876  -28.693 105.490 1.00 182.17 ? 650  ARG C CA    1 
ATOM   8648  C  C     . ARG C 2 650  ? 80.586  -28.314 104.036 1.00 178.54 ? 650  ARG C C     1 
ATOM   8649  O  O     . ARG C 2 650  ? 80.229  -27.169 103.773 1.00 177.99 ? 650  ARG C O     1 
ATOM   8650  C  CB    . ARG C 2 650  ? 79.763  -29.606 106.031 1.00 187.14 ? 650  ARG C CB    1 
ATOM   8651  C  CG    . ARG C 2 650  ? 80.051  -30.274 107.383 1.00 196.11 ? 650  ARG C CG    1 
ATOM   8652  C  CD    . ARG C 2 650  ? 78.762  -30.714 108.098 1.00 205.86 ? 650  ARG C CD    1 
ATOM   8653  N  NE    . ARG C 2 650  ? 78.024  -29.577 108.656 1.00 215.82 ? 650  ARG C NE    1 
ATOM   8654  C  CZ    . ARG C 2 650  ? 77.057  -28.910 108.022 1.00 213.74 ? 650  ARG C CZ    1 
ATOM   8655  N  NH1   . ARG C 2 650  ? 76.692  -29.266 106.796 1.00 212.55 ? 650  ARG C NH1   1 
ATOM   8656  N  NH2   . ARG C 2 650  ? 76.451  -27.883 108.611 1.00 207.73 ? 650  ARG C NH2   1 
ATOM   8657  N  N     . LYS C 2 651  ? 80.768  -29.241 103.092 1.00 177.12 ? 651  LYS C N     1 
ATOM   8658  C  CA    . LYS C 2 651  ? 80.420  -28.974 101.687 1.00 171.95 ? 651  LYS C CA    1 
ATOM   8659  C  C     . LYS C 2 651  ? 78.953  -28.571 101.545 1.00 170.13 ? 651  LYS C C     1 
ATOM   8660  O  O     . LYS C 2 651  ? 78.058  -29.288 101.992 1.00 174.15 ? 651  LYS C O     1 
ATOM   8661  C  CB    . LYS C 2 651  ? 80.724  -30.188 100.794 1.00 173.87 ? 651  LYS C CB    1 
ATOM   8662  C  CG    . LYS C 2 651  ? 79.979  -30.212 99.443  1.00 169.29 ? 651  LYS C CG    1 
ATOM   8663  C  CD    . LYS C 2 651  ? 80.159  -31.557 98.719  1.00 174.27 ? 651  LYS C CD    1 
ATOM   8664  C  CE    . LYS C 2 651  ? 79.167  -31.744 97.563  1.00 165.19 ? 651  LYS C CE    1 
ATOM   8665  N  NZ    . LYS C 2 651  ? 79.731  -31.396 96.229  1.00 155.13 ? 651  LYS C NZ    1 
ATOM   8666  N  N     . GLY C 2 652  ? 78.713  -27.418 100.927 1.00 166.55 ? 652  GLY C N     1 
ATOM   8667  C  CA    . GLY C 2 652  ? 77.361  -26.936 100.696 1.00 161.95 ? 652  GLY C CA    1 
ATOM   8668  C  C     . GLY C 2 652  ? 76.896  -25.777 101.562 1.00 154.34 ? 652  GLY C C     1 
ATOM   8669  O  O     . GLY C 2 652  ? 75.904  -25.134 101.236 1.00 151.29 ? 652  GLY C O     1 
ATOM   8670  N  N     . ASP C 2 653  ? 77.613  -25.506 102.653 1.00 159.64 ? 653  ASP C N     1 
ATOM   8671  C  CA    . ASP C 2 653  ? 77.304  -24.398 103.567 1.00 158.28 ? 653  ASP C CA    1 
ATOM   8672  C  C     . ASP C 2 653  ? 77.492  -23.039 102.890 1.00 154.92 ? 653  ASP C C     1 
ATOM   8673  O  O     . ASP C 2 653  ? 78.200  -22.938 101.889 1.00 158.32 ? 653  ASP C O     1 
ATOM   8674  C  CB    . ASP C 2 653  ? 78.210  -24.452 104.809 1.00 166.94 ? 653  ASP C CB    1 
ATOM   8675  C  CG    . ASP C 2 653  ? 77.697  -25.395 105.889 1.00 174.21 ? 653  ASP C CG    1 
ATOM   8676  O  OD1   . ASP C 2 653  ? 77.951  -25.116 107.083 1.00 172.24 ? 653  ASP C OD1   1 
ATOM   8677  O  OD2   . ASP C 2 653  ? 77.057  -26.412 105.551 1.00 179.76 ? 653  ASP C OD2   1 
ATOM   8678  N  N     . LEU C 2 654  ? 76.876  -21.997 103.449 1.00 144.94 ? 654  LEU C N     1 
ATOM   8679  C  CA    . LEU C 2 654  ? 76.864  -20.662 102.840 1.00 137.89 ? 654  LEU C CA    1 
ATOM   8680  C  C     . LEU C 2 654  ? 78.066  -19.797 103.231 1.00 138.63 ? 654  LEU C C     1 
ATOM   8681  O  O     . LEU C 2 654  ? 78.320  -19.615 104.411 1.00 144.09 ? 654  LEU C O     1 
ATOM   8682  C  CB    . LEU C 2 654  ? 75.598  -19.941 103.285 1.00 131.05 ? 654  LEU C CB    1 
ATOM   8683  C  CG    . LEU C 2 654  ? 75.116  -18.781 102.427 1.00 131.39 ? 654  LEU C CG    1 
ATOM   8684  C  CD1   . LEU C 2 654  ? 74.031  -19.291 101.513 1.00 137.37 ? 654  LEU C CD1   1 
ATOM   8685  C  CD2   . LEU C 2 654  ? 74.611  -17.636 103.287 1.00 131.73 ? 654  LEU C CD2   1 
ATOM   8686  N  N     . LEU C 2 655  ? 78.845  -19.301 102.272 1.00 137.77 ? 655  LEU C N     1 
ATOM   8687  C  CA    . LEU C 2 655  ? 79.847  -18.288 102.618 1.00 135.02 ? 655  LEU C CA    1 
ATOM   8688  C  C     . LEU C 2 655  ? 79.412  -16.830 102.473 1.00 132.97 ? 655  LEU C C     1 
ATOM   8689  O  O     . LEU C 2 655  ? 79.954  -15.950 103.136 1.00 132.29 ? 655  LEU C O     1 
ATOM   8690  C  CB    . LEU C 2 655  ? 81.108  -18.519 101.803 1.00 130.47 ? 655  LEU C CB    1 
ATOM   8691  C  CG    . LEU C 2 655  ? 81.441  -19.994 101.837 1.00 136.46 ? 655  LEU C CG    1 
ATOM   8692  C  CD1   . LEU C 2 655  ? 82.532  -20.273 100.864 1.00 141.78 ? 655  LEU C CD1   1 
ATOM   8693  C  CD2   . LEU C 2 655  ? 81.857  -20.371 103.242 1.00 146.70 ? 655  LEU C CD2   1 
ATOM   8694  N  N     . ALA C 2 656  ? 78.420  -16.580 101.627 1.00 131.74 ? 656  ALA C N     1 
ATOM   8695  C  CA    . ALA C 2 656  ? 78.037  -15.212 101.308 1.00 129.02 ? 656  ALA C CA    1 
ATOM   8696  C  C     . ALA C 2 656  ? 76.601  -15.112 100.826 1.00 130.66 ? 656  ALA C C     1 
ATOM   8697  O  O     . ALA C 2 656  ? 76.125  -15.989 100.121 1.00 132.18 ? 656  ALA C O     1 
ATOM   8698  C  CB    . ALA C 2 656  ? 78.976  -14.642 100.267 1.00 129.32 ? 656  ALA C CB    1 
ATOM   8699  N  N     . ASP C 2 657  ? 75.931  -14.015 101.161 1.00 131.33 ? 657  ASP C N     1 
ATOM   8700  C  CA    . ASP C 2 657  ? 74.528  -13.830 100.806 1.00 131.00 ? 657  ASP C CA    1 
ATOM   8701  C  C     . ASP C 2 657  ? 74.389  -13.058 99.502  1.00 133.35 ? 657  ASP C C     1 
ATOM   8702  O  O     . ASP C 2 657  ? 75.118  -12.099 99.256  1.00 133.71 ? 657  ASP C O     1 
ATOM   8703  C  CB    . ASP C 2 657  ? 73.786  -13.088 101.921 1.00 133.51 ? 657  ASP C CB    1 
ATOM   8704  C  CG    . ASP C 2 657  ? 72.814  -13.976 102.673 1.00 128.91 ? 657  ASP C CG    1 
ATOM   8705  O  OD1   . ASP C 2 657  ? 72.270  -14.915 102.059 1.00 125.67 ? 657  ASP C OD1   1 
ATOM   8706  O  OD2   . ASP C 2 657  ? 72.585  -13.721 103.873 1.00 128.30 ? 657  ASP C OD2   1 
ATOM   8707  N  N     . GLY C 2 658  ? 73.417  -13.455 98.689  1.00 132.83 ? 658  GLY C N     1 
ATOM   8708  C  CA    . GLY C 2 658  ? 73.209  -12.835 97.396  1.00 134.92 ? 658  GLY C CA    1 
ATOM   8709  C  C     . GLY C 2 658  ? 72.725  -11.403 97.522  1.00 139.37 ? 658  GLY C C     1 
ATOM   8710  O  O     . GLY C 2 658  ? 72.717  -10.847 98.636  1.00 138.13 ? 658  GLY C O     1 
ATOM   8711  N  N     . PRO C 2 659  ? 72.346  -10.785 96.381  1.00 141.54 ? 659  PRO C N     1 
ATOM   8712  C  CA    . PRO C 2 659  ? 71.975  -9.367  96.419  1.00 141.61 ? 659  PRO C CA    1 
ATOM   8713  C  C     . PRO C 2 659  ? 70.794  -9.196  97.357  1.00 139.62 ? 659  PRO C C     1 
ATOM   8714  O  O     . PRO C 2 659  ? 70.837  -8.409  98.313  1.00 138.60 ? 659  PRO C O     1 
ATOM   8715  C  CB    . PRO C 2 659  ? 71.523  -9.079  94.972  1.00 131.52 ? 659  PRO C CB    1 
ATOM   8716  C  CG    . PRO C 2 659  ? 72.068  -10.185 94.147  1.00 132.01 ? 659  PRO C CG    1 
ATOM   8717  C  CD    . PRO C 2 659  ? 72.095  -11.382 95.058  1.00 138.57 ? 659  PRO C CD    1 
ATOM   8718  N  N     . ALA C 2 660  ? 69.755  -9.982  97.117  1.00 129.81 ? 660  ALA C N     1 
ATOM   8719  C  CA    . ALA C 2 660  ? 68.709  -10.068 98.096  1.00 123.02 ? 660  ALA C CA    1 
ATOM   8720  C  C     . ALA C 2 660  ? 68.560  -11.522 98.450  1.00 118.58 ? 660  ALA C C     1 
ATOM   8721  O  O     . ALA C 2 660  ? 67.970  -12.305 97.723  1.00 114.69 ? 660  ALA C O     1 
ATOM   8722  C  CB    . ALA C 2 660  ? 67.439  -9.500  97.543  1.00 118.64 ? 660  ALA C CB    1 
ATOM   8723  N  N     . SER C 2 661  ? 69.114  -11.853 99.600  1.00 121.50 ? 661  SER C N     1 
ATOM   8724  C  CA    . SER C 2 661  ? 68.955  -13.137 100.225 1.00 117.91 ? 661  SER C CA    1 
ATOM   8725  C  C     . SER C 2 661  ? 69.223  -12.910 101.697 1.00 121.88 ? 661  SER C C     1 
ATOM   8726  O  O     . SER C 2 661  ? 70.065  -12.092 102.071 1.00 124.44 ? 661  SER C O     1 
ATOM   8727  C  CB    . SER C 2 661  ? 69.956  -14.132 99.649  1.00 125.02 ? 661  SER C CB    1 
ATOM   8728  O  OG    . SER C 2 661  ? 70.345  -15.097 100.610 1.00 124.31 ? 661  SER C OG    1 
ATOM   8729  N  N     . GLU C 2 662  ? 68.522  -13.643 102.542 1.00 126.06 ? 662  GLU C N     1 
ATOM   8730  C  CA    . GLU C 2 662  ? 68.723  -13.510 103.973 1.00 131.09 ? 662  GLU C CA    1 
ATOM   8731  C  C     . GLU C 2 662  ? 69.196  -14.857 104.502 1.00 133.47 ? 662  GLU C C     1 
ATOM   8732  O  O     . GLU C 2 662  ? 68.412  -15.805 104.596 1.00 131.45 ? 662  GLU C O     1 
ATOM   8733  C  CB    . GLU C 2 662  ? 67.407  -13.100 104.644 1.00 130.08 ? 662  GLU C CB    1 
ATOM   8734  C  CG    . GLU C 2 662  ? 67.536  -12.628 106.088 1.00 132.57 ? 662  GLU C CG    1 
ATOM   8735  C  CD    . GLU C 2 662  ? 66.228  -12.083 106.650 1.00 129.16 ? 662  GLU C CD    1 
ATOM   8736  O  OE1   . GLU C 2 662  ? 65.161  -12.701 106.414 1.00 124.35 ? 662  GLU C OE1   1 
ATOM   8737  O  OE2   . GLU C 2 662  ? 66.275  -11.029 107.328 1.00 131.07 ? 662  GLU C OE2   1 
ATOM   8738  N  N     . ASN C 2 663  ? 70.475  -14.925 104.867 1.00 136.06 ? 663  ASN C N     1 
ATOM   8739  C  CA    . ASN C 2 663  ? 71.094  -16.177 105.304 1.00 137.61 ? 663  ASN C CA    1 
ATOM   8740  C  C     . ASN C 2 663  ? 70.731  -17.376 104.413 1.00 132.00 ? 663  ASN C C     1 
ATOM   8741  O  O     . ASN C 2 663  ? 70.373  -18.449 104.898 1.00 128.39 ? 663  ASN C O     1 
ATOM   8742  C  CB    . ASN C 2 663  ? 70.836  -16.445 106.796 1.00 141.75 ? 663  ASN C CB    1 
ATOM   8743  C  CG    . ASN C 2 663  ? 71.438  -15.362 107.697 1.00 143.28 ? 663  ASN C CG    1 
ATOM   8744  O  OD1   . ASN C 2 663  ? 72.214  -14.517 107.239 1.00 138.95 ? 663  ASN C OD1   1 
ATOM   8745  N  ND2   . ASN C 2 663  ? 71.082  -15.387 108.981 1.00 147.13 ? 663  ASN C ND2   1 
ATOM   8746  N  N     . GLY C 2 664  ? 70.807  -17.153 103.103 1.00 130.40 ? 664  GLY C N     1 
ATOM   8747  C  CA    . GLY C 2 664  ? 70.635  -18.199 102.114 1.00 129.03 ? 664  GLY C CA    1 
ATOM   8748  C  C     . GLY C 2 664  ? 69.235  -18.309 101.551 1.00 128.07 ? 664  GLY C C     1 
ATOM   8749  O  O     . GLY C 2 664  ? 69.042  -18.882 100.482 1.00 125.66 ? 664  GLY C O     1 
ATOM   8750  N  N     . PHE C 2 665  ? 68.258  -17.807 102.302 1.00 124.67 ? 665  PHE C N     1 
ATOM   8751  C  CA    . PHE C 2 665  ? 66.862  -17.726 101.865 1.00 120.94 ? 665  PHE C CA    1 
ATOM   8752  C  C     . PHE C 2 665  ? 66.589  -16.566 100.922 1.00 120.55 ? 665  PHE C C     1 
ATOM   8753  O  O     . PHE C 2 665  ? 67.374  -15.632 100.829 1.00 124.15 ? 665  PHE C O     1 
ATOM   8754  C  CB    . PHE C 2 665  ? 65.923  -17.651 103.059 1.00 123.52 ? 665  PHE C CB    1 
ATOM   8755  C  CG    . PHE C 2 665  ? 65.902  -18.898 103.894 1.00 132.30 ? 665  PHE C CG    1 
ATOM   8756  C  CD1   . PHE C 2 665  ? 64.896  -19.841 103.727 1.00 130.47 ? 665  PHE C CD1   1 
ATOM   8757  C  CD2   . PHE C 2 665  ? 66.887  -19.129 104.851 1.00 135.70 ? 665  PHE C CD2   1 
ATOM   8758  C  CE1   . PHE C 2 665  ? 64.876  -20.990 104.493 1.00 130.93 ? 665  PHE C CE1   1 
ATOM   8759  C  CE2   . PHE C 2 665  ? 66.871  -20.277 105.623 1.00 133.45 ? 665  PHE C CE2   1 
ATOM   8760  C  CZ    . PHE C 2 665  ? 65.862  -21.201 105.449 1.00 133.89 ? 665  PHE C CZ    1 
ATOM   8761  N  N     . LEU C 2 666  ? 65.476  -16.622 100.211 1.00 116.78 ? 666  LEU C N     1 
ATOM   8762  C  CA    . LEU C 2 666  ? 65.193  -15.581 99.246  1.00 113.74 ? 666  LEU C CA    1 
ATOM   8763  C  C     . LEU C 2 666  ? 64.503  -14.379 99.881  1.00 114.86 ? 666  LEU C C     1 
ATOM   8764  O  O     . LEU C 2 666  ? 63.377  -14.479 100.383 1.00 108.14 ? 666  LEU C O     1 
ATOM   8765  C  CB    . LEU C 2 666  ? 64.348  -16.148 98.115  1.00 110.33 ? 666  LEU C CB    1 
ATOM   8766  C  CG    . LEU C 2 666  ? 64.039  -15.165 96.998  1.00 106.67 ? 666  LEU C CG    1 
ATOM   8767  C  CD1   . LEU C 2 666  ? 65.294  -14.414 96.632  1.00 109.01 ? 666  LEU C CD1   1 
ATOM   8768  C  CD2   . LEU C 2 666  ? 63.452  -15.871 95.798  1.00 98.57  ? 666  LEU C CD2   1 
ATOM   8769  N  N     . ALA C 2 667  ? 65.179  -13.233 99.844  1.00 116.86 ? 667  ALA C N     1 
ATOM   8770  C  CA    . ALA C 2 667  ? 64.590  -12.028 100.405 1.00 117.54 ? 667  ALA C CA    1 
ATOM   8771  C  C     . ALA C 2 667  ? 64.307  -10.968 99.349  1.00 116.22 ? 667  ALA C C     1 
ATOM   8772  O  O     . ALA C 2 667  ? 65.153  -10.135 99.050  1.00 111.61 ? 667  ALA C O     1 
ATOM   8773  C  CB    . ALA C 2 667  ? 65.552  -11.460 101.421 1.00 119.30 ? 667  ALA C CB    1 
ATOM   8774  N  N     . LEU C 2 668  ? 63.070  -10.929 98.877  1.00 114.68 ? 668  LEU C N     1 
ATOM   8775  C  CA    . LEU C 2 668  ? 62.662  -9.917  97.919  1.00 111.71 ? 668  LEU C CA    1 
ATOM   8776  C  C     . LEU C 2 668  ? 62.249  -8.628  98.619  1.00 111.88 ? 668  LEU C C     1 
ATOM   8777  O  O     . LEU C 2 668  ? 62.691  -7.528  98.269  1.00 110.44 ? 668  LEU C O     1 
ATOM   8778  C  CB    . LEU C 2 668  ? 61.510  -10.465 97.081  1.00 110.64 ? 668  LEU C CB    1 
ATOM   8779  C  CG    . LEU C 2 668  ? 61.791  -11.893 96.609  1.00 110.21 ? 668  LEU C CG    1 
ATOM   8780  C  CD1   . LEU C 2 668  ? 60.548  -12.591 96.035  1.00 107.10 ? 668  LEU C CD1   1 
ATOM   8781  C  CD2   . LEU C 2 668  ? 62.933  -11.874 95.604  1.00 101.30 ? 668  LEU C CD2   1 
ATOM   8782  N  N     . GLY C 2 669  ? 61.364  -8.798  99.598  1.00 110.50 ? 669  GLY C N     1 
ATOM   8783  C  CA    . GLY C 2 669  ? 60.810  -7.718  100.394 1.00 106.75 ? 669  GLY C CA    1 
ATOM   8784  C  C     . GLY C 2 669  ? 61.185  -7.706  101.859 1.00 102.82 ? 669  GLY C C     1 
ATOM   8785  O  O     . GLY C 2 669  ? 62.213  -8.243  102.271 1.00 103.81 ? 669  GLY C O     1 
ATOM   8786  N  N     . GLN C 2 670  ? 60.317  -7.086  102.648 1.00 99.14  ? 670  GLN C N     1 
ATOM   8787  C  CA    . GLN C 2 670  ? 60.427  -7.159  104.089 1.00 102.88 ? 670  GLN C CA    1 
ATOM   8788  C  C     . GLN C 2 670  ? 59.150  -7.594  104.786 1.00 101.52 ? 670  GLN C C     1 
ATOM   8789  O  O     . GLN C 2 670  ? 58.052  -7.530  104.236 1.00 99.22  ? 670  GLN C O     1 
ATOM   8790  C  CB    . GLN C 2 670  ? 60.886  -5.831  104.657 1.00 102.64 ? 670  GLN C CB    1 
ATOM   8791  C  CG    . GLN C 2 670  ? 62.377  -5.712  104.747 1.00 104.55 ? 670  GLN C CG    1 
ATOM   8792  C  CD    . GLN C 2 670  ? 62.851  -4.377  104.262 1.00 108.07 ? 670  GLN C CD    1 
ATOM   8793  O  OE1   . GLN C 2 670  ? 62.240  -3.779  103.382 1.00 107.93 ? 670  GLN C OE1   1 
ATOM   8794  N  NE2   . GLN C 2 670  ? 63.942  -3.889  104.834 1.00 113.28 ? 670  GLN C NE2   1 
ATOM   8795  N  N     . ASN C 2 671  ? 59.321  -8.042  106.020 1.00 104.40 ? 671  ASN C N     1 
ATOM   8796  C  CA    . ASN C 2 671  ? 58.196  -8.373  106.854 1.00 106.33 ? 671  ASN C CA    1 
ATOM   8797  C  C     . ASN C 2 671  ? 57.841  -7.198  107.726 1.00 106.65 ? 671  ASN C C     1 
ATOM   8798  O  O     . ASN C 2 671  ? 58.503  -6.916  108.733 1.00 102.82 ? 671  ASN C O     1 
ATOM   8799  C  CB    . ASN C 2 671  ? 58.545  -9.548  107.747 1.00 110.45 ? 671  ASN C CB    1 
ATOM   8800  C  CG    . ASN C 2 671  ? 58.932  -10.760 106.963 1.00 110.99 ? 671  ASN C CG    1 
ATOM   8801  O  OD1   . ASN C 2 671  ? 58.079  -11.446 106.409 1.00 110.12 ? 671  ASN C OD1   1 
ATOM   8802  N  ND2   . ASN C 2 671  ? 60.226  -11.037 106.905 1.00 113.54 ? 671  ASN C ND2   1 
ATOM   8803  N  N     . VAL C 2 672  ? 56.728  -6.570  107.376 1.00 108.35 ? 672  VAL C N     1 
ATOM   8804  C  CA    . VAL C 2 672  ? 56.234  -5.436  108.122 1.00 109.17 ? 672  VAL C CA    1 
ATOM   8805  C  C     . VAL C 2 672  ? 54.935  -5.856  108.744 1.00 108.11 ? 672  VAL C C     1 
ATOM   8806  O  O     . VAL C 2 672  ? 54.292  -6.818  108.316 1.00 107.39 ? 672  VAL C O     1 
ATOM   8807  C  CB    . VAL C 2 672  ? 55.926  -4.231  107.239 1.00 102.11 ? 672  VAL C CB    1 
ATOM   8808  C  CG1   . VAL C 2 672  ? 57.188  -3.701  106.596 1.00 98.15  ? 672  VAL C CG1   1 
ATOM   8809  C  CG2   . VAL C 2 672  ? 54.891  -4.609  106.215 1.00 97.99  ? 672  VAL C CG2   1 
ATOM   8810  N  N     . LEU C 2 673  ? 54.569  -5.124  109.778 1.00 106.05 ? 673  LEU C N     1 
ATOM   8811  C  CA    . LEU C 2 673  ? 53.363  -5.379  110.513 1.00 102.40 ? 673  LEU C CA    1 
ATOM   8812  C  C     . LEU C 2 673  ? 52.225  -4.527  109.974 1.00 104.28 ? 673  LEU C C     1 
ATOM   8813  O  O     . LEU C 2 673  ? 52.241  -3.309  110.115 1.00 106.73 ? 673  LEU C O     1 
ATOM   8814  C  CB    . LEU C 2 673  ? 53.634  -5.019  111.951 1.00 104.17 ? 673  LEU C CB    1 
ATOM   8815  C  CG    . LEU C 2 673  ? 52.476  -5.279  112.883 1.00 101.42 ? 673  LEU C CG    1 
ATOM   8816  C  CD1   . LEU C 2 673  ? 51.873  -6.606  112.524 1.00 104.14 ? 673  LEU C CD1   1 
ATOM   8817  C  CD2   . LEU C 2 673  ? 53.028  -5.295  114.284 1.00 102.14 ? 673  LEU C CD2   1 
ATOM   8818  N  N     . VAL C 2 674  ? 51.228  -5.173  109.376 1.00 104.57 ? 674  VAL C N     1 
ATOM   8819  C  CA    . VAL C 2 674  ? 50.172  -4.467  108.649 1.00 100.56 ? 674  VAL C CA    1 
ATOM   8820  C  C     . VAL C 2 674  ? 48.816  -4.616  109.304 1.00 99.52  ? 674  VAL C C     1 
ATOM   8821  O  O     . VAL C 2 674  ? 48.396  -5.730  109.593 1.00 103.21 ? 674  VAL C O     1 
ATOM   8822  C  CB    . VAL C 2 674  ? 50.028  -5.018  107.220 1.00 96.14  ? 674  VAL C CB    1 
ATOM   8823  C  CG1   . VAL C 2 674  ? 50.314  -6.485  107.208 1.00 99.74  ? 674  VAL C CG1   1 
ATOM   8824  C  CG2   . VAL C 2 674  ? 48.629  -4.781  106.705 1.00 94.20  ? 674  VAL C CG2   1 
ATOM   8825  N  N     . ALA C 2 675  ? 48.123  -3.503  109.530 1.00 99.54  ? 675  ALA C N     1 
ATOM   8826  C  CA    . ALA C 2 675  ? 46.748  -3.564  110.028 1.00 98.81  ? 675  ALA C CA    1 
ATOM   8827  C  C     . ALA C 2 675  ? 45.780  -3.322  108.889 1.00 93.74  ? 675  ALA C C     1 
ATOM   8828  O  O     . ALA C 2 675  ? 45.979  -2.404  108.098 1.00 92.79  ? 675  ALA C O     1 
ATOM   8829  C  CB    . ALA C 2 675  ? 46.527  -2.553  111.140 1.00 99.30  ? 675  ALA C CB    1 
ATOM   8830  N  N     . ILE C 2 676  ? 44.725  -4.127  108.809 1.00 94.52  ? 676  ILE C N     1 
ATOM   8831  C  CA    . ILE C 2 676  ? 43.838  -4.039  107.657 1.00 98.60  ? 676  ILE C CA    1 
ATOM   8832  C  C     . ILE C 2 676  ? 42.573  -3.243  107.984 1.00 102.06 ? 676  ILE C C     1 
ATOM   8833  O  O     . ILE C 2 676  ? 41.615  -3.768  108.547 1.00 105.39 ? 676  ILE C O     1 
ATOM   8834  C  CB    . ILE C 2 676  ? 43.433  -5.461  107.183 1.00 96.97  ? 676  ILE C CB    1 
ATOM   8835  C  CG1   . ILE C 2 676  ? 44.683  -6.278  106.833 1.00 93.36  ? 676  ILE C CG1   1 
ATOM   8836  C  CG2   . ILE C 2 676  ? 42.450  -5.390  106.011 1.00 93.14  ? 676  ILE C CG2   1 
ATOM   8837  C  CD1   . ILE C 2 676  ? 44.426  -7.748  106.676 1.00 87.91  ? 676  ILE C CD1   1 
ATOM   8838  N  N     . MET C 2 677  ? 42.581  -1.969  107.598 1.00 100.52 ? 677  MET C N     1 
ATOM   8839  C  CA    . MET C 2 677  ? 41.467  -1.066  107.845 1.00 98.44  ? 677  MET C CA    1 
ATOM   8840  C  C     . MET C 2 677  ? 41.478  0.080   106.860 1.00 99.40  ? 677  MET C C     1 
ATOM   8841  O  O     . MET C 2 677  ? 42.546  0.490   106.403 1.00 96.43  ? 677  MET C O     1 
ATOM   8842  C  CB    . MET C 2 677  ? 41.578  -0.507  109.246 1.00 99.99  ? 677  MET C CB    1 
ATOM   8843  C  CG    . MET C 2 677  ? 42.893  0.179   109.475 1.00 103.05 ? 677  MET C CG    1 
ATOM   8844  S  SD    . MET C 2 677  ? 42.989  0.860   111.122 1.00 118.29 ? 677  MET C SD    1 
ATOM   8845  C  CE    . MET C 2 677  ? 41.446  1.778   111.145 1.00 113.71 ? 677  MET C CE    1 
ATOM   8846  N  N     . PRO C 2 678  ? 40.302  0.647   106.570 1.00 103.04 ? 678  PRO C N     1 
ATOM   8847  C  CA    . PRO C 2 678  ? 40.277  1.870   105.762 1.00 101.62 ? 678  PRO C CA    1 
ATOM   8848  C  C     . PRO C 2 678  ? 40.874  2.951   106.610 1.00 100.53 ? 678  PRO C C     1 
ATOM   8849  O  O     . PRO C 2 678  ? 40.638  2.982   107.809 1.00 103.82 ? 678  PRO C O     1 
ATOM   8850  C  CB    . PRO C 2 678  ? 38.788  2.156   105.586 1.00 102.59 ? 678  PRO C CB    1 
ATOM   8851  C  CG    . PRO C 2 678  ? 38.071  0.911   106.083 1.00 106.21 ? 678  PRO C CG    1 
ATOM   8852  C  CD    . PRO C 2 678  ? 38.973  0.291   107.086 1.00 101.82 ? 678  PRO C CD    1 
ATOM   8853  N  N     . PHE C 2 679  ? 41.674  3.818   106.038 1.00 99.17  ? 679  PHE C N     1 
ATOM   8854  C  CA    . PHE C 2 679  ? 42.165  4.871   106.873 1.00 98.66  ? 679  PHE C CA    1 
ATOM   8855  C  C     . PHE C 2 679  ? 41.952  6.189   106.150 1.00 102.57 ? 679  PHE C C     1 
ATOM   8856  O  O     . PHE C 2 679  ? 42.736  6.573   105.290 1.00 104.77 ? 679  PHE C O     1 
ATOM   8857  C  CB    . PHE C 2 679  ? 43.637  4.576   107.128 1.00 97.33  ? 679  PHE C CB    1 
ATOM   8858  C  CG    . PHE C 2 679  ? 44.296  5.507   108.079 1.00 98.57  ? 679  PHE C CG    1 
ATOM   8859  C  CD1   . PHE C 2 679  ? 44.266  5.253   109.438 1.00 99.31  ? 679  PHE C CD1   1 
ATOM   8860  C  CD2   . PHE C 2 679  ? 44.981  6.622   107.616 1.00 92.08  ? 679  PHE C CD2   1 
ATOM   8861  C  CE1   . PHE C 2 679  ? 44.894  6.118   110.324 1.00 100.97 ? 679  PHE C CE1   1 
ATOM   8862  C  CE2   . PHE C 2 679  ? 45.605  7.477   108.484 1.00 87.99  ? 679  PHE C CE2   1 
ATOM   8863  C  CZ    . PHE C 2 679  ? 45.566  7.230   109.838 1.00 96.66  ? 679  PHE C CZ    1 
ATOM   8864  N  N     . ASP C 2 680  ? 40.919  6.912   106.568 1.00 99.82  ? 680  ASP C N     1 
ATOM   8865  C  CA    . ASP C 2 680  ? 40.628  8.240   106.053 1.00 98.83  ? 680  ASP C CA    1 
ATOM   8866  C  C     . ASP C 2 680  ? 40.695  8.368   104.536 1.00 97.47  ? 680  ASP C C     1 
ATOM   8867  O  O     . ASP C 2 680  ? 41.024  9.429   104.025 1.00 96.53  ? 680  ASP C O     1 
ATOM   8868  C  CB    . ASP C 2 680  ? 41.600  9.228   106.676 1.00 99.89  ? 680  ASP C CB    1 
ATOM   8869  C  CG    . ASP C 2 680  ? 40.929  10.148  107.654 1.00 106.44 ? 680  ASP C CG    1 
ATOM   8870  O  OD1   . ASP C 2 680  ? 40.630  9.694   108.786 1.00 100.58 ? 680  ASP C OD1   1 
ATOM   8871  O  OD2   . ASP C 2 680  ? 40.692  11.321  107.275 1.00 111.21 ? 680  ASP C OD2   1 
ATOM   8872  N  N     . GLY C 2 681  ? 40.369  7.299   103.822 1.00 98.79  ? 681  GLY C N     1 
ATOM   8873  C  CA    . GLY C 2 681  ? 40.505  7.286   102.380 1.00 95.27  ? 681  GLY C CA    1 
ATOM   8874  C  C     . GLY C 2 681  ? 41.913  7.514   101.846 1.00 98.63  ? 681  GLY C C     1 
ATOM   8875  O  O     . GLY C 2 681  ? 42.083  7.841   100.682 1.00 99.83  ? 681  GLY C O     1 
ATOM   8876  N  N     . TYR C 2 682  ? 42.935  7.360   102.678 1.00 103.22 ? 682  TYR C N     1 
ATOM   8877  C  CA    . TYR C 2 682  ? 44.306  7.455   102.178 1.00 99.54  ? 682  TYR C CA    1 
ATOM   8878  C  C     . TYR C 2 682  ? 44.706  6.164   101.503 1.00 100.14 ? 682  TYR C C     1 
ATOM   8879  O  O     . TYR C 2 682  ? 45.588  6.161   100.654 1.00 99.14  ? 682  TYR C O     1 
ATOM   8880  C  CB    . TYR C 2 682  ? 45.290  7.785   103.291 1.00 98.10  ? 682  TYR C CB    1 
ATOM   8881  C  CG    . TYR C 2 682  ? 45.465  9.262   103.511 1.00 101.49 ? 682  TYR C CG    1 
ATOM   8882  C  CD1   . TYR C 2 682  ? 46.478  9.945   102.877 1.00 104.78 ? 682  TYR C CD1   1 
ATOM   8883  C  CD2   . TYR C 2 682  ? 44.604  9.982   104.336 1.00 100.80 ? 682  TYR C CD2   1 
ATOM   8884  C  CE1   . TYR C 2 682  ? 46.658  11.315  103.063 1.00 111.51 ? 682  TYR C CE1   1 
ATOM   8885  C  CE2   . TYR C 2 682  ? 44.770  11.358  104.535 1.00 102.40 ? 682  TYR C CE2   1 
ATOM   8886  C  CZ    . TYR C 2 682  ? 45.804  12.023  103.889 1.00 106.50 ? 682  TYR C CZ    1 
ATOM   8887  O  OH    . TYR C 2 682  ? 46.001  13.388  104.052 1.00 100.16 ? 682  TYR C OH    1 
ATOM   8888  N  N     . ASN C 2 683  ? 44.065  5.067   101.908 1.00 100.00 ? 683  ASN C N     1 
ATOM   8889  C  CA    . ASN C 2 683  ? 44.199  3.772   101.228 1.00 100.43 ? 683  ASN C CA    1 
ATOM   8890  C  C     . ASN C 2 683  ? 43.093  3.475   100.195 1.00 102.09 ? 683  ASN C C     1 
ATOM   8891  O  O     . ASN C 2 683  ? 42.961  2.361   99.688  1.00 102.25 ? 683  ASN C O     1 
ATOM   8892  C  CB    . ASN C 2 683  ? 44.417  2.623   102.210 1.00 95.37  ? 683  ASN C CB    1 
ATOM   8893  C  CG    . ASN C 2 683  ? 43.377  2.578   103.274 1.00 98.15  ? 683  ASN C CG    1 
ATOM   8894  O  OD1   . ASN C 2 683  ? 42.245  3.011   103.065 1.00 100.57 ? 683  ASN C OD1   1 
ATOM   8895  N  ND2   . ASN C 2 683  ? 43.744  2.057   104.434 1.00 98.95  ? 683  ASN C ND2   1 
ATOM   8896  N  N     . PHE C 2 684  ? 42.283  4.487   99.921  1.00 101.44 ? 684  PHE C N     1 
ATOM   8897  C  CA    . PHE C 2 684  ? 41.247  4.424   98.898  1.00 102.78 ? 684  PHE C CA    1 
ATOM   8898  C  C     . PHE C 2 684  ? 41.770  3.921   97.566  1.00 103.22 ? 684  PHE C C     1 
ATOM   8899  O  O     . PHE C 2 684  ? 42.761  4.419   97.050  1.00 101.52 ? 684  PHE C O     1 
ATOM   8900  C  CB    . PHE C 2 684  ? 40.696  5.833   98.694  1.00 107.28 ? 684  PHE C CB    1 
ATOM   8901  C  CG    . PHE C 2 684  ? 39.628  5.950   97.628  1.00 108.96 ? 684  PHE C CG    1 
ATOM   8902  C  CD1   . PHE C 2 684  ? 38.356  5.417   97.824  1.00 106.52 ? 684  PHE C CD1   1 
ATOM   8903  C  CD2   . PHE C 2 684  ? 39.878  6.650   96.459  1.00 103.90 ? 684  PHE C CD2   1 
ATOM   8904  C  CE1   . PHE C 2 684  ? 37.367  5.555   96.859  1.00 104.06 ? 684  PHE C CE1   1 
ATOM   8905  C  CE2   . PHE C 2 684  ? 38.890  6.788   95.491  1.00 106.70 ? 684  PHE C CE2   1 
ATOM   8906  C  CZ    . PHE C 2 684  ? 37.633  6.239   95.691  1.00 104.75 ? 684  PHE C CZ    1 
ATOM   8907  N  N     . GLU C 2 685  ? 41.069  2.942   97.010  1.00 108.37 ? 685  GLU C N     1 
ATOM   8908  C  CA    . GLU C 2 685  ? 41.387  2.343   95.707  1.00 109.77 ? 685  GLU C CA    1 
ATOM   8909  C  C     . GLU C 2 685  ? 42.792  1.814   95.556  1.00 108.54 ? 685  GLU C C     1 
ATOM   8910  O  O     . GLU C 2 685  ? 43.511  2.180   94.624  1.00 105.12 ? 685  GLU C O     1 
ATOM   8911  C  CB    . GLU C 2 685  ? 41.031  3.243   94.516  1.00 105.89 ? 685  GLU C CB    1 
ATOM   8912  C  CG    . GLU C 2 685  ? 39.534  3.354   94.208  1.00 107.82 ? 685  GLU C CG    1 
ATOM   8913  C  CD    . GLU C 2 685  ? 38.812  2.018   93.932  1.00 113.10 ? 685  GLU C CD    1 
ATOM   8914  O  OE1   . GLU C 2 685  ? 39.299  0.919   94.289  1.00 113.67 ? 685  GLU C OE1   1 
ATOM   8915  O  OE2   . GLU C 2 685  ? 37.711  2.078   93.351  1.00 116.62 ? 685  GLU C OE2   1 
ATOM   8916  N  N     . ASP C 2 686  ? 43.178  0.958   96.492  1.00 110.11 ? 686  ASP C N     1 
ATOM   8917  C  CA    . ASP C 2 686  ? 44.401  0.193   96.333  1.00 109.72 ? 686  ASP C CA    1 
ATOM   8918  C  C     . ASP C 2 686  ? 45.675  1.043   96.565  1.00 106.33 ? 686  ASP C C     1 
ATOM   8919  O  O     . ASP C 2 686  ? 46.780  0.565   96.366  1.00 102.59 ? 686  ASP C O     1 
ATOM   8920  C  CB    . ASP C 2 686  ? 44.380  -0.651  95.028  1.00 111.68 ? 686  ASP C CB    1 
ATOM   8921  C  CG    . ASP C 2 686  ? 43.288  -1.767  95.045  1.00 118.11 ? 686  ASP C CG    1 
ATOM   8922  O  OD1   . ASP C 2 686  ? 43.473  -2.833  94.413  1.00 117.67 ? 686  ASP C OD1   1 
ATOM   8923  O  OD2   . ASP C 2 686  ? 42.234  -1.586  95.690  1.00 120.32 ? 686  ASP C OD2   1 
ATOM   8924  N  N     . ALA C 2 687  ? 45.510  2.316   96.925  1.00 106.07 ? 687  ALA C N     1 
ATOM   8925  C  CA    . ALA C 2 687  ? 46.600  3.094   97.532  1.00 102.28 ? 687  ALA C CA    1 
ATOM   8926  C  C     . ALA C 2 687  ? 46.967  2.546   98.942  1.00 106.00 ? 687  ALA C C     1 
ATOM   8927  O  O     . ALA C 2 687  ? 46.214  1.755   99.520  1.00 104.25 ? 687  ALA C O     1 
ATOM   8928  C  CB    . ALA C 2 687  ? 46.236  4.571   97.591  1.00 96.74  ? 687  ALA C CB    1 
ATOM   8929  N  N     . ILE C 2 688  ? 48.138  2.927   99.468  1.00 105.41 ? 688  ILE C N     1 
ATOM   8930  C  CA    . ILE C 2 688  ? 48.685  2.341   100.711 1.00 100.84 ? 688  ILE C CA    1 
ATOM   8931  C  C     . ILE C 2 688  ? 49.377  3.331   101.683 1.00 101.68 ? 688  ILE C C     1 
ATOM   8932  O  O     . ILE C 2 688  ? 50.178  4.162   101.251 1.00 101.86 ? 688  ILE C O     1 
ATOM   8933  C  CB    . ILE C 2 688  ? 49.689  1.246   100.358 1.00 93.51  ? 688  ILE C CB    1 
ATOM   8934  C  CG1   . ILE C 2 688  ? 48.961  0.028   99.810  1.00 95.17  ? 688  ILE C CG1   1 
ATOM   8935  C  CG2   . ILE C 2 688  ? 50.497  0.852   101.556 1.00 94.20  ? 688  ILE C CG2   1 
ATOM   8936  C  CD1   . ILE C 2 688  ? 49.888  -0.930  99.153  1.00 94.48  ? 688  ILE C CD1   1 
ATOM   8937  N  N     . VAL C 2 689  ? 49.092  3.211   102.987 1.00 97.34  ? 689  VAL C N     1 
ATOM   8938  C  CA    . VAL C 2 689  ? 49.576  4.155   103.999 1.00 94.18  ? 689  VAL C CA    1 
ATOM   8939  C  C     . VAL C 2 689  ? 50.698  3.591   104.892 1.00 97.71  ? 689  VAL C C     1 
ATOM   8940  O  O     . VAL C 2 689  ? 50.643  2.437   105.308 1.00 96.06  ? 689  VAL C O     1 
ATOM   8941  C  CB    . VAL C 2 689  ? 48.420  4.630   104.864 1.00 92.37  ? 689  VAL C CB    1 
ATOM   8942  C  CG1   . VAL C 2 689  ? 48.832  5.838   105.641 1.00 98.12  ? 689  VAL C CG1   1 
ATOM   8943  C  CG2   . VAL C 2 689  ? 47.224  4.960   103.989 1.00 92.78  ? 689  VAL C CG2   1 
ATOM   8944  N  N     . ILE C 2 690  ? 51.697  4.426   105.200 1.00 102.85 ? 690  ILE C N     1 
ATOM   8945  C  CA    . ILE C 2 690  ? 53.003  3.977   105.726 1.00 103.01 ? 690  ILE C CA    1 
ATOM   8946  C  C     . ILE C 2 690  ? 53.508  4.607   107.037 1.00 106.10 ? 690  ILE C C     1 
ATOM   8947  O  O     . ILE C 2 690  ? 53.619  5.829   107.142 1.00 112.62 ? 690  ILE C O     1 
ATOM   8948  C  CB    . ILE C 2 690  ? 54.097  4.230   104.659 1.00 102.49 ? 690  ILE C CB    1 
ATOM   8949  C  CG1   . ILE C 2 690  ? 53.938  3.243   103.520 1.00 104.12 ? 690  ILE C CG1   1 
ATOM   8950  C  CG2   . ILE C 2 690  ? 55.494  4.078   105.235 1.00 106.58 ? 690  ILE C CG2   1 
ATOM   8951  C  CD1   . ILE C 2 690  ? 53.701  1.832   104.026 1.00 107.99 ? 690  ILE C CD1   1 
ATOM   8952  N  N     . SER C 2 691  ? 53.847  3.780   108.025 1.00 101.69 ? 691  SER C N     1 
ATOM   8953  C  CA    . SER C 2 691  ? 54.528  4.289   109.217 1.00 103.44 ? 691  SER C CA    1 
ATOM   8954  C  C     . SER C 2 691  ? 55.873  4.838   108.795 1.00 104.67 ? 691  SER C C     1 
ATOM   8955  O  O     . SER C 2 691  ? 56.636  4.158   108.128 1.00 108.84 ? 691  SER C O     1 
ATOM   8956  C  CB    . SER C 2 691  ? 54.697  3.188   110.277 1.00 105.25 ? 691  SER C CB    1 
ATOM   8957  O  OG    . SER C 2 691  ? 55.181  3.680   111.520 1.00 98.97  ? 691  SER C OG    1 
ATOM   8958  N  N     . GLU C 2 692  ? 56.175  6.069   109.176 1.00 104.53 ? 692  GLU C N     1 
ATOM   8959  C  CA    . GLU C 2 692  ? 57.468  6.651   108.838 1.00 108.56 ? 692  GLU C CA    1 
ATOM   8960  C  C     . GLU C 2 692  ? 58.581  5.830   109.490 1.00 109.18 ? 692  GLU C C     1 
ATOM   8961  O  O     . GLU C 2 692  ? 59.750  5.933   109.127 1.00 102.67 ? 692  GLU C O     1 
ATOM   8962  C  CB    . GLU C 2 692  ? 57.510  8.102   109.296 1.00 111.06 ? 692  GLU C CB    1 
ATOM   8963  C  CG    . GLU C 2 692  ? 58.731  8.892   108.904 1.00 108.45 ? 692  GLU C CG    1 
ATOM   8964  C  CD    . GLU C 2 692  ? 58.668  10.293  109.460 1.00 108.49 ? 692  GLU C CD    1 
ATOM   8965  O  OE1   . GLU C 2 692  ? 58.866  10.471  110.683 1.00 109.26 ? 692  GLU C OE1   1 
ATOM   8966  O  OE2   . GLU C 2 692  ? 58.382  11.213  108.678 1.00 107.35 ? 692  GLU C OE2   1 
ATOM   8967  N  N     . GLU C 2 693  ? 58.175  4.981   110.431 1.00 113.69 ? 693  GLU C N     1 
ATOM   8968  C  CA    . GLU C 2 693  ? 59.043  3.999   111.072 1.00 118.83 ? 693  GLU C CA    1 
ATOM   8969  C  C     . GLU C 2 693  ? 59.743  3.078   110.090 1.00 120.78 ? 693  GLU C C     1 
ATOM   8970  O  O     . GLU C 2 693  ? 60.683  2.373   110.469 1.00 123.90 ? 693  GLU C O     1 
ATOM   8971  C  CB    . GLU C 2 693  ? 58.252  3.114   112.054 1.00 120.85 ? 693  GLU C CB    1 
ATOM   8972  C  CG    . GLU C 2 693  ? 58.192  3.644   113.473 1.00 124.92 ? 693  GLU C CG    1 
ATOM   8973  C  CD    . GLU C 2 693  ? 59.521  4.248   113.942 1.00 124.62 ? 693  GLU C CD    1 
ATOM   8974  O  OE1   . GLU C 2 693  ? 60.586  3.654   113.673 1.00 124.77 ? 693  GLU C OE1   1 
ATOM   8975  O  OE2   . GLU C 2 693  ? 59.502  5.319   114.590 1.00 124.94 ? 693  GLU C OE2   1 
ATOM   8976  N  N     . LEU C 2 694  ? 59.252  3.015   108.858 1.00 117.55 ? 694  LEU C N     1 
ATOM   8977  C  CA    . LEU C 2 694  ? 59.939  2.223   107.855 1.00 116.03 ? 694  LEU C CA    1 
ATOM   8978  C  C     . LEU C 2 694  ? 61.120  3.024   107.301 1.00 114.06 ? 694  LEU C C     1 
ATOM   8979  O  O     . LEU C 2 694  ? 62.234  2.502   107.173 1.00 114.60 ? 694  LEU C O     1 
ATOM   8980  C  CB    . LEU C 2 694  ? 58.971  1.721   106.773 1.00 109.23 ? 694  LEU C CB    1 
ATOM   8981  C  CG    . LEU C 2 694  ? 57.927  0.719   107.293 1.00 103.18 ? 694  LEU C CG    1 
ATOM   8982  C  CD1   . LEU C 2 694  ? 56.923  0.374   106.232 1.00 102.54 ? 694  LEU C CD1   1 
ATOM   8983  C  CD2   . LEU C 2 694  ? 58.561  -0.552  107.820 1.00 104.38 ? 694  LEU C CD2   1 
ATOM   8984  N  N     . LEU C 2 695  ? 60.886  4.305   107.032 1.00 109.72 ? 695  LEU C N     1 
ATOM   8985  C  CA    . LEU C 2 695  ? 61.921  5.177   106.480 1.00 114.91 ? 695  LEU C CA    1 
ATOM   8986  C  C     . LEU C 2 695  ? 63.103  5.270   107.425 1.00 117.78 ? 695  LEU C C     1 
ATOM   8987  O  O     . LEU C 2 695  ? 64.272  5.213   107.018 1.00 112.00 ? 695  LEU C O     1 
ATOM   8988  C  CB    . LEU C 2 695  ? 61.367  6.591   106.295 1.00 115.14 ? 695  LEU C CB    1 
ATOM   8989  C  CG    . LEU C 2 695  ? 60.511  6.981   105.090 1.00 109.75 ? 695  LEU C CG    1 
ATOM   8990  C  CD1   . LEU C 2 695  ? 61.326  7.775   104.064 1.00 103.40 ? 695  LEU C CD1   1 
ATOM   8991  C  CD2   . LEU C 2 695  ? 59.873  5.749   104.469 1.00 111.56 ? 695  LEU C CD2   1 
ATOM   8992  N  N     . LYS C 2 696  ? 62.760  5.439   108.698 1.00 121.22 ? 696  LYS C N     1 
ATOM   8993  C  CA    . LYS C 2 696  ? 63.726  5.722   109.738 1.00 120.32 ? 696  LYS C CA    1 
ATOM   8994  C  C     . LYS C 2 696  ? 64.741  4.601   109.782 1.00 117.94 ? 696  LYS C C     1 
ATOM   8995  O  O     . LYS C 2 696  ? 65.920  4.819   109.522 1.00 120.41 ? 696  LYS C O     1 
ATOM   8996  C  CB    . LYS C 2 696  ? 63.028  5.829   111.099 1.00 121.14 ? 696  LYS C CB    1 
ATOM   8997  C  CG    . LYS C 2 696  ? 61.863  6.831   111.210 1.00 117.51 ? 696  LYS C CG    1 
ATOM   8998  C  CD    . LYS C 2 696  ? 61.395  6.919   112.678 1.00 118.74 ? 696  LYS C CD    1 
ATOM   8999  C  CE    . LYS C 2 696  ? 60.267  7.929   112.914 1.00 116.26 ? 696  LYS C CE    1 
ATOM   9000  N  NZ    . LYS C 2 696  ? 60.170  8.314   114.361 1.00 109.69 ? 696  LYS C NZ    1 
ATOM   9001  N  N     . ARG C 2 697  ? 64.265  3.388   110.036 1.00 115.41 ? 697  ARG C N     1 
ATOM   9002  C  CA    . ARG C 2 697  ? 65.157  2.252   110.250 1.00 123.66 ? 697  ARG C CA    1 
ATOM   9003  C  C     . ARG C 2 697  ? 65.535  1.545   108.926 1.00 120.27 ? 697  ARG C C     1 
ATOM   9004  O  O     . ARG C 2 697  ? 66.074  0.435   108.904 1.00 119.08 ? 697  ARG C O     1 
ATOM   9005  C  CB    . ARG C 2 697  ? 64.708  1.344   111.423 1.00 127.58 ? 697  ARG C CB    1 
ATOM   9006  C  CG    . ARG C 2 697  ? 63.878  0.119   111.089 1.00 127.79 ? 697  ARG C CG    1 
ATOM   9007  C  CD    . ARG C 2 697  ? 63.630  -0.772  112.327 1.00 123.85 ? 697  ARG C CD    1 
ATOM   9008  N  NE    . ARG C 2 697  ? 62.712  -1.861  111.996 1.00 121.53 ? 697  ARG C NE    1 
ATOM   9009  C  CZ    . ARG C 2 697  ? 61.431  -1.698  111.650 1.00 116.22 ? 697  ARG C CZ    1 
ATOM   9010  N  NH1   . ARG C 2 697  ? 60.882  -0.484  111.593 1.00 108.21 ? 697  ARG C NH1   1 
ATOM   9011  N  NH2   . ARG C 2 697  ? 60.689  -2.759  111.356 1.00 111.96 ? 697  ARG C NH2   1 
ATOM   9012  N  N     . ASP C 2 698  ? 65.212  2.220   107.825 1.00 118.35 ? 698  ASP C N     1 
ATOM   9013  C  CA    . ASP C 2 698  ? 65.742  1.893   106.495 1.00 118.84 ? 698  ASP C CA    1 
ATOM   9014  C  C     . ASP C 2 698  ? 65.238  0.599   105.910 1.00 117.32 ? 698  ASP C C     1 
ATOM   9015  O  O     . ASP C 2 698  ? 65.966  -0.158  105.257 1.00 115.33 ? 698  ASP C O     1 
ATOM   9016  C  CB    . ASP C 2 698  ? 67.268  1.938   106.468 1.00 119.48 ? 698  ASP C CB    1 
ATOM   9017  C  CG    . ASP C 2 698  ? 67.792  3.231   105.888 1.00 122.84 ? 698  ASP C CG    1 
ATOM   9018  O  OD1   . ASP C 2 698  ? 68.859  3.708   106.336 1.00 123.16 ? 698  ASP C OD1   1 
ATOM   9019  O  OD2   . ASP C 2 698  ? 67.119  3.777   104.988 1.00 122.19 ? 698  ASP C OD2   1 
ATOM   9020  N  N     . PHE C 2 699  ? 63.961  0.371   106.152 1.00 116.25 ? 699  PHE C N     1 
ATOM   9021  C  CA    . PHE C 2 699  ? 63.230  -0.611  105.400 1.00 115.72 ? 699  PHE C CA    1 
ATOM   9022  C  C     . PHE C 2 699  ? 62.993  -0.065  103.994 1.00 113.50 ? 699  PHE C C     1 
ATOM   9023  O  O     . PHE C 2 699  ? 62.915  1.154   103.778 1.00 110.49 ? 699  PHE C O     1 
ATOM   9024  C  CB    . PHE C 2 699  ? 61.920  -0.933  106.113 1.00 108.88 ? 699  PHE C CB    1 
ATOM   9025  C  CG    . PHE C 2 699  ? 62.041  -2.050  107.093 1.00 106.95 ? 699  PHE C CG    1 
ATOM   9026  C  CD1   . PHE C 2 699  ? 62.938  -1.973  108.134 1.00 109.25 ? 699  PHE C CD1   1 
ATOM   9027  C  CD2   . PHE C 2 699  ? 61.268  -3.185  106.962 1.00 106.94 ? 699  PHE C CD2   1 
ATOM   9028  C  CE1   . PHE C 2 699  ? 63.055  -3.005  109.024 1.00 113.20 ? 699  PHE C CE1   1 
ATOM   9029  C  CE2   . PHE C 2 699  ? 61.384  -4.216  107.851 1.00 107.42 ? 699  PHE C CE2   1 
ATOM   9030  C  CZ    . PHE C 2 699  ? 62.275  -4.127  108.882 1.00 107.31 ? 699  PHE C CZ    1 
ATOM   9031  N  N     . TYR C 2 700  ? 62.948  -0.966  103.024 1.00 109.95 ? 700  TYR C N     1 
ATOM   9032  C  CA    . TYR C 2 700  ? 62.509  -0.599  101.690 1.00 110.08 ? 700  TYR C CA    1 
ATOM   9033  C  C     . TYR C 2 700  ? 63.463  0.347   100.976 1.00 116.99 ? 700  TYR C C     1 
ATOM   9034  O  O     . TYR C 2 700  ? 63.254  0.683   99.815  1.00 120.84 ? 700  TYR C O     1 
ATOM   9035  C  CB    . TYR C 2 700  ? 61.045  -0.113  101.708 1.00 105.55 ? 700  TYR C CB    1 
ATOM   9036  C  CG    . TYR C 2 700  ? 60.135  -1.273  102.029 1.00 105.37 ? 700  TYR C CG    1 
ATOM   9037  C  CD1   . TYR C 2 700  ? 59.817  -1.589  103.338 1.00 103.49 ? 700  TYR C CD1   1 
ATOM   9038  C  CD2   . TYR C 2 700  ? 59.670  -2.110  101.026 1.00 103.70 ? 700  TYR C CD2   1 
ATOM   9039  C  CE1   . TYR C 2 700  ? 59.029  -2.683  103.636 1.00 100.56 ? 700  TYR C CE1   1 
ATOM   9040  C  CE2   . TYR C 2 700  ? 58.878  -3.203  101.317 1.00 98.76  ? 700  TYR C CE2   1 
ATOM   9041  C  CZ    . TYR C 2 700  ? 58.562  -3.484  102.618 1.00 96.55  ? 700  TYR C CZ    1 
ATOM   9042  O  OH    . TYR C 2 700  ? 57.778  -4.576  102.887 1.00 96.62  ? 700  TYR C OH    1 
ATOM   9043  N  N     . THR C 2 701  ? 64.520  0.754   101.673 1.00 119.96 ? 701  THR C N     1 
ATOM   9044  C  CA    . THR C 2 701  ? 65.593  1.551   101.080 1.00 117.22 ? 701  THR C CA    1 
ATOM   9045  C  C     . THR C 2 701  ? 66.481  0.666   100.227 1.00 107.91 ? 701  THR C C     1 
ATOM   9046  O  O     . THR C 2 701  ? 66.939  -0.368  100.687 1.00 115.84 ? 701  THR C O     1 
ATOM   9047  C  CB    . THR C 2 701  ? 66.460  2.187   102.162 1.00 116.91 ? 701  THR C CB    1 
ATOM   9048  O  OG1   . THR C 2 701  ? 65.687  3.150   102.900 1.00 118.64 ? 701  THR C OG1   1 
ATOM   9049  C  CG2   . THR C 2 701  ? 67.642  2.855   101.525 1.00 113.90 ? 701  THR C CG2   1 
ATOM   9050  N  N     . SER C 2 702  ? 66.726  1.054   98.987  1.00 102.46 ? 702  SER C N     1 
ATOM   9051  C  CA    . SER C 2 702  ? 67.458  0.173   98.085  1.00 113.23 ? 702  SER C CA    1 
ATOM   9052  C  C     . SER C 2 702  ? 68.449  0.933   97.226  1.00 121.78 ? 702  SER C C     1 
ATOM   9053  O  O     . SER C 2 702  ? 68.278  2.136   96.996  1.00 123.57 ? 702  SER C O     1 
ATOM   9054  C  CB    . SER C 2 702  ? 66.479  -0.570  97.194  1.00 113.35 ? 702  SER C CB    1 
ATOM   9055  O  OG    . SER C 2 702  ? 65.436  0.299   96.798  1.00 111.90 ? 702  SER C OG    1 
ATOM   9056  N  N     . ILE C 2 703  ? 69.474  0.230   96.740  1.00 121.31 ? 703  ILE C N     1 
ATOM   9057  C  CA    . ILE C 2 703  ? 70.561  0.865   95.971  1.00 122.34 ? 703  ILE C CA    1 
ATOM   9058  C  C     . ILE C 2 703  ? 70.512  0.619   94.463  1.00 124.88 ? 703  ILE C C     1 
ATOM   9059  O  O     . ILE C 2 703  ? 70.347  -0.517  94.017  1.00 128.88 ? 703  ILE C O     1 
ATOM   9060  C  CB    . ILE C 2 703  ? 71.931  0.368   96.412  1.00 118.70 ? 703  ILE C CB    1 
ATOM   9061  C  CG1   . ILE C 2 703  ? 72.084  0.472   97.918  1.00 122.79 ? 703  ILE C CG1   1 
ATOM   9062  C  CG2   . ILE C 2 703  ? 73.015  1.163   95.723  1.00 118.89 ? 703  ILE C CG2   1 
ATOM   9063  C  CD1   . ILE C 2 703  ? 73.403  -0.066  98.407  1.00 128.18 ? 703  ILE C CD1   1 
ATOM   9064  N  N     . HIS C 2 704  ? 70.674  1.678   93.676  1.00 121.38 ? 704  HIS C N     1 
ATOM   9065  C  CA    . HIS C 2 704  ? 70.571  1.552   92.232  1.00 119.03 ? 704  HIS C CA    1 
ATOM   9066  C  C     . HIS C 2 704  ? 71.655  2.332   91.518  1.00 121.92 ? 704  HIS C C     1 
ATOM   9067  O  O     . HIS C 2 704  ? 71.712  3.554   91.630  1.00 128.19 ? 704  HIS C O     1 
ATOM   9068  C  CB    . HIS C 2 704  ? 69.194  2.040   91.776  1.00 123.22 ? 704  HIS C CB    1 
ATOM   9069  C  CG    . HIS C 2 704  ? 68.073  1.551   92.638  1.00 127.73 ? 704  HIS C CG    1 
ATOM   9070  N  ND1   . HIS C 2 704  ? 67.402  0.370   92.391  1.00 127.02 ? 704  HIS C ND1   1 
ATOM   9071  C  CD2   . HIS C 2 704  ? 67.519  2.068   93.763  1.00 123.19 ? 704  HIS C CD2   1 
ATOM   9072  C  CE1   . HIS C 2 704  ? 66.477  0.191   93.317  1.00 121.97 ? 704  HIS C CE1   1 
ATOM   9073  N  NE2   . HIS C 2 704  ? 66.527  1.204   94.161  1.00 120.76 ? 704  HIS C NE2   1 
ATOM   9074  N  N     . ILE C 2 705  ? 72.502  1.640   90.764  1.00 120.59 ? 705  ILE C N     1 
ATOM   9075  C  CA    . ILE C 2 705  ? 73.518  2.330   89.975  1.00 120.97 ? 705  ILE C CA    1 
ATOM   9076  C  C     . ILE C 2 705  ? 72.973  2.646   88.591  1.00 121.85 ? 705  ILE C C     1 
ATOM   9077  O  O     . ILE C 2 705  ? 72.325  1.807   87.959  1.00 121.08 ? 705  ILE C O     1 
ATOM   9078  C  CB    . ILE C 2 705  ? 74.823  1.508   89.826  1.00 118.18 ? 705  ILE C CB    1 
ATOM   9079  C  CG1   . ILE C 2 705  ? 75.476  1.238   91.179  1.00 113.65 ? 705  ILE C CG1   1 
ATOM   9080  C  CG2   . ILE C 2 705  ? 75.811  2.240   88.938  1.00 119.15 ? 705  ILE C CG2   1 
ATOM   9081  C  CD1   . ILE C 2 705  ? 74.970  0.005   91.873  1.00 116.25 ? 705  ILE C CD1   1 
ATOM   9082  N  N     . GLU C 2 706  ? 73.213  3.862   88.123  1.00 120.82 ? 706  GLU C N     1 
ATOM   9083  C  CA    . GLU C 2 706  ? 72.918  4.166   86.734  1.00 127.16 ? 706  GLU C CA    1 
ATOM   9084  C  C     . GLU C 2 706  ? 74.250  4.427   86.047  1.00 120.50 ? 706  GLU C C     1 
ATOM   9085  O  O     . GLU C 2 706  ? 75.212  4.813   86.697  1.00 120.71 ? 706  GLU C O     1 
ATOM   9086  C  CB    . GLU C 2 706  ? 71.939  5.347   86.621  1.00 134.63 ? 706  GLU C CB    1 
ATOM   9087  C  CG    . GLU C 2 706  ? 71.383  5.621   85.206  1.00 136.86 ? 706  GLU C CG    1 
ATOM   9088  C  CD    . GLU C 2 706  ? 70.811  4.385   84.499  1.00 138.83 ? 706  GLU C CD    1 
ATOM   9089  O  OE1   . GLU C 2 706  ? 70.203  3.521   85.175  1.00 138.87 ? 706  GLU C OE1   1 
ATOM   9090  O  OE2   . GLU C 2 706  ? 70.964  4.287   83.256  1.00 139.86 ? 706  GLU C OE2   1 
ATOM   9091  N  N     . ARG C 2 707  ? 74.324  4.164   84.749  1.00 120.11 ? 707  ARG C N     1 
ATOM   9092  C  CA    . ARG C 2 707  ? 75.554  4.398   84.002  1.00 125.69 ? 707  ARG C CA    1 
ATOM   9093  C  C     . ARG C 2 707  ? 75.316  5.417   82.899  1.00 131.10 ? 707  ARG C C     1 
ATOM   9094  O  O     . ARG C 2 707  ? 74.342  5.322   82.147  1.00 134.31 ? 707  ARG C O     1 
ATOM   9095  C  CB    . ARG C 2 707  ? 76.093  3.087   83.416  1.00 131.55 ? 707  ARG C CB    1 
ATOM   9096  C  CG    . ARG C 2 707  ? 77.231  3.236   82.412  1.00 128.62 ? 707  ARG C CG    1 
ATOM   9097  C  CD    . ARG C 2 707  ? 77.624  1.881   81.828  1.00 136.87 ? 707  ARG C CD    1 
ATOM   9098  N  NE    . ARG C 2 707  ? 77.632  1.879   80.363  1.00 152.32 ? 707  ARG C NE    1 
ATOM   9099  C  CZ    . ARG C 2 707  ? 78.060  0.866   79.605  1.00 161.91 ? 707  ARG C CZ    1 
ATOM   9100  N  NH1   . ARG C 2 707  ? 78.526  -0.244  80.168  1.00 166.58 ? 707  ARG C NH1   1 
ATOM   9101  N  NH2   . ARG C 2 707  ? 78.027  0.965   78.278  1.00 156.92 ? 707  ARG C NH2   1 
ATOM   9102  N  N     . TYR C 2 708  ? 76.204  6.403   82.832  1.00 128.64 ? 708  TYR C N     1 
ATOM   9103  C  CA    . TYR C 2 708  ? 76.187  7.414   81.791  1.00 124.31 ? 708  TYR C CA    1 
ATOM   9104  C  C     . TYR C 2 708  ? 77.498  7.193   81.041  1.00 131.89 ? 708  TYR C C     1 
ATOM   9105  O  O     . TYR C 2 708  ? 78.443  6.674   81.633  1