data_4GCK
# 
_entry.id   4GCK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4GCK         
NDB   NA1964       
RCSB  RCSB074013   
WWPDB D_1000074013 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3nxc 'slma, e. coli, apo' unspecified 
PDB 4GCL .                    unspecified 
PDB 4GCT .                    unspecified 
PDB 4GCU .                    unspecified 
PDB 4GFK .                    unspecified 
PDB 4GFL .                    unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4GCK 
_pdbx_database_status.recvd_initial_deposition_date   2012-07-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name           'Schumacher, M.A.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
'SlmA forms a higher-order structure on DNA that inhibits cytokinetic Z-ring formation over the nucleoid.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            110 
_citation.page_first                10586 
_citation.page_last                 10591 
_citation.year                      2013 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23754405 
_citation.pdbx_database_id_DOI      10.1073/pnas.1221036110 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tonthat, N.K.'    1 
primary 'Milam, S.L.'      2 
primary 'Chinnam, N.'      3 
primary 'Whitfill, T.'     4 
primary 'Margolin, W.'     5 
primary 'Schumacher, M.A.' 6 
# 
_cell.entry_id           4GCK 
_cell.length_a           71.490 
_cell.length_b           80.750 
_cell.length_c           201.300 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4GCK 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Nucleoid occlusion factor SlmA'                     24381.303 4   ? ? ? ? 
2 polymer syn 
;DNA (5'-D(*GP*TP*GP*AP*GP*TP*AP*CP*TP*CP*AP*C)-3')
;
3662.404  2   ? ? ? ? 
3 water   nat water                                                18.015    448 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MPPGKCLFSGVFCNMAEKQTAKRNRREEILQSLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFI
EDSLITRINLILKDEKDTTARLRLIVLLILGFGERNPGLTRILTGHALMFEQDRLQGRINQLFERIEVQLRQVMREKKMR
EGEGYTLDETLLASQLLAFCEGMLSRFVRSEFKYRPTDDFEARWPLVAAQLQ
;
;MPPGKCLFSGVFCNMAEKQTAKRNRREEILQSLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFI
EDSLITRINLILKDEKDTTARLRLIVLLILGFGERNPGLTRILTGHALMFEQDRLQGRINQLFERIEVQLRQVMREKKMR
EGEGYTLDETLLASQLLAFCEGMLSRFVRSEFKYRPTDDFEARWPLVAAQLQ
;
A,B,C,D ? 
2 polydeoxyribonucleotide no no '(DG)(DT)(DG)(DA)(DG)(DT)(DA)(DC)(DT)(DC)(DA)(DC)' GTGAGTACTCAC W,Z     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   PRO n 
1 4   GLY n 
1 5   LYS n 
1 6   CYS n 
1 7   LEU n 
1 8   PHE n 
1 9   SER n 
1 10  GLY n 
1 11  VAL n 
1 12  PHE n 
1 13  CYS n 
1 14  ASN n 
1 15  MET n 
1 16  ALA n 
1 17  GLU n 
1 18  LYS n 
1 19  GLN n 
1 20  THR n 
1 21  ALA n 
1 22  LYS n 
1 23  ARG n 
1 24  ASN n 
1 25  ARG n 
1 26  ARG n 
1 27  GLU n 
1 28  GLU n 
1 29  ILE n 
1 30  LEU n 
1 31  GLN n 
1 32  SER n 
1 33  LEU n 
1 34  ALA n 
1 35  LEU n 
1 36  MET n 
1 37  LEU n 
1 38  GLU n 
1 39  SER n 
1 40  SER n 
1 41  ASP n 
1 42  GLY n 
1 43  SER n 
1 44  GLN n 
1 45  ARG n 
1 46  ILE n 
1 47  THR n 
1 48  THR n 
1 49  ALA n 
1 50  LYS n 
1 51  LEU n 
1 52  ALA n 
1 53  ALA n 
1 54  SER n 
1 55  VAL n 
1 56  GLY n 
1 57  VAL n 
1 58  SER n 
1 59  GLU n 
1 60  ALA n 
1 61  ALA n 
1 62  LEU n 
1 63  TYR n 
1 64  ARG n 
1 65  HIS n 
1 66  PHE n 
1 67  PRO n 
1 68  SER n 
1 69  LYS n 
1 70  THR n 
1 71  ARG n 
1 72  MET n 
1 73  PHE n 
1 74  ASP n 
1 75  SER n 
1 76  LEU n 
1 77  ILE n 
1 78  GLU n 
1 79  PHE n 
1 80  ILE n 
1 81  GLU n 
1 82  ASP n 
1 83  SER n 
1 84  LEU n 
1 85  ILE n 
1 86  THR n 
1 87  ARG n 
1 88  ILE n 
1 89  ASN n 
1 90  LEU n 
1 91  ILE n 
1 92  LEU n 
1 93  LYS n 
1 94  ASP n 
1 95  GLU n 
1 96  LYS n 
1 97  ASP n 
1 98  THR n 
1 99  THR n 
1 100 ALA n 
1 101 ARG n 
1 102 LEU n 
1 103 ARG n 
1 104 LEU n 
1 105 ILE n 
1 106 VAL n 
1 107 LEU n 
1 108 LEU n 
1 109 ILE n 
1 110 LEU n 
1 111 GLY n 
1 112 PHE n 
1 113 GLY n 
1 114 GLU n 
1 115 ARG n 
1 116 ASN n 
1 117 PRO n 
1 118 GLY n 
1 119 LEU n 
1 120 THR n 
1 121 ARG n 
1 122 ILE n 
1 123 LEU n 
1 124 THR n 
1 125 GLY n 
1 126 HIS n 
1 127 ALA n 
1 128 LEU n 
1 129 MET n 
1 130 PHE n 
1 131 GLU n 
1 132 GLN n 
1 133 ASP n 
1 134 ARG n 
1 135 LEU n 
1 136 GLN n 
1 137 GLY n 
1 138 ARG n 
1 139 ILE n 
1 140 ASN n 
1 141 GLN n 
1 142 LEU n 
1 143 PHE n 
1 144 GLU n 
1 145 ARG n 
1 146 ILE n 
1 147 GLU n 
1 148 VAL n 
1 149 GLN n 
1 150 LEU n 
1 151 ARG n 
1 152 GLN n 
1 153 VAL n 
1 154 MET n 
1 155 ARG n 
1 156 GLU n 
1 157 LYS n 
1 158 LYS n 
1 159 MET n 
1 160 ARG n 
1 161 GLU n 
1 162 GLY n 
1 163 GLU n 
1 164 GLY n 
1 165 TYR n 
1 166 THR n 
1 167 LEU n 
1 168 ASP n 
1 169 GLU n 
1 170 THR n 
1 171 LEU n 
1 172 LEU n 
1 173 ALA n 
1 174 SER n 
1 175 GLN n 
1 176 LEU n 
1 177 LEU n 
1 178 ALA n 
1 179 PHE n 
1 180 CYS n 
1 181 GLU n 
1 182 GLY n 
1 183 MET n 
1 184 LEU n 
1 185 SER n 
1 186 ARG n 
1 187 PHE n 
1 188 VAL n 
1 189 ARG n 
1 190 SER n 
1 191 GLU n 
1 192 PHE n 
1 193 LYS n 
1 194 TYR n 
1 195 ARG n 
1 196 PRO n 
1 197 THR n 
1 198 ASP n 
1 199 ASP n 
1 200 PHE n 
1 201 GLU n 
1 202 ALA n 
1 203 ARG n 
1 204 TRP n 
1 205 PRO n 
1 206 LEU n 
1 207 VAL n 
1 208 ALA n 
1 209 ALA n 
1 210 GLN n 
1 211 LEU n 
1 212 GLN n 
2 1   DG  n 
2 2   DT  n 
2 3   DG  n 
2 4   DA  n 
2 5   DG  n 
2 6   DT  n 
2 7   DA  n 
2 8   DC  n 
2 9   DT  n 
2 10  DC  n 
2 11  DA  n 
2 12  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'slmA, KPK_0113' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    342 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Klebsiella pneumoniae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     507522 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP SLMA_KLEP3 B5XTG2 1 
;MAEKQTAKRNRREEILQSLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKD
EKDTTARLRLIVLLILGFGERNPGLTRILTGHALMFEQDRLQGRINQLFERIEVQLRQVMREKKMREGEGYTLDETLLAS
QLLAFCEGMLSRFVRSEFKYRPTDDFEARWPLVAAQLQ
;
1 ? 
2 PDB 4GCK       4GCK   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4GCK A 15 ? 212 ? B5XTG2 1  ? 198 ? 1  198 
2 1 4GCK B 15 ? 212 ? B5XTG2 1  ? 198 ? 1  198 
3 1 4GCK C 15 ? 212 ? B5XTG2 1  ? 198 ? 1  198 
4 1 4GCK D 15 ? 212 ? B5XTG2 1  ? 198 ? 1  198 
5 2 4GCK W 1  ? 12  ? 4GCK   2  ? 13  ? 2  13  
6 2 4GCK Z 1  ? 12  ? 4GCK   23 ? 34  ? 23 34  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4GCK MET A 1  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -13 1  
1 4GCK PRO A 2  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -12 2  
1 4GCK PRO A 3  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -11 3  
1 4GCK GLY A 4  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -10 4  
1 4GCK LYS A 5  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -9  5  
1 4GCK CYS A 6  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -8  6  
1 4GCK LEU A 7  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -7  7  
1 4GCK PHE A 8  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -6  8  
1 4GCK SER A 9  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -5  9  
1 4GCK GLY A 10 ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -4  10 
1 4GCK VAL A 11 ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -3  11 
1 4GCK PHE A 12 ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -2  12 
1 4GCK CYS A 13 ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -1  13 
1 4GCK ASN A 14 ? UNP B5XTG2 ? ? 'EXPRESSION TAG' 0   14 
2 4GCK MET B 1  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -13 15 
2 4GCK PRO B 2  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -12 16 
2 4GCK PRO B 3  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -11 17 
2 4GCK GLY B 4  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -10 18 
2 4GCK LYS B 5  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -9  19 
2 4GCK CYS B 6  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -8  20 
2 4GCK LEU B 7  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -7  21 
2 4GCK PHE B 8  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -6  22 
2 4GCK SER B 9  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -5  23 
2 4GCK GLY B 10 ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -4  24 
2 4GCK VAL B 11 ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -3  25 
2 4GCK PHE B 12 ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -2  26 
2 4GCK CYS B 13 ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -1  27 
2 4GCK ASN B 14 ? UNP B5XTG2 ? ? 'EXPRESSION TAG' 0   28 
3 4GCK MET C 1  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -13 29 
3 4GCK PRO C 2  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -12 30 
3 4GCK PRO C 3  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -11 31 
3 4GCK GLY C 4  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -10 32 
3 4GCK LYS C 5  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -9  33 
3 4GCK CYS C 6  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -8  34 
3 4GCK LEU C 7  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -7  35 
3 4GCK PHE C 8  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -6  36 
3 4GCK SER C 9  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -5  37 
3 4GCK GLY C 10 ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -4  38 
3 4GCK VAL C 11 ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -3  39 
3 4GCK PHE C 12 ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -2  40 
3 4GCK CYS C 13 ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -1  41 
3 4GCK ASN C 14 ? UNP B5XTG2 ? ? 'EXPRESSION TAG' 0   42 
4 4GCK MET D 1  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -13 43 
4 4GCK PRO D 2  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -12 44 
4 4GCK PRO D 3  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -11 45 
4 4GCK GLY D 4  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -10 46 
4 4GCK LYS D 5  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -9  47 
4 4GCK CYS D 6  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -8  48 
4 4GCK LEU D 7  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -7  49 
4 4GCK PHE D 8  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -6  50 
4 4GCK SER D 9  ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -5  51 
4 4GCK GLY D 10 ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -4  52 
4 4GCK VAL D 11 ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -3  53 
4 4GCK PHE D 12 ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -2  54 
4 4GCK CYS D 13 ? UNP B5XTG2 ? ? 'EXPRESSION TAG' -1  55 
4 4GCK ASN D 14 ? UNP B5XTG2 ? ? 'EXPRESSION TAG' 0   56 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          4GCK 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.77 
_exptl_crystal.density_percent_sol   55.61 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    '200 mM phosphate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2011-04-12 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    mirrors 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.03 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 8.3.1' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   8.3.1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.03 
# 
_reflns.entry_id                     4GCK 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             74 
_reflns.d_resolution_high            2.05 
_reflns.number_obs                   70400 
_reflns.number_all                   70495 
_reflns.percent_possible_obs         99 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        23.2 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 4GCK 
_refine.ls_number_reflns_obs                     70239 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               2784819.54 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             74 
_refine.ls_d_res_high                            2.05 
_refine.ls_percent_reflns_obs                    94.8 
_refine.ls_R_factor_obs                          0.218 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.218 
_refine.ls_R_factor_R_free                       0.243 
_refine.ls_R_factor_R_free_error                 0.003 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  7056 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               37.3 
_refine.aniso_B[1][1]                            -6.49 
_refine.aniso_B[2][2]                            18.51 
_refine.aniso_B[3][3]                            -12.02 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.4 
_refine.solvent_model_param_bsol                 59.2251 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'BULK SOLVENT MODEL USED' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        4GCK 
_refine_analyze.Luzzati_coordinate_error_obs    0.26 
_refine_analyze.Luzzati_sigma_a_obs             0.40 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.30 
_refine_analyze.Luzzati_sigma_a_free            0.45 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6154 
_refine_hist.pdbx_number_atoms_nucleic_acid   486 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             448 
_refine_hist.number_atoms_total               7088 
_refine_hist.d_res_high                       2.05 
_refine_hist.d_res_low                        74 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
c_bond_d           0.011 ?    ? ? ? 'X-RAY DIFFRACTION' 
c_angle_deg        1.4   ?    ? ? ? 'X-RAY DIFFRACTION' 
c_dihedral_angle_d 19.9  ?    ? ? ? 'X-RAY DIFFRACTION' 
c_improper_angle_d 1.04  ?    ? ? ? 'X-RAY DIFFRACTION' 
c_mcbond_it        3.07  1.50 ? ? ? 'X-RAY DIFFRACTION' 
c_mcangle_it       4.04  2.00 ? ? ? 'X-RAY DIFFRACTION' 
c_scbond_it        5.33  2.00 ? ? ? 'X-RAY DIFFRACTION' 
c_scangle_it       7.05  2.50 ? ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.05 
_refine_ls_shell.d_res_low                        2.18 
_refine_ls_shell.number_reflns_R_work             10228 
_refine_ls_shell.R_factor_R_work                  0.349 
_refine_ls_shell.percent_reflns_obs               93.8 
_refine_ls_shell.R_factor_R_free                  0.371 
_refine_ls_shell.R_factor_R_free_error            0.011 
_refine_ls_shell.percent_reflns_R_free            10.4 
_refine_ls_shell.number_reflns_R_free             1189 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 water_rep.param   water.top   'X-RAY DIFFRACTION' 
3 ion.param         ion.top     'X-RAY DIFFRACTION' 
4 dna-rna_rep.param dna-rna.top 'X-RAY DIFFRACTION' 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  4GCK 
_struct.title                     'structure of no-dna complex' 
_struct.pdbx_descriptor           'Nucleoid occlusion factor SlmA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4GCK 
_struct_keywords.pdbx_keywords   'dna binding protein/DNA' 
_struct_keywords.text            'no, dna binding, dna binding protein-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 23  ? SER A 39  ? ARG A 9   SER A 25  1 ? 17 
HELX_P HELX_P2  2  SER A 40  ? GLN A 44  ? SER A 26  GLN A 30  5 ? 5  
HELX_P HELX_P3  3  THR A 47  ? GLY A 56  ? THR A 33  GLY A 42  1 ? 10 
HELX_P HELX_P4  4  SER A 58  ? PHE A 66  ? SER A 44  PHE A 52  1 ? 9  
HELX_P HELX_P5  5  SER A 68  ? GLU A 95  ? SER A 54  GLU A 81  1 ? 28 
HELX_P HELX_P6  6  ASP A 97  ? ASN A 116 ? ASP A 83  ASN A 102 1 ? 20 
HELX_P HELX_P7  7  ASN A 116 ? THR A 124 ? ASN A 102 THR A 110 1 ? 9  
HELX_P HELX_P8  8  HIS A 126 ? GLU A 131 ? HIS A 112 GLU A 117 5 ? 6  
HELX_P HELX_P9  9  GLN A 132 ? GLY A 162 ? GLN A 118 GLY A 148 1 ? 31 
HELX_P HELX_P10 10 ASP A 168 ? SER A 190 ? ASP A 154 SER A 176 1 ? 23 
HELX_P HELX_P11 11 ASP A 199 ? ALA A 209 ? ASP A 185 ALA A 195 1 ? 11 
HELX_P HELX_P12 12 ARG B 25  ? SER B 39  ? ARG B 11  SER B 25  1 ? 15 
HELX_P HELX_P13 13 SER B 40  ? GLN B 44  ? SER B 26  GLN B 30  5 ? 5  
HELX_P HELX_P14 14 THR B 47  ? GLY B 56  ? THR B 33  GLY B 42  1 ? 10 
HELX_P HELX_P15 15 SER B 58  ? TYR B 63  ? SER B 44  TYR B 49  1 ? 6  
HELX_P HELX_P16 16 SER B 68  ? GLU B 95  ? SER B 54  GLU B 81  1 ? 28 
HELX_P HELX_P17 17 ASP B 97  ? ASN B 116 ? ASP B 83  ASN B 102 1 ? 20 
HELX_P HELX_P18 18 ASN B 116 ? THR B 124 ? ASN B 102 THR B 110 1 ? 9  
HELX_P HELX_P19 19 HIS B 126 ? GLN B 132 ? HIS B 112 GLN B 118 5 ? 7  
HELX_P HELX_P20 20 ASP B 133 ? GLU B 156 ? ASP B 119 GLU B 142 1 ? 24 
HELX_P HELX_P21 21 GLU B 156 ? GLY B 162 ? GLU B 142 GLY B 148 1 ? 7  
HELX_P HELX_P22 22 ASP B 168 ? SER B 190 ? ASP B 154 SER B 176 1 ? 23 
HELX_P HELX_P23 23 ASP B 199 ? GLN B 210 ? ASP B 185 GLN B 196 1 ? 12 
HELX_P HELX_P24 24 ASN C 24  ? SER C 39  ? ASN C 10  SER C 25  1 ? 16 
HELX_P HELX_P25 25 SER C 40  ? GLN C 44  ? SER C 26  GLN C 30  5 ? 5  
HELX_P HELX_P26 26 THR C 47  ? GLY C 56  ? THR C 33  GLY C 42  1 ? 10 
HELX_P HELX_P27 27 SER C 58  ? ARG C 64  ? SER C 44  ARG C 50  1 ? 7  
HELX_P HELX_P28 28 SER C 68  ? GLU C 95  ? SER C 54  GLU C 81  1 ? 28 
HELX_P HELX_P29 29 ASP C 97  ? ASN C 116 ? ASP C 83  ASN C 102 1 ? 20 
HELX_P HELX_P30 30 ASN C 116 ? THR C 124 ? ASN C 102 THR C 110 1 ? 9  
HELX_P HELX_P31 31 HIS C 126 ? GLU C 131 ? HIS C 112 GLU C 117 5 ? 6  
HELX_P HELX_P32 32 GLN C 132 ? GLY C 162 ? GLN C 118 GLY C 148 1 ? 31 
HELX_P HELX_P33 33 ASP C 168 ? SER C 190 ? ASP C 154 SER C 176 1 ? 23 
HELX_P HELX_P34 34 ASP C 199 ? ALA C 209 ? ASP C 185 ALA C 195 1 ? 11 
HELX_P HELX_P35 35 ARG D 25  ? SER D 39  ? ARG D 11  SER D 25  1 ? 15 
HELX_P HELX_P36 36 THR D 47  ? GLY D 56  ? THR D 33  GLY D 42  1 ? 10 
HELX_P HELX_P37 37 SER D 58  ? TYR D 63  ? SER D 44  TYR D 49  1 ? 6  
HELX_P HELX_P38 38 SER D 68  ? GLU D 95  ? SER D 54  GLU D 81  1 ? 28 
HELX_P HELX_P39 39 ASP D 97  ? ASN D 116 ? ASP D 83  ASN D 102 1 ? 20 
HELX_P HELX_P40 40 ASN D 116 ? THR D 124 ? ASN D 102 THR D 110 1 ? 9  
HELX_P HELX_P41 41 HIS D 126 ? GLN D 132 ? HIS D 112 GLN D 118 5 ? 7  
HELX_P HELX_P42 42 ASP D 133 ? GLU D 156 ? ASP D 119 GLU D 142 1 ? 24 
HELX_P HELX_P43 43 GLU D 156 ? GLY D 162 ? GLU D 142 GLY D 148 1 ? 7  
HELX_P HELX_P44 44 ASP D 168 ? SER D 190 ? ASP D 154 SER D 176 1 ? 23 
HELX_P HELX_P45 45 ASP D 199 ? ALA D 209 ? ASP D 185 ALA D 195 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? E DG 1  N1 ? ? ? 1_555 F DC 12 N3 ? ? W DG 2  Z DC 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? E DG 1  N2 ? ? ? 1_555 F DC 12 O2 ? ? W DG 2  Z DC 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? E DG 1  O6 ? ? ? 1_555 F DC 12 N4 ? ? W DG 2  Z DC 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? E DT 2  N3 ? ? ? 1_555 F DA 11 N1 ? ? W DT 3  Z DA 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? E DT 2  O4 ? ? ? 1_555 F DA 11 N6 ? ? W DT 3  Z DA 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? E DG 3  N1 ? ? ? 1_555 F DC 10 N3 ? ? W DG 4  Z DC 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? E DG 3  N2 ? ? ? 1_555 F DC 10 O2 ? ? W DG 4  Z DC 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? E DG 3  O6 ? ? ? 1_555 F DC 10 N4 ? ? W DG 4  Z DC 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? E DA 4  N1 ? ? ? 1_555 F DT 9  N3 ? ? W DA 5  Z DT 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? E DA 4  N6 ? ? ? 1_555 F DT 9  O4 ? ? W DA 5  Z DT 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? E DG 5  N1 ? ? ? 1_555 F DC 8  N3 ? ? W DG 6  Z DC 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? E DG 5  N2 ? ? ? 1_555 F DC 8  O2 ? ? W DG 6  Z DC 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? E DG 5  O6 ? ? ? 1_555 F DC 8  N4 ? ? W DG 6  Z DC 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? E DT 6  N3 ? ? ? 1_555 F DA 7  N1 ? ? W DT 7  Z DA 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? E DT 6  O4 ? ? ? 1_555 F DA 7  N6 ? ? W DT 7  Z DA 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? E DA 7  N1 ? ? ? 1_555 F DT 6  N3 ? ? W DA 8  Z DT 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? E DA 7  N6 ? ? ? 1_555 F DT 6  O4 ? ? W DA 8  Z DT 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? E DC 8  N3 ? ? ? 1_555 F DG 5  N1 ? ? W DC 9  Z DG 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? E DC 8  N4 ? ? ? 1_555 F DG 5  O6 ? ? W DC 9  Z DG 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? E DC 8  O2 ? ? ? 1_555 F DG 5  N2 ? ? W DC 9  Z DG 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? E DT 9  N3 ? ? ? 1_555 F DA 4  N1 ? ? W DT 10 Z DA 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? E DT 9  O4 ? ? ? 1_555 F DA 4  N6 ? ? W DT 10 Z DA 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? E DC 10 N3 ? ? ? 1_555 F DG 3  N1 ? ? W DC 11 Z DG 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? E DC 10 N4 ? ? ? 1_555 F DG 3  O6 ? ? W DC 11 Z DG 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? E DC 10 O2 ? ? ? 1_555 F DG 3  N2 ? ? W DC 11 Z DG 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? E DA 11 N1 ? ? ? 1_555 F DT 2  N3 ? ? W DA 12 Z DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? E DA 11 N6 ? ? ? 1_555 F DT 2  O4 ? ? W DA 12 Z DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? E DC 12 N3 ? ? ? 1_555 F DG 1  N1 ? ? W DC 13 Z DG 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? E DC 12 N4 ? ? ? 1_555 F DG 1  O6 ? ? W DC 13 Z DG 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? E DC 12 O2 ? ? ? 1_555 F DG 1  N2 ? ? W DC 13 Z DG 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_database_PDB_matrix.entry_id          4GCK 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4GCK 
_atom_sites.fract_transf_matrix[1][1]   0.013988 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012384 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004968 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . ARG A 1 23  ? -21.920 -3.845  56.722  1.00 83.85  ? 9   ARG A N     1 
ATOM   2    C CA    . ARG A 1 23  ? -22.721 -4.349  57.879  1.00 84.25  ? 9   ARG A CA    1 
ATOM   3    C C     . ARG A 1 23  ? -21.783 -5.003  58.880  1.00 80.92  ? 9   ARG A C     1 
ATOM   4    O O     . ARG A 1 23  ? -20.772 -4.423  59.290  1.00 73.27  ? 9   ARG A O     1 
ATOM   5    C CB    . ARG A 1 23  ? -23.754 -5.385  57.404  1.00 85.75  ? 9   ARG A CB    1 
ATOM   6    C CG    . ARG A 1 23  ? -24.790 -4.846  56.429  1.00 87.72  ? 9   ARG A CG    1 
ATOM   7    C CD    . ARG A 1 23  ? -25.260 -5.934  55.491  1.00 88.92  ? 9   ARG A CD    1 
ATOM   8    N NE    . ARG A 1 23  ? -24.136 -6.708  54.970  1.00 94.46  ? 9   ARG A NE    1 
ATOM   9    C CZ    . ARG A 1 23  ? -23.026 -6.185  54.455  1.00 96.77  ? 9   ARG A CZ    1 
ATOM   10   N NH1   . ARG A 1 23  ? -22.865 -4.869  54.384  1.00 97.06  ? 9   ARG A NH1   1 
ATOM   11   N NH2   . ARG A 1 23  ? -22.072 -6.985  53.997  1.00 98.57  ? 9   ARG A NH2   1 
ATOM   12   N N     . ASN A 1 24  ? -22.140 -6.219  59.274  1.00 79.73  ? 10  ASN A N     1 
ATOM   13   C CA    . ASN A 1 24  ? -21.326 -6.973  60.201  1.00 78.31  ? 10  ASN A CA    1 
ATOM   14   C C     . ASN A 1 24  ? -20.079 -7.314  59.416  1.00 74.98  ? 10  ASN A C     1 
ATOM   15   O O     . ASN A 1 24  ? -19.062 -7.660  60.001  1.00 74.96  ? 10  ASN A O     1 
ATOM   16   C CB    . ASN A 1 24  ? -22.027 -8.264  60.615  1.00 79.70  ? 10  ASN A CB    1 
ATOM   17   C CG    . ASN A 1 24  ? -23.528 -8.116  60.665  1.00 83.16  ? 10  ASN A CG    1 
ATOM   18   O OD1   . ASN A 1 24  ? -24.072 -7.366  61.479  1.00 84.82  ? 10  ASN A OD1   1 
ATOM   19   N ND2   . ASN A 1 24  ? -24.212 -8.830  59.781  1.00 84.75  ? 10  ASN A ND2   1 
ATOM   20   N N     . ARG A 1 25  ? -20.171 -7.210  58.088  1.00 72.83  ? 11  ARG A N     1 
ATOM   21   C CA    . ARG A 1 25  ? -19.045 -7.520  57.198  1.00 69.68  ? 11  ARG A CA    1 
ATOM   22   C C     . ARG A 1 25  ? -17.924 -6.466  57.261  1.00 62.32  ? 11  ARG A C     1 
ATOM   23   O O     . ARG A 1 25  ? -16.741 -6.806  57.259  1.00 56.11  ? 11  ARG A O     1 
ATOM   24   C CB    . ARG A 1 25  ? -19.544 -7.685  55.755  1.00 73.64  ? 11  ARG A CB    1 
ATOM   25   C CG    . ARG A 1 25  ? -18.690 -8.644  54.910  1.00 81.80  ? 11  ARG A CG    1 
ATOM   26   C CD    . ARG A 1 25  ? -19.423 -9.087  53.626  1.00 92.03  ? 11  ARG A CD    1 
ATOM   27   N NE    . ARG A 1 25  ? -18.738 -10.178 52.921  1.00 96.91  ? 11  ARG A NE    1 
ATOM   28   C CZ    . ARG A 1 25  ? -17.802 -10.022 51.984  1.00 95.68  ? 11  ARG A CZ    1 
ATOM   29   N NH1   . ARG A 1 25  ? -17.250 -11.093 51.423  1.00 97.31  ? 11  ARG A NH1   1 
ATOM   30   N NH2   . ARG A 1 25  ? -17.428 -8.809  51.592  1.00 91.29  ? 11  ARG A NH2   1 
ATOM   31   N N     . ARG A 1 26  ? -18.299 -5.191  57.318  1.00 57.84  ? 12  ARG A N     1 
ATOM   32   C CA    . ARG A 1 26  ? -17.317 -4.126  57.420  1.00 52.77  ? 12  ARG A CA    1 
ATOM   33   C C     . ARG A 1 26  ? -16.647 -4.273  58.791  1.00 52.21  ? 12  ARG A C     1 
ATOM   34   O O     . ARG A 1 26  ? -15.428 -4.401  58.890  1.00 44.87  ? 12  ARG A O     1 
ATOM   35   C CB    . ARG A 1 26  ? -18.003 -2.766  57.319  1.00 55.48  ? 12  ARG A CB    1 
ATOM   36   C CG    . ARG A 1 26  ? -17.072 -1.599  57.599  1.00 62.27  ? 12  ARG A CG    1 
ATOM   37   C CD    . ARG A 1 26  ? -17.750 -0.551  58.471  1.00 68.65  ? 12  ARG A CD    1 
ATOM   38   N NE    . ARG A 1 26  ? -16.827 0.434   59.049  1.00 70.52  ? 12  ARG A NE    1 
ATOM   39   C CZ    . ARG A 1 26  ? -16.085 1.294   58.347  1.00 71.10  ? 12  ARG A CZ    1 
ATOM   40   N NH1   . ARG A 1 26  ? -15.292 2.146   58.988  1.00 68.35  ? 12  ARG A NH1   1 
ATOM   41   N NH2   . ARG A 1 26  ? -16.125 1.307   57.012  1.00 66.48  ? 12  ARG A NH2   1 
ATOM   42   N N     . GLU A 1 27  ? -17.467 -4.268  59.841  1.00 50.19  ? 13  GLU A N     1 
ATOM   43   C CA    . GLU A 1 27  ? -16.996 -4.414  61.210  1.00 46.56  ? 13  GLU A CA    1 
ATOM   44   C C     . GLU A 1 27  ? -16.231 -5.714  61.391  1.00 45.61  ? 13  GLU A C     1 
ATOM   45   O O     . GLU A 1 27  ? -15.273 -5.795  62.174  1.00 47.49  ? 13  GLU A O     1 
ATOM   46   C CB    . GLU A 1 27  ? -18.175 -4.379  62.179  1.00 49.41  ? 13  GLU A CB    1 
ATOM   47   C CG    . GLU A 1 27  ? -18.556 -2.976  62.627  1.00 63.02  ? 13  GLU A CG    1 
ATOM   48   C CD    . GLU A 1 27  ? -17.341 -2.139  63.060  1.00 68.74  ? 13  GLU A CD    1 
ATOM   49   O OE1   . GLU A 1 27  ? -16.510 -2.646  63.855  1.00 65.01  ? 13  GLU A OE1   1 
ATOM   50   O OE2   . GLU A 1 27  ? -17.225 -0.970  62.605  1.00 70.75  ? 13  GLU A OE2   1 
ATOM   51   N N     . GLU A 1 28  ? -16.660 -6.734  60.669  1.00 38.94  ? 14  GLU A N     1 
ATOM   52   C CA    . GLU A 1 28  ? -16.014 -8.028  60.719  1.00 43.38  ? 14  GLU A CA    1 
ATOM   53   C C     . GLU A 1 28  ? -14.568 -7.890  60.240  1.00 41.07  ? 14  GLU A C     1 
ATOM   54   O O     . GLU A 1 28  ? -13.642 -8.339  60.911  1.00 43.62  ? 14  GLU A O     1 
ATOM   55   C CB    . GLU A 1 28  ? -16.748 -8.988  59.805  1.00 47.68  ? 14  GLU A CB    1 
ATOM   56   C CG    . GLU A 1 28  ? -16.912 -10.378 60.328  1.00 59.20  ? 14  GLU A CG    1 
ATOM   57   C CD    . GLU A 1 28  ? -17.639 -11.253 59.325  1.00 68.30  ? 14  GLU A CD    1 
ATOM   58   O OE1   . GLU A 1 28  ? -18.803 -10.934 58.978  1.00 69.16  ? 14  GLU A OE1   1 
ATOM   59   O OE2   . GLU A 1 28  ? -17.040 -12.254 58.876  1.00 75.81  ? 14  GLU A OE2   1 
ATOM   60   N N     . ILE A 1 29  ? -14.373 -7.281  59.070  1.00 38.23  ? 15  ILE A N     1 
ATOM   61   C CA    . ILE A 1 29  ? -13.028 -7.111  58.549  1.00 35.01  ? 15  ILE A CA    1 
ATOM   62   C C     . ILE A 1 29  ? -12.160 -6.406  59.598  1.00 31.62  ? 15  ILE A C     1 
ATOM   63   O O     . ILE A 1 29  ? -11.014 -6.829  59.866  1.00 31.05  ? 15  ILE A O     1 
ATOM   64   C CB    . ILE A 1 29  ? -13.036 -6.306  57.235  1.00 34.92  ? 15  ILE A CB    1 
ATOM   65   C CG1   . ILE A 1 29  ? -13.656 -7.160  56.136  1.00 35.07  ? 15  ILE A CG1   1 
ATOM   66   C CG2   . ILE A 1 29  ? -11.613 -5.874  56.850  1.00 30.51  ? 15  ILE A CG2   1 
ATOM   67   C CD1   . ILE A 1 29  ? -14.231 -6.339  54.985  1.00 34.25  ? 15  ILE A CD1   1 
ATOM   68   N N     . LEU A 1 30  ? -12.708 -5.345  60.182  1.00 25.23  ? 16  LEU A N     1 
ATOM   69   C CA    . LEU A 1 30  ? -12.007 -4.580  61.203  1.00 31.91  ? 16  LEU A CA    1 
ATOM   70   C C     . LEU A 1 30  ? -11.645 -5.435  62.404  1.00 28.80  ? 16  LEU A C     1 
ATOM   71   O O     . LEU A 1 30  ? -10.541 -5.331  62.949  1.00 26.75  ? 16  LEU A O     1 
ATOM   72   C CB    . LEU A 1 30  ? -12.861 -3.396  61.649  1.00 28.22  ? 16  LEU A CB    1 
ATOM   73   C CG    . LEU A 1 30  ? -12.984 -2.309  60.585  1.00 30.17  ? 16  LEU A CG    1 
ATOM   74   C CD1   . LEU A 1 30  ? -13.584 -1.051  61.210  1.00 28.81  ? 16  LEU A CD1   1 
ATOM   75   C CD2   . LEU A 1 30  ? -11.585 -1.999  60.028  1.00 31.79  ? 16  LEU A CD2   1 
ATOM   76   N N     . GLN A 1 31  ? -12.575 -6.294  62.800  1.00 33.00  ? 17  GLN A N     1 
ATOM   77   C CA    . GLN A 1 31  ? -12.344 -7.169  63.927  1.00 37.10  ? 17  GLN A CA    1 
ATOM   78   C C     . GLN A 1 31  ? -11.224 -8.138  63.607  1.00 39.26  ? 17  GLN A C     1 
ATOM   79   O O     . GLN A 1 31  ? -10.370 -8.420  64.456  1.00 36.74  ? 17  GLN A O     1 
ATOM   80   C CB    . GLN A 1 31  ? -13.633 -7.911  64.300  1.00 39.11  ? 17  GLN A CB    1 
ATOM   81   C CG    . GLN A 1 31  ? -14.626 -7.007  65.016  1.00 49.78  ? 17  GLN A CG    1 
ATOM   82   C CD    . GLN A 1 31  ? -16.054 -7.567  65.089  1.00 65.58  ? 17  GLN A CD    1 
ATOM   83   O OE1   . GLN A 1 31  ? -16.917 -6.989  65.760  1.00 70.04  ? 17  GLN A OE1   1 
ATOM   84   N NE2   . GLN A 1 31  ? -16.309 -8.678  64.393  1.00 64.37  ? 17  GLN A NE2   1 
ATOM   85   N N     . SER A 1 32  ? -11.190 -8.641  62.383  1.00 37.39  ? 18  SER A N     1 
ATOM   86   C CA    . SER A 1 32  ? -10.122 -9.576  62.025  1.00 37.31  ? 18  SER A CA    1 
ATOM   87   C C     . SER A 1 32  ? -8.785  -8.861  61.969  1.00 38.04  ? 18  SER A C     1 
ATOM   88   O O     . SER A 1 32  ? -7.748  -9.453  62.278  1.00 39.40  ? 18  SER A O     1 
ATOM   89   C CB    . SER A 1 32  ? -10.414 -10.230 60.677  1.00 36.87  ? 18  SER A CB    1 
ATOM   90   O OG    . SER A 1 32  ? -11.744 -10.717 60.678  1.00 43.89  ? 18  SER A OG    1 
ATOM   91   N N     . LEU A 1 33  ? -8.799  -7.589  61.564  1.00 36.93  ? 19  LEU A N     1 
ATOM   92   C CA    . LEU A 1 33  ? -7.553  -6.812  61.490  1.00 32.32  ? 19  LEU A CA    1 
ATOM   93   C C     . LEU A 1 33  ? -6.983  -6.600  62.908  1.00 27.93  ? 19  LEU A C     1 
ATOM   94   O O     . LEU A 1 33  ? -5.785  -6.758  63.133  1.00 29.17  ? 19  LEU A O     1 
ATOM   95   C CB    . LEU A 1 33  ? -7.788  -5.464  60.783  1.00 20.54  ? 19  LEU A CB    1 
ATOM   96   C CG    . LEU A 1 33  ? -6.590  -4.512  60.736  1.00 31.51  ? 19  LEU A CG    1 
ATOM   97   C CD1   . LEU A 1 33  ? -5.398  -5.227  60.148  1.00 25.10  ? 19  LEU A CD1   1 
ATOM   98   C CD2   . LEU A 1 33  ? -6.924  -3.250  59.940  1.00 25.68  ? 19  LEU A CD2   1 
ATOM   99   N N     . ALA A 1 34  ? -7.836  -6.264  63.862  1.00 28.76  ? 20  ALA A N     1 
ATOM   100  C CA    . ALA A 1 34  ? -7.376  -6.064  65.247  1.00 33.30  ? 20  ALA A CA    1 
ATOM   101  C C     . ALA A 1 34  ? -6.775  -7.364  65.813  1.00 34.16  ? 20  ALA A C     1 
ATOM   102  O O     . ALA A 1 34  ? -5.713  -7.342  66.461  1.00 30.58  ? 20  ALA A O     1 
ATOM   103  C CB    . ALA A 1 34  ? -8.518  -5.582  66.115  1.00 30.26  ? 20  ALA A CB    1 
ATOM   104  N N     . LEU A 1 35  ? -7.437  -8.489  65.540  1.00 33.55  ? 21  LEU A N     1 
ATOM   105  C CA    . LEU A 1 35  ? -6.957  -9.805  65.985  1.00 35.53  ? 21  LEU A CA    1 
ATOM   106  C C     . LEU A 1 35  ? -5.612  -10.183 65.411  1.00 35.00  ? 21  LEU A C     1 
ATOM   107  O O     . LEU A 1 35  ? -4.809  -10.824 66.081  1.00 38.33  ? 21  LEU A O     1 
ATOM   108  C CB    . LEU A 1 35  ? -7.925  -10.920 65.594  1.00 35.41  ? 21  LEU A CB    1 
ATOM   109  C CG    . LEU A 1 35  ? -9.299  -10.946 66.250  1.00 45.18  ? 21  LEU A CG    1 
ATOM   110  C CD1   . LEU A 1 35  ? -10.099 -12.102 65.625  1.00 44.95  ? 21  LEU A CD1   1 
ATOM   111  C CD2   . LEU A 1 35  ? -9.158  -11.091 67.789  1.00 40.06  ? 21  LEU A CD2   1 
ATOM   112  N N     . MET A 1 36  ? -5.365  -9.832  64.156  1.00 33.77  ? 22  MET A N     1 
ATOM   113  C CA    . MET A 1 36  ? -4.087  -10.198 63.569  1.00 33.36  ? 22  MET A CA    1 
ATOM   114  C C     . MET A 1 36  ? -3.041  -9.315  64.199  1.00 28.51  ? 22  MET A C     1 
ATOM   115  O O     . MET A 1 36  ? -1.902  -9.733  64.407  1.00 27.11  ? 22  MET A O     1 
ATOM   116  C CB    . MET A 1 36  ? -4.090  -9.988  62.051  1.00 35.31  ? 22  MET A CB    1 
ATOM   117  C CG    . MET A 1 36  ? -5.038  -10.898 61.299  1.00 43.91  ? 22  MET A CG    1 
ATOM   118  S SD    . MET A 1 36  ? -4.766  -10.705 59.515  1.00 47.12  ? 22  MET A SD    1 
ATOM   119  C CE    . MET A 1 36  ? -3.081  -11.197 59.482  1.00 29.60  ? 22  MET A CE    1 
ATOM   120  N N     . LEU A 1 37  ? -3.445  -8.082  64.502  1.00 29.99  ? 23  LEU A N     1 
ATOM   121  C CA    . LEU A 1 37  ? -2.563  -7.117  65.130  1.00 30.45  ? 23  LEU A CA    1 
ATOM   122  C C     . LEU A 1 37  ? -2.199  -7.679  66.526  1.00 33.35  ? 23  LEU A C     1 
ATOM   123  O O     . LEU A 1 37  ? -1.025  -7.651  66.940  1.00 31.80  ? 23  LEU A O     1 
ATOM   124  C CB    . LEU A 1 37  ? -3.282  -5.765  65.240  1.00 28.01  ? 23  LEU A CB    1 
ATOM   125  C CG    . LEU A 1 37  ? -2.879  -4.569  64.354  1.00 34.13  ? 23  LEU A CG    1 
ATOM   126  C CD1   . LEU A 1 37  ? -1.867  -4.951  63.291  1.00 30.84  ? 23  LEU A CD1   1 
ATOM   127  C CD2   . LEU A 1 37  ? -4.115  -3.993  63.724  1.00 27.33  ? 23  LEU A CD2   1 
ATOM   128  N N     . GLU A 1 38  ? -3.197  -8.215  67.227  1.00 29.44  ? 24  GLU A N     1 
ATOM   129  C CA    . GLU A 1 38  ? -2.962  -8.779  68.551  1.00 33.91  ? 24  GLU A CA    1 
ATOM   130  C C     . GLU A 1 38  ? -2.099  -10.044 68.499  1.00 36.92  ? 24  GLU A C     1 
ATOM   131  O O     . GLU A 1 38  ? -1.275  -10.290 69.385  1.00 35.02  ? 24  GLU A O     1 
ATOM   132  C CB    . GLU A 1 38  ? -4.296  -9.080  69.232  1.00 35.58  ? 24  GLU A CB    1 
ATOM   133  C CG    . GLU A 1 38  ? -4.209  -10.143 70.336  1.00 48.11  ? 24  GLU A CG    1 
ATOM   134  C CD    . GLU A 1 38  ? -5.416  -10.147 71.264  1.00 48.32  ? 24  GLU A CD    1 
ATOM   135  O OE1   . GLU A 1 38  ? -6.560  -10.015 70.781  1.00 51.22  ? 24  GLU A OE1   1 
ATOM   136  O OE2   . GLU A 1 38  ? -5.215  -10.291 72.484  1.00 56.43  ? 24  GLU A OE2   1 
ATOM   137  N N     . SER A 1 39  ? -2.277  -10.829 67.440  1.00 39.41  ? 25  SER A N     1 
ATOM   138  C CA    . SER A 1 39  ? -1.551  -12.086 67.242  1.00 36.03  ? 25  SER A CA    1 
ATOM   139  C C     . SER A 1 39  ? -0.076  -11.891 66.936  1.00 35.48  ? 25  SER A C     1 
ATOM   140  O O     . SER A 1 39  ? 0.404   -10.766 66.823  1.00 36.29  ? 25  SER A O     1 
ATOM   141  C CB    . SER A 1 39  ? -2.188  -12.865 66.094  1.00 38.11  ? 25  SER A CB    1 
ATOM   142  O OG    . SER A 1 39  ? -1.688  -12.399 64.847  1.00 33.15  ? 25  SER A OG    1 
ATOM   143  N N     . SER A 1 40  ? 0.658   -12.990 66.797  1.00 37.39  ? 26  SER A N     1 
ATOM   144  C CA    . SER A 1 40  ? 2.075   -12.868 66.496  1.00 41.19  ? 26  SER A CA    1 
ATOM   145  C C     . SER A 1 40  ? 2.313   -12.303 65.087  1.00 41.10  ? 26  SER A C     1 
ATOM   146  O O     . SER A 1 40  ? 3.415   -11.827 64.773  1.00 38.98  ? 26  SER A O     1 
ATOM   147  C CB    . SER A 1 40  ? 2.797   -14.222 66.683  1.00 43.41  ? 26  SER A CB    1 
ATOM   148  O OG    . SER A 1 40  ? 2.183   -15.268 65.955  1.00 49.32  ? 26  SER A OG    1 
ATOM   149  N N     . ASP A 1 41  ? 1.274   -12.336 64.252  1.00 40.76  ? 27  ASP A N     1 
ATOM   150  C CA    . ASP A 1 41  ? 1.359   -11.801 62.886  1.00 43.55  ? 27  ASP A CA    1 
ATOM   151  C C     . ASP A 1 41  ? 1.477   -10.263 62.923  1.00 39.69  ? 27  ASP A C     1 
ATOM   152  O O     . ASP A 1 41  ? 1.930   -9.643  61.967  1.00 33.34  ? 27  ASP A O     1 
ATOM   153  C CB    . ASP A 1 41  ? 0.099   -12.191 62.098  1.00 51.94  ? 27  ASP A CB    1 
ATOM   154  C CG    . ASP A 1 41  ? -0.098  -13.702 62.010  1.00 56.61  ? 27  ASP A CG    1 
ATOM   155  O OD1   . ASP A 1 41  ? 0.074   -14.388 63.037  1.00 67.94  ? 27  ASP A OD1   1 
ATOM   156  O OD2   . ASP A 1 41  ? -0.440  -14.205 60.926  1.00 62.48  ? 27  ASP A OD2   1 
ATOM   157  N N     . GLY A 1 42  ? 1.075   -9.669  64.046  1.00 33.73  ? 28  GLY A N     1 
ATOM   158  C CA    . GLY A 1 42  ? 1.107   -8.225  64.208  1.00 31.48  ? 28  GLY A CA    1 
ATOM   159  C C     . GLY A 1 42  ? 2.474   -7.577  64.188  1.00 31.53  ? 28  GLY A C     1 
ATOM   160  O O     . GLY A 1 42  ? 2.584   -6.353  64.066  1.00 28.80  ? 28  GLY A O     1 
ATOM   161  N N     . SER A 1 43  ? 3.520   -8.380  64.335  1.00 31.12  ? 29  SER A N     1 
ATOM   162  C CA    . SER A 1 43  ? 4.877   -7.850  64.289  1.00 34.88  ? 29  SER A CA    1 
ATOM   163  C C     . SER A 1 43  ? 5.315   -7.755  62.818  1.00 34.80  ? 29  SER A C     1 
ATOM   164  O O     . SER A 1 43  ? 6.405   -7.258  62.512  1.00 30.65  ? 29  SER A O     1 
ATOM   165  C CB    . SER A 1 43  ? 5.835   -8.763  65.041  1.00 35.03  ? 29  SER A CB    1 
ATOM   166  O OG    . SER A 1 43  ? 5.712   -10.092 64.562  1.00 44.89  ? 29  SER A OG    1 
ATOM   167  N N     . GLN A 1 44  ? 4.465   -8.256  61.922  1.00 31.10  ? 30  GLN A N     1 
ATOM   168  C CA    . GLN A 1 44  ? 4.731   -8.208  60.475  1.00 37.79  ? 30  GLN A CA    1 
ATOM   169  C C     . GLN A 1 44  ? 3.653   -7.407  59.741  1.00 31.07  ? 30  GLN A C     1 
ATOM   170  O O     . GLN A 1 44  ? 2.575   -7.135  60.295  1.00 31.83  ? 30  GLN A O     1 
ATOM   171  C CB    . GLN A 1 44  ? 4.787   -9.620  59.897  1.00 37.52  ? 30  GLN A CB    1 
ATOM   172  C CG    . GLN A 1 44  ? 5.923   -10.440 60.449  1.00 49.34  ? 30  GLN A CG    1 
ATOM   173  C CD    . GLN A 1 44  ? 5.881   -11.865 59.955  1.00 58.48  ? 30  GLN A CD    1 
ATOM   174  O OE1   . GLN A 1 44  ? 5.926   -12.126 58.740  1.00 53.46  ? 30  GLN A OE1   1 
ATOM   175  N NE2   . GLN A 1 44  ? 5.788   -12.807 60.894  1.00 65.21  ? 30  GLN A NE2   1 
ATOM   176  N N     . ARG A 1 45  ? 3.925   -7.042  58.491  1.00 34.08  ? 31  ARG A N     1 
ATOM   177  C CA    . ARG A 1 45  ? 2.934   -6.272  57.751  1.00 35.65  ? 31  ARG A CA    1 
ATOM   178  C C     . ARG A 1 45  ? 1.682   -7.087  57.513  1.00 29.21  ? 31  ARG A C     1 
ATOM   179  O O     . ARG A 1 45  ? 1.749   -8.281  57.255  1.00 30.85  ? 31  ARG A O     1 
ATOM   180  C CB    . ARG A 1 45  ? 3.498   -5.753  56.424  1.00 36.90  ? 31  ARG A CB    1 
ATOM   181  C CG    . ARG A 1 45  ? 3.661   -6.767  55.355  1.00 49.28  ? 31  ARG A CG    1 
ATOM   182  C CD    . ARG A 1 45  ? 4.130   -6.068  54.081  1.00 51.07  ? 31  ARG A CD    1 
ATOM   183  N NE    . ARG A 1 45  ? 3.183   -5.052  53.638  1.00 45.34  ? 31  ARG A NE    1 
ATOM   184  C CZ    . ARG A 1 45  ? 3.468   -3.759  53.504  1.00 42.53  ? 31  ARG A CZ    1 
ATOM   185  N NH1   . ARG A 1 45  ? 4.681   -3.301  53.782  1.00 42.10  ? 31  ARG A NH1   1 
ATOM   186  N NH2   . ARG A 1 45  ? 2.536   -2.920  53.077  1.00 43.57  ? 31  ARG A NH2   1 
ATOM   187  N N     . ILE A 1 46  ? 0.531   -6.443  57.628  1.00 23.37  ? 32  ILE A N     1 
ATOM   188  C CA    . ILE A 1 46  ? -0.713  -7.151  57.421  1.00 27.55  ? 32  ILE A CA    1 
ATOM   189  C C     . ILE A 1 46  ? -1.107  -6.991  55.959  1.00 28.82  ? 32  ILE A C     1 
ATOM   190  O O     . ILE A 1 46  ? -1.855  -6.078  55.611  1.00 28.12  ? 32  ILE A O     1 
ATOM   191  C CB    . ILE A 1 46  ? -1.870  -6.595  58.278  1.00 27.99  ? 32  ILE A CB    1 
ATOM   192  C CG1   . ILE A 1 46  ? -1.436  -6.402  59.748  1.00 36.98  ? 32  ILE A CG1   1 
ATOM   193  C CG2   . ILE A 1 46  ? -3.059  -7.545  58.169  1.00 26.44  ? 32  ILE A CG2   1 
ATOM   194  C CD1   . ILE A 1 46  ? -1.219  -7.678  60.522  1.00 35.05  ? 32  ILE A CD1   1 
ATOM   195  N N     . THR A 1 47  ? -0.602  -7.881  55.111  1.00 34.80  ? 33  THR A N     1 
ATOM   196  C CA    . THR A 1 47  ? -0.903  -7.841  53.683  1.00 30.66  ? 33  THR A CA    1 
ATOM   197  C C     . THR A 1 47  ? -2.393  -8.069  53.456  1.00 32.40  ? 33  THR A C     1 
ATOM   198  O O     . THR A 1 47  ? -3.080  -8.633  54.312  1.00 34.57  ? 33  THR A O     1 
ATOM   199  C CB    . THR A 1 47  ? -0.135  -8.926  52.930  1.00 31.50  ? 33  THR A CB    1 
ATOM   200  O OG1   . THR A 1 47  ? -0.557  -10.218 53.395  1.00 37.26  ? 33  THR A OG1   1 
ATOM   201  C CG2   . THR A 1 47  ? 1.357   -8.756  53.123  1.00 24.06  ? 33  THR A CG2   1 
ATOM   202  N N     . THR A 1 48  ? -2.898  -7.618  52.313  1.00 30.04  ? 34  THR A N     1 
ATOM   203  C CA    . THR A 1 48  ? -4.303  -7.804  51.985  1.00 26.29  ? 34  THR A CA    1 
ATOM   204  C C     . THR A 1 48  ? -4.552  -9.295  51.844  1.00 24.70  ? 34  THR A C     1 
ATOM   205  O O     . THR A 1 48  ? -5.626  -9.780  52.181  1.00 34.86  ? 34  THR A O     1 
ATOM   206  C CB    . THR A 1 48  ? -4.672  -7.090  50.678  1.00 27.45  ? 34  THR A CB    1 
ATOM   207  O OG1   . THR A 1 48  ? -3.621  -7.276  49.714  1.00 34.92  ? 34  THR A OG1   1 
ATOM   208  C CG2   . THR A 1 48  ? -4.869  -5.610  50.925  1.00 31.08  ? 34  THR A CG2   1 
ATOM   209  N N     . ALA A 1 49  ? -3.551  -10.016 51.351  1.00 29.80  ? 35  ALA A N     1 
ATOM   210  C CA    . ALA A 1 49  ? -3.634  -11.472 51.192  1.00 36.11  ? 35  ALA A CA    1 
ATOM   211  C C     . ALA A 1 49  ? -3.863  -12.110 52.567  1.00 37.49  ? 35  ALA A C     1 
ATOM   212  O O     . ALA A 1 49  ? -4.842  -12.838 52.769  1.00 38.86  ? 35  ALA A O     1 
ATOM   213  C CB    . ALA A 1 49  ? -2.331  -12.008 50.567  1.00 37.73  ? 35  ALA A CB    1 
ATOM   214  N N     . LYS A 1 50  ? -2.961  -11.830 53.512  1.00 38.82  ? 36  LYS A N     1 
ATOM   215  C CA    . LYS A 1 50  ? -3.105  -12.369 54.856  1.00 37.55  ? 36  LYS A CA    1 
ATOM   216  C C     . LYS A 1 50  ? -4.405  -11.899 55.529  1.00 38.20  ? 36  LYS A C     1 
ATOM   217  O O     . LYS A 1 50  ? -5.102  -12.701 56.149  1.00 45.41  ? 36  LYS A O     1 
ATOM   218  C CB    . LYS A 1 50  ? -1.877  -12.008 55.689  1.00 31.66  ? 36  LYS A CB    1 
ATOM   219  C CG    . LYS A 1 50  ? -0.617  -12.690 55.193  1.00 31.19  ? 36  LYS A CG    1 
ATOM   220  C CD    . LYS A 1 50  ? 0.586   -12.333 56.048  1.00 32.41  ? 36  LYS A CD    1 
ATOM   221  C CE    . LYS A 1 50  ? 1.809   -13.131 55.655  1.00 36.14  ? 36  LYS A CE    1 
ATOM   222  N NZ    . LYS A 1 50  ? 3.007   -12.779 56.494  1.00 33.38  ? 36  LYS A NZ    1 
ATOM   223  N N     . LEU A 1 51  ? -4.768  -10.624 55.400  1.00 38.35  ? 37  LEU A N     1 
ATOM   224  C CA    . LEU A 1 51  ? -6.018  -10.162 56.021  1.00 33.40  ? 37  LEU A CA    1 
ATOM   225  C C     . LEU A 1 51  ? -7.248  -10.836 55.415  1.00 37.00  ? 37  LEU A C     1 
ATOM   226  O O     . LEU A 1 51  ? -8.229  -11.138 56.105  1.00 35.96  ? 37  LEU A O     1 
ATOM   227  C CB    . LEU A 1 51  ? -6.170  -8.650  55.877  1.00 30.16  ? 37  LEU A CB    1 
ATOM   228  C CG    . LEU A 1 51  ? -7.520  -8.101  56.359  1.00 35.19  ? 37  LEU A CG    1 
ATOM   229  C CD1   . LEU A 1 51  ? -7.675  -8.342  57.876  1.00 32.59  ? 37  LEU A CD1   1 
ATOM   230  C CD2   . LEU A 1 51  ? -7.617  -6.601  56.036  1.00 31.76  ? 37  LEU A CD2   1 
ATOM   231  N N     . ALA A 1 52  ? -7.202  -11.061 54.112  1.00 35.99  ? 38  ALA A N     1 
ATOM   232  C CA    . ALA A 1 52  ? -8.316  -11.701 53.432  1.00 37.53  ? 38  ALA A CA    1 
ATOM   233  C C     . ALA A 1 52  ? -8.436  -13.155 53.886  1.00 34.78  ? 38  ALA A C     1 
ATOM   234  O O     . ALA A 1 52  ? -9.539  -13.639 54.134  1.00 32.30  ? 38  ALA A O     1 
ATOM   235  C CB    . ALA A 1 52  ? -8.106  -11.636 51.919  1.00 36.52  ? 38  ALA A CB    1 
ATOM   236  N N     . ALA A 1 53  ? -7.301  -13.849 53.988  1.00 37.27  ? 39  ALA A N     1 
ATOM   237  C CA    . ALA A 1 53  ? -7.308  -15.249 54.405  1.00 38.84  ? 39  ALA A CA    1 
ATOM   238  C C     . ALA A 1 53  ? -7.906  -15.359 55.794  1.00 46.99  ? 39  ALA A C     1 
ATOM   239  O O     . ALA A 1 53  ? -8.701  -16.258 56.079  1.00 49.21  ? 39  ALA A O     1 
ATOM   240  C CB    . ALA A 1 53  ? -5.907  -15.808 54.402  1.00 34.03  ? 39  ALA A CB    1 
ATOM   241  N N     . SER A 1 54  ? -7.531  -14.427 56.659  1.00 49.24  ? 40  SER A N     1 
ATOM   242  C CA    . SER A 1 54  ? -8.037  -14.436 58.018  1.00 47.62  ? 40  SER A CA    1 
ATOM   243  C C     . SER A 1 54  ? -9.536  -14.136 58.087  1.00 44.60  ? 40  SER A C     1 
ATOM   244  O O     . SER A 1 54  ? -10.228 -14.644 58.956  1.00 48.22  ? 40  SER A O     1 
ATOM   245  C CB    . SER A 1 54  ? -7.241  -13.442 58.860  1.00 46.10  ? 40  SER A CB    1 
ATOM   246  O OG    . SER A 1 54  ? -7.789  -13.353 60.153  1.00 52.12  ? 40  SER A OG    1 
ATOM   247  N N     . VAL A 1 55  ? -10.049 -13.320 57.176  1.00 42.51  ? 41  VAL A N     1 
ATOM   248  C CA    . VAL A 1 55  ? -11.477 -13.017 57.177  1.00 40.99  ? 41  VAL A CA    1 
ATOM   249  C C     . VAL A 1 55  ? -12.303 -14.173 56.549  1.00 44.26  ? 41  VAL A C     1 
ATOM   250  O O     . VAL A 1 55  ? -13.510 -14.294 56.774  1.00 43.24  ? 41  VAL A O     1 
ATOM   251  C CB    . VAL A 1 55  ? -11.763 -11.701 56.386  1.00 43.92  ? 41  VAL A CB    1 
ATOM   252  C CG1   . VAL A 1 55  ? -13.258 -11.423 56.352  1.00 43.62  ? 41  VAL A CG1   1 
ATOM   253  C CG2   . VAL A 1 55  ? -11.024 -10.529 57.022  1.00 42.39  ? 41  VAL A CG2   1 
ATOM   254  N N     . GLY A 1 56  ? -11.649 -15.025 55.768  1.00 44.82  ? 42  GLY A N     1 
ATOM   255  C CA    . GLY A 1 56  ? -12.368 -16.107 55.116  1.00 47.64  ? 42  GLY A CA    1 
ATOM   256  C C     . GLY A 1 56  ? -12.924 -15.736 53.736  1.00 49.26  ? 42  GLY A C     1 
ATOM   257  O O     . GLY A 1 56  ? -13.648 -16.524 53.130  1.00 50.80  ? 42  GLY A O     1 
ATOM   258  N N     . VAL A 1 57  ? -12.584 -14.544 53.237  1.00 52.81  ? 43  VAL A N     1 
ATOM   259  C CA    . VAL A 1 57  ? -13.046 -14.062 51.926  1.00 45.53  ? 43  VAL A CA    1 
ATOM   260  C C     . VAL A 1 57  ? -11.885 -13.755 50.974  1.00 44.75  ? 43  VAL A C     1 
ATOM   261  O O     . VAL A 1 57  ? -10.712 -13.943 51.304  1.00 37.92  ? 43  VAL A O     1 
ATOM   262  C CB    . VAL A 1 57  ? -13.864 -12.775 52.078  1.00 45.87  ? 43  VAL A CB    1 
ATOM   263  C CG1   . VAL A 1 57  ? -15.045 -13.019 52.963  1.00 40.89  ? 43  VAL A CG1   1 
ATOM   264  C CG2   . VAL A 1 57  ? -12.996 -11.676 52.677  1.00 43.61  ? 43  VAL A CG2   1 
ATOM   265  N N     . SER A 1 58  ? -12.211 -13.279 49.778  1.00 43.70  ? 44  SER A N     1 
ATOM   266  C CA    . SER A 1 58  ? -11.156 -12.938 48.827  1.00 42.83  ? 44  SER A CA    1 
ATOM   267  C C     . SER A 1 58  ? -10.732 -11.485 49.000  1.00 40.78  ? 44  SER A C     1 
ATOM   268  O O     . SER A 1 58  ? -11.480 -10.635 49.518  1.00 40.17  ? 44  SER A O     1 
ATOM   269  C CB    . SER A 1 58  ? -11.624 -13.115 47.381  1.00 39.82  ? 44  SER A CB    1 
ATOM   270  O OG    . SER A 1 58  ? -12.626 -12.157 47.075  1.00 42.28  ? 44  SER A OG    1 
ATOM   271  N N     . GLU A 1 59  ? -9.526  -11.215 48.535  1.00 38.80  ? 45  GLU A N     1 
ATOM   272  C CA    . GLU A 1 59  ? -8.951  -9.886  48.584  1.00 41.29  ? 45  GLU A CA    1 
ATOM   273  C C     . GLU A 1 59  ? -9.975  -8.870  48.055  1.00 39.90  ? 45  GLU A C     1 
ATOM   274  O O     . GLU A 1 59  ? -10.237 -7.833  48.679  1.00 41.48  ? 45  GLU A O     1 
ATOM   275  C CB    . GLU A 1 59  ? -7.683  -9.902  47.739  1.00 39.29  ? 45  GLU A CB    1 
ATOM   276  C CG    . GLU A 1 59  ? -6.535  -9.175  48.348  1.00 43.74  ? 45  GLU A CG    1 
ATOM   277  C CD    . GLU A 1 59  ? -5.193  -9.812  48.039  1.00 39.90  ? 45  GLU A CD    1 
ATOM   278  O OE1   . GLU A 1 59  ? -4.190  -9.072  48.009  1.00 45.04  ? 45  GLU A OE1   1 
ATOM   279  O OE2   . GLU A 1 59  ? -5.131  -11.042 47.844  1.00 39.91  ? 45  GLU A OE2   1 
ATOM   280  N N     . ALA A 1 60  ? -10.579 -9.193  46.916  1.00 40.54  ? 46  ALA A N     1 
ATOM   281  C CA    . ALA A 1 60  ? -11.575 -8.325  46.301  1.00 38.04  ? 46  ALA A CA    1 
ATOM   282  C C     . ALA A 1 60  ? -12.689 -8.005  47.291  1.00 35.32  ? 46  ALA A C     1 
ATOM   283  O O     . ALA A 1 60  ? -13.113 -6.858  47.402  1.00 32.03  ? 46  ALA A O     1 
ATOM   284  C CB    . ALA A 1 60  ? -12.162 -8.997  45.043  1.00 34.59  ? 46  ALA A CB    1 
ATOM   285  N N     . ALA A 1 61  ? -13.159 -9.022  48.007  1.00 37.26  ? 47  ALA A N     1 
ATOM   286  C CA    . ALA A 1 61  ? -14.240 -8.847  48.985  1.00 35.31  ? 47  ALA A CA    1 
ATOM   287  C C     . ALA A 1 61  ? -13.932 -7.690  49.924  1.00 33.03  ? 47  ALA A C     1 
ATOM   288  O O     . ALA A 1 61  ? -14.811 -6.910  50.298  1.00 36.77  ? 47  ALA A O     1 
ATOM   289  C CB    . ALA A 1 61  ? -14.429 -10.119 49.769  1.00 34.42  ? 47  ALA A CB    1 
ATOM   290  N N     . LEU A 1 62  ? -12.667 -7.573  50.290  1.00 31.87  ? 48  LEU A N     1 
ATOM   291  C CA    . LEU A 1 62  ? -12.227 -6.499  51.175  1.00 34.57  ? 48  LEU A CA    1 
ATOM   292  C C     . LEU A 1 62  ? -12.555 -5.118  50.598  1.00 38.28  ? 48  LEU A C     1 
ATOM   293  O O     . LEU A 1 62  ? -13.011 -4.238  51.332  1.00 36.52  ? 48  LEU A O     1 
ATOM   294  C CB    . LEU A 1 62  ? -10.716 -6.610  51.406  1.00 30.34  ? 48  LEU A CB    1 
ATOM   295  C CG    . LEU A 1 62  ? -10.081 -7.259  52.641  1.00 39.10  ? 48  LEU A CG    1 
ATOM   296  C CD1   . LEU A 1 62  ? -10.990 -8.239  53.377  1.00 36.58  ? 48  LEU A CD1   1 
ATOM   297  C CD2   . LEU A 1 62  ? -8.816  -7.918  52.162  1.00 34.93  ? 48  LEU A CD2   1 
ATOM   298  N N     . TYR A 1 63  ? -12.321 -4.938  49.286  1.00 39.49  ? 49  TYR A N     1 
ATOM   299  C CA    . TYR A 1 63  ? -12.557 -3.662  48.593  1.00 35.32  ? 49  TYR A CA    1 
ATOM   300  C C     . TYR A 1 63  ? -14.014 -3.274  48.340  1.00 34.36  ? 49  TYR A C     1 
ATOM   301  O O     . TYR A 1 63  ? -14.307 -2.153  47.926  1.00 32.40  ? 49  TYR A O     1 
ATOM   302  C CB    . TYR A 1 63  ? -11.731 -3.615  47.299  1.00 29.73  ? 49  TYR A CB    1 
ATOM   303  C CG    . TYR A 1 63  ? -10.249 -3.507  47.620  1.00 32.62  ? 49  TYR A CG    1 
ATOM   304  C CD1   . TYR A 1 63  ? -9.652  -2.257  47.909  1.00 23.82  ? 49  TYR A CD1   1 
ATOM   305  C CD2   . TYR A 1 63  ? -9.475  -4.662  47.784  1.00 26.49  ? 49  TYR A CD2   1 
ATOM   306  C CE1   . TYR A 1 63  ? -8.306  -2.180  48.367  1.00 24.47  ? 49  TYR A CE1   1 
ATOM   307  C CE2   . TYR A 1 63  ? -8.144  -4.597  48.241  1.00 24.99  ? 49  TYR A CE2   1 
ATOM   308  C CZ    . TYR A 1 63  ? -7.568  -3.361  48.531  1.00 26.03  ? 49  TYR A CZ    1 
ATOM   309  O OH    . TYR A 1 63  ? -6.269  -3.345  48.999  1.00 30.26  ? 49  TYR A OH    1 
ATOM   310  N N     . ARG A 1 64  ? -14.935 -4.180  48.627  1.00 36.10  ? 50  ARG A N     1 
ATOM   311  C CA    . ARG A 1 64  ? -16.345 -3.853  48.483  1.00 36.30  ? 50  ARG A CA    1 
ATOM   312  C C     . ARG A 1 64  ? -16.680 -3.013  49.709  1.00 41.35  ? 50  ARG A C     1 
ATOM   313  O O     . ARG A 1 64  ? -17.634 -2.245  49.730  1.00 44.54  ? 50  ARG A O     1 
ATOM   314  C CB    . ARG A 1 64  ? -17.200 -5.116  48.531  1.00 38.00  ? 50  ARG A CB    1 
ATOM   315  C CG    . ARG A 1 64  ? -16.674 -6.296  47.738  1.00 46.21  ? 50  ARG A CG    1 
ATOM   316  C CD    . ARG A 1 64  ? -17.594 -7.498  47.957  1.00 55.66  ? 50  ARG A CD    1 
ATOM   317  N NE    . ARG A 1 64  ? -18.992 -7.142  47.692  1.00 61.68  ? 50  ARG A NE    1 
ATOM   318  C CZ    . ARG A 1 64  ? -19.993 -7.272  48.564  1.00 61.88  ? 50  ARG A CZ    1 
ATOM   319  N NH1   . ARG A 1 64  ? -19.774 -7.760  49.786  1.00 56.60  ? 50  ARG A NH1   1 
ATOM   320  N NH2   . ARG A 1 64  ? -21.220 -6.906  48.207  1.00 60.25  ? 50  ARG A NH2   1 
ATOM   321  N N     . HIS A 1 65  ? -15.867 -3.146  50.742  1.00 39.30  ? 51  HIS A N     1 
ATOM   322  C CA    . HIS A 1 65  ? -16.149 -2.436  51.968  1.00 41.57  ? 51  HIS A CA    1 
ATOM   323  C C     . HIS A 1 65  ? -15.204 -1.307  52.319  1.00 40.08  ? 51  HIS A C     1 
ATOM   324  O O     . HIS A 1 65  ? -15.516 -0.462  53.151  1.00 39.37  ? 51  HIS A O     1 
ATOM   325  C CB    . HIS A 1 65  ? -16.206 -3.446  53.101  1.00 41.96  ? 51  HIS A CB    1 
ATOM   326  C CG    . HIS A 1 65  ? -17.246 -4.503  52.897  1.00 44.81  ? 51  HIS A CG    1 
ATOM   327  N ND1   . HIS A 1 65  ? -18.588 -4.211  52.794  1.00 49.88  ? 51  HIS A ND1   1 
ATOM   328  C CD2   . HIS A 1 65  ? -17.144 -5.851  52.789  1.00 44.77  ? 51  HIS A CD2   1 
ATOM   329  C CE1   . HIS A 1 65  ? -19.271 -5.332  52.636  1.00 48.29  ? 51  HIS A CE1   1 
ATOM   330  N NE2   . HIS A 1 65  ? -18.418 -6.340  52.628  1.00 48.96  ? 51  HIS A NE2   1 
ATOM   331  N N     . PHE A 1 66  ? -14.042 -1.296  51.694  1.00 37.59  ? 52  PHE A N     1 
ATOM   332  C CA    . PHE A 1 66  ? -13.079 -0.248  51.955  1.00 33.68  ? 52  PHE A CA    1 
ATOM   333  C C     . PHE A 1 66  ? -12.390 0.048   50.632  1.00 36.40  ? 52  PHE A C     1 
ATOM   334  O O     . PHE A 1 66  ? -12.173 -0.844  49.813  1.00 39.74  ? 52  PHE A O     1 
ATOM   335  C CB    . PHE A 1 66  ? -12.028 -0.716  52.964  1.00 28.41  ? 52  PHE A CB    1 
ATOM   336  C CG    . PHE A 1 66  ? -12.560 -0.980  54.335  1.00 25.91  ? 52  PHE A CG    1 
ATOM   337  C CD1   . PHE A 1 66  ? -12.711 0.053   55.240  1.00 26.27  ? 52  PHE A CD1   1 
ATOM   338  C CD2   . PHE A 1 66  ? -12.860 -2.279  54.741  1.00 32.19  ? 52  PHE A CD2   1 
ATOM   339  C CE1   . PHE A 1 66  ? -13.162 -0.198  56.559  1.00 33.60  ? 52  PHE A CE1   1 
ATOM   340  C CE2   . PHE A 1 66  ? -13.311 -2.547  56.046  1.00 39.50  ? 52  PHE A CE2   1 
ATOM   341  C CZ    . PHE A 1 66  ? -13.460 -1.502  56.957  1.00 36.05  ? 52  PHE A CZ    1 
ATOM   342  N N     . PRO A 1 67  ? -12.049 1.313   50.401  1.00 33.51  ? 53  PRO A N     1 
ATOM   343  C CA    . PRO A 1 67  ? -11.374 1.706   49.171  1.00 31.40  ? 53  PRO A CA    1 
ATOM   344  C C     . PRO A 1 67  ? -9.893  1.349   49.264  1.00 31.57  ? 53  PRO A C     1 
ATOM   345  O O     . PRO A 1 67  ? -9.238  1.132   48.254  1.00 33.85  ? 53  PRO A O     1 
ATOM   346  C CB    . PRO A 1 67  ? -11.584 3.206   49.158  1.00 28.77  ? 53  PRO A CB    1 
ATOM   347  C CG    . PRO A 1 67  ? -11.479 3.537   50.636  1.00 31.68  ? 53  PRO A CG    1 
ATOM   348  C CD    . PRO A 1 67  ? -12.369 2.488   51.232  1.00 32.80  ? 53  PRO A CD    1 
ATOM   349  N N     . SER A 1 68  ? -9.384  1.274   50.500  1.00 35.73  ? 54  SER A N     1 
ATOM   350  C CA    . SER A 1 68  ? -7.964  0.996   50.773  1.00 31.99  ? 54  SER A CA    1 
ATOM   351  C C     . SER A 1 68  ? -7.680  0.435   52.164  1.00 35.11  ? 54  SER A C     1 
ATOM   352  O O     . SER A 1 68  ? -8.476  0.587   53.092  1.00 32.15  ? 54  SER A O     1 
ATOM   353  C CB    . SER A 1 68  ? -7.171  2.281   50.694  1.00 32.15  ? 54  SER A CB    1 
ATOM   354  O OG    . SER A 1 68  ? -7.542  3.100   51.789  1.00 32.54  ? 54  SER A OG    1 
ATOM   355  N N     . LYS A 1 69  ? -6.511  -0.188  52.307  1.00 37.30  ? 55  LYS A N     1 
ATOM   356  C CA    . LYS A 1 69  ? -6.100  -0.717  53.594  1.00 31.94  ? 55  LYS A CA    1 
ATOM   357  C C     . LYS A 1 69  ? -5.902  0.492   54.511  1.00 31.23  ? 55  LYS A C     1 
ATOM   358  O O     . LYS A 1 69  ? -6.186  0.438   55.721  1.00 29.28  ? 55  LYS A O     1 
ATOM   359  C CB    . LYS A 1 69  ? -4.791  -1.491  53.476  1.00 33.31  ? 55  LYS A CB    1 
ATOM   360  C CG    . LYS A 1 69  ? -4.817  -2.728  54.351  1.00 41.71  ? 55  LYS A CG    1 
ATOM   361  C CD    . LYS A 1 69  ? -3.485  -3.022  54.978  1.00 39.75  ? 55  LYS A CD    1 
ATOM   362  C CE    . LYS A 1 69  ? -2.457  -3.453  53.951  1.00 35.92  ? 55  LYS A CE    1 
ATOM   363  N NZ    . LYS A 1 69  ? -1.145  -3.605  54.632  1.00 33.17  ? 55  LYS A NZ    1 
ATOM   364  N N     . THR A 1 70  ? -5.405  1.585   53.940  1.00 26.95  ? 56  THR A N     1 
ATOM   365  C CA    . THR A 1 70  ? -5.210  2.789   54.734  1.00 32.18  ? 56  THR A CA    1 
ATOM   366  C C     . THR A 1 70  ? -6.495  3.117   55.490  1.00 31.94  ? 56  THR A C     1 
ATOM   367  O O     . THR A 1 70  ? -6.454  3.470   56.676  1.00 34.19  ? 56  THR A O     1 
ATOM   368  C CB    . THR A 1 70  ? -4.835  3.982   53.859  1.00 24.68  ? 56  THR A CB    1 
ATOM   369  O OG1   . THR A 1 70  ? -3.572  3.718   53.261  1.00 30.18  ? 56  THR A OG1   1 
ATOM   370  C CG2   . THR A 1 70  ? -4.702  5.266   54.698  1.00 23.44  ? 56  THR A CG2   1 
ATOM   371  N N     . ARG A 1 71  ? -7.623  2.959   54.801  1.00 28.51  ? 57  ARG A N     1 
ATOM   372  C CA    . ARG A 1 71  ? -8.926  3.248   55.366  1.00 34.00  ? 57  ARG A CA    1 
ATOM   373  C C     . ARG A 1 71  ? -9.285  2.396   56.532  1.00 30.53  ? 57  ARG A C     1 
ATOM   374  O O     . ARG A 1 71  ? -9.931  2.867   57.463  1.00 29.46  ? 57  ARG A O     1 
ATOM   375  C CB    . ARG A 1 71  ? -10.021 3.120   54.311  1.00 38.82  ? 57  ARG A CB    1 
ATOM   376  C CG    . ARG A 1 71  ? -10.341 4.437   53.683  1.00 48.21  ? 57  ARG A CG    1 
ATOM   377  C CD    . ARG A 1 71  ? -10.954 5.399   54.684  1.00 55.17  ? 57  ARG A CD    1 
ATOM   378  N NE    . ARG A 1 71  ? -11.150 6.693   54.037  1.00 71.59  ? 57  ARG A NE    1 
ATOM   379  C CZ    . ARG A 1 71  ? -10.192 7.604   53.861  1.00 73.50  ? 57  ARG A CZ    1 
ATOM   380  N NH1   . ARG A 1 71  ? -8.961  7.373   54.299  1.00 73.53  ? 57  ARG A NH1   1 
ATOM   381  N NH2   . ARG A 1 71  ? -10.461 8.735   53.217  1.00 72.19  ? 57  ARG A NH2   1 
ATOM   382  N N     . MET A 1 72  ? -8.893  1.134   56.477  1.00 31.23  ? 58  MET A N     1 
ATOM   383  C CA    . MET A 1 72  ? -9.175  0.235   57.589  1.00 30.50  ? 58  MET A CA    1 
ATOM   384  C C     . MET A 1 72  ? -8.449  0.731   58.850  1.00 32.19  ? 58  MET A C     1 
ATOM   385  O O     . MET A 1 72  ? -9.048  0.746   59.948  1.00 32.97  ? 58  MET A O     1 
ATOM   386  C CB    . MET A 1 72  ? -8.738  -1.179  57.217  1.00 33.09  ? 58  MET A CB    1 
ATOM   387  C CG    . MET A 1 72  ? -9.247  -1.618  55.840  1.00 30.24  ? 58  MET A CG    1 
ATOM   388  S SD    . MET A 1 72  ? -8.643  -3.240  55.433  1.00 37.70  ? 58  MET A SD    1 
ATOM   389  C CE    . MET A 1 72  ? -9.800  -3.788  54.249  1.00 40.90  ? 58  MET A CE    1 
ATOM   390  N N     . PHE A 1 73  ? -7.184  1.156   58.707  1.00 29.90  ? 59  PHE A N     1 
ATOM   391  C CA    . PHE A 1 73  ? -6.450  1.672   59.869  1.00 29.93  ? 59  PHE A CA    1 
ATOM   392  C C     . PHE A 1 73  ? -7.087  2.964   60.362  1.00 35.12  ? 59  PHE A C     1 
ATOM   393  O O     . PHE A 1 73  ? -7.178  3.189   61.591  1.00 29.14  ? 59  PHE A O     1 
ATOM   394  C CB    . PHE A 1 73  ? -4.965  1.890   59.544  1.00 31.66  ? 59  PHE A CB    1 
ATOM   395  C CG    . PHE A 1 73  ? -4.167  0.627   59.590  1.00 34.12  ? 59  PHE A CG    1 
ATOM   396  C CD1   . PHE A 1 73  ? -3.634  0.158   60.804  1.00 31.09  ? 59  PHE A CD1   1 
ATOM   397  C CD2   . PHE A 1 73  ? -4.068  -0.171  58.451  1.00 26.24  ? 59  PHE A CD2   1 
ATOM   398  C CE1   . PHE A 1 73  ? -3.032  -1.104  60.885  1.00 26.64  ? 59  PHE A CE1   1 
ATOM   399  C CE2   . PHE A 1 73  ? -3.473  -1.428  58.517  1.00 28.24  ? 59  PHE A CE2   1 
ATOM   400  C CZ    . PHE A 1 73  ? -2.951  -1.897  59.736  1.00 28.38  ? 59  PHE A CZ    1 
ATOM   401  N N     . ASP A 1 74  ? -7.533  3.808   59.415  1.00 35.17  ? 60  ASP A N     1 
ATOM   402  C CA    . ASP A 1 74  ? -8.222  5.060   59.781  1.00 32.32  ? 60  ASP A CA    1 
ATOM   403  C C     . ASP A 1 74  ? -9.437  4.723   60.658  1.00 28.00  ? 60  ASP A C     1 
ATOM   404  O O     . ASP A 1 74  ? -9.648  5.347   61.704  1.00 28.14  ? 60  ASP A O     1 
ATOM   405  C CB    . ASP A 1 74  ? -8.698  5.832   58.533  1.00 33.18  ? 60  ASP A CB    1 
ATOM   406  C CG    . ASP A 1 74  ? -7.670  6.829   58.027  1.00 40.01  ? 60  ASP A CG    1 
ATOM   407  O OD1   . ASP A 1 74  ? -7.269  7.757   58.773  1.00 38.32  ? 60  ASP A OD1   1 
ATOM   408  O OD2   . ASP A 1 74  ? -7.260  6.685   56.859  1.00 40.43  ? 60  ASP A OD2   1 
ATOM   409  N N     . SER A 1 75  ? -10.216 3.719   60.248  1.00 24.38  ? 61  SER A N     1 
ATOM   410  C CA    . SER A 1 75  ? -11.397 3.319   61.021  1.00 28.22  ? 61  SER A CA    1 
ATOM   411  C C     . SER A 1 75  ? -10.999 2.789   62.376  1.00 26.14  ? 61  SER A C     1 
ATOM   412  O O     . SER A 1 75  ? -11.676 3.016   63.351  1.00 27.02  ? 61  SER A O     1 
ATOM   413  C CB    . SER A 1 75  ? -12.196 2.234   60.317  1.00 28.32  ? 61  SER A CB    1 
ATOM   414  O OG    . SER A 1 75  ? -12.655 2.708   59.064  1.00 41.98  ? 61  SER A OG    1 
ATOM   415  N N     . LEU A 1 76  ? -9.903  2.055   62.428  1.00 28.93  ? 62  LEU A N     1 
ATOM   416  C CA    . LEU A 1 76  ? -9.459  1.538   63.694  1.00 25.76  ? 62  LEU A CA    1 
ATOM   417  C C     . LEU A 1 76  ? -9.048  2.743   64.560  1.00 30.08  ? 62  LEU A C     1 
ATOM   418  O O     . LEU A 1 76  ? -9.395  2.816   65.738  1.00 29.55  ? 62  LEU A O     1 
ATOM   419  C CB    . LEU A 1 76  ? -8.304  0.568   63.442  1.00 28.55  ? 62  LEU A CB    1 
ATOM   420  C CG    . LEU A 1 76  ? -8.517  -0.933  63.710  1.00 32.66  ? 62  LEU A CG    1 
ATOM   421  C CD1   . LEU A 1 76  ? -9.951  -1.368  63.447  1.00 33.54  ? 62  LEU A CD1   1 
ATOM   422  C CD2   . LEU A 1 76  ? -7.538  -1.741  62.882  1.00 24.06  ? 62  LEU A CD2   1 
ATOM   423  N N     . ILE A 1 77  ? -8.345  3.713   63.970  1.00 31.52  ? 63  ILE A N     1 
ATOM   424  C CA    . ILE A 1 77  ? -7.921  4.884   64.734  1.00 30.35  ? 63  ILE A CA    1 
ATOM   425  C C     . ILE A 1 77  ? -9.125  5.702   65.201  1.00 33.33  ? 63  ILE A C     1 
ATOM   426  O O     . ILE A 1 77  ? -9.144  6.215   66.320  1.00 31.08  ? 63  ILE A O     1 
ATOM   427  C CB    . ILE A 1 77  ? -6.916  5.736   63.918  1.00 26.37  ? 63  ILE A CB    1 
ATOM   428  C CG1   . ILE A 1 77  ? -5.604  4.951   63.789  1.00 25.43  ? 63  ILE A CG1   1 
ATOM   429  C CG2   . ILE A 1 77  ? -6.648  7.074   64.627  1.00 28.48  ? 63  ILE A CG2   1 
ATOM   430  C CD1   . ILE A 1 77  ? -4.553  5.606   62.922  1.00 24.40  ? 63  ILE A CD1   1 
ATOM   431  N N     . GLU A 1 78  ? -10.141 5.816   64.355  1.00 33.87  ? 64  GLU A N     1 
ATOM   432  C CA    . GLU A 1 78  ? -11.352 6.527   64.755  1.00 35.66  ? 64  GLU A CA    1 
ATOM   433  C C     . GLU A 1 78  ? -11.969 5.877   65.982  1.00 29.64  ? 64  GLU A C     1 
ATOM   434  O O     . GLU A 1 78  ? -12.388 6.560   66.922  1.00 29.20  ? 64  GLU A O     1 
ATOM   435  C CB    . GLU A 1 78  ? -12.387 6.517   63.634  1.00 38.55  ? 64  GLU A CB    1 
ATOM   436  C CG    . GLU A 1 78  ? -12.080 7.456   62.506  1.00 53.50  ? 64  GLU A CG    1 
ATOM   437  C CD    . GLU A 1 78  ? -13.289 7.684   61.628  1.00 65.88  ? 64  GLU A CD    1 
ATOM   438  O OE1   . GLU A 1 78  ? -13.118 8.294   60.543  1.00 69.23  ? 64  GLU A OE1   1 
ATOM   439  O OE2   . GLU A 1 78  ? -14.405 7.256   62.037  1.00 64.23  ? 64  GLU A OE2   1 
ATOM   440  N N     . PHE A 1 79  ? -12.040 4.552   65.963  1.00 26.33  ? 65  PHE A N     1 
ATOM   441  C CA    . PHE A 1 79  ? -12.593 3.803   67.089  1.00 26.18  ? 65  PHE A CA    1 
ATOM   442  C C     . PHE A 1 79  ? -11.776 4.050   68.385  1.00 30.20  ? 65  PHE A C     1 
ATOM   443  O O     . PHE A 1 79  ? -12.349 4.172   69.474  1.00 31.16  ? 65  PHE A O     1 
ATOM   444  C CB    . PHE A 1 79  ? -12.617 2.297   66.734  1.00 32.18  ? 65  PHE A CB    1 
ATOM   445  C CG    . PHE A 1 79  ? -12.985 1.417   67.884  1.00 30.37  ? 65  PHE A CG    1 
ATOM   446  C CD1   . PHE A 1 79  ? -14.318 1.264   68.261  1.00 36.75  ? 65  PHE A CD1   1 
ATOM   447  C CD2   . PHE A 1 79  ? -12.001 0.807   68.653  1.00 31.57  ? 65  PHE A CD2   1 
ATOM   448  C CE1   . PHE A 1 79  ? -14.659 0.508   69.382  1.00 31.25  ? 65  PHE A CE1   1 
ATOM   449  C CE2   . PHE A 1 79  ? -12.339 0.050   69.781  1.00 28.52  ? 65  PHE A CE2   1 
ATOM   450  C CZ    . PHE A 1 79  ? -13.662 -0.094  70.148  1.00 29.05  ? 65  PHE A CZ    1 
ATOM   451  N N     . ILE A 1 80  ? -10.445 4.129   68.268  1.00 28.64  ? 66  ILE A N     1 
ATOM   452  C CA    . ILE A 1 80  ? -9.571  4.367   69.431  1.00 26.86  ? 66  ILE A CA    1 
ATOM   453  C C     . ILE A 1 80  ? -9.797  5.764   70.005  1.00 30.17  ? 66  ILE A C     1 
ATOM   454  O O     . ILE A 1 80  ? -9.904  5.956   71.225  1.00 26.60  ? 66  ILE A O     1 
ATOM   455  C CB    . ILE A 1 80  ? -8.060  4.259   69.042  1.00 25.70  ? 66  ILE A CB    1 
ATOM   456  C CG1   . ILE A 1 80  ? -7.696  2.813   68.684  1.00 25.65  ? 66  ILE A CG1   1 
ATOM   457  C CG2   . ILE A 1 80  ? -7.196  4.734   70.204  1.00 24.81  ? 66  ILE A CG2   1 
ATOM   458  C CD1   . ILE A 1 80  ? -6.349  2.658   67.973  1.00 23.47  ? 66  ILE A CD1   1 
ATOM   459  N N     . GLU A 1 81  ? -9.843  6.751   69.113  1.00 29.19  ? 67  GLU A N     1 
ATOM   460  C CA    . GLU A 1 81  ? -10.062 8.115   69.535  1.00 36.44  ? 67  GLU A CA    1 
ATOM   461  C C     . GLU A 1 81  ? -11.444 8.237   70.165  1.00 39.96  ? 67  GLU A C     1 
ATOM   462  O O     . GLU A 1 81  ? -11.599 8.789   71.262  1.00 34.34  ? 67  GLU A O     1 
ATOM   463  C CB    . GLU A 1 81  ? -9.961  9.058   68.347  1.00 42.47  ? 67  GLU A CB    1 
ATOM   464  C CG    . GLU A 1 81  ? -10.305 10.492  68.721  1.00 58.02  ? 67  GLU A CG    1 
ATOM   465  C CD    . GLU A 1 81  ? -9.856  11.498  67.676  1.00 69.64  ? 67  GLU A CD    1 
ATOM   466  O OE1   . GLU A 1 81  ? -10.112 11.250  66.471  1.00 77.55  ? 67  GLU A OE1   1 
ATOM   467  O OE2   . GLU A 1 81  ? -9.253  12.534  68.060  1.00 66.87  ? 67  GLU A OE2   1 
ATOM   468  N N     . ASP A 1 82  ? -12.456 7.715   69.479  1.00 36.23  ? 68  ASP A N     1 
ATOM   469  C CA    . ASP A 1 82  ? -13.794 7.800   70.039  1.00 38.53  ? 68  ASP A CA    1 
ATOM   470  C C     . ASP A 1 82  ? -13.855 7.143   71.413  1.00 35.27  ? 68  ASP A C     1 
ATOM   471  O O     . ASP A 1 82  ? -14.334 7.745   72.368  1.00 32.46  ? 68  ASP A O     1 
ATOM   472  C CB    . ASP A 1 82  ? -14.824 7.158   69.104  1.00 37.73  ? 68  ASP A CB    1 
ATOM   473  C CG    . ASP A 1 82  ? -15.018 7.949   67.832  1.00 50.86  ? 68  ASP A CG    1 
ATOM   474  O OD1   . ASP A 1 82  ? -14.677 9.154   67.808  1.00 52.94  ? 68  ASP A OD1   1 
ATOM   475  O OD2   . ASP A 1 82  ? -15.526 7.370   66.850  1.00 61.90  ? 68  ASP A OD2   1 
ATOM   476  N N     . SER A 1 83  ? -13.362 5.911   71.516  1.00 33.52  ? 69  SER A N     1 
ATOM   477  C CA    . SER A 1 83  ? -13.409 5.217   72.787  1.00 31.23  ? 69  SER A CA    1 
ATOM   478  C C     . SER A 1 83  ? -12.739 6.035   73.888  1.00 32.39  ? 69  SER A C     1 
ATOM   479  O O     . SER A 1 83  ? -13.340 6.296   74.928  1.00 34.87  ? 69  SER A O     1 
ATOM   480  C CB    . SER A 1 83  ? -12.749 3.834   72.673  1.00 31.23  ? 69  SER A CB    1 
ATOM   481  O OG    . SER A 1 83  ? -13.357 3.063   71.643  1.00 41.18  ? 69  SER A OG    1 
ATOM   482  N N     . LEU A 1 84  ? -11.500 6.454   73.661  1.00 30.99  ? 70  LEU A N     1 
ATOM   483  C CA    . LEU A 1 84  ? -10.799 7.200   74.678  1.00 29.98  ? 70  LEU A CA    1 
ATOM   484  C C     . LEU A 1 84  ? -11.379 8.574   74.976  1.00 29.93  ? 70  LEU A C     1 
ATOM   485  O O     . LEU A 1 84  ? -11.560 8.923   76.146  1.00 32.24  ? 70  LEU A O     1 
ATOM   486  C CB    . LEU A 1 84  ? -9.313  7.320   74.323  1.00 28.12  ? 70  LEU A CB    1 
ATOM   487  C CG    . LEU A 1 84  ? -8.533  5.997   74.386  1.00 27.35  ? 70  LEU A CG    1 
ATOM   488  C CD1   . LEU A 1 84  ? -7.104  6.288   73.992  1.00 23.85  ? 70  LEU A CD1   1 
ATOM   489  C CD2   . LEU A 1 84  ? -8.595  5.382   75.817  1.00 27.16  ? 70  LEU A CD2   1 
ATOM   490  N N     . ILE A 1 85  ? -11.683 9.361   73.948  1.00 31.31  ? 71  ILE A N     1 
ATOM   491  C CA    . ILE A 1 85  ? -12.220 10.698  74.198  1.00 34.71  ? 71  ILE A CA    1 
ATOM   492  C C     . ILE A 1 85  ? -13.582 10.640  74.895  1.00 36.76  ? 71  ILE A C     1 
ATOM   493  O O     . ILE A 1 85  ? -13.849 11.397  75.828  1.00 36.30  ? 71  ILE A O     1 
ATOM   494  C CB    . ILE A 1 85  ? -12.337 11.513  72.884  1.00 37.46  ? 71  ILE A CB    1 
ATOM   495  C CG1   . ILE A 1 85  ? -10.998 12.165  72.532  1.00 42.38  ? 71  ILE A CG1   1 
ATOM   496  C CG2   . ILE A 1 85  ? -13.311 12.659  73.063  1.00 40.14  ? 71  ILE A CG2   1 
ATOM   497  C CD1   . ILE A 1 85  ? -9.772  11.377  72.892  1.00 47.72  ? 71  ILE A CD1   1 
ATOM   498  N N     . THR A 1 86  ? -14.429 9.712   74.468  1.00 37.06  ? 72  THR A N     1 
ATOM   499  C CA    . THR A 1 86  ? -15.750 9.612   75.062  1.00 40.73  ? 72  THR A CA    1 
ATOM   500  C C     . THR A 1 86  ? -15.676 9.211   76.515  1.00 39.24  ? 72  THR A C     1 
ATOM   501  O O     . THR A 1 86  ? -16.425 9.730   77.328  1.00 38.17  ? 72  THR A O     1 
ATOM   502  C CB    . THR A 1 86  ? -16.643 8.591   74.333  1.00 40.67  ? 72  THR A CB    1 
ATOM   503  O OG1   . THR A 1 86  ? -16.841 9.001   72.975  1.00 43.73  ? 72  THR A OG1   1 
ATOM   504  C CG2   . THR A 1 86  ? -18.004 8.512   75.012  1.00 49.72  ? 72  THR A CG2   1 
ATOM   505  N N     . ARG A 1 87  ? -14.786 8.283   76.853  1.00 38.15  ? 73  ARG A N     1 
ATOM   506  C CA    . ARG A 1 87  ? -14.699 7.869   78.240  1.00 32.70  ? 73  ARG A CA    1 
ATOM   507  C C     . ARG A 1 87  ? -13.986 8.908   79.080  1.00 33.46  ? 73  ARG A C     1 
ATOM   508  O O     . ARG A 1 87  ? -14.234 9.003   80.269  1.00 32.37  ? 73  ARG A O     1 
ATOM   509  C CB    . ARG A 1 87  ? -14.034 6.506   78.363  1.00 35.35  ? 73  ARG A CB    1 
ATOM   510  C CG    . ARG A 1 87  ? -14.972 5.337   78.053  1.00 47.52  ? 73  ARG A CG    1 
ATOM   511  C CD    . ARG A 1 87  ? -14.293 3.991   78.320  1.00 58.06  ? 73  ARG A CD    1 
ATOM   512  N NE    . ARG A 1 87  ? -14.243 3.146   77.129  1.00 67.83  ? 73  ARG A NE    1 
ATOM   513  C CZ    . ARG A 1 87  ? -13.651 1.955   77.085  1.00 74.28  ? 73  ARG A CZ    1 
ATOM   514  N NH1   . ARG A 1 87  ? -13.059 1.470   78.170  1.00 79.53  ? 73  ARG A NH1   1 
ATOM   515  N NH2   . ARG A 1 87  ? -13.646 1.246   75.961  1.00 75.39  ? 73  ARG A NH2   1 
ATOM   516  N N     . ILE A 1 88  ? -13.102 9.698   78.473  1.00 34.68  ? 74  ILE A N     1 
ATOM   517  C CA    . ILE A 1 88  ? -12.430 10.738  79.231  1.00 32.20  ? 74  ILE A CA    1 
ATOM   518  C C     . ILE A 1 88  ? -13.496 11.750  79.681  1.00 36.35  ? 74  ILE A C     1 
ATOM   519  O O     . ILE A 1 88  ? -13.528 12.146  80.860  1.00 33.90  ? 74  ILE A O     1 
ATOM   520  C CB    . ILE A 1 88  ? -11.336 11.456  78.405  1.00 34.19  ? 74  ILE A CB    1 
ATOM   521  C CG1   . ILE A 1 88  ? -10.184 10.489  78.101  1.00 36.65  ? 74  ILE A CG1   1 
ATOM   522  C CG2   . ILE A 1 88  ? -10.814 12.674  79.160  1.00 27.79  ? 74  ILE A CG2   1 
ATOM   523  C CD1   . ILE A 1 88  ? -9.624  9.814   79.302  1.00 46.70  ? 74  ILE A CD1   1 
ATOM   524  N N     . ASN A 1 89  ? -14.376 12.156  78.765  1.00 34.28  ? 75  ASN A N     1 
ATOM   525  C CA    . ASN A 1 89  ? -15.443 13.107  79.134  1.00 34.82  ? 75  ASN A CA    1 
ATOM   526  C C     . ASN A 1 89  ? -16.343 12.503  80.217  1.00 30.13  ? 75  ASN A C     1 
ATOM   527  O O     . ASN A 1 89  ? -16.758 13.187  81.145  1.00 32.18  ? 75  ASN A O     1 
ATOM   528  C CB    . ASN A 1 89  ? -16.269 13.500  77.915  1.00 31.09  ? 75  ASN A CB    1 
ATOM   529  C CG    . ASN A 1 89  ? -15.421 14.115  76.825  1.00 38.14  ? 75  ASN A CG    1 
ATOM   530  O OD1   . ASN A 1 89  ? -14.408 14.742  77.105  1.00 50.20  ? 75  ASN A OD1   1 
ATOM   531  N ND2   . ASN A 1 89  ? -15.836 13.948  75.571  1.00 44.94  ? 75  ASN A ND2   1 
ATOM   532  N N     . LEU A 1 90  ? -16.602 11.204  80.123  1.00 30.99  ? 76  LEU A N     1 
ATOM   533  C CA    . LEU A 1 90  ? -17.424 10.550  81.118  1.00 32.95  ? 76  LEU A CA    1 
ATOM   534  C C     . LEU A 1 90  ? -16.761 10.707  82.480  1.00 35.62  ? 76  LEU A C     1 
ATOM   535  O O     . LEU A 1 90  ? -17.416 11.002  83.483  1.00 31.66  ? 76  LEU A O     1 
ATOM   536  C CB    . LEU A 1 90  ? -17.582 9.063   80.812  1.00 41.21  ? 76  LEU A CB    1 
ATOM   537  C CG    . LEU A 1 90  ? -18.942 8.566   80.326  1.00 50.33  ? 76  LEU A CG    1 
ATOM   538  C CD1   . LEU A 1 90  ? -20.023 9.492   80.886  1.00 50.91  ? 76  LEU A CD1   1 
ATOM   539  C CD2   . LEU A 1 90  ? -18.992 8.524   78.809  1.00 46.82  ? 76  LEU A CD2   1 
ATOM   540  N N     . ILE A 1 91  ? -15.455 10.488  82.527  1.00 30.72  ? 77  ILE A N     1 
ATOM   541  C CA    . ILE A 1 91  ? -14.739 10.639  83.788  1.00 30.18  ? 77  ILE A CA    1 
ATOM   542  C C     . ILE A 1 91  ? -14.848 12.078  84.311  1.00 28.19  ? 77  ILE A C     1 
ATOM   543  O O     . ILE A 1 91  ? -15.080 12.297  85.486  1.00 30.02  ? 77  ILE A O     1 
ATOM   544  C CB    . ILE A 1 91  ? -13.243 10.286  83.619  1.00 32.70  ? 77  ILE A CB    1 
ATOM   545  C CG1   . ILE A 1 91  ? -13.085 8.777   83.381  1.00 34.42  ? 77  ILE A CG1   1 
ATOM   546  C CG2   . ILE A 1 91  ? -12.462 10.747  84.829  1.00 26.99  ? 77  ILE A CG2   1 
ATOM   547  C CD1   . ILE A 1 91  ? -11.648 8.382   82.965  1.00 35.37  ? 77  ILE A CD1   1 
ATOM   548  N N     . LEU A 1 92  ? -14.684 13.054  83.430  1.00 28.39  ? 78  LEU A N     1 
ATOM   549  C CA    . LEU A 1 92  ? -14.743 14.446  83.836  1.00 33.51  ? 78  LEU A CA    1 
ATOM   550  C C     . LEU A 1 92  ? -16.098 14.859  84.395  1.00 40.08  ? 78  LEU A C     1 
ATOM   551  O O     . LEU A 1 92  ? -16.180 15.710  85.280  1.00 37.81  ? 78  LEU A O     1 
ATOM   552  C CB    . LEU A 1 92  ? -14.389 15.349  82.646  1.00 30.86  ? 78  LEU A CB    1 
ATOM   553  C CG    . LEU A 1 92  ? -12.961 15.103  82.139  1.00 36.02  ? 78  LEU A CG    1 
ATOM   554  C CD1   . LEU A 1 92  ? -12.603 16.069  81.024  1.00 32.17  ? 78  LEU A CD1   1 
ATOM   555  C CD2   . LEU A 1 92  ? -12.004 15.255  83.306  1.00 33.07  ? 78  LEU A CD2   1 
ATOM   556  N N     . LYS A 1 93  ? -17.168 14.275  83.882  1.00 43.40  ? 79  LYS A N     1 
ATOM   557  C CA    . LYS A 1 93  ? -18.473 14.665  84.380  1.00 48.43  ? 79  LYS A CA    1 
ATOM   558  C C     . LYS A 1 93  ? -18.841 13.938  85.657  1.00 47.14  ? 79  LYS A C     1 
ATOM   559  O O     . LYS A 1 93  ? -19.500 14.514  86.520  1.00 48.95  ? 79  LYS A O     1 
ATOM   560  C CB    . LYS A 1 93  ? -19.546 14.465  83.303  1.00 51.44  ? 79  LYS A CB    1 
ATOM   561  C CG    . LYS A 1 93  ? -19.911 13.040  83.001  1.00 61.86  ? 79  LYS A CG    1 
ATOM   562  C CD    . LYS A 1 93  ? -21.129 12.604  83.798  1.00 69.02  ? 79  LYS A CD    1 
ATOM   563  C CE    . LYS A 1 93  ? -21.653 11.268  83.280  1.00 74.80  ? 79  LYS A CE    1 
ATOM   564  N NZ    . LYS A 1 93  ? -22.816 10.758  84.061  1.00 79.00  ? 79  LYS A NZ    1 
ATOM   565  N N     . ASP A 1 94  ? -18.390 12.696  85.810  1.00 43.68  ? 80  ASP A N     1 
ATOM   566  C CA    . ASP A 1 94  ? -18.712 11.931  87.010  1.00 42.08  ? 80  ASP A CA    1 
ATOM   567  C C     . ASP A 1 94  ? -17.809 12.171  88.206  1.00 42.35  ? 80  ASP A C     1 
ATOM   568  O O     . ASP A 1 94  ? -18.264 12.135  89.345  1.00 45.74  ? 80  ASP A O     1 
ATOM   569  C CB    . ASP A 1 94  ? -18.688 10.421  86.739  1.00 45.97  ? 80  ASP A CB    1 
ATOM   570  C CG    . ASP A 1 94  ? -19.805 9.964   85.829  1.00 55.08  ? 80  ASP A CG    1 
ATOM   571  O OD1   . ASP A 1 94  ? -20.845 10.657  85.754  1.00 55.82  ? 80  ASP A OD1   1 
ATOM   572  O OD2   . ASP A 1 94  ? -19.646 8.892   85.200  1.00 56.31  ? 80  ASP A OD2   1 
ATOM   573  N N     . GLU A 1 95  ? -16.525 12.383  87.951  1.00 38.64  ? 81  GLU A N     1 
ATOM   574  C CA    . GLU A 1 95  ? -15.554 12.557  89.015  1.00 31.41  ? 81  GLU A CA    1 
ATOM   575  C C     . GLU A 1 95  ? -15.065 13.991  89.028  1.00 36.13  ? 81  GLU A C     1 
ATOM   576  O O     . GLU A 1 95  ? -14.584 14.496  88.014  1.00 37.78  ? 81  GLU A O     1 
ATOM   577  C CB    . GLU A 1 95  ? -14.407 11.581  88.770  1.00 32.90  ? 81  GLU A CB    1 
ATOM   578  C CG    . GLU A 1 95  ? -13.243 11.733  89.692  1.00 34.91  ? 81  GLU A CG    1 
ATOM   579  C CD    . GLU A 1 95  ? -13.693 11.759  91.126  1.00 39.10  ? 81  GLU A CD    1 
ATOM   580  O OE1   . GLU A 1 95  ? -13.666 12.855  91.736  1.00 40.98  ? 81  GLU A OE1   1 
ATOM   581  O OE2   . GLU A 1 95  ? -14.088 10.686  91.631  1.00 37.81  ? 81  GLU A OE2   1 
ATOM   582  N N     . LYS A 1 96  ? -15.159 14.651  90.176  1.00 34.18  ? 82  LYS A N     1 
ATOM   583  C CA    . LYS A 1 96  ? -14.752 16.041  90.221  1.00 36.86  ? 82  LYS A CA    1 
ATOM   584  C C     . LYS A 1 96  ? -13.420 16.265  90.922  1.00 37.16  ? 82  LYS A C     1 
ATOM   585  O O     . LYS A 1 96  ? -12.825 17.351  90.840  1.00 35.17  ? 82  LYS A O     1 
ATOM   586  C CB    . LYS A 1 96  ? -15.887 16.881  90.840  1.00 36.89  ? 82  LYS A CB    1 
ATOM   587  C CG    . LYS A 1 96  ? -17.211 16.767  90.047  1.00 34.02  ? 82  LYS A CG    1 
ATOM   588  C CD    . LYS A 1 96  ? -17.034 17.102  88.549  1.00 36.49  ? 82  LYS A CD    1 
ATOM   589  C CE    . LYS A 1 96  ? -18.362 17.050  87.778  1.00 41.01  ? 82  LYS A CE    1 
ATOM   590  N NZ    . LYS A 1 96  ? -18.243 17.604  86.386  1.00 37.75  ? 82  LYS A NZ    1 
ATOM   591  N N     . ASP A 1 97  ? -12.941 15.241  91.611  1.00 32.49  ? 83  ASP A N     1 
ATOM   592  C CA    . ASP A 1 97  ? -11.646 15.387  92.258  1.00 39.64  ? 83  ASP A CA    1 
ATOM   593  C C     . ASP A 1 97  ? -10.525 15.321  91.210  1.00 36.99  ? 83  ASP A C     1 
ATOM   594  O O     . ASP A 1 97  ? -10.401 14.337  90.475  1.00 36.38  ? 83  ASP A O     1 
ATOM   595  C CB    . ASP A 1 97  ? -11.395 14.298  93.290  1.00 35.35  ? 83  ASP A CB    1 
ATOM   596  C CG    . ASP A 1 97  ? -10.074 14.491  93.983  1.00 37.48  ? 83  ASP A CG    1 
ATOM   597  O OD1   . ASP A 1 97  ? -9.934  15.519  94.689  1.00 44.29  ? 83  ASP A OD1   1 
ATOM   598  O OD2   . ASP A 1 97  ? -9.170  13.643  93.810  1.00 45.39  ? 83  ASP A OD2   1 
ATOM   599  N N     . THR A 1 98  ? -9.710  16.370  91.170  1.00 37.05  ? 84  THR A N     1 
ATOM   600  C CA    . THR A 1 98  ? -8.611  16.467  90.228  1.00 36.69  ? 84  THR A CA    1 
ATOM   601  C C     . THR A 1 98  ? -7.679  15.256  90.205  1.00 36.58  ? 84  THR A C     1 
ATOM   602  O O     . THR A 1 98  ? -7.435  14.685  89.154  1.00 31.80  ? 84  THR A O     1 
ATOM   603  C CB    . THR A 1 98  ? -7.796  17.757  90.495  1.00 37.40  ? 84  THR A CB    1 
ATOM   604  O OG1   . THR A 1 98  ? -8.622  18.895  90.207  1.00 37.42  ? 84  THR A OG1   1 
ATOM   605  C CG2   . THR A 1 98  ? -6.551  17.810  89.617  1.00 33.03  ? 84  THR A CG2   1 
ATOM   606  N N     . THR A 1 99  ? -7.159  14.852  91.353  1.00 33.79  ? 85  THR A N     1 
ATOM   607  C CA    . THR A 1 99  ? -6.248  13.721  91.361  1.00 35.65  ? 85  THR A CA    1 
ATOM   608  C C     . THR A 1 99  ? -6.964  12.435  90.940  1.00 34.99  ? 85  THR A C     1 
ATOM   609  O O     . THR A 1 99  ? -6.386  11.606  90.241  1.00 30.67  ? 85  THR A O     1 
ATOM   610  C CB    . THR A 1 99  ? -5.587  13.552  92.756  1.00 35.66  ? 85  THR A CB    1 
ATOM   611  O OG1   . THR A 1 99  ? -5.004  14.801  93.144  1.00 44.35  ? 85  THR A OG1   1 
ATOM   612  C CG2   . THR A 1 99  ? -4.480  12.501  92.709  1.00 32.42  ? 85  THR A CG2   1 
ATOM   613  N N     . ALA A 1 100 ? -8.222  12.283  91.359  1.00 33.53  ? 86  ALA A N     1 
ATOM   614  C CA    . ALA A 1 100 ? -9.023  11.109  91.004  1.00 32.03  ? 86  ALA A CA    1 
ATOM   615  C C     . ALA A 1 100 ? -9.205  11.103  89.486  1.00 33.72  ? 86  ALA A C     1 
ATOM   616  O O     . ALA A 1 100 ? -9.161  10.044  88.835  1.00 33.75  ? 86  ALA A O     1 
ATOM   617  C CB    . ALA A 1 100 ? -10.397 11.170  91.691  1.00 25.79  ? 86  ALA A CB    1 
ATOM   618  N N     . ARG A 1 101 ? -9.398  12.295  88.930  1.00 26.49  ? 87  ARG A N     1 
ATOM   619  C CA    . ARG A 1 101 ? -9.575  12.439  87.497  1.00 33.60  ? 87  ARG A CA    1 
ATOM   620  C C     . ARG A 1 101 ? -8.339  11.929  86.744  1.00 33.26  ? 87  ARG A C     1 
ATOM   621  O O     . ARG A 1 101 ? -8.440  11.101  85.826  1.00 33.15  ? 87  ARG A O     1 
ATOM   622  C CB    . ARG A 1 101 ? -9.847  13.904  87.177  1.00 33.76  ? 87  ARG A CB    1 
ATOM   623  C CG    . ARG A 1 101 ? -11.255 14.114  86.694  1.00 43.50  ? 87  ARG A CG    1 
ATOM   624  C CD    . ARG A 1 101 ? -11.991 15.123  87.510  1.00 41.17  ? 87  ARG A CD    1 
ATOM   625  N NE    . ARG A 1 101 ? -11.708 16.489  87.109  1.00 40.81  ? 87  ARG A NE    1 
ATOM   626  C CZ    . ARG A 1 101 ? -12.578 17.284  86.497  1.00 42.25  ? 87  ARG A CZ    1 
ATOM   627  N NH1   . ARG A 1 101 ? -13.795 16.842  86.205  1.00 37.35  ? 87  ARG A NH1   1 
ATOM   628  N NH2   . ARG A 1 101 ? -12.240 18.538  86.213  1.00 36.80  ? 87  ARG A NH2   1 
ATOM   629  N N     . LEU A 1 102 ? -7.180  12.433  87.153  1.00 28.89  ? 88  LEU A N     1 
ATOM   630  C CA    . LEU A 1 102 ? -5.900  12.048  86.578  1.00 31.72  ? 88  LEU A CA    1 
ATOM   631  C C     . LEU A 1 102 ? -5.699  10.515  86.646  1.00 31.46  ? 88  LEU A C     1 
ATOM   632  O O     . LEU A 1 102 ? -5.378  9.867   85.643  1.00 27.99  ? 88  LEU A O     1 
ATOM   633  C CB    . LEU A 1 102 ? -4.789  12.788  87.335  1.00 27.51  ? 88  LEU A CB    1 
ATOM   634  C CG    . LEU A 1 102 ? -4.307  14.151  86.825  1.00 33.88  ? 88  LEU A CG    1 
ATOM   635  C CD1   . LEU A 1 102 ? -5.184  14.651  85.683  1.00 37.78  ? 88  LEU A CD1   1 
ATOM   636  C CD2   . LEU A 1 102 ? -4.246  15.136  87.968  1.00 27.27  ? 88  LEU A CD2   1 
ATOM   637  N N     . ARG A 1 103 ? -5.899  9.955   87.836  1.00 28.63  ? 89  ARG A N     1 
ATOM   638  C CA    . ARG A 1 103 ? -5.774  8.528   88.056  1.00 28.46  ? 89  ARG A CA    1 
ATOM   639  C C     . ARG A 1 103 ? -6.666  7.739   87.104  1.00 28.01  ? 89  ARG A C     1 
ATOM   640  O O     . ARG A 1 103 ? -6.224  6.761   86.484  1.00 28.49  ? 89  ARG A O     1 
ATOM   641  C CB    . ARG A 1 103 ? -6.159  8.195   89.504  1.00 30.85  ? 89  ARG A CB    1 
ATOM   642  C CG    . ARG A 1 103 ? -6.074  6.733   89.841  1.00 28.00  ? 89  ARG A CG    1 
ATOM   643  C CD    . ARG A 1 103 ? -6.361  6.465   91.318  1.00 31.58  ? 89  ARG A CD    1 
ATOM   644  N NE    . ARG A 1 103 ? -6.471  5.007   91.486  1.00 37.54  ? 89  ARG A NE    1 
ATOM   645  C CZ    . ARG A 1 103 ? -7.595  4.311   91.336  1.00 38.53  ? 89  ARG A CZ    1 
ATOM   646  N NH1   . ARG A 1 103 ? -8.694  4.987   91.045  1.00 45.95  ? 89  ARG A NH1   1 
ATOM   647  N NH2   . ARG A 1 103 ? -7.606  2.954   91.414  1.00 35.01  ? 89  ARG A NH2   1 
ATOM   648  N N     . LEU A 1 104 ? -7.934  8.142   87.006  1.00 28.79  ? 90  LEU A N     1 
ATOM   649  C CA    . LEU A 1 104 ? -8.891  7.446   86.131  1.00 22.94  ? 90  LEU A CA    1 
ATOM   650  C C     . LEU A 1 104 ? -8.555  7.565   84.652  1.00 24.45  ? 90  LEU A C     1 
ATOM   651  O O     . LEU A 1 104 ? -8.705  6.597   83.916  1.00 19.07  ? 90  LEU A O     1 
ATOM   652  C CB    . LEU A 1 104 ? -10.319 7.947   86.387  1.00 26.84  ? 90  LEU A CB    1 
ATOM   653  C CG    . LEU A 1 104 ? -10.876 7.525   87.755  1.00 32.35  ? 90  LEU A CG    1 
ATOM   654  C CD1   . LEU A 1 104 ? -12.138 8.317   88.065  1.00 29.91  ? 90  LEU A CD1   1 
ATOM   655  C CD2   . LEU A 1 104 ? -11.144 6.025   87.751  1.00 26.93  ? 90  LEU A CD2   1 
ATOM   656  N N     . ILE A 1 105 ? -8.110  8.736   84.197  1.00 21.05  ? 91  ILE A N     1 
ATOM   657  C CA    . ILE A 1 105 ? -7.728  8.857   82.800  1.00 22.82  ? 91  ILE A CA    1 
ATOM   658  C C     . ILE A 1 105 ? -6.515  7.935   82.483  1.00 26.99  ? 91  ILE A C     1 
ATOM   659  O O     . ILE A 1 105 ? -6.467  7.289   81.425  1.00 23.12  ? 91  ILE A O     1 
ATOM   660  C CB    . ILE A 1 105 ? -7.371  10.322  82.435  1.00 26.69  ? 91  ILE A CB    1 
ATOM   661  C CG1   . ILE A 1 105 ? -8.639  11.211  82.558  1.00 31.26  ? 91  ILE A CG1   1 
ATOM   662  C CG2   . ILE A 1 105 ? -6.817  10.369  80.998  1.00 22.93  ? 91  ILE A CG2   1 
ATOM   663  C CD1   . ILE A 1 105 ? -8.384  12.740  82.467  1.00 24.65  ? 91  ILE A CD1   1 
ATOM   664  N N     . VAL A 1 106 ? -5.539  7.874   83.387  1.00 26.43  ? 92  VAL A N     1 
ATOM   665  C CA    . VAL A 1 106 ? -4.357  7.020   83.159  1.00 27.16  ? 92  VAL A CA    1 
ATOM   666  C C     . VAL A 1 106 ? -4.787  5.559   83.177  1.00 27.12  ? 92  VAL A C     1 
ATOM   667  O O     . VAL A 1 106 ? -4.406  4.795   82.298  1.00 23.60  ? 92  VAL A O     1 
ATOM   668  C CB    . VAL A 1 106 ? -3.260  7.259   84.235  1.00 23.71  ? 92  VAL A CB    1 
ATOM   669  C CG1   . VAL A 1 106 ? -2.254  6.104   84.253  1.00 24.09  ? 92  VAL A CG1   1 
ATOM   670  C CG2   . VAL A 1 106 ? -2.552  8.575   83.932  1.00 20.74  ? 92  VAL A CG2   1 
ATOM   671  N N     . LEU A 1 107 ? -5.605  5.190   84.164  1.00 26.84  ? 93  LEU A N     1 
ATOM   672  C CA    . LEU A 1 107 ? -6.098  3.824   84.256  1.00 27.24  ? 93  LEU A CA    1 
ATOM   673  C C     . LEU A 1 107 ? -6.898  3.476   82.985  1.00 27.14  ? 93  LEU A C     1 
ATOM   674  O O     . LEU A 1 107 ? -6.782  2.374   82.456  1.00 23.68  ? 93  LEU A O     1 
ATOM   675  C CB    . LEU A 1 107 ? -6.988  3.659   85.492  1.00 23.82  ? 93  LEU A CB    1 
ATOM   676  C CG    . LEU A 1 107 ? -7.594  2.247   85.690  1.00 26.23  ? 93  LEU A CG    1 
ATOM   677  C CD1   . LEU A 1 107 ? -6.461  1.227   85.870  1.00 20.98  ? 93  LEU A CD1   1 
ATOM   678  C CD2   . LEU A 1 107 ? -8.502  2.222   86.920  1.00 25.37  ? 93  LEU A CD2   1 
ATOM   679  N N     . LEU A 1 108 ? -7.700  4.413   82.494  1.00 22.72  ? 94  LEU A N     1 
ATOM   680  C CA    . LEU A 1 108 ? -8.496  4.182   81.283  1.00 26.05  ? 94  LEU A CA    1 
ATOM   681  C C     . LEU A 1 108 ? -7.617  3.904   80.046  1.00 25.42  ? 94  LEU A C     1 
ATOM   682  O O     . LEU A 1 108 ? -7.938  3.085   79.184  1.00 22.48  ? 94  LEU A O     1 
ATOM   683  C CB    . LEU A 1 108 ? -9.366  5.410   80.987  1.00 27.00  ? 94  LEU A CB    1 
ATOM   684  C CG    . LEU A 1 108 ? -9.872  5.423   79.538  1.00 31.56  ? 94  LEU A CG    1 
ATOM   685  C CD1   . LEU A 1 108 ? -10.873 4.272   79.371  1.00 30.75  ? 94  LEU A CD1   1 
ATOM   686  C CD2   . LEU A 1 108 ? -10.509 6.750   79.201  1.00 29.28  ? 94  LEU A CD2   1 
ATOM   687  N N     . ILE A 1 109 ? -6.520  4.626   79.942  1.00 26.32  ? 95  ILE A N     1 
ATOM   688  C CA    . ILE A 1 109 ? -5.635  4.446   78.811  1.00 27.42  ? 95  ILE A CA    1 
ATOM   689  C C     . ILE A 1 109 ? -4.981  3.073   78.881  1.00 28.04  ? 95  ILE A C     1 
ATOM   690  O O     . ILE A 1 109 ? -4.962  2.353   77.886  1.00 23.90  ? 95  ILE A O     1 
ATOM   691  C CB    . ILE A 1 109 ? -4.574  5.563   78.789  1.00 26.52  ? 95  ILE A CB    1 
ATOM   692  C CG1   . ILE A 1 109 ? -5.281  6.898   78.530  1.00 24.41  ? 95  ILE A CG1   1 
ATOM   693  C CG2   . ILE A 1 109 ? -3.487  5.269   77.733  1.00 22.85  ? 95  ILE A CG2   1 
ATOM   694  C CD1   . ILE A 1 109 ? -4.380  8.107   78.652  1.00 25.68  ? 95  ILE A CD1   1 
ATOM   695  N N     . LEU A 1 110 ? -4.470  2.707   80.056  1.00 24.94  ? 96  LEU A N     1 
ATOM   696  C CA    . LEU A 1 110 ? -3.804  1.415   80.234  1.00 28.33  ? 96  LEU A CA    1 
ATOM   697  C C     . LEU A 1 110 ? -4.813  0.292   80.086  1.00 23.04  ? 96  LEU A C     1 
ATOM   698  O O     . LEU A 1 110 ? -4.556  -0.711  79.446  1.00 28.62  ? 96  LEU A O     1 
ATOM   699  C CB    . LEU A 1 110 ? -3.118  1.345   81.611  1.00 26.49  ? 96  LEU A CB    1 
ATOM   700  C CG    . LEU A 1 110 ? -1.722  1.940   81.852  1.00 34.91  ? 96  LEU A CG    1 
ATOM   701  C CD1   . LEU A 1 110 ? -1.252  2.798   80.700  1.00 35.07  ? 96  LEU A CD1   1 
ATOM   702  C CD2   . LEU A 1 110 ? -1.748  2.702   83.173  1.00 29.07  ? 96  LEU A CD2   1 
ATOM   703  N N     . GLY A 1 111 ? -5.973  0.477   80.683  1.00 29.91  ? 97  GLY A N     1 
ATOM   704  C CA    . GLY A 1 111 ? -7.017  -0.524  80.592  1.00 26.09  ? 97  GLY A CA    1 
ATOM   705  C C     . GLY A 1 111 ? -7.460  -0.686  79.153  1.00 26.98  ? 97  GLY A C     1 
ATOM   706  O O     . GLY A 1 111 ? -7.606  -1.809  78.678  1.00 20.33  ? 97  GLY A O     1 
ATOM   707  N N     . PHE A 1 112 ? -7.682  0.426   78.450  1.00 22.89  ? 98  PHE A N     1 
ATOM   708  C CA    . PHE A 1 112 ? -8.091  0.324   77.048  1.00 28.56  ? 98  PHE A CA    1 
ATOM   709  C C     . PHE A 1 112 ? -7.036  -0.429  76.240  1.00 25.65  ? 98  PHE A C     1 
ATOM   710  O O     . PHE A 1 112 ? -7.384  -1.265  75.394  1.00 31.26  ? 98  PHE A O     1 
ATOM   711  C CB    . PHE A 1 112 ? -8.302  1.704   76.406  1.00 29.02  ? 98  PHE A CB    1 
ATOM   712  C CG    . PHE A 1 112 ? -8.695  1.636   74.939  1.00 32.15  ? 98  PHE A CG    1 
ATOM   713  C CD1   . PHE A 1 112 ? -10.023 1.414   74.560  1.00 27.54  ? 98  PHE A CD1   1 
ATOM   714  C CD2   . PHE A 1 112 ? -7.724  1.764   73.932  1.00 33.91  ? 98  PHE A CD2   1 
ATOM   715  C CE1   . PHE A 1 112 ? -10.388 1.322   73.191  1.00 22.66  ? 98  PHE A CE1   1 
ATOM   716  C CE2   . PHE A 1 112 ? -8.076  1.673   72.555  1.00 25.04  ? 98  PHE A CE2   1 
ATOM   717  C CZ    . PHE A 1 112 ? -9.421  1.452   72.194  1.00 25.41  ? 98  PHE A CZ    1 
ATOM   718  N N     . GLY A 1 113 ? -5.751  -0.138  76.488  1.00 22.73  ? 99  GLY A N     1 
ATOM   719  C CA    . GLY A 1 113 ? -4.698  -0.801  75.734  1.00 19.90  ? 99  GLY A CA    1 
ATOM   720  C C     . GLY A 1 113 ? -4.657  -2.288  76.022  1.00 24.51  ? 99  GLY A C     1 
ATOM   721  O O     . GLY A 1 113 ? -4.550  -3.124  75.129  1.00 22.58  ? 99  GLY A O     1 
ATOM   722  N N     . GLU A 1 114 ? -4.745  -2.620  77.295  1.00 22.80  ? 100 GLU A N     1 
ATOM   723  C CA    . GLU A 1 114 ? -4.702  -4.009  77.716  1.00 29.55  ? 100 GLU A CA    1 
ATOM   724  C C     . GLU A 1 114 ? -5.863  -4.843  77.139  1.00 27.16  ? 100 GLU A C     1 
ATOM   725  O O     . GLU A 1 114 ? -5.683  -5.997  76.766  1.00 29.49  ? 100 GLU A O     1 
ATOM   726  C CB    . GLU A 1 114 ? -4.717  -4.049  79.255  1.00 28.04  ? 100 GLU A CB    1 
ATOM   727  C CG    . GLU A 1 114 ? -4.472  -5.427  79.864  1.00 28.95  ? 100 GLU A CG    1 
ATOM   728  C CD    . GLU A 1 114 ? -4.278  -5.373  81.372  1.00 33.36  ? 100 GLU A CD    1 
ATOM   729  O OE1   . GLU A 1 114 ? -3.624  -4.424  81.876  1.00 29.38  ? 100 GLU A OE1   1 
ATOM   730  O OE2   . GLU A 1 114 ? -4.783  -6.294  82.045  1.00 27.21  ? 100 GLU A OE2   1 
ATOM   731  N N     . ARG A 1 115 ? -7.041  -4.240  77.089  1.00 26.28  ? 101 ARG A N     1 
ATOM   732  C CA    . ARG A 1 115 ? -8.261  -4.865  76.571  1.00 30.35  ? 101 ARG A CA    1 
ATOM   733  C C     . ARG A 1 115 ? -8.187  -5.086  75.040  1.00 31.64  ? 101 ARG A C     1 
ATOM   734  O O     . ARG A 1 115 ? -8.809  -6.014  74.499  1.00 28.36  ? 101 ARG A O     1 
ATOM   735  C CB    . ARG A 1 115 ? -9.424  -3.939  76.911  1.00 30.74  ? 101 ARG A CB    1 
ATOM   736  C CG    . ARG A 1 115 ? -10.670 -4.552  77.549  1.00 46.30  ? 101 ARG A CG    1 
ATOM   737  C CD    . ARG A 1 115 ? -10.873 -4.100  79.001  1.00 38.04  ? 101 ARG A CD    1 
ATOM   738  N NE    . ARG A 1 115 ? -10.900 -2.636  79.180  1.00 46.22  ? 101 ARG A NE    1 
ATOM   739  C CZ    . ARG A 1 115 ? -11.239 -1.728  78.260  1.00 39.53  ? 101 ARG A CZ    1 
ATOM   740  N NH1   . ARG A 1 115 ? -11.602 -2.084  77.030  1.00 40.57  ? 101 ARG A NH1   1 
ATOM   741  N NH2   . ARG A 1 115 ? -11.201 -0.440  78.581  1.00 36.38  ? 101 ARG A NH2   1 
ATOM   742  N N     . ASN A 1 116 ? -7.399  -4.240  74.372  1.00 25.84  ? 102 ASN A N     1 
ATOM   743  C CA    . ASN A 1 116 ? -7.217  -4.264  72.910  1.00 27.64  ? 102 ASN A CA    1 
ATOM   744  C C     . ASN A 1 116 ? -5.737  -4.290  72.549  1.00 26.94  ? 102 ASN A C     1 
ATOM   745  O O     . ASN A 1 116 ? -5.189  -3.263  72.130  1.00 22.79  ? 102 ASN A O     1 
ATOM   746  C CB    . ASN A 1 116 ? -7.821  -2.993  72.303  1.00 21.86  ? 102 ASN A CB    1 
ATOM   747  C CG    . ASN A 1 116 ? -9.249  -2.793  72.689  1.00 26.31  ? 102 ASN A CG    1 
ATOM   748  O OD1   . ASN A 1 116 ? -10.129 -3.147  71.923  1.00 25.77  ? 102 ASN A OD1   1 
ATOM   749  N ND2   . ASN A 1 116 ? -9.501  -2.231  73.892  1.00 27.70  ? 102 ASN A ND2   1 
ATOM   750  N N     . PRO A 1 117 ? -5.078  -5.468  72.633  1.00 27.99  ? 103 PRO A N     1 
ATOM   751  C CA    . PRO A 1 117 ? -3.651  -5.484  72.304  1.00 25.43  ? 103 PRO A CA    1 
ATOM   752  C C     . PRO A 1 117 ? -3.305  -5.077  70.877  1.00 28.89  ? 103 PRO A C     1 
ATOM   753  O O     . PRO A 1 117 ? -2.292  -4.398  70.652  1.00 26.95  ? 103 PRO A O     1 
ATOM   754  C CB    . PRO A 1 117 ? -3.226  -6.922  72.616  1.00 28.25  ? 103 PRO A CB    1 
ATOM   755  C CG    . PRO A 1 117 ? -4.320  -7.431  73.549  1.00 33.37  ? 103 PRO A CG    1 
ATOM   756  C CD    . PRO A 1 117 ? -5.558  -6.820  72.971  1.00 27.46  ? 103 PRO A CD    1 
ATOM   757  N N     . GLY A 1 118 ? -4.131  -5.493  69.921  1.00 28.76  ? 104 GLY A N     1 
ATOM   758  C CA    . GLY A 1 118 ? -3.888  -5.136  68.520  1.00 27.02  ? 104 GLY A CA    1 
ATOM   759  C C     . GLY A 1 118 ? -3.912  -3.625  68.295  1.00 22.90  ? 104 GLY A C     1 
ATOM   760  O O     . GLY A 1 118 ? -3.059  -3.097  67.599  1.00 26.57  ? 104 GLY A O     1 
ATOM   761  N N     . LEU A 1 119 ? -4.865  -2.928  68.916  1.00 26.35  ? 105 LEU A N     1 
ATOM   762  C CA    . LEU A 1 119 ? -4.968  -1.468  68.794  1.00 25.67  ? 105 LEU A CA    1 
ATOM   763  C C     . LEU A 1 119 ? -3.817  -0.770  69.520  1.00 27.56  ? 105 LEU A C     1 
ATOM   764  O O     . LEU A 1 119 ? -3.408  0.332   69.137  1.00 27.34  ? 105 LEU A O     1 
ATOM   765  C CB    . LEU A 1 119 ? -6.311  -0.958  69.357  1.00 19.43  ? 105 LEU A CB    1 
ATOM   766  C CG    . LEU A 1 119 ? -7.587  -1.563  68.756  1.00 25.07  ? 105 LEU A CG    1 
ATOM   767  C CD1   . LEU A 1 119 ? -8.811  -0.817  69.254  1.00 27.17  ? 105 LEU A CD1   1 
ATOM   768  C CD2   . LEU A 1 119 ? -7.531  -1.489  67.253  1.00 25.35  ? 105 LEU A CD2   1 
ATOM   769  N N     . THR A 1 120 ? -3.314  -1.401  70.584  1.00 19.77  ? 106 THR A N     1 
ATOM   770  C CA    . THR A 1 120 ? -2.206  -0.846  71.309  1.00 23.91  ? 106 THR A CA    1 
ATOM   771  C C     . THR A 1 120 ? -1.024  -0.788  70.325  1.00 25.14  ? 106 THR A C     1 
ATOM   772  O O     . THR A 1 120 ? -0.265  0.185   70.275  1.00 27.90  ? 106 THR A O     1 
ATOM   773  C CB    . THR A 1 120 ? -1.860  -1.733  72.534  1.00 23.58  ? 106 THR A CB    1 
ATOM   774  O OG1   . THR A 1 120 ? -2.973  -1.744  73.432  1.00 29.78  ? 106 THR A OG1   1 
ATOM   775  C CG2   . THR A 1 120 ? -0.630  -1.203  73.273  1.00 23.51  ? 106 THR A CG2   1 
ATOM   776  N N     . ARG A 1 121 ? -0.888  -1.837  69.534  1.00 23.31  ? 107 ARG A N     1 
ATOM   777  C CA    . ARG A 1 121 ? 0.169   -1.930  68.538  1.00 28.94  ? 107 ARG A CA    1 
ATOM   778  C C     . ARG A 1 121 ? 0.086   -0.744  67.560  1.00 27.00  ? 107 ARG A C     1 
ATOM   779  O O     . ARG A 1 121 ? 1.091   -0.345  66.970  1.00 23.95  ? 107 ARG A O     1 
ATOM   780  C CB    . ARG A 1 121 ? 0.039   -3.265  67.809  1.00 30.43  ? 107 ARG A CB    1 
ATOM   781  C CG    . ARG A 1 121 ? 1.341   -3.827  67.283  1.00 38.89  ? 107 ARG A CG    1 
ATOM   782  C CD    . ARG A 1 121 ? 1.236   -5.364  67.075  1.00 35.39  ? 107 ARG A CD    1 
ATOM   783  N NE    . ARG A 1 121 ? 2.525   -5.949  67.386  1.00 34.43  ? 107 ARG A NE    1 
ATOM   784  C CZ    . ARG A 1 121 ? 2.738   -7.208  67.743  1.00 34.96  ? 107 ARG A CZ    1 
ATOM   785  N NH1   . ARG A 1 121 ? 1.750   -8.085  67.844  1.00 26.23  ? 107 ARG A NH1   1 
ATOM   786  N NH2   . ARG A 1 121 ? 3.973   -7.572  68.037  1.00 44.62  ? 107 ARG A NH2   1 
ATOM   787  N N     . ILE A 1 122 ? -1.118  -0.192  67.396  1.00 27.71  ? 108 ILE A N     1 
ATOM   788  C CA    . ILE A 1 122 ? -1.339  0.988   66.550  1.00 27.67  ? 108 ILE A CA    1 
ATOM   789  C C     . ILE A 1 122 ? -0.974  2.217   67.395  1.00 27.05  ? 108 ILE A C     1 
ATOM   790  O O     . ILE A 1 122 ? -0.283  3.135   66.920  1.00 29.09  ? 108 ILE A O     1 
ATOM   791  C CB    . ILE A 1 122 ? -2.835  1.098   66.081  1.00 28.66  ? 108 ILE A CB    1 
ATOM   792  C CG1   . ILE A 1 122 ? -3.094  0.069   64.975  1.00 25.69  ? 108 ILE A CG1   1 
ATOM   793  C CG2   . ILE A 1 122 ? -3.159  2.528   65.577  1.00 18.72  ? 108 ILE A CG2   1 
ATOM   794  C CD1   . ILE A 1 122 ? -4.565  -0.020  64.545  1.00 20.94  ? 108 ILE A CD1   1 
ATOM   795  N N     . LEU A 1 123 ? -1.428  2.229   68.649  1.00 24.41  ? 109 LEU A N     1 
ATOM   796  C CA    . LEU A 1 123 ? -1.133  3.339   69.562  1.00 26.63  ? 109 LEU A CA    1 
ATOM   797  C C     . LEU A 1 123 ? 0.365   3.632   69.742  1.00 23.96  ? 109 LEU A C     1 
ATOM   798  O O     . LEU A 1 123 ? 0.799   4.797   69.781  1.00 21.36  ? 109 LEU A O     1 
ATOM   799  C CB    . LEU A 1 123 ? -1.735  3.059   70.937  1.00 21.68  ? 109 LEU A CB    1 
ATOM   800  C CG    . LEU A 1 123 ? -3.106  3.632   71.176  1.00 29.94  ? 109 LEU A CG    1 
ATOM   801  C CD1   . LEU A 1 123 ? -3.627  3.091   72.512  1.00 27.82  ? 109 LEU A CD1   1 
ATOM   802  C CD2   . LEU A 1 123 ? -3.007  5.183   71.146  1.00 24.02  ? 109 LEU A CD2   1 
ATOM   803  N N     . THR A 1 124 ? 1.144   2.575   69.894  1.00 22.04  ? 110 THR A N     1 
ATOM   804  C CA    . THR A 1 124 ? 2.585   2.717   70.061  1.00 25.02  ? 110 THR A CA    1 
ATOM   805  C C     . THR A 1 124 ? 3.340   3.048   68.760  1.00 26.02  ? 110 THR A C     1 
ATOM   806  O O     . THR A 1 124 ? 4.556   3.283   68.797  1.00 25.49  ? 110 THR A O     1 
ATOM   807  C CB    . THR A 1 124 ? 3.187   1.422   70.673  1.00 31.34  ? 110 THR A CB    1 
ATOM   808  O OG1   . THR A 1 124 ? 2.889   0.298   69.823  1.00 25.96  ? 110 THR A OG1   1 
ATOM   809  C CG2   . THR A 1 124 ? 2.610   1.178   72.090  1.00 25.41  ? 110 THR A CG2   1 
ATOM   810  N N     . GLY A 1 125 ? 2.628   3.053   67.627  1.00 25.22  ? 111 GLY A N     1 
ATOM   811  C CA    . GLY A 1 125 ? 3.236   3.343   66.335  1.00 24.25  ? 111 GLY A CA    1 
ATOM   812  C C     . GLY A 1 125 ? 3.770   2.154   65.528  1.00 29.10  ? 111 GLY A C     1 
ATOM   813  O O     . GLY A 1 125 ? 3.936   2.242   64.306  1.00 24.58  ? 111 GLY A O     1 
ATOM   814  N N     . HIS A 1 126 ? 4.036   1.032   66.191  1.00 25.11  ? 112 HIS A N     1 
ATOM   815  C CA    . HIS A 1 126 ? 4.582   -0.139  65.507  1.00 26.67  ? 112 HIS A CA    1 
ATOM   816  C C     . HIS A 1 126 ? 3.845   -0.647  64.257  1.00 28.83  ? 112 HIS A C     1 
ATOM   817  O O     . HIS A 1 126 ? 4.467   -0.831  63.209  1.00 24.53  ? 112 HIS A O     1 
ATOM   818  C CB    . HIS A 1 126 ? 4.751   -1.279  66.519  1.00 24.53  ? 112 HIS A CB    1 
ATOM   819  C CG    . HIS A 1 126 ? 5.747   -0.968  67.584  1.00 27.27  ? 112 HIS A CG    1 
ATOM   820  N ND1   . HIS A 1 126 ? 5.404   -0.320  68.752  1.00 26.39  ? 112 HIS A ND1   1 
ATOM   821  C CD2   . HIS A 1 126 ? 7.100   -1.068  67.593  1.00 24.13  ? 112 HIS A CD2   1 
ATOM   822  C CE1   . HIS A 1 126 ? 6.500   -0.025  69.427  1.00 22.34  ? 112 HIS A CE1   1 
ATOM   823  N NE2   . HIS A 1 126 ? 7.544   -0.463  68.745  1.00 20.45  ? 112 HIS A NE2   1 
ATOM   824  N N     . ALA A 1 127 ? 2.533   -0.883  64.362  1.00 30.35  ? 113 ALA A N     1 
ATOM   825  C CA    . ALA A 1 127 ? 1.740   -1.395  63.225  1.00 28.54  ? 113 ALA A CA    1 
ATOM   826  C C     . ALA A 1 127 ? 1.667   -0.411  62.055  1.00 28.07  ? 113 ALA A C     1 
ATOM   827  O O     . ALA A 1 127 ? 1.493   -0.803  60.902  1.00 29.54  ? 113 ALA A O     1 
ATOM   828  C CB    . ALA A 1 127 ? 0.314   -1.753  63.691  1.00 28.24  ? 113 ALA A CB    1 
ATOM   829  N N     . LEU A 1 128 ? 1.795   0.870   62.372  1.00 24.37  ? 114 LEU A N     1 
ATOM   830  C CA    . LEU A 1 128 ? 1.755   1.914   61.383  1.00 27.39  ? 114 LEU A CA    1 
ATOM   831  C C     . LEU A 1 128 ? 3.053   2.050   60.564  1.00 29.07  ? 114 LEU A C     1 
ATOM   832  O O     . LEU A 1 128 ? 3.090   2.840   59.630  1.00 25.66  ? 114 LEU A O     1 
ATOM   833  C CB    . LEU A 1 128 ? 1.456   3.248   62.069  1.00 18.67  ? 114 LEU A CB    1 
ATOM   834  C CG    . LEU A 1 128 ? 0.131   3.259   62.807  1.00 25.72  ? 114 LEU A CG    1 
ATOM   835  C CD1   . LEU A 1 128 ? -0.103  4.616   63.401  1.00 20.98  ? 114 LEU A CD1   1 
ATOM   836  C CD2   . LEU A 1 128 ? -0.978  2.863   61.842  1.00 23.83  ? 114 LEU A CD2   1 
ATOM   837  N N     . MET A 1 129 ? 4.106   1.307   60.914  1.00 26.05  ? 115 MET A N     1 
ATOM   838  C CA    . MET A 1 129 ? 5.367   1.405   60.184  1.00 22.69  ? 115 MET A CA    1 
ATOM   839  C C     . MET A 1 129 ? 5.183   0.967   58.729  1.00 30.26  ? 115 MET A C     1 
ATOM   840  O O     . MET A 1 129 ? 5.906   1.416   57.827  1.00 28.23  ? 115 MET A O     1 
ATOM   841  C CB    . MET A 1 129 ? 6.433   0.542   60.855  1.00 25.96  ? 115 MET A CB    1 
ATOM   842  C CG    . MET A 1 129 ? 6.933   1.056   62.223  1.00 21.65  ? 115 MET A CG    1 
ATOM   843  S SD    . MET A 1 129 ? 7.556   2.788   62.175  1.00 27.09  ? 115 MET A SD    1 
ATOM   844  C CE    . MET A 1 129 ? 9.087   2.554   61.194  1.00 18.20  ? 115 MET A CE    1 
ATOM   845  N N     . PHE A 1 130 ? 4.202   0.100   58.501  1.00 27.41  ? 116 PHE A N     1 
ATOM   846  C CA    . PHE A 1 130 ? 3.940   -0.392  57.162  1.00 31.85  ? 116 PHE A CA    1 
ATOM   847  C C     . PHE A 1 130 ? 2.959   0.450   56.380  1.00 30.60  ? 116 PHE A C     1 
ATOM   848  O O     . PHE A 1 130 ? 2.834   0.276   55.178  1.00 35.27  ? 116 PHE A O     1 
ATOM   849  C CB    . PHE A 1 130 ? 3.380   -1.804  57.217  1.00 27.48  ? 116 PHE A CB    1 
ATOM   850  C CG    . PHE A 1 130 ? 4.170   -2.722  58.077  1.00 30.02  ? 116 PHE A CG    1 
ATOM   851  C CD1   . PHE A 1 130 ? 3.737   -3.029  59.376  1.00 33.42  ? 116 PHE A CD1   1 
ATOM   852  C CD2   . PHE A 1 130 ? 5.317   -3.340  57.578  1.00 32.90  ? 116 PHE A CD2   1 
ATOM   853  C CE1   . PHE A 1 130 ? 4.432   -3.936  60.171  1.00 29.53  ? 116 PHE A CE1   1 
ATOM   854  C CE2   . PHE A 1 130 ? 6.025   -4.248  58.358  1.00 33.56  ? 116 PHE A CE2   1 
ATOM   855  C CZ    . PHE A 1 130 ? 5.578   -4.555  59.661  1.00 33.32  ? 116 PHE A CZ    1 
ATOM   856  N N     . GLU A 1 131 ? 2.279   1.371   57.043  1.00 30.49  ? 117 GLU A N     1 
ATOM   857  C CA    . GLU A 1 131 ? 1.260   2.170   56.377  1.00 32.44  ? 117 GLU A CA    1 
ATOM   858  C C     . GLU A 1 131 ? 1.567   3.660   56.223  1.00 34.25  ? 117 GLU A C     1 
ATOM   859  O O     . GLU A 1 131 ? 2.653   4.109   56.597  1.00 35.28  ? 117 GLU A O     1 
ATOM   860  C CB    . GLU A 1 131 ? -0.046  1.984   57.131  1.00 33.23  ? 117 GLU A CB    1 
ATOM   861  C CG    . GLU A 1 131 ? -0.389  0.527   57.415  1.00 32.01  ? 117 GLU A CG    1 
ATOM   862  C CD    . GLU A 1 131 ? -0.733  -0.281  56.166  1.00 34.09  ? 117 GLU A CD    1 
ATOM   863  O OE1   . GLU A 1 131 ? -1.413  0.247   55.253  1.00 35.45  ? 117 GLU A OE1   1 
ATOM   864  O OE2   . GLU A 1 131 ? -0.345  -1.464  56.120  1.00 36.00  ? 117 GLU A OE2   1 
ATOM   865  N N     . GLN A 1 132 ? 0.604   4.396   55.653  1.00 34.15  ? 118 GLN A N     1 
ATOM   866  C CA    . GLN A 1 132 ? 0.693   5.843   55.416  1.00 36.18  ? 118 GLN A CA    1 
ATOM   867  C C     . GLN A 1 132 ? 1.180   6.685   56.592  1.00 36.99  ? 118 GLN A C     1 
ATOM   868  O O     . GLN A 1 132 ? 0.612   6.629   57.681  1.00 33.00  ? 118 GLN A O     1 
ATOM   869  C CB    . GLN A 1 132 ? -0.674  6.383   55.020  1.00 30.58  ? 118 GLN A CB    1 
ATOM   870  C CG    . GLN A 1 132 ? -1.014  6.198   53.582  1.00 47.02  ? 118 GLN A CG    1 
ATOM   871  C CD    . GLN A 1 132 ? -0.018  6.900   52.698  1.00 54.44  ? 118 GLN A CD    1 
ATOM   872  O OE1   . GLN A 1 132 ? 0.111   8.127   52.742  1.00 59.69  ? 118 GLN A OE1   1 
ATOM   873  N NE2   . GLN A 1 132 ? 0.713   6.127   51.897  1.00 56.59  ? 118 GLN A NE2   1 
ATOM   874  N N     . ASP A 1 133 ? 2.196   7.505   56.353  1.00 35.05  ? 119 ASP A N     1 
ATOM   875  C CA    . ASP A 1 133 ? 2.725   8.366   57.398  1.00 38.20  ? 119 ASP A CA    1 
ATOM   876  C C     . ASP A 1 133 ? 1.641   9.208   58.048  1.00 35.48  ? 119 ASP A C     1 
ATOM   877  O O     . ASP A 1 133 ? 1.739   9.591   59.216  1.00 37.40  ? 119 ASP A O     1 
ATOM   878  C CB    . ASP A 1 133 ? 3.814   9.279   56.842  1.00 41.70  ? 119 ASP A CB    1 
ATOM   879  C CG    . ASP A 1 133 ? 5.114   8.544   56.582  1.00 48.89  ? 119 ASP A CG    1 
ATOM   880  O OD1   . ASP A 1 133 ? 6.051   9.177   56.047  1.00 56.10  ? 119 ASP A OD1   1 
ATOM   881  O OD2   . ASP A 1 133 ? 5.208   7.340   56.909  1.00 53.34  ? 119 ASP A OD2   1 
ATOM   882  N N     . ARG A 1 134 ? 0.606   9.498   57.292  1.00 29.15  ? 120 ARG A N     1 
ATOM   883  C CA    . ARG A 1 134 ? -0.506  10.284  57.799  1.00 34.85  ? 120 ARG A CA    1 
ATOM   884  C C     . ARG A 1 134 ? -1.161  9.646   59.045  1.00 32.16  ? 120 ARG A C     1 
ATOM   885  O O     . ARG A 1 134 ? -1.636  10.355  59.938  1.00 30.39  ? 120 ARG A O     1 
ATOM   886  C CB    . ARG A 1 134 ? -1.568  10.427  56.695  1.00 34.81  ? 120 ARG A CB    1 
ATOM   887  C CG    . ARG A 1 134 ? -2.722  11.346  57.062  1.00 46.69  ? 120 ARG A CG    1 
ATOM   888  C CD    . ARG A 1 134 ? -3.852  11.291  56.042  1.00 47.92  ? 120 ARG A CD    1 
ATOM   889  N NE    . ARG A 1 134 ? -4.724  10.142  56.276  1.00 54.78  ? 120 ARG A NE    1 
ATOM   890  C CZ    . ARG A 1 134 ? -4.700  9.029   55.550  1.00 56.63  ? 120 ARG A CZ    1 
ATOM   891  N NH1   . ARG A 1 134 ? -3.850  8.909   54.532  1.00 62.74  ? 120 ARG A NH1   1 
ATOM   892  N NH2   . ARG A 1 134 ? -5.510  8.027   55.850  1.00 44.47  ? 120 ARG A NH2   1 
ATOM   893  N N     . LEU A 1 135 ? -1.198  8.312   59.086  1.00 30.09  ? 121 LEU A N     1 
ATOM   894  C CA    . LEU A 1 135 ? -1.835  7.604   60.183  1.00 29.35  ? 121 LEU A CA    1 
ATOM   895  C C     . LEU A 1 135 ? -1.107  7.820   61.510  1.00 29.04  ? 121 LEU A C     1 
ATOM   896  O O     . LEU A 1 135 ? -1.756  7.987   62.548  1.00 27.83  ? 121 LEU A O     1 
ATOM   897  C CB    . LEU A 1 135 ? -1.951  6.116   59.837  1.00 28.75  ? 121 LEU A CB    1 
ATOM   898  C CG    . LEU A 1 135 ? -2.779  5.808   58.574  1.00 28.00  ? 121 LEU A CG    1 
ATOM   899  C CD1   . LEU A 1 135 ? -2.533  4.356   58.085  1.00 24.74  ? 121 LEU A CD1   1 
ATOM   900  C CD2   . LEU A 1 135 ? -4.270  6.025   58.872  1.00 27.81  ? 121 LEU A CD2   1 
ATOM   901  N N     . GLN A 1 136 ? 0.226   7.843   61.484  1.00 23.19  ? 122 GLN A N     1 
ATOM   902  C CA    . GLN A 1 136 ? 0.976   8.071   62.710  1.00 25.35  ? 122 GLN A CA    1 
ATOM   903  C C     . GLN A 1 136 ? 0.626   9.501   63.107  1.00 28.86  ? 122 GLN A C     1 
ATOM   904  O O     . GLN A 1 136 ? 0.519   9.820   64.303  1.00 24.31  ? 122 GLN A O     1 
ATOM   905  C CB    . GLN A 1 136 ? 2.482   7.971   62.464  1.00 29.12  ? 122 GLN A CB    1 
ATOM   906  C CG    . GLN A 1 136 ? 3.219   7.042   63.425  1.00 44.59  ? 122 GLN A CG    1 
ATOM   907  C CD    . GLN A 1 136 ? 3.074   7.439   64.871  1.00 42.04  ? 122 GLN A CD    1 
ATOM   908  O OE1   . GLN A 1 136 ? 3.091   6.595   65.746  1.00 50.52  ? 122 GLN A OE1   1 
ATOM   909  N NE2   . GLN A 1 136 ? 2.943   8.733   65.130  1.00 53.05  ? 122 GLN A NE2   1 
ATOM   910  N N     . GLY A 1 137 ? 0.453   10.359  62.102  1.00 23.87  ? 123 GLY A N     1 
ATOM   911  C CA    . GLY A 1 137 ? 0.083   11.743  62.363  1.00 29.11  ? 123 GLY A CA    1 
ATOM   912  C C     . GLY A 1 137 ? -1.219  11.823  63.152  1.00 26.54  ? 123 GLY A C     1 
ATOM   913  O O     . GLY A 1 137 ? -1.394  12.648  64.052  1.00 32.33  ? 123 GLY A O     1 
ATOM   914  N N     . ARG A 1 138 ? -2.145  10.942  62.813  1.00 31.52  ? 124 ARG A N     1 
ATOM   915  C CA    . ARG A 1 138 ? -3.430  10.884  63.488  1.00 30.47  ? 124 ARG A CA    1 
ATOM   916  C C     . ARG A 1 138 ? -3.222  10.476  64.948  1.00 28.86  ? 124 ARG A C     1 
ATOM   917  O O     . ARG A 1 138 ? -3.809  11.065  65.855  1.00 25.40  ? 124 ARG A O     1 
ATOM   918  C CB    . ARG A 1 138 ? -4.323  9.862   62.786  1.00 31.38  ? 124 ARG A CB    1 
ATOM   919  C CG    . ARG A 1 138 ? -5.238  10.447  61.770  1.00 43.94  ? 124 ARG A CG    1 
ATOM   920  C CD    . ARG A 1 138 ? -6.657  10.433  62.296  1.00 48.15  ? 124 ARG A CD    1 
ATOM   921  N NE    . ARG A 1 138 ? -7.466  9.441   61.603  1.00 46.43  ? 124 ARG A NE    1 
ATOM   922  C CZ    . ARG A 1 138 ? -8.755  9.252   61.835  1.00 42.66  ? 124 ARG A CZ    1 
ATOM   923  N NH1   . ARG A 1 138 ? -9.368  9.982   62.741  1.00 44.55  ? 124 ARG A NH1   1 
ATOM   924  N NH2   . ARG A 1 138 ? -9.428  8.342   61.155  1.00 46.55  ? 124 ARG A NH2   1 
ATOM   925  N N     . ILE A 1 139 ? -2.400  9.448   65.161  1.00 27.90  ? 125 ILE A N     1 
ATOM   926  C CA    . ILE A 1 139 ? -2.116  8.975   66.499  1.00 25.24  ? 125 ILE A CA    1 
ATOM   927  C C     . ILE A 1 139 ? -1.426  10.061  67.322  1.00 30.69  ? 125 ILE A C     1 
ATOM   928  O O     . ILE A 1 139 ? -1.697  10.194  68.536  1.00 30.88  ? 125 ILE A O     1 
ATOM   929  C CB    . ILE A 1 139 ? -1.252  7.665   66.479  1.00 32.34  ? 125 ILE A CB    1 
ATOM   930  C CG1   . ILE A 1 139 ? -2.117  6.472   66.020  1.00 28.08  ? 125 ILE A CG1   1 
ATOM   931  C CG2   . ILE A 1 139 ? -0.689  7.381   67.867  1.00 27.90  ? 125 ILE A CG2   1 
ATOM   932  C CD1   . ILE A 1 139 ? -3.399  6.276   66.888  1.00 23.49  ? 125 ILE A CD1   1 
ATOM   933  N N     . ASN A 1 140 ? -0.536  10.836  66.691  1.00 28.27  ? 126 ASN A N     1 
ATOM   934  C CA    . ASN A 1 140 ? 0.131   11.912  67.420  1.00 25.37  ? 126 ASN A CA    1 
ATOM   935  C C     . ASN A 1 140 ? -0.916  12.948  67.847  1.00 26.51  ? 126 ASN A C     1 
ATOM   936  O O     . ASN A 1 140 ? -0.866  13.460  68.971  1.00 31.15  ? 126 ASN A O     1 
ATOM   937  C CB    . ASN A 1 140 ? 1.213   12.591  66.571  1.00 23.89  ? 126 ASN A CB    1 
ATOM   938  C CG    . ASN A 1 140 ? 2.507   11.802  66.524  1.00 33.09  ? 126 ASN A CG    1 
ATOM   939  O OD1   . ASN A 1 140 ? 2.812   11.033  67.438  1.00 35.18  ? 126 ASN A OD1   1 
ATOM   940  N ND2   . ASN A 1 140 ? 3.290   12.003  65.459  1.00 31.16  ? 126 ASN A ND2   1 
ATOM   941  N N     . GLN A 1 141 ? -1.862  13.269  66.967  1.00 24.68  ? 127 GLN A N     1 
ATOM   942  C CA    . GLN A 1 141 ? -2.895  14.250  67.341  1.00 28.93  ? 127 GLN A CA    1 
ATOM   943  C C     . GLN A 1 141 ? -3.735  13.747  68.520  1.00 28.38  ? 127 GLN A C     1 
ATOM   944  O O     . GLN A 1 141 ? -4.141  14.539  69.376  1.00 29.74  ? 127 GLN A O     1 
ATOM   945  C CB    . GLN A 1 141 ? -3.825  14.542  66.164  1.00 29.62  ? 127 GLN A CB    1 
ATOM   946  C CG    . GLN A 1 141 ? -3.104  14.980  64.900  1.00 44.89  ? 127 GLN A CG    1 
ATOM   947  C CD    . GLN A 1 141 ? -4.062  15.231  63.741  1.00 55.19  ? 127 GLN A CD    1 
ATOM   948  O OE1   . GLN A 1 141 ? -4.865  16.167  63.777  1.00 60.32  ? 127 GLN A OE1   1 
ATOM   949  N NE2   . GLN A 1 141 ? -3.989  14.387  62.712  1.00 55.79  ? 127 GLN A NE2   1 
ATOM   950  N N     . LEU A 1 142 ? -4.008  12.438  68.549  1.00 26.46  ? 128 LEU A N     1 
ATOM   951  C CA    . LEU A 1 142 ? -4.791  11.837  69.622  1.00 23.19  ? 128 LEU A CA    1 
ATOM   952  C C     . LEU A 1 142 ? -4.006  11.987  70.933  1.00 25.37  ? 128 LEU A C     1 
ATOM   953  O O     . LEU A 1 142 ? -4.571  12.353  71.966  1.00 23.86  ? 128 LEU A O     1 
ATOM   954  C CB    . LEU A 1 142 ? -5.069  10.350  69.313  1.00 25.31  ? 128 LEU A CB    1 
ATOM   955  C CG    . LEU A 1 142 ? -5.782  9.571   70.419  1.00 27.16  ? 128 LEU A CG    1 
ATOM   956  C CD1   . LEU A 1 142 ? -7.145  10.182  70.673  1.00 31.24  ? 128 LEU A CD1   1 
ATOM   957  C CD2   . LEU A 1 142 ? -5.929  8.092   70.032  1.00 29.18  ? 128 LEU A CD2   1 
ATOM   958  N N     . PHE A 1 143 ? -2.700  11.722  70.897  1.00 25.40  ? 129 PHE A N     1 
ATOM   959  C CA    . PHE A 1 143 ? -1.891  11.904  72.096  1.00 26.49  ? 129 PHE A CA    1 
ATOM   960  C C     . PHE A 1 143 ? -1.872  13.365  72.532  1.00 27.78  ? 129 PHE A C     1 
ATOM   961  O O     . PHE A 1 143 ? -1.911  13.651  73.743  1.00 23.86  ? 129 PHE A O     1 
ATOM   962  C CB    . PHE A 1 143 ? -0.454  11.423  71.877  1.00 25.35  ? 129 PHE A CB    1 
ATOM   963  C CG    . PHE A 1 143 ? -0.300  9.949   72.038  1.00 29.15  ? 129 PHE A CG    1 
ATOM   964  C CD1   . PHE A 1 143 ? -0.724  9.327   73.210  1.00 34.48  ? 129 PHE A CD1   1 
ATOM   965  C CD2   . PHE A 1 143 ? 0.225   9.171   71.016  1.00 27.76  ? 129 PHE A CD2   1 
ATOM   966  C CE1   . PHE A 1 143 ? -0.630  7.943   73.359  1.00 35.37  ? 129 PHE A CE1   1 
ATOM   967  C CE2   . PHE A 1 143 ? 0.322   7.789   71.154  1.00 29.14  ? 129 PHE A CE2   1 
ATOM   968  C CZ    . PHE A 1 143 ? -0.109  7.177   72.325  1.00 26.49  ? 129 PHE A CZ    1 
ATOM   969  N N     . GLU A 1 144 ? -1.807  14.287  71.566  1.00 24.04  ? 130 GLU A N     1 
ATOM   970  C CA    . GLU A 1 144 ? -1.810  15.717  71.909  1.00 29.53  ? 130 GLU A CA    1 
ATOM   971  C C     . GLU A 1 144 ? -3.138  16.079  72.558  1.00 29.92  ? 130 GLU A C     1 
ATOM   972  O O     . GLU A 1 144 ? -3.167  16.826  73.536  1.00 28.49  ? 130 GLU A O     1 
ATOM   973  C CB    . GLU A 1 144 ? -1.584  16.603  70.682  1.00 27.29  ? 130 GLU A CB    1 
ATOM   974  C CG    . GLU A 1 144 ? -0.162  16.543  70.135  1.00 46.69  ? 130 GLU A CG    1 
ATOM   975  C CD    . GLU A 1 144 ? 0.875   16.795  71.221  1.00 51.89  ? 130 GLU A CD    1 
ATOM   976  O OE1   . GLU A 1 144 ? 0.629   17.687  72.062  1.00 55.09  ? 130 GLU A OE1   1 
ATOM   977  O OE2   . GLU A 1 144 ? 1.930   16.116  71.232  1.00 53.17  ? 130 GLU A OE2   1 
ATOM   978  N N     . ARG A 1 145 ? -4.234  15.536  72.023  1.00 27.92  ? 131 ARG A N     1 
ATOM   979  C CA    . ARG A 1 145 ? -5.553  15.794  72.587  1.00 30.23  ? 131 ARG A CA    1 
ATOM   980  C C     . ARG A 1 145 ? -5.610  15.298  74.054  1.00 30.81  ? 131 ARG A C     1 
ATOM   981  O O     . ARG A 1 145 ? -6.027  16.025  74.976  1.00 27.47  ? 131 ARG A O     1 
ATOM   982  C CB    . ARG A 1 145 ? -6.614  15.102  71.716  1.00 27.85  ? 131 ARG A CB    1 
ATOM   983  C CG    . ARG A 1 145 ? -8.046  15.403  72.118  1.00 44.51  ? 131 ARG A CG    1 
ATOM   984  C CD    . ARG A 1 145 ? -8.819  16.123  71.013  1.00 54.58  ? 131 ARG A CD    1 
ATOM   985  N NE    . ARG A 1 145 ? -9.768  15.260  70.303  1.00 55.45  ? 131 ARG A NE    1 
ATOM   986  C CZ    . ARG A 1 145 ? -11.057 15.118  70.620  1.00 52.99  ? 131 ARG A CZ    1 
ATOM   987  N NH1   . ARG A 1 145 ? -11.586 15.779  71.640  1.00 46.17  ? 131 ARG A NH1   1 
ATOM   988  N NH2   . ARG A 1 145 ? -11.822 14.302  69.910  1.00 52.37  ? 131 ARG A NH2   1 
ATOM   989  N N     . ILE A 1 146 ? -5.175  14.062  74.273  1.00 28.93  ? 132 ILE A N     1 
ATOM   990  C CA    . ILE A 1 146 ? -5.160  13.495  75.609  1.00 29.18  ? 132 ILE A CA    1 
ATOM   991  C C     . ILE A 1 146 ? -4.277  14.330  76.560  1.00 32.06  ? 132 ILE A C     1 
ATOM   992  O O     . ILE A 1 146 ? -4.665  14.626  77.707  1.00 28.32  ? 132 ILE A O     1 
ATOM   993  C CB    . ILE A 1 146 ? -4.662  12.030  75.549  1.00 31.78  ? 132 ILE A CB    1 
ATOM   994  C CG1   . ILE A 1 146 ? -5.755  11.171  74.904  1.00 29.23  ? 132 ILE A CG1   1 
ATOM   995  C CG2   . ILE A 1 146 ? -4.242  11.545  76.950  1.00 31.49  ? 132 ILE A CG2   1 
ATOM   996  C CD1   . ILE A 1 146 ? -5.361  9.750   74.539  1.00 31.46  ? 132 ILE A CD1   1 
ATOM   997  N N     . GLU A 1 147 ? -3.098  14.732  76.087  1.00 27.97  ? 133 GLU A N     1 
ATOM   998  C CA    . GLU A 1 147 ? -2.218  15.521  76.930  1.00 28.40  ? 133 GLU A CA    1 
ATOM   999  C C     . GLU A 1 147 ? -2.883  16.876  77.232  1.00 27.63  ? 133 GLU A C     1 
ATOM   1000 O O     . GLU A 1 147 ? -2.841  17.383  78.370  1.00 27.21  ? 133 GLU A O     1 
ATOM   1001 C CB    . GLU A 1 147 ? -0.858  15.711  76.241  1.00 25.37  ? 133 GLU A CB    1 
ATOM   1002 C CG    . GLU A 1 147 ? 0.276   15.847  77.234  1.00 29.65  ? 133 GLU A CG    1 
ATOM   1003 C CD    . GLU A 1 147 ? 1.654   15.955  76.586  1.00 34.10  ? 133 GLU A CD    1 
ATOM   1004 O OE1   . GLU A 1 147 ? 1.932   15.230  75.603  1.00 30.85  ? 133 GLU A OE1   1 
ATOM   1005 O OE2   . GLU A 1 147 ? 2.467   16.763  77.087  1.00 32.21  ? 133 GLU A OE2   1 
ATOM   1006 N N     . VAL A 1 148 ? -3.516  17.442  76.213  1.00 25.40  ? 134 VAL A N     1 
ATOM   1007 C CA    . VAL A 1 148 ? -4.199  18.716  76.368  1.00 30.84  ? 134 VAL A CA    1 
ATOM   1008 C C     . VAL A 1 148 ? -5.267  18.605  77.458  1.00 29.97  ? 134 VAL A C     1 
ATOM   1009 O O     . VAL A 1 148 ? -5.383  19.514  78.290  1.00 29.55  ? 134 VAL A O     1 
ATOM   1010 C CB    . VAL A 1 148 ? -4.852  19.162  75.050  1.00 29.42  ? 134 VAL A CB    1 
ATOM   1011 C CG1   . VAL A 1 148 ? -5.661  20.435  75.262  1.00 19.99  ? 134 VAL A CG1   1 
ATOM   1012 C CG2   . VAL A 1 148 ? -3.791  19.382  73.982  1.00 19.99  ? 134 VAL A CG2   1 
ATOM   1013 N N     . GLN A 1 149 ? -6.029  17.503  77.461  1.00 28.22  ? 135 GLN A N     1 
ATOM   1014 C CA    . GLN A 1 149 ? -7.077  17.266  78.478  1.00 24.62  ? 135 GLN A CA    1 
ATOM   1015 C C     . GLN A 1 149 ? -6.460  17.108  79.865  1.00 29.59  ? 135 GLN A C     1 
ATOM   1016 O O     . GLN A 1 149 ? -7.026  17.539  80.865  1.00 29.26  ? 135 GLN A O     1 
ATOM   1017 C CB    . GLN A 1 149 ? -7.866  15.976  78.179  1.00 28.63  ? 135 GLN A CB    1 
ATOM   1018 C CG    . GLN A 1 149 ? -9.222  16.136  77.504  1.00 39.87  ? 135 GLN A CG    1 
ATOM   1019 C CD    . GLN A 1 149 ? -10.160 17.053  78.264  1.00 44.14  ? 135 GLN A CD    1 
ATOM   1020 O OE1   . GLN A 1 149 ? -9.962  17.343  79.453  1.00 48.97  ? 135 GLN A OE1   1 
ATOM   1021 N NE2   . GLN A 1 149 ? -11.191 17.517  77.582  1.00 51.46  ? 135 GLN A NE2   1 
ATOM   1022 N N     . LEU A 1 150 ? -5.312  16.433  79.921  1.00 30.29  ? 136 LEU A N     1 
ATOM   1023 C CA    . LEU A 1 150 ? -4.587  16.227  81.169  1.00 32.98  ? 136 LEU A CA    1 
ATOM   1024 C C     . LEU A 1 150 ? -4.215  17.585  81.764  1.00 33.24  ? 136 LEU A C     1 
ATOM   1025 O O     . LEU A 1 150 ? -4.425  17.836  82.960  1.00 31.09  ? 136 LEU A O     1 
ATOM   1026 C CB    . LEU A 1 150 ? -3.310  15.432  80.890  1.00 34.96  ? 136 LEU A CB    1 
ATOM   1027 C CG    . LEU A 1 150 ? -3.208  13.992  81.403  1.00 38.59  ? 136 LEU A CG    1 
ATOM   1028 C CD1   . LEU A 1 150 ? -4.583  13.339  81.460  1.00 37.51  ? 136 LEU A CD1   1 
ATOM   1029 C CD2   . LEU A 1 150 ? -2.239  13.217  80.514  1.00 30.56  ? 136 LEU A CD2   1 
ATOM   1030 N N     . ARG A 1 151 ? -3.659  18.460  80.926  1.00 32.20  ? 137 ARG A N     1 
ATOM   1031 C CA    . ARG A 1 151 ? -3.277  19.779  81.404  1.00 34.33  ? 137 ARG A CA    1 
ATOM   1032 C C     . ARG A 1 151 ? -4.514  20.528  81.898  1.00 30.76  ? 137 ARG A C     1 
ATOM   1033 O O     . ARG A 1 151 ? -4.474  21.156  82.958  1.00 32.54  ? 137 ARG A O     1 
ATOM   1034 C CB    . ARG A 1 151 ? -2.572  20.590  80.308  1.00 28.45  ? 137 ARG A CB    1 
ATOM   1035 C CG    . ARG A 1 151 ? -1.159  20.147  79.976  1.00 31.60  ? 137 ARG A CG    1 
ATOM   1036 C CD    . ARG A 1 151 ? -0.453  21.196  79.083  1.00 32.23  ? 137 ARG A CD    1 
ATOM   1037 N NE    . ARG A 1 151 ? -1.090  21.347  77.773  1.00 38.37  ? 137 ARG A NE    1 
ATOM   1038 C CZ    . ARG A 1 151 ? -0.878  20.546  76.730  1.00 37.86  ? 137 ARG A CZ    1 
ATOM   1039 N NH1   . ARG A 1 151 ? -0.037  19.525  76.823  1.00 32.94  ? 137 ARG A NH1   1 
ATOM   1040 N NH2   . ARG A 1 151 ? -1.519  20.764  75.591  1.00 34.82  ? 137 ARG A NH2   1 
ATOM   1041 N N     . GLN A 1 152 ? -5.613  20.446  81.152  1.00 32.97  ? 138 GLN A N     1 
ATOM   1042 C CA    . GLN A 1 152 ? -6.834  21.153  81.553  1.00 36.38  ? 138 GLN A CA    1 
ATOM   1043 C C     . GLN A 1 152 ? -7.326  20.709  82.911  1.00 31.93  ? 138 GLN A C     1 
ATOM   1044 O O     . GLN A 1 152 ? -7.714  21.524  83.723  1.00 30.41  ? 138 GLN A O     1 
ATOM   1045 C CB    . GLN A 1 152 ? -7.949  20.981  80.526  1.00 41.88  ? 138 GLN A CB    1 
ATOM   1046 C CG    . GLN A 1 152 ? -9.190  21.835  80.834  1.00 50.84  ? 138 GLN A CG    1 
ATOM   1047 C CD    . GLN A 1 152 ? -10.264 21.689  79.760  1.00 67.52  ? 138 GLN A CD    1 
ATOM   1048 O OE1   . GLN A 1 152 ? -10.011 21.952  78.575  1.00 72.01  ? 138 GLN A OE1   1 
ATOM   1049 N NE2   . GLN A 1 152 ? -11.467 21.263  80.165  1.00 68.07  ? 138 GLN A NE2   1 
ATOM   1050 N N     . VAL A 1 153 ? -7.317  19.407  83.157  1.00 34.11  ? 139 VAL A N     1 
ATOM   1051 C CA    . VAL A 1 153 ? -7.721  18.889  84.450  1.00 30.20  ? 139 VAL A CA    1 
ATOM   1052 C C     . VAL A 1 153 ? -6.814  19.495  85.525  1.00 30.44  ? 139 VAL A C     1 
ATOM   1053 O O     . VAL A 1 153 ? -7.272  19.891  86.602  1.00 27.05  ? 139 VAL A O     1 
ATOM   1054 C CB    . VAL A 1 153 ? -7.568  17.366  84.506  1.00 29.91  ? 139 VAL A CB    1 
ATOM   1055 C CG1   . VAL A 1 153 ? -7.601  16.898  85.927  1.00 23.96  ? 139 VAL A CG1   1 
ATOM   1056 C CG2   . VAL A 1 153 ? -8.671  16.700  83.697  1.00 34.38  ? 139 VAL A CG2   1 
ATOM   1057 N N     . MET A 1 154 ? -5.515  19.549  85.241  1.00 30.17  ? 140 MET A N     1 
ATOM   1058 C CA    . MET A 1 154 ? -4.575  20.111  86.201  1.00 31.77  ? 140 MET A CA    1 
ATOM   1059 C C     . MET A 1 154 ? -4.844  21.583  86.464  1.00 33.14  ? 140 MET A C     1 
ATOM   1060 O O     . MET A 1 154 ? -4.717  22.036  87.604  1.00 33.07  ? 140 MET A O     1 
ATOM   1061 C CB    . MET A 1 154 ? -3.130  19.935  85.721  1.00 29.06  ? 140 MET A CB    1 
ATOM   1062 C CG    . MET A 1 154 ? -2.714  18.483  85.667  1.00 29.03  ? 140 MET A CG    1 
ATOM   1063 S SD    . MET A 1 154 ? -1.126  18.235  84.880  1.00 34.83  ? 140 MET A SD    1 
ATOM   1064 C CE    . MET A 1 154 ? -1.063  16.428  84.974  1.00 27.37  ? 140 MET A CE    1 
ATOM   1065 N N     . ARG A 1 155 ? -5.204  22.331  85.419  1.00 31.08  ? 141 ARG A N     1 
ATOM   1066 C CA    . ARG A 1 155 ? -5.479  23.759  85.570  1.00 35.19  ? 141 ARG A CA    1 
ATOM   1067 C C     . ARG A 1 155 ? -6.731  24.093  86.378  1.00 37.48  ? 141 ARG A C     1 
ATOM   1068 O O     . ARG A 1 155 ? -6.916  25.242  86.774  1.00 42.39  ? 141 ARG A O     1 
ATOM   1069 C CB    . ARG A 1 155 ? -5.554  24.436  84.194  1.00 36.15  ? 141 ARG A CB    1 
ATOM   1070 C CG    . ARG A 1 155 ? -4.177  24.713  83.612  1.00 33.75  ? 141 ARG A CG    1 
ATOM   1071 C CD    . ARG A 1 155 ? -4.146  24.686  82.109  1.00 37.45  ? 141 ARG A CD    1 
ATOM   1072 N NE    . ARG A 1 155 ? -2.761  24.833  81.658  1.00 42.42  ? 141 ARG A NE    1 
ATOM   1073 C CZ    . ARG A 1 155 ? -2.354  24.635  80.411  1.00 42.94  ? 141 ARG A CZ    1 
ATOM   1074 N NH1   . ARG A 1 155 ? -3.236  24.273  79.487  1.00 41.74  ? 141 ARG A NH1   1 
ATOM   1075 N NH2   . ARG A 1 155 ? -1.070  24.807  80.090  1.00 40.39  ? 141 ARG A NH2   1 
ATOM   1076 N N     . GLU A 1 156 ? -7.579  23.105  86.646  1.00 38.49  ? 142 GLU A N     1 
ATOM   1077 C CA    . GLU A 1 156 ? -8.793  23.374  87.421  1.00 39.37  ? 142 GLU A CA    1 
ATOM   1078 C C     . GLU A 1 156 ? -8.610  23.157  88.916  1.00 40.67  ? 142 GLU A C     1 
ATOM   1079 O O     . GLU A 1 156 ? -9.452  23.559  89.711  1.00 43.36  ? 142 GLU A O     1 
ATOM   1080 C CB    . GLU A 1 156 ? -9.952  22.494  86.953  1.00 39.35  ? 142 GLU A CB    1 
ATOM   1081 C CG    . GLU A 1 156 ? -10.375 22.704  85.512  1.00 38.52  ? 142 GLU A CG    1 
ATOM   1082 C CD    . GLU A 1 156 ? -11.627 21.917  85.178  1.00 36.55  ? 142 GLU A CD    1 
ATOM   1083 O OE1   . GLU A 1 156 ? -12.002 21.876  83.988  1.00 38.72  ? 142 GLU A OE1   1 
ATOM   1084 O OE2   . GLU A 1 156 ? -12.235 21.338  86.113  1.00 40.47  ? 142 GLU A OE2   1 
ATOM   1085 N N     . LYS A 1 157 ? -7.507  22.530  89.304  1.00 39.18  ? 143 LYS A N     1 
ATOM   1086 C CA    . LYS A 1 157 ? -7.267  22.246  90.705  1.00 39.47  ? 143 LYS A CA    1 
ATOM   1087 C C     . LYS A 1 157 ? -7.346  23.464  91.636  1.00 43.06  ? 143 LYS A C     1 
ATOM   1088 O O     . LYS A 1 157 ? -7.909  23.369  92.734  1.00 40.65  ? 143 LYS A O     1 
ATOM   1089 C CB    . LYS A 1 157 ? -5.918  21.559  90.868  1.00 37.30  ? 143 LYS A CB    1 
ATOM   1090 C CG    . LYS A 1 157 ? -5.790  20.809  92.186  1.00 35.20  ? 143 LYS A CG    1 
ATOM   1091 C CD    . LYS A 1 157 ? -4.332  20.526  92.475  1.00 43.15  ? 143 LYS A CD    1 
ATOM   1092 C CE    . LYS A 1 157 ? -4.082  20.381  93.950  1.00 48.34  ? 143 LYS A CE    1 
ATOM   1093 N NZ    . LYS A 1 157 ? -2.621  20.224  94.192  1.00 63.22  ? 143 LYS A NZ    1 
ATOM   1094 N N     . LYS A 1 158 ? -6.775  24.594  91.220  1.00 45.04  ? 144 LYS A N     1 
ATOM   1095 C CA    . LYS A 1 158 ? -6.820  25.795  92.059  1.00 46.93  ? 144 LYS A CA    1 
ATOM   1096 C C     . LYS A 1 158 ? -8.272  26.172  92.280  1.00 41.05  ? 144 LYS A C     1 
ATOM   1097 O O     . LYS A 1 158 ? -8.688  26.437  93.410  1.00 39.80  ? 144 LYS A O     1 
ATOM   1098 C CB    . LYS A 1 158 ? -6.072  26.967  91.412  1.00 52.15  ? 144 LYS A CB    1 
ATOM   1099 C CG    . LYS A 1 158 ? -6.002  28.198  92.317  1.00 57.55  ? 144 LYS A CG    1 
ATOM   1100 C CD    . LYS A 1 158 ? -5.230  29.332  91.672  1.00 63.00  ? 144 LYS A CD    1 
ATOM   1101 C CE    . LYS A 1 158 ? -5.270  30.570  92.534  1.00 66.93  ? 144 LYS A CE    1 
ATOM   1102 N NZ    . LYS A 1 158 ? -4.377  31.634  91.999  1.00 75.97  ? 144 LYS A NZ    1 
ATOM   1103 N N     . MET A 1 159 ? -9.039  26.174  91.195  1.00 44.25  ? 145 MET A N     1 
ATOM   1104 C CA    . MET A 1 159 ? -10.462 26.490  91.251  1.00 45.01  ? 145 MET A CA    1 
ATOM   1105 C C     . MET A 1 159 ? -11.213 25.476  92.107  1.00 45.35  ? 145 MET A C     1 
ATOM   1106 O O     . MET A 1 159 ? -12.049 25.850  92.924  1.00 43.89  ? 145 MET A O     1 
ATOM   1107 C CB    . MET A 1 159 ? -11.057 26.480  89.845  1.00 51.16  ? 145 MET A CB    1 
ATOM   1108 C CG    . MET A 1 159 ? -12.573 26.670  89.802  1.00 55.31  ? 145 MET A CG    1 
ATOM   1109 S SD    . MET A 1 159 ? -13.451 25.417  88.804  1.00 71.71  ? 145 MET A SD    1 
ATOM   1110 C CE    . MET A 1 159 ? -12.866 25.789  87.132  1.00 62.59  ? 145 MET A CE    1 
ATOM   1111 N N     . ARG A 1 160 ? -10.906 24.194  91.904  1.00 48.10  ? 146 ARG A N     1 
ATOM   1112 C CA    . ARG A 1 160 ? -11.544 23.093  92.630  1.00 49.80  ? 146 ARG A CA    1 
ATOM   1113 C C     . ARG A 1 160 ? -11.206 23.000  94.105  1.00 49.77  ? 146 ARG A C     1 
ATOM   1114 O O     . ARG A 1 160 ? -12.093 22.786  94.926  1.00 48.28  ? 146 ARG A O     1 
ATOM   1115 C CB    . ARG A 1 160 ? -11.189 21.737  92.007  1.00 48.89  ? 146 ARG A CB    1 
ATOM   1116 C CG    . ARG A 1 160 ? -12.196 21.140  91.029  1.00 47.17  ? 146 ARG A CG    1 
ATOM   1117 C CD    . ARG A 1 160 ? -12.162 21.880  89.727  1.00 48.98  ? 146 ARG A CD    1 
ATOM   1118 N NE    . ARG A 1 160 ? -12.901 21.266  88.614  1.00 50.07  ? 146 ARG A NE    1 
ATOM   1119 C CZ    . ARG A 1 160 ? -14.103 20.697  88.691  1.00 44.32  ? 146 ARG A CZ    1 
ATOM   1120 N NH1   . ARG A 1 160 ? -14.748 20.606  89.847  1.00 46.84  ? 146 ARG A NH1   1 
ATOM   1121 N NH2   . ARG A 1 160 ? -14.705 20.302  87.580  1.00 43.32  ? 146 ARG A NH2   1 
ATOM   1122 N N     . GLU A 1 161 ? -9.933  23.146  94.455  1.00 52.73  ? 147 GLU A N     1 
ATOM   1123 C CA    . GLU A 1 161 ? -9.569  22.993  95.855  1.00 54.88  ? 147 GLU A CA    1 
ATOM   1124 C C     . GLU A 1 161 ? -8.859  24.134  96.568  1.00 54.09  ? 147 GLU A C     1 
ATOM   1125 O O     . GLU A 1 161 ? -8.520  24.016  97.751  1.00 54.57  ? 147 GLU A O     1 
ATOM   1126 C CB    . GLU A 1 161 ? -8.784  21.685  96.034  1.00 55.09  ? 147 GLU A CB    1 
ATOM   1127 C CG    . GLU A 1 161 ? -8.136  21.164  94.764  1.00 59.54  ? 147 GLU A CG    1 
ATOM   1128 C CD    . GLU A 1 161 ? -7.564  19.759  94.930  1.00 62.81  ? 147 GLU A CD    1 
ATOM   1129 O OE1   . GLU A 1 161 ? -6.669  19.586  95.782  1.00 60.46  ? 147 GLU A OE1   1 
ATOM   1130 O OE2   . GLU A 1 161 ? -8.006  18.831  94.211  1.00 60.87  ? 147 GLU A OE2   1 
ATOM   1131 N N     . GLY A 1 162 ? -8.637  25.241  95.875  1.00 53.43  ? 148 GLY A N     1 
ATOM   1132 C CA    . GLY A 1 162 ? -7.997  26.357  96.538  1.00 53.06  ? 148 GLY A CA    1 
ATOM   1133 C C     . GLY A 1 162 ? -6.573  26.598  96.115  1.00 53.80  ? 148 GLY A C     1 
ATOM   1134 O O     . GLY A 1 162 ? -6.107  27.738  96.117  1.00 56.91  ? 148 GLY A O     1 
ATOM   1135 N N     . GLU A 1 163 ? -5.865  25.540  95.754  1.00 51.85  ? 149 GLU A N     1 
ATOM   1136 C CA    . GLU A 1 163 ? -4.493  25.714  95.321  1.00 52.33  ? 149 GLU A CA    1 
ATOM   1137 C C     . GLU A 1 163 ? -4.090  24.826  94.156  1.00 50.82  ? 149 GLU A C     1 
ATOM   1138 O O     . GLU A 1 163 ? -4.424  23.636  94.097  1.00 51.09  ? 149 GLU A O     1 
ATOM   1139 C CB    . GLU A 1 163 ? -3.531  25.506  96.486  1.00 55.94  ? 149 GLU A CB    1 
ATOM   1140 C CG    . GLU A 1 163 ? -2.077  25.627  96.052  1.00 68.38  ? 149 GLU A CG    1 
ATOM   1141 C CD    . GLU A 1 163 ? -1.109  25.807  97.203  1.00 72.81  ? 149 GLU A CD    1 
ATOM   1142 O OE1   . GLU A 1 163 ? 0.118   25.823  96.946  1.00 78.63  ? 149 GLU A OE1   1 
ATOM   1143 O OE2   . GLU A 1 163 ? -1.569  25.942  98.360  1.00 79.12  ? 149 GLU A OE2   1 
ATOM   1144 N N     . GLY A 1 164 ? -3.367  25.425  93.220  1.00 45.97  ? 150 GLY A N     1 
ATOM   1145 C CA    . GLY A 1 164 ? -2.920  24.683  92.064  1.00 48.29  ? 150 GLY A CA    1 
ATOM   1146 C C     . GLY A 1 164 ? -1.658  23.912  92.384  1.00 46.99  ? 150 GLY A C     1 
ATOM   1147 O O     . GLY A 1 164 ? -1.212  23.865  93.533  1.00 45.60  ? 150 GLY A O     1 
ATOM   1148 N N     . TYR A 1 165 ? -1.098  23.286  91.359  1.00 47.84  ? 151 TYR A N     1 
ATOM   1149 C CA    . TYR A 1 165 ? 0.139   22.530  91.491  1.00 46.96  ? 151 TYR A CA    1 
ATOM   1150 C C     . TYR A 1 165 ? 1.272   23.549  91.444  1.00 45.05  ? 151 TYR A C     1 
ATOM   1151 O O     . TYR A 1 165 ? 1.156   24.583  90.779  1.00 46.58  ? 151 TYR A O     1 
ATOM   1152 C CB    . TYR A 1 165 ? 0.282   21.548  90.320  1.00 40.65  ? 151 TYR A CB    1 
ATOM   1153 C CG    . TYR A 1 165 ? -0.664  20.362  90.383  1.00 43.96  ? 151 TYR A CG    1 
ATOM   1154 C CD1   . TYR A 1 165 ? -0.570  19.432  91.413  1.00 45.35  ? 151 TYR A CD1   1 
ATOM   1155 C CD2   . TYR A 1 165 ? -1.643  20.163  89.407  1.00 41.46  ? 151 TYR A CD2   1 
ATOM   1156 C CE1   . TYR A 1 165 ? -1.421  18.329  91.471  1.00 42.92  ? 151 TYR A CE1   1 
ATOM   1157 C CE2   . TYR A 1 165 ? -2.505  19.062  89.459  1.00 40.13  ? 151 TYR A CE2   1 
ATOM   1158 C CZ    . TYR A 1 165 ? -2.386  18.145  90.493  1.00 42.73  ? 151 TYR A CZ    1 
ATOM   1159 O OH    . TYR A 1 165 ? -3.205  17.021  90.550  1.00 43.68  ? 151 TYR A OH    1 
ATOM   1160 N N     . THR A 1 166 ? 2.360   23.268  92.145  1.00 39.98  ? 152 THR A N     1 
ATOM   1161 C CA    . THR A 1 166 ? 3.500   24.172  92.135  1.00 42.53  ? 152 THR A CA    1 
ATOM   1162 C C     . THR A 1 166 ? 4.267   24.106  90.821  1.00 42.90  ? 152 THR A C     1 
ATOM   1163 O O     . THR A 1 166 ? 4.736   25.122  90.306  1.00 44.67  ? 152 THR A O     1 
ATOM   1164 C CB    . THR A 1 166 ? 4.478   23.849  93.288  1.00 39.68  ? 152 THR A CB    1 
ATOM   1165 O OG1   . THR A 1 166 ? 3.940   24.360  94.510  1.00 45.51  ? 152 THR A OG1   1 
ATOM   1166 C CG2   . THR A 1 166 ? 5.835   24.470  93.043  1.00 39.86  ? 152 THR A CG2   1 
ATOM   1167 N N     . LEU A 1 167 ? 4.394   22.901  90.282  1.00 42.44  ? 153 LEU A N     1 
ATOM   1168 C CA    . LEU A 1 167 ? 5.131   22.692  89.043  1.00 37.65  ? 153 LEU A CA    1 
ATOM   1169 C C     . LEU A 1 167 ? 4.274   22.959  87.808  1.00 35.50  ? 153 LEU A C     1 
ATOM   1170 O O     . LEU A 1 167 ? 3.048   22.938  87.869  1.00 32.42  ? 153 LEU A O     1 
ATOM   1171 C CB    . LEU A 1 167 ? 5.642   21.254  89.002  1.00 40.72  ? 153 LEU A CB    1 
ATOM   1172 C CG    . LEU A 1 167 ? 6.432   20.779  90.223  1.00 36.11  ? 153 LEU A CG    1 
ATOM   1173 C CD1   . LEU A 1 167 ? 6.121   19.334  90.537  1.00 45.05  ? 153 LEU A CD1   1 
ATOM   1174 C CD2   . LEU A 1 167 ? 7.893   20.937  89.929  1.00 37.66  ? 153 LEU A CD2   1 
ATOM   1175 N N     . ASP A 1 168 ? 4.938   23.212  86.691  1.00 32.24  ? 154 ASP A N     1 
ATOM   1176 C CA    . ASP A 1 168 ? 4.296   23.464  85.408  1.00 37.48  ? 154 ASP A CA    1 
ATOM   1177 C C     . ASP A 1 168 ? 3.411   22.279  84.976  1.00 39.70  ? 154 ASP A C     1 
ATOM   1178 O O     . ASP A 1 168 ? 3.899   21.154  84.892  1.00 45.79  ? 154 ASP A O     1 
ATOM   1179 C CB    . ASP A 1 168 ? 5.392   23.691  84.375  1.00 37.55  ? 154 ASP A CB    1 
ATOM   1180 C CG    . ASP A 1 168 ? 4.852   24.069  83.011  1.00 47.76  ? 154 ASP A CG    1 
ATOM   1181 O OD1   . ASP A 1 168 ? 3.935   23.387  82.507  1.00 49.90  ? 154 ASP A OD1   1 
ATOM   1182 O OD2   . ASP A 1 168 ? 5.360   25.055  82.434  1.00 55.73  ? 154 ASP A OD2   1 
ATOM   1183 N N     . GLU A 1 169 ? 2.130   22.532  84.676  1.00 38.95  ? 155 GLU A N     1 
ATOM   1184 C CA    . GLU A 1 169 ? 1.182   21.482  84.243  1.00 33.87  ? 155 GLU A CA    1 
ATOM   1185 C C     . GLU A 1 169 ? 1.677   20.820  82.958  1.00 31.40  ? 155 GLU A C     1 
ATOM   1186 O O     . GLU A 1 169 ? 1.426   19.641  82.705  1.00 30.03  ? 155 GLU A O     1 
ATOM   1187 C CB    . GLU A 1 169 ? -0.242  22.036  83.930  1.00 35.87  ? 155 GLU A CB    1 
ATOM   1188 C CG    . GLU A 1 169 ? -0.782  23.207  84.773  1.00 45.19  ? 155 GLU A CG    1 
ATOM   1189 C CD    . GLU A 1 169 ? -0.159  24.555  84.403  1.00 42.62  ? 155 GLU A CD    1 
ATOM   1190 O OE1   . GLU A 1 169 ? 0.943   24.840  84.915  1.00 43.61  ? 155 GLU A OE1   1 
ATOM   1191 O OE2   . GLU A 1 169 ? -0.759  25.317  83.595  1.00 39.84  ? 155 GLU A OE2   1 
ATOM   1192 N N     . THR A 1 170 ? 2.329   21.589  82.109  1.00 29.61  ? 156 THR A N     1 
ATOM   1193 C CA    . THR A 1 170 ? 2.838   21.009  80.883  1.00 33.44  ? 156 THR A CA    1 
ATOM   1194 C C     . THR A 1 170 ? 3.878   19.931  81.187  1.00 31.55  ? 156 THR A C     1 
ATOM   1195 O O     . THR A 1 170 ? 3.936   18.913  80.502  1.00 26.99  ? 156 THR A O     1 
ATOM   1196 C CB    . THR A 1 170 ? 3.424   22.079  79.986  1.00 30.75  ? 156 THR A CB    1 
ATOM   1197 O OG1   . THR A 1 170 ? 2.357   22.936  79.582  1.00 35.70  ? 156 THR A OG1   1 
ATOM   1198 C CG2   . THR A 1 170 ? 4.079   21.462  78.751  1.00 34.42  ? 156 THR A CG2   1 
ATOM   1199 N N     . LEU A 1 171 ? 4.678   20.149  82.225  1.00 32.13  ? 157 LEU A N     1 
ATOM   1200 C CA    . LEU A 1 171 ? 5.683   19.167  82.603  1.00 31.01  ? 157 LEU A CA    1 
ATOM   1201 C C     . LEU A 1 171 ? 4.973   17.973  83.241  1.00 29.69  ? 157 LEU A C     1 
ATOM   1202 O O     . LEU A 1 171 ? 5.291   16.828  82.922  1.00 28.99  ? 157 LEU A O     1 
ATOM   1203 C CB    . LEU A 1 171 ? 6.688   19.776  83.591  1.00 35.51  ? 157 LEU A CB    1 
ATOM   1204 C CG    . LEU A 1 171 ? 7.618   18.855  84.399  1.00 37.00  ? 157 LEU A CG    1 
ATOM   1205 C CD1   . LEU A 1 171 ? 8.632   18.192  83.473  1.00 31.52  ? 157 LEU A CD1   1 
ATOM   1206 C CD2   . LEU A 1 171 ? 8.330   19.662  85.480  1.00 30.46  ? 157 LEU A CD2   1 
ATOM   1207 N N     . LEU A 1 172 ? 3.992   18.238  84.107  1.00 29.71  ? 158 LEU A N     1 
ATOM   1208 C CA    . LEU A 1 172 ? 3.277   17.155  84.780  1.00 32.25  ? 158 LEU A CA    1 
ATOM   1209 C C     . LEU A 1 172 ? 2.487   16.292  83.819  1.00 30.03  ? 158 LEU A C     1 
ATOM   1210 O O     . LEU A 1 172 ? 2.496   15.065  83.929  1.00 31.53  ? 158 LEU A O     1 
ATOM   1211 C CB    . LEU A 1 172 ? 2.337   17.680  85.873  1.00 33.05  ? 158 LEU A CB    1 
ATOM   1212 C CG    . LEU A 1 172 ? 2.942   18.552  86.973  1.00 36.84  ? 158 LEU A CG    1 
ATOM   1213 C CD1   . LEU A 1 172 ? 1.911   18.810  88.063  1.00 34.30  ? 158 LEU A CD1   1 
ATOM   1214 C CD2   . LEU A 1 172 ? 4.166   17.876  87.545  1.00 34.25  ? 158 LEU A CD2   1 
ATOM   1215 N N     . ALA A 1 173 ? 1.820   16.910  82.859  1.00 26.75  ? 159 ALA A N     1 
ATOM   1216 C CA    . ALA A 1 173 ? 1.049   16.117  81.926  1.00 29.11  ? 159 ALA A CA    1 
ATOM   1217 C C     . ALA A 1 173 ? 1.950   15.248  81.036  1.00 32.57  ? 159 ALA A C     1 
ATOM   1218 O O     . ALA A 1 173 ? 1.624   14.083  80.783  1.00 30.72  ? 159 ALA A O     1 
ATOM   1219 C CB    . ALA A 1 173 ? 0.165   17.016  81.076  1.00 31.80  ? 159 ALA A CB    1 
ATOM   1220 N N     . SER A 1 174 ? 3.081   15.784  80.570  1.00 27.46  ? 160 SER A N     1 
ATOM   1221 C CA    . SER A 1 174 ? 3.955   14.982  79.706  1.00 26.04  ? 160 SER A CA    1 
ATOM   1222 C C     . SER A 1 174 ? 4.497   13.828  80.501  1.00 23.24  ? 160 SER A C     1 
ATOM   1223 O O     . SER A 1 174 ? 4.691   12.730  79.972  1.00 30.92  ? 160 SER A O     1 
ATOM   1224 C CB    . SER A 1 174 ? 5.111   15.803  79.114  1.00 25.62  ? 160 SER A CB    1 
ATOM   1225 O OG    . SER A 1 174 ? 5.774   16.585  80.084  1.00 33.30  ? 160 SER A OG    1 
ATOM   1226 N N     . GLN A 1 175 ? 4.726   14.091  81.784  1.00 24.25  ? 161 GLN A N     1 
ATOM   1227 C CA    . GLN A 1 175 ? 5.223   13.113  82.723  1.00 23.31  ? 161 GLN A CA    1 
ATOM   1228 C C     . GLN A 1 175 ? 4.206   11.948  82.810  1.00 26.78  ? 161 GLN A C     1 
ATOM   1229 O O     . GLN A 1 175 ? 4.576   10.772  82.730  1.00 24.35  ? 161 GLN A O     1 
ATOM   1230 C CB    . GLN A 1 175 ? 5.373   13.812  84.063  1.00 26.01  ? 161 GLN A CB    1 
ATOM   1231 C CG    . GLN A 1 175 ? 6.355   13.248  85.014  1.00 33.06  ? 161 GLN A CG    1 
ATOM   1232 C CD    . GLN A 1 175 ? 7.771   13.146  84.464  1.00 33.32  ? 161 GLN A CD    1 
ATOM   1233 O OE1   . GLN A 1 175 ? 8.170   13.859  83.547  1.00 39.73  ? 161 GLN A OE1   1 
ATOM   1234 N NE2   . GLN A 1 175 ? 8.545   12.250  85.051  1.00 32.59  ? 161 GLN A NE2   1 
ATOM   1235 N N     . LEU A 1 176 ? 2.925   12.283  82.960  1.00 22.51  ? 162 LEU A N     1 
ATOM   1236 C CA    . LEU A 1 176 ? 1.864   11.276  83.036  1.00 27.42  ? 162 LEU A CA    1 
ATOM   1237 C C     . LEU A 1 176 ? 1.755   10.471  81.740  1.00 24.20  ? 162 LEU A C     1 
ATOM   1238 O O     . LEU A 1 176 ? 1.670   9.236   81.760  1.00 24.78  ? 162 LEU A O     1 
ATOM   1239 C CB    . LEU A 1 176 ? 0.521   11.955  83.361  1.00 27.68  ? 162 LEU A CB    1 
ATOM   1240 C CG    . LEU A 1 176 ? -0.087  11.926  84.777  1.00 34.66  ? 162 LEU A CG    1 
ATOM   1241 C CD1   . LEU A 1 176 ? 0.960   11.879  85.856  1.00 29.99  ? 162 LEU A CD1   1 
ATOM   1242 C CD2   . LEU A 1 176 ? -1.014  13.155  84.946  1.00 35.96  ? 162 LEU A CD2   1 
ATOM   1243 N N     . LEU A 1 177 ? 1.791   11.158  80.607  1.00 21.54  ? 163 LEU A N     1 
ATOM   1244 C CA    . LEU A 1 177 ? 1.689   10.488  79.332  1.00 20.24  ? 163 LEU A CA    1 
ATOM   1245 C C     . LEU A 1 177 ? 2.904   9.633   79.027  1.00 25.19  ? 163 LEU A C     1 
ATOM   1246 O O     . LEU A 1 177 ? 2.780   8.560   78.400  1.00 25.92  ? 163 LEU A O     1 
ATOM   1247 C CB    . LEU A 1 177 ? 1.501   11.517  78.212  1.00 30.38  ? 163 LEU A CB    1 
ATOM   1248 C CG    . LEU A 1 177 ? 0.774   11.044  76.943  1.00 31.13  ? 163 LEU A CG    1 
ATOM   1249 C CD1   . LEU A 1 177 ? -0.504  10.228  77.307  1.00 34.08  ? 163 LEU A CD1   1 
ATOM   1250 C CD2   . LEU A 1 177 ? 0.403   12.262  76.126  1.00 36.81  ? 163 LEU A CD2   1 
ATOM   1251 N N     . ALA A 1 178 ? 4.074   10.113  79.444  1.00 24.34  ? 164 ALA A N     1 
ATOM   1252 C CA    . ALA A 1 178 ? 5.320   9.395   79.217  1.00 27.00  ? 164 ALA A CA    1 
ATOM   1253 C C     . ALA A 1 178 ? 5.198   8.061   79.913  1.00 28.62  ? 164 ALA A C     1 
ATOM   1254 O O     . ALA A 1 178 ? 5.616   7.036   79.372  1.00 29.01  ? 164 ALA A O     1 
ATOM   1255 C CB    . ALA A 1 178 ? 6.515   10.180  79.772  1.00 31.50  ? 164 ALA A CB    1 
ATOM   1256 N N     . PHE A 1 179 ? 4.622   8.089   81.119  1.00 26.97  ? 165 PHE A N     1 
ATOM   1257 C CA    . PHE A 1 179 ? 4.386   6.887   81.904  1.00 26.89  ? 165 PHE A CA    1 
ATOM   1258 C C     . PHE A 1 179 ? 3.440   5.932   81.157  1.00 21.05  ? 165 PHE A C     1 
ATOM   1259 O O     . PHE A 1 179 ? 3.693   4.733   81.067  1.00 24.15  ? 165 PHE A O     1 
ATOM   1260 C CB    . PHE A 1 179 ? 3.775   7.252   83.277  1.00 28.70  ? 165 PHE A CB    1 
ATOM   1261 C CG    . PHE A 1 179 ? 3.246   6.065   84.048  1.00 22.07  ? 165 PHE A CG    1 
ATOM   1262 C CD1   . PHE A 1 179 ? 4.119   5.119   84.573  1.00 27.27  ? 165 PHE A CD1   1 
ATOM   1263 C CD2   . PHE A 1 179 ? 1.868   5.864   84.190  1.00 21.87  ? 165 PHE A CD2   1 
ATOM   1264 C CE1   . PHE A 1 179 ? 3.650   3.969   85.218  1.00 24.31  ? 165 PHE A CE1   1 
ATOM   1265 C CE2   . PHE A 1 179 ? 1.372   4.713   84.839  1.00 24.27  ? 165 PHE A CE2   1 
ATOM   1266 C CZ    . PHE A 1 179 ? 2.266   3.762   85.355  1.00 24.88  ? 165 PHE A CZ    1 
ATOM   1267 N N     . CYS A 1 180 ? 2.348   6.453   80.621  1.00 23.48  ? 166 CYS A N     1 
ATOM   1268 C CA    . CYS A 1 180 ? 1.394   5.600   79.887  1.00 26.99  ? 166 CYS A CA    1 
ATOM   1269 C C     . CYS A 1 180 ? 2.015   4.995   78.631  1.00 25.96  ? 166 CYS A C     1 
ATOM   1270 O O     . CYS A 1 180 ? 1.859   3.803   78.363  1.00 23.22  ? 166 CYS A O     1 
ATOM   1271 C CB    . CYS A 1 180 ? 0.136   6.390   79.466  1.00 29.54  ? 166 CYS A CB    1 
ATOM   1272 S SG    . CYS A 1 180 ? -0.890  6.957   80.801  1.00 29.21  ? 166 CYS A SG    1 
ATOM   1273 N N     . GLU A 1 181 ? 2.713   5.826   77.865  1.00 21.20  ? 167 GLU A N     1 
ATOM   1274 C CA    . GLU A 1 181 ? 3.356   5.369   76.636  1.00 28.14  ? 167 GLU A CA    1 
ATOM   1275 C C     . GLU A 1 181 ? 4.435   4.361   76.938  1.00 23.70  ? 167 GLU A C     1 
ATOM   1276 O O     . GLU A 1 181 ? 4.641   3.435   76.163  1.00 20.66  ? 167 GLU A O     1 
ATOM   1277 C CB    . GLU A 1 181 ? 3.959   6.547   75.868  1.00 31.84  ? 167 GLU A CB    1 
ATOM   1278 C CG    . GLU A 1 181 ? 2.909   7.430   75.261  1.00 32.23  ? 167 GLU A CG    1 
ATOM   1279 C CD    . GLU A 1 181 ? 3.497   8.471   74.327  1.00 41.58  ? 167 GLU A CD    1 
ATOM   1280 O OE1   . GLU A 1 181 ? 4.198   8.091   73.350  1.00 37.03  ? 167 GLU A OE1   1 
ATOM   1281 O OE2   . GLU A 1 181 ? 3.250   9.672   74.577  1.00 39.22  ? 167 GLU A OE2   1 
ATOM   1282 N N     . GLY A 1 182 ? 5.112   4.545   78.072  1.00 22.14  ? 168 GLY A N     1 
ATOM   1283 C CA    . GLY A 1 182 ? 6.139   3.608   78.476  1.00 26.67  ? 168 GLY A CA    1 
ATOM   1284 C C     . GLY A 1 182 ? 5.531   2.239   78.775  1.00 27.71  ? 168 GLY A C     1 
ATOM   1285 O O     . GLY A 1 182 ? 6.044   1.203   78.346  1.00 28.34  ? 168 GLY A O     1 
ATOM   1286 N N     . MET A 1 183 ? 4.428   2.226   79.512  1.00 25.86  ? 169 MET A N     1 
ATOM   1287 C CA    . MET A 1 183 ? 3.764   0.968   79.836  1.00 24.85  ? 169 MET A CA    1 
ATOM   1288 C C     . MET A 1 183 ? 3.202   0.278   78.568  1.00 22.22  ? 169 MET A C     1 
ATOM   1289 O O     . MET A 1 183 ? 3.300   -0.945  78.417  1.00 22.86  ? 169 MET A O     1 
ATOM   1290 C CB    . MET A 1 183 ? 2.657   1.240   80.858  1.00 22.89  ? 169 MET A CB    1 
ATOM   1291 C CG    . MET A 1 183 ? 3.175   1.799   82.189  1.00 23.85  ? 169 MET A CG    1 
ATOM   1292 S SD    . MET A 1 183 ? 4.184   0.588   83.083  1.00 26.91  ? 169 MET A SD    1 
ATOM   1293 C CE    . MET A 1 183 ? 2.973   -0.671  83.493  1.00 26.94  ? 169 MET A CE    1 
ATOM   1294 N N     . LEU A 1 184 ? 2.640   1.053   77.643  1.00 20.85  ? 170 LEU A N     1 
ATOM   1295 C CA    . LEU A 1 184 ? 2.084   0.473   76.422  1.00 22.06  ? 170 LEU A CA    1 
ATOM   1296 C C     . LEU A 1 184 ? 3.210   -0.087  75.556  1.00 24.16  ? 170 LEU A C     1 
ATOM   1297 O O     . LEU A 1 184 ? 3.101   -1.169  74.969  1.00 20.81  ? 170 LEU A O     1 
ATOM   1298 C CB    . LEU A 1 184 ? 1.275   1.527   75.664  1.00 23.15  ? 170 LEU A CB    1 
ATOM   1299 C CG    . LEU A 1 184 ? -0.016  2.028   76.354  1.00 30.91  ? 170 LEU A CG    1 
ATOM   1300 C CD1   . LEU A 1 184 ? -0.725  3.076   75.472  1.00 27.80  ? 170 LEU A CD1   1 
ATOM   1301 C CD2   . LEU A 1 184 ? -0.962  0.848   76.639  1.00 28.75  ? 170 LEU A CD2   1 
ATOM   1302 N N     . SER A 1 185 ? 4.317   0.632   75.501  1.00 24.01  ? 171 SER A N     1 
ATOM   1303 C CA    . SER A 1 185 ? 5.453   0.166   74.707  1.00 28.42  ? 171 SER A CA    1 
ATOM   1304 C C     . SER A 1 185 ? 5.983   -1.177  75.240  1.00 30.48  ? 171 SER A C     1 
ATOM   1305 O O     . SER A 1 185 ? 6.348   -2.071  74.458  1.00 27.25  ? 171 SER A O     1 
ATOM   1306 C CB    . SER A 1 185 ? 6.543   1.238   74.720  1.00 32.02  ? 171 SER A CB    1 
ATOM   1307 O OG    . SER A 1 185 ? 7.711   0.782   74.065  1.00 53.96  ? 171 SER A OG    1 
ATOM   1308 N N     . ARG A 1 186 ? 6.015   -1.316  76.568  1.00 26.71  ? 172 ARG A N     1 
ATOM   1309 C CA    . ARG A 1 186 ? 6.484   -2.544  77.208  1.00 25.93  ? 172 ARG A CA    1 
ATOM   1310 C C     . ARG A 1 186 ? 5.513   -3.684  76.943  1.00 23.99  ? 172 ARG A C     1 
ATOM   1311 O O     . ARG A 1 186 ? 5.924   -4.840  76.735  1.00 22.60  ? 172 ARG A O     1 
ATOM   1312 C CB    . ARG A 1 186 ? 6.647   -2.349  78.739  1.00 25.01  ? 172 ARG A CB    1 
ATOM   1313 C CG    . ARG A 1 186 ? 7.890   -1.534  79.161  1.00 32.41  ? 172 ARG A CG    1 
ATOM   1314 C CD    . ARG A 1 186 ? 7.818   -1.114  80.620  1.00 33.09  ? 172 ARG A CD    1 
ATOM   1315 N NE    . ARG A 1 186 ? 8.026   -2.246  81.530  1.00 37.11  ? 172 ARG A NE    1 
ATOM   1316 C CZ    . ARG A 1 186 ? 9.222   -2.728  81.862  1.00 41.68  ? 172 ARG A CZ    1 
ATOM   1317 N NH1   . ARG A 1 186 ? 10.327  -2.168  81.366  1.00 39.75  ? 172 ARG A NH1   1 
ATOM   1318 N NH2   . ARG A 1 186 ? 9.316   -3.787  82.663  1.00 34.05  ? 172 ARG A NH2   1 
ATOM   1319 N N     . PHE A 1 187 ? 4.224   -3.373  76.986  1.00 20.58  ? 173 PHE A N     1 
ATOM   1320 C CA    . PHE A 1 187 ? 3.188   -4.373  76.723  1.00 23.26  ? 173 PHE A CA    1 
ATOM   1321 C C     . PHE A 1 187 ? 3.418   -4.910  75.286  1.00 22.73  ? 173 PHE A C     1 
ATOM   1322 O O     . PHE A 1 187 ? 3.402   -6.119  75.025  1.00 21.70  ? 173 PHE A O     1 
ATOM   1323 C CB    . PHE A 1 187 ? 1.805   -3.691  76.882  1.00 19.45  ? 173 PHE A CB    1 
ATOM   1324 C CG    . PHE A 1 187 ? 0.622   -4.584  76.647  1.00 23.95  ? 173 PHE A CG    1 
ATOM   1325 C CD1   . PHE A 1 187 ? 0.562   -5.879  77.188  1.00 23.17  ? 173 PHE A CD1   1 
ATOM   1326 C CD2   . PHE A 1 187 ? -0.510  -4.074  75.984  1.00 25.24  ? 173 PHE A CD2   1 
ATOM   1327 C CE1   . PHE A 1 187 ? -0.618  -6.650  77.079  1.00 25.09  ? 173 PHE A CE1   1 
ATOM   1328 C CE2   . PHE A 1 187 ? -1.697  -4.837  75.875  1.00 25.52  ? 173 PHE A CE2   1 
ATOM   1329 C CZ    . PHE A 1 187 ? -1.756  -6.124  76.421  1.00 18.28  ? 173 PHE A CZ    1 
ATOM   1330 N N     . VAL A 1 188 ? 3.690   -4.002  74.361  1.00 24.84  ? 174 VAL A N     1 
ATOM   1331 C CA    . VAL A 1 188 ? 3.923   -4.417  72.997  1.00 25.91  ? 174 VAL A CA    1 
ATOM   1332 C C     . VAL A 1 188 ? 5.205   -5.210  72.783  1.00 30.96  ? 174 VAL A C     1 
ATOM   1333 O O     . VAL A 1 188 ? 5.140   -6.274  72.147  1.00 28.64  ? 174 VAL A O     1 
ATOM   1334 C CB    . VAL A 1 188 ? 3.881   -3.220  72.031  1.00 24.06  ? 174 VAL A CB    1 
ATOM   1335 C CG1   . VAL A 1 188 ? 4.406   -3.647  70.612  1.00 29.13  ? 174 VAL A CG1   1 
ATOM   1336 C CG2   . VAL A 1 188 ? 2.412   -2.712  71.909  1.00 26.65  ? 174 VAL A CG2   1 
ATOM   1337 N N     . ARG A 1 189 ? 6.352   -4.718  73.285  1.00 30.31  ? 175 ARG A N     1 
ATOM   1338 C CA    . ARG A 1 189 ? 7.618   -5.451  73.078  1.00 30.18  ? 175 ARG A CA    1 
ATOM   1339 C C     . ARG A 1 189 ? 7.603   -6.825  73.682  1.00 29.61  ? 175 ARG A C     1 
ATOM   1340 O O     . ARG A 1 189 ? 8.236   -7.731  73.147  1.00 26.96  ? 175 ARG A O     1 
ATOM   1341 C CB    . ARG A 1 189 ? 8.890   -4.795  73.654  1.00 30.04  ? 175 ARG A CB    1 
ATOM   1342 C CG    . ARG A 1 189 ? 8.848   -3.539  74.460  1.00 34.69  ? 175 ARG A CG    1 
ATOM   1343 C CD    . ARG A 1 189 ? 10.294  -3.236  74.889  1.00 29.88  ? 175 ARG A CD    1 
ATOM   1344 N NE    . ARG A 1 189 ? 10.407  -2.984  76.321  1.00 26.75  ? 175 ARG A NE    1 
ATOM   1345 C CZ    . ARG A 1 189 ? 10.901  -3.850  77.203  1.00 27.73  ? 175 ARG A CZ    1 
ATOM   1346 N NH1   . ARG A 1 189 ? 11.349  -5.054  76.831  1.00 23.60  ? 175 ARG A NH1   1 
ATOM   1347 N NH2   . ARG A 1 189 ? 10.932  -3.515  78.478  1.00 28.45  ? 175 ARG A NH2   1 
ATOM   1348 N N     . SER A 1 190 ? 6.922   -6.962  74.813  1.00 27.81  ? 176 SER A N     1 
ATOM   1349 C CA    . SER A 1 190 ? 6.849   -8.240  75.518  1.00 29.09  ? 176 SER A CA    1 
ATOM   1350 C C     . SER A 1 190 ? 5.860   -9.243  74.952  1.00 28.02  ? 176 SER A C     1 
ATOM   1351 O O     . SER A 1 190 ? 5.616   -10.259 75.578  1.00 29.53  ? 176 SER A O     1 
ATOM   1352 C CB    . SER A 1 190 ? 6.522   -8.002  76.997  1.00 20.29  ? 176 SER A CB    1 
ATOM   1353 O OG    . SER A 1 190 ? 5.238   -7.412  77.120  1.00 26.48  ? 176 SER A OG    1 
ATOM   1354 N N     . GLU A 1 191 ? 5.291   -8.968  73.777  1.00 36.95  ? 177 GLU A N     1 
ATOM   1355 C CA    . GLU A 1 191 ? 4.323   -9.877  73.156  1.00 37.97  ? 177 GLU A CA    1 
ATOM   1356 C C     . GLU A 1 191 ? 3.099   -9.882  74.023  1.00 33.94  ? 177 GLU A C     1 
ATOM   1357 O O     . GLU A 1 191 ? 2.430   -10.909 74.155  1.00 28.58  ? 177 GLU A O     1 
ATOM   1358 C CB    . GLU A 1 191 ? 4.849   -11.312 73.103  1.00 47.39  ? 177 GLU A CB    1 
ATOM   1359 C CG    . GLU A 1 191 ? 6.271   -11.455 72.633  1.00 65.35  ? 177 GLU A CG    1 
ATOM   1360 C CD    . GLU A 1 191 ? 6.424   -11.078 71.189  1.00 73.27  ? 177 GLU A CD    1 
ATOM   1361 O OE1   . GLU A 1 191 ? 5.965   -9.970  70.818  1.00 76.45  ? 177 GLU A OE1   1 
ATOM   1362 O OE2   . GLU A 1 191 ? 7.006   -11.886 70.428  1.00 82.12  ? 177 GLU A OE2   1 
ATOM   1363 N N     . PHE A 1 192 ? 2.832   -8.735  74.635  1.00 31.27  ? 178 PHE A N     1 
ATOM   1364 C CA    . PHE A 1 192 ? 1.684   -8.563  75.516  1.00 28.50  ? 178 PHE A CA    1 
ATOM   1365 C C     . PHE A 1 192 ? 1.736   -9.334  76.834  1.00 30.99  ? 178 PHE A C     1 
ATOM   1366 O O     . PHE A 1 192 ? 0.689   -9.605  77.431  1.00 34.93  ? 178 PHE A O     1 
ATOM   1367 C CB    . PHE A 1 192 ? 0.392   -8.873  74.741  1.00 26.27  ? 178 PHE A CB    1 
ATOM   1368 C CG    . PHE A 1 192 ? 0.258   -8.069  73.475  1.00 29.80  ? 178 PHE A CG    1 
ATOM   1369 C CD1   . PHE A 1 192 ? 0.185   -8.701  72.235  1.00 28.26  ? 178 PHE A CD1   1 
ATOM   1370 C CD2   . PHE A 1 192 ? 0.304   -6.665  73.513  1.00 24.43  ? 178 PHE A CD2   1 
ATOM   1371 C CE1   . PHE A 1 192 ? 0.162   -7.955  71.056  1.00 27.16  ? 178 PHE A CE1   1 
ATOM   1372 C CE2   . PHE A 1 192 ? 0.284   -5.920  72.346  1.00 30.00  ? 178 PHE A CE2   1 
ATOM   1373 C CZ    . PHE A 1 192 ? 0.215   -6.568  71.106  1.00 28.42  ? 178 PHE A CZ    1 
ATOM   1374 N N     . LYS A 1 193 ? 2.943   -9.679  77.299  1.00 27.62  ? 179 LYS A N     1 
ATOM   1375 C CA    . LYS A 1 193 ? 3.090   -10.373 78.580  1.00 29.97  ? 179 LYS A CA    1 
ATOM   1376 C C     . LYS A 1 193 ? 3.053   -9.388  79.748  1.00 31.92  ? 179 LYS A C     1 
ATOM   1377 O O     . LYS A 1 193 ? 2.505   -9.684  80.813  1.00 35.52  ? 179 LYS A O     1 
ATOM   1378 C CB    . LYS A 1 193 ? 4.393   -11.180 78.633  1.00 33.07  ? 179 LYS A CB    1 
ATOM   1379 C CG    . LYS A 1 193 ? 4.293   -12.494 77.864  1.00 45.71  ? 179 LYS A CG    1 
ATOM   1380 C CD    . LYS A 1 193 ? 5.530   -13.408 78.002  1.00 53.33  ? 179 LYS A CD    1 
ATOM   1381 C CE    . LYS A 1 193 ? 6.626   -13.157 76.944  1.00 55.75  ? 179 LYS A CE    1 
ATOM   1382 N NZ    . LYS A 1 193 ? 7.611   -12.093 77.302  1.00 62.53  ? 179 LYS A NZ    1 
ATOM   1383 N N     . TYR A 1 194 ? 3.636   -8.211  79.552  1.00 29.64  ? 180 TYR A N     1 
ATOM   1384 C CA    . TYR A 1 194 ? 3.656   -7.195  80.597  1.00 30.57  ? 180 TYR A CA    1 
ATOM   1385 C C     . TYR A 1 194 ? 2.415   -6.355  80.495  1.00 27.62  ? 180 TYR A C     1 
ATOM   1386 O O     . TYR A 1 194 ? 2.463   -5.267  79.906  1.00 30.73  ? 180 TYR A O     1 
ATOM   1387 C CB    . TYR A 1 194 ? 4.868   -6.256  80.450  1.00 32.98  ? 180 TYR A CB    1 
ATOM   1388 C CG    . TYR A 1 194 ? 6.202   -6.916  80.573  1.00 40.68  ? 180 TYR A CG    1 
ATOM   1389 C CD1   . TYR A 1 194 ? 6.336   -8.145  81.214  1.00 47.89  ? 180 TYR A CD1   1 
ATOM   1390 C CD2   . TYR A 1 194 ? 7.355   -6.295  80.080  1.00 48.66  ? 180 TYR A CD2   1 
ATOM   1391 C CE1   . TYR A 1 194 ? 7.582   -8.746  81.366  1.00 50.50  ? 180 TYR A CE1   1 
ATOM   1392 C CE2   . TYR A 1 194 ? 8.610   -6.883  80.227  1.00 47.26  ? 180 TYR A CE2   1 
ATOM   1393 C CZ    . TYR A 1 194 ? 8.717   -8.104  80.872  1.00 51.73  ? 180 TYR A CZ    1 
ATOM   1394 O OH    . TYR A 1 194 ? 9.955   -8.667  81.056  1.00 52.60  ? 180 TYR A OH    1 
ATOM   1395 N N     . ARG A 1 195 ? 1.324   -6.839  81.073  1.00 31.02  ? 181 ARG A N     1 
ATOM   1396 C CA    . ARG A 1 195 ? 0.051   -6.129  81.023  1.00 36.98  ? 181 ARG A CA    1 
ATOM   1397 C C     . ARG A 1 195 ? 0.165   -4.722  81.627  1.00 33.09  ? 181 ARG A C     1 
ATOM   1398 O O     . ARG A 1 195 ? 0.701   -4.539  82.709  1.00 33.39  ? 181 ARG A O     1 
ATOM   1399 C CB    . ARG A 1 195 ? -1.046  -6.917  81.755  1.00 42.98  ? 181 ARG A CB    1 
ATOM   1400 C CG    . ARG A 1 195 ? -1.207  -8.382  81.350  1.00 52.66  ? 181 ARG A CG    1 
ATOM   1401 C CD    . ARG A 1 195 ? -1.908  -8.606  80.016  1.00 65.32  ? 181 ARG A CD    1 
ATOM   1402 N NE    . ARG A 1 195 ? -1.761  -10.001 79.565  1.00 75.66  ? 181 ARG A NE    1 
ATOM   1403 C CZ    . ARG A 1 195 ? -2.178  -10.489 78.391  1.00 74.38  ? 181 ARG A CZ    1 
ATOM   1404 N NH1   . ARG A 1 195 ? -2.797  -9.711  77.493  1.00 69.68  ? 181 ARG A NH1   1 
ATOM   1405 N NH2   . ARG A 1 195 ? -1.953  -11.770 78.107  1.00 71.57  ? 181 ARG A NH2   1 
ATOM   1406 N N     . PRO A 1 196 ? -0.348  -3.714  80.915  1.00 31.00  ? 182 PRO A N     1 
ATOM   1407 C CA    . PRO A 1 196 ? -0.351  -2.302  81.291  1.00 28.02  ? 182 PRO A CA    1 
ATOM   1408 C C     . PRO A 1 196 ? -0.904  -1.945  82.687  1.00 28.78  ? 182 PRO A C     1 
ATOM   1409 O O     . PRO A 1 196 ? -0.409  -1.010  83.317  1.00 28.80  ? 182 PRO A O     1 
ATOM   1410 C CB    . PRO A 1 196 ? -1.199  -1.661  80.195  1.00 27.73  ? 182 PRO A CB    1 
ATOM   1411 C CG    . PRO A 1 196 ? -1.112  -2.549  79.076  1.00 27.12  ? 182 PRO A CG    1 
ATOM   1412 C CD    . PRO A 1 196 ? -1.047  -3.916  79.636  1.00 26.85  ? 182 PRO A CD    1 
ATOM   1413 N N     . THR A 1 197 ? -1.950  -2.643  83.153  1.00 25.88  ? 183 THR A N     1 
ATOM   1414 C CA    . THR A 1 197 ? -2.552  -2.333  84.463  1.00 23.26  ? 183 THR A CA    1 
ATOM   1415 C C     . THR A 1 197 ? -1.995  -3.127  85.609  1.00 25.05  ? 183 THR A C     1 
ATOM   1416 O O     . THR A 1 197 ? -2.413  -2.925  86.752  1.00 25.09  ? 183 THR A O     1 
ATOM   1417 C CB    . THR A 1 197 ? -4.107  -2.519  84.497  1.00 22.71  ? 183 THR A CB    1 
ATOM   1418 O OG1   . THR A 1 197 ? -4.463  -3.907  84.299  1.00 25.23  ? 183 THR A OG1   1 
ATOM   1419 C CG2   . THR A 1 197 ? -4.746  -1.646  83.438  1.00 24.99  ? 183 THR A CG2   1 
ATOM   1420 N N     . ASP A 1 198 ? -1.045  -4.015  85.319  1.00 33.09  ? 184 ASP A N     1 
ATOM   1421 C CA    . ASP A 1 198 ? -0.450  -4.829  86.363  1.00 36.19  ? 184 ASP A CA    1 
ATOM   1422 C C     . ASP A 1 198 ? 0.171   -3.949  87.455  1.00 31.36  ? 184 ASP A C     1 
ATOM   1423 O O     . ASP A 1 198 ? 0.994   -3.058  87.168  1.00 33.45  ? 184 ASP A O     1 
ATOM   1424 C CB    . ASP A 1 198 ? 0.593   -5.784  85.769  1.00 41.39  ? 184 ASP A CB    1 
ATOM   1425 C CG    . ASP A 1 198 ? -0.041  -6.994  85.069  1.00 48.60  ? 184 ASP A CG    1 
ATOM   1426 O OD1   . ASP A 1 198 ? -1.192  -7.378  85.429  1.00 39.11  ? 184 ASP A OD1   1 
ATOM   1427 O OD2   . ASP A 1 198 ? 0.628   -7.566  84.165  1.00 54.51  ? 184 ASP A OD2   1 
ATOM   1428 N N     . ASP A 1 199 ? -0.261  -4.172  88.700  1.00 25.43  ? 185 ASP A N     1 
ATOM   1429 C CA    . ASP A 1 199 ? 0.228   -3.395  89.843  1.00 25.86  ? 185 ASP A CA    1 
ATOM   1430 C C     . ASP A 1 199 ? -0.151  -1.917  89.750  1.00 23.36  ? 185 ASP A C     1 
ATOM   1431 O O     . ASP A 1 199 ? 0.486   -1.080  90.386  1.00 22.35  ? 185 ASP A O     1 
ATOM   1432 C CB    . ASP A 1 199 ? 1.755   -3.524  89.966  1.00 31.27  ? 185 ASP A CB    1 
ATOM   1433 C CG    . ASP A 1 199 ? 2.184   -4.872  90.559  1.00 40.86  ? 185 ASP A CG    1 
ATOM   1434 O OD1   . ASP A 1 199 ? 1.907   -5.097  91.754  1.00 52.08  ? 185 ASP A OD1   1 
ATOM   1435 O OD2   . ASP A 1 199 ? 2.789   -5.706  89.850  1.00 41.76  ? 185 ASP A OD2   1 
ATOM   1436 N N     . PHE A 1 200 ? -1.205  -1.602  88.987  1.00 21.86  ? 186 PHE A N     1 
ATOM   1437 C CA    . PHE A 1 200 ? -1.601  -0.213  88.830  1.00 22.29  ? 186 PHE A CA    1 
ATOM   1438 C C     . PHE A 1 200 ? -1.740  0.485   90.159  1.00 25.93  ? 186 PHE A C     1 
ATOM   1439 O O     . PHE A 1 200 ? -1.262  1.598   90.342  1.00 28.15  ? 186 PHE A O     1 
ATOM   1440 C CB    . PHE A 1 200 ? -2.922  -0.070  88.098  1.00 22.37  ? 186 PHE A CB    1 
ATOM   1441 C CG    . PHE A 1 200 ? -3.346  1.373   87.951  1.00 25.92  ? 186 PHE A CG    1 
ATOM   1442 C CD1   . PHE A 1 200 ? -2.675  2.220   87.073  1.00 25.60  ? 186 PHE A CD1   1 
ATOM   1443 C CD2   . PHE A 1 200 ? -4.364  1.899   88.739  1.00 26.30  ? 186 PHE A CD2   1 
ATOM   1444 C CE1   . PHE A 1 200 ? -3.006  3.567   86.988  1.00 27.42  ? 186 PHE A CE1   1 
ATOM   1445 C CE2   . PHE A 1 200 ? -4.698  3.247   88.662  1.00 29.75  ? 186 PHE A CE2   1 
ATOM   1446 C CZ    . PHE A 1 200 ? -4.022  4.077   87.779  1.00 28.25  ? 186 PHE A CZ    1 
ATOM   1447 N N     . GLU A 1 201 ? -2.436  -0.169  91.079  1.00 25.61  ? 187 GLU A N     1 
ATOM   1448 C CA    . GLU A 1 201 ? -2.665  0.261   92.458  1.00 25.69  ? 187 GLU A CA    1 
ATOM   1449 C C     . GLU A 1 201 ? -1.385  0.585   93.192  1.00 23.86  ? 187 GLU A C     1 
ATOM   1450 O O     . GLU A 1 201 ? -1.360  1.481   94.023  1.00 24.78  ? 187 GLU A O     1 
ATOM   1451 C CB    . GLU A 1 201 ? -3.230  -0.888  93.260  1.00 31.41  ? 187 GLU A CB    1 
ATOM   1452 C CG    . GLU A 1 201 ? -4.716  -0.930  93.385  1.00 44.07  ? 187 GLU A CG    1 
ATOM   1453 C CD    . GLU A 1 201 ? -5.397  -0.213  92.260  1.00 19.98  ? 187 GLU A CD    1 
ATOM   1454 O OE1   . GLU A 1 201 ? -5.775  0.973   92.416  1.00 20.02  ? 187 GLU A OE1   1 
ATOM   1455 O OE2   . GLU A 1 201 ? -5.568  -0.809  91.172  1.00 20.01  ? 187 GLU A OE2   1 
ATOM   1456 N N     . ALA A 1 202 ? -0.331  -0.181  92.931  1.00 24.86  ? 188 ALA A N     1 
ATOM   1457 C CA    . ALA A 1 202 ? 0.940   0.072   93.609  1.00 24.32  ? 188 ALA A CA    1 
ATOM   1458 C C     . ALA A 1 202 ? 1.697   1.153   92.816  1.00 22.93  ? 188 ALA A C     1 
ATOM   1459 O O     . ALA A 1 202 ? 2.456   1.929   93.382  1.00 25.17  ? 188 ALA A O     1 
ATOM   1460 C CB    . ALA A 1 202 ? 1.772   -1.209  93.692  1.00 25.98  ? 188 ALA A CB    1 
ATOM   1461 N N     . ARG A 1 203 ? 1.473   1.227   91.502  1.00 24.84  ? 189 ARG A N     1 
ATOM   1462 C CA    . ARG A 1 203 ? 2.163   2.226   90.685  1.00 25.46  ? 189 ARG A CA    1 
ATOM   1463 C C     . ARG A 1 203 ? 1.553   3.610   90.742  1.00 28.99  ? 189 ARG A C     1 
ATOM   1464 O O     . ARG A 1 203 ? 2.279   4.601   90.749  1.00 24.37  ? 189 ARG A O     1 
ATOM   1465 C CB    . ARG A 1 203 ? 2.224   1.800   89.205  1.00 22.36  ? 189 ARG A CB    1 
ATOM   1466 C CG    . ARG A 1 203 ? 2.940   0.464   88.986  1.00 17.21  ? 189 ARG A CG    1 
ATOM   1467 C CD    . ARG A 1 203 ? 3.033   0.155   87.504  1.00 21.10  ? 189 ARG A CD    1 
ATOM   1468 N NE    . ARG A 1 203 ? 3.647   -1.155  87.292  1.00 27.01  ? 189 ARG A NE    1 
ATOM   1469 C CZ    . ARG A 1 203 ? 4.956   -1.398  87.308  1.00 28.97  ? 189 ARG A CZ    1 
ATOM   1470 N NH1   . ARG A 1 203 ? 5.841   -0.425  87.514  1.00 21.33  ? 189 ARG A NH1   1 
ATOM   1471 N NH2   . ARG A 1 203 ? 5.385   -2.636  87.155  1.00 24.03  ? 189 ARG A NH2   1 
ATOM   1472 N N     . TRP A 1 204 ? 0.228   3.698   90.803  1.00 23.23  ? 190 TRP A N     1 
ATOM   1473 C CA    . TRP A 1 204 ? -0.361  5.021   90.777  1.00 25.40  ? 190 TRP A CA    1 
ATOM   1474 C C     . TRP A 1 204 ? 0.156   5.956   91.858  1.00 24.62  ? 190 TRP A C     1 
ATOM   1475 O O     . TRP A 1 204 ? 0.492   7.104   91.571  1.00 24.39  ? 190 TRP A O     1 
ATOM   1476 C CB    . TRP A 1 204 ? -1.896  4.968   90.783  1.00 27.79  ? 190 TRP A CB    1 
ATOM   1477 C CG    . TRP A 1 204 ? -2.430  6.353   90.808  1.00 24.28  ? 190 TRP A CG    1 
ATOM   1478 C CD1   . TRP A 1 204 ? -2.960  6.990   91.877  1.00 29.11  ? 190 TRP A CD1   1 
ATOM   1479 C CD2   . TRP A 1 204 ? -2.309  7.328   89.778  1.00 24.62  ? 190 TRP A CD2   1 
ATOM   1480 N NE1   . TRP A 1 204 ? -3.182  8.305   91.582  1.00 33.62  ? 190 TRP A NE1   1 
ATOM   1481 C CE2   . TRP A 1 204 ? -2.793  8.541   90.286  1.00 28.58  ? 190 TRP A CE2   1 
ATOM   1482 C CE3   . TRP A 1 204 ? -1.852  7.291   88.447  1.00 28.44  ? 190 TRP A CE3   1 
ATOM   1483 C CZ2   . TRP A 1 204 ? -2.808  9.720   89.550  1.00 31.56  ? 190 TRP A CZ2   1 
ATOM   1484 C CZ3   . TRP A 1 204 ? -1.871  8.456   87.708  1.00 26.45  ? 190 TRP A CZ3   1 
ATOM   1485 C CH2   . TRP A 1 204 ? -2.356  9.657   88.257  1.00 31.24  ? 190 TRP A CH2   1 
ATOM   1486 N N     . PRO A 1 205 ? 0.226   5.483   93.115  1.00 28.30  ? 191 PRO A N     1 
ATOM   1487 C CA    . PRO A 1 205 ? 0.723   6.286   94.242  1.00 28.59  ? 191 PRO A CA    1 
ATOM   1488 C C     . PRO A 1 205 ? 2.093   6.892   93.905  1.00 29.97  ? 191 PRO A C     1 
ATOM   1489 O O     . PRO A 1 205 ? 2.372   8.045   94.226  1.00 28.15  ? 191 PRO A O     1 
ATOM   1490 C CB    . PRO A 1 205 ? 0.821   5.261   95.368  1.00 30.29  ? 191 PRO A CB    1 
ATOM   1491 C CG    . PRO A 1 205 ? -0.344  4.336   95.058  1.00 26.23  ? 191 PRO A CG    1 
ATOM   1492 C CD    . PRO A 1 205 ? -0.279  4.172   93.572  1.00 21.18  ? 191 PRO A CD    1 
ATOM   1493 N N     . LEU A 1 206 ? 2.936   6.099   93.247  1.00 27.92  ? 192 LEU A N     1 
ATOM   1494 C CA    . LEU A 1 206 ? 4.271   6.548   92.846  1.00 31.44  ? 192 LEU A CA    1 
ATOM   1495 C C     . LEU A 1 206 ? 4.158   7.664   91.804  1.00 30.26  ? 192 LEU A C     1 
ATOM   1496 O O     . LEU A 1 206 ? 4.862   8.669   91.861  1.00 25.92  ? 192 LEU A O     1 
ATOM   1497 C CB    . LEU A 1 206 ? 5.050   5.367   92.272  1.00 27.79  ? 192 LEU A CB    1 
ATOM   1498 C CG    . LEU A 1 206 ? 5.819   4.494   93.255  1.00 33.56  ? 192 LEU A CG    1 
ATOM   1499 C CD1   . LEU A 1 206 ? 5.221   4.580   94.659  1.00 33.82  ? 192 LEU A CD1   1 
ATOM   1500 C CD2   . LEU A 1 206 ? 5.882   3.084   92.695  1.00 30.08  ? 192 LEU A CD2   1 
ATOM   1501 N N     . VAL A 1 207 ? 3.259   7.475   90.844  1.00 31.80  ? 193 VAL A N     1 
ATOM   1502 C CA    . VAL A 1 207 ? 3.043   8.468   89.797  1.00 31.55  ? 193 VAL A CA    1 
ATOM   1503 C C     . VAL A 1 207 ? 2.491   9.762   90.385  1.00 29.42  ? 193 VAL A C     1 
ATOM   1504 O O     . VAL A 1 207 ? 2.952   10.852  90.041  1.00 27.55  ? 193 VAL A O     1 
ATOM   1505 C CB    . VAL A 1 207 ? 2.051   7.957   88.735  1.00 35.08  ? 193 VAL A CB    1 
ATOM   1506 C CG1   . VAL A 1 207 ? 1.746   9.048   87.725  1.00 32.25  ? 193 VAL A CG1   1 
ATOM   1507 C CG2   . VAL A 1 207 ? 2.612   6.721   88.043  1.00 24.20  ? 193 VAL A CG2   1 
ATOM   1508 N N     . ALA A 1 208 ? 1.507   9.625   91.273  1.00 27.55  ? 194 ALA A N     1 
ATOM   1509 C CA    . ALA A 1 208 ? 0.851   10.772  91.908  1.00 32.73  ? 194 ALA A CA    1 
ATOM   1510 C C     . ALA A 1 208 ? 1.816   11.609  92.737  1.00 33.31  ? 194 ALA A C     1 
ATOM   1511 O O     . ALA A 1 208 ? 1.609   12.814  92.905  1.00 31.60  ? 194 ALA A O     1 
ATOM   1512 C CB    . ALA A 1 208 ? -0.306  10.301  92.776  1.00 24.16  ? 194 ALA A CB    1 
ATOM   1513 N N     . ALA A 1 209 ? 2.863   10.961  93.253  1.00 28.66  ? 195 ALA A N     1 
ATOM   1514 C CA    . ALA A 1 209 ? 3.881   11.631  94.051  1.00 28.57  ? 195 ALA A CA    1 
ATOM   1515 C C     . ALA A 1 209 ? 4.555   12.710  93.217  1.00 30.67  ? 195 ALA A C     1 
ATOM   1516 O O     . ALA A 1 209 ? 5.155   13.626  93.758  1.00 34.10  ? 195 ALA A O     1 
ATOM   1517 C CB    . ALA A 1 209 ? 4.939   10.617  94.535  1.00 31.19  ? 195 ALA A CB    1 
ATOM   1518 N N     . GLN A 1 210 ? 4.480   12.578  91.898  1.00 33.14  ? 196 GLN A N     1 
ATOM   1519 C CA    . GLN A 1 210 ? 5.072   13.566  90.998  1.00 36.49  ? 196 GLN A CA    1 
ATOM   1520 C C     . GLN A 1 210 ? 4.230   14.837  90.907  1.00 38.45  ? 196 GLN A C     1 
ATOM   1521 O O     . GLN A 1 210 ? 4.740   15.913  90.581  1.00 39.91  ? 196 GLN A O     1 
ATOM   1522 C CB    . GLN A 1 210 ? 5.179   13.006  89.586  1.00 37.20  ? 196 GLN A CB    1 
ATOM   1523 C CG    . GLN A 1 210 ? 6.133   11.863  89.392  1.00 39.05  ? 196 GLN A CG    1 
ATOM   1524 C CD    . GLN A 1 210 ? 6.188   11.476  87.939  1.00 39.09  ? 196 GLN A CD    1 
ATOM   1525 O OE1   . GLN A 1 210 ? 5.184   11.045  87.373  1.00 48.69  ? 196 GLN A OE1   1 
ATOM   1526 N NE2   . GLN A 1 210 ? 7.347   11.653  87.314  1.00 35.48  ? 196 GLN A NE2   1 
ATOM   1527 N N     . LEU A 1 211 ? 2.935   14.697  91.175  1.00 36.82  ? 197 LEU A N     1 
ATOM   1528 C CA    . LEU A 1 211 ? 2.004   15.812  91.077  1.00 41.34  ? 197 LEU A CA    1 
ATOM   1529 C C     . LEU A 1 211 ? 2.201   16.813  92.187  1.00 45.16  ? 197 LEU A C     1 
ATOM   1530 O O     . LEU A 1 211 ? 1.451   16.827  93.170  1.00 43.36  ? 197 LEU A O     1 
ATOM   1531 C CB    . LEU A 1 211 ? 0.555   15.298  91.083  1.00 34.60  ? 197 LEU A CB    1 
ATOM   1532 C CG    . LEU A 1 211 ? 0.314   14.213  90.017  1.00 37.64  ? 197 LEU A CG    1 
ATOM   1533 C CD1   . LEU A 1 211 ? -1.148  13.769  89.994  1.00 30.36  ? 197 LEU A CD1   1 
ATOM   1534 C CD2   . LEU A 1 211 ? 0.734   14.751  88.670  1.00 33.31  ? 197 LEU A CD2   1 
ATOM   1535 N N     . GLN A 1 212 ? 3.204   17.667  92.008  1.00 47.96  ? 198 GLN A N     1 
ATOM   1536 C CA    . GLN A 1 212 ? 3.516   18.677  93.003  1.00 51.56  ? 198 GLN A CA    1 
ATOM   1537 C C     . GLN A 1 212 ? 3.259   20.078  92.451  1.00 54.13  ? 198 GLN A C     1 
ATOM   1538 O O     . GLN A 1 212 ? 3.435   20.285  91.225  1.00 48.41  ? 198 GLN A O     1 
ATOM   1539 C CB    . GLN A 1 212 ? 4.981   18.555  93.411  1.00 52.01  ? 198 GLN A CB    1 
ATOM   1540 C CG    . GLN A 1 212 ? 5.381   17.220  93.999  1.00 54.48  ? 198 GLN A CG    1 
ATOM   1541 C CD    . GLN A 1 212 ? 6.883   16.995  93.894  1.00 61.34  ? 198 GLN A CD    1 
ATOM   1542 O OE1   . GLN A 1 212 ? 7.668   17.948  93.955  1.00 61.59  ? 198 GLN A OE1   1 
ATOM   1543 N NE2   . GLN A 1 212 ? 7.293   15.734  93.736  1.00 60.37  ? 198 GLN A NE2   1 
ATOM   1544 O OXT   . GLN A 1 212 ? 2.911   20.959  93.272  1.00 59.18  ? 198 GLN A OXT   1 
ATOM   1545 N N     . ASN B 1 24  ? 37.028  -2.710  55.888  1.00 87.52  ? 10  ASN B N     1 
ATOM   1546 C CA    . ASN B 1 24  ? 36.432  -1.584  56.660  1.00 87.05  ? 10  ASN B CA    1 
ATOM   1547 C C     . ASN B 1 24  ? 35.094  -1.155  56.101  1.00 85.73  ? 10  ASN B C     1 
ATOM   1548 O O     . ASN B 1 24  ? 34.479  -0.229  56.624  1.00 86.32  ? 10  ASN B O     1 
ATOM   1549 C CB    . ASN B 1 24  ? 37.359  -0.365  56.665  1.00 89.86  ? 10  ASN B CB    1 
ATOM   1550 C CG    . ASN B 1 24  ? 38.431  -0.452  57.729  1.00 93.60  ? 10  ASN B CG    1 
ATOM   1551 O OD1   . ASN B 1 24  ? 39.204  0.490   57.928  1.00 97.08  ? 10  ASN B OD1   1 
ATOM   1552 N ND2   . ASN B 1 24  ? 38.484  -1.584  58.425  1.00 91.89  ? 10  ASN B ND2   1 
ATOM   1553 N N     . ARG B 1 25  ? 34.651  -1.800  55.026  1.00 84.01  ? 11  ARG B N     1 
ATOM   1554 C CA    . ARG B 1 25  ? 33.361  -1.453  54.443  1.00 81.97  ? 11  ARG B CA    1 
ATOM   1555 C C     . ARG B 1 25  ? 32.288  -1.872  55.428  1.00 79.03  ? 11  ARG B C     1 
ATOM   1556 O O     . ARG B 1 25  ? 31.222  -1.255  55.506  1.00 77.51  ? 11  ARG B O     1 
ATOM   1557 C CB    . ARG B 1 25  ? 33.133  -2.158  53.101  1.00 82.80  ? 11  ARG B CB    1 
ATOM   1558 C CG    . ARG B 1 25  ? 33.485  -1.298  51.904  1.00 87.55  ? 11  ARG B CG    1 
ATOM   1559 C CD    . ARG B 1 25  ? 34.990  -1.038  51.829  1.00 92.30  ? 11  ARG B CD    1 
ATOM   1560 N NE    . ARG B 1 25  ? 35.314  0.189   51.101  1.00 94.15  ? 11  ARG B NE    1 
ATOM   1561 C CZ    . ARG B 1 25  ? 34.799  0.521   49.921  1.00 96.47  ? 11  ARG B CZ    1 
ATOM   1562 N NH1   . ARG B 1 25  ? 35.154  1.658   49.333  1.00 96.32  ? 11  ARG B NH1   1 
ATOM   1563 N NH2   . ARG B 1 25  ? 33.922  -0.280  49.329  1.00 96.75  ? 11  ARG B NH2   1 
ATOM   1564 N N     . ARG B 1 26  ? 32.585  -2.924  56.184  1.00 74.74  ? 12  ARG B N     1 
ATOM   1565 C CA    . ARG B 1 26  ? 31.656  -3.420  57.171  1.00 69.37  ? 12  ARG B CA    1 
ATOM   1566 C C     . ARG B 1 26  ? 31.239  -2.229  58.033  1.00 69.71  ? 12  ARG B C     1 
ATOM   1567 O O     . ARG B 1 26  ? 30.054  -2.043  58.313  1.00 70.96  ? 12  ARG B O     1 
ATOM   1568 C CB    . ARG B 1 26  ? 32.319  -4.492  58.017  1.00 64.86  ? 12  ARG B CB    1 
ATOM   1569 C CG    . ARG B 1 26  ? 31.346  -5.319  58.807  1.00 64.38  ? 12  ARG B CG    1 
ATOM   1570 C CD    . ARG B 1 26  ? 32.069  -6.233  59.775  1.00 67.63  ? 12  ARG B CD    1 
ATOM   1571 N NE    . ARG B 1 26  ? 31.142  -6.970  60.634  1.00 74.62  ? 12  ARG B NE    1 
ATOM   1572 C CZ    . ARG B 1 26  ? 30.314  -7.918  60.203  1.00 73.87  ? 12  ARG B CZ    1 
ATOM   1573 N NH1   . ARG B 1 26  ? 29.506  -8.533  61.058  1.00 72.66  ? 12  ARG B NH1   1 
ATOM   1574 N NH2   . ARG B 1 26  ? 30.299  -8.258  58.919  1.00 71.62  ? 12  ARG B NH2   1 
ATOM   1575 N N     . GLU B 1 27  ? 32.204  -1.402  58.429  1.00 66.86  ? 13  GLU B N     1 
ATOM   1576 C CA    . GLU B 1 27  ? 31.895  -0.229  59.238  1.00 64.00  ? 13  GLU B CA    1 
ATOM   1577 C C     . GLU B 1 27  ? 31.211  0.867   58.439  1.00 62.89  ? 13  GLU B C     1 
ATOM   1578 O O     . GLU B 1 27  ? 30.396  1.622   58.970  1.00 64.03  ? 13  GLU B O     1 
ATOM   1579 C CB    . GLU B 1 27  ? 33.161  0.347   59.859  1.00 67.32  ? 13  GLU B CB    1 
ATOM   1580 C CG    . GLU B 1 27  ? 33.475  -0.181  61.238  1.00 72.54  ? 13  GLU B CG    1 
ATOM   1581 C CD    . GLU B 1 27  ? 32.383  0.143   62.238  1.00 77.19  ? 13  GLU B CD    1 
ATOM   1582 O OE1   . GLU B 1 27  ? 31.952  1.321   62.285  1.00 77.49  ? 13  GLU B OE1   1 
ATOM   1583 O OE2   . GLU B 1 27  ? 31.963  -0.779  62.977  1.00 78.50  ? 13  GLU B OE2   1 
ATOM   1584 N N     . GLU B 1 28  ? 31.546  0.962   57.161  1.00 59.08  ? 14  GLU B N     1 
ATOM   1585 C CA    . GLU B 1 28  ? 30.972  1.998   56.312  1.00 58.19  ? 14  GLU B CA    1 
ATOM   1586 C C     . GLU B 1 28  ? 29.470  1.809   56.131  1.00 55.06  ? 14  GLU B C     1 
ATOM   1587 O O     . GLU B 1 28  ? 28.693  2.773   56.154  1.00 48.41  ? 14  GLU B O     1 
ATOM   1588 C CB    . GLU B 1 28  ? 31.637  1.973   54.939  1.00 62.30  ? 14  GLU B CB    1 
ATOM   1589 C CG    . GLU B 1 28  ? 33.143  1.800   54.971  1.00 69.92  ? 14  GLU B CG    1 
ATOM   1590 C CD    . GLU B 1 28  ? 33.792  2.223   53.669  1.00 71.81  ? 14  GLU B CD    1 
ATOM   1591 O OE1   . GLU B 1 28  ? 33.299  1.813   52.589  1.00 71.43  ? 14  GLU B OE1   1 
ATOM   1592 O OE2   . GLU B 1 28  ? 34.796  2.969   53.734  1.00 74.23  ? 14  GLU B OE2   1 
ATOM   1593 N N     . ILE B 1 29  ? 29.101  0.550   55.911  1.00 50.64  ? 15  ILE B N     1 
ATOM   1594 C CA    . ILE B 1 29  ? 27.727  0.120   55.716  1.00 49.16  ? 15  ILE B CA    1 
ATOM   1595 C C     . ILE B 1 29  ? 26.909  0.433   56.972  1.00 46.83  ? 15  ILE B C     1 
ATOM   1596 O O     . ILE B 1 29  ? 25.879  1.116   56.887  1.00 43.67  ? 15  ILE B O     1 
ATOM   1597 C CB    . ILE B 1 29  ? 27.687  -1.409  55.426  1.00 50.38  ? 15  ILE B CB    1 
ATOM   1598 C CG1   . ILE B 1 29  ? 28.503  -1.700  54.158  1.00 50.82  ? 15  ILE B CG1   1 
ATOM   1599 C CG2   . ILE B 1 29  ? 26.243  -1.904  55.310  1.00 50.63  ? 15  ILE B CG2   1 
ATOM   1600 C CD1   . ILE B 1 29  ? 28.633  -3.171  53.814  1.00 52.28  ? 15  ILE B CD1   1 
ATOM   1601 N N     . LEU B 1 30  ? 27.385  -0.046  58.129  1.00 45.31  ? 16  LEU B N     1 
ATOM   1602 C CA    . LEU B 1 30  ? 26.696  0.181   59.410  1.00 46.19  ? 16  LEU B CA    1 
ATOM   1603 C C     . LEU B 1 30  ? 26.464  1.665   59.677  1.00 44.72  ? 16  LEU B C     1 
ATOM   1604 O O     . LEU B 1 30  ? 25.374  2.066   60.071  1.00 43.36  ? 16  LEU B O     1 
ATOM   1605 C CB    . LEU B 1 30  ? 27.494  -0.426  60.552  1.00 42.30  ? 16  LEU B CB    1 
ATOM   1606 C CG    . LEU B 1 30  ? 27.665  -1.939  60.475  1.00 35.36  ? 16  LEU B CG    1 
ATOM   1607 C CD1   . LEU B 1 30  ? 28.503  -2.384  61.645  1.00 36.64  ? 16  LEU B CD1   1 
ATOM   1608 C CD2   . LEU B 1 30  ? 26.326  -2.632  60.505  1.00 36.68  ? 16  LEU B CD2   1 
ATOM   1609 N N     . GLN B 1 31  ? 27.500  2.464   59.451  1.00 40.89  ? 17  GLN B N     1 
ATOM   1610 C CA    . GLN B 1 31  ? 27.440  3.907   59.624  1.00 43.22  ? 17  GLN B CA    1 
ATOM   1611 C C     . GLN B 1 31  ? 26.309  4.494   58.795  1.00 41.87  ? 17  GLN B C     1 
ATOM   1612 O O     . GLN B 1 31  ? 25.567  5.366   59.263  1.00 40.03  ? 17  GLN B O     1 
ATOM   1613 C CB    . GLN B 1 31  ? 28.754  4.545   59.160  1.00 47.47  ? 17  GLN B CB    1 
ATOM   1614 C CG    . GLN B 1 31  ? 29.920  4.419   60.109  1.00 62.01  ? 17  GLN B CG    1 
ATOM   1615 C CD    . GLN B 1 31  ? 29.690  5.196   61.390  1.00 70.27  ? 17  GLN B CD    1 
ATOM   1616 O OE1   . GLN B 1 31  ? 29.233  6.343   61.357  1.00 71.96  ? 17  GLN B OE1   1 
ATOM   1617 N NE2   . GLN B 1 31  ? 30.012  4.580   62.530  1.00 72.25  ? 17  GLN B NE2   1 
ATOM   1618 N N     . SER B 1 32  ? 26.215  4.031   57.545  1.00 44.20  ? 18  SER B N     1 
ATOM   1619 C CA    . SER B 1 32  ? 25.194  4.492   56.604  1.00 45.99  ? 18  SER B CA    1 
ATOM   1620 C C     . SER B 1 32  ? 23.815  4.084   57.083  1.00 38.58  ? 18  SER B C     1 
ATOM   1621 O O     . SER B 1 32  ? 22.916  4.917   57.182  1.00 39.03  ? 18  SER B O     1 
ATOM   1622 C CB    . SER B 1 32  ? 25.447  3.928   55.191  1.00 50.17  ? 18  SER B CB    1 
ATOM   1623 O OG    . SER B 1 32  ? 26.545  4.573   54.558  1.00 57.00  ? 18  SER B OG    1 
ATOM   1624 N N     . LEU B 1 33  ? 23.651  2.800   57.374  1.00 35.27  ? 19  LEU B N     1 
ATOM   1625 C CA    . LEU B 1 33  ? 22.378  2.314   57.866  1.00 37.83  ? 19  LEU B CA    1 
ATOM   1626 C C     . LEU B 1 33  ? 21.911  3.213   59.025  1.00 39.06  ? 19  LEU B C     1 
ATOM   1627 O O     . LEU B 1 33  ? 20.757  3.634   59.074  1.00 40.57  ? 19  LEU B O     1 
ATOM   1628 C CB    . LEU B 1 33  ? 22.522  0.857   58.315  1.00 32.05  ? 19  LEU B CB    1 
ATOM   1629 C CG    . LEU B 1 33  ? 21.268  0.251   58.928  1.00 32.92  ? 19  LEU B CG    1 
ATOM   1630 C CD1   . LEU B 1 33  ? 20.050  0.627   58.085  1.00 29.92  ? 19  LEU B CD1   1 
ATOM   1631 C CD2   . LEU B 1 33  ? 21.434  -1.250  59.049  1.00 24.79  ? 19  LEU B CD2   1 
ATOM   1632 N N     . ALA B 1 34  ? 22.823  3.537   59.935  1.00 38.69  ? 20  ALA B N     1 
ATOM   1633 C CA    . ALA B 1 34  ? 22.493  4.389   61.069  1.00 41.04  ? 20  ALA B CA    1 
ATOM   1634 C C     . ALA B 1 34  ? 22.049  5.764   60.599  1.00 41.61  ? 20  ALA B C     1 
ATOM   1635 O O     . ALA B 1 34  ? 21.068  6.330   61.108  1.00 38.21  ? 20  ALA B O     1 
ATOM   1636 C CB    . ALA B 1 34  ? 23.703  4.527   62.007  1.00 37.04  ? 20  ALA B CB    1 
ATOM   1637 N N     . LEU B 1 35  ? 22.767  6.309   59.622  1.00 42.44  ? 21  LEU B N     1 
ATOM   1638 C CA    . LEU B 1 35  ? 22.427  7.632   59.107  1.00 43.28  ? 21  LEU B CA    1 
ATOM   1639 C C     . LEU B 1 35  ? 21.039  7.617   58.490  1.00 42.10  ? 21  LEU B C     1 
ATOM   1640 O O     . LEU B 1 35  ? 20.227  8.525   58.705  1.00 39.71  ? 21  LEU B O     1 
ATOM   1641 C CB    . LEU B 1 35  ? 23.475  8.080   58.095  1.00 47.94  ? 21  LEU B CB    1 
ATOM   1642 C CG    . LEU B 1 35  ? 24.514  8.956   58.799  1.00 55.80  ? 21  LEU B CG    1 
ATOM   1643 C CD1   . LEU B 1 35  ? 25.785  9.112   57.952  1.00 57.51  ? 21  LEU B CD1   1 
ATOM   1644 C CD2   . LEU B 1 35  ? 23.855  10.303  59.107  1.00 54.02  ? 21  LEU B CD2   1 
ATOM   1645 N N     . MET B 1 36  ? 20.751  6.558   57.747  1.00 38.91  ? 22  MET B N     1 
ATOM   1646 C CA    . MET B 1 36  ? 19.447  6.436   57.126  1.00 41.36  ? 22  MET B CA    1 
ATOM   1647 C C     . MET B 1 36  ? 18.384  6.282   58.220  1.00 40.43  ? 22  MET B C     1 
ATOM   1648 O O     . MET B 1 36  ? 17.335  6.929   58.171  1.00 36.33  ? 22  MET B O     1 
ATOM   1649 C CB    . MET B 1 36  ? 19.462  5.246   56.167  1.00 44.33  ? 22  MET B CB    1 
ATOM   1650 C CG    . MET B 1 36  ? 20.522  5.422   55.067  1.00 44.61  ? 22  MET B CG    1 
ATOM   1651 S SD    . MET B 1 36  ? 20.406  4.189   53.790  1.00 52.65  ? 22  MET B SD    1 
ATOM   1652 C CE    . MET B 1 36  ? 18.799  4.657   53.120  1.00 35.79  ? 22  MET B CE    1 
ATOM   1653 N N     . LEU B 1 37  ? 18.665  5.442   59.218  1.00 38.22  ? 23  LEU B N     1 
ATOM   1654 C CA    . LEU B 1 37  ? 17.722  5.258   60.324  1.00 37.82  ? 23  LEU B CA    1 
ATOM   1655 C C     . LEU B 1 37  ? 17.400  6.614   60.951  1.00 35.42  ? 23  LEU B C     1 
ATOM   1656 O O     . LEU B 1 37  ? 16.250  6.895   61.307  1.00 32.37  ? 23  LEU B O     1 
ATOM   1657 C CB    . LEU B 1 37  ? 18.310  4.327   61.386  1.00 33.91  ? 23  LEU B CB    1 
ATOM   1658 C CG    . LEU B 1 37  ? 17.798  2.888   61.531  1.00 36.82  ? 23  LEU B CG    1 
ATOM   1659 C CD1   . LEU B 1 37  ? 16.712  2.577   60.548  1.00 32.79  ? 23  LEU B CD1   1 
ATOM   1660 C CD2   . LEU B 1 37  ? 18.956  1.938   61.372  1.00 30.76  ? 23  LEU B CD2   1 
ATOM   1661 N N     . GLU B 1 38  ? 18.420  7.456   61.069  1.00 38.27  ? 24  GLU B N     1 
ATOM   1662 C CA    . GLU B 1 38  ? 18.251  8.786   61.655  1.00 40.23  ? 24  GLU B CA    1 
ATOM   1663 C C     . GLU B 1 38  ? 17.487  9.732   60.728  1.00 43.11  ? 24  GLU B C     1 
ATOM   1664 O O     . GLU B 1 38  ? 16.704  10.562  61.186  1.00 42.58  ? 24  GLU B O     1 
ATOM   1665 C CB    . GLU B 1 38  ? 19.614  9.395   62.002  1.00 39.65  ? 24  GLU B CB    1 
ATOM   1666 C CG    . GLU B 1 38  ? 19.524  10.836  62.507  1.00 43.01  ? 24  GLU B CG    1 
ATOM   1667 C CD    . GLU B 1 38  ? 20.882  11.417  62.902  1.00 52.34  ? 24  GLU B CD    1 
ATOM   1668 O OE1   . GLU B 1 38  ? 21.901  10.682  62.834  1.00 45.66  ? 24  GLU B OE1   1 
ATOM   1669 O OE2   . GLU B 1 38  ? 20.928  12.614  63.282  1.00 48.54  ? 24  GLU B OE2   1 
ATOM   1670 N N     . SER B 1 39  ? 17.708  9.600   59.423  1.00 47.80  ? 25  SER B N     1 
ATOM   1671 C CA    . SER B 1 39  ? 17.043  10.466  58.457  1.00 48.35  ? 25  SER B CA    1 
ATOM   1672 C C     . SER B 1 39  ? 15.536  10.271  58.409  1.00 48.99  ? 25  SER B C     1 
ATOM   1673 O O     . SER B 1 39  ? 14.984  9.328   58.980  1.00 43.55  ? 25  SER B O     1 
ATOM   1674 C CB    . SER B 1 39  ? 17.601  10.230  57.058  1.00 46.80  ? 25  SER B CB    1 
ATOM   1675 O OG    . SER B 1 39  ? 17.199  8.965   56.573  1.00 55.72  ? 25  SER B OG    1 
ATOM   1676 N N     . SER B 1 40  ? 14.877  11.168  57.691  1.00 51.65  ? 26  SER B N     1 
ATOM   1677 C CA    . SER B 1 40  ? 13.431  11.107  57.552  1.00 55.48  ? 26  SER B CA    1 
ATOM   1678 C C     . SER B 1 40  ? 13.025  9.828   56.835  1.00 53.28  ? 26  SER B C     1 
ATOM   1679 O O     . SER B 1 40  ? 11.860  9.466   56.814  1.00 57.57  ? 26  SER B O     1 
ATOM   1680 C CB    . SER B 1 40  ? 12.909  12.354  56.815  1.00 55.90  ? 26  SER B CB    1 
ATOM   1681 O OG    . SER B 1 40  ? 13.715  12.699  55.696  1.00 63.06  ? 26  SER B OG    1 
ATOM   1682 N N     . ASP B 1 41  ? 14.003  9.131   56.272  1.00 54.35  ? 27  ASP B N     1 
ATOM   1683 C CA    . ASP B 1 41  ? 13.746  7.873   55.568  1.00 56.05  ? 27  ASP B CA    1 
ATOM   1684 C C     . ASP B 1 41  ? 13.790  6.677   56.515  1.00 54.60  ? 27  ASP B C     1 
ATOM   1685 O O     . ASP B 1 41  ? 13.534  5.534   56.106  1.00 51.03  ? 27  ASP B O     1 
ATOM   1686 C CB    . ASP B 1 41  ? 14.777  7.670   54.454  1.00 64.03  ? 27  ASP B CB    1 
ATOM   1687 C CG    . ASP B 1 41  ? 14.403  8.394   53.169  1.00 67.66  ? 27  ASP B CG    1 
ATOM   1688 O OD1   . ASP B 1 41  ? 13.928  9.555   53.237  1.00 65.41  ? 27  ASP B OD1   1 
ATOM   1689 O OD2   . ASP B 1 41  ? 14.598  7.793   52.089  1.00 71.60  ? 27  ASP B OD2   1 
ATOM   1690 N N     . GLY B 1 42  ? 14.138  6.953   57.774  1.00 51.68  ? 28  GLY B N     1 
ATOM   1691 C CA    . GLY B 1 42  ? 14.202  5.918   58.790  1.00 45.61  ? 28  GLY B CA    1 
ATOM   1692 C C     . GLY B 1 42  ? 12.822  5.483   59.268  1.00 44.95  ? 28  GLY B C     1 
ATOM   1693 O O     . GLY B 1 42  ? 12.715  4.505   60.003  1.00 46.67  ? 28  GLY B O     1 
ATOM   1694 N N     . SER B 1 43  ? 11.767  6.193   58.858  1.00 42.50  ? 29  SER B N     1 
ATOM   1695 C CA    . SER B 1 43  ? 10.400  5.832   59.243  1.00 43.66  ? 29  SER B CA    1 
ATOM   1696 C C     . SER B 1 43  ? 9.793   4.745   58.328  1.00 42.73  ? 29  SER B C     1 
ATOM   1697 O O     . SER B 1 43  ? 8.618   4.425   58.423  1.00 43.44  ? 29  SER B O     1 
ATOM   1698 C CB    . SER B 1 43  ? 9.499   7.062   59.228  1.00 47.85  ? 29  SER B CB    1 
ATOM   1699 O OG    . SER B 1 43  ? 9.429   7.621   57.921  1.00 59.43  ? 29  SER B OG    1 
ATOM   1700 N N     . GLN B 1 44  ? 10.586  4.199   57.419  1.00 45.14  ? 30  GLN B N     1 
ATOM   1701 C CA    . GLN B 1 44  ? 10.108  3.124   56.561  1.00 45.06  ? 30  GLN B CA    1 
ATOM   1702 C C     . GLN B 1 44  ? 11.258  2.226   56.195  1.00 43.76  ? 30  GLN B C     1 
ATOM   1703 O O     . GLN B 1 44  ? 12.410  2.555   56.445  1.00 40.84  ? 30  GLN B O     1 
ATOM   1704 C CB    . GLN B 1 44  ? 9.439   3.647   55.308  1.00 49.64  ? 30  GLN B CB    1 
ATOM   1705 C CG    . GLN B 1 44  ? 10.227  4.642   54.533  1.00 57.79  ? 30  GLN B CG    1 
ATOM   1706 C CD    . GLN B 1 44  ? 9.294   5.562   53.776  1.00 67.28  ? 30  GLN B CD    1 
ATOM   1707 O OE1   . GLN B 1 44  ? 8.497   6.285   54.387  1.00 71.39  ? 30  GLN B OE1   1 
ATOM   1708 N NE2   . GLN B 1 44  ? 9.366   5.528   52.443  1.00 70.33  ? 30  GLN B NE2   1 
ATOM   1709 N N     . ARG B 1 45  ? 10.922  1.078   55.625  1.00 45.42  ? 31  ARG B N     1 
ATOM   1710 C CA    . ARG B 1 45  ? 11.893  0.062   55.242  1.00 46.52  ? 31  ARG B CA    1 
ATOM   1711 C C     . ARG B 1 45  ? 13.175  0.610   54.636  1.00 46.55  ? 31  ARG B C     1 
ATOM   1712 O O     . ARG B 1 45  ? 13.140  1.469   53.756  1.00 49.83  ? 31  ARG B O     1 
ATOM   1713 C CB    . ARG B 1 45  ? 11.239  -0.911  54.254  1.00 45.89  ? 31  ARG B CB    1 
ATOM   1714 C CG    . ARG B 1 45  ? 11.907  -2.271  54.169  1.00 50.32  ? 31  ARG B CG    1 
ATOM   1715 C CD    . ARG B 1 45  ? 11.025  -3.263  53.425  1.00 42.84  ? 31  ARG B CD    1 
ATOM   1716 N NE    . ARG B 1 45  ? 10.606  -4.380  54.279  1.00 52.94  ? 31  ARG B NE    1 
ATOM   1717 C CZ    . ARG B 1 45  ? 11.264  -5.531  54.356  1.00 56.96  ? 31  ARG B CZ    1 
ATOM   1718 N NH1   . ARG B 1 45  ? 12.363  -5.699  53.636  1.00 58.85  ? 31  ARG B NH1   1 
ATOM   1719 N NH2   . ARG B 1 45  ? 10.808  -6.522  55.117  1.00 61.07  ? 31  ARG B NH2   1 
ATOM   1720 N N     . ILE B 1 46  ? 14.309  0.123   55.123  1.00 44.71  ? 32  ILE B N     1 
ATOM   1721 C CA    . ILE B 1 46  ? 15.600  0.537   54.586  1.00 40.12  ? 32  ILE B CA    1 
ATOM   1722 C C     . ILE B 1 46  ? 15.979  -0.560  53.577  1.00 44.13  ? 32  ILE B C     1 
ATOM   1723 O O     . ILE B 1 46  ? 16.450  -1.632  53.961  1.00 43.61  ? 32  ILE B O     1 
ATOM   1724 C CB    . ILE B 1 46  ? 16.677  0.581   55.681  1.00 43.29  ? 32  ILE B CB    1 
ATOM   1725 C CG1   . ILE B 1 46  ? 16.237  1.489   56.845  1.00 44.45  ? 32  ILE B CG1   1 
ATOM   1726 C CG2   . ILE B 1 46  ? 18.001  1.023   55.083  1.00 39.54  ? 32  ILE B CG2   1 
ATOM   1727 C CD1   . ILE B 1 46  ? 15.960  2.926   56.472  1.00 48.62  ? 32  ILE B CD1   1 
ATOM   1728 N N     . THR B 1 47  ? 15.761  -0.312  52.290  1.00 39.96  ? 33  THR B N     1 
ATOM   1729 C CA    . THR B 1 47  ? 16.096  -1.321  51.279  1.00 36.86  ? 33  THR B CA    1 
ATOM   1730 C C     . THR B 1 47  ? 17.589  -1.468  51.061  1.00 34.92  ? 33  THR B C     1 
ATOM   1731 O O     . THR B 1 47  ? 18.360  -0.510  51.194  1.00 27.35  ? 33  THR B O     1 
ATOM   1732 C CB    . THR B 1 47  ? 15.480  -0.986  49.904  1.00 40.70  ? 33  THR B CB    1 
ATOM   1733 O OG1   . THR B 1 47  ? 15.921  0.323   49.505  1.00 43.30  ? 33  THR B OG1   1 
ATOM   1734 C CG2   . THR B 1 47  ? 13.941  -1.041  49.965  1.00 38.74  ? 33  THR B CG2   1 
ATOM   1735 N N     . THR B 1 48  ? 17.999  -2.676  50.706  1.00 35.20  ? 34  THR B N     1 
ATOM   1736 C CA    . THR B 1 48  ? 19.412  -2.945  50.448  1.00 42.08  ? 34  THR B CA    1 
ATOM   1737 C C     . THR B 1 48  ? 19.908  -2.103  49.267  1.00 41.36  ? 34  THR B C     1 
ATOM   1738 O O     . THR B 1 48  ? 21.067  -1.687  49.230  1.00 41.94  ? 34  THR B O     1 
ATOM   1739 C CB    . THR B 1 48  ? 19.658  -4.454  50.141  1.00 44.01  ? 34  THR B CB    1 
ATOM   1740 O OG1   . THR B 1 48  ? 18.842  -4.862  49.032  1.00 40.71  ? 34  THR B OG1   1 
ATOM   1741 C CG2   . THR B 1 48  ? 19.330  -5.316  51.362  1.00 36.61  ? 34  THR B CG2   1 
ATOM   1742 N N     . ALA B 1 49  ? 19.022  -1.839  48.310  1.00 43.85  ? 35  ALA B N     1 
ATOM   1743 C CA    . ALA B 1 49  ? 19.389  -1.035  47.141  1.00 44.73  ? 35  ALA B CA    1 
ATOM   1744 C C     . ALA B 1 49  ? 19.727  0.374   47.583  1.00 44.84  ? 35  ALA B C     1 
ATOM   1745 O O     . ALA B 1 49  ? 20.728  0.953   47.156  1.00 44.47  ? 35  ALA B O     1 
ATOM   1746 C CB    . ALA B 1 49  ? 18.245  -0.998  46.148  1.00 42.50  ? 35  ALA B CB    1 
ATOM   1747 N N     . LYS B 1 50  ? 18.884  0.923   48.446  1.00 45.96  ? 36  LYS B N     1 
ATOM   1748 C CA    . LYS B 1 50  ? 19.094  2.275   48.953  1.00 51.22  ? 36  LYS B CA    1 
ATOM   1749 C C     . LYS B 1 50  ? 20.350  2.318   49.829  1.00 49.90  ? 36  LYS B C     1 
ATOM   1750 O O     . LYS B 1 50  ? 21.133  3.271   49.782  1.00 50.42  ? 36  LYS B O     1 
ATOM   1751 C CB    . LYS B 1 50  ? 17.876  2.701   49.768  1.00 57.34  ? 36  LYS B CB    1 
ATOM   1752 C CG    . LYS B 1 50  ? 17.675  4.202   49.892  1.00 65.33  ? 36  LYS B CG    1 
ATOM   1753 C CD    . LYS B 1 50  ? 16.389  4.629   49.203  1.00 67.84  ? 36  LYS B CD    1 
ATOM   1754 C CE    . LYS B 1 50  ? 15.173  3.930   49.814  1.00 74.61  ? 36  LYS B CE    1 
ATOM   1755 N NZ    . LYS B 1 50  ? 13.872  4.265   49.130  1.00 74.41  ? 36  LYS B NZ    1 
ATOM   1756 N N     . LEU B 1 51  ? 20.546  1.272   50.623  1.00 48.17  ? 37  LEU B N     1 
ATOM   1757 C CA    . LEU B 1 51  ? 21.698  1.202   51.512  1.00 46.39  ? 37  LEU B CA    1 
ATOM   1758 C C     . LEU B 1 51  ? 22.986  1.128   50.700  1.00 46.97  ? 37  LEU B C     1 
ATOM   1759 O O     . LEU B 1 51  ? 23.935  1.867   50.964  1.00 45.93  ? 37  LEU B O     1 
ATOM   1760 C CB    . LEU B 1 51  ? 21.574  -0.014  52.439  1.00 44.05  ? 37  LEU B CB    1 
ATOM   1761 C CG    . LEU B 1 51  ? 22.651  -0.165  53.510  1.00 42.94  ? 37  LEU B CG    1 
ATOM   1762 C CD1   . LEU B 1 51  ? 22.722  1.122   54.336  1.00 42.34  ? 37  LEU B CD1   1 
ATOM   1763 C CD2   . LEU B 1 51  ? 22.336  -1.375  54.382  1.00 40.33  ? 37  LEU B CD2   1 
ATOM   1764 N N     . ALA B 1 52  ? 23.011  0.236   49.714  1.00 49.60  ? 38  ALA B N     1 
ATOM   1765 C CA    . ALA B 1 52  ? 24.177  0.087   48.848  1.00 54.21  ? 38  ALA B CA    1 
ATOM   1766 C C     . ALA B 1 52  ? 24.456  1.421   48.148  1.00 54.44  ? 38  ALA B C     1 
ATOM   1767 O O     . ALA B 1 52  ? 25.597  1.877   48.087  1.00 53.30  ? 38  ALA B O     1 
ATOM   1768 C CB    . ALA B 1 52  ? 23.926  -1.005  47.818  1.00 53.97  ? 38  ALA B CB    1 
ATOM   1769 N N     . ALA B 1 53  ? 23.407  2.048   47.625  1.00 56.50  ? 39  ALA B N     1 
ATOM   1770 C CA    . ALA B 1 53  ? 23.566  3.334   46.954  1.00 61.20  ? 39  ALA B CA    1 
ATOM   1771 C C     . ALA B 1 53  ? 24.166  4.331   47.939  1.00 64.24  ? 39  ALA B C     1 
ATOM   1772 O O     . ALA B 1 53  ? 25.160  4.996   47.639  1.00 66.90  ? 39  ALA B O     1 
ATOM   1773 C CB    . ALA B 1 53  ? 22.218  3.843   46.442  1.00 56.89  ? 39  ALA B CB    1 
ATOM   1774 N N     . SER B 1 54  ? 23.567  4.418   49.121  1.00 67.20  ? 40  SER B N     1 
ATOM   1775 C CA    . SER B 1 54  ? 24.038  5.338   50.149  1.00 69.76  ? 40  SER B CA    1 
ATOM   1776 C C     . SER B 1 54  ? 25.530  5.160   50.398  1.00 70.43  ? 40  SER B C     1 
ATOM   1777 O O     . SER B 1 54  ? 26.286  6.131   50.439  1.00 69.13  ? 40  SER B O     1 
ATOM   1778 C CB    . SER B 1 54  ? 23.269  5.105   51.450  1.00 72.15  ? 40  SER B CB    1 
ATOM   1779 O OG    . SER B 1 54  ? 23.683  6.009   52.459  1.00 75.60  ? 40  SER B OG    1 
ATOM   1780 N N     . VAL B 1 55  ? 25.943  3.911   50.572  1.00 72.21  ? 41  VAL B N     1 
ATOM   1781 C CA    . VAL B 1 55  ? 27.341  3.589   50.819  1.00 74.99  ? 41  VAL B CA    1 
ATOM   1782 C C     . VAL B 1 55  ? 28.174  4.099   49.660  1.00 77.69  ? 41  VAL B C     1 
ATOM   1783 O O     . VAL B 1 55  ? 29.000  5.006   49.818  1.00 80.48  ? 41  VAL B O     1 
ATOM   1784 C CB    . VAL B 1 55  ? 27.545  2.056   50.944  1.00 75.27  ? 41  VAL B CB    1 
ATOM   1785 C CG1   . VAL B 1 55  ? 29.024  1.706   50.841  1.00 75.16  ? 41  VAL B CG1   1 
ATOM   1786 C CG2   . VAL B 1 55  ? 26.980  1.566   52.265  1.00 78.23  ? 41  VAL B CG2   1 
ATOM   1787 N N     . GLY B 1 56  ? 27.930  3.504   48.494  1.00 77.39  ? 42  GLY B N     1 
ATOM   1788 C CA    . GLY B 1 56  ? 28.646  3.862   47.291  1.00 74.52  ? 42  GLY B CA    1 
ATOM   1789 C C     . GLY B 1 56  ? 28.852  2.623   46.445  1.00 74.67  ? 42  GLY B C     1 
ATOM   1790 O O     . GLY B 1 56  ? 29.166  2.725   45.260  1.00 76.26  ? 42  GLY B O     1 
ATOM   1791 N N     . VAL B 1 57  ? 28.677  1.446   47.040  1.00 71.82  ? 43  VAL B N     1 
ATOM   1792 C CA    . VAL B 1 57  ? 28.849  0.210   46.285  1.00 69.91  ? 43  VAL B CA    1 
ATOM   1793 C C     . VAL B 1 57  ? 27.524  -0.345  45.769  1.00 69.29  ? 43  VAL B C     1 
ATOM   1794 O O     . VAL B 1 57  ? 26.505  0.348   45.741  1.00 68.11  ? 43  VAL B O     1 
ATOM   1795 C CB    . VAL B 1 57  ? 29.528  -0.880  47.125  1.00 71.06  ? 43  VAL B CB    1 
ATOM   1796 C CG1   . VAL B 1 57  ? 30.784  -0.323  47.779  1.00 71.39  ? 43  VAL B CG1   1 
ATOM   1797 C CG2   . VAL B 1 57  ? 28.554  -1.420  48.154  1.00 71.11  ? 43  VAL B CG2   1 
ATOM   1798 N N     . SER B 1 58  ? 27.549  -1.608  45.360  1.00 68.24  ? 44  SER B N     1 
ATOM   1799 C CA    . SER B 1 58  ? 26.362  -2.252  44.836  1.00 66.84  ? 44  SER B CA    1 
ATOM   1800 C C     . SER B 1 58  ? 25.809  -3.217  45.868  1.00 67.96  ? 44  SER B C     1 
ATOM   1801 O O     . SER B 1 58  ? 26.478  -3.538  46.856  1.00 66.81  ? 44  SER B O     1 
ATOM   1802 C CB    . SER B 1 58  ? 26.711  -3.018  43.561  1.00 66.86  ? 44  SER B CB    1 
ATOM   1803 O OG    . SER B 1 58  ? 27.599  -4.081  43.856  1.00 60.87  ? 44  SER B OG    1 
ATOM   1804 N N     . GLU B 1 59  ? 24.585  -3.677  45.633  1.00 65.56  ? 45  GLU B N     1 
ATOM   1805 C CA    . GLU B 1 59  ? 23.956  -4.617  46.536  1.00 66.88  ? 45  GLU B CA    1 
ATOM   1806 C C     . GLU B 1 59  ? 24.802  -5.892  46.584  1.00 69.78  ? 45  GLU B C     1 
ATOM   1807 O O     . GLU B 1 59  ? 24.726  -6.668  47.541  1.00 71.42  ? 45  GLU B O     1 
ATOM   1808 C CB    . GLU B 1 59  ? 22.545  -4.972  46.059  1.00 63.84  ? 45  GLU B CB    1 
ATOM   1809 C CG    . GLU B 1 59  ? 21.491  -3.871  46.140  1.00 61.06  ? 45  GLU B CG    1 
ATOM   1810 C CD    . GLU B 1 59  ? 20.090  -4.464  46.120  1.00 63.27  ? 45  GLU B CD    1 
ATOM   1811 O OE1   . GLU B 1 59  ? 19.088  -3.747  45.909  1.00 64.03  ? 45  GLU B OE1   1 
ATOM   1812 O OE2   . GLU B 1 59  ? 19.999  -5.686  46.331  1.00 67.25  ? 45  GLU B OE2   1 
ATOM   1813 N N     . ALA B 1 60  ? 25.609  -6.104  45.548  1.00 68.92  ? 46  ALA B N     1 
ATOM   1814 C CA    . ALA B 1 60  ? 26.455  -7.293  45.467  1.00 67.69  ? 46  ALA B CA    1 
ATOM   1815 C C     . ALA B 1 60  ? 27.624  -7.199  46.443  1.00 64.59  ? 46  ALA B C     1 
ATOM   1816 O O     . ALA B 1 60  ? 27.983  -8.172  47.110  1.00 61.14  ? 46  ALA B O     1 
ATOM   1817 C CB    . ALA B 1 60  ? 26.973  -7.456  44.042  1.00 68.00  ? 46  ALA B CB    1 
ATOM   1818 N N     . ALA B 1 61  ? 28.212  -6.013  46.511  1.00 65.24  ? 47  ALA B N     1 
ATOM   1819 C CA    . ALA B 1 61  ? 29.344  -5.755  47.389  1.00 65.07  ? 47  ALA B CA    1 
ATOM   1820 C C     . ALA B 1 61  ? 28.874  -5.818  48.835  1.00 65.71  ? 47  ALA B C     1 
ATOM   1821 O O     . ALA B 1 61  ? 29.584  -6.289  49.729  1.00 68.33  ? 47  ALA B O     1 
ATOM   1822 C CB    . ALA B 1 61  ? 29.914  -4.379  47.087  1.00 64.78  ? 47  ALA B CB    1 
ATOM   1823 N N     . LEU B 1 62  ? 27.655  -5.338  49.040  1.00 63.54  ? 48  LEU B N     1 
ATOM   1824 C CA    . LEU B 1 62  ? 27.028  -5.299  50.349  1.00 58.24  ? 48  LEU B CA    1 
ATOM   1825 C C     . LEU B 1 62  ? 27.049  -6.662  50.997  1.00 55.47  ? 48  LEU B C     1 
ATOM   1826 O O     . LEU B 1 62  ? 27.477  -6.807  52.141  1.00 53.36  ? 48  LEU B O     1 
ATOM   1827 C CB    . LEU B 1 62  ? 25.580  -4.831  50.204  1.00 54.61  ? 48  LEU B CB    1 
ATOM   1828 C CG    . LEU B 1 62  ? 25.089  -3.752  51.156  1.00 52.21  ? 48  LEU B CG    1 
ATOM   1829 C CD1   . LEU B 1 62  ? 26.092  -2.601  51.195  1.00 51.35  ? 48  LEU B CD1   1 
ATOM   1830 C CD2   . LEU B 1 62  ? 23.717  -3.267  50.687  1.00 51.63  ? 48  LEU B CD2   1 
ATOM   1831 N N     . TYR B 1 63  ? 26.593  -7.663  50.253  1.00 54.16  ? 49  TYR B N     1 
ATOM   1832 C CA    . TYR B 1 63  ? 26.524  -9.012  50.788  1.00 58.86  ? 49  TYR B CA    1 
ATOM   1833 C C     . TYR B 1 63  ? 27.831  -9.762  50.908  1.00 62.49  ? 49  TYR B C     1 
ATOM   1834 O O     . TYR B 1 63  ? 27.831  -10.951 51.217  1.00 62.45  ? 49  TYR B O     1 
ATOM   1835 C CB    . TYR B 1 63  ? 25.504  -9.840  50.007  1.00 57.46  ? 49  TYR B CB    1 
ATOM   1836 C CG    . TYR B 1 63  ? 24.072  -9.513  50.392  1.00 58.33  ? 49  TYR B CG    1 
ATOM   1837 C CD1   . TYR B 1 63  ? 23.365  -10.312 51.297  1.00 54.95  ? 49  TYR B CD1   1 
ATOM   1838 C CD2   . TYR B 1 63  ? 23.439  -8.379  49.884  1.00 57.69  ? 49  TYR B CD2   1 
ATOM   1839 C CE1   . TYR B 1 63  ? 22.055  -9.988  51.687  1.00 60.15  ? 49  TYR B CE1   1 
ATOM   1840 C CE2   . TYR B 1 63  ? 22.132  -8.041  50.270  1.00 61.84  ? 49  TYR B CE2   1 
ATOM   1841 C CZ    . TYR B 1 63  ? 21.445  -8.848  51.169  1.00 61.48  ? 49  TYR B CZ    1 
ATOM   1842 O OH    . TYR B 1 63  ? 20.156  -8.514  51.545  1.00 59.60  ? 49  TYR B OH    1 
ATOM   1843 N N     . ARG B 1 64  ? 28.954  -9.094  50.669  1.00 65.37  ? 50  ARG B N     1 
ATOM   1844 C CA    . ARG B 1 64  ? 30.208  -9.801  50.846  1.00 70.06  ? 50  ARG B CA    1 
ATOM   1845 C C     . ARG B 1 64  ? 30.742  -9.433  52.232  1.00 71.84  ? 50  ARG B C     1 
ATOM   1846 O O     . ARG B 1 64  ? 31.787  -9.929  52.671  1.00 72.89  ? 50  ARG B O     1 
ATOM   1847 C CB    . ARG B 1 64  ? 31.215  -9.458  49.741  1.00 72.64  ? 50  ARG B CB    1 
ATOM   1848 C CG    . ARG B 1 64  ? 32.000  -8.168  49.905  1.00 77.54  ? 50  ARG B CG    1 
ATOM   1849 C CD    . ARG B 1 64  ? 33.222  -8.200  48.977  1.00 81.71  ? 50  ARG B CD    1 
ATOM   1850 N NE    . ARG B 1 64  ? 32.830  -8.445  47.591  1.00 79.37  ? 50  ARG B NE    1 
ATOM   1851 C CZ    . ARG B 1 64  ? 32.474  -7.492  46.737  1.00 79.10  ? 50  ARG B CZ    1 
ATOM   1852 N NH1   . ARG B 1 64  ? 32.474  -6.220  47.120  1.00 75.78  ? 50  ARG B NH1   1 
ATOM   1853 N NH2   . ARG B 1 64  ? 32.083  -7.814  45.511  1.00 79.66  ? 50  ARG B NH2   1 
ATOM   1854 N N     . HIS B 1 65  ? 29.994  -8.571  52.922  1.00 68.99  ? 51  HIS B N     1 
ATOM   1855 C CA    . HIS B 1 65  ? 30.348  -8.132  54.264  1.00 66.48  ? 51  HIS B CA    1 
ATOM   1856 C C     . HIS B 1 65  ? 29.305  -8.568  55.282  1.00 63.09  ? 51  HIS B C     1 
ATOM   1857 O O     . HIS B 1 65  ? 29.567  -8.562  56.483  1.00 62.97  ? 51  HIS B O     1 
ATOM   1858 C CB    . HIS B 1 65  ? 30.484  -6.616  54.306  1.00 68.47  ? 51  HIS B CB    1 
ATOM   1859 C CG    . HIS B 1 65  ? 31.634  -6.095  53.507  1.00 74.51  ? 51  HIS B CG    1 
ATOM   1860 N ND1   . HIS B 1 65  ? 31.688  -6.188  52.132  1.00 74.63  ? 51  HIS B ND1   1 
ATOM   1861 C CD2   . HIS B 1 65  ? 32.771  -5.465  53.888  1.00 74.48  ? 51  HIS B CD2   1 
ATOM   1862 C CE1   . HIS B 1 65  ? 32.808  -5.634  51.702  1.00 77.82  ? 51  HIS B CE1   1 
ATOM   1863 N NE2   . HIS B 1 65  ? 33.483  -5.187  52.747  1.00 76.60  ? 51  HIS B NE2   1 
ATOM   1864 N N     . PHE B 1 66  ? 28.124  -8.935  54.789  1.00 57.40  ? 52  PHE B N     1 
ATOM   1865 C CA    . PHE B 1 66  ? 27.021  -9.374  55.634  1.00 51.98  ? 52  PHE B CA    1 
ATOM   1866 C C     . PHE B 1 66  ? 26.188  -10.406 54.896  1.00 51.59  ? 52  PHE B C     1 
ATOM   1867 O O     . PHE B 1 66  ? 25.826  -10.197 53.745  1.00 55.90  ? 52  PHE B O     1 
ATOM   1868 C CB    . PHE B 1 66  ? 26.121  -8.190  55.977  1.00 50.02  ? 52  PHE B CB    1 
ATOM   1869 C CG    . PHE B 1 66  ? 26.784  -7.147  56.809  1.00 42.33  ? 52  PHE B CG    1 
ATOM   1870 C CD1   . PHE B 1 66  ? 26.901  -7.315  58.183  1.00 41.99  ? 52  PHE B CD1   1 
ATOM   1871 C CD2   . PHE B 1 66  ? 27.308  -6.003  56.221  1.00 47.48  ? 52  PHE B CD2   1 
ATOM   1872 C CE1   . PHE B 1 66  ? 27.527  -6.354  58.965  1.00 45.92  ? 52  PHE B CE1   1 
ATOM   1873 C CE2   . PHE B 1 66  ? 27.942  -5.024  56.991  1.00 43.42  ? 52  PHE B CE2   1 
ATOM   1874 C CZ    . PHE B 1 66  ? 28.054  -5.201  58.369  1.00 46.20  ? 52  PHE B CZ    1 
ATOM   1875 N N     . PRO B 1 67  ? 25.869  -11.532 55.553  1.00 49.20  ? 53  PRO B N     1 
ATOM   1876 C CA    . PRO B 1 67  ? 25.062  -12.617 54.972  1.00 49.03  ? 53  PRO B CA    1 
ATOM   1877 C C     . PRO B 1 67  ? 23.637  -12.142 54.680  1.00 52.77  ? 53  PRO B C     1 
ATOM   1878 O O     . PRO B 1 67  ? 22.971  -12.628 53.755  1.00 52.98  ? 53  PRO B O     1 
ATOM   1879 C CB    . PRO B 1 67  ? 25.044  -13.679 56.076  1.00 45.93  ? 53  PRO B CB    1 
ATOM   1880 C CG    . PRO B 1 67  ? 26.278  -13.388 56.871  1.00 51.80  ? 53  PRO B CG    1 
ATOM   1881 C CD    . PRO B 1 67  ? 26.304  -11.878 56.915  1.00 47.75  ? 53  PRO B CD    1 
ATOM   1882 N N     . SER B 1 68  ? 23.173  -11.200 55.501  1.00 53.64  ? 54  SER B N     1 
ATOM   1883 C CA    . SER B 1 68  ? 21.829  -10.663 55.382  1.00 49.69  ? 54  SER B CA    1 
ATOM   1884 C C     . SER B 1 68  ? 21.719  -9.274  55.973  1.00 47.75  ? 54  SER B C     1 
ATOM   1885 O O     . SER B 1 68  ? 22.692  -8.708  56.482  1.00 51.26  ? 54  SER B O     1 
ATOM   1886 C CB    . SER B 1 68  ? 20.845  -11.571 56.107  1.00 46.69  ? 54  SER B CB    1 
ATOM   1887 O OG    . SER B 1 68  ? 21.154  -11.600 57.484  1.00 54.94  ? 54  SER B OG    1 
ATOM   1888 N N     . LYS B 1 69  ? 20.512  -8.729  55.906  1.00 43.86  ? 55  LYS B N     1 
ATOM   1889 C CA    . LYS B 1 69  ? 20.257  -7.415  56.455  1.00 38.66  ? 55  LYS B CA    1 
ATOM   1890 C C     . LYS B 1 69  ? 20.170  -7.535  57.975  1.00 34.11  ? 55  LYS B C     1 
ATOM   1891 O O     . LYS B 1 69  ? 20.578  -6.630  58.704  1.00 32.88  ? 55  LYS B O     1 
ATOM   1892 C CB    . LYS B 1 69  ? 18.957  -6.850  55.881  1.00 40.05  ? 55  LYS B CB    1 
ATOM   1893 C CG    . LYS B 1 69  ? 19.150  -5.462  55.343  1.00 44.32  ? 55  LYS B CG    1 
ATOM   1894 C CD    . LYS B 1 69  ? 17.942  -4.583  55.575  1.00 44.53  ? 55  LYS B CD    1 
ATOM   1895 C CE    . LYS B 1 69  ? 16.785  -5.039  54.751  1.00 39.07  ? 55  LYS B CE    1 
ATOM   1896 N NZ    . LYS B 1 69  ? 15.764  -3.980  54.806  1.00 39.24  ? 55  LYS B NZ    1 
ATOM   1897 N N     . THR B 1 70  ? 19.633  -8.663  58.437  1.00 30.30  ? 56  THR B N     1 
ATOM   1898 C CA    . THR B 1 70  ? 19.505  -8.958  59.856  1.00 39.98  ? 56  THR B CA    1 
ATOM   1899 C C     . THR B 1 70  ? 20.861  -8.828  60.532  1.00 42.77  ? 56  THR B C     1 
ATOM   1900 O O     . THR B 1 70  ? 20.963  -8.327  61.655  1.00 42.71  ? 56  THR B O     1 
ATOM   1901 C CB    . THR B 1 70  ? 19.073  -10.387 60.072  1.00 39.72  ? 56  THR B CB    1 
ATOM   1902 O OG1   . THR B 1 70  ? 18.184  -10.756 59.020  1.00 45.38  ? 56  THR B OG1   1 
ATOM   1903 C CG2   . THR B 1 70  ? 18.387  -10.540 61.423  1.00 40.49  ? 56  THR B CG2   1 
ATOM   1904 N N     . ARG B 1 71  ? 21.892  -9.310  59.844  1.00 38.30  ? 57  ARG B N     1 
ATOM   1905 C CA    . ARG B 1 71  ? 23.245  -9.261  60.371  1.00 42.36  ? 57  ARG B CA    1 
ATOM   1906 C C     . ARG B 1 71  ? 23.671  -7.842  60.645  1.00 38.99  ? 57  ARG B C     1 
ATOM   1907 O O     . ARG B 1 71  ? 24.389  -7.579  61.609  1.00 35.41  ? 57  ARG B O     1 
ATOM   1908 C CB    . ARG B 1 71  ? 24.237  -9.904  59.398  1.00 46.26  ? 57  ARG B CB    1 
ATOM   1909 C CG    . ARG B 1 71  ? 24.634  -11.292 59.806  1.00 48.88  ? 57  ARG B CG    1 
ATOM   1910 C CD    . ARG B 1 71  ? 25.377  -11.228 61.123  1.00 57.48  ? 57  ARG B CD    1 
ATOM   1911 N NE    . ARG B 1 71  ? 25.008  -12.324 62.011  1.00 65.94  ? 57  ARG B NE    1 
ATOM   1912 C CZ    . ARG B 1 71  ? 23.755  -12.649 62.330  1.00 70.90  ? 57  ARG B CZ    1 
ATOM   1913 N NH1   . ARG B 1 71  ? 22.730  -11.966 61.828  1.00 70.81  ? 57  ARG B NH1   1 
ATOM   1914 N NH2   . ARG B 1 71  ? 23.526  -13.655 63.166  1.00 70.92  ? 57  ARG B NH2   1 
ATOM   1915 N N     . MET B 1 72  ? 23.243  -6.927  59.786  1.00 38.86  ? 58  MET B N     1 
ATOM   1916 C CA    . MET B 1 72  ? 23.599  -5.534  59.982  1.00 37.01  ? 58  MET B CA    1 
ATOM   1917 C C     . MET B 1 72  ? 22.925  -5.050  61.262  1.00 37.58  ? 58  MET B C     1 
ATOM   1918 O O     . MET B 1 72  ? 23.583  -4.459  62.106  1.00 38.83  ? 58  MET B O     1 
ATOM   1919 C CB    . MET B 1 72  ? 23.146  -4.711  58.796  1.00 35.78  ? 58  MET B CB    1 
ATOM   1920 C CG    . MET B 1 72  ? 23.833  -5.123  57.526  1.00 41.58  ? 58  MET B CG    1 
ATOM   1921 S SD    . MET B 1 72  ? 23.201  -4.237  56.091  1.00 46.66  ? 58  MET B SD    1 
ATOM   1922 C CE    . MET B 1 72  ? 22.479  -5.603  55.256  1.00 53.07  ? 58  MET B CE    1 
ATOM   1923 N N     . PHE B 1 73  ? 21.628  -5.324  61.422  1.00 34.04  ? 59  PHE B N     1 
ATOM   1924 C CA    . PHE B 1 73  ? 20.923  -4.906  62.631  1.00 38.53  ? 59  PHE B CA    1 
ATOM   1925 C C     . PHE B 1 73  ? 21.491  -5.585  63.886  1.00 37.74  ? 59  PHE B C     1 
ATOM   1926 O O     . PHE B 1 73  ? 21.538  -4.974  64.950  1.00 40.16  ? 59  PHE B O     1 
ATOM   1927 C CB    . PHE B 1 73  ? 19.406  -5.163  62.495  1.00 33.30  ? 59  PHE B CB    1 
ATOM   1928 C CG    . PHE B 1 73  ? 18.693  -4.117  61.660  1.00 36.52  ? 59  PHE B CG    1 
ATOM   1929 C CD1   . PHE B 1 73  ? 18.301  -2.897  62.226  1.00 33.70  ? 59  PHE B CD1   1 
ATOM   1930 C CD2   . PHE B 1 73  ? 18.489  -4.315  60.292  1.00 35.94  ? 59  PHE B CD2   1 
ATOM   1931 C CE1   . PHE B 1 73  ? 17.727  -1.893  61.447  1.00 32.09  ? 59  PHE B CE1   1 
ATOM   1932 C CE2   . PHE B 1 73  ? 17.915  -3.311  59.496  1.00 33.79  ? 59  PHE B CE2   1 
ATOM   1933 C CZ    . PHE B 1 73  ? 17.534  -2.098  60.074  1.00 31.88  ? 59  PHE B CZ    1 
ATOM   1934 N N     . ASP B 1 74  ? 21.909  -6.844  63.765  1.00 41.35  ? 60  ASP B N     1 
ATOM   1935 C CA    . ASP B 1 74  ? 22.505  -7.555  64.892  1.00 39.38  ? 60  ASP B CA    1 
ATOM   1936 C C     . ASP B 1 74  ? 23.747  -6.759  65.306  1.00 41.90  ? 60  ASP B C     1 
ATOM   1937 O O     . ASP B 1 74  ? 23.995  -6.563  66.506  1.00 40.32  ? 60  ASP B O     1 
ATOM   1938 C CB    . ASP B 1 74  ? 22.941  -8.967  64.496  1.00 43.55  ? 60  ASP B CB    1 
ATOM   1939 C CG    . ASP B 1 74  ? 21.892  -10.026 64.810  1.00 53.52  ? 60  ASP B CG    1 
ATOM   1940 O OD1   . ASP B 1 74  ? 21.366  -10.027 65.947  1.00 53.15  ? 60  ASP B OD1   1 
ATOM   1941 O OD2   . ASP B 1 74  ? 21.607  -10.878 63.933  1.00 56.59  ? 60  ASP B OD2   1 
ATOM   1942 N N     . SER B 1 75  ? 24.511  -6.286  64.316  1.00 36.27  ? 61  SER B N     1 
ATOM   1943 C CA    . SER B 1 75  ? 25.721  -5.516  64.598  1.00 36.79  ? 61  SER B CA    1 
ATOM   1944 C C     . SER B 1 75  ? 25.365  -4.212  65.254  1.00 37.79  ? 61  SER B C     1 
ATOM   1945 O O     . SER B 1 75  ? 26.048  -3.775  66.175  1.00 39.30  ? 61  SER B O     1 
ATOM   1946 C CB    . SER B 1 75  ? 26.523  -5.224  63.325  1.00 37.13  ? 61  SER B CB    1 
ATOM   1947 O OG    . SER B 1 75  ? 27.020  -6.415  62.738  1.00 42.90  ? 61  SER B OG    1 
ATOM   1948 N N     . LEU B 1 76  ? 24.292  -3.583  64.788  1.00 35.48  ? 62  LEU B N     1 
ATOM   1949 C CA    . LEU B 1 76  ? 23.872  -2.309  65.365  1.00 32.28  ? 62  LEU B CA    1 
ATOM   1950 C C     . LEU B 1 76  ? 23.421  -2.453  66.818  1.00 32.38  ? 62  LEU B C     1 
ATOM   1951 O O     . LEU B 1 76  ? 23.728  -1.604  67.671  1.00 30.22  ? 62  LEU B O     1 
ATOM   1952 C CB    . LEU B 1 76  ? 22.760  -1.725  64.515  1.00 38.91  ? 62  LEU B CB    1 
ATOM   1953 C CG    . LEU B 1 76  ? 23.198  -0.499  63.705  1.00 41.16  ? 62  LEU B CG    1 
ATOM   1954 C CD1   . LEU B 1 76  ? 24.599  -0.661  63.177  1.00 39.53  ? 62  LEU B CD1   1 
ATOM   1955 C CD2   . LEU B 1 76  ? 22.213  -0.279  62.575  1.00 37.08  ? 62  LEU B CD2   1 
ATOM   1956 N N     . ILE B 1 77  ? 22.704  -3.540  67.081  1.00 25.06  ? 63  ILE B N     1 
ATOM   1957 C CA    . ILE B 1 77  ? 22.201  -3.866  68.396  1.00 30.83  ? 63  ILE B CA    1 
ATOM   1958 C C     . ILE B 1 77  ? 23.373  -4.130  69.348  1.00 34.80  ? 63  ILE B C     1 
ATOM   1959 O O     . ILE B 1 77  ? 23.412  -3.609  70.479  1.00 34.91  ? 63  ILE B O     1 
ATOM   1960 C CB    . ILE B 1 77  ? 21.259  -5.096  68.300  1.00 28.83  ? 63  ILE B CB    1 
ATOM   1961 C CG1   . ILE B 1 77  ? 19.932  -4.675  67.634  1.00 29.13  ? 63  ILE B CG1   1 
ATOM   1962 C CG2   . ILE B 1 77  ? 21.012  -5.695  69.667  1.00 28.59  ? 63  ILE B CG2   1 
ATOM   1963 C CD1   . ILE B 1 77  ? 18.999  -5.855  67.239  1.00 24.49  ? 63  ILE B CD1   1 
ATOM   1964 N N     . GLU B 1 78  ? 24.334  -4.927  68.895  1.00 37.65  ? 64  GLU B N     1 
ATOM   1965 C CA    . GLU B 1 78  ? 25.504  -5.204  69.716  1.00 37.79  ? 64  GLU B CA    1 
ATOM   1966 C C     . GLU B 1 78  ? 26.198  -3.870  70.034  1.00 34.14  ? 64  GLU B C     1 
ATOM   1967 O O     . GLU B 1 78  ? 26.700  -3.655  71.159  1.00 31.21  ? 64  GLU B O     1 
ATOM   1968 C CB    . GLU B 1 78  ? 26.446  -6.141  68.980  1.00 41.27  ? 64  GLU B CB    1 
ATOM   1969 C CG    . GLU B 1 78  ? 27.764  -6.318  69.672  1.00 57.56  ? 64  GLU B CG    1 
ATOM   1970 C CD    . GLU B 1 78  ? 28.505  -7.546  69.185  1.00 68.64  ? 64  GLU B CD    1 
ATOM   1971 O OE1   . GLU B 1 78  ? 27.971  -8.670  69.372  1.00 70.38  ? 64  GLU B OE1   1 
ATOM   1972 O OE2   . GLU B 1 78  ? 29.614  -7.379  68.619  1.00 67.74  ? 64  GLU B OE2   1 
ATOM   1973 N N     . PHE B 1 79  ? 26.230  -2.960  69.062  1.00 29.43  ? 65  PHE B N     1 
ATOM   1974 C CA    . PHE B 1 79  ? 26.837  -1.656  69.344  1.00 29.28  ? 65  PHE B CA    1 
ATOM   1975 C C     . PHE B 1 79  ? 26.048  -0.954  70.466  1.00 29.36  ? 65  PHE B C     1 
ATOM   1976 O O     . PHE B 1 79  ? 26.648  -0.388  71.379  1.00 28.23  ? 65  PHE B O     1 
ATOM   1977 C CB    . PHE B 1 79  ? 26.857  -0.751  68.110  1.00 28.95  ? 65  PHE B CB    1 
ATOM   1978 C CG    . PHE B 1 79  ? 27.351  0.654   68.400  1.00 32.10  ? 65  PHE B CG    1 
ATOM   1979 C CD1   . PHE B 1 79  ? 28.709  0.907   68.616  1.00 32.39  ? 65  PHE B CD1   1 
ATOM   1980 C CD2   . PHE B 1 79  ? 26.462  1.720   68.449  1.00 29.84  ? 65  PHE B CD2   1 
ATOM   1981 C CE1   . PHE B 1 79  ? 29.172  2.207   68.877  1.00 28.17  ? 65  PHE B CE1   1 
ATOM   1982 C CE2   . PHE B 1 79  ? 26.904  3.022   68.707  1.00 27.60  ? 65  PHE B CE2   1 
ATOM   1983 C CZ    . PHE B 1 79  ? 28.270  3.267   68.919  1.00 33.78  ? 65  PHE B CZ    1 
ATOM   1984 N N     . ILE B 1 80  ? 24.710  -0.991  70.388  1.00 30.22  ? 66  ILE B N     1 
ATOM   1985 C CA    . ILE B 1 80  ? 23.860  -0.357  71.406  1.00 30.48  ? 66  ILE B CA    1 
ATOM   1986 C C     . ILE B 1 80  ? 24.117  -0.932  72.785  1.00 29.59  ? 66  ILE B C     1 
ATOM   1987 O O     . ILE B 1 80  ? 24.256  -0.200  73.756  1.00 24.98  ? 66  ILE B O     1 
ATOM   1988 C CB    . ILE B 1 80  ? 22.347  -0.556  71.154  1.00 28.06  ? 66  ILE B CB    1 
ATOM   1989 C CG1   . ILE B 1 80  ? 21.989  -0.146  69.724  1.00 30.15  ? 66  ILE B CG1   1 
ATOM   1990 C CG2   . ILE B 1 80  ? 21.539  0.233   72.216  1.00 24.26  ? 66  ILE B CG2   1 
ATOM   1991 C CD1   . ILE B 1 80  ? 20.505  0.139   69.504  1.00 39.06  ? 66  ILE B CD1   1 
ATOM   1992 N N     . GLU B 1 81  ? 24.152  -2.253  72.872  1.00 26.22  ? 67  GLU B N     1 
ATOM   1993 C CA    . GLU B 1 81  ? 24.383  -2.893  74.145  1.00 32.34  ? 67  GLU B CA    1 
ATOM   1994 C C     . GLU B 1 81  ? 25.748  -2.566  74.778  1.00 31.89  ? 67  GLU B C     1 
ATOM   1995 O O     . GLU B 1 81  ? 25.829  -2.288  75.970  1.00 30.97  ? 67  GLU B O     1 
ATOM   1996 C CB    . GLU B 1 81  ? 24.245  -4.401  73.986  1.00 36.25  ? 67  GLU B CB    1 
ATOM   1997 C CG    . GLU B 1 81  ? 24.436  -5.132  75.298  1.00 48.11  ? 67  GLU B CG    1 
ATOM   1998 C CD    . GLU B 1 81  ? 23.821  -6.503  75.264  1.00 57.28  ? 67  GLU B CD    1 
ATOM   1999 O OE1   . GLU B 1 81  ? 23.055  -6.769  74.303  1.00 70.00  ? 67  GLU B OE1   1 
ATOM   2000 O OE2   . GLU B 1 81  ? 24.091  -7.305  76.190  1.00 59.03  ? 67  GLU B OE2   1 
ATOM   2001 N N     . ASP B 1 82  ? 26.813  -2.608  73.988  1.00 34.51  ? 68  ASP B N     1 
ATOM   2002 C CA    . ASP B 1 82  ? 28.134  -2.312  74.523  1.00 35.76  ? 68  ASP B CA    1 
ATOM   2003 C C     . ASP B 1 82  ? 28.220  -0.875  74.988  1.00 35.97  ? 68  ASP B C     1 
ATOM   2004 O O     . ASP B 1 82  ? 28.763  -0.594  76.060  1.00 35.40  ? 68  ASP B O     1 
ATOM   2005 C CB    . ASP B 1 82  ? 29.225  -2.543  73.479  1.00 39.53  ? 68  ASP B CB    1 
ATOM   2006 C CG    . ASP B 1 82  ? 29.306  -3.976  73.041  1.00 53.32  ? 68  ASP B CG    1 
ATOM   2007 O OD1   . ASP B 1 82  ? 28.961  -4.855  73.859  1.00 60.96  ? 68  ASP B OD1   1 
ATOM   2008 O OD2   . ASP B 1 82  ? 29.724  -4.226  71.888  1.00 60.25  ? 68  ASP B OD2   1 
ATOM   2009 N N     . SER B 1 83  ? 27.679  0.039   74.191  1.00 30.84  ? 69  SER B N     1 
ATOM   2010 C CA    . SER B 1 83  ? 27.754  1.443   74.561  1.00 33.07  ? 69  SER B CA    1 
ATOM   2011 C C     . SER B 1 83  ? 27.090  1.630   75.899  1.00 32.02  ? 69  SER B C     1 
ATOM   2012 O O     . SER B 1 83  ? 27.680  2.216   76.805  1.00 34.05  ? 69  SER B O     1 
ATOM   2013 C CB    . SER B 1 83  ? 27.062  2.320   73.538  1.00 24.33  ? 69  SER B CB    1 
ATOM   2014 O OG    . SER B 1 83  ? 27.381  1.882   72.231  1.00 34.52  ? 69  SER B OG    1 
ATOM   2015 N N     . LEU B 1 84  ? 25.876  1.096   76.035  1.00 33.01  ? 70  LEU B N     1 
ATOM   2016 C CA    . LEU B 1 84  ? 25.117  1.244   77.271  1.00 27.24  ? 70  LEU B CA    1 
ATOM   2017 C C     . LEU B 1 84  ? 25.646  0.472   78.478  1.00 28.35  ? 70  LEU B C     1 
ATOM   2018 O O     . LEU B 1 84  ? 25.808  1.055   79.554  1.00 27.27  ? 70  LEU B O     1 
ATOM   2019 C CB    . LEU B 1 84  ? 23.636  0.894   77.047  1.00 28.85  ? 70  LEU B CB    1 
ATOM   2020 C CG    . LEU B 1 84  ? 22.666  1.907   76.400  1.00 31.20  ? 70  LEU B CG    1 
ATOM   2021 C CD1   . LEU B 1 84  ? 22.940  3.274   76.947  1.00 32.93  ? 70  LEU B CD1   1 
ATOM   2022 C CD2   . LEU B 1 84  ? 22.842  1.965   74.928  1.00 43.88  ? 70  LEU B CD2   1 
ATOM   2023 N N     . ILE B 1 85  ? 25.896  -0.829  78.323  1.00 25.91  ? 71  ILE B N     1 
ATOM   2024 C CA    . ILE B 1 85  ? 26.389  -1.633  79.442  1.00 26.52  ? 71  ILE B CA    1 
ATOM   2025 C C     . ILE B 1 85  ? 27.766  -1.147  79.896  1.00 31.14  ? 71  ILE B C     1 
ATOM   2026 O O     . ILE B 1 85  ? 28.037  -1.021  81.100  1.00 27.77  ? 71  ILE B O     1 
ATOM   2027 C CB    . ILE B 1 85  ? 26.488  -3.124  79.059  1.00 32.45  ? 71  ILE B CB    1 
ATOM   2028 C CG1   . ILE B 1 85  ? 25.097  -3.672  78.692  1.00 27.51  ? 71  ILE B CG1   1 
ATOM   2029 C CG2   . ILE B 1 85  ? 27.130  -3.910  80.194  1.00 28.12  ? 71  ILE B CG2   1 
ATOM   2030 C CD1   . ILE B 1 85  ? 24.052  -3.599  79.812  1.00 32.83  ? 71  ILE B CD1   1 
ATOM   2031 N N     . THR B 1 86  ? 28.633  -0.855  78.934  1.00 31.35  ? 72  THR B N     1 
ATOM   2032 C CA    . THR B 1 86  ? 29.963  -0.361  79.270  1.00 32.79  ? 72  THR B CA    1 
ATOM   2033 C C     . THR B 1 86  ? 29.841  0.908   80.088  1.00 34.13  ? 72  THR B C     1 
ATOM   2034 O O     . THR B 1 86  ? 30.525  1.046   81.096  1.00 32.48  ? 72  THR B O     1 
ATOM   2035 C CB    . THR B 1 86  ? 30.790  -0.052  77.997  1.00 37.85  ? 72  THR B CB    1 
ATOM   2036 O OG1   . THR B 1 86  ? 31.160  -1.283  77.361  1.00 37.11  ? 72  THR B OG1   1 
ATOM   2037 C CG2   . THR B 1 86  ? 32.045  0.753   78.327  1.00 40.19  ? 72  THR B CG2   1 
ATOM   2038 N N     . ARG B 1 87  ? 28.965  1.830   79.682  1.00 30.98  ? 73  ARG B N     1 
ATOM   2039 C CA    . ARG B 1 87  ? 28.844  3.084   80.417  1.00 29.66  ? 73  ARG B CA    1 
ATOM   2040 C C     . ARG B 1 87  ? 28.163  2.925   81.760  1.00 32.07  ? 73  ARG B C     1 
ATOM   2041 O O     . ARG B 1 87  ? 28.401  3.710   82.673  1.00 33.45  ? 73  ARG B O     1 
ATOM   2042 C CB    . ARG B 1 87  ? 28.090  4.135   79.615  1.00 31.20  ? 73  ARG B CB    1 
ATOM   2043 C CG    . ARG B 1 87  ? 28.600  4.316   78.210  1.00 49.47  ? 73  ARG B CG    1 
ATOM   2044 C CD    . ARG B 1 87  ? 29.087  5.717   77.925  1.00 53.31  ? 73  ARG B CD    1 
ATOM   2045 N NE    . ARG B 1 87  ? 28.960  6.038   76.501  1.00 61.90  ? 73  ARG B NE    1 
ATOM   2046 C CZ    . ARG B 1 87  ? 29.522  5.344   75.506  1.00 68.82  ? 73  ARG B CZ    1 
ATOM   2047 N NH1   . ARG B 1 87  ? 30.263  4.273   75.756  1.00 72.45  ? 73  ARG B NH1   1 
ATOM   2048 N NH2   . ARG B 1 87  ? 29.340  5.713   74.244  1.00 71.28  ? 73  ARG B NH2   1 
ATOM   2049 N N     . ILE B 1 88  ? 27.300  1.931   81.895  1.00 28.12  ? 74  ILE B N     1 
ATOM   2050 C CA    . ILE B 1 88  ? 26.652  1.763   83.167  1.00 28.46  ? 74  ILE B CA    1 
ATOM   2051 C C     . ILE B 1 88  ? 27.675  1.252   84.173  1.00 28.84  ? 74  ILE B C     1 
ATOM   2052 O O     . ILE B 1 88  ? 27.657  1.642   85.348  1.00 27.79  ? 74  ILE B O     1 
ATOM   2053 C CB    . ILE B 1 88  ? 25.454  0.803   83.105  1.00 25.49  ? 74  ILE B CB    1 
ATOM   2054 C CG1   . ILE B 1 88  ? 24.335  1.425   82.248  1.00 33.45  ? 74  ILE B CG1   1 
ATOM   2055 C CG2   . ILE B 1 88  ? 24.946  0.537   84.534  1.00 24.01  ? 74  ILE B CG2   1 
ATOM   2056 C CD1   . ILE B 1 88  ? 23.170  0.479   81.898  1.00 31.33  ? 74  ILE B CD1   1 
ATOM   2057 N N     . ASN B 1 89  ? 28.570  0.383   83.721  1.00 32.27  ? 75  ASN B N     1 
ATOM   2058 C CA    . ASN B 1 89  ? 29.594  -0.133  84.613  1.00 33.70  ? 75  ASN B CA    1 
ATOM   2059 C C     . ASN B 1 89  ? 30.494  1.021   85.070  1.00 32.79  ? 75  ASN B C     1 
ATOM   2060 O O     . ASN B 1 89  ? 30.854  1.112   86.258  1.00 29.73  ? 75  ASN B O     1 
ATOM   2061 C CB    . ASN B 1 89  ? 30.397  -1.237  83.920  1.00 30.38  ? 75  ASN B CB    1 
ATOM   2062 C CG    . ASN B 1 89  ? 29.559  -2.478  83.652  1.00 34.39  ? 75  ASN B CG    1 
ATOM   2063 O OD1   . ASN B 1 89  ? 28.531  -2.694  84.299  1.00 36.22  ? 75  ASN B OD1   1 
ATOM   2064 N ND2   . ASN B 1 89  ? 30.000  -3.306  82.711  1.00 33.98  ? 75  ASN B ND2   1 
ATOM   2065 N N     . LEU B 1 90  ? 30.821  1.922   84.144  1.00 30.73  ? 76  LEU B N     1 
ATOM   2066 C CA    . LEU B 1 90  ? 31.651  3.066   84.506  1.00 28.28  ? 76  LEU B CA    1 
ATOM   2067 C C     . LEU B 1 90  ? 30.948  3.873   85.563  1.00 28.90  ? 76  LEU B C     1 
ATOM   2068 O O     . LEU B 1 90  ? 31.568  4.311   86.522  1.00 27.19  ? 76  LEU B O     1 
ATOM   2069 C CB    . LEU B 1 90  ? 31.947  3.948   83.299  1.00 26.05  ? 76  LEU B CB    1 
ATOM   2070 C CG    . LEU B 1 90  ? 33.043  3.336   82.447  1.00 33.83  ? 76  LEU B CG    1 
ATOM   2071 C CD1   . LEU B 1 90  ? 33.176  4.067   81.136  1.00 37.47  ? 76  LEU B CD1   1 
ATOM   2072 C CD2   . LEU B 1 90  ? 34.349  3.392   83.232  1.00 37.92  ? 76  LEU B CD2   1 
ATOM   2073 N N     . ILE B 1 91  ? 29.646  4.059   85.395  1.00 25.85  ? 77  ILE B N     1 
ATOM   2074 C CA    . ILE B 1 91  ? 28.873  4.814   86.365  1.00 26.36  ? 77  ILE B CA    1 
ATOM   2075 C C     . ILE B 1 91  ? 28.938  4.194   87.765  1.00 25.62  ? 77  ILE B C     1 
ATOM   2076 O O     . ILE B 1 91  ? 29.066  4.907   88.742  1.00 26.84  ? 77  ILE B O     1 
ATOM   2077 C CB    . ILE B 1 91  ? 27.373  4.891   85.930  1.00 30.11  ? 77  ILE B CB    1 
ATOM   2078 C CG1   . ILE B 1 91  ? 27.202  5.888   84.776  1.00 25.10  ? 77  ILE B CG1   1 
ATOM   2079 C CG2   . ILE B 1 91  ? 26.489  5.196   87.153  1.00 15.91  ? 77  ILE B CG2   1 
ATOM   2080 C CD1   . ILE B 1 91  ? 25.832  5.760   84.044  1.00 21.62  ? 77  ILE B CD1   1 
ATOM   2081 N N     . LEU B 1 92  ? 28.837  2.867   87.850  1.00 23.27  ? 78  LEU B N     1 
ATOM   2082 C CA    . LEU B 1 92  ? 28.846  2.170   89.131  1.00 27.45  ? 78  LEU B CA    1 
ATOM   2083 C C     . LEU B 1 92  ? 30.189  2.266   89.856  1.00 30.44  ? 78  LEU B C     1 
ATOM   2084 O O     . LEU B 1 92  ? 30.286  2.189   91.092  1.00 29.68  ? 78  LEU B O     1 
ATOM   2085 C CB    . LEU B 1 92  ? 28.480  0.696   88.912  1.00 26.74  ? 78  LEU B CB    1 
ATOM   2086 C CG    . LEU B 1 92  ? 27.084  0.473   88.315  1.00 29.92  ? 78  LEU B CG    1 
ATOM   2087 C CD1   . LEU B 1 92  ? 26.886  -1.017  88.007  1.00 29.94  ? 78  LEU B CD1   1 
ATOM   2088 C CD2   . LEU B 1 92  ? 26.015  0.981   89.287  1.00 23.27  ? 78  LEU B CD2   1 
ATOM   2089 N N     . LYS B 1 93  ? 31.240  2.420   89.078  1.00 32.39  ? 79  LYS B N     1 
ATOM   2090 C CA    . LYS B 1 93  ? 32.553  2.514   89.659  1.00 35.06  ? 79  LYS B CA    1 
ATOM   2091 C C     . LYS B 1 93  ? 32.935  3.951   89.997  1.00 37.10  ? 79  LYS B C     1 
ATOM   2092 O O     . LYS B 1 93  ? 33.800  4.176   90.812  1.00 43.57  ? 79  LYS B O     1 
ATOM   2093 C CB    . LYS B 1 93  ? 33.576  1.939   88.669  1.00 36.13  ? 79  LYS B CB    1 
ATOM   2094 C CG    . LYS B 1 93  ? 33.619  0.415   88.603  1.00 35.62  ? 79  LYS B CG    1 
ATOM   2095 C CD    . LYS B 1 93  ? 34.754  -0.063  87.719  1.00 42.56  ? 79  LYS B CD    1 
ATOM   2096 C CE    . LYS B 1 93  ? 34.592  -1.535  87.368  1.00 47.76  ? 79  LYS B CE    1 
ATOM   2097 N NZ    . LYS B 1 93  ? 34.711  -2.424  88.554  1.00 61.72  ? 79  LYS B NZ    1 
ATOM   2098 N N     . ASP B 1 94  ? 32.216  4.890   89.406  1.00 33.05  ? 80  ASP B N     1 
ATOM   2099 C CA    . ASP B 1 94  ? 32.503  6.315   89.496  1.00 36.55  ? 80  ASP B CA    1 
ATOM   2100 C C     . ASP B 1 94  ? 31.589  6.969   90.538  1.00 35.66  ? 80  ASP B C     1 
ATOM   2101 O O     . ASP B 1 94  ? 31.928  7.978   91.163  1.00 35.97  ? 80  ASP B O     1 
ATOM   2102 C CB    . ASP B 1 94  ? 32.232  6.879   88.069  1.00 48.76  ? 80  ASP B CB    1 
ATOM   2103 C CG    . ASP B 1 94  ? 33.161  8.032   87.636  1.00 64.08  ? 80  ASP B CG    1 
ATOM   2104 O OD1   . ASP B 1 94  ? 33.364  9.058   88.340  1.00 69.68  ? 80  ASP B OD1   1 
ATOM   2105 O OD2   . ASP B 1 94  ? 33.726  7.880   86.531  1.00 72.90  ? 80  ASP B OD2   1 
ATOM   2106 N N     . GLU B 1 95  ? 30.407  6.394   90.739  1.00 33.35  ? 81  GLU B N     1 
ATOM   2107 C CA    . GLU B 1 95  ? 29.433  6.976   91.680  1.00 28.05  ? 81  GLU B CA    1 
ATOM   2108 C C     . GLU B 1 95  ? 28.970  5.984   92.726  1.00 29.36  ? 81  GLU B C     1 
ATOM   2109 O O     . GLU B 1 95  ? 28.453  4.905   92.418  1.00 28.26  ? 81  GLU B O     1 
ATOM   2110 C CB    . GLU B 1 95  ? 28.216  7.547   90.908  1.00 29.67  ? 81  GLU B CB    1 
ATOM   2111 C CG    . GLU B 1 95  ? 27.134  8.163   91.795  1.00 28.96  ? 81  GLU B CG    1 
ATOM   2112 C CD    . GLU B 1 95  ? 27.689  9.222   92.737  1.00 33.94  ? 81  GLU B CD    1 
ATOM   2113 O OE1   . GLU B 1 95  ? 27.660  9.002   93.966  1.00 32.92  ? 81  GLU B OE1   1 
ATOM   2114 O OE2   . GLU B 1 95  ? 28.162  10.272  92.243  1.00 38.50  ? 81  GLU B OE2   1 
ATOM   2115 N N     . LYS B 1 96  ? 29.157  6.384   93.974  1.00 27.88  ? 82  LYS B N     1 
ATOM   2116 C CA    . LYS B 1 96  ? 28.832  5.590   95.136  1.00 33.22  ? 82  LYS B CA    1 
ATOM   2117 C C     . LYS B 1 96  ? 27.376  5.686   95.597  1.00 33.52  ? 82  LYS B C     1 
ATOM   2118 O O     . LYS B 1 96  ? 26.787  4.688   96.024  1.00 29.35  ? 82  LYS B O     1 
ATOM   2119 C CB    . LYS B 1 96  ? 29.810  6.002   96.244  1.00 34.13  ? 82  LYS B CB    1 
ATOM   2120 C CG    . LYS B 1 96  ? 29.352  5.882   97.661  1.00 39.58  ? 82  LYS B CG    1 
ATOM   2121 C CD    . LYS B 1 96  ? 30.592  5.739   98.523  1.00 44.63  ? 82  LYS B CD    1 
ATOM   2122 C CE    . LYS B 1 96  ? 30.301  6.043   99.968  1.00 48.14  ? 82  LYS B CE    1 
ATOM   2123 N NZ    . LYS B 1 96  ? 31.463  5.654   100.787 1.00 35.68  ? 82  LYS B NZ    1 
ATOM   2124 N N     . ASP B 1 97  ? 26.802  6.882   95.495  1.00 32.48  ? 83  ASP B N     1 
ATOM   2125 C CA    . ASP B 1 97  ? 25.428  7.126   95.911  1.00 32.46  ? 83  ASP B CA    1 
ATOM   2126 C C     . ASP B 1 97  ? 24.375  6.382   95.077  1.00 28.97  ? 83  ASP B C     1 
ATOM   2127 O O     . ASP B 1 97  ? 24.398  6.425   93.842  1.00 24.91  ? 83  ASP B O     1 
ATOM   2128 C CB    . ASP B 1 97  ? 25.145  8.617   95.856  1.00 34.74  ? 83  ASP B CB    1 
ATOM   2129 C CG    . ASP B 1 97  ? 23.778  8.954   96.394  1.00 37.61  ? 83  ASP B CG    1 
ATOM   2130 O OD1   . ASP B 1 97  ? 23.526  8.617   97.577  1.00 34.47  ? 83  ASP B OD1   1 
ATOM   2131 O OD2   . ASP B 1 97  ? 22.970  9.546   95.639  1.00 33.13  ? 83  ASP B OD2   1 
ATOM   2132 N N     . THR B 1 98  ? 23.448  5.709   95.755  1.00 29.24  ? 84  THR B N     1 
ATOM   2133 C CA    . THR B 1 98  ? 22.410  4.949   95.070  1.00 30.68  ? 84  THR B CA    1 
ATOM   2134 C C     . THR B 1 98  ? 21.534  5.814   94.149  1.00 28.84  ? 84  THR B C     1 
ATOM   2135 O O     . THR B 1 98  ? 21.408  5.529   92.955  1.00 25.48  ? 84  THR B O     1 
ATOM   2136 C CB    . THR B 1 98  ? 21.517  4.178   96.092  1.00 33.17  ? 84  THR B CB    1 
ATOM   2137 O OG1   . THR B 1 98  ? 22.281  3.117   96.689  1.00 36.98  ? 84  THR B OG1   1 
ATOM   2138 C CG2   . THR B 1 98  ? 20.291  3.563   95.399  1.00 33.03  ? 84  THR B CG2   1 
ATOM   2139 N N     . THR B 1 99  ? 20.963  6.886   94.693  1.00 27.92  ? 85  THR B N     1 
ATOM   2140 C CA    . THR B 1 99  ? 20.093  7.740   93.896  1.00 30.07  ? 85  THR B CA    1 
ATOM   2141 C C     . THR B 1 99  ? 20.824  8.401   92.748  1.00 30.29  ? 85  THR B C     1 
ATOM   2142 O O     . THR B 1 99  ? 20.278  8.520   91.649  1.00 29.38  ? 85  THR B O     1 
ATOM   2143 C CB    . THR B 1 99  ? 19.414  8.848   94.746  1.00 27.94  ? 85  THR B CB    1 
ATOM   2144 O OG1   . THR B 1 99  ? 18.818  8.270   95.912  1.00 32.04  ? 85  THR B OG1   1 
ATOM   2145 C CG2   . THR B 1 99  ? 18.305  9.516   93.938  1.00 29.10  ? 85  THR B CG2   1 
ATOM   2146 N N     . ALA B 1 100 ? 22.056  8.838   92.988  1.00 26.88  ? 86  ALA B N     1 
ATOM   2147 C CA    . ALA B 1 100 ? 22.835  9.489   91.932  1.00 24.37  ? 86  ALA B CA    1 
ATOM   2148 C C     . ALA B 1 100 ? 23.147  8.494   90.829  1.00 20.13  ? 86  ALA B C     1 
ATOM   2149 O O     . ALA B 1 100 ? 23.219  8.850   89.648  1.00 22.15  ? 86  ALA B O     1 
ATOM   2150 C CB    . ALA B 1 100 ? 24.135  10.056  92.514  1.00 26.24  ? 86  ALA B CB    1 
ATOM   2151 N N     . ARG B 1 101 ? 23.322  7.239   91.221  1.00 21.74  ? 87  ARG B N     1 
ATOM   2152 C CA    . ARG B 1 101 ? 23.605  6.169   90.262  1.00 26.70  ? 87  ARG B CA    1 
ATOM   2153 C C     . ARG B 1 101 ? 22.390  6.016   89.350  1.00 26.72  ? 87  ARG B C     1 
ATOM   2154 O O     . ARG B 1 101 ? 22.514  5.979   88.115  1.00 22.73  ? 87  ARG B O     1 
ATOM   2155 C CB    . ARG B 1 101 ? 23.895  4.841   90.996  1.00 29.42  ? 87  ARG B CB    1 
ATOM   2156 C CG    . ARG B 1 101 ? 25.398  4.505   91.059  1.00 30.15  ? 87  ARG B CG    1 
ATOM   2157 C CD    . ARG B 1 101 ? 25.911  4.047   92.445  1.00 34.37  ? 87  ARG B CD    1 
ATOM   2158 N NE    . ARG B 1 101 ? 25.650  2.643   92.727  1.00 38.72  ? 87  ARG B NE    1 
ATOM   2159 C CZ    . ARG B 1 101 ? 26.577  1.694   92.901  1.00 32.56  ? 87  ARG B CZ    1 
ATOM   2160 N NH1   . ARG B 1 101 ? 27.865  1.964   92.827  1.00 29.37  ? 87  ARG B NH1   1 
ATOM   2161 N NH2   . ARG B 1 101 ? 26.193  0.445   93.144  1.00 33.03  ? 87  ARG B NH2   1 
ATOM   2162 N N     . LEU B 1 102 ? 21.216  5.960   89.978  1.00 23.71  ? 88  LEU B N     1 
ATOM   2163 C CA    . LEU B 1 102 ? 19.973  5.813   89.249  1.00 26.00  ? 88  LEU B CA    1 
ATOM   2164 C C     . LEU B 1 102 ? 19.788  6.988   88.303  1.00 27.04  ? 88  LEU B C     1 
ATOM   2165 O O     . LEU B 1 102 ? 19.475  6.799   87.121  1.00 26.84  ? 88  LEU B O     1 
ATOM   2166 C CB    . LEU B 1 102 ? 18.806  5.694   90.229  1.00 23.96  ? 88  LEU B CB    1 
ATOM   2167 C CG    . LEU B 1 102 ? 18.833  4.399   91.049  1.00 27.64  ? 88  LEU B CG    1 
ATOM   2168 C CD1   . LEU B 1 102 ? 17.663  4.472   92.021  1.00 23.76  ? 88  LEU B CD1   1 
ATOM   2169 C CD2   . LEU B 1 102 ? 18.743  3.139   90.154  1.00 21.14  ? 88  LEU B CD2   1 
ATOM   2170 N N     . ARG B 1 103 ? 20.002  8.201   88.806  1.00 24.10  ? 89  ARG B N     1 
ATOM   2171 C CA    . ARG B 1 103 ? 19.905  9.376   87.954  1.00 25.14  ? 89  ARG B CA    1 
ATOM   2172 C C     . ARG B 1 103 ? 20.842  9.259   86.726  1.00 31.25  ? 89  ARG B C     1 
ATOM   2173 O O     . ARG B 1 103 ? 20.417  9.468   85.572  1.00 27.97  ? 89  ARG B O     1 
ATOM   2174 C CB    . ARG B 1 103 ? 20.264  10.642  88.748  1.00 25.44  ? 89  ARG B CB    1 
ATOM   2175 C CG    . ARG B 1 103 ? 19.901  11.934  88.030  1.00 25.75  ? 89  ARG B CG    1 
ATOM   2176 C CD    . ARG B 1 103 ? 20.442  13.173  88.746  1.00 24.22  ? 89  ARG B CD    1 
ATOM   2177 N NE    . ARG B 1 103 ? 21.342  13.871  87.842  1.00 42.95  ? 89  ARG B NE    1 
ATOM   2178 C CZ    . ARG B 1 103 ? 21.101  15.054  87.287  1.00 46.80  ? 89  ARG B CZ    1 
ATOM   2179 N NH1   . ARG B 1 103 ? 19.968  15.714  87.547  1.00 53.06  ? 89  ARG B NH1   1 
ATOM   2180 N NH2   . ARG B 1 103 ? 21.988  15.558  86.443  1.00 33.07  ? 89  ARG B NH2   1 
ATOM   2181 N N     . LEU B 1 104 ? 22.108  8.905   86.958  1.00 29.12  ? 90  LEU B N     1 
ATOM   2182 C CA    . LEU B 1 104 ? 23.053  8.810   85.842  1.00 28.87  ? 90  LEU B CA    1 
ATOM   2183 C C     . LEU B 1 104 ? 22.707  7.752   84.809  1.00 22.99  ? 90  LEU B C     1 
ATOM   2184 O O     . LEU B 1 104 ? 22.875  7.962   83.612  1.00 22.38  ? 90  LEU B O     1 
ATOM   2185 C CB    . LEU B 1 104 ? 24.478  8.571   86.351  1.00 27.95  ? 90  LEU B CB    1 
ATOM   2186 C CG    . LEU B 1 104 ? 25.159  9.727   87.095  1.00 30.98  ? 90  LEU B CG    1 
ATOM   2187 C CD1   . LEU B 1 104 ? 26.476  9.232   87.727  1.00 30.15  ? 90  LEU B CD1   1 
ATOM   2188 C CD2   . LEU B 1 104 ? 25.445  10.846  86.139  1.00 30.19  ? 90  LEU B CD2   1 
ATOM   2189 N N     . ILE B 1 105 ? 22.238  6.603   85.265  1.00 25.97  ? 91  ILE B N     1 
ATOM   2190 C CA    . ILE B 1 105 ? 21.868  5.550   84.343  1.00 24.18  ? 91  ILE B CA    1 
ATOM   2191 C C     . ILE B 1 105 ? 20.665  6.009   83.477  1.00 28.51  ? 91  ILE B C     1 
ATOM   2192 O O     . ILE B 1 105 ? 20.649  5.801   82.254  1.00 26.17  ? 91  ILE B O     1 
ATOM   2193 C CB    . ILE B 1 105 ? 21.536  4.247   85.126  1.00 28.40  ? 91  ILE B CB    1 
ATOM   2194 C CG1   . ILE B 1 105 ? 22.819  3.716   85.791  1.00 27.51  ? 91  ILE B CG1   1 
ATOM   2195 C CG2   . ILE B 1 105 ? 20.926  3.201   84.183  1.00 22.42  ? 91  ILE B CG2   1 
ATOM   2196 C CD1   . ILE B 1 105 ? 22.607  2.530   86.739  1.00 29.10  ? 91  ILE B CD1   1 
ATOM   2197 N N     . VAL B 1 106 ? 19.669  6.644   84.089  1.00 28.40  ? 92  VAL B N     1 
ATOM   2198 C CA    . VAL B 1 106 ? 18.533  7.115   83.298  1.00 28.11  ? 92  VAL B CA    1 
ATOM   2199 C C     . VAL B 1 106 ? 19.005  8.178   82.332  1.00 23.32  ? 92  VAL B C     1 
ATOM   2200 O O     . VAL B 1 106 ? 18.657  8.156   81.143  1.00 25.92  ? 92  VAL B O     1 
ATOM   2201 C CB    . VAL B 1 106 ? 17.379  7.688   84.188  1.00 28.39  ? 92  VAL B CB    1 
ATOM   2202 C CG1   . VAL B 1 106 ? 16.319  8.430   83.326  1.00 30.95  ? 92  VAL B CG1   1 
ATOM   2203 C CG2   . VAL B 1 106 ? 16.703  6.561   84.927  1.00 25.00  ? 92  VAL B CG2   1 
ATOM   2204 N N     . LEU B 1 107 ? 19.805  9.112   82.826  1.00 28.64  ? 93  LEU B N     1 
ATOM   2205 C CA    . LEU B 1 107 ? 20.298  10.179  81.963  1.00 29.14  ? 93  LEU B CA    1 
ATOM   2206 C C     . LEU B 1 107 ? 21.087  9.592   80.798  1.00 31.00  ? 93  LEU B C     1 
ATOM   2207 O O     . LEU B 1 107 ? 20.984  10.061  79.666  1.00 30.03  ? 93  LEU B O     1 
ATOM   2208 C CB    . LEU B 1 107 ? 21.166  11.149  82.749  1.00 29.24  ? 93  LEU B CB    1 
ATOM   2209 C CG    . LEU B 1 107 ? 21.725  12.351  81.976  1.00 33.30  ? 93  LEU B CG    1 
ATOM   2210 C CD1   . LEU B 1 107 ? 20.604  13.122  81.276  1.00 26.12  ? 93  LEU B CD1   1 
ATOM   2211 C CD2   . LEU B 1 107 ? 22.440  13.242  82.967  1.00 31.25  ? 93  LEU B CD2   1 
ATOM   2212 N N     . LEU B 1 108 ? 21.865  8.554   81.082  1.00 31.52  ? 94  LEU B N     1 
ATOM   2213 C CA    . LEU B 1 108 ? 22.637  7.861   80.063  1.00 28.82  ? 94  LEU B CA    1 
ATOM   2214 C C     . LEU B 1 108 ? 21.730  7.258   78.999  1.00 27.88  ? 94  LEU B C     1 
ATOM   2215 O O     . LEU B 1 108 ? 21.987  7.405   77.805  1.00 29.66  ? 94  LEU B O     1 
ATOM   2216 C CB    . LEU B 1 108 ? 23.463  6.734   80.701  1.00 29.73  ? 94  LEU B CB    1 
ATOM   2217 C CG    . LEU B 1 108 ? 23.994  5.696   79.719  1.00 22.36  ? 94  LEU B CG    1 
ATOM   2218 C CD1   . LEU B 1 108 ? 25.044  6.325   78.829  1.00 22.52  ? 94  LEU B CD1   1 
ATOM   2219 C CD2   . LEU B 1 108 ? 24.588  4.539   80.481  1.00 24.33  ? 94  LEU B CD2   1 
ATOM   2220 N N     . ILE B 1 109 ? 20.686  6.549   79.419  1.00 26.47  ? 95  ILE B N     1 
ATOM   2221 C CA    . ILE B 1 109 ? 19.775  5.941   78.452  1.00 24.91  ? 95  ILE B CA    1 
ATOM   2222 C C     . ILE B 1 109 ? 19.105  7.043   77.624  1.00 25.08  ? 95  ILE B C     1 
ATOM   2223 O O     . ILE B 1 109 ? 19.106  6.986   76.399  1.00 29.59  ? 95  ILE B O     1 
ATOM   2224 C CB    . ILE B 1 109 ? 18.717  5.054   79.176  1.00 28.74  ? 95  ILE B CB    1 
ATOM   2225 C CG1   . ILE B 1 109 ? 19.406  3.806   79.724  1.00 23.37  ? 95  ILE B CG1   1 
ATOM   2226 C CG2   . ILE B 1 109 ? 17.560  4.646   78.231  1.00 22.29  ? 95  ILE B CG2   1 
ATOM   2227 C CD1   . ILE B 1 109 ? 18.620  3.183   80.863  1.00 21.73  ? 95  ILE B CD1   1 
ATOM   2228 N N     . LEU B 1 110 ? 18.563  8.066   78.274  1.00 26.60  ? 96  LEU B N     1 
ATOM   2229 C CA    . LEU B 1 110 ? 17.924  9.140   77.522  1.00 29.04  ? 96  LEU B CA    1 
ATOM   2230 C C     . LEU B 1 110 ? 18.916  9.857   76.597  1.00 31.61  ? 96  LEU B C     1 
ATOM   2231 O O     . LEU B 1 110 ? 18.612  10.125  75.420  1.00 27.66  ? 96  LEU B O     1 
ATOM   2232 C CB    . LEU B 1 110 ? 17.301  10.148  78.479  1.00 27.50  ? 96  LEU B CB    1 
ATOM   2233 C CG    . LEU B 1 110 ? 15.863  9.937   78.971  1.00 30.58  ? 96  LEU B CG    1 
ATOM   2234 C CD1   . LEU B 1 110 ? 15.391  8.535   78.677  1.00 27.83  ? 96  LEU B CD1   1 
ATOM   2235 C CD2   . LEU B 1 110 ? 15.782  10.295  80.438  1.00 34.42  ? 96  LEU B CD2   1 
ATOM   2236 N N     . GLY B 1 111 ? 20.103  10.139  77.135  1.00 29.94  ? 97  GLY B N     1 
ATOM   2237 C CA    . GLY B 1 111 ? 21.140  10.841  76.394  1.00 29.22  ? 97  GLY B CA    1 
ATOM   2238 C C     . GLY B 1 111 ? 21.650  10.107  75.175  1.00 32.17  ? 97  GLY B C     1 
ATOM   2239 O O     . GLY B 1 111 ? 21.813  10.688  74.094  1.00 28.35  ? 97  GLY B O     1 
ATOM   2240 N N     . PHE B 1 112 ? 21.924  8.821   75.349  1.00 34.86  ? 98  PHE B N     1 
ATOM   2241 C CA    . PHE B 1 112 ? 22.386  8.000   74.242  1.00 36.36  ? 98  PHE B CA    1 
ATOM   2242 C C     . PHE B 1 112 ? 21.318  7.989   73.139  1.00 35.99  ? 98  PHE B C     1 
ATOM   2243 O O     . PHE B 1 112 ? 21.635  8.010   71.939  1.00 32.16  ? 98  PHE B O     1 
ATOM   2244 C CB    . PHE B 1 112 ? 22.599  6.569   74.708  1.00 33.53  ? 98  PHE B CB    1 
ATOM   2245 C CG    . PHE B 1 112 ? 23.124  5.670   73.643  1.00 33.66  ? 98  PHE B CG    1 
ATOM   2246 C CD1   . PHE B 1 112 ? 24.487  5.589   73.399  1.00 33.32  ? 98  PHE B CD1   1 
ATOM   2247 C CD2   . PHE B 1 112 ? 22.265  4.887   72.895  1.00 35.82  ? 98  PHE B CD2   1 
ATOM   2248 C CE1   . PHE B 1 112 ? 24.984  4.731   72.416  1.00 35.89  ? 98  PHE B CE1   1 
ATOM   2249 C CE2   . PHE B 1 112 ? 22.757  4.031   71.910  1.00 39.29  ? 98  PHE B CE2   1 
ATOM   2250 C CZ    . PHE B 1 112 ? 24.122  3.954   71.680  1.00 30.93  ? 98  PHE B CZ    1 
ATOM   2251 N N     . GLY B 1 113 ? 20.052  7.923   73.557  1.00 33.27  ? 99  GLY B N     1 
ATOM   2252 C CA    . GLY B 1 113 ? 18.957  7.904   72.600  1.00 31.88  ? 99  GLY B CA    1 
ATOM   2253 C C     . GLY B 1 113 ? 18.918  9.187   71.807  1.00 29.09  ? 99  GLY B C     1 
ATOM   2254 O O     . GLY B 1 113 ? 18.842  9.185   70.569  1.00 29.71  ? 99  GLY B O     1 
ATOM   2255 N N     . GLU B 1 114 ? 18.975  10.302  72.518  1.00 29.06  ? 100 GLU B N     1 
ATOM   2256 C CA    . GLU B 1 114 ? 18.971  11.592  71.849  1.00 31.36  ? 100 GLU B CA    1 
ATOM   2257 C C     . GLU B 1 114 ? 20.134  11.736  70.837  1.00 32.54  ? 100 GLU B C     1 
ATOM   2258 O O     . GLU B 1 114 ? 19.926  12.186  69.713  1.00 32.83  ? 100 GLU B O     1 
ATOM   2259 C CB    . GLU B 1 114 ? 19.065  12.691  72.884  1.00 33.75  ? 100 GLU B CB    1 
ATOM   2260 C CG    . GLU B 1 114 ? 18.689  14.021  72.335  1.00 35.90  ? 100 GLU B CG    1 
ATOM   2261 C CD    . GLU B 1 114 ? 18.420  15.021  73.429  1.00 38.46  ? 100 GLU B CD    1 
ATOM   2262 O OE1   . GLU B 1 114 ? 17.765  14.655  74.435  1.00 34.67  ? 100 GLU B OE1   1 
ATOM   2263 O OE2   . GLU B 1 114 ? 18.850  16.184  73.277  1.00 43.32  ? 100 GLU B OE2   1 
ATOM   2264 N N     . ARG B 1 115 ? 21.343  11.342  71.243  1.00 32.64  ? 101 ARG B N     1 
ATOM   2265 C CA    . ARG B 1 115 ? 22.537  11.435  70.395  1.00 33.22  ? 101 ARG B CA    1 
ATOM   2266 C C     . ARG B 1 115 ? 22.590  10.409  69.268  1.00 35.19  ? 101 ARG B C     1 
ATOM   2267 O O     . ARG B 1 115 ? 23.414  10.518  68.366  1.00 33.40  ? 101 ARG B O     1 
ATOM   2268 C CB    . ARG B 1 115 ? 23.811  11.282  71.242  1.00 33.10  ? 101 ARG B CB    1 
ATOM   2269 C CG    . ARG B 1 115 ? 23.978  12.343  72.324  1.00 33.02  ? 101 ARG B CG    1 
ATOM   2270 C CD    . ARG B 1 115 ? 25.310  12.182  73.043  1.00 37.92  ? 101 ARG B CD    1 
ATOM   2271 N NE    . ARG B 1 115 ? 25.159  11.413  74.276  1.00 48.91  ? 101 ARG B NE    1 
ATOM   2272 C CZ    . ARG B 1 115 ? 25.480  10.127  74.411  1.00 55.10  ? 101 ARG B CZ    1 
ATOM   2273 N NH1   . ARG B 1 115 ? 25.985  9.433   73.381  1.00 46.85  ? 101 ARG B NH1   1 
ATOM   2274 N NH2   . ARG B 1 115 ? 25.296  9.537   75.592  1.00 55.76  ? 101 ARG B NH2   1 
ATOM   2275 N N     . ASN B 1 116 ? 21.728  9.403   69.320  1.00 31.54  ? 102 ASN B N     1 
ATOM   2276 C CA    . ASN B 1 116 ? 21.713  8.381   68.269  1.00 31.79  ? 102 ASN B CA    1 
ATOM   2277 C C     . ASN B 1 116 ? 20.260  8.098   67.863  1.00 33.71  ? 102 ASN B C     1 
ATOM   2278 O O     . ASN B 1 116 ? 19.767  6.982   68.043  1.00 37.90  ? 102 ASN B O     1 
ATOM   2279 C CB    . ASN B 1 116 ? 22.376  7.097   68.783  1.00 27.47  ? 102 ASN B CB    1 
ATOM   2280 C CG    . ASN B 1 116 ? 23.821  7.313   69.178  1.00 34.57  ? 102 ASN B CG    1 
ATOM   2281 O OD1   . ASN B 1 116 ? 24.708  7.235   68.338  1.00 32.51  ? 102 ASN B OD1   1 
ATOM   2282 N ND2   . ASN B 1 116 ? 24.064  7.608   70.466  1.00 28.26  ? 102 ASN B ND2   1 
ATOM   2283 N N     . PRO B 1 117 ? 19.572  9.093   67.265  1.00 30.54  ? 103 PRO B N     1 
ATOM   2284 C CA    . PRO B 1 117 ? 18.171  8.906   66.862  1.00 27.98  ? 103 PRO B CA    1 
ATOM   2285 C C     . PRO B 1 117 ? 17.903  7.659   66.048  1.00 28.41  ? 103 PRO B C     1 
ATOM   2286 O O     . PRO B 1 117 ? 16.925  6.966   66.295  1.00 26.33  ? 103 PRO B O     1 
ATOM   2287 C CB    . PRO B 1 117 ? 17.841  10.187  66.090  1.00 29.08  ? 103 PRO B CB    1 
ATOM   2288 C CG    . PRO B 1 117 ? 18.832  11.192  66.611  1.00 33.28  ? 103 PRO B CG    1 
ATOM   2289 C CD    . PRO B 1 117 ? 20.099  10.375  66.763  1.00 26.82  ? 103 PRO B CD    1 
ATOM   2290 N N     . GLY B 1 118 ? 18.756  7.379   65.066  1.00 30.16  ? 104 GLY B N     1 
ATOM   2291 C CA    . GLY B 1 118 ? 18.572  6.195   64.242  1.00 27.83  ? 104 GLY B CA    1 
ATOM   2292 C C     . GLY B 1 118 ? 18.610  4.893   65.038  1.00 28.25  ? 104 GLY B C     1 
ATOM   2293 O O     . GLY B 1 118 ? 17.834  3.963   64.764  1.00 28.72  ? 104 GLY B O     1 
ATOM   2294 N N     . LEU B 1 119 ? 19.514  4.814   66.016  1.00 26.01  ? 105 LEU B N     1 
ATOM   2295 C CA    . LEU B 1 119 ? 19.617  3.611   66.823  1.00 25.56  ? 105 LEU B CA    1 
ATOM   2296 C C     . LEU B 1 119 ? 18.428  3.562   67.795  1.00 29.35  ? 105 LEU B C     1 
ATOM   2297 O O     . LEU B 1 119 ? 17.957  2.483   68.165  1.00 27.65  ? 105 LEU B O     1 
ATOM   2298 C CB    . LEU B 1 119 ? 20.945  3.589   67.585  1.00 28.18  ? 105 LEU B CB    1 
ATOM   2299 C CG    . LEU B 1 119 ? 22.253  3.624   66.775  1.00 29.23  ? 105 LEU B CG    1 
ATOM   2300 C CD1   . LEU B 1 119 ? 23.412  3.645   67.729  1.00 29.91  ? 105 LEU B CD1   1 
ATOM   2301 C CD2   . LEU B 1 119 ? 22.372  2.425   65.857  1.00 29.14  ? 105 LEU B CD2   1 
ATOM   2302 N N     . THR B 1 120 ? 17.929  4.734   68.190  1.00 25.78  ? 106 THR B N     1 
ATOM   2303 C CA    . THR B 1 120 ? 16.802  4.797   69.103  1.00 28.98  ? 106 THR B CA    1 
ATOM   2304 C C     . THR B 1 120 ? 15.629  4.115   68.441  1.00 27.56  ? 106 THR B C     1 
ATOM   2305 O O     . THR B 1 120 ? 14.849  3.448   69.124  1.00 24.45  ? 106 THR B O     1 
ATOM   2306 C CB    . THR B 1 120 ? 16.407  6.263   69.473  1.00 32.91  ? 106 THR B CB    1 
ATOM   2307 O OG1   . THR B 1 120 ? 17.473  6.874   70.211  1.00 32.25  ? 106 THR B OG1   1 
ATOM   2308 C CG2   . THR B 1 120 ? 15.140  6.284   70.340  1.00 29.56  ? 106 THR B CG2   1 
ATOM   2309 N N     . ARG B 1 121 ? 15.527  4.281   67.116  1.00 22.91  ? 107 ARG B N     1 
ATOM   2310 C CA    . ARG B 1 121 ? 14.465  3.675   66.328  1.00 25.78  ? 107 ARG B CA    1 
ATOM   2311 C C     . ARG B 1 121 ? 14.529  2.155   66.433  1.00 28.37  ? 107 ARG B C     1 
ATOM   2312 O O     . ARG B 1 121 ? 13.515  1.479   66.271  1.00 22.50  ? 107 ARG B O     1 
ATOM   2313 C CB    . ARG B 1 121 ? 14.569  4.075   64.860  1.00 33.50  ? 107 ARG B CB    1 
ATOM   2314 C CG    . ARG B 1 121 ? 13.679  5.229   64.443  1.00 32.97  ? 107 ARG B CG    1 
ATOM   2315 C CD    . ARG B 1 121 ? 13.446  5.158   62.935  1.00 40.28  ? 107 ARG B CD    1 
ATOM   2316 N NE    . ARG B 1 121 ? 13.624  6.455   62.291  1.00 48.49  ? 107 ARG B NE    1 
ATOM   2317 C CZ    . ARG B 1 121 ? 12.737  7.440   62.327  1.00 44.93  ? 107 ARG B CZ    1 
ATOM   2318 N NH1   . ARG B 1 121 ? 11.591  7.270   62.979  1.00 49.73  ? 107 ARG B NH1   1 
ATOM   2319 N NH2   . ARG B 1 121 ? 13.010  8.595   61.729  1.00 40.23  ? 107 ARG B NH2   1 
ATOM   2320 N N     . ILE B 1 122 ? 15.724  1.622   66.677  1.00 24.69  ? 108 ILE B N     1 
ATOM   2321 C CA    . ILE B 1 122 ? 15.879  0.181   66.853  1.00 28.79  ? 108 ILE B CA    1 
ATOM   2322 C C     . ILE B 1 122 ? 15.461  -0.183  68.293  1.00 27.08  ? 108 ILE B C     1 
ATOM   2323 O O     . ILE B 1 122 ? 14.775  -1.193  68.534  1.00 29.19  ? 108 ILE B O     1 
ATOM   2324 C CB    . ILE B 1 122 ? 17.349  -0.263  66.637  1.00 28.09  ? 108 ILE B CB    1 
ATOM   2325 C CG1   . ILE B 1 122 ? 17.703  -0.165  65.146  1.00 33.11  ? 108 ILE B CG1   1 
ATOM   2326 C CG2   . ILE B 1 122 ? 17.535  -1.693  67.152  1.00 26.68  ? 108 ILE B CG2   1 
ATOM   2327 C CD1   . ILE B 1 122 ? 19.198  -0.372  64.826  1.00 31.52  ? 108 ILE B CD1   1 
ATOM   2328 N N     . LEU B 1 123 ? 15.866  0.665   69.237  1.00 28.76  ? 109 LEU B N     1 
ATOM   2329 C CA    . LEU B 1 123 ? 15.567  0.476   70.660  1.00 31.87  ? 109 LEU B CA    1 
ATOM   2330 C C     . LEU B 1 123 ? 14.066  0.419   70.957  1.00 31.77  ? 109 LEU B C     1 
ATOM   2331 O O     . LEU B 1 123 ? 13.600  -0.395  71.783  1.00 29.74  ? 109 LEU B O     1 
ATOM   2332 C CB    . LEU B 1 123 ? 16.178  1.614   71.470  1.00 30.18  ? 109 LEU B CB    1 
ATOM   2333 C CG    . LEU B 1 123 ? 17.388  1.330   72.341  1.00 33.18  ? 109 LEU B CG    1 
ATOM   2334 C CD1   . LEU B 1 123 ? 17.737  2.617   73.099  1.00 33.18  ? 109 LEU B CD1   1 
ATOM   2335 C CD2   . LEU B 1 123 ? 17.091  0.181   73.306  1.00 27.76  ? 109 LEU B CD2   1 
ATOM   2336 N N     . THR B 1 124 ? 13.314  1.298   70.300  1.00 28.60  ? 110 THR B N     1 
ATOM   2337 C CA    . THR B 1 124 ? 11.869  1.351   70.493  1.00 31.25  ? 110 THR B CA    1 
ATOM   2338 C C     . THR B 1 124 ? 11.170  0.275   69.684  1.00 27.70  ? 110 THR B C     1 
ATOM   2339 O O     . THR B 1 124 ? 9.958   0.102   69.783  1.00 30.10  ? 110 THR B O     1 
ATOM   2340 C CB    . THR B 1 124 ? 11.297  2.715   70.088  1.00 28.65  ? 110 THR B CB    1 
ATOM   2341 O OG1   . THR B 1 124 ? 11.588  2.960   68.705  1.00 29.17  ? 110 THR B OG1   1 
ATOM   2342 C CG2   . THR B 1 124 ? 11.911  3.809   70.948  1.00 26.09  ? 110 THR B CG2   1 
ATOM   2343 N N     . GLY B 1 125 ? 11.941  -0.435  68.871  1.00 30.62  ? 111 GLY B N     1 
ATOM   2344 C CA    . GLY B 1 125 ? 11.378  -1.497  68.062  1.00 28.65  ? 111 GLY B CA    1 
ATOM   2345 C C     . GLY B 1 125 ? 10.708  -1.067  66.767  1.00 29.92  ? 111 GLY B C     1 
ATOM   2346 O O     . GLY B 1 125 ? 10.256  -1.921  66.019  1.00 23.17  ? 111 GLY B O     1 
ATOM   2347 N N     . HIS B 1 126 ? 10.606  0.230   66.486  1.00 27.66  ? 112 HIS B N     1 
ATOM   2348 C CA    . HIS B 1 126 ? 9.954   0.628   65.238  1.00 28.38  ? 112 HIS B CA    1 
ATOM   2349 C C     . HIS B 1 126 ? 10.727  0.178   64.015  1.00 29.04  ? 112 HIS B C     1 
ATOM   2350 O O     . HIS B 1 126 ? 10.185  -0.552  63.179  1.00 27.32  ? 112 HIS B O     1 
ATOM   2351 C CB    . HIS B 1 126 ? 9.719   2.138   65.210  1.00 31.53  ? 112 HIS B CB    1 
ATOM   2352 C CG    . HIS B 1 126 ? 8.760   2.595   66.264  1.00 36.64  ? 112 HIS B CG    1 
ATOM   2353 N ND1   . HIS B 1 126 ? 9.128   2.750   67.585  1.00 27.37  ? 112 HIS B ND1   1 
ATOM   2354 C CD2   . HIS B 1 126 ? 7.423   2.815   66.216  1.00 29.73  ? 112 HIS B CD2   1 
ATOM   2355 C CE1   . HIS B 1 126 ? 8.056   3.044   68.303  1.00 32.53  ? 112 HIS B CE1   1 
ATOM   2356 N NE2   . HIS B 1 126 ? 7.008   3.087   67.497  1.00 31.09  ? 112 HIS B NE2   1 
ATOM   2357 N N     . ALA B 1 127 ? 12.005  0.559   63.931  1.00 25.90  ? 113 ALA B N     1 
ATOM   2358 C CA    . ALA B 1 127 ? 12.824  0.187   62.786  1.00 24.04  ? 113 ALA B CA    1 
ATOM   2359 C C     . ALA B 1 127 ? 12.856  -1.327  62.605  1.00 30.22  ? 113 ALA B C     1 
ATOM   2360 O O     . ALA B 1 127 ? 13.059  -1.814  61.496  1.00 32.64  ? 113 ALA B O     1 
ATOM   2361 C CB    . ALA B 1 127 ? 14.245  0.711   62.951  1.00 24.03  ? 113 ALA B CB    1 
ATOM   2362 N N     . LEU B 1 128 ? 12.638  -2.082  63.673  1.00 27.99  ? 114 LEU B N     1 
ATOM   2363 C CA    . LEU B 1 128 ? 12.688  -3.536  63.540  1.00 27.83  ? 114 LEU B CA    1 
ATOM   2364 C C     . LEU B 1 128 ? 11.412  -4.176  63.016  1.00 31.67  ? 114 LEU B C     1 
ATOM   2365 O O     . LEU B 1 128 ? 11.384  -5.396  62.789  1.00 29.32  ? 114 LEU B O     1 
ATOM   2366 C CB    . LEU B 1 128 ? 13.064  -4.197  64.877  1.00 27.93  ? 114 LEU B CB    1 
ATOM   2367 C CG    . LEU B 1 128 ? 14.371  -3.776  65.551  1.00 28.17  ? 114 LEU B CG    1 
ATOM   2368 C CD1   . LEU B 1 128 ? 14.541  -4.613  66.805  1.00 24.66  ? 114 LEU B CD1   1 
ATOM   2369 C CD2   . LEU B 1 128 ? 15.568  -3.911  64.600  1.00 21.35  ? 114 LEU B CD2   1 
ATOM   2370 N N     . MET B 1 129 ? 10.349  -3.387  62.840  1.00 27.90  ? 115 MET B N     1 
ATOM   2371 C CA    . MET B 1 129 ? 9.111   -3.976  62.332  1.00 30.39  ? 115 MET B CA    1 
ATOM   2372 C C     . MET B 1 129 ? 9.387   -4.573  60.955  1.00 33.04  ? 115 MET B C     1 
ATOM   2373 O O     . MET B 1 129 ? 8.817   -5.608  60.591  1.00 30.76  ? 115 MET B O     1 
ATOM   2374 C CB    . MET B 1 129 ? 8.001   -2.923  62.232  1.00 27.94  ? 115 MET B CB    1 
ATOM   2375 C CG    . MET B 1 129 ? 7.548   -2.394  63.569  1.00 25.20  ? 115 MET B CG    1 
ATOM   2376 S SD    . MET B 1 129 ? 7.059   -3.760  64.591  1.00 27.96  ? 115 MET B SD    1 
ATOM   2377 C CE    . MET B 1 129 ? 5.633   -4.372  63.679  1.00 30.47  ? 115 MET B CE    1 
ATOM   2378 N N     . PHE B 1 130 ? 10.294  -3.927  60.218  1.00 31.36  ? 116 PHE B N     1 
ATOM   2379 C CA    . PHE B 1 130 ? 10.666  -4.349  58.864  1.00 36.87  ? 116 PHE B CA    1 
ATOM   2380 C C     . PHE B 1 130 ? 11.631  -5.528  58.810  1.00 37.82  ? 116 PHE B C     1 
ATOM   2381 O O     . PHE B 1 130 ? 11.982  -5.993  57.712  1.00 33.92  ? 116 PHE B O     1 
ATOM   2382 C CB    . PHE B 1 130 ? 11.325  -3.192  58.096  1.00 27.42  ? 116 PHE B CB    1 
ATOM   2383 C CG    . PHE B 1 130 ? 10.486  -1.956  58.018  1.00 29.81  ? 116 PHE B CG    1 
ATOM   2384 C CD1   . PHE B 1 130 ? 10.935  -0.766  58.573  1.00 30.02  ? 116 PHE B CD1   1 
ATOM   2385 C CD2   . PHE B 1 130 ? 9.250   -1.973  57.373  1.00 28.23  ? 116 PHE B CD2   1 
ATOM   2386 C CE1   . PHE B 1 130 ? 10.151  0.394   58.505  1.00 35.54  ? 116 PHE B CE1   1 
ATOM   2387 C CE2   . PHE B 1 130 ? 8.462   -0.819  57.298  1.00 28.63  ? 116 PHE B CE2   1 
ATOM   2388 C CZ    . PHE B 1 130 ? 8.911   0.358   57.855  1.00 32.83  ? 116 PHE B CZ    1 
ATOM   2389 N N     . GLU B 1 131 ? 12.076  -5.999  59.973  1.00 36.18  ? 117 GLU B N     1 
ATOM   2390 C CA    . GLU B 1 131 ? 13.053  -7.083  59.983  1.00 35.89  ? 117 GLU B CA    1 
ATOM   2391 C C     . GLU B 1 131 ? 12.693  -8.307  60.830  1.00 37.02  ? 117 GLU B C     1 
ATOM   2392 O O     . GLU B 1 131 ? 11.605  -8.372  61.421  1.00 42.56  ? 117 GLU B O     1 
ATOM   2393 C CB    . GLU B 1 131 ? 14.411  -6.498  60.386  1.00 33.72  ? 117 GLU B CB    1 
ATOM   2394 C CG    . GLU B 1 131 ? 15.536  -6.787  59.382  1.00 48.64  ? 117 GLU B CG    1 
ATOM   2395 C CD    . GLU B 1 131 ? 15.316  -6.133  58.042  1.00 38.15  ? 117 GLU B CD    1 
ATOM   2396 O OE1   . GLU B 1 131 ? 15.142  -4.905  57.969  1.00 39.84  ? 117 GLU B OE1   1 
ATOM   2397 O OE2   . GLU B 1 131 ? 15.323  -6.855  57.036  1.00 62.93  ? 117 GLU B OE2   1 
ATOM   2398 N N     . GLN B 1 132 ? 13.608  -9.278  60.884  1.00 39.97  ? 118 GLN B N     1 
ATOM   2399 C CA    . GLN B 1 132 ? 13.408  -10.535 61.627  1.00 43.37  ? 118 GLN B CA    1 
ATOM   2400 C C     . GLN B 1 132 ? 13.017  -10.386 63.094  1.00 42.62  ? 118 GLN B C     1 
ATOM   2401 O O     . GLN B 1 132 ? 13.745  -9.746  63.854  1.00 38.35  ? 118 GLN B O     1 
ATOM   2402 C CB    . GLN B 1 132 ? 14.679  -11.374 61.554  1.00 42.28  ? 118 GLN B CB    1 
ATOM   2403 C CG    . GLN B 1 132 ? 14.853  -12.125 60.268  1.00 55.64  ? 118 GLN B CG    1 
ATOM   2404 C CD    . GLN B 1 132 ? 16.202  -12.806 60.204  1.00 66.58  ? 118 GLN B CD    1 
ATOM   2405 O OE1   . GLN B 1 132 ? 16.737  -13.245 61.234  1.00 73.64  ? 118 GLN B OE1   1 
ATOM   2406 N NE2   . GLN B 1 132 ? 16.763  -12.913 58.994  1.00 64.23  ? 118 GLN B NE2   1 
ATOM   2407 N N     . ASP B 1 133 ? 11.908  -11.023 63.490  1.00 40.31  ? 119 ASP B N     1 
ATOM   2408 C CA    . ASP B 1 133 ? 11.395  -10.954 64.870  1.00 43.36  ? 119 ASP B CA    1 
ATOM   2409 C C     . ASP B 1 133 ? 12.372  -11.191 66.018  1.00 44.43  ? 119 ASP B C     1 
ATOM   2410 O O     . ASP B 1 133 ? 12.242  -10.586 67.087  1.00 47.82  ? 119 ASP B O     1 
ATOM   2411 C CB    . ASP B 1 133 ? 10.207  -11.905 65.060  1.00 44.66  ? 119 ASP B CB    1 
ATOM   2412 C CG    . ASP B 1 133 ? 8.990   -11.499 64.236  1.00 51.13  ? 119 ASP B CG    1 
ATOM   2413 O OD1   . ASP B 1 133 ? 8.799   -10.282 64.000  1.00 58.23  ? 119 ASP B OD1   1 
ATOM   2414 O OD2   . ASP B 1 133 ? 8.215   -12.392 63.833  1.00 53.98  ? 119 ASP B OD2   1 
ATOM   2415 N N     . ARG B 1 134 ? 13.335  -12.078 65.832  1.00 42.96  ? 120 ARG B N     1 
ATOM   2416 C CA    . ARG B 1 134 ? 14.270  -12.323 66.915  1.00 45.11  ? 120 ARG B CA    1 
ATOM   2417 C C     . ARG B 1 134 ? 15.116  -11.085 67.232  1.00 40.04  ? 120 ARG B C     1 
ATOM   2418 O O     . ARG B 1 134 ? 15.748  -11.035 68.278  1.00 40.38  ? 120 ARG B O     1 
ATOM   2419 C CB    . ARG B 1 134 ? 15.202  -13.498 66.590  1.00 47.66  ? 120 ARG B CB    1 
ATOM   2420 C CG    . ARG B 1 134 ? 16.158  -13.244 65.433  1.00 52.25  ? 120 ARG B CG    1 
ATOM   2421 C CD    . ARG B 1 134 ? 17.346  -14.196 65.515  1.00 55.74  ? 120 ARG B CD    1 
ATOM   2422 N NE    . ARG B 1 134 ? 18.502  -13.546 66.124  1.00 52.87  ? 120 ARG B NE    1 
ATOM   2423 C CZ    . ARG B 1 134 ? 19.395  -12.840 65.440  1.00 55.49  ? 120 ARG B CZ    1 
ATOM   2424 N NH1   . ARG B 1 134 ? 19.269  -12.702 64.129  1.00 59.91  ? 120 ARG B NH1   1 
ATOM   2425 N NH2   . ARG B 1 134 ? 20.402  -12.254 66.066  1.00 56.82  ? 120 ARG B NH2   1 
ATOM   2426 N N     . LEU B 1 135 ? 15.148  -10.096 66.345  1.00 36.87  ? 121 LEU B N     1 
ATOM   2427 C CA    . LEU B 1 135 ? 15.944  -8.910  66.641  1.00 35.31  ? 121 LEU B CA    1 
ATOM   2428 C C     . LEU B 1 135 ? 15.316  -8.144  67.804  1.00 37.45  ? 121 LEU B C     1 
ATOM   2429 O O     . LEU B 1 135 ? 16.040  -7.582  68.644  1.00 34.40  ? 121 LEU B O     1 
ATOM   2430 C CB    . LEU B 1 135 ? 16.096  -8.027  65.407  1.00 32.95  ? 121 LEU B CB    1 
ATOM   2431 C CG    . LEU B 1 135 ? 17.000  -8.606  64.310  1.00 32.03  ? 121 LEU B CG    1 
ATOM   2432 C CD1   . LEU B 1 135 ? 16.783  -7.843  63.036  1.00 31.06  ? 121 LEU B CD1   1 
ATOM   2433 C CD2   . LEU B 1 135 ? 18.477  -8.530  64.731  1.00 26.99  ? 121 LEU B CD2   1 
ATOM   2434 N N     . GLN B 1 136 ? 13.980  -8.145  67.870  1.00 32.32  ? 122 GLN B N     1 
ATOM   2435 C CA    . GLN B 1 136 ? 13.259  -7.480  68.952  1.00 29.31  ? 122 GLN B CA    1 
ATOM   2436 C C     . GLN B 1 136 ? 13.524  -8.235  70.264  1.00 34.38  ? 122 GLN B C     1 
ATOM   2437 O O     . GLN B 1 136 ? 13.630  -7.635  71.341  1.00 30.82  ? 122 GLN B O     1 
ATOM   2438 C CB    . GLN B 1 136 ? 11.754  -7.474  68.668  1.00 27.62  ? 122 GLN B CB    1 
ATOM   2439 C CG    . GLN B 1 136 ? 10.875  -6.880  69.803  1.00 28.51  ? 122 GLN B CG    1 
ATOM   2440 C CD    . GLN B 1 136 ? 11.246  -5.424  70.139  1.00 40.39  ? 122 GLN B CD    1 
ATOM   2441 O OE1   . GLN B 1 136 ? 11.285  -4.559  69.263  1.00 38.05  ? 122 GLN B OE1   1 
ATOM   2442 N NE2   . GLN B 1 136 ? 11.525  -5.158  71.414  1.00 39.92  ? 122 GLN B NE2   1 
ATOM   2443 N N     . GLY B 1 137 ? 13.627  -9.558  70.170  1.00 32.70  ? 123 GLY B N     1 
ATOM   2444 C CA    . GLY B 1 137 ? 13.875  -10.355 71.355  1.00 32.97  ? 123 GLY B CA    1 
ATOM   2445 C C     . GLY B 1 137 ? 15.246  -10.035 71.906  1.00 32.50  ? 123 GLY B C     1 
ATOM   2446 O O     . GLY B 1 137 ? 15.497  -10.138 73.103  1.00 34.26  ? 123 GLY B O     1 
ATOM   2447 N N     . ARG B 1 138 ? 16.137  -9.644  71.015  1.00 32.21  ? 124 ARG B N     1 
ATOM   2448 C CA    . ARG B 1 138 ? 17.476  -9.271  71.417  1.00 37.52  ? 124 ARG B CA    1 
ATOM   2449 C C     . ARG B 1 138 ? 17.412  -7.922  72.140  1.00 34.60  ? 124 ARG B C     1 
ATOM   2450 O O     . ARG B 1 138 ? 18.157  -7.692  73.100  1.00 36.58  ? 124 ARG B O     1 
ATOM   2451 C CB    . ARG B 1 138 ? 18.398  -9.197  70.192  1.00 36.35  ? 124 ARG B CB    1 
ATOM   2452 C CG    . ARG B 1 138 ? 19.839  -8.995  70.555  1.00 41.76  ? 124 ARG B CG    1 
ATOM   2453 C CD    . ARG B 1 138 ? 20.770  -9.290  69.389  1.00 44.79  ? 124 ARG B CD    1 
ATOM   2454 N NE    . ARG B 1 138 ? 22.164  -9.196  69.824  1.00 48.19  ? 124 ARG B NE    1 
ATOM   2455 C CZ    . ARG B 1 138 ? 23.210  -9.055  69.016  1.00 46.70  ? 124 ARG B CZ    1 
ATOM   2456 N NH1   . ARG B 1 138 ? 23.045  -8.987  67.702  1.00 47.73  ? 124 ARG B NH1   1 
ATOM   2457 N NH2   . ARG B 1 138 ? 24.428  -8.970  69.529  1.00 49.69  ? 124 ARG B NH2   1 
ATOM   2458 N N     . ILE B 1 139 ? 16.515  -7.036  71.699  1.00 29.66  ? 125 ILE B N     1 
ATOM   2459 C CA    . ILE B 1 139 ? 16.362  -5.732  72.348  1.00 28.12  ? 125 ILE B CA    1 
ATOM   2460 C C     . ILE B 1 139 ? 15.739  -5.949  73.735  1.00 25.59  ? 125 ILE B C     1 
ATOM   2461 O O     . ILE B 1 139 ? 16.182  -5.364  74.725  1.00 28.05  ? 125 ILE B O     1 
ATOM   2462 C CB    . ILE B 1 139 ? 15.504  -4.789  71.455  1.00 31.24  ? 125 ILE B CB    1 
ATOM   2463 C CG1   . ILE B 1 139 ? 16.377  -4.297  70.296  1.00 29.89  ? 125 ILE B CG1   1 
ATOM   2464 C CG2   . ILE B 1 139 ? 14.913  -3.612  72.255  1.00 22.40  ? 125 ILE B CG2   1 
ATOM   2465 C CD1   . ILE B 1 139 ? 17.634  -3.526  70.734  1.00 29.30  ? 125 ILE B CD1   1 
ATOM   2466 N N     . ASN B 1 140 ? 14.740  -6.821  73.813  1.00 26.70  ? 126 ASN B N     1 
ATOM   2467 C CA    . ASN B 1 140 ? 14.111  -7.117  75.083  1.00 27.73  ? 126 ASN B CA    1 
ATOM   2468 C C     . ASN B 1 140 ? 15.141  -7.662  76.078  1.00 32.69  ? 126 ASN B C     1 
ATOM   2469 O O     . ASN B 1 140 ? 15.067  -7.393  77.279  1.00 31.23  ? 126 ASN B O     1 
ATOM   2470 C CB    . ASN B 1 140 ? 12.982  -8.121  74.906  1.00 28.70  ? 126 ASN B CB    1 
ATOM   2471 C CG    . ASN B 1 140 ? 11.776  -7.522  74.203  1.00 31.43  ? 126 ASN B CG    1 
ATOM   2472 O OD1   . ASN B 1 140 ? 11.587  -6.308  74.175  1.00 30.40  ? 126 ASN B OD1   1 
ATOM   2473 N ND2   . ASN B 1 140 ? 10.944  -8.378  73.653  1.00 26.99  ? 126 ASN B ND2   1 
ATOM   2474 N N     . GLN B 1 141 ? 16.103  -8.430  75.581  1.00 34.35  ? 127 GLN B N     1 
ATOM   2475 C CA    . GLN B 1 141 ? 17.131  -8.949  76.451  1.00 37.44  ? 127 GLN B CA    1 
ATOM   2476 C C     . GLN B 1 141 ? 17.967  -7.781  76.992  1.00 34.05  ? 127 GLN B C     1 
ATOM   2477 O O     . GLN B 1 141 ? 18.294  -7.746  78.179  1.00 33.47  ? 127 GLN B O     1 
ATOM   2478 C CB    . GLN B 1 141 ? 17.976  -9.955  75.686  1.00 37.57  ? 127 GLN B CB    1 
ATOM   2479 C CG    . GLN B 1 141 ? 17.217  -11.258 75.480  1.00 47.42  ? 127 GLN B CG    1 
ATOM   2480 C CD    . GLN B 1 141 ? 18.000  -12.285 74.676  1.00 55.66  ? 127 GLN B CD    1 
ATOM   2481 O OE1   . GLN B 1 141 ? 18.307  -12.071 73.497  1.00 57.90  ? 127 GLN B OE1   1 
ATOM   2482 N NE2   . GLN B 1 141 ? 18.324  -13.411 75.309  1.00 57.30  ? 127 GLN B NE2   1 
ATOM   2483 N N     . LEU B 1 142 ? 18.274  -6.801  76.140  1.00 30.65  ? 128 LEU B N     1 
ATOM   2484 C CA    . LEU B 1 142 ? 19.051  -5.661  76.610  1.00 28.64  ? 128 LEU B CA    1 
ATOM   2485 C C     . LEU B 1 142 ? 18.248  -4.938  77.704  1.00 28.25  ? 128 LEU B C     1 
ATOM   2486 O O     . LEU B 1 142 ? 18.779  -4.638  78.756  1.00 22.09  ? 128 LEU B O     1 
ATOM   2487 C CB    . LEU B 1 142 ? 19.346  -4.712  75.458  1.00 31.29  ? 128 LEU B CB    1 
ATOM   2488 C CG    . LEU B 1 142 ? 20.559  -3.771  75.461  1.00 40.64  ? 128 LEU B CG    1 
ATOM   2489 C CD1   . LEU B 1 142 ? 20.090  -2.450  74.869  1.00 28.09  ? 128 LEU B CD1   1 
ATOM   2490 C CD2   . LEU B 1 142 ? 21.177  -3.575  76.842  1.00 28.51  ? 128 LEU B CD2   1 
ATOM   2491 N N     . PHE B 1 143 ? 16.962  -4.675  77.447  1.00 27.50  ? 129 PHE B N     1 
ATOM   2492 C CA    . PHE B 1 143 ? 16.111  -4.011  78.422  1.00 24.84  ? 129 PHE B CA    1 
ATOM   2493 C C     . PHE B 1 143 ? 16.078  -4.810  79.738  1.00 25.12  ? 129 PHE B C     1 
ATOM   2494 O O     . PHE B 1 143 ? 16.135  -4.220  80.810  1.00 22.89  ? 129 PHE B O     1 
ATOM   2495 C CB    . PHE B 1 143 ? 14.669  -3.819  77.864  1.00 24.76  ? 129 PHE B CB    1 
ATOM   2496 C CG    . PHE B 1 143 ? 14.498  -2.584  76.986  1.00 24.86  ? 129 PHE B CG    1 
ATOM   2497 C CD1   . PHE B 1 143 ? 14.781  -1.322  77.488  1.00 26.58  ? 129 PHE B CD1   1 
ATOM   2498 C CD2   . PHE B 1 143 ? 14.046  -2.690  75.665  1.00 23.41  ? 129 PHE B CD2   1 
ATOM   2499 C CE1   . PHE B 1 143 ? 14.614  -0.173  76.702  1.00 23.82  ? 129 PHE B CE1   1 
ATOM   2500 C CE2   . PHE B 1 143 ? 13.876  -1.554  74.876  1.00 31.05  ? 129 PHE B CE2   1 
ATOM   2501 C CZ    . PHE B 1 143 ? 14.166  -0.285  75.398  1.00 24.97  ? 129 PHE B CZ    1 
ATOM   2502 N N     . GLU B 1 144 ? 15.979  -6.142  79.657  1.00 22.39  ? 130 GLU B N     1 
ATOM   2503 C CA    . GLU B 1 144 ? 15.957  -6.978  80.861  1.00 25.54  ? 130 GLU B CA    1 
ATOM   2504 C C     . GLU B 1 144 ? 17.285  -6.850  81.605  1.00 26.77  ? 130 GLU B C     1 
ATOM   2505 O O     . GLU B 1 144 ? 17.328  -6.763  82.840  1.00 30.73  ? 130 GLU B O     1 
ATOM   2506 C CB    . GLU B 1 144 ? 15.724  -8.455  80.519  1.00 22.68  ? 130 GLU B CB    1 
ATOM   2507 C CG    . GLU B 1 144 ? 14.284  -8.809  80.138  1.00 33.97  ? 130 GLU B CG    1 
ATOM   2508 C CD    . GLU B 1 144 ? 13.266  -8.368  81.174  1.00 42.08  ? 130 GLU B CD    1 
ATOM   2509 O OE1   . GLU B 1 144 ? 13.497  -8.589  82.395  1.00 42.24  ? 130 GLU B OE1   1 
ATOM   2510 O OE2   . GLU B 1 144 ? 12.224  -7.801  80.759  1.00 43.38  ? 130 GLU B OE2   1 
ATOM   2511 N N     . ARG B 1 145 ? 18.368  -6.833  80.842  1.00 30.59  ? 131 ARG B N     1 
ATOM   2512 C CA    . ARG B 1 145 ? 19.686  -6.712  81.424  1.00 28.93  ? 131 ARG B CA    1 
ATOM   2513 C C     . ARG B 1 145 ? 19.781  -5.399  82.186  1.00 29.26  ? 131 ARG B C     1 
ATOM   2514 O O     . ARG B 1 145 ? 20.256  -5.350  83.325  1.00 29.16  ? 131 ARG B O     1 
ATOM   2515 C CB    . ARG B 1 145 ? 20.758  -6.759  80.333  1.00 26.86  ? 131 ARG B CB    1 
ATOM   2516 C CG    . ARG B 1 145 ? 22.154  -6.824  80.911  1.00 28.11  ? 131 ARG B CG    1 
ATOM   2517 C CD    . ARG B 1 145 ? 23.168  -7.136  79.848  1.00 35.31  ? 131 ARG B CD    1 
ATOM   2518 N NE    . ARG B 1 145 ? 24.490  -7.312  80.441  1.00 42.62  ? 131 ARG B NE    1 
ATOM   2519 C CZ    . ARG B 1 145 ? 25.580  -7.576  79.738  1.00 42.08  ? 131 ARG B CZ    1 
ATOM   2520 N NH1   . ARG B 1 145 ? 25.499  -7.689  78.414  1.00 40.70  ? 131 ARG B NH1   1 
ATOM   2521 N NH2   . ARG B 1 145 ? 26.741  -7.728  80.358  1.00 42.91  ? 131 ARG B NH2   1 
ATOM   2522 N N     . ILE B 1 146 ? 19.326  -4.331  81.550  1.00 27.42  ? 132 ILE B N     1 
ATOM   2523 C CA    . ILE B 1 146 ? 19.357  -3.029  82.187  1.00 26.17  ? 132 ILE B CA    1 
ATOM   2524 C C     . ILE B 1 146 ? 18.465  -3.010  83.409  1.00 28.09  ? 132 ILE B C     1 
ATOM   2525 O O     . ILE B 1 146 ? 18.851  -2.484  84.452  1.00 28.30  ? 132 ILE B O     1 
ATOM   2526 C CB    . ILE B 1 146 ? 18.880  -1.929  81.225  1.00 23.86  ? 132 ILE B CB    1 
ATOM   2527 C CG1   . ILE B 1 146 ? 19.951  -1.661  80.183  1.00 27.98  ? 132 ILE B CG1   1 
ATOM   2528 C CG2   . ILE B 1 146 ? 18.555  -0.667  82.003  1.00 27.08  ? 132 ILE B CG2   1 
ATOM   2529 C CD1   . ILE B 1 146 ? 19.477  -0.805  79.024  1.00 31.47  ? 132 ILE B CD1   1 
ATOM   2530 N N     . GLU B 1 147 ? 17.257  -3.558  83.283  1.00 22.61  ? 133 GLU B N     1 
ATOM   2531 C CA    . GLU B 1 147 ? 16.356  -3.552  84.426  1.00 29.49  ? 133 GLU B CA    1 
ATOM   2532 C C     . GLU B 1 147 ? 16.943  -4.349  85.607  1.00 26.65  ? 133 GLU B C     1 
ATOM   2533 O O     . GLU B 1 147 ? 16.781  -3.962  86.758  1.00 29.43  ? 133 GLU B O     1 
ATOM   2534 C CB    . GLU B 1 147 ? 15.001  -4.124  84.011  1.00 29.34  ? 133 GLU B CB    1 
ATOM   2535 C CG    . GLU B 1 147 ? 13.879  -3.548  84.798  1.00 33.98  ? 133 GLU B CG    1 
ATOM   2536 C CD    . GLU B 1 147 ? 12.537  -4.044  84.319  1.00 31.59  ? 133 GLU B CD    1 
ATOM   2537 O OE1   . GLU B 1 147 ? 12.344  -4.083  83.092  1.00 38.12  ? 133 GLU B OE1   1 
ATOM   2538 O OE2   . GLU B 1 147 ? 11.684  -4.382  85.160  1.00 36.23  ? 133 GLU B OE2   1 
ATOM   2539 N N     . VAL B 1 148 ? 17.633  -5.450  85.306  1.00 28.89  ? 134 VAL B N     1 
ATOM   2540 C CA    . VAL B 1 148 ? 18.261  -6.296  86.329  1.00 28.29  ? 134 VAL B CA    1 
ATOM   2541 C C     . VAL B 1 148 ? 19.345  -5.528  87.084  1.00 29.58  ? 134 VAL B C     1 
ATOM   2542 O O     . VAL B 1 148 ? 19.500  -5.692  88.301  1.00 27.29  ? 134 VAL B O     1 
ATOM   2543 C CB    . VAL B 1 148 ? 18.899  -7.550  85.703  1.00 28.92  ? 134 VAL B CB    1 
ATOM   2544 C CG1   . VAL B 1 148 ? 19.642  -8.347  86.764  1.00 19.99  ? 134 VAL B CG1   1 
ATOM   2545 C CG2   . VAL B 1 148 ? 17.837  -8.411  85.038  1.00 19.98  ? 134 VAL B CG2   1 
ATOM   2546 N N     . GLN B 1 149 ? 20.081  -4.688  86.355  1.00 26.92  ? 135 GLN B N     1 
ATOM   2547 C CA    . GLN B 1 149 ? 21.133  -3.845  86.928  1.00 28.50  ? 135 GLN B CA    1 
ATOM   2548 C C     . GLN B 1 149 ? 20.516  -2.746  87.798  1.00 30.69  ? 135 GLN B C     1 
ATOM   2549 O O     . GLN B 1 149 ? 21.030  -2.417  88.866  1.00 29.22  ? 135 GLN B O     1 
ATOM   2550 C CB    . GLN B 1 149 ? 21.947  -3.191  85.820  1.00 28.01  ? 135 GLN B CB    1 
ATOM   2551 C CG    . GLN B 1 149 ? 23.057  -2.283  86.356  1.00 34.34  ? 135 GLN B CG    1 
ATOM   2552 C CD    . GLN B 1 149 ? 24.109  -3.044  87.147  1.00 31.13  ? 135 GLN B CD    1 
ATOM   2553 O OE1   . GLN B 1 149 ? 25.047  -3.581  86.572  1.00 37.47  ? 135 GLN B OE1   1 
ATOM   2554 N NE2   . GLN B 1 149 ? 23.938  -3.113  88.475  1.00 31.50  ? 135 GLN B NE2   1 
ATOM   2555 N N     . LEU B 1 150 ? 19.415  -2.165  87.320  1.00 30.90  ? 136 LEU B N     1 
ATOM   2556 C CA    . LEU B 1 150 ? 18.693  -1.127  88.069  1.00 26.49  ? 136 LEU B CA    1 
ATOM   2557 C C     . LEU B 1 150 ? 18.210  -1.713  89.409  1.00 26.56  ? 136 LEU B C     1 
ATOM   2558 O O     . LEU B 1 150 ? 18.269  -1.051  90.457  1.00 27.21  ? 136 LEU B O     1 
ATOM   2559 C CB    . LEU B 1 150 ? 17.500  -0.625  87.253  1.00 24.14  ? 136 LEU B CB    1 
ATOM   2560 C CG    . LEU B 1 150 ? 17.806  0.356   86.143  1.00 27.48  ? 136 LEU B CG    1 
ATOM   2561 C CD1   . LEU B 1 150 ? 16.442  0.808   85.501  1.00 24.97  ? 136 LEU B CD1   1 
ATOM   2562 C CD2   . LEU B 1 150 ? 18.514  1.553   86.721  1.00 28.19  ? 136 LEU B CD2   1 
ATOM   2563 N N     . ARG B 1 151 ? 17.769  -2.972  89.366  1.00 26.13  ? 137 ARG B N     1 
ATOM   2564 C CA    . ARG B 1 151 ? 17.291  -3.716  90.538  1.00 28.89  ? 137 ARG B CA    1 
ATOM   2565 C C     . ARG B 1 151 ? 18.454  -3.971  91.508  1.00 30.59  ? 137 ARG B C     1 
ATOM   2566 O O     . ARG B 1 151 ? 18.313  -3.850  92.730  1.00 27.18  ? 137 ARG B O     1 
ATOM   2567 C CB    . ARG B 1 151 ? 16.719  -5.049  90.058  1.00 31.86  ? 137 ARG B CB    1 
ATOM   2568 C CG    . ARG B 1 151 ? 15.392  -5.416  90.611  1.00 34.01  ? 137 ARG B CG    1 
ATOM   2569 C CD    . ARG B 1 151 ? 14.517  -6.055  89.544  1.00 28.79  ? 137 ARG B CD    1 
ATOM   2570 N NE    . ARG B 1 151 ? 15.168  -7.135  88.805  1.00 31.25  ? 137 ARG B NE    1 
ATOM   2571 C CZ    . ARG B 1 151 ? 14.918  -7.401  87.525  1.00 35.01  ? 137 ARG B CZ    1 
ATOM   2572 N NH1   . ARG B 1 151 ? 14.039  -6.670  86.856  1.00 36.34  ? 137 ARG B NH1   1 
ATOM   2573 N NH2   . ARG B 1 151 ? 15.551  -8.383  86.903  1.00 36.05  ? 137 ARG B NH2   1 
ATOM   2574 N N     . GLN B 1 152 ? 19.606  -4.343  90.955  1.00 30.62  ? 138 GLN B N     1 
ATOM   2575 C CA    . GLN B 1 152 ? 20.773  -4.597  91.785  1.00 30.17  ? 138 GLN B CA    1 
ATOM   2576 C C     . GLN B 1 152 ? 21.166  -3.318  92.501  1.00 27.05  ? 138 GLN B C     1 
ATOM   2577 O O     . GLN B 1 152 ? 21.422  -3.351  93.703  1.00 27.38  ? 138 GLN B O     1 
ATOM   2578 C CB    . GLN B 1 152 ? 21.968  -5.100  90.966  1.00 30.10  ? 138 GLN B CB    1 
ATOM   2579 C CG    . GLN B 1 152 ? 23.103  -5.657  91.855  1.00 42.99  ? 138 GLN B CG    1 
ATOM   2580 C CD    . GLN B 1 152 ? 22.583  -6.631  92.936  1.00 55.69  ? 138 GLN B CD    1 
ATOM   2581 O OE1   . GLN B 1 152 ? 21.868  -7.596  92.635  1.00 57.57  ? 138 GLN B OE1   1 
ATOM   2582 N NE2   . GLN B 1 152 ? 22.941  -6.371  94.197  1.00 52.76  ? 138 GLN B NE2   1 
ATOM   2583 N N     . VAL B 1 153 ? 21.224  -2.200  91.770  1.00 27.05  ? 139 VAL B N     1 
ATOM   2584 C CA    . VAL B 1 153 ? 21.581  -0.908  92.372  1.00 25.33  ? 139 VAL B CA    1 
ATOM   2585 C C     . VAL B 1 153 ? 20.659  -0.571  93.541  1.00 26.06  ? 139 VAL B C     1 
ATOM   2586 O O     . VAL B 1 153 ? 21.131  -0.248  94.642  1.00 25.86  ? 139 VAL B O     1 
ATOM   2587 C CB    . VAL B 1 153 ? 21.571  0.240   91.315  1.00 22.07  ? 139 VAL B CB    1 
ATOM   2588 C CG1   . VAL B 1 153 ? 21.504  1.615   91.988  1.00 20.44  ? 139 VAL B CG1   1 
ATOM   2589 C CG2   . VAL B 1 153 ? 22.854  0.192   90.503  1.00 22.33  ? 139 VAL B CG2   1 
ATOM   2590 N N     . MET B 1 154 ? 19.347  -0.675  93.314  1.00 26.02  ? 140 MET B N     1 
ATOM   2591 C CA    . MET B 1 154 ? 18.377  -0.378  94.354  1.00 25.31  ? 140 MET B CA    1 
ATOM   2592 C C     . MET B 1 154 ? 18.517  -1.271  95.578  1.00 24.65  ? 140 MET B C     1 
ATOM   2593 O O     . MET B 1 154 ? 18.412  -0.799  96.722  1.00 22.32  ? 140 MET B O     1 
ATOM   2594 C CB    . MET B 1 154 ? 16.950  -0.510  93.796  1.00 23.13  ? 140 MET B CB    1 
ATOM   2595 C CG    . MET B 1 154 ? 16.552  0.609   92.887  1.00 28.22  ? 140 MET B CG    1 
ATOM   2596 S SD    . MET B 1 154 ? 15.057  0.164   91.956  1.00 29.57  ? 140 MET B SD    1 
ATOM   2597 C CE    . MET B 1 154 ? 15.288  1.086   90.528  1.00 31.67  ? 140 MET B CE    1 
ATOM   2598 N N     . ARG B 1 155 ? 18.733  -2.568  95.358  1.00 28.26  ? 141 ARG B N     1 
ATOM   2599 C CA    . ARG B 1 155 ? 18.860  -3.489  96.491  1.00 34.98  ? 141 ARG B CA    1 
ATOM   2600 C C     . ARG B 1 155 ? 20.061  -3.193  97.376  1.00 32.79  ? 141 ARG B C     1 
ATOM   2601 O O     . ARG B 1 155 ? 20.039  -3.489  98.564  1.00 35.36  ? 141 ARG B O     1 
ATOM   2602 C CB    . ARG B 1 155 ? 18.946  -4.951  96.024  1.00 39.85  ? 141 ARG B CB    1 
ATOM   2603 C CG    . ARG B 1 155 ? 17.641  -5.479  95.439  1.00 55.37  ? 141 ARG B CG    1 
ATOM   2604 C CD    . ARG B 1 155 ? 17.603  -7.005  95.373  1.00 59.51  ? 141 ARG B CD    1 
ATOM   2605 N NE    . ARG B 1 155 ? 16.609  -7.473  94.404  1.00 65.37  ? 141 ARG B NE    1 
ATOM   2606 C CZ    . ARG B 1 155 ? 16.904  -7.869  93.165  1.00 64.34  ? 141 ARG B CZ    1 
ATOM   2607 N NH1   . ARG B 1 155 ? 18.172  -7.853  92.747  1.00 57.08  ? 141 ARG B NH1   1 
ATOM   2608 N NH2   . ARG B 1 155 ? 15.933  -8.288  92.350  1.00 61.29  ? 141 ARG B NH2   1 
ATOM   2609 N N     . GLU B 1 156 ? 21.099  -2.602  96.808  1.00 26.01  ? 142 GLU B N     1 
ATOM   2610 C CA    . GLU B 1 156 ? 22.282  -2.316  97.597  1.00 30.66  ? 142 GLU B CA    1 
ATOM   2611 C C     . GLU B 1 156 ? 22.170  -1.076  98.445  1.00 30.96  ? 142 GLU B C     1 
ATOM   2612 O O     . GLU B 1 156 ? 23.045  -0.807  99.254  1.00 24.79  ? 142 GLU B O     1 
ATOM   2613 C CB    . GLU B 1 156 ? 23.516  -2.243  96.688  1.00 23.22  ? 142 GLU B CB    1 
ATOM   2614 C CG    . GLU B 1 156 ? 23.851  -3.625  96.137  1.00 29.28  ? 142 GLU B CG    1 
ATOM   2615 C CD    . GLU B 1 156 ? 25.057  -3.655  95.222  1.00 25.27  ? 142 GLU B CD    1 
ATOM   2616 O OE1   . GLU B 1 156 ? 25.315  -4.736  94.646  1.00 32.38  ? 142 GLU B OE1   1 
ATOM   2617 O OE2   . GLU B 1 156 ? 25.746  -2.616  95.085  1.00 31.25  ? 142 GLU B OE2   1 
ATOM   2618 N N     . LYS B 1 157 ? 21.074  -0.341  98.286  1.00 29.87  ? 143 LYS B N     1 
ATOM   2619 C CA    . LYS B 1 157 ? 20.889  0.876   99.042  1.00 28.93  ? 143 LYS B CA    1 
ATOM   2620 C C     . LYS B 1 157 ? 20.908  0.627   100.557 1.00 32.17  ? 143 LYS B C     1 
ATOM   2621 O O     . LYS B 1 157 ? 21.534  1.381   101.328 1.00 27.95  ? 143 LYS B O     1 
ATOM   2622 C CB    . LYS B 1 157 ? 19.577  1.530   98.624  1.00 26.49  ? 143 LYS B CB    1 
ATOM   2623 C CG    . LYS B 1 157 ? 19.321  2.877   99.285  1.00 29.24  ? 143 LYS B CG    1 
ATOM   2624 C CD    . LYS B 1 157 ? 18.005  3.480   98.792  1.00 37.76  ? 143 LYS B CD    1 
ATOM   2625 C CE    . LYS B 1 157 ? 17.570  4.644   99.642  1.00 41.50  ? 143 LYS B CE    1 
ATOM   2626 N NZ    . LYS B 1 157 ? 18.596  5.719   99.619  1.00 46.11  ? 143 LYS B NZ    1 
ATOM   2627 N N     . LYS B 1 158 ? 20.254  -0.441  100.993 1.00 36.09  ? 144 LYS B N     1 
ATOM   2628 C CA    . LYS B 1 158 ? 20.203  -0.732  102.426 1.00 43.41  ? 144 LYS B CA    1 
ATOM   2629 C C     . LYS B 1 158 ? 21.594  -0.983  103.017 1.00 40.27  ? 144 LYS B C     1 
ATOM   2630 O O     . LYS B 1 158 ? 21.925  -0.436  104.079 1.00 38.68  ? 144 LYS B O     1 
ATOM   2631 C CB    . LYS B 1 158 ? 19.287  -1.930  102.690 1.00 50.05  ? 144 LYS B CB    1 
ATOM   2632 C CG    . LYS B 1 158 ? 19.661  -3.178  101.883 1.00 61.58  ? 144 LYS B CG    1 
ATOM   2633 C CD    . LYS B 1 158 ? 18.680  -4.315  102.174 1.00 67.56  ? 144 LYS B CD    1 
ATOM   2634 C CE    . LYS B 1 158 ? 19.116  -5.625  101.509 1.00 75.76  ? 144 LYS B CE    1 
ATOM   2635 N NZ    . LYS B 1 158 ? 18.275  -6.788  101.945 1.00 76.13  ? 144 LYS B NZ    1 
ATOM   2636 N N     . MET B 1 159 ? 22.396  -1.797  102.330 1.00 38.04  ? 145 MET B N     1 
ATOM   2637 C CA    . MET B 1 159 ? 23.756  -2.118  102.779 1.00 36.44  ? 145 MET B CA    1 
ATOM   2638 C C     . MET B 1 159 ? 24.656  -0.914  102.733 1.00 34.54  ? 145 MET B C     1 
ATOM   2639 O O     . MET B 1 159 ? 25.507  -0.698  103.610 1.00 35.79  ? 145 MET B O     1 
ATOM   2640 C CB    . MET B 1 159 ? 24.364  -3.170  101.885 1.00 37.95  ? 145 MET B CB    1 
ATOM   2641 C CG    . MET B 1 159 ? 23.868  -4.529  102.173 1.00 45.29  ? 145 MET B CG    1 
ATOM   2642 S SD    . MET B 1 159 ? 24.315  -5.501  100.798 1.00 49.94  ? 145 MET B SD    1 
ATOM   2643 C CE    . MET B 1 159 ? 22.840  -5.356  99.860  1.00 31.87  ? 145 MET B CE    1 
ATOM   2644 N N     . ARG B 1 160 ? 24.488  -0.148  101.672 1.00 29.55  ? 146 ARG B N     1 
ATOM   2645 C CA    . ARG B 1 160 ? 25.281  1.034   101.487 1.00 31.60  ? 146 ARG B CA    1 
ATOM   2646 C C     . ARG B 1 160 ? 24.875  2.169   102.413 1.00 36.24  ? 146 ARG B C     1 
ATOM   2647 O O     . ARG B 1 160 ? 25.645  2.576   103.268 1.00 45.22  ? 146 ARG B O     1 
ATOM   2648 C CB    . ARG B 1 160 ? 25.201  1.485   100.032 1.00 21.98  ? 146 ARG B CB    1 
ATOM   2649 C CG    . ARG B 1 160 ? 25.838  0.519   99.062  1.00 16.61  ? 146 ARG B CG    1 
ATOM   2650 C CD    . ARG B 1 160 ? 25.741  0.980   97.617  1.00 17.21  ? 146 ARG B CD    1 
ATOM   2651 N NE    . ARG B 1 160 ? 26.378  0.011   96.720  1.00 25.72  ? 146 ARG B NE    1 
ATOM   2652 C CZ    . ARG B 1 160 ? 27.656  0.078   96.340  1.00 33.37  ? 146 ARG B CZ    1 
ATOM   2653 N NH1   . ARG B 1 160 ? 28.430  1.067   96.768  1.00 31.24  ? 146 ARG B NH1   1 
ATOM   2654 N NH2   . ARG B 1 160 ? 28.156  -0.849  95.546  1.00 29.52  ? 146 ARG B NH2   1 
ATOM   2655 N N     . GLU B 1 161 ? 23.648  2.646   102.272 1.00 45.34  ? 147 GLU B N     1 
ATOM   2656 C CA    . GLU B 1 161 ? 23.182  3.782   103.046 1.00 45.15  ? 147 GLU B CA    1 
ATOM   2657 C C     . GLU B 1 161 ? 22.361  3.470   104.285 1.00 46.72  ? 147 GLU B C     1 
ATOM   2658 O O     . GLU B 1 161 ? 21.918  4.388   104.963 1.00 50.57  ? 147 GLU B O     1 
ATOM   2659 C CB    . GLU B 1 161 ? 22.433  4.751   102.097 1.00 45.78  ? 147 GLU B CB    1 
ATOM   2660 C CG    . GLU B 1 161 ? 22.226  4.179   100.688 1.00 45.35  ? 147 GLU B CG    1 
ATOM   2661 C CD    . GLU B 1 161 ? 22.271  5.207   99.541  1.00 50.04  ? 147 GLU B CD    1 
ATOM   2662 O OE1   . GLU B 1 161 ? 21.364  6.064   99.490  1.00 41.50  ? 147 GLU B OE1   1 
ATOM   2663 O OE2   . GLU B 1 161 ? 23.209  5.141   98.687  1.00 39.70  ? 147 GLU B OE2   1 
ATOM   2664 N N     . GLY B 1 162 ? 22.162  2.192   104.594 1.00 48.26  ? 148 GLY B N     1 
ATOM   2665 C CA    . GLY B 1 162 ? 21.404  1.846   105.791 1.00 56.38  ? 148 GLY B CA    1 
ATOM   2666 C C     . GLY B 1 162 ? 19.953  1.396   105.626 1.00 61.89  ? 148 GLY B C     1 
ATOM   2667 O O     . GLY B 1 162 ? 19.611  0.246   105.948 1.00 61.52  ? 148 GLY B O     1 
ATOM   2668 N N     . GLU B 1 163 ? 19.086  2.296   105.160 1.00 61.04  ? 149 GLU B N     1 
ATOM   2669 C CA    . GLU B 1 163 ? 17.680  1.949   104.954 1.00 59.61  ? 149 GLU B CA    1 
ATOM   2670 C C     . GLU B 1 163 ? 17.385  1.897   103.458 1.00 57.23  ? 149 GLU B C     1 
ATOM   2671 O O     . GLU B 1 163 ? 17.703  2.823   102.702 1.00 52.64  ? 149 GLU B O     1 
ATOM   2672 C CB    . GLU B 1 163 ? 16.747  2.964   105.641 1.00 65.04  ? 149 GLU B CB    1 
ATOM   2673 C CG    . GLU B 1 163 ? 16.435  4.235   104.840 1.00 73.36  ? 149 GLU B CG    1 
ATOM   2674 C CD    . GLU B 1 163 ? 17.656  5.110   104.596 1.00 78.83  ? 149 GLU B CD    1 
ATOM   2675 O OE1   . GLU B 1 163 ? 18.625  4.627   103.964 1.00 77.23  ? 149 GLU B OE1   1 
ATOM   2676 O OE2   . GLU B 1 163 ? 17.640  6.285   105.040 1.00 83.43  ? 149 GLU B OE2   1 
ATOM   2677 N N     . GLY B 1 164 ? 16.781  0.804   103.024 1.00 54.15  ? 150 GLY B N     1 
ATOM   2678 C CA    . GLY B 1 164 ? 16.482  0.690   101.614 1.00 53.61  ? 150 GLY B CA    1 
ATOM   2679 C C     . GLY B 1 164 ? 15.161  1.326   101.251 1.00 47.43  ? 150 GLY B C     1 
ATOM   2680 O O     . GLY B 1 164 ? 14.686  2.268   101.892 1.00 48.84  ? 150 GLY B O     1 
ATOM   2681 N N     . TYR B 1 165 ? 14.569  0.781   100.206 1.00 43.11  ? 151 TYR B N     1 
ATOM   2682 C CA    . TYR B 1 165 ? 13.296  1.242   99.717  1.00 36.57  ? 151 TYR B CA    1 
ATOM   2683 C C     . TYR B 1 165 ? 12.166  0.470   100.364 1.00 37.64  ? 151 TYR B C     1 
ATOM   2684 O O     . TYR B 1 165 ? 12.262  -0.735  100.607 1.00 40.40  ? 151 TYR B O     1 
ATOM   2685 C CB    . TYR B 1 165 ? 13.215  1.035   98.210  1.00 33.65  ? 151 TYR B CB    1 
ATOM   2686 C CG    . TYR B 1 165 ? 14.159  1.900   97.459  1.00 30.81  ? 151 TYR B CG    1 
ATOM   2687 C CD1   . TYR B 1 165 ? 13.988  3.283   97.436  1.00 29.85  ? 151 TYR B CD1   1 
ATOM   2688 C CD2   . TYR B 1 165 ? 15.239  1.349   96.788  1.00 29.85  ? 151 TYR B CD2   1 
ATOM   2689 C CE1   . TYR B 1 165 ? 14.872  4.096   96.761  1.00 33.11  ? 151 TYR B CE1   1 
ATOM   2690 C CE2   . TYR B 1 165 ? 16.137  2.150   96.108  1.00 32.77  ? 151 TYR B CE2   1 
ATOM   2691 C CZ    . TYR B 1 165 ? 15.951  3.518   96.099  1.00 36.49  ? 151 TYR B CZ    1 
ATOM   2692 O OH    . TYR B 1 165 ? 16.859  4.298   95.448  1.00 39.97  ? 151 TYR B OH    1 
ATOM   2693 N N     . THR B 1 166 ? 11.087  1.176   100.629 1.00 35.33  ? 152 THR B N     1 
ATOM   2694 C CA    . THR B 1 166 ? 9.912   0.571   101.206 1.00 42.02  ? 152 THR B CA    1 
ATOM   2695 C C     . THR B 1 166 ? 9.247   -0.378  100.201 1.00 42.34  ? 152 THR B C     1 
ATOM   2696 O O     . THR B 1 166 ? 8.769   -1.452  100.568 1.00 44.69  ? 152 THR B O     1 
ATOM   2697 C CB    . THR B 1 166 ? 8.959   1.681   101.635 1.00 41.49  ? 152 THR B CB    1 
ATOM   2698 O OG1   . THR B 1 166 ? 9.369   2.128   102.924 1.00 49.07  ? 152 THR B OG1   1 
ATOM   2699 C CG2   . THR B 1 166 ? 7.506   1.208   101.678 1.00 48.00  ? 152 THR B CG2   1 
ATOM   2700 N N     . LEU B 1 167 ? 9.256   -0.001  98.924  1.00 40.48  ? 153 LEU B N     1 
ATOM   2701 C CA    . LEU B 1 167 ? 8.626   -0.810  97.896  1.00 33.58  ? 153 LEU B CA    1 
ATOM   2702 C C     . LEU B 1 167 ? 9.572   -1.811  97.244  1.00 33.75  ? 153 LEU B C     1 
ATOM   2703 O O     . LEU B 1 167 ? 10.796  -1.680  97.338  1.00 33.84  ? 153 LEU B O     1 
ATOM   2704 C CB    . LEU B 1 167 ? 8.022   0.127   96.848  1.00 39.60  ? 153 LEU B CB    1 
ATOM   2705 C CG    . LEU B 1 167 ? 7.177   1.222   97.535  1.00 44.64  ? 153 LEU B CG    1 
ATOM   2706 C CD1   . LEU B 1 167 ? 6.907   2.385   96.604  1.00 42.92  ? 153 LEU B CD1   1 
ATOM   2707 C CD2   . LEU B 1 167 ? 5.872   0.611   98.043  1.00 45.74  ? 153 LEU B CD2   1 
ATOM   2708 N N     . ASP B 1 168 ? 9.000   -2.814  96.584  1.00 32.02  ? 154 ASP B N     1 
ATOM   2709 C CA    . ASP B 1 168 ? 9.787   -3.847  95.893  1.00 35.70  ? 154 ASP B CA    1 
ATOM   2710 C C     . ASP B 1 168 ? 10.631  -3.214  94.806  1.00 29.65  ? 154 ASP B C     1 
ATOM   2711 O O     . ASP B 1 168 ? 10.133  -2.376  94.053  1.00 27.11  ? 154 ASP B O     1 
ATOM   2712 C CB    . ASP B 1 168 ? 8.872   -4.893  95.247  1.00 36.20  ? 154 ASP B CB    1 
ATOM   2713 C CG    . ASP B 1 168 ? 9.579   -6.224  95.017  1.00 55.28  ? 154 ASP B CG    1 
ATOM   2714 O OD1   . ASP B 1 168 ? 10.514  -6.289  94.183  1.00 56.09  ? 154 ASP B OD1   1 
ATOM   2715 O OD2   . ASP B 1 168 ? 9.195   -7.214  95.689  1.00 66.99  ? 154 ASP B OD2   1 
ATOM   2716 N N     . GLU B 1 169 ? 11.896  -3.626  94.729  1.00 26.68  ? 155 GLU B N     1 
ATOM   2717 C CA    . GLU B 1 169 ? 12.821  -3.102  93.727  1.00 28.74  ? 155 GLU B CA    1 
ATOM   2718 C C     . GLU B 1 169 ? 12.321  -3.448  92.329  1.00 30.24  ? 155 GLU B C     1 
ATOM   2719 O O     . GLU B 1 169 ? 12.607  -2.738  91.381  1.00 26.65  ? 155 GLU B O     1 
ATOM   2720 C CB    . GLU B 1 169 ? 14.236  -3.710  93.875  1.00 33.17  ? 155 GLU B CB    1 
ATOM   2721 C CG    . GLU B 1 169 ? 15.029  -3.275  95.118  1.00 46.82  ? 155 GLU B CG    1 
ATOM   2722 C CD    . GLU B 1 169 ? 14.434  -3.788  96.430  1.00 49.07  ? 155 GLU B CD    1 
ATOM   2723 O OE1   . GLU B 1 169 ? 14.076  -4.997  96.478  1.00 42.23  ? 155 GLU B OE1   1 
ATOM   2724 O OE2   . GLU B 1 169 ? 14.340  -2.990  97.401  1.00 48.24  ? 155 GLU B OE2   1 
ATOM   2725 N N     . THR B 1 170 ? 11.600  -4.552  92.191  1.00 31.15  ? 156 THR B N     1 
ATOM   2726 C CA    . THR B 1 170 ? 11.111  -4.934  90.875  1.00 34.90  ? 156 THR B CA    1 
ATOM   2727 C C     . THR B 1 170 ? 10.076  -3.925  90.380  1.00 31.86  ? 156 THR B C     1 
ATOM   2728 O O     . THR B 1 170 ? 10.001  -3.625  89.186  1.00 30.43  ? 156 THR B O     1 
ATOM   2729 C CB    . THR B 1 170 ? 10.486  -6.349  90.878  1.00 36.97  ? 156 THR B CB    1 
ATOM   2730 O OG1   . THR B 1 170 ? 11.456  -7.302  91.338  1.00 44.04  ? 156 THR B OG1   1 
ATOM   2731 C CG2   . THR B 1 170 ? 10.059  -6.729  89.459  1.00 35.62  ? 156 THR B CG2   1 
ATOM   2732 N N     . LEU B 1 171 ? 9.274   -3.419  91.304  1.00 28.66  ? 157 LEU B N     1 
ATOM   2733 C CA    . LEU B 1 171 ? 8.276   -2.436  90.962  1.00 27.40  ? 157 LEU B CA    1 
ATOM   2734 C C     . LEU B 1 171 ? 8.958   -1.129  90.585  1.00 26.56  ? 157 LEU B C     1 
ATOM   2735 O O     . LEU B 1 171 ? 8.601   -0.511  89.588  1.00 27.22  ? 157 LEU B O     1 
ATOM   2736 C CB    . LEU B 1 171 ? 7.362   -2.178  92.151  1.00 31.66  ? 157 LEU B CB    1 
ATOM   2737 C CG    . LEU B 1 171 ? 6.278   -1.119  91.932  1.00 34.82  ? 157 LEU B CG    1 
ATOM   2738 C CD1   . LEU B 1 171 ? 5.239   -1.657  90.965  1.00 36.94  ? 157 LEU B CD1   1 
ATOM   2739 C CD2   . LEU B 1 171 ? 5.614   -0.790  93.269  1.00 35.83  ? 157 LEU B CD2   1 
ATOM   2740 N N     . LEU B 1 172 ? 9.951   -0.724  91.380  1.00 25.93  ? 158 LEU B N     1 
ATOM   2741 C CA    . LEU B 1 172 ? 10.665  0.544   91.160  1.00 26.36  ? 158 LEU B CA    1 
ATOM   2742 C C     . LEU B 1 172 ? 11.519  0.596   89.887  1.00 24.55  ? 158 LEU B C     1 
ATOM   2743 O O     . LEU B 1 172 ? 11.546  1.610   89.183  1.00 23.11  ? 158 LEU B O     1 
ATOM   2744 C CB    . LEU B 1 172 ? 11.550  0.877   92.372  1.00 20.19  ? 158 LEU B CB    1 
ATOM   2745 C CG    . LEU B 1 172 ? 10.864  0.925   93.748  1.00 27.58  ? 158 LEU B CG    1 
ATOM   2746 C CD1   . LEU B 1 172 ? 11.819  1.478   94.815  1.00 22.50  ? 158 LEU B CD1   1 
ATOM   2747 C CD2   . LEU B 1 172 ? 9.617   1.795   93.656  1.00 20.52  ? 158 LEU B CD2   1 
ATOM   2748 N N     . ALA B 1 173 ? 12.206  -0.494  89.583  1.00 23.89  ? 159 ALA B N     1 
ATOM   2749 C CA    . ALA B 1 173 ? 13.053  -0.511  88.409  1.00 24.52  ? 159 ALA B CA    1 
ATOM   2750 C C     . ALA B 1 173 ? 12.196  -0.555  87.151  1.00 26.14  ? 159 ALA B C     1 
ATOM   2751 O O     . ALA B 1 173 ? 12.588  0.011   86.132  1.00 25.40  ? 159 ALA B O     1 
ATOM   2752 C CB    . ALA B 1 173 ? 14.023  -1.699  88.458  1.00 18.99  ? 159 ALA B CB    1 
ATOM   2753 N N     . SER B 1 174 ? 11.026  -1.197  87.205  1.00 21.74  ? 160 SER B N     1 
ATOM   2754 C CA    . SER B 1 174 ? 10.180  -1.245  86.010  1.00 25.38  ? 160 SER B CA    1 
ATOM   2755 C C     . SER B 1 174 ? 9.584   0.151   85.810  1.00 21.73  ? 160 SER B C     1 
ATOM   2756 O O     . SER B 1 174 ? 9.420   0.631   84.681  1.00 22.66  ? 160 SER B O     1 
ATOM   2757 C CB    . SER B 1 174 ? 9.056   -2.291  86.153  1.00 16.98  ? 160 SER B CB    1 
ATOM   2758 O OG    . SER B 1 174 ? 8.249   -2.017  87.284  1.00 30.82  ? 160 SER B OG    1 
ATOM   2759 N N     . GLN B 1 175 ? 9.240   0.778   86.917  1.00 20.49  ? 161 GLN B N     1 
ATOM   2760 C CA    . GLN B 1 175 ? 8.692   2.125   86.909  1.00 23.21  ? 161 GLN B CA    1 
ATOM   2761 C C     . GLN B 1 175 ? 9.739   3.008   86.227  1.00 25.52  ? 161 GLN B C     1 
ATOM   2762 O O     . GLN B 1 175 ? 9.412   3.794   85.337  1.00 25.59  ? 161 GLN B O     1 
ATOM   2763 C CB    . GLN B 1 175 ? 8.466   2.565   88.347  1.00 25.17  ? 161 GLN B CB    1 
ATOM   2764 C CG    . GLN B 1 175 ? 7.601   3.777   88.527  1.00 31.40  ? 161 GLN B CG    1 
ATOM   2765 C CD    . GLN B 1 175 ? 6.117   3.570   88.163  1.00 35.29  ? 161 GLN B CD    1 
ATOM   2766 O OE1   . GLN B 1 175 ? 5.637   2.453   87.921  1.00 26.07  ? 161 GLN B OE1   1 
ATOM   2767 N NE2   . GLN B 1 175 ? 5.387   4.672   88.139  1.00 27.72  ? 161 GLN B NE2   1 
ATOM   2768 N N     . LEU B 1 176 ? 11.007  2.837   86.617  1.00 24.71  ? 162 LEU B N     1 
ATOM   2769 C CA    . LEU B 1 176 ? 12.096  3.623   86.045  1.00 26.07  ? 162 LEU B CA    1 
ATOM   2770 C C     . LEU B 1 176 ? 12.286  3.425   84.554  1.00 28.73  ? 162 LEU B C     1 
ATOM   2771 O O     . LEU B 1 176 ? 12.452  4.384   83.792  1.00 23.46  ? 162 LEU B O     1 
ATOM   2772 C CB    . LEU B 1 176 ? 13.406  3.300   86.767  1.00 30.61  ? 162 LEU B CB    1 
ATOM   2773 C CG    . LEU B 1 176 ? 14.194  4.515   87.255  1.00 38.30  ? 162 LEU B CG    1 
ATOM   2774 C CD1   . LEU B 1 176 ? 13.293  5.499   87.960  1.00 29.73  ? 162 LEU B CD1   1 
ATOM   2775 C CD2   . LEU B 1 176 ? 15.284  4.030   88.188  1.00 41.45  ? 162 LEU B CD2   1 
ATOM   2776 N N     . LEU B 1 177 ? 12.246  2.173   84.125  1.00 26.22  ? 163 LEU B N     1 
ATOM   2777 C CA    . LEU B 1 177 ? 12.455  1.881   82.731  1.00 31.71  ? 163 LEU B CA    1 
ATOM   2778 C C     . LEU B 1 177 ? 11.236  2.276   81.916  1.00 27.55  ? 163 LEU B C     1 
ATOM   2779 O O     . LEU B 1 177 ? 11.356  2.702   80.776  1.00 26.61  ? 163 LEU B O     1 
ATOM   2780 C CB    . LEU B 1 177 ? 12.802  0.402   82.564  1.00 37.21  ? 163 LEU B CB    1 
ATOM   2781 C CG    . LEU B 1 177 ? 13.722  0.112   81.380  1.00 42.77  ? 163 LEU B CG    1 
ATOM   2782 C CD1   . LEU B 1 177 ? 14.867  1.129   81.319  1.00 41.90  ? 163 LEU B CD1   1 
ATOM   2783 C CD2   . LEU B 1 177 ? 14.260  -1.293  81.529  1.00 45.13  ? 163 LEU B CD2   1 
ATOM   2784 N N     . ALA B 1 178 ? 10.066  2.154   82.515  1.00 28.78  ? 164 ALA B N     1 
ATOM   2785 C CA    . ALA B 1 178 ? 8.856   2.548   81.835  1.00 29.43  ? 164 ALA B CA    1 
ATOM   2786 C C     . ALA B 1 178 ? 9.009   4.017   81.480  1.00 27.04  ? 164 ALA B C     1 
ATOM   2787 O O     . ALA B 1 178 ? 8.650   4.438   80.367  1.00 25.42  ? 164 ALA B O     1 
ATOM   2788 C CB    . ALA B 1 178 ? 7.655   2.362   82.731  1.00 26.70  ? 164 ALA B CB    1 
ATOM   2789 N N     . PHE B 1 179 ? 9.541   4.804   82.416  1.00 22.91  ? 165 PHE B N     1 
ATOM   2790 C CA    . PHE B 1 179 ? 9.714   6.230   82.135  1.00 25.08  ? 165 PHE B CA    1 
ATOM   2791 C C     . PHE B 1 179 ? 10.653  6.436   80.953  1.00 25.01  ? 165 PHE B C     1 
ATOM   2792 O O     . PHE B 1 179 ? 10.364  7.230   80.050  1.00 23.98  ? 165 PHE B O     1 
ATOM   2793 C CB    . PHE B 1 179 ? 10.232  6.975   83.360  1.00 27.84  ? 165 PHE B CB    1 
ATOM   2794 C CG    . PHE B 1 179 ? 10.768  8.354   83.049  1.00 23.54  ? 165 PHE B CG    1 
ATOM   2795 C CD1   . PHE B 1 179 ? 9.911   9.398   82.733  1.00 23.12  ? 165 PHE B CD1   1 
ATOM   2796 C CD2   . PHE B 1 179 ? 12.143  8.592   83.068  1.00 23.26  ? 165 PHE B CD2   1 
ATOM   2797 C CE1   . PHE B 1 179 ? 10.414  10.677  82.437  1.00 23.97  ? 165 PHE B CE1   1 
ATOM   2798 C CE2   . PHE B 1 179 ? 12.666  9.861   82.772  1.00 27.45  ? 165 PHE B CE2   1 
ATOM   2799 C CZ    . PHE B 1 179 ? 11.803  10.905  82.462  1.00 25.08  ? 165 PHE B CZ    1 
ATOM   2800 N N     . CYS B 1 180 ? 11.764  5.706   80.936  1.00 26.21  ? 166 CYS B N     1 
ATOM   2801 C CA    . CYS B 1 180 ? 12.716  5.835   79.831  1.00 24.84  ? 166 CYS B CA    1 
ATOM   2802 C C     . CYS B 1 180 ? 12.122  5.439   78.486  1.00 23.43  ? 166 CYS B C     1 
ATOM   2803 O O     . CYS B 1 180 ? 12.309  6.145   77.498  1.00 20.18  ? 166 CYS B O     1 
ATOM   2804 C CB    . CYS B 1 180 ? 13.959  4.984   80.088  1.00 25.57  ? 166 CYS B CB    1 
ATOM   2805 S SG    . CYS B 1 180 ? 14.884  5.518   81.523  1.00 26.59  ? 166 CYS B SG    1 
ATOM   2806 N N     . GLU B 1 181 ? 11.413  4.309   78.440  1.00 21.70  ? 167 GLU B N     1 
ATOM   2807 C CA    . GLU B 1 181 ? 10.826  3.850   77.194  1.00 25.10  ? 167 GLU B CA    1 
ATOM   2808 C C     . GLU B 1 181 ? 9.767   4.832   76.710  1.00 26.68  ? 167 GLU B C     1 
ATOM   2809 O O     . GLU B 1 181 ? 9.653   5.098   75.514  1.00 25.60  ? 167 GLU B O     1 
ATOM   2810 C CB    . GLU B 1 181 ? 10.225  2.443   77.365  1.00 20.90  ? 167 GLU B CB    1 
ATOM   2811 C CG    . GLU B 1 181 ? 11.305  1.414   77.719  1.00 27.09  ? 167 GLU B CG    1 
ATOM   2812 C CD    . GLU B 1 181 ? 10.807  -0.032  77.727  1.00 35.92  ? 167 GLU B CD    1 
ATOM   2813 O OE1   . GLU B 1 181 ? 10.283  -0.499  76.684  1.00 26.93  ? 167 GLU B OE1   1 
ATOM   2814 O OE2   . GLU B 1 181 ? 10.956  -0.707  78.782  1.00 29.16  ? 167 GLU B OE2   1 
ATOM   2815 N N     . GLY B 1 182 ? 9.009   5.383   77.644  1.00 21.81  ? 168 GLY B N     1 
ATOM   2816 C CA    . GLY B 1 182 ? 7.981   6.339   77.271  1.00 22.31  ? 168 GLY B CA    1 
ATOM   2817 C C     . GLY B 1 182 ? 8.631   7.548   76.620  1.00 28.20  ? 168 GLY B C     1 
ATOM   2818 O O     . GLY B 1 182 ? 8.174   8.019   75.575  1.00 28.38  ? 168 GLY B O     1 
ATOM   2819 N N     . MET B 1 183 ? 9.721   8.026   77.216  1.00 27.01  ? 169 MET B N     1 
ATOM   2820 C CA    . MET B 1 183 ? 10.440  9.166   76.668  1.00 25.22  ? 169 MET B CA    1 
ATOM   2821 C C     . MET B 1 183 ? 11.035  8.859   75.298  1.00 21.98  ? 169 MET B C     1 
ATOM   2822 O O     . MET B 1 183 ? 11.012  9.701   74.401  1.00 23.38  ? 169 MET B O     1 
ATOM   2823 C CB    . MET B 1 183 ? 11.558  9.605   77.621  1.00 27.32  ? 169 MET B CB    1 
ATOM   2824 C CG    . MET B 1 183 ? 11.058  10.196  78.941  1.00 32.51  ? 169 MET B CG    1 
ATOM   2825 S SD    . MET B 1 183 ? 9.955   11.647  78.757  1.00 27.18  ? 169 MET B SD    1 
ATOM   2826 C CE    . MET B 1 183 ? 11.132  12.991  78.343  1.00 29.18  ? 169 MET B CE    1 
ATOM   2827 N N     . LEU B 1 184 ? 11.578  7.665   75.106  1.00 23.72  ? 170 LEU B N     1 
ATOM   2828 C CA    . LEU B 1 184 ? 12.155  7.374   73.806  1.00 25.99  ? 170 LEU B CA    1 
ATOM   2829 C C     . LEU B 1 184 ? 11.052  7.230   72.769  1.00 26.82  ? 170 LEU B C     1 
ATOM   2830 O O     . LEU B 1 184 ? 11.203  7.672   71.631  1.00 30.03  ? 170 LEU B O     1 
ATOM   2831 C CB    . LEU B 1 184 ? 13.025  6.125   73.874  1.00 24.24  ? 170 LEU B CB    1 
ATOM   2832 C CG    . LEU B 1 184 ? 14.213  6.260   74.849  1.00 31.95  ? 170 LEU B CG    1 
ATOM   2833 C CD1   . LEU B 1 184 ? 14.889  4.909   74.956  1.00 26.87  ? 170 LEU B CD1   1 
ATOM   2834 C CD2   . LEU B 1 184 ? 15.209  7.333   74.386  1.00 20.10  ? 170 LEU B CD2   1 
ATOM   2835 N N     . SER B 1 185 ? 9.947   6.612   73.177  1.00 26.18  ? 171 SER B N     1 
ATOM   2836 C CA    . SER B 1 185 ? 8.782   6.432   72.328  1.00 27.26  ? 171 SER B CA    1 
ATOM   2837 C C     . SER B 1 185 ? 8.306   7.788   71.785  1.00 22.65  ? 171 SER B C     1 
ATOM   2838 O O     . SER B 1 185 ? 8.102   7.919   70.589  1.00 24.26  ? 171 SER B O     1 
ATOM   2839 C CB    . SER B 1 185 ? 7.670   5.766   73.131  1.00 35.15  ? 171 SER B CB    1 
ATOM   2840 O OG    . SER B 1 185 ? 6.452   5.803   72.425  1.00 44.61  ? 171 SER B OG    1 
ATOM   2841 N N     . ARG B 1 186 ? 8.145   8.782   72.660  1.00 24.31  ? 172 ARG B N     1 
ATOM   2842 C CA    . ARG B 1 186 ? 7.735   10.138  72.251  1.00 30.91  ? 172 ARG B CA    1 
ATOM   2843 C C     . ARG B 1 186 ? 8.763   10.748  71.323  1.00 29.52  ? 172 ARG B C     1 
ATOM   2844 O O     . ARG B 1 186 ? 8.404   11.395  70.336  1.00 31.95  ? 172 ARG B O     1 
ATOM   2845 C CB    . ARG B 1 186 ? 7.543   11.069  73.460  1.00 28.71  ? 172 ARG B CB    1 
ATOM   2846 C CG    . ARG B 1 186 ? 6.212   10.866  74.148  1.00 38.87  ? 172 ARG B CG    1 
ATOM   2847 C CD    . ARG B 1 186 ? 6.219   11.331  75.609  1.00 44.29  ? 172 ARG B CD    1 
ATOM   2848 N NE    . ARG B 1 186 ? 6.039   12.778  75.721  1.00 46.89  ? 172 ARG B NE    1 
ATOM   2849 C CZ    . ARG B 1 186 ? 4.860   13.389  75.675  1.00 44.17  ? 172 ARG B CZ    1 
ATOM   2850 N NH1   . ARG B 1 186 ? 3.747   12.676  75.527  1.00 46.35  ? 172 ARG B NH1   1 
ATOM   2851 N NH2   . ARG B 1 186 ? 4.795   14.708  75.754  1.00 38.69  ? 172 ARG B NH2   1 
ATOM   2852 N N     . PHE B 1 187 ? 10.041  10.549  71.634  1.00 28.80  ? 173 PHE B N     1 
ATOM   2853 C CA    . PHE B 1 187 ? 11.109  11.066  70.778  1.00 26.14  ? 173 PHE B CA    1 
ATOM   2854 C C     . PHE B 1 187 ? 10.886  10.554  69.328  1.00 25.60  ? 173 PHE B C     1 
ATOM   2855 O O     . PHE B 1 187 ? 10.783  11.348  68.393  1.00 25.66  ? 173 PHE B O     1 
ATOM   2856 C CB    . PHE B 1 187 ? 12.456  10.618  71.359  1.00 27.56  ? 173 PHE B CB    1 
ATOM   2857 C CG    . PHE B 1 187 ? 13.670  11.082  70.586  1.00 29.17  ? 173 PHE B CG    1 
ATOM   2858 C CD1   . PHE B 1 187 ? 13.844  12.429  70.240  1.00 29.32  ? 173 PHE B CD1   1 
ATOM   2859 C CD2   . PHE B 1 187 ? 14.712  10.182  70.321  1.00 28.97  ? 173 PHE B CD2   1 
ATOM   2860 C CE1   . PHE B 1 187 ? 15.051  12.871  69.644  1.00 24.44  ? 173 PHE B CE1   1 
ATOM   2861 C CE2   . PHE B 1 187 ? 15.934  10.615  69.724  1.00 27.68  ? 173 PHE B CE2   1 
ATOM   2862 C CZ    . PHE B 1 187 ? 16.095  11.965  69.392  1.00 20.73  ? 173 PHE B CZ    1 
ATOM   2863 N N     . VAL B 1 188 ? 10.767  9.240   69.155  1.00 20.70  ? 174 VAL B N     1 
ATOM   2864 C CA    . VAL B 1 188 ? 10.532  8.623   67.851  1.00 22.25  ? 174 VAL B CA    1 
ATOM   2865 C C     . VAL B 1 188 ? 9.196   9.069   67.199  1.00 27.53  ? 174 VAL B C     1 
ATOM   2866 O O     . VAL B 1 188 ? 9.165   9.422   66.020  1.00 27.16  ? 174 VAL B O     1 
ATOM   2867 C CB    . VAL B 1 188 ? 10.554  7.043   67.991  1.00 27.09  ? 174 VAL B CB    1 
ATOM   2868 C CG1   . VAL B 1 188 ? 10.197  6.379   66.676  1.00 27.35  ? 174 VAL B CG1   1 
ATOM   2869 C CG2   . VAL B 1 188 ? 11.947  6.576   68.416  1.00 24.32  ? 174 VAL B CG2   1 
ATOM   2870 N N     . ARG B 1 189 ? 8.104   9.058   67.965  1.00 25.44  ? 175 ARG B N     1 
ATOM   2871 C CA    . ARG B 1 189 ? 6.773   9.465   67.477  1.00 29.40  ? 175 ARG B CA    1 
ATOM   2872 C C     . ARG B 1 189 ? 6.813   10.820  66.772  1.00 25.07  ? 175 ARG B C     1 
ATOM   2873 O O     . ARG B 1 189 ? 6.219   11.011  65.726  1.00 32.78  ? 175 ARG B O     1 
ATOM   2874 C CB    . ARG B 1 189 ? 5.767   9.706   68.642  1.00 30.60  ? 175 ARG B CB    1 
ATOM   2875 C CG    . ARG B 1 189 ? 5.070   8.573   69.290  1.00 33.36  ? 175 ARG B CG    1 
ATOM   2876 C CD    . ARG B 1 189 ? 3.700   9.045   69.827  1.00 34.28  ? 175 ARG B CD    1 
ATOM   2877 N NE    . ARG B 1 189 ? 3.703   9.740   71.118  1.00 25.62  ? 175 ARG B NE    1 
ATOM   2878 C CZ    . ARG B 1 189 ? 3.322   11.000  71.279  1.00 20.86  ? 175 ARG B CZ    1 
ATOM   2879 N NH1   . ARG B 1 189 ? 2.928   11.706  70.225  1.00 20.13  ? 175 ARG B NH1   1 
ATOM   2880 N NH2   . ARG B 1 189 ? 3.279   11.535  72.487  1.00 23.90  ? 175 ARG B NH2   1 
ATOM   2881 N N     . SER B 1 190 ? 7.428   11.774  67.458  1.00 25.36  ? 176 SER B N     1 
ATOM   2882 C CA    . SER B 1 190 ? 7.515   13.158  67.037  1.00 27.56  ? 176 SER B CA    1 
ATOM   2883 C C     . SER B 1 190 ? 8.562   13.414  65.992  1.00 30.24  ? 176 SER B C     1 
ATOM   2884 O O     . SER B 1 190 ? 8.893   14.555  65.697  1.00 33.35  ? 176 SER B O     1 
ATOM   2885 C CB    . SER B 1 190 ? 7.785   14.039  68.258  1.00 25.92  ? 176 SER B CB    1 
ATOM   2886 O OG    . SER B 1 190 ? 8.965   13.642  68.938  1.00 29.75  ? 176 SER B OG    1 
ATOM   2887 N N     . GLU B 1 191 ? 9.082   12.347  65.420  1.00 32.45  ? 177 GLU B N     1 
ATOM   2888 C CA    . GLU B 1 191 ? 10.102  12.497  64.406  1.00 38.08  ? 177 GLU B CA    1 
ATOM   2889 C C     . GLU B 1 191 ? 11.310  13.234  65.010  1.00 36.88  ? 177 GLU B C     1 
ATOM   2890 O O     . GLU B 1 191 ? 11.904  14.110  64.384  1.00 39.85  ? 177 GLU B O     1 
ATOM   2891 C CB    . GLU B 1 191 ? 9.502   13.261  63.237  1.00 39.41  ? 177 GLU B CB    1 
ATOM   2892 C CG    . GLU B 1 191 ? 10.063  12.902  61.910  1.00 57.60  ? 177 GLU B CG    1 
ATOM   2893 C CD    . GLU B 1 191 ? 9.028   13.078  60.831  1.00 67.40  ? 177 GLU B CD    1 
ATOM   2894 O OE1   . GLU B 1 191 ? 8.220   14.033  60.954  1.00 69.26  ? 177 GLU B OE1   1 
ATOM   2895 O OE2   . GLU B 1 191 ? 9.025   12.268  59.871  1.00 73.93  ? 177 GLU B OE2   1 
ATOM   2896 N N     . PHE B 1 192 ? 11.645  12.862  66.245  1.00 33.78  ? 178 PHE B N     1 
ATOM   2897 C CA    . PHE B 1 192 ? 12.767  13.409  66.987  1.00 29.55  ? 178 PHE B CA    1 
ATOM   2898 C C     . PHE B 1 192 ? 12.629  14.846  67.475  1.00 34.54  ? 178 PHE B C     1 
ATOM   2899 O O     . PHE B 1 192 ? 13.630  15.466  67.810  1.00 33.44  ? 178 PHE B O     1 
ATOM   2900 C CB    . PHE B 1 192 ? 14.041  13.250  66.161  1.00 26.51  ? 178 PHE B CB    1 
ATOM   2901 C CG    . PHE B 1 192 ? 14.268  11.841  65.701  1.00 26.44  ? 178 PHE B CG    1 
ATOM   2902 C CD1   . PHE B 1 192 ? 14.629  11.565  64.384  1.00 24.27  ? 178 PHE B CD1   1 
ATOM   2903 C CD2   . PHE B 1 192 ? 14.059  10.777  66.580  1.00 26.52  ? 178 PHE B CD2   1 
ATOM   2904 C CE1   . PHE B 1 192 ? 14.786  10.244  63.945  1.00 27.33  ? 178 PHE B CE1   1 
ATOM   2905 C CE2   . PHE B 1 192 ? 14.212  9.452   66.155  1.00 21.52  ? 178 PHE B CE2   1 
ATOM   2906 C CZ    . PHE B 1 192 ? 14.570  9.188   64.839  1.00 23.33  ? 178 PHE B CZ    1 
ATOM   2907 N N     . LYS B 1 193 ? 11.405  15.377  67.527  1.00 35.07  ? 179 LYS B N     1 
ATOM   2908 C CA    . LYS B 1 193 ? 11.202  16.743  68.022  1.00 35.63  ? 179 LYS B CA    1 
ATOM   2909 C C     . LYS B 1 193 ? 11.191  16.776  69.551  1.00 32.16  ? 179 LYS B C     1 
ATOM   2910 O O     . LYS B 1 193 ? 11.741  17.674  70.156  1.00 32.91  ? 179 LYS B O     1 
ATOM   2911 C CB    . LYS B 1 193 ? 9.889   17.340  67.505  1.00 43.51  ? 179 LYS B CB    1 
ATOM   2912 C CG    . LYS B 1 193 ? 10.020  18.073  66.175  1.00 52.30  ? 179 LYS B CG    1 
ATOM   2913 C CD    . LYS B 1 193 ? 9.636   17.188  64.990  1.00 60.38  ? 179 LYS B CD    1 
ATOM   2914 C CE    . LYS B 1 193 ? 9.716   17.951  63.658  1.00 65.74  ? 179 LYS B CE    1 
ATOM   2915 N NZ    . LYS B 1 193 ? 8.786   17.369  62.628  1.00 66.39  ? 179 LYS B NZ    1 
ATOM   2916 N N     . TYR B 1 194 ? 10.564  15.793  70.182  1.00 35.31  ? 180 TYR B N     1 
ATOM   2917 C CA    . TYR B 1 194 ? 10.516  15.754  71.651  1.00 34.94  ? 180 TYR B CA    1 
ATOM   2918 C C     . TYR B 1 194 ? 11.770  15.063  72.193  1.00 33.94  ? 180 TYR B C     1 
ATOM   2919 O O     . TYR B 1 194 ? 11.812  13.840  72.309  1.00 32.76  ? 180 TYR B O     1 
ATOM   2920 C CB    . TYR B 1 194 ? 9.273   14.998  72.147  1.00 35.44  ? 180 TYR B CB    1 
ATOM   2921 C CG    . TYR B 1 194 ? 7.928   15.602  71.765  1.00 47.66  ? 180 TYR B CG    1 
ATOM   2922 C CD1   . TYR B 1 194 ? 7.799   16.968  71.445  1.00 53.01  ? 180 TYR B CD1   1 
ATOM   2923 C CD2   . TYR B 1 194 ? 6.759   14.816  71.779  1.00 55.19  ? 180 TYR B CD2   1 
ATOM   2924 C CE1   . TYR B 1 194 ? 6.543   17.526  71.157  1.00 50.54  ? 180 TYR B CE1   1 
ATOM   2925 C CE2   . TYR B 1 194 ? 5.499   15.369  71.491  1.00 52.03  ? 180 TYR B CE2   1 
ATOM   2926 C CZ    . TYR B 1 194 ? 5.402   16.714  71.187  1.00 54.92  ? 180 TYR B CZ    1 
ATOM   2927 O OH    . TYR B 1 194 ? 4.158   17.235  70.941  1.00 59.66  ? 180 TYR B OH    1 
ATOM   2928 N N     . ARG B 1 195 ? 12.783  15.865  72.493  1.00 35.10  ? 181 ARG B N     1 
ATOM   2929 C CA    . ARG B 1 195 ? 14.067  15.396  73.021  1.00 40.31  ? 181 ARG B CA    1 
ATOM   2930 C C     . ARG B 1 195 ? 13.950  14.697  74.395  1.00 36.04  ? 181 ARG B C     1 
ATOM   2931 O O     . ARG B 1 195 ? 13.460  15.274  75.353  1.00 34.78  ? 181 ARG B O     1 
ATOM   2932 C CB    . ARG B 1 195 ? 15.015  16.586  73.161  1.00 44.99  ? 181 ARG B CB    1 
ATOM   2933 C CG    . ARG B 1 195 ? 15.308  17.348  71.876  1.00 54.93  ? 181 ARG B CG    1 
ATOM   2934 C CD    . ARG B 1 195 ? 16.346  16.631  71.060  1.00 65.59  ? 181 ARG B CD    1 
ATOM   2935 N NE    . ARG B 1 195 ? 16.426  17.117  69.685  1.00 76.24  ? 181 ARG B NE    1 
ATOM   2936 C CZ    . ARG B 1 195 ? 17.146  16.535  68.724  1.00 81.73  ? 181 ARG B CZ    1 
ATOM   2937 N NH1   . ARG B 1 195 ? 17.865  15.438  68.979  1.00 81.20  ? 181 ARG B NH1   1 
ATOM   2938 N NH2   . ARG B 1 195 ? 17.132  17.037  67.495  1.00 84.03  ? 181 ARG B NH2   1 
ATOM   2939 N N     . PRO B 1 196 ? 14.426  13.449  74.502  1.00 34.89  ? 182 PRO B N     1 
ATOM   2940 C CA    . PRO B 1 196 ? 14.389  12.655  75.742  1.00 34.32  ? 182 PRO B CA    1 
ATOM   2941 C C     . PRO B 1 196 ? 15.003  13.347  76.971  1.00 34.61  ? 182 PRO B C     1 
ATOM   2942 O O     . PRO B 1 196 ? 14.506  13.193  78.071  1.00 35.82  ? 182 PRO B O     1 
ATOM   2943 C CB    . PRO B 1 196 ? 15.186  11.399  75.385  1.00 34.84  ? 182 PRO B CB    1 
ATOM   2944 C CG    . PRO B 1 196 ? 15.031  11.277  73.902  1.00 33.35  ? 182 PRO B CG    1 
ATOM   2945 C CD    . PRO B 1 196 ? 15.049  12.698  73.397  1.00 30.08  ? 182 PRO B CD    1 
ATOM   2946 N N     . THR B 1 197 ? 16.100  14.084  76.800  1.00 35.02  ? 183 THR B N     1 
ATOM   2947 C CA    . THR B 1 197 ? 16.750  14.730  77.947  1.00 35.97  ? 183 THR B CA    1 
ATOM   2948 C C     . THR B 1 197 ? 16.272  16.159  78.147  1.00 39.58  ? 183 THR B C     1 
ATOM   2949 O O     . THR B 1 197 ? 16.772  16.902  79.015  1.00 36.32  ? 183 THR B O     1 
ATOM   2950 C CB    . THR B 1 197 ? 18.297  14.769  77.801  1.00 28.17  ? 183 THR B CB    1 
ATOM   2951 O OG1   . THR B 1 197 ? 18.644  15.684  76.760  1.00 30.40  ? 183 THR B OG1   1 
ATOM   2952 C CG2   . THR B 1 197 ? 18.844  13.395  77.445  1.00 30.56  ? 183 THR B CG2   1 
ATOM   2953 N N     . ASP B 1 198 ? 15.290  16.553  77.358  1.00 44.04  ? 184 ASP B N     1 
ATOM   2954 C CA    . ASP B 1 198 ? 14.793  17.901  77.515  1.00 46.75  ? 184 ASP B CA    1 
ATOM   2955 C C     . ASP B 1 198 ? 14.037  18.089  78.846  1.00 41.11  ? 184 ASP B C     1 
ATOM   2956 O O     . ASP B 1 198 ? 13.164  17.308  79.248  1.00 37.95  ? 184 ASP B O     1 
ATOM   2957 C CB    . ASP B 1 198 ? 14.009  18.275  76.246  1.00 56.01  ? 184 ASP B CB    1 
ATOM   2958 C CG    . ASP B 1 198 ? 14.922  18.923  75.165  1.00 65.27  ? 184 ASP B CG    1 
ATOM   2959 O OD1   . ASP B 1 198 ? 16.053  18.435  74.909  1.00 66.37  ? 184 ASP B OD1   1 
ATOM   2960 O OD2   . ASP B 1 198 ? 14.525  19.929  74.540  1.00 72.94  ? 184 ASP B OD2   1 
ATOM   2961 N N     . ASP B 1 199 ? 14.501  19.086  79.583  1.00 37.43  ? 185 ASP B N     1 
ATOM   2962 C CA    . ASP B 1 199 ? 13.983  19.398  80.918  1.00 41.33  ? 185 ASP B CA    1 
ATOM   2963 C C     . ASP B 1 199 ? 14.333  18.332  81.955  1.00 37.24  ? 185 ASP B C     1 
ATOM   2964 O O     . ASP B 1 199 ? 13.693  18.272  83.004  1.00 34.57  ? 185 ASP B O     1 
ATOM   2965 C CB    . ASP B 1 199 ? 12.468  19.570  80.910  1.00 44.88  ? 185 ASP B CB    1 
ATOM   2966 C CG    . ASP B 1 199 ? 12.058  20.984  80.641  1.00 55.49  ? 185 ASP B CG    1 
ATOM   2967 O OD1   . ASP B 1 199 ? 12.202  21.813  81.568  1.00 53.75  ? 185 ASP B OD1   1 
ATOM   2968 O OD2   . ASP B 1 199 ? 11.605  21.264  79.505  1.00 58.31  ? 185 ASP B OD2   1 
ATOM   2969 N N     . PHE B 1 200 ? 15.346  17.509  81.667  1.00 35.73  ? 186 PHE B N     1 
ATOM   2970 C CA    . PHE B 1 200 ? 15.756  16.438  82.582  1.00 33.89  ? 186 PHE B CA    1 
ATOM   2971 C C     . PHE B 1 200 ? 15.926  16.939  83.985  1.00 32.96  ? 186 PHE B C     1 
ATOM   2972 O O     . PHE B 1 200 ? 15.552  16.323  84.970  1.00 31.11  ? 186 PHE B O     1 
ATOM   2973 C CB    . PHE B 1 200 ? 17.055  15.791  82.113  1.00 29.80  ? 186 PHE B CB    1 
ATOM   2974 C CG    . PHE B 1 200 ? 17.447  14.609  82.931  1.00 29.53  ? 186 PHE B CG    1 
ATOM   2975 C CD1   . PHE B 1 200 ? 16.788  13.389  82.774  1.00 27.28  ? 186 PHE B CD1   1 
ATOM   2976 C CD2   . PHE B 1 200 ? 18.430  14.727  83.905  1.00 28.79  ? 186 PHE B CD2   1 
ATOM   2977 C CE1   . PHE B 1 200 ? 17.106  12.314  83.573  1.00 30.09  ? 186 PHE B CE1   1 
ATOM   2978 C CE2   . PHE B 1 200 ? 18.758  13.654  84.714  1.00 27.62  ? 186 PHE B CE2   1 
ATOM   2979 C CZ    . PHE B 1 200 ? 18.098  12.451  84.554  1.00 27.67  ? 186 PHE B CZ    1 
ATOM   2980 N N     . GLU B 1 201 ? 16.473  18.115  84.005  1.00 35.22  ? 187 GLU B N     1 
ATOM   2981 C CA    . GLU B 1 201 ? 16.676  18.780  85.217  1.00 37.10  ? 187 GLU B CA    1 
ATOM   2982 C C     . GLU B 1 201 ? 15.475  18.865  86.142  1.00 31.24  ? 187 GLU B C     1 
ATOM   2983 O O     . GLU B 1 201 ? 15.583  18.700  87.367  1.00 28.51  ? 187 GLU B O     1 
ATOM   2984 C CB    . GLU B 1 201 ? 17.229  20.133  84.867  1.00 40.76  ? 187 GLU B CB    1 
ATOM   2985 C CG    . GLU B 1 201 ? 18.458  20.402  85.714  1.00 47.84  ? 187 GLU B CG    1 
ATOM   2986 C CD    . GLU B 1 201 ? 19.780  19.815  85.222  1.00 19.99  ? 187 GLU B CD    1 
ATOM   2987 O OE1   . GLU B 1 201 ? 19.971  18.563  85.272  1.00 20.01  ? 187 GLU B OE1   1 
ATOM   2988 O OE2   . GLU B 1 201 ? 20.669  20.622  84.780  1.00 20.04  ? 187 GLU B OE2   1 
ATOM   2989 N N     . ALA B 1 202 ? 14.335  19.110  85.518  1.00 30.86  ? 188 ALA B N     1 
ATOM   2990 C CA    . ALA B 1 202 ? 13.057  19.241  86.214  1.00 30.32  ? 188 ALA B CA    1 
ATOM   2991 C C     . ALA B 1 202 ? 12.310  17.903  86.285  1.00 31.37  ? 188 ALA B C     1 
ATOM   2992 O O     . ALA B 1 202 ? 11.542  17.648  87.223  1.00 31.89  ? 188 ALA B O     1 
ATOM   2993 C CB    . ALA B 1 202 ? 12.192  20.281  85.527  1.00 28.17  ? 188 ALA B CB    1 
ATOM   2994 N N     . ARG B 1 203 ? 12.539  17.039  85.304  1.00 27.56  ? 189 ARG B N     1 
ATOM   2995 C CA    . ARG B 1 203 ? 11.863  15.739  85.318  1.00 31.19  ? 189 ARG B CA    1 
ATOM   2996 C C     . ARG B 1 203 ? 12.468  14.777  86.329  1.00 26.84  ? 189 ARG B C     1 
ATOM   2997 O O     . ARG B 1 203 ? 11.729  14.120  87.050  1.00 29.64  ? 189 ARG B O     1 
ATOM   2998 C CB    . ARG B 1 203 ? 11.900  15.067  83.941  1.00 31.28  ? 189 ARG B CB    1 
ATOM   2999 C CG    . ARG B 1 203 ? 11.045  15.720  82.878  1.00 30.83  ? 189 ARG B CG    1 
ATOM   3000 C CD    . ARG B 1 203 ? 11.117  14.968  81.549  1.00 28.86  ? 189 ARG B CD    1 
ATOM   3001 N NE    . ARG B 1 203 ? 10.514  15.770  80.491  1.00 34.94  ? 189 ARG B NE    1 
ATOM   3002 C CZ    . ARG B 1 203 ? 9.206   15.969  80.338  1.00 33.90  ? 189 ARG B CZ    1 
ATOM   3003 N NH1   . ARG B 1 203 ? 8.320   15.412  81.162  1.00 30.12  ? 189 ARG B NH1   1 
ATOM   3004 N NH2   . ARG B 1 203 ? 8.786   16.779  79.383  1.00 31.21  ? 189 ARG B NH2   1 
ATOM   3005 N N     . TRP B 1 204 ? 13.803  14.710  86.398  1.00 25.88  ? 190 TRP B N     1 
ATOM   3006 C CA    . TRP B 1 204 ? 14.465  13.767  87.294  1.00 25.13  ? 190 TRP B CA    1 
ATOM   3007 C C     . TRP B 1 204 ? 13.955  13.702  88.741  1.00 24.70  ? 190 TRP B C     1 
ATOM   3008 O O     . TRP B 1 204 ? 13.729  12.609  89.283  1.00 23.00  ? 190 TRP B O     1 
ATOM   3009 C CB    . TRP B 1 204 ? 15.975  13.975  87.311  1.00 23.39  ? 190 TRP B CB    1 
ATOM   3010 C CG    . TRP B 1 204 ? 16.548  13.079  88.313  1.00 30.05  ? 190 TRP B CG    1 
ATOM   3011 C CD1   . TRP B 1 204 ? 17.045  13.433  89.534  1.00 30.18  ? 190 TRP B CD1   1 
ATOM   3012 C CD2   . TRP B 1 204 ? 16.487  11.646  88.302  1.00 24.89  ? 190 TRP B CD2   1 
ATOM   3013 N NE1   . TRP B 1 204 ? 17.282  12.314  90.288  1.00 28.81  ? 190 TRP B NE1   1 
ATOM   3014 C CE2   . TRP B 1 204 ? 16.948  11.198  89.560  1.00 27.05  ? 190 TRP B CE2   1 
ATOM   3015 C CE3   . TRP B 1 204 ? 16.065  10.697  87.358  1.00 23.42  ? 190 TRP B CE3   1 
ATOM   3016 C CZ2   . TRP B 1 204 ? 17.021  9.838   89.905  1.00 25.68  ? 190 TRP B CZ2   1 
ATOM   3017 C CZ3   . TRP B 1 204 ? 16.126  9.345   87.692  1.00 27.77  ? 190 TRP B CZ3   1 
ATOM   3018 C CH2   . TRP B 1 204 ? 16.601  8.926   88.963  1.00 24.13  ? 190 TRP B CH2   1 
ATOM   3019 N N     . PRO B 1 205 ? 13.798  14.863  89.399  1.00 26.11  ? 191 PRO B N     1 
ATOM   3020 C CA    . PRO B 1 205 ? 13.301  14.935  90.782  1.00 27.07  ? 191 PRO B CA    1 
ATOM   3021 C C     . PRO B 1 205 ? 11.897  14.296  90.904  1.00 29.29  ? 191 PRO B C     1 
ATOM   3022 O O     . PRO B 1 205 ? 11.546  13.757  91.948  1.00 27.44  ? 191 PRO B O     1 
ATOM   3023 C CB    . PRO B 1 205 ? 13.255  16.433  91.049  1.00 27.70  ? 191 PRO B CB    1 
ATOM   3024 C CG    . PRO B 1 205 ? 14.343  16.972  90.162  1.00 23.81  ? 191 PRO B CG    1 
ATOM   3025 C CD    . PRO B 1 205 ? 14.224  16.190  88.912  1.00 24.83  ? 191 PRO B CD    1 
ATOM   3026 N N     . LEU B 1 206 ? 11.104  14.381  89.833  1.00 29.17  ? 192 LEU B N     1 
ATOM   3027 C CA    . LEU B 1 206 ? 9.765   13.793  89.813  1.00 33.07  ? 192 LEU B CA    1 
ATOM   3028 C C     . LEU B 1 206 ? 9.868   12.275  89.707  1.00 32.33  ? 192 LEU B C     1 
ATOM   3029 O O     . LEU B 1 206 ? 9.117   11.532  90.362  1.00 34.52  ? 192 LEU B O     1 
ATOM   3030 C CB    . LEU B 1 206 ? 8.964   14.347  88.628  1.00 31.98  ? 192 LEU B CB    1 
ATOM   3031 C CG    . LEU B 1 206 ? 8.123   15.603  88.886  1.00 33.11  ? 192 LEU B CG    1 
ATOM   3032 C CD1   . LEU B 1 206 ? 8.616   16.366  90.100  1.00 29.47  ? 192 LEU B CD1   1 
ATOM   3033 C CD2   . LEU B 1 206 ? 8.148   16.460  87.652  1.00 33.71  ? 192 LEU B CD2   1 
ATOM   3034 N N     . VAL B 1 207 ? 10.796  11.814  88.873  1.00 27.87  ? 193 VAL B N     1 
ATOM   3035 C CA    . VAL B 1 207 ? 11.001  10.379  88.707  1.00 29.12  ? 193 VAL B CA    1 
ATOM   3036 C C     . VAL B 1 207 ? 11.530  9.834   90.036  1.00 31.77  ? 193 VAL B C     1 
ATOM   3037 O O     . VAL B 1 207 ? 11.035  8.818   90.533  1.00 28.70  ? 193 VAL B O     1 
ATOM   3038 C CB    . VAL B 1 207 ? 11.969  10.081  87.534  1.00 30.66  ? 193 VAL B CB    1 
ATOM   3039 C CG1   . VAL B 1 207 ? 12.268  8.593   87.458  1.00 34.51  ? 193 VAL B CG1   1 
ATOM   3040 C CG2   . VAL B 1 207 ? 11.365  10.580  86.223  1.00 26.40  ? 193 VAL B CG2   1 
ATOM   3041 N N     . ALA B 1 208 ? 12.526  10.518  90.601  1.00 26.79  ? 194 ALA B N     1 
ATOM   3042 C CA    . ALA B 1 208 ? 13.133  10.113  91.864  1.00 28.38  ? 194 ALA B CA    1 
ATOM   3043 C C     . ALA B 1 208 ? 12.107  10.112  93.005  1.00 26.21  ? 194 ALA B C     1 
ATOM   3044 O O     . ALA B 1 208 ? 12.260  9.373   93.994  1.00 23.83  ? 194 ALA B O     1 
ATOM   3045 C CB    . ALA B 1 208 ? 14.320  11.041  92.187  1.00 26.53  ? 194 ALA B CB    1 
ATOM   3046 N N     . ALA B 1 209 ? 11.064  10.940  92.873  1.00 26.77  ? 195 ALA B N     1 
ATOM   3047 C CA    . ALA B 1 209 ? 10.011  10.987  93.879  1.00 29.26  ? 195 ALA B CA    1 
ATOM   3048 C C     . ALA B 1 209 ? 9.295   9.624   93.870  1.00 30.76  ? 195 ALA B C     1 
ATOM   3049 O O     . ALA B 1 209 ? 8.705   9.208   94.855  1.00 32.04  ? 195 ALA B O     1 
ATOM   3050 C CB    . ALA B 1 209 ? 9.023   12.115  93.575  1.00 28.12  ? 195 ALA B CB    1 
ATOM   3051 N N     . GLN B 1 210 ? 9.373   8.920   92.751  1.00 35.21  ? 196 GLN B N     1 
ATOM   3052 C CA    . GLN B 1 210 ? 8.746   7.602   92.649  1.00 39.47  ? 196 GLN B CA    1 
ATOM   3053 C C     . GLN B 1 210 ? 9.506   6.487   93.378  1.00 37.68  ? 196 GLN B C     1 
ATOM   3054 O O     . GLN B 1 210 ? 8.956   5.407   93.595  1.00 41.50  ? 196 GLN B O     1 
ATOM   3055 C CB    . GLN B 1 210 ? 8.577   7.207   91.180  1.00 39.36  ? 196 GLN B CB    1 
ATOM   3056 C CG    . GLN B 1 210 ? 7.936   8.278   90.369  1.00 38.06  ? 196 GLN B CG    1 
ATOM   3057 C CD    . GLN B 1 210 ? 7.305   7.743   89.108  1.00 45.53  ? 196 GLN B CD    1 
ATOM   3058 O OE1   . GLN B 1 210 ? 7.967   7.164   88.271  1.00 50.20  ? 196 GLN B OE1   1 
ATOM   3059 N NE2   . GLN B 1 210 ? 6.001   7.944   88.970  1.00 60.26  ? 196 GLN B NE2   1 
ATOM   3060 N N     . LEU B 1 211 ? 10.752  6.748   93.762  1.00 36.26  ? 197 LEU B N     1 
ATOM   3061 C CA    . LEU B 1 211 ? 11.580  5.755   94.449  1.00 40.61  ? 197 LEU B CA    1 
ATOM   3062 C C     . LEU B 1 211 ? 11.378  5.764   95.967  1.00 39.80  ? 197 LEU B C     1 
ATOM   3063 O O     . LEU B 1 211 ? 12.088  6.473   96.679  1.00 47.49  ? 197 LEU B O     1 
ATOM   3064 C CB    . LEU B 1 211 ? 13.060  6.009   94.119  1.00 34.60  ? 197 LEU B CB    1 
ATOM   3065 C CG    . LEU B 1 211 ? 13.362  6.138   92.618  1.00 38.84  ? 197 LEU B CG    1 
ATOM   3066 C CD1   . LEU B 1 211 ? 14.841  6.398   92.403  1.00 35.01  ? 197 LEU B CD1   1 
ATOM   3067 C CD2   . LEU B 1 211 ? 12.933  4.853   91.891  1.00 30.77  ? 197 LEU B CD2   1 
ATOM   3068 N N     . GLN B 1 212 ? 10.421  4.979   96.469  1.00 44.60  ? 198 GLN B N     1 
ATOM   3069 C CA    . GLN B 1 212 ? 10.147  4.947   97.924  1.00 45.88  ? 198 GLN B CA    1 
ATOM   3070 C C     . GLN B 1 212 ? 10.211  3.563   98.584  1.00 44.18  ? 198 GLN B C     1 
ATOM   3071 O O     . GLN B 1 212 ? 9.988   2.547   97.894  1.00 42.25  ? 198 GLN B O     1 
ATOM   3072 C CB    . GLN B 1 212 ? 8.773   5.603   98.235  1.00 42.56  ? 198 GLN B CB    1 
ATOM   3073 C CG    . GLN B 1 212 ? 7.949   5.968   97.006  1.00 45.45  ? 198 GLN B CG    1 
ATOM   3074 C CD    . GLN B 1 212 ? 6.700   6.806   97.308  1.00 46.37  ? 198 GLN B CD    1 
ATOM   3075 O OE1   . GLN B 1 212 ? 5.937   6.501   98.232  1.00 45.42  ? 198 GLN B OE1   1 
ATOM   3076 N NE2   . GLN B 1 212 ? 6.477   7.850   96.504  1.00 38.12  ? 198 GLN B NE2   1 
ATOM   3077 O OXT   . GLN B 1 212 ? 10.481  3.519   99.805  1.00 48.86  ? 198 GLN B OXT   1 
ATOM   3078 N N     . ARG C 1 23  ? 21.637  -0.960  25.833  1.00 88.56  ? 9   ARG C N     1 
ATOM   3079 C CA    . ARG C 1 23  ? 22.173  -2.286  26.259  1.00 88.45  ? 9   ARG C CA    1 
ATOM   3080 C C     . ARG C 1 23  ? 21.549  -3.420  25.472  1.00 84.95  ? 9   ARG C C     1 
ATOM   3081 O O     . ARG C 1 23  ? 20.460  -3.286  24.918  1.00 83.90  ? 9   ARG C O     1 
ATOM   3082 C CB    . ARG C 1 23  ? 21.917  -2.532  27.757  1.00 91.37  ? 9   ARG C CB    1 
ATOM   3083 C CG    . ARG C 1 23  ? 22.952  -1.920  28.700  1.00 96.38  ? 9   ARG C CG    1 
ATOM   3084 C CD    . ARG C 1 23  ? 22.540  -2.080  30.162  1.00 98.07  ? 9   ARG C CD    1 
ATOM   3085 N NE    . ARG C 1 23  ? 21.222  -1.497  30.408  1.00 101.01 ? 9   ARG C NE    1 
ATOM   3086 C CZ    . ARG C 1 23  ? 20.912  -0.222  30.186  1.00 102.53 ? 9   ARG C CZ    1 
ATOM   3087 N NH1   . ARG C 1 23  ? 21.823  0.623   29.715  1.00 101.02 ? 9   ARG C NH1   1 
ATOM   3088 N NH2   . ARG C 1 23  ? 19.681  0.209   30.424  1.00 104.27 ? 9   ARG C NH2   1 
ATOM   3089 N N     . ASN C 1 24  ? 22.263  -4.539  25.437  1.00 83.97  ? 10  ASN C N     1 
ATOM   3090 C CA    . ASN C 1 24  ? 21.805  -5.740  24.758  1.00 79.67  ? 10  ASN C CA    1 
ATOM   3091 C C     . ASN C 1 24  ? 20.475  -6.126  25.388  1.00 72.69  ? 10  ASN C C     1 
ATOM   3092 O O     . ASN C 1 24  ? 19.531  -6.468  24.678  1.00 70.61  ? 10  ASN C O     1 
ATOM   3093 C CB    . ASN C 1 24  ? 22.845  -6.869  24.927  1.00 83.31  ? 10  ASN C CB    1 
ATOM   3094 C CG    . ASN C 1 24  ? 22.264  -8.256  24.699  1.00 85.35  ? 10  ASN C CG    1 
ATOM   3095 O OD1   . ASN C 1 24  ? 21.572  -8.808  25.566  1.00 84.83  ? 10  ASN C OD1   1 
ATOM   3096 N ND2   . ASN C 1 24  ? 22.541  -8.827  23.528  1.00 85.13  ? 10  ASN C ND2   1 
ATOM   3097 N N     . ARG C 1 25  ? 20.405  -6.060  26.718  1.00 63.66  ? 11  ARG C N     1 
ATOM   3098 C CA    . ARG C 1 25  ? 19.177  -6.402  27.414  1.00 58.15  ? 11  ARG C CA    1 
ATOM   3099 C C     . ARG C 1 25  ? 18.097  -5.376  27.155  1.00 51.29  ? 11  ARG C C     1 
ATOM   3100 O O     . ARG C 1 25  ? 16.949  -5.741  26.929  1.00 53.63  ? 11  ARG C O     1 
ATOM   3101 C CB    . ARG C 1 25  ? 19.406  -6.518  28.916  1.00 60.27  ? 11  ARG C CB    1 
ATOM   3102 C CG    . ARG C 1 25  ? 19.755  -7.915  29.373  1.00 71.27  ? 11  ARG C CG    1 
ATOM   3103 C CD    . ARG C 1 25  ? 18.631  -8.903  29.084  1.00 75.90  ? 11  ARG C CD    1 
ATOM   3104 N NE    . ARG C 1 25  ? 19.168  -10.131 28.508  1.00 87.22  ? 11  ARG C NE    1 
ATOM   3105 C CZ    . ARG C 1 25  ? 18.935  -11.350 28.981  1.00 90.86  ? 11  ARG C CZ    1 
ATOM   3106 N NH1   . ARG C 1 25  ? 18.169  -11.510 30.049  1.00 92.38  ? 11  ARG C NH1   1 
ATOM   3107 N NH2   . ARG C 1 25  ? 19.471  -12.409 28.386  1.00 93.59  ? 11  ARG C NH2   1 
ATOM   3108 N N     . ARG C 1 26  ? 18.460  -4.098  27.195  1.00 43.26  ? 12  ARG C N     1 
ATOM   3109 C CA    . ARG C 1 26  ? 17.488  -3.039  26.957  1.00 43.84  ? 12  ARG C CA    1 
ATOM   3110 C C     . ARG C 1 26  ? 16.897  -3.193  25.557  1.00 42.30  ? 12  ARG C C     1 
ATOM   3111 O O     . ARG C 1 26  ? 15.682  -3.286  25.408  1.00 38.76  ? 12  ARG C O     1 
ATOM   3112 C CB    . ARG C 1 26  ? 18.138  -1.665  27.096  1.00 42.57  ? 12  ARG C CB    1 
ATOM   3113 C CG    . ARG C 1 26  ? 17.145  -0.519  27.186  1.00 42.09  ? 12  ARG C CG    1 
ATOM   3114 C CD    . ARG C 1 26  ? 17.857  0.801   27.498  1.00 50.37  ? 12  ARG C CD    1 
ATOM   3115 N NE    . ARG C 1 26  ? 16.946  1.889   27.874  1.00 53.77  ? 12  ARG C NE    1 
ATOM   3116 C CZ    . ARG C 1 26  ? 16.150  2.561   27.035  1.00 57.60  ? 12  ARG C CZ    1 
ATOM   3117 N NH1   . ARG C 1 26  ? 16.122  2.291   25.744  1.00 58.22  ? 12  ARG C NH1   1 
ATOM   3118 N NH2   . ARG C 1 26  ? 15.355  3.517   27.491  1.00 56.77  ? 12  ARG C NH2   1 
ATOM   3119 N N     . GLU C 1 27  ? 17.763  -3.226  24.544  1.00 37.80  ? 13  GLU C N     1 
ATOM   3120 C CA    . GLU C 1 27  ? 17.323  -3.378  23.170  1.00 42.33  ? 13  GLU C CA    1 
ATOM   3121 C C     . GLU C 1 27  ? 16.559  -4.674  22.977  1.00 40.35  ? 13  GLU C C     1 
ATOM   3122 O O     . GLU C 1 27  ? 15.573  -4.722  22.240  1.00 40.84  ? 13  GLU C O     1 
ATOM   3123 C CB    . GLU C 1 27  ? 18.511  -3.349  22.207  1.00 48.41  ? 13  GLU C CB    1 
ATOM   3124 C CG    . GLU C 1 27  ? 18.952  -1.951  21.819  1.00 63.69  ? 13  GLU C CG    1 
ATOM   3125 C CD    . GLU C 1 27  ? 17.777  -1.064  21.411  1.00 70.72  ? 13  GLU C CD    1 
ATOM   3126 O OE1   . GLU C 1 27  ? 17.039  -1.424  20.458  1.00 70.61  ? 13  GLU C OE1   1 
ATOM   3127 O OE2   . GLU C 1 27  ? 17.593  -0.004  22.052  1.00 76.32  ? 13  GLU C OE2   1 
ATOM   3128 N N     . GLU C 1 28  ? 17.016  -5.721  23.648  1.00 34.38  ? 14  GLU C N     1 
ATOM   3129 C CA    . GLU C 1 28  ? 16.382  -7.033  23.557  1.00 38.10  ? 14  GLU C CA    1 
ATOM   3130 C C     . GLU C 1 28  ? 14.928  -6.953  24.040  1.00 34.57  ? 14  GLU C C     1 
ATOM   3131 O O     . GLU C 1 28  ? 14.021  -7.534  23.449  1.00 34.30  ? 14  GLU C O     1 
ATOM   3132 C CB    . GLU C 1 28  ? 17.157  -8.023  24.417  1.00 38.42  ? 14  GLU C CB    1 
ATOM   3133 C CG    . GLU C 1 28  ? 16.841  -9.484  24.218  1.00 51.45  ? 14  GLU C CG    1 
ATOM   3134 C CD    . GLU C 1 28  ? 17.550  -10.350 25.262  1.00 60.69  ? 14  GLU C CD    1 
ATOM   3135 O OE1   . GLU C 1 28  ? 18.702  -10.005 25.640  1.00 58.94  ? 14  GLU C OE1   1 
ATOM   3136 O OE2   . GLU C 1 28  ? 16.962  -11.367 25.700  1.00 58.70  ? 14  GLU C OE2   1 
ATOM   3137 N N     . ILE C 1 29  ? 14.723  -6.247  25.140  1.00 31.38  ? 15  ILE C N     1 
ATOM   3138 C CA    . ILE C 1 29  ? 13.401  -6.085  25.693  1.00 29.34  ? 15  ILE C CA    1 
ATOM   3139 C C     . ILE C 1 29  ? 12.508  -5.320  24.703  1.00 26.31  ? 15  ILE C C     1 
ATOM   3140 O O     . ILE C 1 29  ? 11.342  -5.679  24.507  1.00 27.75  ? 15  ILE C O     1 
ATOM   3141 C CB    . ILE C 1 29  ? 13.476  -5.316  27.006  1.00 26.62  ? 15  ILE C CB    1 
ATOM   3142 C CG1   . ILE C 1 29  ? 14.166  -6.175  28.051  1.00 29.46  ? 15  ILE C CG1   1 
ATOM   3143 C CG2   . ILE C 1 29  ? 12.057  -4.869  27.456  1.00 24.62  ? 15  ILE C CG2   1 
ATOM   3144 C CD1   . ILE C 1 29  ? 14.483  -5.417  29.341  1.00 33.40  ? 15  ILE C CD1   1 
ATOM   3145 N N     . LEU C 1 30  ? 13.061  -4.275  24.087  1.00 25.76  ? 16  LEU C N     1 
ATOM   3146 C CA    . LEU C 1 30  ? 12.305  -3.462  23.139  1.00 30.66  ? 16  LEU C CA    1 
ATOM   3147 C C     . LEU C 1 30  ? 11.940  -4.295  21.914  1.00 32.26  ? 16  LEU C C     1 
ATOM   3148 O O     . LEU C 1 30  ? 10.801  -4.241  21.429  1.00 31.43  ? 16  LEU C O     1 
ATOM   3149 C CB    . LEU C 1 30  ? 13.114  -2.211  22.756  1.00 25.46  ? 16  LEU C CB    1 
ATOM   3150 C CG    . LEU C 1 30  ? 13.286  -1.220  23.920  1.00 21.81  ? 16  LEU C CG    1 
ATOM   3151 C CD1   . LEU C 1 30  ? 14.110  -0.021  23.471  1.00 24.26  ? 16  LEU C CD1   1 
ATOM   3152 C CD2   . LEU C 1 30  ? 11.893  -0.736  24.388  1.00 23.52  ? 16  LEU C CD2   1 
ATOM   3153 N N     . GLN C 1 31  ? 12.902  -5.085  21.443  1.00 31.19  ? 17  GLN C N     1 
ATOM   3154 C CA    . GLN C 1 31  ? 12.703  -5.953  20.299  1.00 32.65  ? 17  GLN C CA    1 
ATOM   3155 C C     . GLN C 1 31  ? 11.593  -6.962  20.617  1.00 34.64  ? 17  GLN C C     1 
ATOM   3156 O O     . GLN C 1 31  ? 10.742  -7.229  19.767  1.00 36.04  ? 17  GLN C O     1 
ATOM   3157 C CB    . GLN C 1 31  ? 14.002  -6.675  19.953  1.00 32.61  ? 17  GLN C CB    1 
ATOM   3158 C CG    . GLN C 1 31  ? 13.913  -7.478  18.664  1.00 51.30  ? 17  GLN C CG    1 
ATOM   3159 C CD    . GLN C 1 31  ? 13.513  -6.629  17.450  1.00 58.02  ? 17  GLN C CD    1 
ATOM   3160 O OE1   . GLN C 1 31  ? 14.251  -5.731  17.032  1.00 60.73  ? 17  GLN C OE1   1 
ATOM   3161 N NE2   . GLN C 1 31  ? 12.335  -6.913  16.885  1.00 61.10  ? 17  GLN C NE2   1 
ATOM   3162 N N     . SER C 1 32  ? 11.596  -7.517  21.829  1.00 28.73  ? 18  SER C N     1 
ATOM   3163 C CA    . SER C 1 32  ? 10.551  -8.455  22.251  1.00 32.01  ? 18  SER C CA    1 
ATOM   3164 C C     . SER C 1 32  ? 9.169   -7.792  22.325  1.00 29.23  ? 18  SER C C     1 
ATOM   3165 O O     . SER C 1 32  ? 8.158   -8.424  22.009  1.00 26.46  ? 18  SER C O     1 
ATOM   3166 C CB    . SER C 1 32  ? 10.890  -9.049  23.623  1.00 32.03  ? 18  SER C CB    1 
ATOM   3167 O OG    . SER C 1 32  ? 12.015  -9.888  23.497  1.00 41.96  ? 18  SER C OG    1 
ATOM   3168 N N     . LEU C 1 33  ? 9.134   -6.530  22.773  1.00 30.61  ? 19  LEU C N     1 
ATOM   3169 C CA    . LEU C 1 33  ? 7.887   -5.751  22.871  1.00 30.13  ? 19  LEU C CA    1 
ATOM   3170 C C     . LEU C 1 33  ? 7.290   -5.547  21.452  1.00 26.13  ? 19  LEU C C     1 
ATOM   3171 O O     . LEU C 1 33  ? 6.105   -5.807  21.215  1.00 26.40  ? 19  LEU C O     1 
ATOM   3172 C CB    . LEU C 1 33  ? 8.182   -4.384  23.487  1.00 19.83  ? 19  LEU C CB    1 
ATOM   3173 C CG    . LEU C 1 33  ? 7.153   -3.728  24.392  1.00 29.26  ? 19  LEU C CG    1 
ATOM   3174 C CD1   . LEU C 1 33  ? 7.368   -2.218  24.322  1.00 26.92  ? 19  LEU C CD1   1 
ATOM   3175 C CD2   . LEU C 1 33  ? 5.747   -4.083  24.013  1.00 25.63  ? 19  LEU C CD2   1 
ATOM   3176 N N     . ALA C 1 34  ? 8.121   -5.038  20.544  1.00 24.39  ? 20  ALA C N     1 
ATOM   3177 C CA    . ALA C 1 34  ? 7.753   -4.809  19.141  1.00 23.89  ? 20  ALA C CA    1 
ATOM   3178 C C     . ALA C 1 34  ? 7.244   -6.127  18.532  1.00 23.86  ? 20  ALA C C     1 
ATOM   3179 O O     . ALA C 1 34  ? 6.195   -6.166  17.883  1.00 24.02  ? 20  ALA C O     1 
ATOM   3180 C CB    . ALA C 1 34  ? 8.953   -4.305  18.370  1.00 22.91  ? 20  ALA C CB    1 
ATOM   3181 N N     . LEU C 1 35  ? 7.979   -7.212  18.758  1.00 24.94  ? 21  LEU C N     1 
ATOM   3182 C CA    . LEU C 1 35  ? 7.551   -8.529  18.274  1.00 27.65  ? 21  LEU C CA    1 
ATOM   3183 C C     . LEU C 1 35  ? 6.203   -8.989  18.879  1.00 28.55  ? 21  LEU C C     1 
ATOM   3184 O O     . LEU C 1 35  ? 5.353   -9.563  18.180  1.00 25.88  ? 21  LEU C O     1 
ATOM   3185 C CB    . LEU C 1 35  ? 8.643   -9.566  18.552  1.00 25.26  ? 21  LEU C CB    1 
ATOM   3186 C CG    . LEU C 1 35  ? 9.754   -9.560  17.499  1.00 36.06  ? 21  LEU C CG    1 
ATOM   3187 C CD1   . LEU C 1 35  ? 10.971  -10.365 17.991  1.00 34.95  ? 21  LEU C CD1   1 
ATOM   3188 C CD2   . LEU C 1 35  ? 9.200   -10.139 16.178  1.00 35.14  ? 21  LEU C CD2   1 
ATOM   3189 N N     . MET C 1 36  ? 5.986   -8.742  20.171  1.00 29.06  ? 22  MET C N     1 
ATOM   3190 C CA    . MET C 1 36  ? 4.725   -9.136  20.756  1.00 25.63  ? 22  MET C CA    1 
ATOM   3191 C C     . MET C 1 36  ? 3.595   -8.370  20.132  1.00 23.40  ? 22  MET C C     1 
ATOM   3192 O O     . MET C 1 36  ? 2.520   -8.922  19.933  1.00 19.81  ? 22  MET C O     1 
ATOM   3193 C CB    . MET C 1 36  ? 4.707   -8.894  22.265  1.00 26.93  ? 22  MET C CB    1 
ATOM   3194 C CG    . MET C 1 36  ? 5.583   -9.863  23.018  1.00 36.57  ? 22  MET C CG    1 
ATOM   3195 S SD    . MET C 1 36  ? 5.320   -9.744  24.799  1.00 41.15  ? 22  MET C SD    1 
ATOM   3196 C CE    . MET C 1 36  ? 3.558   -10.301 24.846  1.00 37.08  ? 22  MET C CE    1 
ATOM   3197 N N     . LEU C 1 37  ? 3.833   -7.090  19.850  1.00 22.56  ? 23  LEU C N     1 
ATOM   3198 C CA    . LEU C 1 37  ? 2.828   -6.212  19.255  1.00 22.30  ? 23  LEU C CA    1 
ATOM   3199 C C     . LEU C 1 37  ? 2.389   -6.677  17.852  1.00 26.88  ? 23  LEU C C     1 
ATOM   3200 O O     . LEU C 1 37  ? 1.264   -6.408  17.418  1.00 25.51  ? 23  LEU C O     1 
ATOM   3201 C CB    . LEU C 1 37  ? 3.385   -4.777  19.209  1.00 25.72  ? 23  LEU C CB    1 
ATOM   3202 C CG    . LEU C 1 37  ? 3.506   -4.105  20.578  1.00 23.79  ? 23  LEU C CG    1 
ATOM   3203 C CD1   . LEU C 1 37  ? 4.294   -2.801  20.497  1.00 23.99  ? 23  LEU C CD1   1 
ATOM   3204 C CD2   . LEU C 1 37  ? 2.105   -3.831  21.084  1.00 21.22  ? 23  LEU C CD2   1 
ATOM   3205 N N     . GLU C 1 38  ? 3.270   -7.402  17.169  1.00 31.19  ? 24  GLU C N     1 
ATOM   3206 C CA    . GLU C 1 38  ? 3.005   -7.910  15.828  1.00 30.94  ? 24  GLU C CA    1 
ATOM   3207 C C     . GLU C 1 38  ? 2.194   -9.204  15.871  1.00 34.36  ? 24  GLU C C     1 
ATOM   3208 O O     . GLU C 1 38  ? 1.396   -9.495  14.964  1.00 30.96  ? 24  GLU C O     1 
ATOM   3209 C CB    . GLU C 1 38  ? 4.330   -8.171  15.133  1.00 31.56  ? 24  GLU C CB    1 
ATOM   3210 C CG    . GLU C 1 38  ? 4.210   -8.570  13.687  1.00 40.67  ? 24  GLU C CG    1 
ATOM   3211 C CD    . GLU C 1 38  ? 5.566   -8.931  13.067  1.00 49.15  ? 24  GLU C CD    1 
ATOM   3212 O OE1   . GLU C 1 38  ? 5.667   -9.006  11.824  1.00 55.34  ? 24  GLU C OE1   1 
ATOM   3213 O OE2   . GLU C 1 38  ? 6.533   -9.153  13.817  1.00 47.52  ? 24  GLU C OE2   1 
ATOM   3214 N N     . SER C 1 39  ? 2.390   -9.958  16.950  1.00 32.72  ? 25  SER C N     1 
ATOM   3215 C CA    . SER C 1 39  ? 1.743   -11.249 17.156  1.00 27.45  ? 25  SER C CA    1 
ATOM   3216 C C     . SER C 1 39  ? 0.272   -11.192 17.545  1.00 28.74  ? 25  SER C C     1 
ATOM   3217 O O     . SER C 1 39  ? -0.327  -10.135 17.619  1.00 30.79  ? 25  SER C O     1 
ATOM   3218 C CB    . SER C 1 39  ? 2.513   -12.025 18.232  1.00 29.46  ? 25  SER C CB    1 
ATOM   3219 O OG    . SER C 1 39  ? 2.230   -11.499 19.529  1.00 25.27  ? 25  SER C OG    1 
ATOM   3220 N N     . SER C 1 40  ? -0.300  -12.363 17.811  1.00 32.10  ? 26  SER C N     1 
ATOM   3221 C CA    . SER C 1 40  ? -1.690  -12.463 18.215  1.00 36.31  ? 26  SER C CA    1 
ATOM   3222 C C     . SER C 1 40  ? -1.856  -11.775 19.570  1.00 35.08  ? 26  SER C C     1 
ATOM   3223 O O     . SER C 1 40  ? -2.963  -11.374 19.945  1.00 31.03  ? 26  SER C O     1 
ATOM   3224 C CB    . SER C 1 40  ? -2.126  -13.948 18.304  1.00 41.02  ? 26  SER C CB    1 
ATOM   3225 O OG    . SER C 1 40  ? -1.403  -14.675 19.295  1.00 44.59  ? 26  SER C OG    1 
ATOM   3226 N N     . ASP C 1 41  ? -0.752  -11.636 20.300  1.00 34.35  ? 27  ASP C N     1 
ATOM   3227 C CA    . ASP C 1 41  ? -0.788  -10.979 21.607  1.00 35.07  ? 27  ASP C CA    1 
ATOM   3228 C C     . ASP C 1 41  ? -0.987  -9.469  21.479  1.00 33.13  ? 27  ASP C C     1 
ATOM   3229 O O     . ASP C 1 41  ? -1.438  -8.833  22.419  1.00 32.96  ? 27  ASP C O     1 
ATOM   3230 C CB    . ASP C 1 41  ? 0.520   -11.230 22.388  1.00 39.27  ? 27  ASP C CB    1 
ATOM   3231 C CG    . ASP C 1 41  ? 0.711   -12.703 22.767  1.00 46.80  ? 27  ASP C CG    1 
ATOM   3232 O OD1   . ASP C 1 41  ? -0.304  -13.392 23.028  1.00 50.38  ? 27  ASP C OD1   1 
ATOM   3233 O OD2   . ASP C 1 41  ? 1.878   -13.161 22.813  1.00 46.48  ? 27  ASP C OD2   1 
ATOM   3234 N N     . GLY C 1 42  ? -0.661  -8.915  20.306  1.00 30.57  ? 28  GLY C N     1 
ATOM   3235 C CA    . GLY C 1 42  ? -0.751  -7.478  20.070  1.00 23.69  ? 28  GLY C CA    1 
ATOM   3236 C C     . GLY C 1 42  ? -2.094  -6.798  20.201  1.00 25.05  ? 28  GLY C C     1 
ATOM   3237 O O     . GLY C 1 42  ? -2.186  -5.567  20.432  1.00 26.99  ? 28  GLY C O     1 
ATOM   3238 N N     . SER C 1 43  ? -3.154  -7.577  20.057  1.00 24.06  ? 29  SER C N     1 
ATOM   3239 C CA    . SER C 1 43  ? -4.500  -7.020  20.175  1.00 27.76  ? 29  SER C CA    1 
ATOM   3240 C C     . SER C 1 43  ? -4.882  -6.931  21.645  1.00 25.43  ? 29  SER C C     1 
ATOM   3241 O O     . SER C 1 43  ? -5.962  -6.430  21.989  1.00 25.20  ? 29  SER C O     1 
ATOM   3242 C CB    . SER C 1 43  ? -5.505  -7.915  19.459  1.00 26.72  ? 29  SER C CB    1 
ATOM   3243 O OG    . SER C 1 43  ? -5.383  -9.241  19.945  1.00 33.66  ? 29  SER C OG    1 
ATOM   3244 N N     . GLN C 1 44  ? -4.007  -7.448  22.508  1.00 26.49  ? 30  GLN C N     1 
ATOM   3245 C CA    . GLN C 1 44  ? -4.262  -7.442  23.949  1.00 29.00  ? 30  GLN C CA    1 
ATOM   3246 C C     . GLN C 1 44  ? -3.181  -6.708  24.689  1.00 29.09  ? 30  GLN C C     1 
ATOM   3247 O O     . GLN C 1 44  ? -2.110  -6.423  24.143  1.00 24.16  ? 30  GLN C O     1 
ATOM   3248 C CB    . GLN C 1 44  ? -4.288  -8.857  24.520  1.00 31.06  ? 30  GLN C CB    1 
ATOM   3249 C CG    . GLN C 1 44  ? -5.393  -9.727  23.991  1.00 47.57  ? 30  GLN C CG    1 
ATOM   3250 C CD    . GLN C 1 44  ? -5.212  -11.162 24.412  1.00 51.94  ? 30  GLN C CD    1 
ATOM   3251 O OE1   . GLN C 1 44  ? -4.244  -11.808 24.023  1.00 60.47  ? 30  GLN C OE1   1 
ATOM   3252 N NE2   . GLN C 1 44  ? -6.134  -11.667 25.219  1.00 56.58  ? 30  GLN C NE2   1 
ATOM   3253 N N     . ARG C 1 45  ? -3.478  -6.450  25.958  1.00 29.98  ? 31  ARG C N     1 
ATOM   3254 C CA    . ARG C 1 45  ? -2.565  -5.765  26.840  1.00 23.88  ? 31  ARG C CA    1 
ATOM   3255 C C     . ARG C 1 45  ? -1.242  -6.506  26.977  1.00 30.30  ? 31  ARG C C     1 
ATOM   3256 O O     . ARG C 1 45  ? -1.223  -7.720  27.245  1.00 29.08  ? 31  ARG C O     1 
ATOM   3257 C CB    . ARG C 1 45  ? -3.205  -5.625  28.207  1.00 25.90  ? 31  ARG C CB    1 
ATOM   3258 C CG    . ARG C 1 45  ? -2.210  -5.203  29.271  1.00 32.79  ? 31  ARG C CG    1 
ATOM   3259 C CD    . ARG C 1 45  ? -2.892  -4.816  30.610  1.00 37.20  ? 31  ARG C CD    1 
ATOM   3260 N NE    . ARG C 1 45  ? -3.491  -3.506  30.530  1.00 43.47  ? 31  ARG C NE    1 
ATOM   3261 C CZ    . ARG C 1 45  ? -2.967  -2.426  31.085  1.00 45.61  ? 31  ARG C CZ    1 
ATOM   3262 N NH1   . ARG C 1 45  ? -1.838  -2.492  31.781  1.00 42.00  ? 31  ARG C NH1   1 
ATOM   3263 N NH2   . ARG C 1 45  ? -3.555  -1.261  30.900  1.00 49.45  ? 31  ARG C NH2   1 
ATOM   3264 N N     . ILE C 1 46  ? -0.127  -5.800  26.782  1.00 22.65  ? 32  ILE C N     1 
ATOM   3265 C CA    . ILE C 1 46  ? 1.151   -6.467  26.948  1.00 28.08  ? 32  ILE C CA    1 
ATOM   3266 C C     . ILE C 1 46  ? 1.536   -6.337  28.432  1.00 28.65  ? 32  ILE C C     1 
ATOM   3267 O O     . ILE C 1 46  ? 2.183   -5.373  28.831  1.00 32.71  ? 32  ILE C O     1 
ATOM   3268 C CB    . ILE C 1 46  ? 2.260   -5.833  26.105  1.00 24.58  ? 32  ILE C CB    1 
ATOM   3269 C CG1   . ILE C 1 46  ? 1.834   -5.712  24.626  1.00 30.54  ? 32  ILE C CG1   1 
ATOM   3270 C CG2   . ILE C 1 46  ? 3.530   -6.664  26.247  1.00 25.02  ? 32  ILE C CG2   1 
ATOM   3271 C CD1   . ILE C 1 46  ? 1.626   -7.019  23.928  1.00 33.63  ? 32  ILE C CD1   1 
ATOM   3272 N N     . THR C 1 47  ? 1.113   -7.294  29.248  1.00 33.08  ? 33  THR C N     1 
ATOM   3273 C CA    . THR C 1 47  ? 1.421   -7.277  30.680  1.00 28.11  ? 33  THR C CA    1 
ATOM   3274 C C     . THR C 1 47  ? 2.920   -7.482  30.889  1.00 30.93  ? 33  THR C C     1 
ATOM   3275 O O     . THR C 1 47  ? 3.619   -8.001  30.009  1.00 27.92  ? 33  THR C O     1 
ATOM   3276 C CB    . THR C 1 47  ? 0.676   -8.394  31.426  1.00 29.99  ? 33  THR C CB    1 
ATOM   3277 O OG1   . THR C 1 47  ? 1.065   -9.662  30.883  1.00 32.26  ? 33  THR C OG1   1 
ATOM   3278 C CG2   . THR C 1 47  ? -0.817  -8.231  31.289  1.00 29.35  ? 33  THR C CG2   1 
ATOM   3279 N N     . THR C 1 48  ? 3.426   -7.047  32.042  1.00 28.54  ? 34  THR C N     1 
ATOM   3280 C CA    . THR C 1 48  ? 4.831   -7.228  32.346  1.00 28.89  ? 34  THR C CA    1 
ATOM   3281 C C     . THR C 1 48  ? 5.090   -8.735  32.462  1.00 28.23  ? 34  THR C C     1 
ATOM   3282 O O     . THR C 1 48  ? 6.168   -9.221  32.112  1.00 30.12  ? 34  THR C O     1 
ATOM   3283 C CB    . THR C 1 48  ? 5.216   -6.536  33.677  1.00 30.55  ? 34  THR C CB    1 
ATOM   3284 O OG1   . THR C 1 48  ? 4.197   -6.775  34.652  1.00 28.95  ? 34  THR C OG1   1 
ATOM   3285 C CG2   . THR C 1 48  ? 5.394   -5.043  33.479  1.00 25.48  ? 34  THR C CG2   1 
ATOM   3286 N N     . ALA C 1 49  ? 4.112   -9.484  32.951  1.00 28.53  ? 35  ALA C N     1 
ATOM   3287 C CA    . ALA C 1 49  ? 4.316   -10.924 33.067  1.00 30.34  ? 35  ALA C CA    1 
ATOM   3288 C C     . ALA C 1 49  ? 4.580   -11.499 31.663  1.00 32.15  ? 35  ALA C C     1 
ATOM   3289 O O     . ALA C 1 49  ? 5.620   -12.120 31.426  1.00 32.05  ? 35  ALA C O     1 
ATOM   3290 C CB    . ALA C 1 49  ? 3.092   -11.586 33.724  1.00 32.82  ? 35  ALA C CB    1 
ATOM   3291 N N     . LYS C 1 50  ? 3.664   -11.255 30.722  1.00 35.91  ? 36  LYS C N     1 
ATOM   3292 C CA    . LYS C 1 50  ? 3.819   -11.733 29.333  1.00 33.19  ? 36  LYS C CA    1 
ATOM   3293 C C     . LYS C 1 50  ? 5.108   -11.254 28.645  1.00 28.97  ? 36  LYS C C     1 
ATOM   3294 O O     . LYS C 1 50  ? 5.828   -12.032 28.025  1.00 38.93  ? 36  LYS C O     1 
ATOM   3295 C CB    . LYS C 1 50  ? 2.589   -11.330 28.524  1.00 30.52  ? 36  LYS C CB    1 
ATOM   3296 C CG    . LYS C 1 50  ? 1.359   -12.118 28.931  1.00 28.58  ? 36  LYS C CG    1 
ATOM   3297 C CD    . LYS C 1 50  ? 0.066   -11.478 28.478  1.00 32.03  ? 36  LYS C CD    1 
ATOM   3298 C CE    . LYS C 1 50  ? -0.811  -12.482 27.775  1.00 36.38  ? 36  LYS C CE    1 
ATOM   3299 N NZ    . LYS C 1 50  ? -2.193  -12.499 28.293  1.00 36.92  ? 36  LYS C NZ    1 
ATOM   3300 N N     . LEU C 1 51  ? 5.428   -9.981  28.768  1.00 29.26  ? 37  LEU C N     1 
ATOM   3301 C CA    . LEU C 1 51  ? 6.641   -9.479  28.158  1.00 29.29  ? 37  LEU C CA    1 
ATOM   3302 C C     . LEU C 1 51  ? 7.868   -10.159 28.774  1.00 32.79  ? 37  LEU C C     1 
ATOM   3303 O O     . LEU C 1 51  ? 8.832   -10.452 28.073  1.00 31.70  ? 37  LEU C O     1 
ATOM   3304 C CB    . LEU C 1 51  ? 6.720   -7.949  28.336  1.00 27.73  ? 37  LEU C CB    1 
ATOM   3305 C CG    . LEU C 1 51  ? 7.949   -7.214  27.801  1.00 30.03  ? 37  LEU C CG    1 
ATOM   3306 C CD1   . LEU C 1 51  ? 7.975   -7.318  26.259  1.00 30.80  ? 37  LEU C CD1   1 
ATOM   3307 C CD2   . LEU C 1 51  ? 7.900   -5.744  28.248  1.00 23.88  ? 37  LEU C CD2   1 
ATOM   3308 N N     . ALA C 1 52  ? 7.827   -10.412 30.084  1.00 34.98  ? 38  ALA C N     1 
ATOM   3309 C CA    . ALA C 1 52  ? 8.948   -11.061 30.777  1.00 34.76  ? 38  ALA C CA    1 
ATOM   3310 C C     . ALA C 1 52  ? 9.140   -12.489 30.246  1.00 34.37  ? 38  ALA C C     1 
ATOM   3311 O O     . ALA C 1 52  ? 10.258  -12.909 29.959  1.00 35.61  ? 38  ALA C O     1 
ATOM   3312 C CB    . ALA C 1 52  ? 8.688   -11.084 32.305  1.00 37.80  ? 38  ALA C CB    1 
ATOM   3313 N N     . ALA C 1 53  ? 8.047   -13.229 30.129  1.00 31.65  ? 39  ALA C N     1 
ATOM   3314 C CA    . ALA C 1 53  ? 8.091   -14.591 29.610  1.00 36.94  ? 39  ALA C CA    1 
ATOM   3315 C C     . ALA C 1 53  ? 8.661   -14.576 28.183  1.00 42.25  ? 39  ALA C C     1 
ATOM   3316 O O     . ALA C 1 53  ? 9.451   -15.436 27.787  1.00 42.82  ? 39  ALA C O     1 
ATOM   3317 C CB    . ALA C 1 53  ? 6.673   -15.177 29.608  1.00 30.97  ? 39  ALA C CB    1 
ATOM   3318 N N     . SER C 1 54  ? 8.263   -13.568 27.420  1.00 44.95  ? 40  SER C N     1 
ATOM   3319 C CA    . SER C 1 54  ? 8.709   -13.430 26.048  1.00 41.92  ? 40  SER C CA    1 
ATOM   3320 C C     . SER C 1 54  ? 10.204  -13.125 25.989  1.00 40.63  ? 40  SER C C     1 
ATOM   3321 O O     . SER C 1 54  ? 10.929  -13.617 25.112  1.00 39.91  ? 40  SER C O     1 
ATOM   3322 C CB    . SER C 1 54  ? 7.890   -12.317 25.372  1.00 44.34  ? 40  SER C CB    1 
ATOM   3323 O OG    . SER C 1 54  ? 8.260   -12.126 24.021  1.00 49.69  ? 40  SER C OG    1 
ATOM   3324 N N     . VAL C 1 55  ? 10.685  -12.313 26.917  1.00 37.63  ? 41  VAL C N     1 
ATOM   3325 C CA    . VAL C 1 55  ? 12.106  -11.994 26.902  1.00 39.82  ? 41  VAL C CA    1 
ATOM   3326 C C     . VAL C 1 55  ? 12.913  -13.167 27.463  1.00 41.22  ? 41  VAL C C     1 
ATOM   3327 O O     . VAL C 1 55  ? 14.096  -13.320 27.144  1.00 39.81  ? 41  VAL C O     1 
ATOM   3328 C CB    . VAL C 1 55  ? 12.419  -10.726 27.746  1.00 41.03  ? 41  VAL C CB    1 
ATOM   3329 C CG1   . VAL C 1 55  ? 13.916  -10.445 27.738  1.00 37.92  ? 41  VAL C CG1   1 
ATOM   3330 C CG2   . VAL C 1 55  ? 11.675  -9.528  27.190  1.00 38.83  ? 41  VAL C CG2   1 
ATOM   3331 N N     . GLY C 1 56  ? 12.267  -13.998 28.286  1.00 42.36  ? 42  GLY C N     1 
ATOM   3332 C CA    . GLY C 1 56  ? 12.954  -15.121 28.901  1.00 40.24  ? 42  GLY C CA    1 
ATOM   3333 C C     . GLY C 1 56  ? 13.443  -14.810 30.316  1.00 44.79  ? 42  GLY C C     1 
ATOM   3334 O O     . GLY C 1 56  ? 14.032  -15.669 30.975  1.00 47.98  ? 42  GLY C O     1 
ATOM   3335 N N     . VAL C 1 57  ? 13.192  -13.590 30.793  1.00 42.78  ? 43  VAL C N     1 
ATOM   3336 C CA    . VAL C 1 57  ? 13.616  -13.171 32.131  1.00 39.34  ? 43  VAL C CA    1 
ATOM   3337 C C     . VAL C 1 57  ? 12.456  -13.008 33.133  1.00 40.75  ? 43  VAL C C     1 
ATOM   3338 O O     . VAL C 1 57  ? 11.301  -13.322 32.823  1.00 39.71  ? 43  VAL C O     1 
ATOM   3339 C CB    . VAL C 1 57  ? 14.413  -11.830 32.061  1.00 41.06  ? 43  VAL C CB    1 
ATOM   3340 C CG1   . VAL C 1 57  ? 15.646  -11.995 31.173  1.00 33.25  ? 43  VAL C CG1   1 
ATOM   3341 C CG2   . VAL C 1 57  ? 13.535  -10.722 31.528  1.00 37.11  ? 43  VAL C CG2   1 
ATOM   3342 N N     . SER C 1 58  ? 12.761  -12.551 34.349  1.00 32.87  ? 44  SER C N     1 
ATOM   3343 C CA    . SER C 1 58  ? 11.707  -12.333 35.339  1.00 35.55  ? 44  SER C CA    1 
ATOM   3344 C C     . SER C 1 58  ? 11.237  -10.884 35.171  1.00 33.92  ? 44  SER C C     1 
ATOM   3345 O O     . SER C 1 58  ? 11.920  -10.072 34.528  1.00 35.27  ? 44  SER C O     1 
ATOM   3346 C CB    . SER C 1 58  ? 12.263  -12.520 36.747  1.00 36.50  ? 44  SER C CB    1 
ATOM   3347 O OG    . SER C 1 58  ? 13.268  -11.553 36.984  1.00 35.86  ? 44  SER C OG    1 
ATOM   3348 N N     . GLU C 1 59  ? 10.097  -10.543 35.757  1.00 34.50  ? 45  GLU C N     1 
ATOM   3349 C CA    . GLU C 1 59  ? 9.595   -9.182  35.630  1.00 36.69  ? 45  GLU C CA    1 
ATOM   3350 C C     . GLU C 1 59  ? 10.558  -8.191  36.261  1.00 36.36  ? 45  GLU C C     1 
ATOM   3351 O O     . GLU C 1 59  ? 10.724  -7.068  35.761  1.00 32.78  ? 45  GLU C O     1 
ATOM   3352 C CB    . GLU C 1 59  ? 8.216   -9.062  36.265  1.00 31.05  ? 45  GLU C CB    1 
ATOM   3353 C CG    . GLU C 1 59  ? 7.261   -10.090 35.709  1.00 36.24  ? 45  GLU C CG    1 
ATOM   3354 C CD    . GLU C 1 59  ? 5.833   -9.887  36.149  1.00 34.15  ? 45  GLU C CD    1 
ATOM   3355 O OE1   . GLU C 1 59  ? 5.152   -10.910 36.392  1.00 38.65  ? 45  GLU C OE1   1 
ATOM   3356 O OE2   . GLU C 1 59  ? 5.380   -8.719  36.239  1.00 37.80  ? 45  GLU C OE2   1 
ATOM   3357 N N     . ALA C 1 60  ? 11.213  -8.611  37.340  1.00 36.79  ? 46  ALA C N     1 
ATOM   3358 C CA    . ALA C 1 60  ? 12.154  -7.728  38.017  1.00 37.65  ? 46  ALA C CA    1 
ATOM   3359 C C     . ALA C 1 60  ? 13.298  -7.372  37.067  1.00 33.74  ? 46  ALA C C     1 
ATOM   3360 O O     . ALA C 1 60  ? 13.750  -6.229  37.020  1.00 31.70  ? 46  ALA C O     1 
ATOM   3361 C CB    . ALA C 1 60  ? 12.688  -8.394  39.301  1.00 36.85  ? 46  ALA C CB    1 
ATOM   3362 N N     . ALA C 1 61  ? 13.763  -8.356  36.312  1.00 32.93  ? 47  ALA C N     1 
ATOM   3363 C CA    . ALA C 1 61  ? 14.838  -8.132  35.357  1.00 36.32  ? 47  ALA C CA    1 
ATOM   3364 C C     . ALA C 1 61  ? 14.476  -6.963  34.439  1.00 33.45  ? 47  ALA C C     1 
ATOM   3365 O O     . ALA C 1 61  ? 15.334  -6.187  34.022  1.00 39.56  ? 47  ALA C O     1 
ATOM   3366 C CB    . ALA C 1 61  ? 15.078  -9.413  34.534  1.00 39.49  ? 47  ALA C CB    1 
ATOM   3367 N N     . LEU C 1 62  ? 13.197  -6.835  34.128  1.00 31.33  ? 48  LEU C N     1 
ATOM   3368 C CA    . LEU C 1 62  ? 12.727  -5.764  33.268  1.00 29.77  ? 48  LEU C CA    1 
ATOM   3369 C C     . LEU C 1 62  ? 13.009  -4.393  33.876  1.00 31.37  ? 48  LEU C C     1 
ATOM   3370 O O     . LEU C 1 62  ? 13.424  -3.439  33.189  1.00 29.36  ? 48  LEU C O     1 
ATOM   3371 C CB    . LEU C 1 62  ? 11.222  -5.935  33.043  1.00 29.52  ? 48  LEU C CB    1 
ATOM   3372 C CG    . LEU C 1 62  ? 10.683  -6.602  31.764  1.00 35.65  ? 48  LEU C CG    1 
ATOM   3373 C CD1   . LEU C 1 62  ? 11.731  -7.456  31.042  1.00 32.64  ? 48  LEU C CD1   1 
ATOM   3374 C CD2   . LEU C 1 62  ? 9.447   -7.400  32.141  1.00 31.02  ? 48  LEU C CD2   1 
ATOM   3375 N N     . TYR C 1 63  ? 12.801  -4.297  35.182  1.00 32.93  ? 49  TYR C N     1 
ATOM   3376 C CA    . TYR C 1 63  ? 13.006  -3.036  35.871  1.00 33.14  ? 49  TYR C CA    1 
ATOM   3377 C C     . TYR C 1 63  ? 14.449  -2.630  36.120  1.00 34.08  ? 49  TYR C C     1 
ATOM   3378 O O     . TYR C 1 63  ? 14.698  -1.528  36.588  1.00 34.89  ? 49  TYR C O     1 
ATOM   3379 C CB    . TYR C 1 63  ? 12.167  -3.009  37.145  1.00 29.29  ? 49  TYR C CB    1 
ATOM   3380 C CG    . TYR C 1 63  ? 10.688  -2.934  36.818  1.00 28.75  ? 49  TYR C CG    1 
ATOM   3381 C CD1   . TYR C 1 63  ? 10.063  -1.708  36.502  1.00 21.25  ? 49  TYR C CD1   1 
ATOM   3382 C CD2   . TYR C 1 63  ? 9.929   -4.099  36.734  1.00 21.30  ? 49  TYR C CD2   1 
ATOM   3383 C CE1   . TYR C 1 63  ? 8.696   -1.675  36.097  1.00 28.95  ? 49  TYR C CE1   1 
ATOM   3384 C CE2   . TYR C 1 63  ? 8.585   -4.075  36.339  1.00 17.88  ? 49  TYR C CE2   1 
ATOM   3385 C CZ    . TYR C 1 63  ? 7.979   -2.877  36.018  1.00 24.60  ? 49  TYR C CZ    1 
ATOM   3386 O OH    . TYR C 1 63  ? 6.682   -2.925  35.580  1.00 28.30  ? 49  TYR C OH    1 
ATOM   3387 N N     . ARG C 1 64  ? 15.397  -3.498  35.763  1.00 36.12  ? 50  ARG C N     1 
ATOM   3388 C CA    . ARG C 1 64  ? 16.809  -3.161  35.869  1.00 36.16  ? 50  ARG C CA    1 
ATOM   3389 C C     . ARG C 1 64  ? 17.132  -2.327  34.631  1.00 40.63  ? 50  ARG C C     1 
ATOM   3390 O O     . ARG C 1 64  ? 18.215  -1.753  34.532  1.00 40.97  ? 50  ARG C O     1 
ATOM   3391 C CB    . ARG C 1 64  ? 17.705  -4.387  35.778  1.00 37.69  ? 50  ARG C CB    1 
ATOM   3392 C CG    . ARG C 1 64  ? 17.272  -5.597  36.556  1.00 45.06  ? 50  ARG C CG    1 
ATOM   3393 C CD    . ARG C 1 64  ? 18.256  -6.700  36.245  1.00 55.33  ? 50  ARG C CD    1 
ATOM   3394 N NE    . ARG C 1 64  ? 19.592  -6.322  36.703  1.00 61.85  ? 50  ARG C NE    1 
ATOM   3395 C CZ    . ARG C 1 64  ? 20.703  -6.434  35.986  1.00 64.38  ? 50  ARG C CZ    1 
ATOM   3396 N NH1   . ARG C 1 64  ? 20.655  -6.920  34.753  1.00 66.89  ? 50  ARG C NH1   1 
ATOM   3397 N NH2   . ARG C 1 64  ? 21.864  -6.055  36.508  1.00 64.77  ? 50  ARG C NH2   1 
ATOM   3398 N N     . HIS C 1 65  ? 16.201  -2.273  33.679  1.00 37.21  ? 51  HIS C N     1 
ATOM   3399 C CA    . HIS C 1 65  ? 16.439  -1.542  32.437  1.00 41.29  ? 51  HIS C CA    1 
ATOM   3400 C C     . HIS C 1 65  ? 15.458  -0.404  32.169  1.00 41.28  ? 51  HIS C C     1 
ATOM   3401 O O     . HIS C 1 65  ? 15.769  0.533   31.426  1.00 42.62  ? 51  HIS C O     1 
ATOM   3402 C CB    . HIS C 1 65  ? 16.447  -2.534  31.278  1.00 39.04  ? 51  HIS C CB    1 
ATOM   3403 C CG    . HIS C 1 65  ? 17.407  -3.661  31.484  1.00 39.75  ? 51  HIS C CG    1 
ATOM   3404 N ND1   . HIS C 1 65  ? 18.772  -3.511  31.331  1.00 47.40  ? 51  HIS C ND1   1 
ATOM   3405 C CD2   . HIS C 1 65  ? 17.214  -4.931  31.921  1.00 42.84  ? 51  HIS C CD2   1 
ATOM   3406 C CE1   . HIS C 1 65  ? 19.376  -4.639  31.666  1.00 48.83  ? 51  HIS C CE1   1 
ATOM   3407 N NE2   . HIS C 1 65  ? 18.455  -5.517  32.029  1.00 47.43  ? 51  HIS C NE2   1 
ATOM   3408 N N     . PHE C 1 66  ? 14.282  -0.477  32.776  1.00 36.32  ? 52  PHE C N     1 
ATOM   3409 C CA    . PHE C 1 66  ? 13.302  0.578   32.596  1.00 36.88  ? 52  PHE C CA    1 
ATOM   3410 C C     . PHE C 1 66  ? 12.632  0.825   33.919  1.00 34.37  ? 52  PHE C C     1 
ATOM   3411 O O     . PHE C 1 66  ? 12.419  -0.088  34.704  1.00 38.42  ? 52  PHE C O     1 
ATOM   3412 C CB    . PHE C 1 66  ? 12.237  0.187   31.564  1.00 33.43  ? 52  PHE C CB    1 
ATOM   3413 C CG    . PHE C 1 66  ? 12.783  -0.061  30.201  1.00 27.97  ? 52  PHE C CG    1 
ATOM   3414 C CD1   . PHE C 1 66  ? 12.855  0.966   29.271  1.00 28.31  ? 52  PHE C CD1   1 
ATOM   3415 C CD2   . PHE C 1 66  ? 13.234  -1.326  29.848  1.00 25.94  ? 52  PHE C CD2   1 
ATOM   3416 C CE1   . PHE C 1 66  ? 13.378  0.731   27.990  1.00 37.85  ? 52  PHE C CE1   1 
ATOM   3417 C CE2   . PHE C 1 66  ? 13.759  -1.577  28.574  1.00 31.22  ? 52  PHE C CE2   1 
ATOM   3418 C CZ    . PHE C 1 66  ? 13.832  -0.552  27.642  1.00 29.26  ? 52  PHE C CZ    1 
ATOM   3419 N N     . PRO C 1 67  ? 12.296  2.080   34.182  1.00 34.57  ? 53  PRO C N     1 
ATOM   3420 C CA    . PRO C 1 67  ? 11.635  2.436   35.435  1.00 32.91  ? 53  PRO C CA    1 
ATOM   3421 C C     . PRO C 1 67  ? 10.162  2.029   35.400  1.00 34.26  ? 53  PRO C C     1 
ATOM   3422 O O     . PRO C 1 67  ? 9.573   1.713   36.429  1.00 31.74  ? 53  PRO C O     1 
ATOM   3423 C CB    . PRO C 1 67  ? 11.842  3.948   35.506  1.00 34.69  ? 53  PRO C CB    1 
ATOM   3424 C CG    . PRO C 1 67  ? 11.889  4.358   34.059  1.00 39.16  ? 53  PRO C CG    1 
ATOM   3425 C CD    . PRO C 1 67  ? 12.709  3.273   33.413  1.00 29.66  ? 53  PRO C CD    1 
ATOM   3426 N N     . SER C 1 68  ? 9.587   2.007   34.198  1.00 34.97  ? 54  SER C N     1 
ATOM   3427 C CA    . SER C 1 68  ? 8.171   1.663   33.998  1.00 31.78  ? 54  SER C CA    1 
ATOM   3428 C C     . SER C 1 68  ? 7.948   1.110   32.585  1.00 31.79  ? 54  SER C C     1 
ATOM   3429 O O     . SER C 1 68  ? 8.784   1.288   31.701  1.00 30.03  ? 54  SER C O     1 
ATOM   3430 C CB    . SER C 1 68  ? 7.312   2.919   34.153  1.00 32.15  ? 54  SER C CB    1 
ATOM   3431 O OG    . SER C 1 68  ? 7.699   3.911   33.198  1.00 34.58  ? 54  SER C OG    1 
ATOM   3432 N N     . LYS C 1 69  ? 6.823   0.444   32.368  1.00 31.88  ? 55  LYS C N     1 
ATOM   3433 C CA    . LYS C 1 69  ? 6.519   -0.066  31.031  1.00 32.83  ? 55  LYS C CA    1 
ATOM   3434 C C     . LYS C 1 69  ? 6.269   1.158   30.145  1.00 30.38  ? 55  LYS C C     1 
ATOM   3435 O O     . LYS C 1 69  ? 6.564   1.146   28.949  1.00 27.36  ? 55  LYS C O     1 
ATOM   3436 C CB    . LYS C 1 69  ? 5.266   -0.957  31.051  1.00 35.98  ? 55  LYS C CB    1 
ATOM   3437 C CG    . LYS C 1 69  ? 5.285   -2.065  29.992  1.00 39.44  ? 55  LYS C CG    1 
ATOM   3438 C CD    . LYS C 1 69  ? 3.891   -2.372  29.452  1.00 35.98  ? 55  LYS C CD    1 
ATOM   3439 C CE    . LYS C 1 69  ? 2.894   -2.559  30.579  1.00 29.63  ? 55  LYS C CE    1 
ATOM   3440 N NZ    . LYS C 1 69  ? 1.527   -2.593  30.008  1.00 31.12  ? 55  LYS C NZ    1 
ATOM   3441 N N     . THR C 1 70  ? 5.708   2.216   30.730  1.00 30.25  ? 56  THR C N     1 
ATOM   3442 C CA    . THR C 1 70  ? 5.477   3.440   29.974  1.00 30.06  ? 56  THR C CA    1 
ATOM   3443 C C     . THR C 1 70  ? 6.766   3.865   29.251  1.00 32.53  ? 56  THR C C     1 
ATOM   3444 O O     . THR C 1 70  ? 6.733   4.363   28.115  1.00 32.55  ? 56  THR C O     1 
ATOM   3445 C CB    . THR C 1 70  ? 5.044   4.576   30.890  1.00 27.82  ? 56  THR C CB    1 
ATOM   3446 O OG1   . THR C 1 70  ? 3.778   4.255   31.461  1.00 31.57  ? 56  THR C OG1   1 
ATOM   3447 C CG2   . THR C 1 70  ? 4.918   5.892   30.111  1.00 26.71  ? 56  THR C CG2   1 
ATOM   3448 N N     . ARG C 1 71  ? 7.910   3.669   29.898  1.00 32.43  ? 57  ARG C N     1 
ATOM   3449 C CA    . ARG C 1 71  ? 9.167   4.063   29.273  1.00 33.39  ? 57  ARG C CA    1 
ATOM   3450 C C     . ARG C 1 71  ? 9.541   3.212   28.089  1.00 30.21  ? 57  ARG C C     1 
ATOM   3451 O O     . ARG C 1 71  ? 10.180  3.701   27.170  1.00 29.49  ? 57  ARG C O     1 
ATOM   3452 C CB    . ARG C 1 71  ? 10.307  4.081   30.283  1.00 33.45  ? 57  ARG C CB    1 
ATOM   3453 C CG    . ARG C 1 71  ? 10.340  5.381   31.050  1.00 48.92  ? 57  ARG C CG    1 
ATOM   3454 C CD    . ARG C 1 71  ? 10.768  6.556   30.159  1.00 50.58  ? 57  ARG C CD    1 
ATOM   3455 N NE    . ARG C 1 71  ? 10.603  7.825   30.871  1.00 61.34  ? 57  ARG C NE    1 
ATOM   3456 C CZ    . ARG C 1 71  ? 9.438   8.448   31.050  1.00 64.75  ? 57  ARG C CZ    1 
ATOM   3457 N NH1   . ARG C 1 71  ? 8.315   7.931   30.556  1.00 60.19  ? 57  ARG C NH1   1 
ATOM   3458 N NH2   . ARG C 1 71  ? 9.393   9.576   31.753  1.00 61.43  ? 57  ARG C NH2   1 
ATOM   3459 N N     . MET C 1 72  ? 9.168   1.936   28.106  1.00 26.95  ? 58  MET C N     1 
ATOM   3460 C CA    . MET C 1 72  ? 9.473   1.088   26.952  1.00 25.47  ? 58  MET C CA    1 
ATOM   3461 C C     . MET C 1 72  ? 8.697   1.672   25.745  1.00 27.30  ? 58  MET C C     1 
ATOM   3462 O O     . MET C 1 72  ? 9.282   1.851   24.681  1.00 27.18  ? 58  MET C O     1 
ATOM   3463 C CB    . MET C 1 72  ? 9.046   -0.366  27.217  1.00 30.89  ? 58  MET C CB    1 
ATOM   3464 C CG    . MET C 1 72  ? 9.651   -0.979  28.489  1.00 31.97  ? 58  MET C CG    1 
ATOM   3465 S SD    . MET C 1 72  ? 8.988   -2.633  28.891  1.00 33.42  ? 58  MET C SD    1 
ATOM   3466 C CE    . MET C 1 72  ? 9.619   -2.764  30.589  1.00 27.20  ? 58  MET C CE    1 
ATOM   3467 N N     . PHE C 1 73  ? 7.402   1.977   25.910  1.00 21.09  ? 59  PHE C N     1 
ATOM   3468 C CA    . PHE C 1 73  ? 6.616   2.574   24.822  1.00 24.08  ? 59  PHE C CA    1 
ATOM   3469 C C     . PHE C 1 73  ? 7.232   3.896   24.400  1.00 26.45  ? 59  PHE C C     1 
ATOM   3470 O O     . PHE C 1 73  ? 7.320   4.205   23.188  1.00 26.79  ? 59  PHE C O     1 
ATOM   3471 C CB    . PHE C 1 73  ? 5.137   2.755   25.239  1.00 23.15  ? 59  PHE C CB    1 
ATOM   3472 C CG    . PHE C 1 73  ? 4.345   1.475   25.156  1.00 23.35  ? 59  PHE C CG    1 
ATOM   3473 C CD1   . PHE C 1 73  ? 3.853   1.027   23.922  1.00 26.78  ? 59  PHE C CD1   1 
ATOM   3474 C CD2   . PHE C 1 73  ? 4.222   0.639   26.261  1.00 26.21  ? 59  PHE C CD2   1 
ATOM   3475 C CE1   . PHE C 1 73  ? 3.265   -0.245  23.783  1.00 22.87  ? 59  PHE C CE1   1 
ATOM   3476 C CE2   . PHE C 1 73  ? 3.639   -0.633  26.139  1.00 28.33  ? 59  PHE C CE2   1 
ATOM   3477 C CZ    . PHE C 1 73  ? 3.158   -1.074  24.888  1.00 28.14  ? 59  PHE C CZ    1 
ATOM   3478 N N     . ASP C 1 74  ? 7.656   4.696   25.373  1.00 23.78  ? 60  ASP C N     1 
ATOM   3479 C CA    . ASP C 1 74  ? 8.340   5.950   25.028  1.00 28.90  ? 60  ASP C CA    1 
ATOM   3480 C C     . ASP C 1 74  ? 9.581   5.655   24.156  1.00 27.25  ? 60  ASP C C     1 
ATOM   3481 O O     . ASP C 1 74  ? 9.818   6.346   23.176  1.00 27.44  ? 60  ASP C O     1 
ATOM   3482 C CB    . ASP C 1 74  ? 8.792   6.709   26.277  1.00 30.44  ? 60  ASP C CB    1 
ATOM   3483 C CG    . ASP C 1 74  ? 7.753   7.690   26.766  1.00 36.03  ? 60  ASP C CG    1 
ATOM   3484 O OD1   . ASP C 1 74  ? 7.330   8.555   25.971  1.00 37.03  ? 60  ASP C OD1   1 
ATOM   3485 O OD2   . ASP C 1 74  ? 7.358   7.605   27.948  1.00 41.30  ? 60  ASP C OD2   1 
ATOM   3486 N N     . SER C 1 75  ? 10.363  4.626   24.496  1.00 28.79  ? 61  SER C N     1 
ATOM   3487 C CA    . SER C 1 75  ? 11.540  4.308   23.693  1.00 28.25  ? 61  SER C CA    1 
ATOM   3488 C C     . SER C 1 75  ? 11.138  3.902   22.295  1.00 24.26  ? 61  SER C C     1 
ATOM   3489 O O     . SER C 1 75  ? 11.776  4.300   21.317  1.00 23.52  ? 61  SER C O     1 
ATOM   3490 C CB    . SER C 1 75  ? 12.351  3.179   24.312  1.00 29.53  ? 61  SER C CB    1 
ATOM   3491 O OG    . SER C 1 75  ? 12.901  3.569   25.559  1.00 37.55  ? 61  SER C OG    1 
ATOM   3492 N N     . LEU C 1 76  ? 10.069  3.128   22.197  1.00 22.95  ? 62  LEU C N     1 
ATOM   3493 C CA    . LEU C 1 76  ? 9.607   2.674   20.888  1.00 24.12  ? 62  LEU C CA    1 
ATOM   3494 C C     . LEU C 1 76  ? 9.120   3.844   20.023  1.00 22.28  ? 62  LEU C C     1 
ATOM   3495 O O     . LEU C 1 76  ? 9.383   3.889   18.831  1.00 22.89  ? 62  LEU C O     1 
ATOM   3496 C CB    . LEU C 1 76  ? 8.520   1.609   21.084  1.00 23.74  ? 62  LEU C CB    1 
ATOM   3497 C CG    . LEU C 1 76  ? 8.912   0.161   20.770  1.00 30.16  ? 62  LEU C CG    1 
ATOM   3498 C CD1   . LEU C 1 76  ? 10.363  -0.105  21.105  1.00 31.74  ? 62  LEU C CD1   1 
ATOM   3499 C CD2   . LEU C 1 76  ? 8.007   -0.783  21.530  1.00 21.94  ? 62  LEU C CD2   1 
ATOM   3500 N N     . ILE C 1 77  ? 8.420   4.800   20.622  1.00 26.43  ? 63  ILE C N     1 
ATOM   3501 C CA    . ILE C 1 77  ? 7.949   5.958   19.860  1.00 28.16  ? 63  ILE C CA    1 
ATOM   3502 C C     . ILE C 1 77  ? 9.144   6.806   19.415  1.00 31.82  ? 63  ILE C C     1 
ATOM   3503 O O     . ILE C 1 77  ? 9.146   7.361   18.298  1.00 30.47  ? 63  ILE C O     1 
ATOM   3504 C CB    . ILE C 1 77  ? 6.946   6.805   20.693  1.00 26.67  ? 63  ILE C CB    1 
ATOM   3505 C CG1   . ILE C 1 77  ? 5.684   5.971   20.995  1.00 34.17  ? 63  ILE C CG1   1 
ATOM   3506 C CG2   . ILE C 1 77  ? 6.565   8.057   19.938  1.00 25.61  ? 63  ILE C CG2   1 
ATOM   3507 C CD1   . ILE C 1 77  ? 4.698   6.630   21.973  1.00 28.17  ? 63  ILE C CD1   1 
ATOM   3508 N N     . GLU C 1 78  ? 10.167  6.907   20.275  1.00 28.81  ? 64  GLU C N     1 
ATOM   3509 C CA    . GLU C 1 78  ? 11.372  7.674   19.919  1.00 29.45  ? 64  GLU C CA    1 
ATOM   3510 C C     . GLU C 1 78  ? 12.021  7.078   18.682  1.00 23.28  ? 64  GLU C C     1 
ATOM   3511 O O     . GLU C 1 78  ? 12.458  7.785   17.776  1.00 23.41  ? 64  GLU C O     1 
ATOM   3512 C CB    . GLU C 1 78  ? 12.366  7.702   21.087  1.00 29.20  ? 64  GLU C CB    1 
ATOM   3513 C CG    . GLU C 1 78  ? 12.017  8.801   22.109  1.00 48.86  ? 64  GLU C CG    1 
ATOM   3514 C CD    . GLU C 1 78  ? 12.894  8.799   23.364  1.00 53.49  ? 64  GLU C CD    1 
ATOM   3515 O OE1   . GLU C 1 78  ? 14.149  8.790   23.215  1.00 57.72  ? 64  GLU C OE1   1 
ATOM   3516 O OE2   . GLU C 1 78  ? 12.319  8.818   24.487  1.00 48.33  ? 64  GLU C OE2   1 
ATOM   3517 N N     . PHE C 1 79  ? 12.059  5.756   18.648  1.00 25.26  ? 65  PHE C N     1 
ATOM   3518 C CA    . PHE C 1 79  ? 12.608  5.052   17.526  1.00 24.09  ? 65  PHE C CA    1 
ATOM   3519 C C     . PHE C 1 79  ? 11.791  5.320   16.245  1.00 26.64  ? 65  PHE C C     1 
ATOM   3520 O O     . PHE C 1 79  ? 12.363  5.567   15.169  1.00 23.47  ? 65  PHE C O     1 
ATOM   3521 C CB    . PHE C 1 79  ? 12.622  3.551   17.820  1.00 27.23  ? 65  PHE C CB    1 
ATOM   3522 C CG    . PHE C 1 79  ? 13.079  2.741   16.667  1.00 27.91  ? 65  PHE C CG    1 
ATOM   3523 C CD1   . PHE C 1 79  ? 14.449  2.636   16.376  1.00 30.83  ? 65  PHE C CD1   1 
ATOM   3524 C CD2   . PHE C 1 79  ? 12.156  2.138   15.823  1.00 27.03  ? 65  PHE C CD2   1 
ATOM   3525 C CE1   . PHE C 1 79  ? 14.892  1.946   15.260  1.00 28.57  ? 65  PHE C CE1   1 
ATOM   3526 C CE2   . PHE C 1 79  ? 12.579  1.436   14.692  1.00 25.68  ? 65  PHE C CE2   1 
ATOM   3527 C CZ    . PHE C 1 79  ? 13.952  1.338   14.406  1.00 36.21  ? 65  PHE C CZ    1 
ATOM   3528 N N     . ILE C 1 80  ? 10.460  5.258   16.352  1.00 23.97  ? 66  ILE C N     1 
ATOM   3529 C CA    . ILE C 1 80  ? 9.600   5.502   15.198  1.00 21.61  ? 66  ILE C CA    1 
ATOM   3530 C C     . ILE C 1 80  ? 9.849   6.923   14.697  1.00 25.06  ? 66  ILE C C     1 
ATOM   3531 O O     . ILE C 1 80  ? 10.030  7.154   13.495  1.00 25.27  ? 66  ILE C O     1 
ATOM   3532 C CB    . ILE C 1 80  ? 8.081   5.378   15.538  1.00 12.88  ? 66  ILE C CB    1 
ATOM   3533 C CG1   . ILE C 1 80  ? 7.696   3.933   15.859  1.00 23.13  ? 66  ILE C CG1   1 
ATOM   3534 C CG2   . ILE C 1 80  ? 7.259   5.792   14.326  1.00 19.70  ? 66  ILE C CG2   1 
ATOM   3535 C CD1   . ILE C 1 80  ? 6.394   3.812   16.720  1.00 20.52  ? 66  ILE C CD1   1 
ATOM   3536 N N     . GLU C 1 81  ? 9.840   7.867   15.629  1.00 23.80  ? 67  GLU C N     1 
ATOM   3537 C CA    . GLU C 1 81  ? 10.093  9.281   15.335  1.00 30.72  ? 67  GLU C CA    1 
ATOM   3538 C C     . GLU C 1 81  ? 11.397  9.467   14.557  1.00 29.29  ? 67  GLU C C     1 
ATOM   3539 O O     . GLU C 1 81  ? 11.417  10.005  13.442  1.00 30.98  ? 67  GLU C O     1 
ATOM   3540 C CB    . GLU C 1 81  ? 10.221  10.061  16.645  1.00 34.28  ? 67  GLU C CB    1 
ATOM   3541 C CG    . GLU C 1 81  ? 9.008   10.849  17.055  1.00 53.96  ? 67  GLU C CG    1 
ATOM   3542 C CD    . GLU C 1 81  ? 9.159   12.313  16.723  1.00 63.49  ? 67  GLU C CD    1 
ATOM   3543 O OE1   . GLU C 1 81  ? 8.200   13.057  16.971  1.00 67.53  ? 67  GLU C OE1   1 
ATOM   3544 O OE2   . GLU C 1 81  ? 10.227  12.728  16.215  1.00 64.84  ? 67  GLU C OE2   1 
ATOM   3545 N N     . ASP C 1 82  ? 12.487  9.020   15.167  1.00 30.62  ? 68  ASP C N     1 
ATOM   3546 C CA    . ASP C 1 82  ? 13.808  9.151   14.574  1.00 31.15  ? 68  ASP C CA    1 
ATOM   3547 C C     . ASP C 1 82  ? 13.892  8.521   13.204  1.00 31.59  ? 68  ASP C C     1 
ATOM   3548 O O     . ASP C 1 82  ? 14.391  9.135   12.263  1.00 30.40  ? 68  ASP C O     1 
ATOM   3549 C CB    . ASP C 1 82  ? 14.873  8.507   15.475  1.00 34.99  ? 68  ASP C CB    1 
ATOM   3550 C CG    . ASP C 1 82  ? 15.102  9.287   16.746  1.00 47.95  ? 68  ASP C CG    1 
ATOM   3551 O OD1   . ASP C 1 82  ? 14.693  10.473  16.793  1.00 54.99  ? 68  ASP C OD1   1 
ATOM   3552 O OD2   . ASP C 1 82  ? 15.697  8.726   17.694  1.00 48.38  ? 68  ASP C OD2   1 
ATOM   3553 N N     . SER C 1 83  ? 13.423  7.285   13.091  1.00 28.18  ? 69  SER C N     1 
ATOM   3554 C CA    . SER C 1 83  ? 13.507  6.621   11.824  1.00 27.97  ? 69  SER C CA    1 
ATOM   3555 C C     . SER C 1 83  ? 12.814  7.437   10.758  1.00 28.20  ? 69  SER C C     1 
ATOM   3556 O O     . SER C 1 83  ? 13.389  7.734   9.707   1.00 31.58  ? 69  SER C O     1 
ATOM   3557 C CB    . SER C 1 83  ? 12.861  5.246   11.901  1.00 29.07  ? 69  SER C CB    1 
ATOM   3558 O OG    . SER C 1 83  ? 13.416  4.533   12.979  1.00 25.33  ? 69  SER C OG    1 
ATOM   3559 N N     . LEU C 1 84  ? 11.590  7.838   11.050  1.00 21.52  ? 70  LEU C N     1 
ATOM   3560 C CA    . LEU C 1 84  ? 10.807  8.543   10.069  1.00 24.96  ? 70  LEU C CA    1 
ATOM   3561 C C     . LEU C 1 84  ? 11.356  9.896   9.707   1.00 22.95  ? 70  LEU C C     1 
ATOM   3562 O O     . LEU C 1 84  ? 11.484  10.224  8.528   1.00 23.21  ? 70  LEU C O     1 
ATOM   3563 C CB    . LEU C 1 84  ? 9.352   8.689   10.569  1.00 23.08  ? 70  LEU C CB    1 
ATOM   3564 C CG    . LEU C 1 84  ? 8.237   7.806   10.008  1.00 26.03  ? 70  LEU C CG    1 
ATOM   3565 C CD1   . LEU C 1 84  ? 8.770   6.554   9.381   1.00 30.97  ? 70  LEU C CD1   1 
ATOM   3566 C CD2   . LEU C 1 84  ? 7.250   7.494   11.105  1.00 22.34  ? 70  LEU C CD2   1 
ATOM   3567 N N     . ILE C 1 85  ? 11.681  10.679  10.721  1.00 22.24  ? 71  ILE C N     1 
ATOM   3568 C CA    . ILE C 1 85  ? 12.174  12.023  10.472  1.00 27.86  ? 71  ILE C CA    1 
ATOM   3569 C C     . ILE C 1 85  ? 13.521  12.014  9.776   1.00 26.97  ? 71  ILE C C     1 
ATOM   3570 O O     . ILE C 1 85  ? 13.734  12.780  8.841   1.00 25.77  ? 71  ILE C O     1 
ATOM   3571 C CB    . ILE C 1 85  ? 12.264  12.836  11.780  1.00 26.49  ? 71  ILE C CB    1 
ATOM   3572 C CG1   . ILE C 1 85  ? 10.875  12.935  12.420  1.00 28.65  ? 71  ILE C CG1   1 
ATOM   3573 C CG2   . ILE C 1 85  ? 12.772  14.230  11.490  1.00 29.50  ? 71  ILE C CG2   1 
ATOM   3574 C CD1   . ILE C 1 85  ? 9.783   13.409  11.445  1.00 26.89  ? 71  ILE C CD1   1 
ATOM   3575 N N     . THR C 1 86  ? 14.413  11.129  10.215  1.00 27.14  ? 72  THR C N     1 
ATOM   3576 C CA    . THR C 1 86  ? 15.741  11.031  9.615   1.00 30.28  ? 72  THR C CA    1 
ATOM   3577 C C     . THR C 1 86  ? 15.655  10.638  8.148   1.00 31.54  ? 72  THR C C     1 
ATOM   3578 O O     . THR C 1 86  ? 16.399  11.139  7.312   1.00 29.19  ? 72  THR C O     1 
ATOM   3579 C CB    . THR C 1 86  ? 16.613  9.978   10.309  1.00 28.79  ? 72  THR C CB    1 
ATOM   3580 O OG1   . THR C 1 86  ? 16.962  10.427  11.619  1.00 33.39  ? 72  THR C OG1   1 
ATOM   3581 C CG2   . THR C 1 86  ? 17.890  9.747   9.508   1.00 37.57  ? 72  THR C CG2   1 
ATOM   3582 N N     . ARG C 1 87  ? 14.739  9.741   7.826   1.00 30.44  ? 73  ARG C N     1 
ATOM   3583 C CA    . ARG C 1 87  ? 14.634  9.324   6.451   1.00 29.45  ? 73  ARG C CA    1 
ATOM   3584 C C     . ARG C 1 87  ? 13.929  10.328  5.585   1.00 28.08  ? 73  ARG C C     1 
ATOM   3585 O O     . ARG C 1 87  ? 14.207  10.417  4.411   1.00 31.55  ? 73  ARG C O     1 
ATOM   3586 C CB    . ARG C 1 87  ? 13.942  7.984   6.374   1.00 32.05  ? 73  ARG C CB    1 
ATOM   3587 C CG    . ARG C 1 87  ? 14.802  6.895   6.955   1.00 43.63  ? 73  ARG C CG    1 
ATOM   3588 C CD    . ARG C 1 87  ? 14.094  5.594   6.834   1.00 51.11  ? 73  ARG C CD    1 
ATOM   3589 N NE    . ARG C 1 87  ? 14.895  4.509   7.351   1.00 63.90  ? 73  ARG C NE    1 
ATOM   3590 C CZ    . ARG C 1 87  ? 14.553  3.240   7.212   1.00 71.51  ? 73  ARG C CZ    1 
ATOM   3591 N NH1   . ARG C 1 87  ? 13.428  2.947   6.573   1.00 69.88  ? 73  ARG C NH1   1 
ATOM   3592 N NH2   . ARG C 1 87  ? 15.329  2.277   7.701   1.00 71.35  ? 73  ARG C NH2   1 
ATOM   3593 N N     . ILE C 1 88  ? 12.998  11.076  6.155   1.00 27.92  ? 74  ILE C N     1 
ATOM   3594 C CA    . ILE C 1 88  ? 12.323  12.078  5.371   1.00 26.71  ? 74  ILE C CA    1 
ATOM   3595 C C     . ILE C 1 88  ? 13.378  13.132  4.990   1.00 25.73  ? 74  ILE C C     1 
ATOM   3596 O O     . ILE C 1 88  ? 13.458  13.549  3.842   1.00 29.29  ? 74  ILE C O     1 
ATOM   3597 C CB    . ILE C 1 88  ? 11.182  12.705  6.150   1.00 22.57  ? 74  ILE C CB    1 
ATOM   3598 C CG1   . ILE C 1 88  ? 10.013  11.719  6.249   1.00 27.44  ? 74  ILE C CG1   1 
ATOM   3599 C CG2   . ILE C 1 88  ? 10.727  13.960  5.462   1.00 22.48  ? 74  ILE C CG2   1 
ATOM   3600 C CD1   . ILE C 1 88  ? 8.831   12.234  7.120   1.00 25.07  ? 74  ILE C CD1   1 
ATOM   3601 N N     . ASN C 1 89  ? 14.194  13.543  5.950   1.00 29.90  ? 75  ASN C N     1 
ATOM   3602 C CA    . ASN C 1 89  ? 15.251  14.520  5.682   1.00 32.38  ? 75  ASN C CA    1 
ATOM   3603 C C     . ASN C 1 89  ? 16.194  14.096  4.550   1.00 30.56  ? 75  ASN C C     1 
ATOM   3604 O O     . ASN C 1 89  ? 16.557  14.910  3.679   1.00 30.64  ? 75  ASN C O     1 
ATOM   3605 C CB    . ASN C 1 89  ? 16.025  14.771  6.965   1.00 29.09  ? 75  ASN C CB    1 
ATOM   3606 C CG    . ASN C 1 89  ? 15.192  15.508  7.963   1.00 35.56  ? 75  ASN C CG    1 
ATOM   3607 O OD1   . ASN C 1 89  ? 14.324  16.300  7.578   1.00 41.19  ? 75  ASN C OD1   1 
ATOM   3608 N ND2   . ASN C 1 89  ? 15.439  15.277  9.248   1.00 35.63  ? 75  ASN C ND2   1 
ATOM   3609 N N     . LEU C 1 90  ? 16.552  12.813  4.550   1.00 28.33  ? 76  LEU C N     1 
ATOM   3610 C CA    . LEU C 1 90  ? 17.428  12.239  3.544   1.00 25.57  ? 76  LEU C CA    1 
ATOM   3611 C C     . LEU C 1 90  ? 16.742  12.316  2.196   1.00 30.97  ? 76  LEU C C     1 
ATOM   3612 O O     . LEU C 1 90  ? 17.347  12.654  1.179   1.00 23.77  ? 76  LEU C O     1 
ATOM   3613 C CB    . LEU C 1 90  ? 17.747  10.780  3.895   1.00 28.26  ? 76  LEU C CB    1 
ATOM   3614 C CG    . LEU C 1 90  ? 18.856  10.574  4.933   1.00 35.91  ? 76  LEU C CG    1 
ATOM   3615 C CD1   . LEU C 1 90  ? 18.940  9.105   5.391   1.00 36.39  ? 76  LEU C CD1   1 
ATOM   3616 C CD2   . LEU C 1 90  ? 20.173  11.005  4.299   1.00 32.37  ? 76  LEU C CD2   1 
ATOM   3617 N N     . ILE C 1 91  ? 15.460  11.979  2.179   1.00 28.56  ? 77  ILE C N     1 
ATOM   3618 C CA    . ILE C 1 91  ? 14.723  12.062  0.945   1.00 20.51  ? 77  ILE C CA    1 
ATOM   3619 C C     . ILE C 1 91  ? 14.773  13.501  0.441   1.00 20.20  ? 77  ILE C C     1 
ATOM   3620 O O     . ILE C 1 91  ? 14.975  13.743  -0.739  1.00 24.98  ? 77  ILE C O     1 
ATOM   3621 C CB    . ILE C 1 91  ? 13.261  11.707  1.168   1.00 22.09  ? 77  ILE C CB    1 
ATOM   3622 C CG1   . ILE C 1 91  ? 13.098  10.194  1.264   1.00 29.83  ? 77  ILE C CG1   1 
ATOM   3623 C CG2   . ILE C 1 91  ? 12.430  12.240  0.037   1.00 21.34  ? 77  ILE C CG2   1 
ATOM   3624 C CD1   . ILE C 1 91  ? 11.758  9.780   1.882   1.00 24.99  ? 77  ILE C CD1   1 
ATOM   3625 N N     . LEU C 1 92  ? 14.577  14.468  1.327   1.00 22.23  ? 78  LEU C N     1 
ATOM   3626 C CA    . LEU C 1 92  ? 14.578  15.860  0.865   1.00 28.90  ? 78  LEU C CA    1 
ATOM   3627 C C     . LEU C 1 92  ? 15.915  16.318  0.275   1.00 31.16  ? 78  LEU C C     1 
ATOM   3628 O O     . LEU C 1 92  ? 15.952  17.261  -0.513  1.00 29.31  ? 78  LEU C O     1 
ATOM   3629 C CB    . LEU C 1 92  ? 14.151  16.789  2.000   1.00 25.77  ? 78  LEU C CB    1 
ATOM   3630 C CG    . LEU C 1 92  ? 12.717  16.480  2.454   1.00 26.11  ? 78  LEU C CG    1 
ATOM   3631 C CD1   . LEU C 1 92  ? 12.348  17.318  3.646   1.00 30.39  ? 78  LEU C CD1   1 
ATOM   3632 C CD2   . LEU C 1 92  ? 11.762  16.741  1.327   1.00 24.21  ? 78  LEU C CD2   1 
ATOM   3633 N N     . LYS C 1 93  ? 17.005  15.661  0.663   1.00 30.60  ? 79  LYS C N     1 
ATOM   3634 C CA    . LYS C 1 93  ? 18.308  16.014  0.122   1.00 33.43  ? 79  LYS C CA    1 
ATOM   3635 C C     . LYS C 1 93  ? 18.678  15.261  -1.144  1.00 35.35  ? 79  LYS C C     1 
ATOM   3636 O O     . LYS C 1 93  ? 19.446  15.766  -1.932  1.00 41.36  ? 79  LYS C O     1 
ATOM   3637 C CB    . LYS C 1 93  ? 19.404  15.803  1.178   1.00 32.54  ? 79  LYS C CB    1 
ATOM   3638 C CG    . LYS C 1 93  ? 19.230  16.695  2.401   1.00 37.85  ? 79  LYS C CG    1 
ATOM   3639 C CD    . LYS C 1 93  ? 20.495  16.826  3.224   1.00 40.47  ? 79  LYS C CD    1 
ATOM   3640 C CE    . LYS C 1 93  ? 20.241  17.703  4.444   1.00 44.41  ? 79  LYS C CE    1 
ATOM   3641 N NZ    . LYS C 1 93  ? 21.521  18.109  5.109   1.00 51.40  ? 79  LYS C NZ    1 
ATOM   3642 N N     . ASP C 1 94  ? 18.072  14.096  -1.360  1.00 34.90  ? 80  ASP C N     1 
ATOM   3643 C CA    . ASP C 1 94  ? 18.383  13.228  -2.496  1.00 34.71  ? 80  ASP C CA    1 
ATOM   3644 C C     . ASP C 1 94  ? 17.370  13.465  -3.646  1.00 34.39  ? 80  ASP C C     1 
ATOM   3645 O O     . ASP C 1 94  ? 17.667  13.260  -4.827  1.00 40.16  ? 80  ASP C O     1 
ATOM   3646 C CB    . ASP C 1 94  ? 18.365  11.772  -1.943  1.00 45.96  ? 80  ASP C CB    1 
ATOM   3647 C CG    . ASP C 1 94  ? 18.732  10.643  -2.986  1.00 60.66  ? 80  ASP C CG    1 
ATOM   3648 O OD1   . ASP C 1 94  ? 18.637  10.731  -4.247  1.00 67.26  ? 80  ASP C OD1   1 
ATOM   3649 O OD2   . ASP C 1 94  ? 19.121  9.566   -2.481  1.00 68.76  ? 80  ASP C OD2   1 
ATOM   3650 N N     . GLU C 1 95  ? 16.189  13.983  -3.334  1.00 33.53  ? 81  GLU C N     1 
ATOM   3651 C CA    . GLU C 1 95  ? 15.188  14.189  -4.368  1.00 29.88  ? 81  GLU C CA    1 
ATOM   3652 C C     . GLU C 1 95  ? 14.803  15.656  -4.543  1.00 30.85  ? 81  GLU C C     1 
ATOM   3653 O O     . GLU C 1 95  ? 14.366  16.319  -3.615  1.00 26.59  ? 81  GLU C O     1 
ATOM   3654 C CB    . GLU C 1 95  ? 13.948  13.343  -4.052  1.00 34.15  ? 81  GLU C CB    1 
ATOM   3655 C CG    . GLU C 1 95  ? 12.855  13.473  -5.086  1.00 25.43  ? 81  GLU C CG    1 
ATOM   3656 C CD    . GLU C 1 95  ? 13.369  13.181  -6.470  1.00 33.99  ? 81  GLU C CD    1 
ATOM   3657 O OE1   . GLU C 1 95  ? 13.207  14.059  -7.341  1.00 29.85  ? 81  GLU C OE1   1 
ATOM   3658 O OE2   . GLU C 1 95  ? 13.935  12.078  -6.680  1.00 33.01  ? 81  GLU C OE2   1 
ATOM   3659 N N     . LYS C 1 96  ? 14.960  16.127  -5.768  1.00 28.77  ? 82  LYS C N     1 
ATOM   3660 C CA    . LYS C 1 96  ? 14.697  17.507  -6.125  1.00 34.57  ? 82  LYS C CA    1 
ATOM   3661 C C     . LYS C 1 96  ? 13.218  17.775  -6.475  1.00 34.34  ? 82  LYS C C     1 
ATOM   3662 O O     . LYS C 1 96  ? 12.648  18.788  -6.066  1.00 33.83  ? 82  LYS C O     1 
ATOM   3663 C CB    . LYS C 1 96  ? 15.606  17.854  -7.307  1.00 34.29  ? 82  LYS C CB    1 
ATOM   3664 C CG    . LYS C 1 96  ? 15.537  19.269  -7.782  1.00 46.57  ? 82  LYS C CG    1 
ATOM   3665 C CD    . LYS C 1 96  ? 16.454  19.476  -8.977  1.00 49.80  ? 82  LYS C CD    1 
ATOM   3666 C CE    . LYS C 1 96  ? 16.528  20.939  -9.367  1.00 48.26  ? 82  LYS C CE    1 
ATOM   3667 N NZ    . LYS C 1 96  ? 17.476  21.143  -10.487 1.00 45.01  ? 82  LYS C NZ    1 
ATOM   3668 N N     . ASP C 1 97  ? 12.610  16.854  -7.214  1.00 28.53  ? 83  ASP C N     1 
ATOM   3669 C CA    . ASP C 1 97  ? 11.220  16.998  -7.658  1.00 30.86  ? 83  ASP C CA    1 
ATOM   3670 C C     . ASP C 1 97  ? 10.199  16.896  -6.529  1.00 28.56  ? 83  ASP C C     1 
ATOM   3671 O O     . ASP C 1 97  ? 10.229  15.959  -5.731  1.00 31.42  ? 83  ASP C O     1 
ATOM   3672 C CB    . ASP C 1 97  ? 10.900  15.944  -8.716  1.00 29.21  ? 83  ASP C CB    1 
ATOM   3673 C CG    . ASP C 1 97  ? 9.520   16.132  -9.312  1.00 34.42  ? 83  ASP C CG    1 
ATOM   3674 O OD1   . ASP C 1 97  ? 9.328   17.156  -9.994  1.00 41.17  ? 83  ASP C OD1   1 
ATOM   3675 O OD2   . ASP C 1 97  ? 8.623   15.279  -9.097  1.00 32.34  ? 83  ASP C OD2   1 
ATOM   3676 N N     . THR C 1 98  ? 9.280   17.858  -6.488  1.00 28.22  ? 84  THR C N     1 
ATOM   3677 C CA    . THR C 1 98  ? 8.234   17.910  -5.464  1.00 28.84  ? 84  THR C CA    1 
ATOM   3678 C C     . THR C 1 98  ? 7.328   16.679  -5.415  1.00 27.87  ? 84  THR C C     1 
ATOM   3679 O O     . THR C 1 98  ? 7.110   16.101  -4.362  1.00 24.40  ? 84  THR C O     1 
ATOM   3680 C CB    . THR C 1 98  ? 7.355   19.161  -5.670  1.00 29.47  ? 84  THR C CB    1 
ATOM   3681 O OG1   . THR C 1 98  ? 8.167   20.334  -5.495  1.00 31.88  ? 84  THR C OG1   1 
ATOM   3682 C CG2   . THR C 1 98  ? 6.180   19.192  -4.669  1.00 30.29  ? 84  THR C CG2   1 
ATOM   3683 N N     . THR C 1 99  ? 6.808   16.281  -6.562  1.00 24.69  ? 85  THR C N     1 
ATOM   3684 C CA    . THR C 1 99  ? 5.927   15.140  -6.614  1.00 25.74  ? 85  THR C CA    1 
ATOM   3685 C C     . THR C 1 99  ? 6.687   13.884  -6.225  1.00 26.93  ? 85  THR C C     1 
ATOM   3686 O O     . THR C 1 99  ? 6.162   13.038  -5.498  1.00 23.60  ? 85  THR C O     1 
ATOM   3687 C CB    . THR C 1 99  ? 5.323   14.984  -8.017  1.00 28.90  ? 85  THR C CB    1 
ATOM   3688 O OG1   . THR C 1 99  ? 4.583   16.165  -8.333  1.00 33.64  ? 85  THR C OG1   1 
ATOM   3689 C CG2   . THR C 1 99  ? 4.367   13.796  -8.069  1.00 30.21  ? 85  THR C CG2   1 
ATOM   3690 N N     . ALA C 1 100 ? 7.927   13.763  -6.692  1.00 23.33  ? 86  ALA C N     1 
ATOM   3691 C CA    . ALA C 1 100 ? 8.731   12.599  -6.358  1.00 22.00  ? 86  ALA C CA    1 
ATOM   3692 C C     . ALA C 1 100 ? 8.992   12.574  -4.847  1.00 25.35  ? 86  ALA C C     1 
ATOM   3693 O O     . ALA C 1 100 ? 8.997   11.494  -4.231  1.00 23.29  ? 86  ALA C O     1 
ATOM   3694 C CB    . ALA C 1 100 ? 10.069  12.625  -7.154  1.00 20.70  ? 86  ALA C CB    1 
ATOM   3695 N N     . ARG C 1 101 ? 9.194   13.758  -4.245  1.00 22.73  ? 87  ARG C N     1 
ATOM   3696 C CA    . ARG C 1 101 ? 9.431   13.853  -2.796  1.00 24.55  ? 87  ARG C CA    1 
ATOM   3697 C C     . ARG C 1 101 ? 8.213   13.362  -2.004  1.00 27.65  ? 87  ARG C C     1 
ATOM   3698 O O     . ARG C 1 101 ? 8.331   12.594  -1.040  1.00 23.58  ? 87  ARG C O     1 
ATOM   3699 C CB    . ARG C 1 101 ? 9.749   15.302  -2.400  1.00 29.77  ? 87  ARG C CB    1 
ATOM   3700 C CG    . ARG C 1 101 ? 11.227  15.572  -2.278  1.00 29.89  ? 87  ARG C CG    1 
ATOM   3701 C CD    . ARG C 1 101 ? 11.677  16.746  -3.089  1.00 33.72  ? 87  ARG C CD    1 
ATOM   3702 N NE    . ARG C 1 101 ? 11.484  18.023  -2.434  1.00 36.00  ? 87  ARG C NE    1 
ATOM   3703 C CZ    . ARG C 1 101 ? 12.414  18.724  -1.783  1.00 33.82  ? 87  ARG C CZ    1 
ATOM   3704 N NH1   . ARG C 1 101 ? 13.663  18.299  -1.659  1.00 37.11  ? 87  ARG C NH1   1 
ATOM   3705 N NH2   . ARG C 1 101 ? 12.081  19.898  -1.271  1.00 41.09  ? 87  ARG C NH2   1 
ATOM   3706 N N     . LEU C 1 102 ? 7.045   13.838  -2.421  1.00 24.07  ? 88  LEU C N     1 
ATOM   3707 C CA    . LEU C 1 102 ? 5.793   13.450  -1.818  1.00 24.53  ? 88  LEU C CA    1 
ATOM   3708 C C     . LEU C 1 102 ? 5.624   11.907  -1.966  1.00 26.58  ? 88  LEU C C     1 
ATOM   3709 O O     . LEU C 1 102 ? 5.323   11.199  -0.996  1.00 24.80  ? 88  LEU C O     1 
ATOM   3710 C CB    . LEU C 1 102 ? 4.677   14.219  -2.519  1.00 20.59  ? 88  LEU C CB    1 
ATOM   3711 C CG    . LEU C 1 102 ? 4.121   15.534  -1.940  1.00 28.34  ? 88  LEU C CG    1 
ATOM   3712 C CD1   . LEU C 1 102 ? 4.746   15.936  -0.573  1.00 20.67  ? 88  LEU C CD1   1 
ATOM   3713 C CD2   . LEU C 1 102 ? 4.292   16.595  -2.994  1.00 27.71  ? 88  LEU C CD2   1 
ATOM   3714 N N     . ARG C 1 103 ? 5.864   11.388  -3.168  1.00 25.14  ? 89  ARG C N     1 
ATOM   3715 C CA    . ARG C 1 103 ? 5.766   9.954   -3.411  1.00 25.58  ? 89  ARG C CA    1 
ATOM   3716 C C     . ARG C 1 103 ? 6.667   9.116   -2.502  1.00 22.36  ? 89  ARG C C     1 
ATOM   3717 O O     . ARG C 1 103 ? 6.216   8.142   -1.916  1.00 24.28  ? 89  ARG C O     1 
ATOM   3718 C CB    . ARG C 1 103 ? 6.106   9.652   -4.868  1.00 24.53  ? 89  ARG C CB    1 
ATOM   3719 C CG    . ARG C 1 103 ? 5.990   8.203   -5.209  1.00 24.77  ? 89  ARG C CG    1 
ATOM   3720 C CD    . ARG C 1 103 ? 6.299   7.995   -6.670  1.00 31.82  ? 89  ARG C CD    1 
ATOM   3721 N NE    . ARG C 1 103 ? 6.499   6.602   -6.946  1.00 38.90  ? 89  ARG C NE    1 
ATOM   3722 C CZ    . ARG C 1 103 ? 7.612   5.930   -6.658  1.00 47.95  ? 89  ARG C CZ    1 
ATOM   3723 N NH1   . ARG C 1 103 ? 7.736   4.606   -6.928  1.00 51.16  ? 89  ARG C NH1   1 
ATOM   3724 N NH2   . ARG C 1 103 ? 8.634   6.588   -6.130  1.00 47.15  ? 89  ARG C NH2   1 
ATOM   3725 N N     . LEU C 1 104 ? 7.943   9.479   -2.399  1.00 22.53  ? 90  LEU C N     1 
ATOM   3726 C CA    . LEU C 1 104 ? 8.882   8.766   -1.541  1.00 22.14  ? 90  LEU C CA    1 
ATOM   3727 C C     . LEU C 1 104 ? 8.536   8.866   -0.065  1.00 22.20  ? 90  LEU C C     1 
ATOM   3728 O O     . LEU C 1 104 ? 8.707   7.901   0.684   1.00 19.42  ? 90  LEU C O     1 
ATOM   3729 C CB    . LEU C 1 104 ? 10.333  9.269   -1.761  1.00 25.96  ? 90  LEU C CB    1 
ATOM   3730 C CG    . LEU C 1 104 ? 10.922  8.935   -3.141  1.00 26.76  ? 90  LEU C CG    1 
ATOM   3731 C CD1   . LEU C 1 104 ? 12.262  9.581   -3.302  1.00 30.28  ? 90  LEU C CD1   1 
ATOM   3732 C CD2   . LEU C 1 104 ? 11.042  7.425   -3.316  1.00 24.74  ? 90  LEU C CD2   1 
ATOM   3733 N N     . ILE C 1 105 ? 8.049   10.019  0.379   1.00 17.23  ? 91  ILE C N     1 
ATOM   3734 C CA    . ILE C 1 105 ? 7.689   10.133  1.776   1.00 20.41  ? 91  ILE C CA    1 
ATOM   3735 C C     . ILE C 1 105 ? 6.489   9.235   2.155   1.00 23.32  ? 91  ILE C C     1 
ATOM   3736 O O     . ILE C 1 105 ? 6.459   8.635   3.237   1.00 18.28  ? 91  ILE C O     1 
ATOM   3737 C CB    . ILE C 1 105 ? 7.350   11.570  2.139   1.00 23.79  ? 91  ILE C CB    1 
ATOM   3738 C CG1   . ILE C 1 105 ? 8.636   12.416  2.101   1.00 27.12  ? 91  ILE C CG1   1 
ATOM   3739 C CG2   . ILE C 1 105 ? 6.720   11.606  3.558   1.00 20.58  ? 91  ILE C CG2   1 
ATOM   3740 C CD1   . ILE C 1 105 ? 8.396   13.894  2.321   1.00 23.81  ? 91  ILE C CD1   1 
ATOM   3741 N N     . VAL C 1 106 ? 5.495   9.179   1.274   1.00 22.97  ? 92  VAL C N     1 
ATOM   3742 C CA    . VAL C 1 106 ? 4.326   8.348   1.523   1.00 25.37  ? 92  VAL C CA    1 
ATOM   3743 C C     . VAL C 1 106 ? 4.811   6.885   1.477   1.00 21.35  ? 92  VAL C C     1 
ATOM   3744 O O     . VAL C 1 106 ? 4.446   6.084   2.329   1.00 26.46  ? 92  VAL C O     1 
ATOM   3745 C CB    . VAL C 1 106 ? 3.241   8.619   0.451   1.00 20.51  ? 92  VAL C CB    1 
ATOM   3746 C CG1   . VAL C 1 106 ? 2.214   7.473   0.408   1.00 19.35  ? 92  VAL C CG1   1 
ATOM   3747 C CG2   . VAL C 1 106 ? 2.558   9.940   0.750   1.00 19.50  ? 92  VAL C CG2   1 
ATOM   3748 N N     . LEU C 1 107 ? 5.629   6.543   0.478   1.00 20.19  ? 93  LEU C N     1 
ATOM   3749 C CA    . LEU C 1 107 ? 6.155   5.188   0.372   1.00 19.28  ? 93  LEU C CA    1 
ATOM   3750 C C     . LEU C 1 107 ? 6.966   4.823   1.617   1.00 21.68  ? 93  LEU C C     1 
ATOM   3751 O O     . LEU C 1 107 ? 6.889   3.686   2.118   1.00 22.27  ? 93  LEU C O     1 
ATOM   3752 C CB    . LEU C 1 107 ? 7.024   5.040   -0.870  1.00 19.28  ? 93  LEU C CB    1 
ATOM   3753 C CG    . LEU C 1 107 ? 7.753   3.694   -1.090  1.00 22.97  ? 93  LEU C CG    1 
ATOM   3754 C CD1   . LEU C 1 107 ? 6.782   2.546   -1.167  1.00 19.97  ? 93  LEU C CD1   1 
ATOM   3755 C CD2   . LEU C 1 107 ? 8.548   3.759   -2.372  1.00 22.64  ? 93  LEU C CD2   1 
ATOM   3756 N N     . LEU C 1 108 ? 7.729   5.775   2.129   1.00 22.82  ? 94  LEU C N     1 
ATOM   3757 C CA    . LEU C 1 108 ? 8.532   5.527   3.331   1.00 25.34  ? 94  LEU C CA    1 
ATOM   3758 C C     . LEU C 1 108 ? 7.635   5.211   4.531   1.00 24.36  ? 94  LEU C C     1 
ATOM   3759 O O     . LEU C 1 108 ? 7.891   4.277   5.298   1.00 20.96  ? 94  LEU C O     1 
ATOM   3760 C CB    . LEU C 1 108 ? 9.390   6.761   3.673   1.00 24.17  ? 94  LEU C CB    1 
ATOM   3761 C CG    . LEU C 1 108 ? 9.923   6.770   5.114   1.00 29.05  ? 94  LEU C CG    1 
ATOM   3762 C CD1   . LEU C 1 108 ? 11.014  5.693   5.232   1.00 27.42  ? 94  LEU C CD1   1 
ATOM   3763 C CD2   . LEU C 1 108 ? 10.474  8.130   5.476   1.00 31.33  ? 94  LEU C CD2   1 
ATOM   3764 N N     . ILE C 1 109 ? 6.601   6.029   4.711   1.00 27.47  ? 95  ILE C N     1 
ATOM   3765 C CA    . ILE C 1 109 ? 5.682   5.869   5.835   1.00 25.02  ? 95  ILE C CA    1 
ATOM   3766 C C     . ILE C 1 109 ? 5.060   4.474   5.752   1.00 22.71  ? 95  ILE C C     1 
ATOM   3767 O O     . ILE C 1 109 ? 5.055   3.733   6.733   1.00 18.72  ? 95  ILE C O     1 
ATOM   3768 C CB    . ILE C 1 109 ? 4.608   6.990   5.810   1.00 19.08  ? 95  ILE C CB    1 
ATOM   3769 C CG1   . ILE C 1 109 ? 5.287   8.331   6.109   1.00 26.71  ? 95  ILE C CG1   1 
ATOM   3770 C CG2   . ILE C 1 109 ? 3.471   6.694   6.822   1.00 23.11  ? 95  ILE C CG2   1 
ATOM   3771 C CD1   . ILE C 1 109 ? 4.365   9.570   5.989   1.00 19.89  ? 95  ILE C CD1   1 
ATOM   3772 N N     . LEU C 1 110 ? 4.574   4.103   4.570   1.00 24.71  ? 96  LEU C N     1 
ATOM   3773 C CA    . LEU C 1 110 ? 3.953   2.789   4.395   1.00 23.62  ? 96  LEU C CA    1 
ATOM   3774 C C     . LEU C 1 110 ? 4.966   1.627   4.511   1.00 24.26  ? 96  LEU C C     1 
ATOM   3775 O O     . LEU C 1 110 ? 4.665   0.582   5.101   1.00 24.08  ? 96  LEU C O     1 
ATOM   3776 C CB    . LEU C 1 110 ? 3.237   2.747   3.046   1.00 23.31  ? 96  LEU C CB    1 
ATOM   3777 C CG    . LEU C 1 110 ? 1.782   3.208   2.855   1.00 37.10  ? 96  LEU C CG    1 
ATOM   3778 C CD1   . LEU C 1 110 ? 1.395   4.307   3.814   1.00 37.34  ? 96  LEU C CD1   1 
ATOM   3779 C CD2   . LEU C 1 110 ? 1.617   3.635   1.381   1.00 28.19  ? 96  LEU C CD2   1 
ATOM   3780 N N     . GLY C 1 111 ? 6.161   1.818   3.951   1.00 25.71  ? 97  GLY C N     1 
ATOM   3781 C CA    . GLY C 1 111 ? 7.212   0.800   3.991   1.00 23.57  ? 97  GLY C CA    1 
ATOM   3782 C C     . GLY C 1 111 ? 7.658   0.574   5.418   1.00 22.57  ? 97  GLY C C     1 
ATOM   3783 O O     . GLY C 1 111 ? 7.808   -0.556  5.878   1.00 13.40  ? 97  GLY C O     1 
ATOM   3784 N N     . PHE C 1 112 ? 7.886   1.660   6.136   1.00 18.23  ? 98  PHE C N     1 
ATOM   3785 C CA    . PHE C 1 112 ? 8.248   1.531   7.552   1.00 26.12  ? 98  PHE C CA    1 
ATOM   3786 C C     . PHE C 1 112 ? 7.195   0.721   8.355   1.00 17.96  ? 98  PHE C C     1 
ATOM   3787 O O     . PHE C 1 112 ? 7.540   -0.147  9.183   1.00 24.84  ? 98  PHE C O     1 
ATOM   3788 C CB    . PHE C 1 112 ? 8.386   2.911   8.198   1.00 18.47  ? 98  PHE C CB    1 
ATOM   3789 C CG    . PHE C 1 112 ? 8.791   2.859   9.637   1.00 25.04  ? 98  PHE C CG    1 
ATOM   3790 C CD1   . PHE C 1 112 ? 10.124  2.644   9.990   1.00 26.26  ? 98  PHE C CD1   1 
ATOM   3791 C CD2   . PHE C 1 112 ? 7.843   2.958   10.643  1.00 28.67  ? 98  PHE C CD2   1 
ATOM   3792 C CE1   . PHE C 1 112 ? 10.495  2.537   11.325  1.00 26.24  ? 98  PHE C CE1   1 
ATOM   3793 C CE2   . PHE C 1 112 ? 8.204   2.851   11.980  1.00 23.49  ? 98  PHE C CE2   1 
ATOM   3794 C CZ    . PHE C 1 112 ? 9.542   2.634   12.323  1.00 30.20  ? 98  PHE C CZ    1 
ATOM   3795 N N     . GLY C 1 113 ? 5.916   1.030   8.136   1.00 18.83  ? 99  GLY C N     1 
ATOM   3796 C CA    . GLY C 1 113 ? 4.866   0.338   8.850   1.00 17.56  ? 99  GLY C CA    1 
ATOM   3797 C C     . GLY C 1 113 ? 4.854   -1.133  8.488   1.00 16.52  ? 99  GLY C C     1 
ATOM   3798 O O     . GLY C 1 113 ? 4.773   -1.995  9.346   1.00 15.28  ? 99  GLY C O     1 
ATOM   3799 N N     . GLU C 1 114 ? 4.932   -1.410  7.199   1.00 19.37  ? 100 GLU C N     1 
ATOM   3800 C CA    . GLU C 1 114 ? 4.942   -2.773  6.728   1.00 24.09  ? 100 GLU C CA    1 
ATOM   3801 C C     . GLU C 1 114 ? 6.092   -3.581  7.318   1.00 24.44  ? 100 GLU C C     1 
ATOM   3802 O O     . GLU C 1 114 ? 5.911   -4.749  7.645   1.00 27.92  ? 100 GLU C O     1 
ATOM   3803 C CB    . GLU C 1 114 ? 5.010   -2.811  5.193   1.00 20.81  ? 100 GLU C CB    1 
ATOM   3804 C CG    . GLU C 1 114 ? 4.822   -4.235  4.632   1.00 26.60  ? 100 GLU C CG    1 
ATOM   3805 C CD    . GLU C 1 114 ? 4.505   -4.254  3.136   1.00 32.87  ? 100 GLU C CD    1 
ATOM   3806 O OE1   . GLU C 1 114 ? 3.749   -3.376  2.676   1.00 27.17  ? 100 GLU C OE1   1 
ATOM   3807 O OE2   . GLU C 1 114 ? 5.000   -5.153  2.426   1.00 26.41  ? 100 GLU C OE2   1 
ATOM   3808 N N     . ARG C 1 115 ? 7.284   -3.000  7.437   1.00 27.44  ? 101 ARG C N     1 
ATOM   3809 C CA    . ARG C 1 115 ? 8.350   -3.802  8.009   1.00 26.47  ? 101 ARG C CA    1 
ATOM   3810 C C     . ARG C 1 115 ? 8.427   -3.754  9.531   1.00 27.77  ? 101 ARG C C     1 
ATOM   3811 O O     . ARG C 1 115 ? 9.249   -4.448  10.101  1.00 23.95  ? 101 ARG C O     1 
ATOM   3812 C CB    . ARG C 1 115 ? 9.709   -3.487  7.380   1.00 33.15  ? 101 ARG C CB    1 
ATOM   3813 C CG    . ARG C 1 115 ? 10.132  -2.058  7.332   1.00 35.73  ? 101 ARG C CG    1 
ATOM   3814 C CD    . ARG C 1 115 ? 11.261  -1.923  6.293   1.00 44.44  ? 101 ARG C CD    1 
ATOM   3815 N NE    . ARG C 1 115 ? 11.219  -0.619  5.623   1.00 42.33  ? 101 ARG C NE    1 
ATOM   3816 C CZ    . ARG C 1 115 ? 11.572  0.529   6.195   1.00 43.42  ? 101 ARG C CZ    1 
ATOM   3817 N NH1   . ARG C 1 115 ? 12.021  0.539   7.455   1.00 35.22  ? 101 ARG C NH1   1 
ATOM   3818 N NH2   . ARG C 1 115 ? 11.431  1.673   5.518   1.00 36.94  ? 101 ARG C NH2   1 
ATOM   3819 N N     . ASN C 1 116 ? 7.547   -2.970  10.168  1.00 22.58  ? 102 ASN C N     1 
ATOM   3820 C CA    . ASN C 1 116 ? 7.472   -2.829  11.626  1.00 23.66  ? 102 ASN C CA    1 
ATOM   3821 C C     . ASN C 1 116 ? 5.991   -2.909  12.029  1.00 25.65  ? 102 ASN C C     1 
ATOM   3822 O O     . ASN C 1 116 ? 5.427   -1.958  12.571  1.00 21.14  ? 102 ASN C O     1 
ATOM   3823 C CB    . ASN C 1 116 ? 8.068   -1.473  12.043  1.00 22.81  ? 102 ASN C CB    1 
ATOM   3824 C CG    . ASN C 1 116 ? 9.579   -1.387  11.775  1.00 24.71  ? 102 ASN C CG    1 
ATOM   3825 O OD1   . ASN C 1 116 ? 10.377  -1.879  12.561  1.00 27.51  ? 102 ASN C OD1   1 
ATOM   3826 N ND2   . ASN C 1 116 ? 9.964   -0.787  10.653  1.00 17.19  ? 102 ASN C ND2   1 
ATOM   3827 N N     . PRO C 1 117 ? 5.358   -4.076  11.808  1.00 26.05  ? 103 PRO C N     1 
ATOM   3828 C CA    . PRO C 1 117 ? 3.940   -4.290  12.129  1.00 25.39  ? 103 PRO C CA    1 
ATOM   3829 C C     . PRO C 1 117 ? 3.604   -3.949  13.584  1.00 25.61  ? 103 PRO C C     1 
ATOM   3830 O O     . PRO C 1 117 ? 2.633   -3.230  13.858  1.00 26.16  ? 103 PRO C O     1 
ATOM   3831 C CB    . PRO C 1 117 ? 3.715   -5.781  11.795  1.00 25.61  ? 103 PRO C CB    1 
ATOM   3832 C CG    . PRO C 1 117 ? 4.832   -6.138  10.897  1.00 27.46  ? 103 PRO C CG    1 
ATOM   3833 C CD    . PRO C 1 117 ? 6.008   -5.331  11.393  1.00 19.39  ? 103 PRO C CD    1 
ATOM   3834 N N     . GLY C 1 118 ? 4.401   -4.477  14.508  1.00 23.07  ? 104 GLY C N     1 
ATOM   3835 C CA    . GLY C 1 118 ? 4.195   -4.193  15.916  1.00 20.42  ? 104 GLY C CA    1 
ATOM   3836 C C     . GLY C 1 118 ? 4.200   -2.696  16.181  1.00 24.35  ? 104 GLY C C     1 
ATOM   3837 O O     . GLY C 1 118 ? 3.304   -2.214  16.867  1.00 23.72  ? 104 GLY C O     1 
ATOM   3838 N N     . LEU C 1 119 ? 5.177   -1.954  15.642  1.00 24.53  ? 105 LEU C N     1 
ATOM   3839 C CA    . LEU C 1 119 ? 5.227   -0.494  15.844  1.00 22.38  ? 105 LEU C CA    1 
ATOM   3840 C C     . LEU C 1 119 ? 4.075   0.261   15.134  1.00 27.19  ? 105 LEU C C     1 
ATOM   3841 O O     . LEU C 1 119 ? 3.676   1.354   15.572  1.00 25.92  ? 105 LEU C O     1 
ATOM   3842 C CB    . LEU C 1 119 ? 6.568   0.078   15.372  1.00 20.87  ? 105 LEU C CB    1 
ATOM   3843 C CG    . LEU C 1 119 ? 7.889   -0.517  15.902  1.00 21.54  ? 105 LEU C CG    1 
ATOM   3844 C CD1   . LEU C 1 119 ? 9.047   0.284   15.331  1.00 22.71  ? 105 LEU C CD1   1 
ATOM   3845 C CD2   . LEU C 1 119 ? 7.943   -0.487  17.402  1.00 19.95  ? 105 LEU C CD2   1 
ATOM   3846 N N     . THR C 1 120 ? 3.567   -0.293  14.024  1.00 22.82  ? 106 THR C N     1 
ATOM   3847 C CA    . THR C 1 120 ? 2.461   0.327   13.316  1.00 24.52  ? 106 THR C CA    1 
ATOM   3848 C C     . THR C 1 120 ? 1.252   0.295   14.262  1.00 23.63  ? 106 THR C C     1 
ATOM   3849 O O     . THR C 1 120 ? 0.454   1.232   14.291  1.00 21.09  ? 106 THR C O     1 
ATOM   3850 C CB    . THR C 1 120 ? 2.089   -0.435  11.988  1.00 24.14  ? 106 THR C CB    1 
ATOM   3851 O OG1   . THR C 1 120 ? 3.149   -0.285  11.055  1.00 23.37  ? 106 THR C OG1   1 
ATOM   3852 C CG2   . THR C 1 120 ? 0.766   0.131   11.341  1.00 21.54  ? 106 THR C CG2   1 
ATOM   3853 N N     . ARG C 1 121 ? 1.121   -0.785  15.032  1.00 23.55  ? 107 ARG C N     1 
ATOM   3854 C CA    . ARG C 1 121 ? 0.016   -0.901  16.007  1.00 28.19  ? 107 ARG C CA    1 
ATOM   3855 C C     . ARG C 1 121 ? 0.046   0.234   17.052  1.00 24.34  ? 107 ARG C C     1 
ATOM   3856 O O     . ARG C 1 121 ? -0.973  0.572   17.657  1.00 19.65  ? 107 ARG C O     1 
ATOM   3857 C CB    . ARG C 1 121 ? 0.046   -2.267  16.724  1.00 25.89  ? 107 ARG C CB    1 
ATOM   3858 C CG    . ARG C 1 121 ? -1.353  -2.730  17.040  1.00 29.01  ? 107 ARG C CG    1 
ATOM   3859 C CD    . ARG C 1 121 ? -1.463  -3.923  17.962  1.00 31.66  ? 107 ARG C CD    1 
ATOM   3860 N NE    . ARG C 1 121 ? -1.039  -5.200  17.377  1.00 29.17  ? 107 ARG C NE    1 
ATOM   3861 C CZ    . ARG C 1 121 ? -1.843  -6.073  16.780  1.00 22.86  ? 107 ARG C CZ    1 
ATOM   3862 N NH1   . ARG C 1 121 ? -3.136  -5.822  16.655  1.00 24.92  ? 107 ARG C NH1   1 
ATOM   3863 N NH2   . ARG C 1 121 ? -1.347  -7.237  16.360  1.00 27.62  ? 107 ARG C NH2   1 
ATOM   3864 N N     . ILE C 1 122 ? 1.233   0.799   17.259  1.00 25.64  ? 108 ILE C N     1 
ATOM   3865 C CA    . ILE C 1 122 ? 1.446   1.931   18.156  1.00 22.83  ? 108 ILE C CA    1 
ATOM   3866 C C     . ILE C 1 122 ? 1.076   3.198   17.366  1.00 30.66  ? 108 ILE C C     1 
ATOM   3867 O O     . ILE C 1 122 ? 0.322   4.044   17.845  1.00 32.16  ? 108 ILE C O     1 
ATOM   3868 C CB    . ILE C 1 122 ? 2.939   2.018   18.584  1.00 25.90  ? 108 ILE C CB    1 
ATOM   3869 C CG1   . ILE C 1 122 ? 3.239   0.934   19.635  1.00 23.56  ? 108 ILE C CG1   1 
ATOM   3870 C CG2   . ILE C 1 122 ? 3.268   3.419   19.119  1.00 19.23  ? 108 ILE C CG2   1 
ATOM   3871 C CD1   . ILE C 1 122 ? 4.736   0.787   19.974  1.00 23.14  ? 108 ILE C CD1   1 
ATOM   3872 N N     . LEU C 1 123 ? 1.606   3.303   16.143  1.00 28.26  ? 109 LEU C N     1 
ATOM   3873 C CA    . LEU C 1 123 ? 1.338   4.438   15.274  1.00 28.79  ? 109 LEU C CA    1 
ATOM   3874 C C     . LEU C 1 123 ? -0.185  4.599   14.988  1.00 28.32  ? 109 LEU C C     1 
ATOM   3875 O O     . LEU C 1 123 ? -0.678  5.728   14.848  1.00 22.60  ? 109 LEU C O     1 
ATOM   3876 C CB    . LEU C 1 123 ? 2.151   4.273   13.969  1.00 26.62  ? 109 LEU C CB    1 
ATOM   3877 C CG    . LEU C 1 123 ? 2.486   5.473   13.079  1.00 32.17  ? 109 LEU C CG    1 
ATOM   3878 C CD1   . LEU C 1 123 ? 3.266   6.511   13.847  1.00 22.44  ? 109 LEU C CD1   1 
ATOM   3879 C CD2   . LEU C 1 123 ? 3.321   4.982   11.886  1.00 34.03  ? 109 LEU C CD2   1 
ATOM   3880 N N     . THR C 1 124 ? -0.943  3.506   14.869  1.00 19.74  ? 110 THR C N     1 
ATOM   3881 C CA    . THR C 1 124 ? -2.384  3.691   14.664  1.00 20.35  ? 110 THR C CA    1 
ATOM   3882 C C     . THR C 1 124 ? -3.160  3.981   15.974  1.00 20.37  ? 110 THR C C     1 
ATOM   3883 O O     . THR C 1 124 ? -4.391  4.210   15.944  1.00 22.87  ? 110 THR C O     1 
ATOM   3884 C CB    . THR C 1 124 ? -3.030  2.475   14.007  1.00 24.76  ? 110 THR C CB    1 
ATOM   3885 O OG1   . THR C 1 124 ? -2.709  1.303   14.769  1.00 21.43  ? 110 THR C OG1   1 
ATOM   3886 C CG2   . THR C 1 124 ? -2.570  2.339   12.556  1.00 22.43  ? 110 THR C CG2   1 
ATOM   3887 N N     . GLY C 1 125 ? -2.450  3.937   17.107  1.00 17.94  ? 111 GLY C N     1 
ATOM   3888 C CA    . GLY C 1 125 ? -3.049  4.198   18.409  1.00 22.27  ? 111 GLY C CA    1 
ATOM   3889 C C     . GLY C 1 125 ? -3.652  3.020   19.170  1.00 25.75  ? 111 GLY C C     1 
ATOM   3890 O O     . GLY C 1 125 ? -3.957  3.123   20.372  1.00 23.26  ? 111 GLY C O     1 
ATOM   3891 N N     . HIS C 1 126 ? -3.832  1.892   18.492  1.00 23.50  ? 112 HIS C N     1 
ATOM   3892 C CA    . HIS C 1 126 ? -4.409  0.727   19.152  1.00 23.84  ? 112 HIS C CA    1 
ATOM   3893 C C     . HIS C 1 126 ? -3.608  0.189   20.323  1.00 24.74  ? 112 HIS C C     1 
ATOM   3894 O O     . HIS C 1 126 ? -4.162  -0.073  21.374  1.00 21.72  ? 112 HIS C O     1 
ATOM   3895 C CB    . HIS C 1 126 ? -4.639  -0.381  18.132  1.00 17.92  ? 112 HIS C CB    1 
ATOM   3896 C CG    . HIS C 1 126 ? -5.558  0.029   17.030  1.00 26.56  ? 112 HIS C CG    1 
ATOM   3897 N ND1   . HIS C 1 126 ? -5.120  0.721   15.919  1.00 25.16  ? 112 HIS C ND1   1 
ATOM   3898 C CD2   . HIS C 1 126 ? -6.905  -0.068  16.913  1.00 18.65  ? 112 HIS C CD2   1 
ATOM   3899 C CE1   . HIS C 1 126 ? -6.161  1.033   15.165  1.00 19.21  ? 112 HIS C CE1   1 
ATOM   3900 N NE2   . HIS C 1 126 ? -7.252  0.570   15.749  1.00 18.80  ? 112 HIS C NE2   1 
ATOM   3901 N N     . ALA C 1 127 ? -2.300  0.032   20.148  1.00 28.58  ? 113 ALA C N     1 
ATOM   3902 C CA    . ALA C 1 127 ? -1.449  -0.508  21.214  1.00 24.17  ? 113 ALA C CA    1 
ATOM   3903 C C     . ALA C 1 127 ? -1.429  0.385   22.436  1.00 23.71  ? 113 ALA C C     1 
ATOM   3904 O O     . ALA C 1 127 ? -1.232  -0.063  23.579  1.00 29.02  ? 113 ALA C O     1 
ATOM   3905 C CB    . ALA C 1 127 ? -0.011  -0.693  20.673  1.00 23.16  ? 113 ALA C CB    1 
ATOM   3906 N N     . LEU C 1 128 ? -1.615  1.670   22.181  1.00 25.18  ? 114 LEU C N     1 
ATOM   3907 C CA    . LEU C 1 128 ? -1.592  2.665   23.224  1.00 23.58  ? 114 LEU C CA    1 
ATOM   3908 C C     . LEU C 1 128 ? -2.852  2.750   24.071  1.00 24.44  ? 114 LEU C C     1 
ATOM   3909 O O     . LEU C 1 128 ? -2.839  3.437   25.079  1.00 21.88  ? 114 LEU C O     1 
ATOM   3910 C CB    . LEU C 1 128 ? -1.292  4.024   22.612  1.00 21.89  ? 114 LEU C CB    1 
ATOM   3911 C CG    . LEU C 1 128 ? 0.056   4.079   21.925  1.00 25.57  ? 114 LEU C CG    1 
ATOM   3912 C CD1   . LEU C 1 128 ? 0.273   5.477   21.406  1.00 24.44  ? 114 LEU C CD1   1 
ATOM   3913 C CD2   . LEU C 1 128 ? 1.146   3.672   22.916  1.00 21.37  ? 114 LEU C CD2   1 
ATOM   3914 N N     . MET C 1 129 ? -3.929  2.063   23.673  1.00 22.99  ? 115 MET C N     1 
ATOM   3915 C CA    . MET C 1 129 ? -5.170  2.092   24.449  1.00 22.32  ? 115 MET C CA    1 
ATOM   3916 C C     . MET C 1 129 ? -4.991  1.634   25.915  1.00 28.50  ? 115 MET C C     1 
ATOM   3917 O O     . MET C 1 129 ? -5.713  2.093   26.798  1.00 23.00  ? 115 MET C O     1 
ATOM   3918 C CB    . MET C 1 129 ? -6.244  1.250   23.762  1.00 22.40  ? 115 MET C CB    1 
ATOM   3919 C CG    . MET C 1 129 ? -6.638  1.785   22.384  1.00 25.10  ? 115 MET C CG    1 
ATOM   3920 S SD    . MET C 1 129 ? -7.435  3.394   22.480  1.00 29.56  ? 115 MET C SD    1 
ATOM   3921 C CE    . MET C 1 129 ? -6.265  4.467   23.123  1.00 53.07  ? 115 MET C CE    1 
ATOM   3922 N N     . PHE C 1 130 ? -4.006  0.766   26.159  1.00 27.01  ? 116 PHE C N     1 
ATOM   3923 C CA    . PHE C 1 130 ? -3.722  0.251   27.499  1.00 26.28  ? 116 PHE C CA    1 
ATOM   3924 C C     . PHE C 1 130 ? -2.706  1.085   28.261  1.00 27.33  ? 116 PHE C C     1 
ATOM   3925 O O     . PHE C 1 130 ? -2.510  0.893   29.446  1.00 30.28  ? 116 PHE C O     1 
ATOM   3926 C CB    . PHE C 1 130 ? -3.144  -1.169  27.427  1.00 23.58  ? 116 PHE C CB    1 
ATOM   3927 C CG    . PHE C 1 130 ? -3.858  -2.067  26.473  1.00 27.48  ? 116 PHE C CG    1 
ATOM   3928 C CD1   . PHE C 1 130 ? -3.349  -2.275  25.184  1.00 24.57  ? 116 PHE C CD1   1 
ATOM   3929 C CD2   . PHE C 1 130 ? -5.044  -2.708  26.852  1.00 30.00  ? 116 PHE C CD2   1 
ATOM   3930 C CE1   . PHE C 1 130 ? -4.010  -3.090  24.299  1.00 21.58  ? 116 PHE C CE1   1 
ATOM   3931 C CE2   . PHE C 1 130 ? -5.713  -3.528  25.973  1.00 25.98  ? 116 PHE C CE2   1 
ATOM   3932 C CZ    . PHE C 1 130 ? -5.201  -3.728  24.694  1.00 23.76  ? 116 PHE C CZ    1 
ATOM   3933 N N     . GLU C 1 131 ? -2.066  2.019   27.590  1.00 28.05  ? 117 GLU C N     1 
ATOM   3934 C CA    . GLU C 1 131 ? -1.011  2.787   28.219  1.00 31.94  ? 117 GLU C CA    1 
ATOM   3935 C C     . GLU C 1 131 ? -1.360  4.245   28.438  1.00 33.71  ? 117 GLU C C     1 
ATOM   3936 O O     . GLU C 1 131 ? -2.435  4.695   28.055  1.00 34.83  ? 117 GLU C O     1 
ATOM   3937 C CB    . GLU C 1 131 ? 0.239   2.646   27.349  1.00 34.16  ? 117 GLU C CB    1 
ATOM   3938 C CG    . GLU C 1 131 ? 0.564   1.171   27.008  1.00 29.40  ? 117 GLU C CG    1 
ATOM   3939 C CD    . GLU C 1 131 ? 0.823   0.327   28.254  1.00 36.17  ? 117 GLU C CD    1 
ATOM   3940 O OE1   . GLU C 1 131 ? 0.584   -0.901  28.217  1.00 38.66  ? 117 GLU C OE1   1 
ATOM   3941 O OE2   . GLU C 1 131 ? 1.280   0.888   29.269  1.00 37.63  ? 117 GLU C OE2   1 
ATOM   3942 N N     . GLN C 1 132 ? -0.440  4.969   29.066  1.00 36.78  ? 118 GLN C N     1 
ATOM   3943 C CA    . GLN C 1 132 ? -0.603  6.400   29.360  1.00 40.17  ? 118 GLN C CA    1 
ATOM   3944 C C     . GLN C 1 132 ? -1.075  7.250   28.155  1.00 37.44  ? 118 GLN C C     1 
ATOM   3945 O O     . GLN C 1 132 ? -0.473  7.198   27.083  1.00 30.42  ? 118 GLN C O     1 
ATOM   3946 C CB    . GLN C 1 132 ? 0.735   6.971   29.871  1.00 40.58  ? 118 GLN C CB    1 
ATOM   3947 C CG    . GLN C 1 132 ? 1.052   6.679   31.326  1.00 43.54  ? 118 GLN C CG    1 
ATOM   3948 C CD    . GLN C 1 132 ? 0.018   7.276   32.268  1.00 56.12  ? 118 GLN C CD    1 
ATOM   3949 O OE1   . GLN C 1 132 ? -0.308  8.467   32.191  1.00 60.61  ? 118 GLN C OE1   1 
ATOM   3950 N NE2   . GLN C 1 132 ? -0.504  6.450   33.168  1.00 60.62  ? 118 GLN C NE2   1 
ATOM   3951 N N     . ASP C 1 133 ? -2.115  8.058   28.357  1.00 32.70  ? 119 ASP C N     1 
ATOM   3952 C CA    . ASP C 1 133 ? -2.647  8.907   27.299  1.00 35.56  ? 119 ASP C CA    1 
ATOM   3953 C C     . ASP C 1 133 ? -1.584  9.791   26.667  1.00 34.89  ? 119 ASP C C     1 
ATOM   3954 O O     . ASP C 1 133 ? -1.658  10.105  25.477  1.00 33.64  ? 119 ASP C O     1 
ATOM   3955 C CB    . ASP C 1 133 ? -3.767  9.810   27.829  1.00 36.42  ? 119 ASP C CB    1 
ATOM   3956 C CG    . ASP C 1 133 ? -5.049  9.064   28.091  1.00 40.26  ? 119 ASP C CG    1 
ATOM   3957 O OD1   . ASP C 1 133 ? -5.265  7.993   27.483  1.00 50.83  ? 119 ASP C OD1   1 
ATOM   3958 O OD2   . ASP C 1 133 ? -5.860  9.562   28.897  1.00 49.29  ? 119 ASP C OD2   1 
ATOM   3959 N N     . ARG C 1 134 ? -0.617  10.212  27.479  1.00 33.53  ? 120 ARG C N     1 
ATOM   3960 C CA    . ARG C 1 134 ? 0.492   11.057  27.025  1.00 32.16  ? 120 ARG C CA    1 
ATOM   3961 C C     . ARG C 1 134 ? 1.183   10.466  25.778  1.00 30.93  ? 120 ARG C C     1 
ATOM   3962 O O     . ARG C 1 134 ? 1.642   11.197  24.892  1.00 27.46  ? 120 ARG C O     1 
ATOM   3963 C CB    . ARG C 1 134 ? 1.509   11.228  28.181  1.00 33.63  ? 120 ARG C CB    1 
ATOM   3964 C CG    . ARG C 1 134 ? 2.826   11.940  27.806  1.00 37.35  ? 120 ARG C CG    1 
ATOM   3965 C CD    . ARG C 1 134 ? 3.806   11.964  28.999  1.00 42.31  ? 120 ARG C CD    1 
ATOM   3966 N NE    . ARG C 1 134 ? 4.282   10.632  29.383  1.00 43.08  ? 120 ARG C NE    1 
ATOM   3967 C CZ    . ARG C 1 134 ? 5.144   9.907   28.665  1.00 39.69  ? 120 ARG C CZ    1 
ATOM   3968 N NH1   . ARG C 1 134 ? 5.634   10.389  27.528  1.00 40.92  ? 120 ARG C NH1   1 
ATOM   3969 N NH2   . ARG C 1 134 ? 5.492   8.690   29.072  1.00 32.72  ? 120 ARG C NH2   1 
ATOM   3970 N N     . LEU C 1 135 ? 1.256   9.140   25.704  1.00 28.18  ? 121 LEU C N     1 
ATOM   3971 C CA    . LEU C 1 135 ? 1.904   8.516   24.566  1.00 28.19  ? 121 LEU C CA    1 
ATOM   3972 C C     . LEU C 1 135 ? 1.152   8.796   23.244  1.00 28.58  ? 121 LEU C C     1 
ATOM   3973 O O     . LEU C 1 135 ? 1.774   9.077   22.197  1.00 26.67  ? 121 LEU C O     1 
ATOM   3974 C CB    . LEU C 1 135 ? 2.047   7.013   24.846  1.00 25.95  ? 121 LEU C CB    1 
ATOM   3975 C CG    . LEU C 1 135 ? 2.804   6.705   26.136  1.00 26.49  ? 121 LEU C CG    1 
ATOM   3976 C CD1   . LEU C 1 135 ? 2.589   5.231   26.485  1.00 24.96  ? 121 LEU C CD1   1 
ATOM   3977 C CD2   . LEU C 1 135 ? 4.298   7.024   25.988  1.00 23.90  ? 121 LEU C CD2   1 
ATOM   3978 N N     . GLN C 1 136 ? -0.180  8.736   23.276  1.00 27.25  ? 122 GLN C N     1 
ATOM   3979 C CA    . GLN C 1 136 ? -0.954  8.998   22.070  1.00 24.26  ? 122 GLN C CA    1 
ATOM   3980 C C     . GLN C 1 136 ? -0.648  10.448  21.701  1.00 27.60  ? 122 GLN C C     1 
ATOM   3981 O O     . GLN C 1 136 ? -0.557  10.816  20.512  1.00 26.97  ? 122 GLN C O     1 
ATOM   3982 C CB    . GLN C 1 136 ? -2.445  8.824   22.340  1.00 18.62  ? 122 GLN C CB    1 
ATOM   3983 C CG    . GLN C 1 136 ? -3.302  9.138   21.122  1.00 30.07  ? 122 GLN C CG    1 
ATOM   3984 C CD    . GLN C 1 136 ? -2.936  8.299   19.906  1.00 28.56  ? 122 GLN C CD    1 
ATOM   3985 O OE1   . GLN C 1 136 ? -2.691  8.827   18.814  1.00 31.13  ? 122 GLN C OE1   1 
ATOM   3986 N NE2   . GLN C 1 136 ? -2.907  6.993   20.085  1.00 34.14  ? 122 GLN C NE2   1 
ATOM   3987 N N     . GLY C 1 137 ? -0.473  11.279  22.723  1.00 24.82  ? 123 GLY C N     1 
ATOM   3988 C CA    . GLY C 1 137 ? -0.131  12.669  22.455  1.00 29.55  ? 123 GLY C CA    1 
ATOM   3989 C C     . GLY C 1 137 ? 1.173   12.758  21.668  1.00 26.49  ? 123 GLY C C     1 
ATOM   3990 O O     . GLY C 1 137 ? 1.290   13.558  20.743  1.00 30.84  ? 123 GLY C O     1 
ATOM   3991 N N     . ARG C 1 138 ? 2.159   11.932  22.016  1.00 27.91  ? 124 ARG C N     1 
ATOM   3992 C CA    . ARG C 1 138 ? 3.446   11.947  21.301  1.00 25.77  ? 124 ARG C CA    1 
ATOM   3993 C C     . ARG C 1 138 ? 3.244   11.530  19.853  1.00 24.01  ? 124 ARG C C     1 
ATOM   3994 O O     . ARG C 1 138 ? 3.828   12.122  18.962  1.00 23.72  ? 124 ARG C O     1 
ATOM   3995 C CB    . ARG C 1 138 ? 4.452   10.989  21.922  1.00 24.68  ? 124 ARG C CB    1 
ATOM   3996 C CG    . ARG C 1 138 ? 4.865   11.317  23.313  1.00 42.10  ? 124 ARG C CG    1 
ATOM   3997 C CD    . ARG C 1 138 ? 6.334   11.699  23.341  1.00 48.73  ? 124 ARG C CD    1 
ATOM   3998 N NE    . ARG C 1 138 ? 7.218   10.630  22.882  1.00 48.52  ? 124 ARG C NE    1 
ATOM   3999 C CZ    . ARG C 1 138 ? 8.542   10.742  22.842  1.00 53.21  ? 124 ARG C CZ    1 
ATOM   4000 N NH1   . ARG C 1 138 ? 9.118   11.871  23.232  1.00 58.30  ? 124 ARG C NH1   1 
ATOM   4001 N NH2   . ARG C 1 138 ? 9.294   9.739   22.420  1.00 50.62  ? 124 ARG C NH2   1 
ATOM   4002 N N     . ILE C 1 139 ? 2.444   10.486  19.633  1.00 23.03  ? 125 ILE C N     1 
ATOM   4003 C CA    . ILE C 1 139 ? 2.143   10.027  18.289  1.00 18.05  ? 125 ILE C CA    1 
ATOM   4004 C C     . ILE C 1 139 ? 1.449   11.129  17.475  1.00 20.89  ? 125 ILE C C     1 
ATOM   4005 O O     . ILE C 1 139 ? 1.810   11.380  16.302  1.00 24.26  ? 125 ILE C O     1 
ATOM   4006 C CB    . ILE C 1 139 ? 1.274   8.737   18.350  1.00 28.48  ? 125 ILE C CB    1 
ATOM   4007 C CG1   . ILE C 1 139 ? 2.165   7.567   18.812  1.00 23.79  ? 125 ILE C CG1   1 
ATOM   4008 C CG2   . ILE C 1 139 ? 0.625   8.445   17.014  1.00 20.26  ? 125 ILE C CG2   1 
ATOM   4009 C CD1   . ILE C 1 139 ? 3.431   7.443   17.988  1.00 26.29  ? 125 ILE C CD1   1 
ATOM   4010 N N     . ASN C 1 140 ? 0.470   11.798  18.076  1.00 26.60  ? 126 ASN C N     1 
ATOM   4011 C CA    . ASN C 1 140 ? -0.210  12.882  17.376  1.00 24.07  ? 126 ASN C CA    1 
ATOM   4012 C C     . ASN C 1 140 ? 0.789   13.966  16.981  1.00 24.93  ? 126 ASN C C     1 
ATOM   4013 O O     . ASN C 1 140 ? 0.731   14.518  15.874  1.00 26.32  ? 126 ASN C O     1 
ATOM   4014 C CB    . ASN C 1 140 ? -1.305  13.480  18.243  1.00 24.27  ? 126 ASN C CB    1 
ATOM   4015 C CG    . ASN C 1 140 ? -2.534  12.615  18.279  1.00 32.60  ? 126 ASN C CG    1 
ATOM   4016 O OD1   . ASN C 1 140 ? -2.747  11.793  17.374  1.00 29.70  ? 126 ASN C OD1   1 
ATOM   4017 N ND2   . ASN C 1 140 ? -3.368  12.794  19.309  1.00 24.97  ? 126 ASN C ND2   1 
ATOM   4018 N N     . GLN C 1 141 ? 1.711   14.259  17.890  1.00 29.70  ? 127 GLN C N     1 
ATOM   4019 C CA    . GLN C 1 141 ? 2.744   15.245  17.633  1.00 29.75  ? 127 GLN C CA    1 
ATOM   4020 C C     . GLN C 1 141 ? 3.564   14.821  16.420  1.00 28.44  ? 127 GLN C C     1 
ATOM   4021 O O     . GLN C 1 141 ? 3.943   15.658  15.580  1.00 28.78  ? 127 GLN C O     1 
ATOM   4022 C CB    . GLN C 1 141 ? 3.650   15.396  18.865  1.00 29.82  ? 127 GLN C CB    1 
ATOM   4023 C CG    . GLN C 1 141 ? 3.069   16.309  19.916  1.00 45.69  ? 127 GLN C CG    1 
ATOM   4024 C CD    . GLN C 1 141 ? 4.059   16.644  21.022  1.00 58.64  ? 127 GLN C CD    1 
ATOM   4025 O OE1   . GLN C 1 141 ? 4.121   15.966  22.057  1.00 62.44  ? 127 GLN C OE1   1 
ATOM   4026 N NE2   . GLN C 1 141 ? 4.852   17.693  20.803  1.00 67.98  ? 127 GLN C NE2   1 
ATOM   4027 N N     . LEU C 1 142 ? 3.798   13.516  16.297  1.00 26.57  ? 128 LEU C N     1 
ATOM   4028 C CA    . LEU C 1 142 ? 4.603   13.009  15.188  1.00 25.52  ? 128 LEU C CA    1 
ATOM   4029 C C     . LEU C 1 142 ? 3.857   13.190  13.880  1.00 26.99  ? 128 LEU C C     1 
ATOM   4030 O O     . LEU C 1 142 ? 4.421   13.639  12.875  1.00 23.50  ? 128 LEU C O     1 
ATOM   4031 C CB    . LEU C 1 142 ? 4.941   11.536  15.421  1.00 23.89  ? 128 LEU C CB    1 
ATOM   4032 C CG    . LEU C 1 142 ? 5.706   10.868  14.288  1.00 29.58  ? 128 LEU C CG    1 
ATOM   4033 C CD1   . LEU C 1 142 ? 6.989   11.653  14.007  1.00 27.30  ? 128 LEU C CD1   1 
ATOM   4034 C CD2   . LEU C 1 142 ? 6.023   9.410   14.662  1.00 17.62  ? 128 LEU C CD2   1 
ATOM   4035 N N     . PHE C 1 143 ? 2.568   12.856  13.891  1.00 24.71  ? 129 PHE C N     1 
ATOM   4036 C CA    . PHE C 1 143 ? 1.780   13.015  12.690  1.00 23.08  ? 129 PHE C CA    1 
ATOM   4037 C C     . PHE C 1 143 ? 1.742   14.465  12.305  1.00 22.70  ? 129 PHE C C     1 
ATOM   4038 O O     . PHE C 1 143 ? 1.816   14.765  11.126  1.00 21.22  ? 129 PHE C O     1 
ATOM   4039 C CB    . PHE C 1 143 ? 0.358   12.477  12.888  1.00 25.20  ? 129 PHE C CB    1 
ATOM   4040 C CG    . PHE C 1 143 ? 0.266   10.990  12.739  1.00 27.98  ? 129 PHE C CG    1 
ATOM   4041 C CD1   . PHE C 1 143 ? 0.630   10.390  11.542  1.00 31.03  ? 129 PHE C CD1   1 
ATOM   4042 C CD2   . PHE C 1 143 ? -0.195  10.192  13.780  1.00 28.52  ? 129 PHE C CD2   1 
ATOM   4043 C CE1   . PHE C 1 143 ? 0.522   9.022   11.367  1.00 31.45  ? 129 PHE C CE1   1 
ATOM   4044 C CE2   . PHE C 1 143 ? -0.308  8.806   13.619  1.00 28.46  ? 129 PHE C CE2   1 
ATOM   4045 C CZ    . PHE C 1 143 ? 0.056   8.223   12.411  1.00 31.00  ? 129 PHE C CZ    1 
ATOM   4046 N N     . GLU C 1 144 ? 1.627   15.360  13.295  1.00 25.16  ? 130 GLU C N     1 
ATOM   4047 C CA    . GLU C 1 144 ? 1.605   16.803  13.006  1.00 30.63  ? 130 GLU C CA    1 
ATOM   4048 C C     . GLU C 1 144 ? 2.951   17.222  12.399  1.00 30.67  ? 130 GLU C C     1 
ATOM   4049 O O     . GLU C 1 144 ? 2.991   18.011  11.452  1.00 22.91  ? 130 GLU C O     1 
ATOM   4050 C CB    . GLU C 1 144 ? 1.320   17.621  14.275  1.00 30.94  ? 130 GLU C CB    1 
ATOM   4051 C CG    . GLU C 1 144 ? -0.126  17.489  14.812  1.00 45.34  ? 130 GLU C CG    1 
ATOM   4052 C CD    . GLU C 1 144 ? -1.182  17.942  13.800  1.00 51.90  ? 130 GLU C CD    1 
ATOM   4053 O OE1   . GLU C 1 144 ? -0.917  18.941  13.095  1.00 55.50  ? 130 GLU C OE1   1 
ATOM   4054 O OE2   . GLU C 1 144 ? -2.274  17.313  13.716  1.00 44.05  ? 130 GLU C OE2   1 
ATOM   4055 N N     . ARG C 1 145 ? 4.047   16.678  12.929  1.00 27.57  ? 131 ARG C N     1 
ATOM   4056 C CA    . ARG C 1 145 ? 5.366   16.991  12.379  1.00 26.94  ? 131 ARG C CA    1 
ATOM   4057 C C     . ARG C 1 145 ? 5.459   16.549  10.898  1.00 26.07  ? 131 ARG C C     1 
ATOM   4058 O O     . ARG C 1 145 ? 5.851   17.329  10.017  1.00 22.45  ? 131 ARG C O     1 
ATOM   4059 C CB    . ARG C 1 145 ? 6.438   16.311  13.229  1.00 32.42  ? 131 ARG C CB    1 
ATOM   4060 C CG    . ARG C 1 145 ? 7.797   16.298  12.574  1.00 43.81  ? 131 ARG C CG    1 
ATOM   4061 C CD    . ARG C 1 145 ? 8.810   17.096  13.346  1.00 46.05  ? 131 ARG C CD    1 
ATOM   4062 N NE    . ARG C 1 145 ? 9.681   16.245  14.145  1.00 49.30  ? 131 ARG C NE    1 
ATOM   4063 C CZ    . ARG C 1 145 ? 11.009  16.338  14.143  1.00 46.94  ? 131 ARG C CZ    1 
ATOM   4064 N NH1   . ARG C 1 145 ? 11.608  17.238  13.381  1.00 48.14  ? 131 ARG C NH1   1 
ATOM   4065 N NH2   . ARG C 1 145 ? 11.738  15.545  14.911  1.00 46.61  ? 131 ARG C NH2   1 
ATOM   4066 N N     . ILE C 1 146 ? 5.065   15.309  10.613  1.00 26.49  ? 132 ILE C N     1 
ATOM   4067 C CA    . ILE C 1 146 ? 5.072   14.796  9.246   1.00 26.14  ? 132 ILE C CA    1 
ATOM   4068 C C     . ILE C 1 146 ? 4.197   15.651  8.297   1.00 28.46  ? 132 ILE C C     1 
ATOM   4069 O O     . ILE C 1 146 ? 4.619   16.032  7.191   1.00 25.01  ? 132 ILE C O     1 
ATOM   4070 C CB    . ILE C 1 146 ? 4.559   13.319  9.231   1.00 24.55  ? 132 ILE C CB    1 
ATOM   4071 C CG1   . ILE C 1 146 ? 5.577   12.447  9.974   1.00 27.35  ? 132 ILE C CG1   1 
ATOM   4072 C CG2   . ILE C 1 146 ? 4.268   12.860  7.790   1.00 27.40  ? 132 ILE C CG2   1 
ATOM   4073 C CD1   . ILE C 1 146 ? 5.137   11.050  10.270  1.00 24.08  ? 132 ILE C CD1   1 
ATOM   4074 N N     . GLU C 1 147 ? 2.976   15.936  8.735   1.00 24.43  ? 133 GLU C N     1 
ATOM   4075 C CA    . GLU C 1 147 ? 2.035   16.702  7.940   1.00 29.34  ? 133 GLU C CA    1 
ATOM   4076 C C     . GLU C 1 147 ? 2.576   18.107  7.618   1.00 28.04  ? 133 GLU C C     1 
ATOM   4077 O O     . GLU C 1 147 ? 2.392   18.617  6.506   1.00 26.80  ? 133 GLU C O     1 
ATOM   4078 C CB    . GLU C 1 147 ? 0.685   16.793  8.687   1.00 26.16  ? 133 GLU C CB    1 
ATOM   4079 C CG    . GLU C 1 147 ? -0.484  17.194  7.805   1.00 33.31  ? 133 GLU C CG    1 
ATOM   4080 C CD    . GLU C 1 147 ? -1.852  17.051  8.488   1.00 34.79  ? 133 GLU C CD    1 
ATOM   4081 O OE1   . GLU C 1 147 ? -1.976  16.235  9.425   1.00 39.84  ? 133 GLU C OE1   1 
ATOM   4082 O OE2   . GLU C 1 147 ? -2.801  17.754  8.071   1.00 35.01  ? 133 GLU C OE2   1 
ATOM   4083 N N     . VAL C 1 148 ? 3.256   18.714  8.588   1.00 28.63  ? 134 VAL C N     1 
ATOM   4084 C CA    . VAL C 1 148 ? 3.829   20.051  8.422   1.00 29.11  ? 134 VAL C CA    1 
ATOM   4085 C C     . VAL C 1 148 ? 4.986   20.031  7.415   1.00 30.67  ? 134 VAL C C     1 
ATOM   4086 O O     . VAL C 1 148 ? 5.222   21.013  6.685   1.00 27.17  ? 134 VAL C O     1 
ATOM   4087 C CB    . VAL C 1 148 ? 4.354   20.600  9.758   1.00 29.36  ? 134 VAL C CB    1 
ATOM   4088 C CG1   . VAL C 1 148 ? 5.051   21.940  9.542   1.00 19.99  ? 134 VAL C CG1   1 
ATOM   4089 C CG2   . VAL C 1 148 ? 3.221   20.748  10.754  1.00 19.98  ? 134 VAL C CG2   1 
ATOM   4090 N N     . GLN C 1 149 ? 5.697   18.908  7.367   1.00 29.39  ? 135 GLN C N     1 
ATOM   4091 C CA    . GLN C 1 149 ? 6.788   18.747  6.414   1.00 30.47  ? 135 GLN C CA    1 
ATOM   4092 C C     . GLN C 1 149 ? 6.196   18.617  5.022   1.00 30.08  ? 135 GLN C C     1 
ATOM   4093 O O     . GLN C 1 149 ? 6.700   19.203  4.068   1.00 29.85  ? 135 GLN C O     1 
ATOM   4094 C CB    . GLN C 1 149 ? 7.596   17.475  6.706   1.00 30.74  ? 135 GLN C CB    1 
ATOM   4095 C CG    . GLN C 1 149 ? 8.973   17.732  7.282   1.00 45.77  ? 135 GLN C CG    1 
ATOM   4096 C CD    . GLN C 1 149 ? 9.967   18.298  6.268   1.00 38.89  ? 135 GLN C CD    1 
ATOM   4097 O OE1   . GLN C 1 149 ? 9.591   18.939  5.269   1.00 39.76  ? 135 GLN C OE1   1 
ATOM   4098 N NE2   . GLN C 1 149 ? 11.246  18.083  6.539   1.00 41.96  ? 135 GLN C NE2   1 
ATOM   4099 N N     . LEU C 1 150 ? 5.131   17.829  4.899   1.00 31.34  ? 136 LEU C N     1 
ATOM   4100 C CA    . LEU C 1 150 ? 4.493   17.633  3.593   1.00 30.16  ? 136 LEU C CA    1 
ATOM   4101 C C     . LEU C 1 150 ? 3.979   18.958  3.090   1.00 24.36  ? 136 LEU C C     1 
ATOM   4102 O O     . LEU C 1 150 ? 4.042   19.260  1.894   1.00 25.66  ? 136 LEU C O     1 
ATOM   4103 C CB    . LEU C 1 150 ? 3.313   16.680  3.704   1.00 27.25  ? 136 LEU C CB    1 
ATOM   4104 C CG    . LEU C 1 150 ? 3.577   15.221  4.060   1.00 27.11  ? 136 LEU C CG    1 
ATOM   4105 C CD1   . LEU C 1 150 ? 2.265   14.549  4.438   1.00 27.97  ? 136 LEU C CD1   1 
ATOM   4106 C CD2   . LEU C 1 150 ? 4.215   14.539  2.890   1.00 22.69  ? 136 LEU C CD2   1 
ATOM   4107 N N     . ARG C 1 151 ? 3.425   19.724  4.013   1.00 22.91  ? 137 ARG C N     1 
ATOM   4108 C CA    . ARG C 1 151 ? 2.887   21.033  3.680   1.00 27.96  ? 137 ARG C CA    1 
ATOM   4109 C C     . ARG C 1 151 ? 4.053   21.881  3.166   1.00 23.30  ? 137 ARG C C     1 
ATOM   4110 O O     . ARG C 1 151 ? 3.971   22.497  2.114   1.00 27.42  ? 137 ARG C O     1 
ATOM   4111 C CB    . ARG C 1 151 ? 2.260   21.636  4.929   1.00 29.84  ? 137 ARG C CB    1 
ATOM   4112 C CG    . ARG C 1 151 ? 0.926   22.289  4.703   1.00 32.23  ? 137 ARG C CG    1 
ATOM   4113 C CD    . ARG C 1 151 ? 0.026   22.095  5.909   1.00 23.97  ? 137 ARG C CD    1 
ATOM   4114 N NE    . ARG C 1 151 ? 0.702   22.391  7.167   1.00 29.01  ? 137 ARG C NE    1 
ATOM   4115 C CZ    . ARG C 1 151 ? 0.409   21.799  8.321   1.00 31.77  ? 137 ARG C CZ    1 
ATOM   4116 N NH1   . ARG C 1 151 ? -0.552  20.881  8.381   1.00 30.08  ? 137 ARG C NH1   1 
ATOM   4117 N NH2   . ARG C 1 151 ? 1.103   22.094  9.412   1.00 35.08  ? 137 ARG C NH2   1 
ATOM   4118 N N     . GLN C 1 152 ? 5.158   21.850  3.896   1.00 29.42  ? 138 GLN C N     1 
ATOM   4119 C CA    . GLN C 1 152 ? 6.373   22.599  3.517   1.00 33.86  ? 138 GLN C CA    1 
ATOM   4120 C C     . GLN C 1 152 ? 6.902   22.162  2.143   1.00 27.47  ? 138 GLN C C     1 
ATOM   4121 O O     . GLN C 1 152 ? 7.281   22.998  1.324   1.00 24.26  ? 138 GLN C O     1 
ATOM   4122 C CB    . GLN C 1 152 ? 7.448   22.415  4.603   1.00 39.10  ? 138 GLN C CB    1 
ATOM   4123 C CG    . GLN C 1 152 ? 8.471   23.537  4.682   1.00 54.40  ? 138 GLN C CG    1 
ATOM   4124 C CD    . GLN C 1 152 ? 9.790   23.210  3.988   1.00 66.62  ? 138 GLN C CD    1 
ATOM   4125 O OE1   . GLN C 1 152 ? 10.411  22.167  4.246   1.00 71.20  ? 138 GLN C OE1   1 
ATOM   4126 N NE2   . GLN C 1 152 ? 10.236  24.113  3.114   1.00 72.48  ? 138 GLN C NE2   1 
ATOM   4127 N N     . VAL C 1 153 ? 6.954   20.854  1.891   1.00 27.37  ? 139 VAL C N     1 
ATOM   4128 C CA    . VAL C 1 153 ? 7.387   20.361  0.589   1.00 22.90  ? 139 VAL C CA    1 
ATOM   4129 C C     . VAL C 1 153 ? 6.455   20.907  -0.516  1.00 26.15  ? 139 VAL C C     1 
ATOM   4130 O O     . VAL C 1 153 ? 6.915   21.341  -1.589  1.00 23.49  ? 139 VAL C O     1 
ATOM   4131 C CB    . VAL C 1 153 ? 7.353   18.795  0.522   1.00 22.94  ? 139 VAL C CB    1 
ATOM   4132 C CG1   . VAL C 1 153 ? 7.345   18.317  -0.949  1.00 19.66  ? 139 VAL C CG1   1 
ATOM   4133 C CG2   . VAL C 1 153 ? 8.558   18.211  1.236   1.00 24.25  ? 139 VAL C CG2   1 
ATOM   4134 N N     . MET C 1 154 ? 5.146   20.863  -0.262  1.00 21.98  ? 140 MET C N     1 
ATOM   4135 C CA    . MET C 1 154 ? 4.159   21.330  -1.234  1.00 28.56  ? 140 MET C CA    1 
ATOM   4136 C C     . MET C 1 154 ? 4.274   22.819  -1.538  1.00 26.80  ? 140 MET C C     1 
ATOM   4137 O O     . MET C 1 154 ? 4.090   23.244  -2.681  1.00 27.37  ? 140 MET C O     1 
ATOM   4138 C CB    . MET C 1 154 ? 2.738   21.046  -0.734  1.00 25.88  ? 140 MET C CB    1 
ATOM   4139 C CG    . MET C 1 154 ? 2.310   19.589  -0.870  1.00 34.38  ? 140 MET C CG    1 
ATOM   4140 S SD    . MET C 1 154 ? 0.797   19.179  0.067   1.00 29.57  ? 140 MET C SD    1 
ATOM   4141 C CE    . MET C 1 154 ? 0.882   17.352  -0.002  1.00 27.51  ? 140 MET C CE    1 
ATOM   4142 N N     . ARG C 1 155 ? 4.570   23.606  -0.512  1.00 27.49  ? 141 ARG C N     1 
ATOM   4143 C CA    . ARG C 1 155 ? 4.704   25.046  -0.670  1.00 34.35  ? 141 ARG C CA    1 
ATOM   4144 C C     . ARG C 1 155 ? 5.912   25.440  -1.502  1.00 33.34  ? 141 ARG C C     1 
ATOM   4145 O O     . ARG C 1 155 ? 5.969   26.531  -2.056  1.00 32.80  ? 141 ARG C O     1 
ATOM   4146 C CB    . ARG C 1 155 ? 4.757   25.724  0.711   1.00 31.84  ? 141 ARG C CB    1 
ATOM   4147 C CG    . ARG C 1 155 ? 3.352   25.978  1.246   1.00 45.08  ? 141 ARG C CG    1 
ATOM   4148 C CD    . ARG C 1 155 ? 3.280   26.921  2.458   1.00 51.25  ? 141 ARG C CD    1 
ATOM   4149 N NE    . ARG C 1 155 ? 3.397   26.231  3.736   1.00 48.20  ? 141 ARG C NE    1 
ATOM   4150 C CZ    . ARG C 1 155 ? 4.554   25.965  4.328   1.00 53.28  ? 141 ARG C CZ    1 
ATOM   4151 N NH1   . ARG C 1 155 ? 5.687   26.341  3.746   1.00 58.11  ? 141 ARG C NH1   1 
ATOM   4152 N NH2   . ARG C 1 155 ? 4.580   25.327  5.498   1.00 44.36  ? 141 ARG C NH2   1 
ATOM   4153 N N     . GLU C 1 156 ? 6.870   24.533  -1.599  1.00 34.21  ? 142 GLU C N     1 
ATOM   4154 C CA    . GLU C 1 156 ? 8.085   24.782  -2.356  1.00 34.95  ? 142 GLU C CA    1 
ATOM   4155 C C     . GLU C 1 156 ? 7.901   24.564  -3.847  1.00 33.05  ? 142 GLU C C     1 
ATOM   4156 O O     . GLU C 1 156 ? 8.717   25.023  -4.640  1.00 32.89  ? 142 GLU C O     1 
ATOM   4157 C CB    . GLU C 1 156 ? 9.170   23.833  -1.880  1.00 36.56  ? 142 GLU C CB    1 
ATOM   4158 C CG    . GLU C 1 156 ? 10.424  24.482  -1.401  1.00 47.60  ? 142 GLU C CG    1 
ATOM   4159 C CD    . GLU C 1 156 ? 10.510  24.462  0.084   1.00 45.90  ? 142 GLU C CD    1 
ATOM   4160 O OE1   . GLU C 1 156 ? 9.612   25.052  0.715   1.00 57.93  ? 142 GLU C OE1   1 
ATOM   4161 O OE2   . GLU C 1 156 ? 11.456  23.852  0.615   1.00 39.81  ? 142 GLU C OE2   1 
ATOM   4162 N N     . LYS C 1 157 ? 6.840   23.866  -4.245  1.00 29.93  ? 143 LYS C N     1 
ATOM   4163 C CA    . LYS C 1 157 ? 6.651   23.579  -5.653  1.00 30.50  ? 143 LYS C CA    1 
ATOM   4164 C C     . LYS C 1 157 ? 6.737   24.830  -6.514  1.00 36.16  ? 143 LYS C C     1 
ATOM   4165 O O     . LYS C 1 157 ? 7.354   24.822  -7.579  1.00 33.05  ? 143 LYS C O     1 
ATOM   4166 C CB    . LYS C 1 157 ? 5.306   22.897  -5.887  1.00 34.41  ? 143 LYS C CB    1 
ATOM   4167 C CG    . LYS C 1 157 ? 5.218   22.199  -7.239  1.00 36.70  ? 143 LYS C CG    1 
ATOM   4168 C CD    . LYS C 1 157 ? 3.830   21.615  -7.473  1.00 39.76  ? 143 LYS C CD    1 
ATOM   4169 C CE    . LYS C 1 157 ? 3.716   21.076  -8.876  1.00 42.83  ? 143 LYS C CE    1 
ATOM   4170 N NZ    . LYS C 1 157 ? 2.299   21.219  -9.313  1.00 58.00  ? 143 LYS C NZ    1 
ATOM   4171 N N     . LYS C 1 158 ? 6.106   25.905  -6.053  1.00 43.80  ? 144 LYS C N     1 
ATOM   4172 C CA    . LYS C 1 158 ? 6.114   27.172  -6.789  1.00 49.00  ? 144 LYS C CA    1 
ATOM   4173 C C     . LYS C 1 158 ? 7.547   27.594  -7.119  1.00 44.43  ? 144 LYS C C     1 
ATOM   4174 O O     . LYS C 1 158 ? 7.941   27.695  -8.291  1.00 39.88  ? 144 LYS C O     1 
ATOM   4175 C CB    . LYS C 1 158 ? 5.439   28.273  -5.949  1.00 57.77  ? 144 LYS C CB    1 
ATOM   4176 C CG    . LYS C 1 158 ? 3.986   28.560  -6.325  1.00 67.79  ? 144 LYS C CG    1 
ATOM   4177 C CD    . LYS C 1 158 ? 3.017   28.281  -5.157  1.00 73.77  ? 144 LYS C CD    1 
ATOM   4178 C CE    . LYS C 1 158 ? 1.545   28.392  -5.597  1.00 72.08  ? 144 LYS C CE    1 
ATOM   4179 N NZ    . LYS C 1 158 ? 0.586   27.882  -4.561  1.00 75.75  ? 144 LYS C NZ    1 
ATOM   4180 N N     . MET C 1 159 ? 8.316   27.829  -6.062  1.00 42.34  ? 145 MET C N     1 
ATOM   4181 C CA    . MET C 1 159 ? 9.704   28.248  -6.189  1.00 43.41  ? 145 MET C CA    1 
ATOM   4182 C C     . MET C 1 159 ? 10.571  27.349  -7.041  1.00 39.55  ? 145 MET C C     1 
ATOM   4183 O O     . MET C 1 159 ? 11.341  27.811  -7.885  1.00 45.73  ? 145 MET C O     1 
ATOM   4184 C CB    . MET C 1 159 ? 10.302  28.341  -4.809  1.00 45.12  ? 145 MET C CB    1 
ATOM   4185 C CG    . MET C 1 159 ? 9.792   29.516  -4.096  1.00 49.88  ? 145 MET C CG    1 
ATOM   4186 S SD    . MET C 1 159 ? 10.025  29.246  -2.412  1.00 59.44  ? 145 MET C SD    1 
ATOM   4187 C CE    . MET C 1 159 ? 8.358   28.881  -1.954  1.00 40.12  ? 145 MET C CE    1 
ATOM   4188 N N     . ARG C 1 160 ? 10.433  26.053  -6.816  1.00 36.10  ? 146 ARG C N     1 
ATOM   4189 C CA    . ARG C 1 160 ? 11.222  25.074  -7.517  1.00 34.05  ? 146 ARG C CA    1 
ATOM   4190 C C     . ARG C 1 160 ? 10.853  24.812  -8.956  1.00 41.67  ? 146 ARG C C     1 
ATOM   4191 O O     . ARG C 1 160 ? 11.714  24.434  -9.754  1.00 48.35  ? 146 ARG C O     1 
ATOM   4192 C CB    . ARG C 1 160 ? 11.188  23.762  -6.740  1.00 25.08  ? 146 ARG C CB    1 
ATOM   4193 C CG    . ARG C 1 160 ? 11.637  23.938  -5.319  1.00 27.13  ? 146 ARG C CG    1 
ATOM   4194 C CD    . ARG C 1 160 ? 11.585  22.628  -4.557  1.00 27.03  ? 146 ARG C CD    1 
ATOM   4195 N NE    . ARG C 1 160 ? 12.300  22.705  -3.293  1.00 30.67  ? 146 ARG C NE    1 
ATOM   4196 C CZ    . ARG C 1 160 ? 13.539  22.235  -3.112  1.00 35.31  ? 146 ARG C CZ    1 
ATOM   4197 N NH1   . ARG C 1 160 ? 14.186  21.659  -4.107  1.00 24.85  ? 146 ARG C NH1   1 
ATOM   4198 N NH2   . ARG C 1 160 ? 14.122  22.331  -1.934  1.00 34.78  ? 146 ARG C NH2   1 
ATOM   4199 N N     . GLU C 1 161 ? 9.588   24.997  -9.308  1.00 44.29  ? 147 GLU C N     1 
ATOM   4200 C CA    . GLU C 1 161 ? 9.206   24.698  -10.672 1.00 46.48  ? 147 GLU C CA    1 
ATOM   4201 C C     . GLU C 1 161 ? 8.231   25.647  -11.326 1.00 45.30  ? 147 GLU C C     1 
ATOM   4202 O O     . GLU C 1 161 ? 7.736   25.360  -12.411 1.00 49.14  ? 147 GLU C O     1 
ATOM   4203 C CB    . GLU C 1 161 ? 8.684   23.266  -10.746 1.00 45.81  ? 147 GLU C CB    1 
ATOM   4204 C CG    . GLU C 1 161 ? 7.928   22.818  -9.520  1.00 47.90  ? 147 GLU C CG    1 
ATOM   4205 C CD    . GLU C 1 161 ? 7.478   21.384  -9.639  1.00 50.42  ? 147 GLU C CD    1 
ATOM   4206 O OE1   . GLU C 1 161 ? 6.504   21.112  -10.351 1.00 52.72  ? 147 GLU C OE1   1 
ATOM   4207 O OE2   . GLU C 1 161 ? 8.102   20.498  -9.046  1.00 50.53  ? 147 GLU C OE2   1 
ATOM   4208 N N     . GLY C 1 162 ? 7.965   26.775  -10.676 1.00 47.73  ? 148 GLY C N     1 
ATOM   4209 C CA    . GLY C 1 162 ? 7.080   27.777  -11.253 1.00 54.00  ? 148 GLY C CA    1 
ATOM   4210 C C     . GLY C 1 162 ? 5.633   27.739  -10.809 1.00 60.00  ? 148 GLY C C     1 
ATOM   4211 O O     . GLY C 1 162 ? 5.140   28.652  -10.115 1.00 60.39  ? 148 GLY C O     1 
ATOM   4212 N N     . GLU C 1 163 ? 4.948   26.675  -11.211 1.00 59.51  ? 149 GLU C N     1 
ATOM   4213 C CA    . GLU C 1 163 ? 3.549   26.521  -10.867 1.00 60.30  ? 149 GLU C CA    1 
ATOM   4214 C C     . GLU C 1 163 ? 3.342   25.728  -9.592  1.00 54.65  ? 149 GLU C C     1 
ATOM   4215 O O     . GLU C 1 163 ? 3.620   24.522  -9.538  1.00 53.16  ? 149 GLU C O     1 
ATOM   4216 C CB    . GLU C 1 163 ? 2.796   25.846  -12.016 1.00 67.62  ? 149 GLU C CB    1 
ATOM   4217 C CG    . GLU C 1 163 ? 1.289   25.790  -11.792 1.00 80.32  ? 149 GLU C CG    1 
ATOM   4218 C CD    . GLU C 1 163 ? 0.504   25.519  -13.065 1.00 88.33  ? 149 GLU C CD    1 
ATOM   4219 O OE1   . GLU C 1 163 ? -0.748  25.466  -12.993 1.00 94.04  ? 149 GLU C OE1   1 
ATOM   4220 O OE2   . GLU C 1 163 ? 1.135   25.362  -14.134 1.00 89.89  ? 149 GLU C OE2   1 
ATOM   4221 N N     . GLY C 1 164 ? 2.864   26.424  -8.566  1.00 46.71  ? 150 GLY C N     1 
ATOM   4222 C CA    . GLY C 1 164 ? 2.576   25.779  -7.303  1.00 45.30  ? 150 GLY C CA    1 
ATOM   4223 C C     . GLY C 1 164 ? 1.236   25.061  -7.413  1.00 42.50  ? 150 GLY C C     1 
ATOM   4224 O O     . GLY C 1 164 ? 0.739   24.825  -8.517  1.00 38.49  ? 150 GLY C O     1 
ATOM   4225 N N     . TYR C 1 165 ? 0.637   24.713  -6.285  1.00 38.55  ? 151 TYR C N     1 
ATOM   4226 C CA    . TYR C 1 165 ? -0.641  24.015  -6.339  1.00 38.36  ? 151 TYR C CA    1 
ATOM   4227 C C     . TYR C 1 165 ? -1.803  24.988  -6.320  1.00 38.60  ? 151 TYR C C     1 
ATOM   4228 O O     . TYR C 1 165 ? -1.741  26.038  -5.680  1.00 42.04  ? 151 TYR C O     1 
ATOM   4229 C CB    . TYR C 1 165 ? -0.773  23.028  -5.160  1.00 36.00  ? 151 TYR C CB    1 
ATOM   4230 C CG    . TYR C 1 165 ? 0.095   21.788  -5.277  1.00 32.81  ? 151 TYR C CG    1 
ATOM   4231 C CD1   . TYR C 1 165 ? -0.208  20.789  -6.196  1.00 36.05  ? 151 TYR C CD1   1 
ATOM   4232 C CD2   . TYR C 1 165 ? 1.221   21.611  -4.466  1.00 33.17  ? 151 TYR C CD2   1 
ATOM   4233 C CE1   . TYR C 1 165 ? 0.582   19.640  -6.304  1.00 37.55  ? 151 TYR C CE1   1 
ATOM   4234 C CE2   . TYR C 1 165 ? 2.020   20.458  -4.572  1.00 32.55  ? 151 TYR C CE2   1 
ATOM   4235 C CZ    . TYR C 1 165 ? 1.688   19.481  -5.490  1.00 39.06  ? 151 TYR C CZ    1 
ATOM   4236 O OH    . TYR C 1 165 ? 2.428   18.322  -5.584  1.00 34.72  ? 151 TYR C OH    1 
ATOM   4237 N N     . THR C 1 166 ? -2.856  24.634  -7.038  1.00 36.50  ? 152 THR C N     1 
ATOM   4238 C CA    . THR C 1 166 ? -4.042  25.451  -7.083  1.00 38.88  ? 152 THR C CA    1 
ATOM   4239 C C     . THR C 1 166 ? -4.751  25.377  -5.754  1.00 38.79  ? 152 THR C C     1 
ATOM   4240 O O     . THR C 1 166 ? -5.249  26.383  -5.265  1.00 42.39  ? 152 THR C O     1 
ATOM   4241 C CB    . THR C 1 166 ? -5.014  24.969  -8.174  1.00 39.49  ? 152 THR C CB    1 
ATOM   4242 O OG1   . THR C 1 166 ? -4.521  25.396  -9.445  1.00 49.16  ? 152 THR C OG1   1 
ATOM   4243 C CG2   . THR C 1 166 ? -6.412  25.541  -7.965  1.00 42.05  ? 152 THR C CG2   1 
ATOM   4244 N N     . LEU C 1 167 ? -4.799  24.184  -5.169  1.00 38.90  ? 153 LEU C N     1 
ATOM   4245 C CA    . LEU C 1 167 ? -5.487  23.993  -3.896  1.00 34.93  ? 153 LEU C CA    1 
ATOM   4246 C C     . LEU C 1 167 ? -4.590  24.239  -2.703  1.00 35.06  ? 153 LEU C C     1 
ATOM   4247 O O     . LEU C 1 167 ? -3.364  24.201  -2.802  1.00 32.15  ? 153 LEU C O     1 
ATOM   4248 C CB    . LEU C 1 167 ? -6.060  22.582  -3.833  1.00 41.01  ? 153 LEU C CB    1 
ATOM   4249 C CG    . LEU C 1 167 ? -6.929  22.279  -5.062  1.00 42.18  ? 153 LEU C CG    1 
ATOM   4250 C CD1   . LEU C 1 167 ? -7.099  20.789  -5.257  1.00 43.84  ? 153 LEU C CD1   1 
ATOM   4251 C CD2   . LEU C 1 167 ? -8.267  22.966  -4.896  1.00 44.13  ? 153 LEU C CD2   1 
ATOM   4252 N N     . ASP C 1 168 ? -5.222  24.507  -1.571  1.00 32.79  ? 154 ASP C N     1 
ATOM   4253 C CA    . ASP C 1 168 ? -4.540  24.760  -0.319  1.00 32.57  ? 154 ASP C CA    1 
ATOM   4254 C C     . ASP C 1 168 ? -3.656  23.585  0.099   1.00 35.06  ? 154 ASP C C     1 
ATOM   4255 O O     . ASP C 1 168 ? -4.107  22.430  0.078   1.00 32.24  ? 154 ASP C O     1 
ATOM   4256 C CB    . ASP C 1 168 ? -5.584  25.012  0.769   1.00 38.86  ? 154 ASP C CB    1 
ATOM   4257 C CG    . ASP C 1 168 ? -4.961  25.343  2.098   1.00 48.72  ? 154 ASP C CG    1 
ATOM   4258 O OD1   . ASP C 1 168 ? -4.103  24.565  2.557   1.00 62.52  ? 154 ASP C OD1   1 
ATOM   4259 O OD2   . ASP C 1 168 ? -5.324  26.383  2.687   1.00 61.15  ? 154 ASP C OD2   1 
ATOM   4260 N N     . GLU C 1 169 ? -2.421  23.886  0.513   1.00 31.22  ? 155 GLU C N     1 
ATOM   4261 C CA    . GLU C 1 169 ? -1.458  22.867  0.953   1.00 38.00  ? 155 GLU C CA    1 
ATOM   4262 C C     . GLU C 1 169 ? -1.940  22.094  2.179   1.00 31.67  ? 155 GLU C C     1 
ATOM   4263 O O     . GLU C 1 169 ? -1.633  20.918  2.344   1.00 30.12  ? 155 GLU C O     1 
ATOM   4264 C CB    . GLU C 1 169 ? -0.080  23.499  1.287   1.00 43.42  ? 155 GLU C CB    1 
ATOM   4265 C CG    . GLU C 1 169 ? 0.762   23.962  0.088   1.00 54.56  ? 155 GLU C CG    1 
ATOM   4266 C CD    . GLU C 1 169 ? 0.289   25.283  -0.521  1.00 56.06  ? 155 GLU C CD    1 
ATOM   4267 O OE1   . GLU C 1 169 ? -0.179  26.148  0.253   1.00 57.55  ? 155 GLU C OE1   1 
ATOM   4268 O OE2   . GLU C 1 169 ? 0.404   25.467  -1.759  1.00 56.50  ? 155 GLU C OE2   1 
ATOM   4269 N N     . THR C 1 170 ? -2.677  22.756  3.051   1.00 32.54  ? 156 THR C N     1 
ATOM   4270 C CA    . THR C 1 170 ? -3.200  22.099  4.258   1.00 35.03  ? 156 THR C CA    1 
ATOM   4271 C C     . THR C 1 170 ? -4.194  21.000  3.881   1.00 30.94  ? 156 THR C C     1 
ATOM   4272 O O     . THR C 1 170 ? -4.209  19.923  4.472   1.00 31.14  ? 156 THR C O     1 
ATOM   4273 C CB    . THR C 1 170 ? -3.921  23.098  5.181   1.00 36.39  ? 156 THR C CB    1 
ATOM   4274 O OG1   . THR C 1 170 ? -3.015  24.145  5.532   1.00 38.04  ? 156 THR C OG1   1 
ATOM   4275 C CG2   . THR C 1 170 ? -4.395  22.400  6.463   1.00 32.39  ? 156 THR C CG2   1 
ATOM   4276 N N     . LEU C 1 171 ? -5.023  21.291  2.892   1.00 31.26  ? 157 LEU C N     1 
ATOM   4277 C CA    . LEU C 1 171 ? -5.988  20.330  2.403   1.00 32.91  ? 157 LEU C CA    1 
ATOM   4278 C C     . LEU C 1 171 ? -5.221  19.202  1.706   1.00 29.57  ? 157 LEU C C     1 
ATOM   4279 O O     . LEU C 1 171 ? -5.493  18.025  1.939   1.00 28.35  ? 157 LEU C O     1 
ATOM   4280 C CB    . LEU C 1 171 ? -6.946  21.009  1.421   1.00 34.82  ? 157 LEU C CB    1 
ATOM   4281 C CG    . LEU C 1 171 ? -7.940  20.094  0.729   1.00 34.59  ? 157 LEU C CG    1 
ATOM   4282 C CD1   . LEU C 1 171 ? -8.936  19.586  1.753   1.00 37.42  ? 157 LEU C CD1   1 
ATOM   4283 C CD2   . LEU C 1 171 ? -8.628  20.845  -0.388  1.00 32.26  ? 157 LEU C CD2   1 
ATOM   4284 N N     . LEU C 1 172 ? -4.238  19.553  0.881   1.00 27.42  ? 158 LEU C N     1 
ATOM   4285 C CA    . LEU C 1 172 ? -3.482  18.527  0.183   1.00 27.18  ? 158 LEU C CA    1 
ATOM   4286 C C     . LEU C 1 172 ? -2.675  17.630  1.096   1.00 26.39  ? 158 LEU C C     1 
ATOM   4287 O O     . LEU C 1 172 ? -2.652  16.410  0.904   1.00 22.53  ? 158 LEU C O     1 
ATOM   4288 C CB    . LEU C 1 172 ? -2.577  19.131  -0.878  1.00 22.91  ? 158 LEU C CB    1 
ATOM   4289 C CG    . LEU C 1 172 ? -3.361  19.891  -1.951  1.00 31.63  ? 158 LEU C CG    1 
ATOM   4290 C CD1   . LEU C 1 172 ? -2.398  20.217  -3.107  1.00 23.95  ? 158 LEU C CD1   1 
ATOM   4291 C CD2   . LEU C 1 172 ? -4.573  19.065  -2.458  1.00 24.61  ? 158 LEU C CD2   1 
ATOM   4292 N N     . ALA C 1 173 ? -2.044  18.207  2.108   1.00 22.31  ? 159 ALA C N     1 
ATOM   4293 C CA    . ALA C 1 173 ? -1.254  17.399  3.014   1.00 28.09  ? 159 ALA C CA    1 
ATOM   4294 C C     . ALA C 1 173 ? -2.123  16.500  3.900   1.00 28.30  ? 159 ALA C C     1 
ATOM   4295 O O     . ALA C 1 173 ? -1.741  15.344  4.170   1.00 23.46  ? 159 ALA C O     1 
ATOM   4296 C CB    . ALA C 1 173 ? -0.334  18.294  3.888   1.00 23.80  ? 159 ALA C CB    1 
ATOM   4297 N N     . SER C 1 174 ? -3.281  16.998  4.351   1.00 25.43  ? 160 SER C N     1 
ATOM   4298 C CA    . SER C 1 174 ? -4.126  16.165  5.212   1.00 26.66  ? 160 SER C CA    1 
ATOM   4299 C C     . SER C 1 174 ? -4.707  15.034  4.399   1.00 25.47  ? 160 SER C C     1 
ATOM   4300 O O     . SER C 1 174 ? -4.935  13.920  4.902   1.00 27.94  ? 160 SER C O     1 
ATOM   4301 C CB    . SER C 1 174 ? -5.226  16.987  5.914   1.00 24.80  ? 160 SER C CB    1 
ATOM   4302 O OG    . SER C 1 174 ? -5.971  17.778  5.019   1.00 29.18  ? 160 SER C OG    1 
ATOM   4303 N N     . GLN C 1 175 ? -4.881  15.318  3.114   1.00 24.22  ? 161 GLN C N     1 
ATOM   4304 C CA    . GLN C 1 175 ? -5.389  14.359  2.180   1.00 20.80  ? 161 GLN C CA    1 
ATOM   4305 C C     . GLN C 1 175 ? -4.342  13.233  2.005   1.00 27.77  ? 161 GLN C C     1 
ATOM   4306 O O     . GLN C 1 175 ? -4.700  12.058  2.003   1.00 25.49  ? 161 GLN C O     1 
ATOM   4307 C CB    . GLN C 1 175 ? -5.686  15.095  0.888   1.00 23.26  ? 161 GLN C CB    1 
ATOM   4308 C CG    . GLN C 1 175 ? -6.516  14.372  -0.068  1.00 24.01  ? 161 GLN C CG    1 
ATOM   4309 C CD    . GLN C 1 175 ? -8.004  14.251  0.326   1.00 29.09  ? 161 GLN C CD    1 
ATOM   4310 O OE1   . GLN C 1 175 ? -8.470  14.771  1.342   1.00 26.70  ? 161 GLN C OE1   1 
ATOM   4311 N NE2   . GLN C 1 175 ? -8.747  13.540  -0.503  1.00 23.47  ? 161 GLN C NE2   1 
ATOM   4312 N N     . LEU C 1 176 ? -3.056  13.575  1.866   1.00 22.31  ? 162 LEU C N     1 
ATOM   4313 C CA    . LEU C 1 176 ? -2.016  12.543  1.759   1.00 24.42  ? 162 LEU C CA    1 
ATOM   4314 C C     . LEU C 1 176 ? -1.898  11.741  3.054   1.00 20.98  ? 162 LEU C C     1 
ATOM   4315 O O     . LEU C 1 176 ? -1.792  10.506  3.049   1.00 22.13  ? 162 LEU C O     1 
ATOM   4316 C CB    . LEU C 1 176 ? -0.662  13.173  1.476   1.00 20.00  ? 162 LEU C CB    1 
ATOM   4317 C CG    . LEU C 1 176 ? -0.459  13.533  0.014   1.00 30.16  ? 162 LEU C CG    1 
ATOM   4318 C CD1   . LEU C 1 176 ? 0.959   14.088  -0.223  1.00 35.64  ? 162 LEU C CD1   1 
ATOM   4319 C CD2   . LEU C 1 176 ? -0.662  12.280  -0.800  1.00 28.05  ? 162 LEU C CD2   1 
ATOM   4320 N N     . LEU C 1 177 ? -1.914  12.442  4.173   1.00 20.47  ? 163 LEU C N     1 
ATOM   4321 C CA    . LEU C 1 177 ? -1.820  11.783  5.459   1.00 26.36  ? 163 LEU C CA    1 
ATOM   4322 C C     . LEU C 1 177 ? -3.021  10.889  5.714   1.00 28.16  ? 163 LEU C C     1 
ATOM   4323 O O     . LEU C 1 177 ? -2.871  9.825   6.314   1.00 28.36  ? 163 LEU C O     1 
ATOM   4324 C CB    . LEU C 1 177 ? -1.693  12.804  6.587   1.00 28.86  ? 163 LEU C CB    1 
ATOM   4325 C CG    . LEU C 1 177 ? -1.080  12.252  7.878   1.00 36.97  ? 163 LEU C CG    1 
ATOM   4326 C CD1   . LEU C 1 177 ? 0.212   11.515  7.562   1.00 36.05  ? 163 LEU C CD1   1 
ATOM   4327 C CD2   . LEU C 1 177 ? -0.792  13.384  8.830   1.00 35.95  ? 163 LEU C CD2   1 
ATOM   4328 N N     . ALA C 1 178 ? -4.205  11.290  5.260   1.00 26.10  ? 164 ALA C N     1 
ATOM   4329 C CA    . ALA C 1 178 ? -5.387  10.454  5.478   1.00 25.67  ? 164 ALA C CA    1 
ATOM   4330 C C     . ALA C 1 178 ? -5.227  9.113   4.782   1.00 22.21  ? 164 ALA C C     1 
ATOM   4331 O O     . ALA C 1 178 ? -5.628  8.084   5.314   1.00 24.23  ? 164 ALA C O     1 
ATOM   4332 C CB    . ALA C 1 178 ? -6.655  11.166  4.977   1.00 30.22  ? 164 ALA C CB    1 
ATOM   4333 N N     . PHE C 1 179 ? -4.666  9.135   3.577   1.00 20.61  ? 165 PHE C N     1 
ATOM   4334 C CA    . PHE C 1 179 ? -4.417  7.924   2.812   1.00 22.28  ? 165 PHE C CA    1 
ATOM   4335 C C     . PHE C 1 179 ? -3.438  7.019   3.577   1.00 17.58  ? 165 PHE C C     1 
ATOM   4336 O O     . PHE C 1 179 ? -3.650  5.816   3.712   1.00 18.71  ? 165 PHE C O     1 
ATOM   4337 C CB    . PHE C 1 179 ? -3.848  8.290   1.435   1.00 22.23  ? 165 PHE C CB    1 
ATOM   4338 C CG    . PHE C 1 179 ? -3.275  7.128   0.666   1.00 19.21  ? 165 PHE C CG    1 
ATOM   4339 C CD1   . PHE C 1 179 ? -4.108  6.167   0.120   1.00 18.94  ? 165 PHE C CD1   1 
ATOM   4340 C CD2   . PHE C 1 179 ? -1.894  6.954   0.572   1.00 21.34  ? 165 PHE C CD2   1 
ATOM   4341 C CE1   . PHE C 1 179 ? -3.601  5.078   -0.538  1.00 22.19  ? 165 PHE C CE1   1 
ATOM   4342 C CE2   . PHE C 1 179 ? -1.361  5.849   -0.097  1.00 21.90  ? 165 PHE C CE2   1 
ATOM   4343 C CZ    . PHE C 1 179 ? -2.219  4.896   -0.634  1.00 26.03  ? 165 PHE C CZ    1 
ATOM   4344 N N     . CYS C 1 180 ? -2.359  7.595   4.074   1.00 24.77  ? 166 CYS C N     1 
ATOM   4345 C CA    . CYS C 1 180 ? -1.389  6.822   4.840   1.00 25.31  ? 166 CYS C CA    1 
ATOM   4346 C C     . CYS C 1 180 ? -2.027  6.196   6.067   1.00 26.37  ? 166 CYS C C     1 
ATOM   4347 O O     . CYS C 1 180 ? -1.867  4.985   6.332   1.00 17.14  ? 166 CYS C O     1 
ATOM   4348 C CB    . CYS C 1 180 ? -0.219  7.712   5.285   1.00 25.00  ? 166 CYS C CB    1 
ATOM   4349 S SG    . CYS C 1 180 ? 0.807   8.322   3.912   1.00 24.68  ? 166 CYS C SG    1 
ATOM   4350 N N     . GLU C 1 181 ? -2.737  7.018   6.831   1.00 18.33  ? 167 GLU C N     1 
ATOM   4351 C CA    . GLU C 1 181 ? -3.368  6.514   8.044   1.00 24.57  ? 167 GLU C CA    1 
ATOM   4352 C C     . GLU C 1 181 ? -4.419  5.460   7.704   1.00 24.39  ? 167 GLU C C     1 
ATOM   4353 O O     . GLU C 1 181 ? -4.582  4.509   8.457   1.00 21.50  ? 167 GLU C O     1 
ATOM   4354 C CB    . GLU C 1 181 ? -3.985  7.650   8.868   1.00 28.54  ? 167 GLU C CB    1 
ATOM   4355 C CG    . GLU C 1 181 ? -2.961  8.484   9.626   1.00 30.83  ? 167 GLU C CG    1 
ATOM   4356 C CD    . GLU C 1 181 ? -3.599  9.549   10.504  1.00 40.35  ? 167 GLU C CD    1 
ATOM   4357 O OE1   . GLU C 1 181 ? -4.227  9.194   11.530  1.00 37.15  ? 167 GLU C OE1   1 
ATOM   4358 O OE2   . GLU C 1 181 ? -3.478  10.742  10.157  1.00 36.08  ? 167 GLU C OE2   1 
ATOM   4359 N N     . GLY C 1 182 ? -5.076  5.621   6.550   1.00 23.97  ? 168 GLY C N     1 
ATOM   4360 C CA    . GLY C 1 182 ? -6.070  4.669   6.099   1.00 21.06  ? 168 GLY C CA    1 
ATOM   4361 C C     . GLY C 1 182 ? -5.461  3.310   5.773   1.00 20.95  ? 168 GLY C C     1 
ATOM   4362 O O     . GLY C 1 182 ? -6.014  2.278   6.144   1.00 20.92  ? 168 GLY C O     1 
ATOM   4363 N N     . MET C 1 183 ? -4.336  3.298   5.070   1.00 20.10  ? 169 MET C N     1 
ATOM   4364 C CA    . MET C 1 183 ? -3.658  2.041   4.736   1.00 21.41  ? 169 MET C CA    1 
ATOM   4365 C C     . MET C 1 183 ? -3.099  1.368   5.999   1.00 21.11  ? 169 MET C C     1 
ATOM   4366 O O     . MET C 1 183 ? -3.202  0.149   6.155   1.00 22.72  ? 169 MET C O     1 
ATOM   4367 C CB    . MET C 1 183 ? -2.545  2.319   3.737   1.00 20.72  ? 169 MET C CB    1 
ATOM   4368 C CG    . MET C 1 183 ? -3.044  2.974   2.453   1.00 23.31  ? 169 MET C CG    1 
ATOM   4369 S SD    . MET C 1 183 ? -4.094  1.842   1.485   1.00 24.51  ? 169 MET C SD    1 
ATOM   4370 C CE    . MET C 1 183 ? -2.775  0.712   0.859   1.00 23.56  ? 169 MET C CE    1 
ATOM   4371 N N     . LEU C 1 184 ? -2.498  2.145   6.899   1.00 18.10  ? 170 LEU C N     1 
ATOM   4372 C CA    . LEU C 1 184 ? -1.980  1.574   8.144   1.00 21.11  ? 170 LEU C CA    1 
ATOM   4373 C C     . LEU C 1 184 ? -3.128  1.017   9.002   1.00 22.11  ? 170 LEU C C     1 
ATOM   4374 O O     . LEU C 1 184 ? -3.001  -0.056  9.600   1.00 20.92  ? 170 LEU C O     1 
ATOM   4375 C CB    . LEU C 1 184 ? -1.193  2.634   8.928   1.00 18.57  ? 170 LEU C CB    1 
ATOM   4376 C CG    . LEU C 1 184 ? 0.063   3.114   8.188   1.00 24.07  ? 170 LEU C CG    1 
ATOM   4377 C CD1   . LEU C 1 184 ? 0.715   4.273   8.948   1.00 24.40  ? 170 LEU C CD1   1 
ATOM   4378 C CD2   . LEU C 1 184 ? 1.028   1.937   8.012   1.00 26.53  ? 170 LEU C CD2   1 
ATOM   4379 N N     . SER C 1 185 ? -4.255  1.721   9.069   1.00 19.86  ? 171 SER C N     1 
ATOM   4380 C CA    . SER C 1 185 ? -5.385  1.208   9.859   1.00 23.29  ? 171 SER C CA    1 
ATOM   4381 C C     . SER C 1 185 ? -5.834  -0.158  9.360   1.00 20.28  ? 171 SER C C     1 
ATOM   4382 O O     . SER C 1 185 ? -6.171  -1.036  10.147  1.00 19.99  ? 171 SER C O     1 
ATOM   4383 C CB    . SER C 1 185 ? -6.591  2.140   9.771   1.00 28.34  ? 171 SER C CB    1 
ATOM   4384 O OG    . SER C 1 185 ? -6.376  3.286   10.562  1.00 46.76  ? 171 SER C OG    1 
ATOM   4385 N N     . ARG C 1 186 ? -5.866  -0.312  8.038   1.00 20.67  ? 172 ARG C N     1 
ATOM   4386 C CA    . ARG C 1 186 ? -6.288  -1.558  7.414   1.00 22.70  ? 172 ARG C CA    1 
ATOM   4387 C C     . ARG C 1 186 ? -5.297  -2.663  7.666   1.00 22.76  ? 172 ARG C C     1 
ATOM   4388 O O     . ARG C 1 186 ? -5.668  -3.819  7.859   1.00 22.15  ? 172 ARG C O     1 
ATOM   4389 C CB    . ARG C 1 186 ? -6.449  -1.378  5.906   1.00 22.30  ? 172 ARG C CB    1 
ATOM   4390 C CG    . ARG C 1 186 ? -7.875  -1.176  5.507   1.00 42.00  ? 172 ARG C CG    1 
ATOM   4391 C CD    . ARG C 1 186 ? -8.010  -0.892  4.026   1.00 45.02  ? 172 ARG C CD    1 
ATOM   4392 N NE    . ARG C 1 186 ? -8.223  -2.135  3.289   1.00 50.40  ? 172 ARG C NE    1 
ATOM   4393 C CZ    . ARG C 1 186 ? -8.780  -2.174  2.088   1.00 44.80  ? 172 ARG C CZ    1 
ATOM   4394 N NH1   . ARG C 1 186 ? -9.152  -1.031  1.527   1.00 51.45  ? 172 ARG C NH1   1 
ATOM   4395 N NH2   . ARG C 1 186 ? -8.986  -3.333  1.476   1.00 39.00  ? 172 ARG C NH2   1 
ATOM   4396 N N     . PHE C 1 187 ? -4.028  -2.305  7.591   1.00 21.39  ? 173 PHE C N     1 
ATOM   4397 C CA    . PHE C 1 187 ? -2.954  -3.236  7.847   1.00 23.99  ? 173 PHE C CA    1 
ATOM   4398 C C     . PHE C 1 187 ? -3.174  -3.779  9.264   1.00 21.60  ? 173 PHE C C     1 
ATOM   4399 O O     . PHE C 1 187 ? -3.150  -5.000  9.506   1.00 20.40  ? 173 PHE C O     1 
ATOM   4400 C CB    . PHE C 1 187 ? -1.628  -2.479  7.746   1.00 22.05  ? 173 PHE C CB    1 
ATOM   4401 C CG    . PHE C 1 187 ? -0.414  -3.340  7.878   1.00 17.80  ? 173 PHE C CG    1 
ATOM   4402 C CD1   . PHE C 1 187 ? -0.337  -4.566  7.232   1.00 22.63  ? 173 PHE C CD1   1 
ATOM   4403 C CD2   . PHE C 1 187 ? 0.701   -2.865  8.566   1.00 21.40  ? 173 PHE C CD2   1 
ATOM   4404 C CE1   . PHE C 1 187 ? 0.844   -5.321  7.262   1.00 23.98  ? 173 PHE C CE1   1 
ATOM   4405 C CE2   . PHE C 1 187 ? 1.886   -3.601  8.606   1.00 22.62  ? 173 PHE C CE2   1 
ATOM   4406 C CZ    . PHE C 1 187 ? 1.961   -4.838  7.944   1.00 22.94  ? 173 PHE C CZ    1 
ATOM   4407 N N     . VAL C 1 188 ? -3.398  -2.878  10.209  1.00 19.26  ? 174 VAL C N     1 
ATOM   4408 C CA    . VAL C 1 188 ? -3.640  -3.299  11.593  1.00 21.54  ? 174 VAL C CA    1 
ATOM   4409 C C     . VAL C 1 188 ? -4.923  -4.174  11.741  1.00 26.80  ? 174 VAL C C     1 
ATOM   4410 O O     . VAL C 1 188 ? -4.826  -5.312  12.217  1.00 25.53  ? 174 VAL C O     1 
ATOM   4411 C CB    . VAL C 1 188 ? -3.700  -2.047  12.543  1.00 20.49  ? 174 VAL C CB    1 
ATOM   4412 C CG1   . VAL C 1 188 ? -4.258  -2.422  13.913  1.00 19.98  ? 174 VAL C CG1   1 
ATOM   4413 C CG2   . VAL C 1 188 ? -2.300  -1.431  12.689  1.00 19.75  ? 174 VAL C CG2   1 
ATOM   4414 N N     . ARG C 1 189 ? -6.089  -3.663  11.302  1.00 26.87  ? 175 ARG C N     1 
ATOM   4415 C CA    . ARG C 1 189 ? -7.408  -4.358  11.398  1.00 29.35  ? 175 ARG C CA    1 
ATOM   4416 C C     . ARG C 1 189 ? -7.320  -5.799  10.963  1.00 29.74  ? 175 ARG C C     1 
ATOM   4417 O O     . ARG C 1 189 ? -7.918  -6.701  11.556  1.00 25.41  ? 175 ARG C O     1 
ATOM   4418 C CB    . ARG C 1 189 ? -8.475  -3.852  10.396  1.00 27.82  ? 175 ARG C CB    1 
ATOM   4419 C CG    . ARG C 1 189 ? -8.884  -2.445  10.342  1.00 33.24  ? 175 ARG C CG    1 
ATOM   4420 C CD    . ARG C 1 189 ? -10.258 -2.359  9.680   1.00 19.74  ? 175 ARG C CD    1 
ATOM   4421 N NE    . ARG C 1 189 ? -10.256 -2.119  8.235   1.00 17.13  ? 175 ARG C NE    1 
ATOM   4422 C CZ    . ARG C 1 189 ? -10.711 -2.993  7.342   1.00 17.18  ? 175 ARG C CZ    1 
ATOM   4423 N NH1   . ARG C 1 189 ? -11.199 -4.175  7.750   1.00 17.44  ? 175 ARG C NH1   1 
ATOM   4424 N NH2   . ARG C 1 189 ? -10.697 -2.696  6.053   1.00 16.50  ? 175 ARG C NH2   1 
ATOM   4425 N N     . SER C 1 190 ? -6.660  -5.952  9.821   1.00 29.27  ? 176 SER C N     1 
ATOM   4426 C CA    . SER C 1 190 ? -6.542  -7.224  9.136   1.00 29.10  ? 176 SER C CA    1 
ATOM   4427 C C     . SER C 1 190 ? -5.461  -8.120  9.696   1.00 31.88  ? 176 SER C C     1 
ATOM   4428 O O     . SER C 1 190 ? -5.163  -9.176  9.136   1.00 34.25  ? 176 SER C O     1 
ATOM   4429 C CB    . SER C 1 190 ? -6.308  -6.960  7.639   1.00 20.69  ? 176 SER C CB    1 
ATOM   4430 O OG    . SER C 1 190 ? -5.047  -6.367  7.429   1.00 22.22  ? 176 SER C OG    1 
ATOM   4431 N N     . GLU C 1 191 ? -4.886  -7.692  10.809  1.00 31.74  ? 177 GLU C N     1 
ATOM   4432 C CA    . GLU C 1 191 ? -3.846  -8.448  11.456  1.00 35.16  ? 177 GLU C CA    1 
ATOM   4433 C C     . GLU C 1 191 ? -2.695  -8.656  10.498  1.00 32.65  ? 177 GLU C C     1 
ATOM   4434 O O     . GLU C 1 191 ? -2.104  -9.742  10.363  1.00 26.38  ? 177 GLU C O     1 
ATOM   4435 C CB    . GLU C 1 191 ? -4.429  -9.749  11.990  1.00 43.00  ? 177 GLU C CB    1 
ATOM   4436 C CG    . GLU C 1 191 ? -5.129  -9.497  13.308  1.00 57.41  ? 177 GLU C CG    1 
ATOM   4437 C CD    . GLU C 1 191 ? -4.141  -8.934  14.355  1.00 67.69  ? 177 GLU C CD    1 
ATOM   4438 O OE1   . GLU C 1 191 ? -4.551  -8.234  15.307  1.00 66.22  ? 177 GLU C OE1   1 
ATOM   4439 O OE2   . GLU C 1 191 ? -2.928  -9.199  14.230  1.00 72.08  ? 177 GLU C OE2   1 
ATOM   4440 N N     . PHE C 1 192 ? -2.396  -7.543  9.842   1.00 23.17  ? 178 PHE C N     1 
ATOM   4441 C CA    . PHE C 1 192 ? -1.308  -7.436  8.906   1.00 24.69  ? 178 PHE C CA    1 
ATOM   4442 C C     . PHE C 1 192 ? -1.388  -8.159  7.583   1.00 25.16  ? 178 PHE C C     1 
ATOM   4443 O O     . PHE C 1 192 ? -0.355  -8.354  6.939   1.00 23.15  ? 178 PHE C O     1 
ATOM   4444 C CB    . PHE C 1 192 ? -0.004  -7.776  9.625   1.00 21.80  ? 178 PHE C CB    1 
ATOM   4445 C CG    . PHE C 1 192 ? 0.147   -7.034  10.914  1.00 24.72  ? 178 PHE C CG    1 
ATOM   4446 C CD1   . PHE C 1 192 ? 0.204   -7.720  12.132  1.00 22.88  ? 178 PHE C CD1   1 
ATOM   4447 C CD2   . PHE C 1 192 ? 0.105   -5.630  10.930  1.00 23.72  ? 178 PHE C CD2   1 
ATOM   4448 C CE1   . PHE C 1 192 ? 0.207   -7.031  13.339  1.00 22.61  ? 178 PHE C CE1   1 
ATOM   4449 C CE2   . PHE C 1 192 ? 0.107   -4.928  12.143  1.00 26.98  ? 178 PHE C CE2   1 
ATOM   4450 C CZ    . PHE C 1 192 ? 0.157   -5.631  13.353  1.00 26.37  ? 178 PHE C CZ    1 
ATOM   4451 N N     . LYS C 1 193 ? -2.594  -8.523  7.145   1.00 26.25  ? 179 LYS C N     1 
ATOM   4452 C CA    . LYS C 1 193 ? -2.711  -9.193  5.855   1.00 33.60  ? 179 LYS C CA    1 
ATOM   4453 C C     . LYS C 1 193 ? -2.747  -8.205  4.690   1.00 27.63  ? 179 LYS C C     1 
ATOM   4454 O O     . LYS C 1 193 ? -2.244  -8.501  3.605   1.00 25.05  ? 179 LYS C O     1 
ATOM   4455 C CB    . LYS C 1 193 ? -3.924  -10.136 5.838   1.00 34.72  ? 179 LYS C CB    1 
ATOM   4456 C CG    . LYS C 1 193 ? -3.603  -11.456 6.553   1.00 51.20  ? 179 LYS C CG    1 
ATOM   4457 C CD    . LYS C 1 193 ? -4.735  -12.480 6.460   1.00 65.15  ? 179 LYS C CD    1 
ATOM   4458 C CE    . LYS C 1 193 ? -5.058  -12.840 5.000   1.00 71.97  ? 179 LYS C CE    1 
ATOM   4459 N NZ    . LYS C 1 193 ? -3.884  -13.422 4.275   1.00 76.68  ? 179 LYS C NZ    1 
ATOM   4460 N N     . TYR C 1 194 ? -3.315  -7.026  4.916   1.00 31.83  ? 180 TYR C N     1 
ATOM   4461 C CA    . TYR C 1 194 ? -3.373  -6.005  3.867   1.00 34.02  ? 180 TYR C CA    1 
ATOM   4462 C C     . TYR C 1 194 ? -2.127  -5.138  3.989   1.00 30.41  ? 180 TYR C C     1 
ATOM   4463 O O     . TYR C 1 194 ? -2.174  -4.074  4.641   1.00 24.54  ? 180 TYR C O     1 
ATOM   4464 C CB    . TYR C 1 194 ? -4.606  -5.098  4.012   1.00 41.03  ? 180 TYR C CB    1 
ATOM   4465 C CG    . TYR C 1 194 ? -5.950  -5.778  3.907   1.00 53.10  ? 180 TYR C CG    1 
ATOM   4466 C CD1   . TYR C 1 194 ? -6.057  -7.123  3.545   1.00 63.73  ? 180 TYR C CD1   1 
ATOM   4467 C CD2   . TYR C 1 194 ? -7.129  -5.070  4.161   1.00 59.99  ? 180 TYR C CD2   1 
ATOM   4468 C CE1   . TYR C 1 194 ? -7.308  -7.748  3.436   1.00 65.41  ? 180 TYR C CE1   1 
ATOM   4469 C CE2   . TYR C 1 194 ? -8.378  -5.681  4.053   1.00 61.99  ? 180 TYR C CE2   1 
ATOM   4470 C CZ    . TYR C 1 194 ? -8.461  -7.016  3.686   1.00 64.67  ? 180 TYR C CZ    1 
ATOM   4471 O OH    . TYR C 1 194 ? -9.695  -7.600  3.522   1.00 64.09  ? 180 TYR C OH    1 
ATOM   4472 N N     . ARG C 1 195 ? -1.045  -5.576  3.345   1.00 28.41  ? 181 ARG C N     1 
ATOM   4473 C CA    . ARG C 1 195 ? 0.230   -4.855  3.403   1.00 31.22  ? 181 ARG C CA    1 
ATOM   4474 C C     . ARG C 1 195 ? 0.025   -3.478  2.812   1.00 28.59  ? 181 ARG C C     1 
ATOM   4475 O O     . ARG C 1 195 ? -0.594  -3.331  1.763   1.00 26.97  ? 181 ARG C O     1 
ATOM   4476 C CB    . ARG C 1 195 ? 1.316   -5.562  2.605   1.00 37.46  ? 181 ARG C CB    1 
ATOM   4477 C CG    . ARG C 1 195 ? 1.473   -7.056  2.846   1.00 42.20  ? 181 ARG C CG    1 
ATOM   4478 C CD    . ARG C 1 195 ? 2.223   -7.372  4.087   1.00 53.75  ? 181 ARG C CD    1 
ATOM   4479 N NE    . ARG C 1 195 ? 2.892   -8.678  4.012   1.00 62.99  ? 181 ARG C NE    1 
ATOM   4480 C CZ    . ARG C 1 195 ? 3.210   -9.417  5.079   1.00 69.57  ? 181 ARG C CZ    1 
ATOM   4481 N NH1   . ARG C 1 195 ? 2.916   -8.988  6.315   1.00 67.70  ? 181 ARG C NH1   1 
ATOM   4482 N NH2   . ARG C 1 195 ? 3.831   -10.585 4.914   1.00 67.46  ? 181 ARG C NH2   1 
ATOM   4483 N N     . PRO C 1 196 ? 0.553   -2.452  3.475   1.00 28.57  ? 182 PRO C N     1 
ATOM   4484 C CA    . PRO C 1 196 ? 0.452   -1.049  3.060   1.00 29.81  ? 182 PRO C CA    1 
ATOM   4485 C C     . PRO C 1 196 ? 1.049   -0.762  1.686   1.00 29.06  ? 182 PRO C C     1 
ATOM   4486 O O     . PRO C 1 196 ? 0.556   0.100   0.970   1.00 33.79  ? 182 PRO C O     1 
ATOM   4487 C CB    . PRO C 1 196 ? 1.217   -0.297  4.158   1.00 31.90  ? 182 PRO C CB    1 
ATOM   4488 C CG    . PRO C 1 196 ? 1.285   -1.242  5.292   1.00 28.30  ? 182 PRO C CG    1 
ATOM   4489 C CD    . PRO C 1 196 ? 1.347   -2.598  4.705   1.00 27.60  ? 182 PRO C CD    1 
ATOM   4490 N N     . THR C 1 197 ? 2.112   -1.471  1.309   1.00 23.39  ? 183 THR C N     1 
ATOM   4491 C CA    . THR C 1 197 ? 2.747   -1.187  0.024   1.00 26.01  ? 183 THR C CA    1 
ATOM   4492 C C     . THR C 1 197 ? 2.282   -2.042  -1.120  1.00 26.86  ? 183 THR C C     1 
ATOM   4493 O O     . THR C 1 197 ? 2.751   -1.894  -2.235  1.00 28.00  ? 183 THR C O     1 
ATOM   4494 C CB    . THR C 1 197 ? 4.311   -1.265  0.076   1.00 25.85  ? 183 THR C CB    1 
ATOM   4495 O OG1   . THR C 1 197 ? 4.730   -2.625  0.291   1.00 23.62  ? 183 THR C OG1   1 
ATOM   4496 C CG2   . THR C 1 197 ? 4.873   -0.335  1.188   1.00 20.09  ? 183 THR C CG2   1 
ATOM   4497 N N     . ASP C 1 198 ? 1.347   -2.937  -0.874  1.00 35.76  ? 184 ASP C N     1 
ATOM   4498 C CA    . ASP C 1 198 ? 0.870   -3.748  -1.980  1.00 39.34  ? 184 ASP C CA    1 
ATOM   4499 C C     . ASP C 1 198 ? 0.178   -2.827  -3.005  1.00 38.22  ? 184 ASP C C     1 
ATOM   4500 O O     . ASP C 1 198 ? -0.680  -1.998  -2.651  1.00 37.27  ? 184 ASP C O     1 
ATOM   4501 C CB    . ASP C 1 198 ? -0.072  -4.838  -1.455  1.00 41.76  ? 184 ASP C CB    1 
ATOM   4502 C CG    . ASP C 1 198 ? 0.687   -6.074  -0.935  1.00 40.99  ? 184 ASP C CG    1 
ATOM   4503 O OD1   . ASP C 1 198 ? 1.859   -5.952  -0.525  1.00 41.27  ? 184 ASP C OD1   1 
ATOM   4504 O OD2   . ASP C 1 198 ? 0.108   -7.177  -0.932  1.00 48.41  ? 184 ASP C OD2   1 
ATOM   4505 N N     . ASP C 1 199 ? 0.594   -2.938  -4.263  1.00 25.52  ? 185 ASP C N     1 
ATOM   4506 C CA    . ASP C 1 199 ? 0.018   -2.115  -5.317  1.00 26.44  ? 185 ASP C CA    1 
ATOM   4507 C C     . ASP C 1 199 ? 0.294   -0.631  -5.171  1.00 22.99  ? 185 ASP C C     1 
ATOM   4508 O O     . ASP C 1 199 ? -0.465  0.188   -5.691  1.00 23.59  ? 185 ASP C O     1 
ATOM   4509 C CB    . ASP C 1 199 ? -1.485  -2.338  -5.398  1.00 27.56  ? 185 ASP C CB    1 
ATOM   4510 C CG    . ASP C 1 199 ? -1.814  -3.699  -5.933  1.00 35.65  ? 185 ASP C CG    1 
ATOM   4511 O OD1   . ASP C 1 199 ? -1.227  -4.066  -6.986  1.00 44.36  ? 185 ASP C OD1   1 
ATOM   4512 O OD2   . ASP C 1 199 ? -2.636  -4.390  -5.309  1.00 44.36  ? 185 ASP C OD2   1 
ATOM   4513 N N     . PHE C 1 200 ? 1.377   -0.297  -4.468  1.00 21.01  ? 186 PHE C N     1 
ATOM   4514 C CA    . PHE C 1 200 ? 1.745   1.099   -4.284  1.00 20.59  ? 186 PHE C CA    1 
ATOM   4515 C C     . PHE C 1 200 ? 1.872   1.777   -5.638  1.00 22.91  ? 186 PHE C C     1 
ATOM   4516 O O     . PHE C 1 200 ? 1.334   2.878   -5.845  1.00 24.79  ? 186 PHE C O     1 
ATOM   4517 C CB    . PHE C 1 200 ? 3.079   1.232   -3.553  1.00 22.85  ? 186 PHE C CB    1 
ATOM   4518 C CG    . PHE C 1 200 ? 3.541   2.664   -3.400  1.00 26.23  ? 186 PHE C CG    1 
ATOM   4519 C CD1   . PHE C 1 200 ? 2.924   3.506   -2.485  1.00 23.41  ? 186 PHE C CD1   1 
ATOM   4520 C CD2   . PHE C 1 200 ? 4.506   3.194   -4.255  1.00 22.44  ? 186 PHE C CD2   1 
ATOM   4521 C CE1   . PHE C 1 200 ? 3.284   4.858   -2.399  1.00 28.29  ? 186 PHE C CE1   1 
ATOM   4522 C CE2   . PHE C 1 200 ? 4.868   4.549   -4.177  1.00 22.28  ? 186 PHE C CE2   1 
ATOM   4523 C CZ    . PHE C 1 200 ? 4.248   5.375   -3.263  1.00 19.67  ? 186 PHE C CZ    1 
ATOM   4524 N N     . GLU C 1 201 ? 2.595   1.131   -6.553  1.00 22.78  ? 187 GLU C N     1 
ATOM   4525 C CA    . GLU C 1 201 ? 2.784   1.682   -7.890  1.00 24.80  ? 187 GLU C CA    1 
ATOM   4526 C C     . GLU C 1 201 ? 1.489   1.919   -8.643  1.00 23.26  ? 187 GLU C C     1 
ATOM   4527 O O     . GLU C 1 201 ? 1.417   2.829   -9.457  1.00 27.26  ? 187 GLU C O     1 
ATOM   4528 C CB    . GLU C 1 201 ? 3.677   0.772   -8.732  1.00 28.12  ? 187 GLU C CB    1 
ATOM   4529 C CG    . GLU C 1 201 ? 5.110   0.672   -8.232  1.00 37.71  ? 187 GLU C CG    1 
ATOM   4530 C CD    . GLU C 1 201 ? 5.838   1.986   -8.313  1.00 19.97  ? 187 GLU C CD    1 
ATOM   4531 O OE1   . GLU C 1 201 ? 6.205   2.536   -7.253  1.00 20.02  ? 187 GLU C OE1   1 
ATOM   4532 O OE2   . GLU C 1 201 ? 6.067   2.477   -9.457  1.00 20.03  ? 187 GLU C OE2   1 
ATOM   4533 N N     . ALA C 1 202 ? 0.468   1.105   -8.401  1.00 20.88  ? 188 ALA C N     1 
ATOM   4534 C CA    . ALA C 1 202 ? -0.808  1.344   -9.059  1.00 20.34  ? 188 ALA C CA    1 
ATOM   4535 C C     . ALA C 1 202 ? -1.596  2.385   -8.262  1.00 22.16  ? 188 ALA C C     1 
ATOM   4536 O O     . ALA C 1 202 ? -2.371  3.151   -8.826  1.00 24.92  ? 188 ALA C O     1 
ATOM   4537 C CB    . ALA C 1 202 ? -1.613  0.045   -9.164  1.00 23.30  ? 188 ALA C CB    1 
ATOM   4538 N N     . ARG C 1 203 ? -1.389  2.435   -6.939  1.00 24.61  ? 189 ARG C N     1 
ATOM   4539 C CA    . ARG C 1 203 ? -2.107  3.403   -6.107  1.00 23.45  ? 189 ARG C CA    1 
ATOM   4540 C C     . ARG C 1 203 ? -1.552  4.823   -6.131  1.00 22.61  ? 189 ARG C C     1 
ATOM   4541 O O     . ARG C 1 203 ? -2.309  5.802   -6.077  1.00 18.18  ? 189 ARG C O     1 
ATOM   4542 C CB    . ARG C 1 203 ? -2.141  2.967   -4.634  1.00 21.71  ? 189 ARG C CB    1 
ATOM   4543 C CG    . ARG C 1 203 ? -2.913  1.721   -4.362  1.00 19.36  ? 189 ARG C CG    1 
ATOM   4544 C CD    . ARG C 1 203 ? -2.931  1.446   -2.896  1.00 21.57  ? 189 ARG C CD    1 
ATOM   4545 N NE    . ARG C 1 203 ? -3.474  0.117   -2.659  1.00 26.48  ? 189 ARG C NE    1 
ATOM   4546 C CZ    . ARG C 1 203 ? -4.765  -0.198  -2.716  1.00 31.88  ? 189 ARG C CZ    1 
ATOM   4547 N NH1   . ARG C 1 203 ? -5.701  0.732   -2.982  1.00 21.66  ? 189 ARG C NH1   1 
ATOM   4548 N NH2   . ARG C 1 203 ? -5.112  -1.480  -2.598  1.00 23.03  ? 189 ARG C NH2   1 
ATOM   4549 N N     . TRP C 1 204 ? -0.243  4.957   -6.239  1.00 21.13  ? 190 TRP C N     1 
ATOM   4550 C CA    . TRP C 1 204 ? 0.298   6.293   -6.162  1.00 22.21  ? 190 TRP C CA    1 
ATOM   4551 C C     . TRP C 1 204 ? -0.207  7.268   -7.214  1.00 19.97  ? 190 TRP C C     1 
ATOM   4552 O O     . TRP C 1 204 ? -0.620  8.382   -6.877  1.00 24.29  ? 190 TRP C O     1 
ATOM   4553 C CB    . TRP C 1 204 ? 1.845   6.247   -6.109  1.00 22.43  ? 190 TRP C CB    1 
ATOM   4554 C CG    . TRP C 1 204 ? 2.420   7.621   -6.195  1.00 25.19  ? 190 TRP C CG    1 
ATOM   4555 C CD1   . TRP C 1 204 ? 2.928   8.216   -7.318  1.00 26.09  ? 190 TRP C CD1   1 
ATOM   4556 C CD2   . TRP C 1 204 ? 2.324   8.657   -5.204  1.00 20.08  ? 190 TRP C CD2   1 
ATOM   4557 N NE1   . TRP C 1 204 ? 3.132   9.559   -7.098  1.00 24.74  ? 190 TRP C NE1   1 
ATOM   4558 C CE2   . TRP C 1 204 ? 2.761   9.863   -5.822  1.00 24.67  ? 190 TRP C CE2   1 
ATOM   4559 C CE3   . TRP C 1 204 ? 1.883   8.694   -3.876  1.00 24.14  ? 190 TRP C CE3   1 
ATOM   4560 C CZ2   . TRP C 1 204 ? 2.797   11.096  -5.131  1.00 24.37  ? 190 TRP C CZ2   1 
ATOM   4561 C CZ3   . TRP C 1 204 ? 1.918   9.921   -3.184  1.00 23.94  ? 190 TRP C CZ3   1 
ATOM   4562 C CH2   . TRP C 1 204 ? 2.363   11.109  -3.825  1.00 26.38  ? 190 TRP C CH2   1 
ATOM   4563 N N     . PRO C 1 205 ? -0.206  6.873   -8.497  1.00 24.45  ? 191 PRO C N     1 
ATOM   4564 C CA    . PRO C 1 205 ? -0.692  7.810   -9.506  1.00 22.92  ? 191 PRO C CA    1 
ATOM   4565 C C     . PRO C 1 205 ? -2.124  8.280   -9.157  1.00 27.61  ? 191 PRO C C     1 
ATOM   4566 O O     . PRO C 1 205 ? -2.517  9.396   -9.460  1.00 23.28  ? 191 PRO C O     1 
ATOM   4567 C CB    . PRO C 1 205 ? -0.657  6.984   -10.790 1.00 24.05  ? 191 PRO C CB    1 
ATOM   4568 C CG    . PRO C 1 205 ? 0.399   5.954   -10.507 1.00 28.25  ? 191 PRO C CG    1 
ATOM   4569 C CD    . PRO C 1 205 ? 0.157   5.576   -9.101  1.00 21.88  ? 191 PRO C CD    1 
ATOM   4570 N N     . LEU C 1 206 ? -2.902  7.432   -8.487  1.00 22.96  ? 192 LEU C N     1 
ATOM   4571 C CA    . LEU C 1 206 ? -4.257  7.868   -8.159  1.00 26.88  ? 192 LEU C CA    1 
ATOM   4572 C C     . LEU C 1 206 ? -4.154  8.897   -7.048  1.00 24.80  ? 192 LEU C C     1 
ATOM   4573 O O     . LEU C 1 206 ? -4.924  9.873   -7.001  1.00 23.79  ? 192 LEU C O     1 
ATOM   4574 C CB    . LEU C 1 206 ? -5.158  6.712   -7.725  1.00 25.26  ? 192 LEU C CB    1 
ATOM   4575 C CG    . LEU C 1 206 ? -5.004  5.461   -8.582  1.00 23.13  ? 192 LEU C CG    1 
ATOM   4576 C CD1   . LEU C 1 206 ? -6.050  4.517   -8.101  1.00 27.05  ? 192 LEU C CD1   1 
ATOM   4577 C CD2   . LEU C 1 206 ? -5.166  5.729   -10.087 1.00 22.37  ? 192 LEU C CD2   1 
ATOM   4578 N N     . VAL C 1 207 ? -3.228  8.645   -6.123  1.00 25.77  ? 193 VAL C N     1 
ATOM   4579 C CA    . VAL C 1 207 ? -3.056  9.529   -5.009  1.00 27.79  ? 193 VAL C CA    1 
ATOM   4580 C C     . VAL C 1 207 ? -2.541  10.861  -5.546  1.00 29.66  ? 193 VAL C C     1 
ATOM   4581 O O     . VAL C 1 207 ? -3.017  11.932  -5.142  1.00 25.87  ? 193 VAL C O     1 
ATOM   4582 C CB    . VAL C 1 207 ? -2.082  8.931   -3.965  1.00 32.06  ? 193 VAL C CB    1 
ATOM   4583 C CG1   . VAL C 1 207 ? -1.820  9.931   -2.852  1.00 35.81  ? 193 VAL C CG1   1 
ATOM   4584 C CG2   . VAL C 1 207 ? -2.650  7.634   -3.400  1.00 26.30  ? 193 VAL C CG2   1 
ATOM   4585 N N     . ALA C 1 208 ? -1.562  10.799  -6.445  1.00 25.57  ? 194 ALA C N     1 
ATOM   4586 C CA    . ALA C 1 208 ? -0.960  12.022  -7.009  1.00 32.21  ? 194 ALA C CA    1 
ATOM   4587 C C     . ALA C 1 208 ? -1.976  12.862  -7.785  1.00 29.86  ? 194 ALA C C     1 
ATOM   4588 O O     . ALA C 1 208 ? -1.844  14.087  -7.866  1.00 31.48  ? 194 ALA C O     1 
ATOM   4589 C CB    . ALA C 1 208 ? 0.218   11.664  -7.923  1.00 22.66  ? 194 ALA C CB    1 
ATOM   4590 N N     . ALA C 1 209 ? -2.985  12.183  -8.332  1.00 26.85  ? 195 ALA C N     1 
ATOM   4591 C CA    . ALA C 1 209 ? -4.055  12.791  -9.107  1.00 24.89  ? 195 ALA C CA    1 
ATOM   4592 C C     . ALA C 1 209 ? -4.818  13.811  -8.259  1.00 26.23  ? 195 ALA C C     1 
ATOM   4593 O O     . ALA C 1 209 ? -5.470  14.698  -8.790  1.00 27.95  ? 195 ALA C O     1 
ATOM   4594 C CB    . ALA C 1 209 ? -5.000  11.699  -9.623  1.00 30.36  ? 195 ALA C CB    1 
ATOM   4595 N N     . GLN C 1 210 ? -4.703  13.676  -6.941  1.00 24.08  ? 196 GLN C N     1 
ATOM   4596 C CA    . GLN C 1 210 ? -5.319  14.577  -5.985  1.00 31.84  ? 196 GLN C CA    1 
ATOM   4597 C C     . GLN C 1 210 ? -4.539  15.877  -5.781  1.00 34.82  ? 196 GLN C C     1 
ATOM   4598 O O     . GLN C 1 210 ? -5.101  16.892  -5.368  1.00 38.73  ? 196 GLN C O     1 
ATOM   4599 C CB    . GLN C 1 210 ? -5.427  13.898  -4.630  1.00 32.31  ? 196 GLN C CB    1 
ATOM   4600 C CG    . GLN C 1 210 ? -6.433  12.816  -4.584  1.00 34.21  ? 196 GLN C CG    1 
ATOM   4601 C CD    . GLN C 1 210 ? -6.711  12.361  -3.174  1.00 41.05  ? 196 GLN C CD    1 
ATOM   4602 O OE1   . GLN C 1 210 ? -6.198  11.343  -2.721  1.00 49.87  ? 196 GLN C OE1   1 
ATOM   4603 N NE2   . GLN C 1 210 ? -7.533  13.117  -2.470  1.00 43.72  ? 196 GLN C NE2   1 
ATOM   4604 N N     . LEU C 1 211 ? -3.247  15.832  -6.059  1.00 35.66  ? 197 LEU C N     1 
ATOM   4605 C CA    . LEU C 1 211 ? -2.396  16.983  -5.874  1.00 39.34  ? 197 LEU C CA    1 
ATOM   4606 C C     . LEU C 1 211 ? -2.699  18.005  -6.938  1.00 37.85  ? 197 LEU C C     1 
ATOM   4607 O O     . LEU C 1 211 ? -2.101  17.986  -8.026  1.00 36.83  ? 197 LEU C O     1 
ATOM   4608 C CB    . LEU C 1 211 ? -0.927  16.555  -5.931  1.00 39.55  ? 197 LEU C CB    1 
ATOM   4609 C CG    . LEU C 1 211 ? -0.552  15.594  -4.809  1.00 43.66  ? 197 LEU C CG    1 
ATOM   4610 C CD1   . LEU C 1 211 ? 0.951   15.319  -4.860  1.00 43.65  ? 197 LEU C CD1   1 
ATOM   4611 C CD2   . LEU C 1 211 ? -0.976  16.189  -3.453  1.00 39.42  ? 197 LEU C CD2   1 
ATOM   4612 N N     . GLN C 1 212 ? -3.613  18.916  -6.615  1.00 38.82  ? 198 GLN C N     1 
ATOM   4613 C CA    . GLN C 1 212 ? -4.019  19.931  -7.586  1.00 42.70  ? 198 GLN C CA    1 
ATOM   4614 C C     . GLN C 1 212 ? -3.830  21.380  -7.151  1.00 35.06  ? 198 GLN C C     1 
ATOM   4615 O O     . GLN C 1 212 ? -3.896  21.655  -5.940  1.00 38.24  ? 198 GLN C O     1 
ATOM   4616 C CB    . GLN C 1 212 ? -5.488  19.693  -7.967  1.00 43.85  ? 198 GLN C CB    1 
ATOM   4617 C CG    . GLN C 1 212 ? -5.760  18.340  -8.639  1.00 44.02  ? 198 GLN C CG    1 
ATOM   4618 C CD    . GLN C 1 212 ? -7.258  18.032  -8.738  1.00 45.99  ? 198 GLN C CD    1 
ATOM   4619 O OE1   . GLN C 1 212 ? -8.089  18.937  -8.739  1.00 47.80  ? 198 GLN C OE1   1 
ATOM   4620 N NE2   . GLN C 1 212 ? -7.599  16.754  -8.829  1.00 48.85  ? 198 GLN C NE2   1 
ATOM   4621 O OXT   . GLN C 1 212 ? -3.642  22.232  -8.048  1.00 37.31  ? 198 GLN C OXT   1 
ATOM   4622 N N     . ASN D 1 24  ? -35.797 -2.646  26.935  1.00 70.42  ? 10  ASN D N     1 
ATOM   4623 C CA    . ASN D 1 24  ? -35.953 -1.203  27.279  1.00 69.68  ? 10  ASN D CA    1 
ATOM   4624 C C     . ASN D 1 24  ? -34.780 -0.790  28.163  1.00 68.43  ? 10  ASN D C     1 
ATOM   4625 O O     . ASN D 1 24  ? -34.176 0.267   27.959  1.00 64.80  ? 10  ASN D O     1 
ATOM   4626 C CB    . ASN D 1 24  ? -37.277 -0.967  28.015  1.00 72.58  ? 10  ASN D CB    1 
ATOM   4627 C CG    . ASN D 1 24  ? -37.609 0.516   28.171  1.00 75.62  ? 10  ASN D CG    1 
ATOM   4628 O OD1   . ASN D 1 24  ? -36.723 1.341   28.422  1.00 77.22  ? 10  ASN D OD1   1 
ATOM   4629 N ND2   . ASN D 1 24  ? -38.893 0.857   28.042  1.00 73.61  ? 10  ASN D ND2   1 
ATOM   4630 N N     . ARG D 1 25  ? -34.469 -1.611  29.163  1.00 66.74  ? 11  ARG D N     1 
ATOM   4631 C CA    . ARG D 1 25  ? -33.324 -1.316  30.013  1.00 68.00  ? 11  ARG D CA    1 
ATOM   4632 C C     . ARG D 1 25  ? -32.138 -1.659  29.121  1.00 66.15  ? 11  ARG D C     1 
ATOM   4633 O O     . ARG D 1 25  ? -31.083 -1.029  29.179  1.00 61.34  ? 11  ARG D O     1 
ATOM   4634 C CB    . ARG D 1 25  ? -33.303 -2.208  31.248  1.00 67.37  ? 11  ARG D CB    1 
ATOM   4635 C CG    . ARG D 1 25  ? -33.381 -1.429  32.531  1.00 74.58  ? 11  ARG D CG    1 
ATOM   4636 C CD    . ARG D 1 25  ? -34.802 -0.921  32.755  1.00 79.69  ? 11  ARG D CD    1 
ATOM   4637 N NE    . ARG D 1 25  ? -34.864 0.053   33.839  1.00 83.89  ? 11  ARG D NE    1 
ATOM   4638 C CZ    . ARG D 1 25  ? -34.354 -0.145  35.051  1.00 86.44  ? 11  ARG D CZ    1 
ATOM   4639 N NH1   . ARG D 1 25  ? -34.460 0.804   35.970  1.00 88.89  ? 11  ARG D NH1   1 
ATOM   4640 N NH2   . ARG D 1 25  ? -33.738 -1.288  35.343  1.00 84.04  ? 11  ARG D NH2   1 
ATOM   4641 N N     . ARG D 1 26  ? -32.353 -2.674  28.289  1.00 64.01  ? 12  ARG D N     1 
ATOM   4642 C CA    . ARG D 1 26  ? -31.361 -3.137  27.340  1.00 64.32  ? 12  ARG D CA    1 
ATOM   4643 C C     . ARG D 1 26  ? -30.938 -1.941  26.479  1.00 62.48  ? 12  ARG D C     1 
ATOM   4644 O O     . ARG D 1 26  ? -29.759 -1.773  26.177  1.00 61.49  ? 12  ARG D O     1 
ATOM   4645 C CB    . ARG D 1 26  ? -31.972 -4.243  26.477  1.00 61.73  ? 12  ARG D CB    1 
ATOM   4646 C CG    . ARG D 1 26  ? -30.965 -5.149  25.825  1.00 66.09  ? 12  ARG D CG    1 
ATOM   4647 C CD    . ARG D 1 26  ? -31.595 -6.464  25.442  1.00 65.95  ? 12  ARG D CD    1 
ATOM   4648 N NE    . ARG D 1 26  ? -30.621 -7.431  24.940  1.00 68.14  ? 12  ARG D NE    1 
ATOM   4649 C CZ    . ARG D 1 26  ? -29.909 -7.288  23.824  1.00 72.14  ? 12  ARG D CZ    1 
ATOM   4650 N NH1   . ARG D 1 26  ? -29.054 -8.239  23.462  1.00 72.60  ? 12  ARG D NH1   1 
ATOM   4651 N NH2   . ARG D 1 26  ? -30.044 -6.201  23.069  1.00 71.38  ? 12  ARG D NH2   1 
ATOM   4652 N N     . GLU D 1 27  ? -31.901 -1.101  26.109  1.00 61.43  ? 13  GLU D N     1 
ATOM   4653 C CA    . GLU D 1 27  ? -31.610 0.074   25.296  1.00 59.55  ? 13  GLU D CA    1 
ATOM   4654 C C     . GLU D 1 27  ? -30.898 1.137   26.109  1.00 57.39  ? 13  GLU D C     1 
ATOM   4655 O O     . GLU D 1 27  ? -30.021 1.844   25.600  1.00 55.08  ? 13  GLU D O     1 
ATOM   4656 C CB    . GLU D 1 27  ? -32.894 0.669   24.724  1.00 64.09  ? 13  GLU D CB    1 
ATOM   4657 C CG    . GLU D 1 27  ? -33.677 -0.285  23.851  1.00 71.41  ? 13  GLU D CG    1 
ATOM   4658 C CD    . GLU D 1 27  ? -32.840 -0.835  22.713  1.00 77.01  ? 13  GLU D CD    1 
ATOM   4659 O OE1   . GLU D 1 27  ? -32.212 -0.022  21.999  1.00 77.13  ? 13  GLU D OE1   1 
ATOM   4660 O OE2   . GLU D 1 27  ? -32.812 -2.076  22.531  1.00 80.30  ? 13  GLU D OE2   1 
ATOM   4661 N N     . GLU D 1 28  ? -31.284 1.253   27.375  1.00 53.93  ? 14  GLU D N     1 
ATOM   4662 C CA    . GLU D 1 28  ? -30.681 2.239   28.269  1.00 54.44  ? 14  GLU D CA    1 
ATOM   4663 C C     . GLU D 1 28  ? -29.192 1.984   28.440  1.00 49.56  ? 14  GLU D C     1 
ATOM   4664 O O     . GLU D 1 28  ? -28.389 2.907   28.394  1.00 50.16  ? 14  GLU D O     1 
ATOM   4665 C CB    . GLU D 1 28  ? -31.331 2.191   29.656  1.00 58.55  ? 14  GLU D CB    1 
ATOM   4666 C CG    . GLU D 1 28  ? -32.780 2.651   29.719  1.00 70.78  ? 14  GLU D CG    1 
ATOM   4667 C CD    . GLU D 1 28  ? -33.271 2.771   31.157  1.00 78.94  ? 14  GLU D CD    1 
ATOM   4668 O OE1   . GLU D 1 28  ? -33.142 1.777   31.913  1.00 82.26  ? 14  GLU D OE1   1 
ATOM   4669 O OE2   . GLU D 1 28  ? -33.779 3.857   31.532  1.00 80.17  ? 14  GLU D OE2   1 
ATOM   4670 N N     . ILE D 1 29  ? -28.847 0.724   28.676  1.00 43.48  ? 15  ILE D N     1 
ATOM   4671 C CA    . ILE D 1 29  ? -27.473 0.312   28.861  1.00 44.77  ? 15  ILE D CA    1 
ATOM   4672 C C     . ILE D 1 29  ? -26.645 0.623   27.599  1.00 43.47  ? 15  ILE D C     1 
ATOM   4673 O O     . ILE D 1 29  ? -25.616 1.303   27.670  1.00 40.98  ? 15  ILE D O     1 
ATOM   4674 C CB    . ILE D 1 29  ? -27.416 -1.197  29.176  1.00 45.57  ? 15  ILE D CB    1 
ATOM   4675 C CG1   . ILE D 1 29  ? -28.187 -1.477  30.475  1.00 48.85  ? 15  ILE D CG1   1 
ATOM   4676 C CG2   . ILE D 1 29  ? -25.980 -1.648  29.299  1.00 37.86  ? 15  ILE D CG2   1 
ATOM   4677 C CD1   . ILE D 1 29  ? -28.226 -2.948  30.886  1.00 48.17  ? 15  ILE D CD1   1 
ATOM   4678 N N     . LEU D 1 30  ? -27.114 0.143   26.450  1.00 41.49  ? 16  LEU D N     1 
ATOM   4679 C CA    . LEU D 1 30  ? -26.428 0.371   25.173  1.00 41.06  ? 16  LEU D CA    1 
ATOM   4680 C C     . LEU D 1 30  ? -26.244 1.855   24.911  1.00 39.96  ? 16  LEU D C     1 
ATOM   4681 O O     . LEU D 1 30  ? -25.167 2.301   24.510  1.00 39.40  ? 16  LEU D O     1 
ATOM   4682 C CB    . LEU D 1 30  ? -27.212 -0.276  24.032  1.00 35.00  ? 16  LEU D CB    1 
ATOM   4683 C CG    . LEU D 1 30  ? -27.266 -1.802  24.171  1.00 34.75  ? 16  LEU D CG    1 
ATOM   4684 C CD1   . LEU D 1 30  ? -28.165 -2.369  23.088  1.00 37.05  ? 16  LEU D CD1   1 
ATOM   4685 C CD2   . LEU D 1 30  ? -25.861 -2.393  24.074  1.00 34.80  ? 16  LEU D CD2   1 
ATOM   4686 N N     . GLN D 1 31  ? -27.291 2.626   25.163  1.00 42.87  ? 17  GLN D N     1 
ATOM   4687 C CA    . GLN D 1 31  ? -27.220 4.068   24.974  1.00 44.36  ? 17  GLN D CA    1 
ATOM   4688 C C     . GLN D 1 31  ? -26.143 4.689   25.884  1.00 42.53  ? 17  GLN D C     1 
ATOM   4689 O O     . GLN D 1 31  ? -25.391 5.559   25.446  1.00 41.23  ? 17  GLN D O     1 
ATOM   4690 C CB    . GLN D 1 31  ? -28.583 4.706   25.271  1.00 50.84  ? 17  GLN D CB    1 
ATOM   4691 C CG    . GLN D 1 31  ? -28.789 6.014   24.548  1.00 60.37  ? 17  GLN D CG    1 
ATOM   4692 C CD    . GLN D 1 31  ? -28.927 5.805   23.049  1.00 70.13  ? 17  GLN D CD    1 
ATOM   4693 O OE1   . GLN D 1 31  ? -28.700 6.719   22.251  1.00 74.43  ? 17  GLN D OE1   1 
ATOM   4694 N NE2   . GLN D 1 31  ? -29.312 4.594   22.659  1.00 72.95  ? 17  GLN D NE2   1 
ATOM   4695 N N     . SER D 1 32  ? -26.086 4.245   27.147  1.00 42.79  ? 18  SER D N     1 
ATOM   4696 C CA    . SER D 1 32  ? -25.111 4.755   28.118  1.00 41.20  ? 18  SER D CA    1 
ATOM   4697 C C     . SER D 1 32  ? -23.708 4.306   27.727  1.00 34.74  ? 18  SER D C     1 
ATOM   4698 O O     . SER D 1 32  ? -22.744 5.057   27.857  1.00 31.03  ? 18  SER D O     1 
ATOM   4699 C CB    . SER D 1 32  ? -25.428 4.253   29.542  1.00 43.86  ? 18  SER D CB    1 
ATOM   4700 O OG    . SER D 1 32  ? -26.767 4.546   29.929  1.00 50.68  ? 18  SER D OG    1 
ATOM   4701 N N     . LEU D 1 33  ? -23.594 3.069   27.263  1.00 27.76  ? 19  LEU D N     1 
ATOM   4702 C CA    . LEU D 1 33  ? -22.298 2.587   26.841  1.00 34.26  ? 19  LEU D CA    1 
ATOM   4703 C C     . LEU D 1 33  ? -21.785 3.516   25.717  1.00 37.31  ? 19  LEU D C     1 
ATOM   4704 O O     . LEU D 1 33  ? -20.653 4.025   25.774  1.00 38.64  ? 19  LEU D O     1 
ATOM   4705 C CB    . LEU D 1 33  ? -22.420 1.141   26.351  1.00 25.06  ? 19  LEU D CB    1 
ATOM   4706 C CG    . LEU D 1 33  ? -21.168 0.573   25.694  1.00 26.25  ? 19  LEU D CG    1 
ATOM   4707 C CD1   . LEU D 1 33  ? -19.955 0.892   26.573  1.00 27.83  ? 19  LEU D CD1   1 
ATOM   4708 C CD2   . LEU D 1 33  ? -21.336 -0.945  25.458  1.00 25.72  ? 19  LEU D CD2   1 
ATOM   4709 N N     . ALA D 1 34  ? -22.643 3.758   24.725  1.00 34.15  ? 20  ALA D N     1 
ATOM   4710 C CA    . ALA D 1 34  ? -22.308 4.613   23.600  1.00 34.53  ? 20  ALA D CA    1 
ATOM   4711 C C     . ALA D 1 34  ? -21.895 6.006   24.081  1.00 35.98  ? 20  ALA D C     1 
ATOM   4712 O O     . ALA D 1 34  ? -20.900 6.571   23.597  1.00 28.64  ? 20  ALA D O     1 
ATOM   4713 C CB    . ALA D 1 34  ? -23.499 4.716   22.633  1.00 26.90  ? 20  ALA D CB    1 
ATOM   4714 N N     . LEU D 1 35  ? -22.650 6.554   25.033  1.00 36.43  ? 21  LEU D N     1 
ATOM   4715 C CA    . LEU D 1 35  ? -22.337 7.878   25.571  1.00 36.50  ? 21  LEU D CA    1 
ATOM   4716 C C     . LEU D 1 35  ? -20.971 7.855   26.217  1.00 36.55  ? 21  LEU D C     1 
ATOM   4717 O O     . LEU D 1 35  ? -20.192 8.800   26.079  1.00 36.07  ? 21  LEU D O     1 
ATOM   4718 C CB    . LEU D 1 35  ? -23.376 8.305   26.611  1.00 40.68  ? 21  LEU D CB    1 
ATOM   4719 C CG    . LEU D 1 35  ? -24.603 8.967   25.969  1.00 50.83  ? 21  LEU D CG    1 
ATOM   4720 C CD1   . LEU D 1 35  ? -25.753 9.160   26.973  1.00 51.30  ? 21  LEU D CD1   1 
ATOM   4721 C CD2   . LEU D 1 35  ? -24.149 10.300  25.388  1.00 45.20  ? 21  LEU D CD2   1 
ATOM   4722 N N     . MET D 1 36  ? -20.680 6.774   26.931  1.00 36.61  ? 22  MET D N     1 
ATOM   4723 C CA    . MET D 1 36  ? -19.389 6.650   27.593  1.00 36.17  ? 22  MET D CA    1 
ATOM   4724 C C     . MET D 1 36  ? -18.281 6.534   26.540  1.00 36.87  ? 22  MET D C     1 
ATOM   4725 O O     . MET D 1 36  ? -17.227 7.175   26.662  1.00 32.16  ? 22  MET D O     1 
ATOM   4726 C CB    . MET D 1 36  ? -19.394 5.441   28.539  1.00 41.39  ? 22  MET D CB    1 
ATOM   4727 C CG    . MET D 1 36  ? -20.365 5.577   29.740  1.00 41.93  ? 22  MET D CG    1 
ATOM   4728 S SD    . MET D 1 36  ? -20.335 4.135   30.828  1.00 44.60  ? 22  MET D SD    1 
ATOM   4729 C CE    . MET D 1 36  ? -18.786 4.376   31.531  1.00 31.57  ? 22  MET D CE    1 
ATOM   4730 N N     . LEU D 1 37  ? -18.525 5.734   25.501  1.00 35.29  ? 23  LEU D N     1 
ATOM   4731 C CA    . LEU D 1 37  ? -17.549 5.586   24.415  1.00 35.41  ? 23  LEU D CA    1 
ATOM   4732 C C     . LEU D 1 37  ? -17.318 6.976   23.791  1.00 40.02  ? 23  LEU D C     1 
ATOM   4733 O O     . LEU D 1 37  ? -16.214 7.291   23.328  1.00 35.75  ? 23  LEU D O     1 
ATOM   4734 C CB    . LEU D 1 37  ? -18.062 4.624   23.345  1.00 30.69  ? 23  LEU D CB    1 
ATOM   4735 C CG    . LEU D 1 37  ? -17.499 3.206   23.141  1.00 36.89  ? 23  LEU D CG    1 
ATOM   4736 C CD1   . LEU D 1 37  ? -16.431 2.883   24.150  1.00 31.78  ? 23  LEU D CD1   1 
ATOM   4737 C CD2   . LEU D 1 37  ? -18.643 2.198   23.189  1.00 31.57  ? 23  LEU D CD2   1 
ATOM   4738 N N     . GLU D 1 38  ? -18.353 7.814   23.795  1.00 37.53  ? 24  GLU D N     1 
ATOM   4739 C CA    . GLU D 1 38  ? -18.217 9.156   23.243  1.00 41.29  ? 24  GLU D CA    1 
ATOM   4740 C C     . GLU D 1 38  ? -17.411 10.140  24.117  1.00 40.18  ? 24  GLU D C     1 
ATOM   4741 O O     . GLU D 1 38  ? -16.693 10.986  23.586  1.00 39.45  ? 24  GLU D O     1 
ATOM   4742 C CB    . GLU D 1 38  ? -19.602 9.750   22.950  1.00 41.94  ? 24  GLU D CB    1 
ATOM   4743 C CG    . GLU D 1 38  ? -19.536 11.098  22.243  1.00 44.15  ? 24  GLU D CG    1 
ATOM   4744 C CD    . GLU D 1 38  ? -20.907 11.686  21.917  1.00 50.67  ? 24  GLU D CD    1 
ATOM   4745 O OE1   . GLU D 1 38  ? -21.907 10.933  21.894  1.00 47.92  ? 24  GLU D OE1   1 
ATOM   4746 O OE2   . GLU D 1 38  ? -20.976 12.908  21.661  1.00 49.99  ? 24  GLU D OE2   1 
ATOM   4747 N N     . SER D 1 39  ? -17.527 10.036  25.444  1.00 42.26  ? 25  SER D N     1 
ATOM   4748 C CA    . SER D 1 39  ? -16.816 10.941  26.357  1.00 41.96  ? 25  SER D CA    1 
ATOM   4749 C C     . SER D 1 39  ? -15.303 10.762  26.335  1.00 45.25  ? 25  SER D C     1 
ATOM   4750 O O     . SER D 1 39  ? -14.766 9.846   25.711  1.00 47.49  ? 25  SER D O     1 
ATOM   4751 C CB    . SER D 1 39  ? -17.276 10.730  27.800  1.00 39.94  ? 25  SER D CB    1 
ATOM   4752 O OG    . SER D 1 39  ? -16.589 9.625   28.379  1.00 43.50  ? 25  SER D OG    1 
ATOM   4753 N N     . SER D 1 40  ? -14.625 11.642  27.060  1.00 46.95  ? 26  SER D N     1 
ATOM   4754 C CA    . SER D 1 40  ? -13.178 11.622  27.175  1.00 48.22  ? 26  SER D CA    1 
ATOM   4755 C C     . SER D 1 40  ? -12.709 10.339  27.867  1.00 50.17  ? 26  SER D C     1 
ATOM   4756 O O     . SER D 1 40  ? -11.510 10.066  27.943  1.00 52.48  ? 26  SER D O     1 
ATOM   4757 C CB    . SER D 1 40  ? -12.734 12.831  27.977  1.00 50.68  ? 26  SER D CB    1 
ATOM   4758 O OG    . SER D 1 40  ? -13.442 12.868  29.210  1.00 59.30  ? 26  SER D OG    1 
ATOM   4759 N N     . ASP D 1 41  ? -13.666 9.564   28.370  1.00 52.20  ? 27  ASP D N     1 
ATOM   4760 C CA    . ASP D 1 41  ? -13.388 8.302   29.047  1.00 52.69  ? 27  ASP D CA    1 
ATOM   4761 C C     . ASP D 1 41  ? -13.445 7.134   28.060  1.00 52.55  ? 27  ASP D C     1 
ATOM   4762 O O     . ASP D 1 41  ? -13.069 6.005   28.390  1.00 50.95  ? 27  ASP D O     1 
ATOM   4763 C CB    . ASP D 1 41  ? -14.411 8.078   30.164  1.00 61.39  ? 27  ASP D CB    1 
ATOM   4764 C CG    . ASP D 1 41  ? -14.177 8.983   31.373  1.00 66.81  ? 27  ASP D CG    1 
ATOM   4765 O OD1   . ASP D 1 41  ? -13.963 10.201  31.192  1.00 71.75  ? 27  ASP D OD1   1 
ATOM   4766 O OD2   . ASP D 1 41  ? -14.220 8.473   32.512  1.00 72.73  ? 27  ASP D OD2   1 
ATOM   4767 N N     . GLY D 1 42  ? -13.932 7.405   26.849  1.00 51.33  ? 28  GLY D N     1 
ATOM   4768 C CA    . GLY D 1 42  ? -14.008 6.365   25.835  1.00 47.14  ? 28  GLY D CA    1 
ATOM   4769 C C     . GLY D 1 42  ? -12.606 5.937   25.437  1.00 46.49  ? 28  GLY D C     1 
ATOM   4770 O O     . GLY D 1 42  ? -12.411 4.881   24.835  1.00 45.01  ? 28  GLY D O     1 
ATOM   4771 N N     . SER D 1 43  ? -11.641 6.783   25.791  1.00 44.93  ? 29  SER D N     1 
ATOM   4772 C CA    . SER D 1 43  ? -10.215 6.602   25.536  1.00 45.22  ? 29  SER D CA    1 
ATOM   4773 C C     . SER D 1 43  ? -9.607  5.443   26.347  1.00 45.40  ? 29  SER D C     1 
ATOM   4774 O O     . SER D 1 43  ? -8.432  5.103   26.208  1.00 45.79  ? 29  SER D O     1 
ATOM   4775 C CB    . SER D 1 43  ? -9.499  7.909   25.887  1.00 51.29  ? 29  SER D CB    1 
ATOM   4776 O OG    . SER D 1 43  ? -8.101  7.724   25.975  1.00 63.72  ? 29  SER D OG    1 
ATOM   4777 N N     . GLN D 1 44  ? -10.399 4.844   27.220  1.00 46.18  ? 30  GLN D N     1 
ATOM   4778 C CA    . GLN D 1 44  ? -9.900  3.725   27.997  1.00 44.89  ? 30  GLN D CA    1 
ATOM   4779 C C     . GLN D 1 44  ? -11.012 2.758   28.311  1.00 43.23  ? 30  GLN D C     1 
ATOM   4780 O O     . GLN D 1 44  ? -12.181 3.015   28.032  1.00 43.34  ? 30  GLN D O     1 
ATOM   4781 C CB    . GLN D 1 44  ? -9.237  4.189   29.288  1.00 51.41  ? 30  GLN D CB    1 
ATOM   4782 C CG    . GLN D 1 44  ? -10.093 5.055   30.171  1.00 56.09  ? 30  GLN D CG    1 
ATOM   4783 C CD    . GLN D 1 44  ? -9.277  5.689   31.284  1.00 68.28  ? 30  GLN D CD    1 
ATOM   4784 O OE1   . GLN D 1 44  ? -8.094  6.004   31.103  1.00 66.57  ? 30  GLN D OE1   1 
ATOM   4785 N NE2   . GLN D 1 44  ? -9.907  5.895   32.440  1.00 71.98  ? 30  GLN D NE2   1 
ATOM   4786 N N     . ARG D 1 45  ? -10.634 1.635   28.889  1.00 38.12  ? 31  ARG D N     1 
ATOM   4787 C CA    . ARG D 1 45  ? -11.582 0.605   29.200  1.00 37.55  ? 31  ARG D CA    1 
ATOM   4788 C C     . ARG D 1 45  ? -12.833 1.095   29.917  1.00 41.99  ? 31  ARG D C     1 
ATOM   4789 O O     . ARG D 1 45  ? -12.761 1.938   30.815  1.00 41.07  ? 31  ARG D O     1 
ATOM   4790 C CB    . ARG D 1 45  ? -10.871 -0.457  30.010  1.00 33.46  ? 31  ARG D CB    1 
ATOM   4791 C CG    . ARG D 1 45  ? -11.734 -1.160  30.997  1.00 36.30  ? 31  ARG D CG    1 
ATOM   4792 C CD    . ARG D 1 45  ? -10.986 -2.369  31.483  1.00 43.05  ? 31  ARG D CD    1 
ATOM   4793 N NE    . ARG D 1 45  ? -11.561 -3.557  30.871  1.00 53.07  ? 31  ARG D NE    1 
ATOM   4794 C CZ    . ARG D 1 45  ? -10.904 -4.422  30.109  1.00 46.93  ? 31  ARG D CZ    1 
ATOM   4795 N NH1   . ARG D 1 45  ? -9.613  -4.258  29.848  1.00 41.94  ? 31  ARG D NH1   1 
ATOM   4796 N NH2   . ARG D 1 45  ? -11.560 -5.450  29.594  1.00 46.92  ? 31  ARG D NH2   1 
ATOM   4797 N N     . ILE D 1 46  ? -13.989 0.598   29.480  1.00 43.61  ? 32  ILE D N     1 
ATOM   4798 C CA    . ILE D 1 46  ? -15.252 0.945   30.125  1.00 41.45  ? 32  ILE D CA    1 
ATOM   4799 C C     . ILE D 1 46  ? -15.606 -0.251  30.998  1.00 38.92  ? 32  ILE D C     1 
ATOM   4800 O O     . ILE D 1 46  ? -16.074 -1.283  30.519  1.00 42.78  ? 32  ILE D O     1 
ATOM   4801 C CB    . ILE D 1 46  ? -16.396 1.222   29.104  1.00 42.72  ? 32  ILE D CB    1 
ATOM   4802 C CG1   . ILE D 1 46  ? -16.206 2.599   28.455  1.00 46.15  ? 32  ILE D CG1   1 
ATOM   4803 C CG2   . ILE D 1 46  ? -17.744 1.253   29.816  1.00 38.56  ? 32  ILE D CG2   1 
ATOM   4804 C CD1   . ILE D 1 46  ? -15.013 2.715   27.587  1.00 51.97  ? 32  ILE D CD1   1 
ATOM   4805 N N     . THR D 1 47  ? -15.356 -0.106  32.288  1.00 37.07  ? 33  THR D N     1 
ATOM   4806 C CA    . THR D 1 47  ? -15.613 -1.162  33.259  1.00 34.55  ? 33  THR D CA    1 
ATOM   4807 C C     . THR D 1 47  ? -17.102 -1.365  33.472  1.00 34.61  ? 33  THR D C     1 
ATOM   4808 O O     . THR D 1 47  ? -17.894 -0.424  33.329  1.00 31.14  ? 33  THR D O     1 
ATOM   4809 C CB    . THR D 1 47  ? -15.024 -0.799  34.618  1.00 36.77  ? 33  THR D CB    1 
ATOM   4810 O OG1   . THR D 1 47  ? -15.765 0.310   35.146  1.00 39.34  ? 33  THR D OG1   1 
ATOM   4811 C CG2   . THR D 1 47  ? -13.530 -0.421  34.490  1.00 35.38  ? 33  THR D CG2   1 
ATOM   4812 N N     . THR D 1 48  ? -17.488 -2.590  33.818  1.00 31.08  ? 34  THR D N     1 
ATOM   4813 C CA    . THR D 1 48  ? -18.899 -2.876  34.074  1.00 36.74  ? 34  THR D CA    1 
ATOM   4814 C C     . THR D 1 48  ? -19.388 -2.119  35.322  1.00 38.05  ? 34  THR D C     1 
ATOM   4815 O O     . THR D 1 48  ? -20.561 -1.754  35.412  1.00 42.38  ? 34  THR D O     1 
ATOM   4816 C CB    . THR D 1 48  ? -19.142 -4.406  34.258  1.00 38.96  ? 34  THR D CB    1 
ATOM   4817 O OG1   . THR D 1 48  ? -18.349 -4.898  35.343  1.00 37.66  ? 34  THR D OG1   1 
ATOM   4818 C CG2   . THR D 1 48  ? -18.727 -5.164  32.981  1.00 39.27  ? 34  THR D CG2   1 
ATOM   4819 N N     . ALA D 1 49  ? -18.498 -1.853  36.275  1.00 37.79  ? 35  ALA D N     1 
ATOM   4820 C CA    . ALA D 1 49  ? -18.926 -1.133  37.479  1.00 41.38  ? 35  ALA D CA    1 
ATOM   4821 C C     . ALA D 1 49  ? -19.388 0.253   37.078  1.00 43.64  ? 35  ALA D C     1 
ATOM   4822 O O     . ALA D 1 49  ? -20.498 0.678   37.383  1.00 48.64  ? 35  ALA D O     1 
ATOM   4823 C CB    . ALA D 1 49  ? -17.775 -1.023  38.471  1.00 38.54  ? 35  ALA D CB    1 
ATOM   4824 N N     . LYS D 1 50  ? -18.506 0.945   36.375  1.00 45.97  ? 36  LYS D N     1 
ATOM   4825 C CA    . LYS D 1 50  ? -18.756 2.292   35.892  1.00 50.51  ? 36  LYS D CA    1 
ATOM   4826 C C     . LYS D 1 50  ? -19.954 2.366   34.934  1.00 50.53  ? 36  LYS D C     1 
ATOM   4827 O O     . LYS D 1 50  ? -20.687 3.359   34.922  1.00 54.84  ? 36  LYS D O     1 
ATOM   4828 C CB    . LYS D 1 50  ? -17.489 2.771   35.211  1.00 54.95  ? 36  LYS D CB    1 
ATOM   4829 C CG    . LYS D 1 50  ? -17.400 4.235   34.917  1.00 63.00  ? 36  LYS D CG    1 
ATOM   4830 C CD    . LYS D 1 50  ? -15.930 4.651   34.969  1.00 67.51  ? 36  LYS D CD    1 
ATOM   4831 C CE    . LYS D 1 50  ? -15.016 3.640   34.261  1.00 69.92  ? 36  LYS D CE    1 
ATOM   4832 N NZ    . LYS D 1 50  ? -13.564 3.927   34.482  1.00 68.88  ? 36  LYS D NZ    1 
ATOM   4833 N N     . LEU D 1 51  ? -20.159 1.319   34.136  1.00 47.98  ? 37  LEU D N     1 
ATOM   4834 C CA    . LEU D 1 51  ? -21.275 1.298   33.195  1.00 47.61  ? 37  LEU D CA    1 
ATOM   4835 C C     . LEU D 1 51  ? -22.572 1.165   33.995  1.00 53.14  ? 37  LEU D C     1 
ATOM   4836 O O     . LEU D 1 51  ? -23.553 1.873   33.731  1.00 53.29  ? 37  LEU D O     1 
ATOM   4837 C CB    . LEU D 1 51  ? -21.138 0.132   32.199  1.00 37.27  ? 37  LEU D CB    1 
ATOM   4838 C CG    . LEU D 1 51  ? -22.288 -0.031  31.185  1.00 43.37  ? 37  LEU D CG    1 
ATOM   4839 C CD1   . LEU D 1 51  ? -22.365 1.225   30.297  1.00 38.33  ? 37  LEU D CD1   1 
ATOM   4840 C CD2   . LEU D 1 51  ? -22.090 -1.289  30.328  1.00 34.24  ? 37  LEU D CD2   1 
ATOM   4841 N N     . ALA D 1 52  ? -22.571 0.254   34.966  1.00 52.07  ? 38  ALA D N     1 
ATOM   4842 C CA    . ALA D 1 52  ? -23.733 0.059   35.824  1.00 56.03  ? 38  ALA D CA    1 
ATOM   4843 C C     . ALA D 1 52  ? -24.057 1.390   36.526  1.00 56.95  ? 38  ALA D C     1 
ATOM   4844 O O     . ALA D 1 52  ? -25.226 1.774   36.651  1.00 56.43  ? 38  ALA D O     1 
ATOM   4845 C CB    . ALA D 1 52  ? -23.447 -1.020  36.852  1.00 51.65  ? 38  ALA D CB    1 
ATOM   4846 N N     . ALA D 1 53  ? -23.014 2.083   36.980  1.00 55.76  ? 39  ALA D N     1 
ATOM   4847 C CA    . ALA D 1 53  ? -23.177 3.371   37.643  1.00 56.11  ? 39  ALA D CA    1 
ATOM   4848 C C     . ALA D 1 53  ? -23.913 4.327   36.714  1.00 57.42  ? 39  ALA D C     1 
ATOM   4849 O O     . ALA D 1 53  ? -24.953 4.876   37.076  1.00 61.46  ? 39  ALA D O     1 
ATOM   4850 C CB    . ALA D 1 53  ? -21.818 3.948   38.008  1.00 54.95  ? 39  ALA D CB    1 
ATOM   4851 N N     . SER D 1 54  ? -23.371 4.519   35.515  1.00 60.14  ? 40  SER D N     1 
ATOM   4852 C CA    . SER D 1 54  ? -23.979 5.416   34.540  1.00 62.73  ? 40  SER D CA    1 
ATOM   4853 C C     . SER D 1 54  ? -25.474 5.155   34.439  1.00 65.07  ? 40  SER D C     1 
ATOM   4854 O O     . SER D 1 54  ? -26.280 6.061   34.632  1.00 64.93  ? 40  SER D O     1 
ATOM   4855 C CB    . SER D 1 54  ? -23.325 5.242   33.156  1.00 65.32  ? 40  SER D CB    1 
ATOM   4856 O OG    . SER D 1 54  ? -22.421 6.305   32.856  1.00 62.56  ? 40  SER D OG    1 
ATOM   4857 N N     . VAL D 1 55  ? -25.826 3.908   34.140  1.00 68.07  ? 41  VAL D N     1 
ATOM   4858 C CA    . VAL D 1 55  ? -27.216 3.475   33.999  1.00 70.96  ? 41  VAL D CA    1 
ATOM   4859 C C     . VAL D 1 55  ? -28.051 3.794   35.235  1.00 71.98  ? 41  VAL D C     1 
ATOM   4860 O O     . VAL D 1 55  ? -28.885 4.700   35.232  1.00 74.49  ? 41  VAL D O     1 
ATOM   4861 C CB    . VAL D 1 55  ? -27.296 1.950   33.762  1.00 72.36  ? 41  VAL D CB    1 
ATOM   4862 C CG1   . VAL D 1 55  ? -28.739 1.529   33.584  1.00 71.67  ? 41  VAL D CG1   1 
ATOM   4863 C CG2   . VAL D 1 55  ? -26.461 1.562   32.545  1.00 74.13  ? 41  VAL D CG2   1 
ATOM   4864 N N     . GLY D 1 56  ? -27.824 3.031   36.292  1.00 70.21  ? 42  GLY D N     1 
ATOM   4865 C CA    . GLY D 1 56  ? -28.559 3.245   37.513  1.00 66.34  ? 42  GLY D CA    1 
ATOM   4866 C C     . GLY D 1 56  ? -28.587 1.940   38.258  1.00 66.80  ? 42  GLY D C     1 
ATOM   4867 O O     . GLY D 1 56  ? -28.517 1.923   39.479  1.00 67.24  ? 42  GLY D O     1 
ATOM   4868 N N     . VAL D 1 57  ? -28.665 0.837   37.522  1.00 66.22  ? 43  VAL D N     1 
ATOM   4869 C CA    . VAL D 1 57  ? -28.707 -0.469  38.163  1.00 65.76  ? 43  VAL D CA    1 
ATOM   4870 C C     . VAL D 1 57  ? -27.362 -0.882  38.744  1.00 64.52  ? 43  VAL D C     1 
ATOM   4871 O O     . VAL D 1 57  ? -26.364 -0.165  38.650  1.00 63.88  ? 43  VAL D O     1 
ATOM   4872 C CB    . VAL D 1 57  ? -29.150 -1.564  37.185  1.00 64.21  ? 43  VAL D CB    1 
ATOM   4873 C CG1   . VAL D 1 57  ? -30.312 -1.055  36.343  1.00 66.90  ? 43  VAL D CG1   1 
ATOM   4874 C CG2   . VAL D 1 57  ? -27.975 -2.002  36.329  1.00 62.24  ? 43  VAL D CG2   1 
ATOM   4875 N N     . SER D 1 58  ? -27.357 -2.055  39.356  1.00 65.69  ? 44  SER D N     1 
ATOM   4876 C CA    . SER D 1 58  ? -26.150 -2.597  39.942  1.00 65.07  ? 44  SER D CA    1 
ATOM   4877 C C     . SER D 1 58  ? -25.442 -3.354  38.833  1.00 63.72  ? 44  SER D C     1 
ATOM   4878 O O     . SER D 1 58  ? -25.966 -3.502  37.728  1.00 63.61  ? 44  SER D O     1 
ATOM   4879 C CB    . SER D 1 58  ? -26.501 -3.570  41.059  1.00 64.48  ? 44  SER D CB    1 
ATOM   4880 O OG    . SER D 1 58  ? -27.259 -4.650  40.533  1.00 68.12  ? 44  SER D OG    1 
ATOM   4881 N N     . GLU D 1 59  ? -24.258 -3.851  39.149  1.00 61.53  ? 45  GLU D N     1 
ATOM   4882 C CA    . GLU D 1 59  ? -23.451 -4.597  38.203  1.00 59.90  ? 45  GLU D CA    1 
ATOM   4883 C C     . GLU D 1 59  ? -24.133 -5.929  37.873  1.00 60.46  ? 45  GLU D C     1 
ATOM   4884 O O     . GLU D 1 59  ? -24.157 -6.356  36.716  1.00 58.35  ? 45  GLU D O     1 
ATOM   4885 C CB    . GLU D 1 59  ? -22.058 -4.811  38.814  1.00 57.95  ? 45  GLU D CB    1 
ATOM   4886 C CG    . GLU D 1 59  ? -20.951 -5.255  37.867  1.00 58.21  ? 45  GLU D CG    1 
ATOM   4887 C CD    . GLU D 1 59  ? -19.560 -4.820  38.352  1.00 62.49  ? 45  GLU D CD    1 
ATOM   4888 O OE1   . GLU D 1 59  ? -18.548 -5.458  37.977  1.00 61.85  ? 45  GLU D OE1   1 
ATOM   4889 O OE2   . GLU D 1 59  ? -19.474 -3.823  39.101  1.00 57.89  ? 45  GLU D OE2   1 
ATOM   4890 N N     . ALA D 1 60  ? -24.703 -6.581  38.884  1.00 62.21  ? 46  ALA D N     1 
ATOM   4891 C CA    . ALA D 1 60  ? -25.376 -7.860  38.669  1.00 59.56  ? 46  ALA D CA    1 
ATOM   4892 C C     . ALA D 1 60  ? -26.642 -7.674  37.832  1.00 58.11  ? 46  ALA D C     1 
ATOM   4893 O O     . ALA D 1 60  ? -27.002 -8.561  37.048  1.00 58.59  ? 46  ALA D O     1 
ATOM   4894 C CB    . ALA D 1 60  ? -25.708 -8.516  40.004  1.00 58.61  ? 46  ALA D CB    1 
ATOM   4895 N N     . ALA D 1 61  ? -27.309 -6.528  37.983  1.00 53.98  ? 47  ALA D N     1 
ATOM   4896 C CA    . ALA D 1 61  ? -28.518 -6.261  37.208  1.00 54.55  ? 47  ALA D CA    1 
ATOM   4897 C C     . ALA D 1 61  ? -28.171 -6.304  35.726  1.00 58.51  ? 47  ALA D C     1 
ATOM   4898 O O     . ALA D 1 61  ? -28.857 -6.952  34.910  1.00 56.76  ? 47  ALA D O     1 
ATOM   4899 C CB    . ALA D 1 61  ? -29.069 -4.898  37.554  1.00 56.42  ? 47  ALA D CB    1 
ATOM   4900 N N     . LEU D 1 62  ? -27.091 -5.594  35.401  1.00 57.51  ? 48  LEU D N     1 
ATOM   4901 C CA    . LEU D 1 62  ? -26.573 -5.484  34.044  1.00 50.97  ? 48  LEU D CA    1 
ATOM   4902 C C     . LEU D 1 62  ? -26.520 -6.843  33.409  1.00 48.51  ? 48  LEU D C     1 
ATOM   4903 O O     . LEU D 1 62  ? -26.891 -7.010  32.244  1.00 45.43  ? 48  LEU D O     1 
ATOM   4904 C CB    . LEU D 1 62  ? -25.162 -4.894  34.075  1.00 50.87  ? 48  LEU D CB    1 
ATOM   4905 C CG    . LEU D 1 62  ? -24.902 -3.543  33.422  1.00 48.60  ? 48  LEU D CG    1 
ATOM   4906 C CD1   . LEU D 1 62  ? -26.080 -2.615  33.616  1.00 51.98  ? 48  LEU D CD1   1 
ATOM   4907 C CD2   . LEU D 1 62  ? -23.654 -2.948  34.035  1.00 50.87  ? 48  LEU D CD2   1 
ATOM   4908 N N     . TYR D 1 63  ? -26.059 -7.821  34.180  1.00 47.50  ? 49  TYR D N     1 
ATOM   4909 C CA    . TYR D 1 63  ? -25.942 -9.164  33.652  1.00 54.17  ? 49  TYR D CA    1 
ATOM   4910 C C     . TYR D 1 63  ? -27.237 -9.940  33.533  1.00 58.30  ? 49  TYR D C     1 
ATOM   4911 O O     . TYR D 1 63  ? -27.213 -11.143 33.298  1.00 62.84  ? 49  TYR D O     1 
ATOM   4912 C CB    . TYR D 1 63  ? -24.896 -9.955  34.435  1.00 50.56  ? 49  TYR D CB    1 
ATOM   4913 C CG    . TYR D 1 63  ? -23.486 -9.589  34.025  1.00 51.54  ? 49  TYR D CG    1 
ATOM   4914 C CD1   . TYR D 1 63  ? -22.844 -10.245 32.966  1.00 50.91  ? 49  TYR D CD1   1 
ATOM   4915 C CD2   . TYR D 1 63  ? -22.815 -8.538  34.648  1.00 50.30  ? 49  TYR D CD2   1 
ATOM   4916 C CE1   . TYR D 1 63  ? -21.560 -9.853  32.541  1.00 48.37  ? 49  TYR D CE1   1 
ATOM   4917 C CE2   . TYR D 1 63  ? -21.549 -8.138  34.230  1.00 49.11  ? 49  TYR D CE2   1 
ATOM   4918 C CZ    . TYR D 1 63  ? -20.928 -8.793  33.181  1.00 48.47  ? 49  TYR D CZ    1 
ATOM   4919 O OH    . TYR D 1 63  ? -19.693 -8.356  32.768  1.00 50.16  ? 49  TYR D OH    1 
ATOM   4920 N N     . ARG D 1 64  ? -28.371 -9.262  33.676  1.00 62.04  ? 50  ARG D N     1 
ATOM   4921 C CA    . ARG D 1 64  ? -29.644 -9.946  33.500  1.00 69.54  ? 50  ARG D CA    1 
ATOM   4922 C C     . ARG D 1 64  ? -30.196 -9.551  32.130  1.00 71.08  ? 50  ARG D C     1 
ATOM   4923 O O     . ARG D 1 64  ? -31.205 -10.094 31.668  1.00 72.17  ? 50  ARG D O     1 
ATOM   4924 C CB    . ARG D 1 64  ? -30.640 -9.570  34.595  1.00 73.75  ? 50  ARG D CB    1 
ATOM   4925 C CG    . ARG D 1 64  ? -31.396 -8.282  34.359  1.00 76.92  ? 50  ARG D CG    1 
ATOM   4926 C CD    . ARG D 1 64  ? -32.316 -8.021  35.537  1.00 78.82  ? 50  ARG D CD    1 
ATOM   4927 N NE    . ARG D 1 64  ? -31.576 -8.173  36.784  1.00 80.82  ? 50  ARG D NE    1 
ATOM   4928 C CZ    . ARG D 1 64  ? -32.079 -7.947  37.989  1.00 83.03  ? 50  ARG D CZ    1 
ATOM   4929 N NH1   . ARG D 1 64  ? -33.340 -7.552  38.117  1.00 86.56  ? 50  ARG D NH1   1 
ATOM   4930 N NH2   . ARG D 1 64  ? -31.319 -8.119  39.064  1.00 80.48  ? 50  ARG D NH2   1 
ATOM   4931 N N     . HIS D 1 65  ? -29.514 -8.601  31.489  1.00 71.44  ? 51  HIS D N     1 
ATOM   4932 C CA    . HIS D 1 65  ? -29.879 -8.113  30.159  1.00 66.44  ? 51  HIS D CA    1 
ATOM   4933 C C     . HIS D 1 65  ? -28.829 -8.507  29.122  1.00 62.37  ? 51  HIS D C     1 
ATOM   4934 O O     . HIS D 1 65  ? -29.115 -8.587  27.925  1.00 63.76  ? 51  HIS D O     1 
ATOM   4935 C CB    . HIS D 1 65  ? -30.007 -6.596  30.174  1.00 67.99  ? 51  HIS D CB    1 
ATOM   4936 C CG    . HIS D 1 65  ? -31.167 -6.099  30.973  1.00 70.64  ? 51  HIS D CG    1 
ATOM   4937 N ND1   . HIS D 1 65  ? -31.186 -6.118  32.352  1.00 70.71  ? 51  HIS D ND1   1 
ATOM   4938 C CD2   . HIS D 1 65  ? -32.345 -5.555  30.585  1.00 69.10  ? 51  HIS D CD2   1 
ATOM   4939 C CE1   . HIS D 1 65  ? -32.324 -5.602  32.779  1.00 68.59  ? 51  HIS D CE1   1 
ATOM   4940 N NE2   . HIS D 1 65  ? -33.045 -5.253  31.727  1.00 73.03  ? 51  HIS D NE2   1 
ATOM   4941 N N     . PHE D 1 66  ? -27.609 -8.736  29.599  1.00 57.70  ? 52  PHE D N     1 
ATOM   4942 C CA    . PHE D 1 66  ? -26.487 -9.110  28.752  1.00 51.13  ? 52  PHE D CA    1 
ATOM   4943 C C     . PHE D 1 66  ? -25.627 -10.115 29.517  1.00 51.73  ? 52  PHE D C     1 
ATOM   4944 O O     . PHE D 1 66  ? -25.221 -9.862  30.657  1.00 53.81  ? 52  PHE D O     1 
ATOM   4945 C CB    . PHE D 1 66  ? -25.658 -7.870  28.429  1.00 47.56  ? 52  PHE D CB    1 
ATOM   4946 C CG    . PHE D 1 66  ? -26.357 -6.874  27.549  1.00 40.58  ? 52  PHE D CG    1 
ATOM   4947 C CD1   . PHE D 1 66  ? -26.461 -7.093  26.177  1.00 44.77  ? 52  PHE D CD1   1 
ATOM   4948 C CD2   . PHE D 1 66  ? -26.901 -5.710  28.085  1.00 43.14  ? 52  PHE D CD2   1 
ATOM   4949 C CE1   . PHE D 1 66  ? -27.078 -6.161  25.340  1.00 44.78  ? 52  PHE D CE1   1 
ATOM   4950 C CE2   . PHE D 1 66  ? -27.521 -4.766  27.260  1.00 39.39  ? 52  PHE D CE2   1 
ATOM   4951 C CZ    . PHE D 1 66  ? -27.613 -4.998  25.883  1.00 42.02  ? 52  PHE D CZ    1 
ATOM   4952 N N     . PRO D 1 67  ? -25.324 -11.265 28.899  1.00 48.09  ? 53  PRO D N     1 
ATOM   4953 C CA    . PRO D 1 67  ? -24.501 -12.280 29.575  1.00 46.16  ? 53  PRO D CA    1 
ATOM   4954 C C     . PRO D 1 67  ? -23.034 -11.857 29.656  1.00 46.91  ? 53  PRO D C     1 
ATOM   4955 O O     . PRO D 1 67  ? -22.247 -12.426 30.417  1.00 46.19  ? 53  PRO D O     1 
ATOM   4956 C CB    . PRO D 1 67  ? -24.680 -13.535 28.713  1.00 41.22  ? 53  PRO D CB    1 
ATOM   4957 C CG    . PRO D 1 67  ? -25.404 -13.070 27.448  1.00 46.98  ? 53  PRO D CG    1 
ATOM   4958 C CD    . PRO D 1 67  ? -25.486 -11.567 27.471  1.00 44.62  ? 53  PRO D CD    1 
ATOM   4959 N N     . SER D 1 68  ? -22.665 -10.859 28.861  1.00 45.76  ? 54  SER D N     1 
ATOM   4960 C CA    . SER D 1 68  ? -21.298 -10.381 28.858  1.00 44.83  ? 54  SER D CA    1 
ATOM   4961 C C     . SER D 1 68  ? -21.218 -8.976  28.332  1.00 45.73  ? 54  SER D C     1 
ATOM   4962 O O     . SER D 1 68  ? -22.198 -8.415  27.831  1.00 50.25  ? 54  SER D O     1 
ATOM   4963 C CB    . SER D 1 68  ? -20.433 -11.259 27.970  1.00 44.82  ? 54  SER D CB    1 
ATOM   4964 O OG    . SER D 1 68  ? -20.933 -11.225 26.641  1.00 52.42  ? 54  SER D OG    1 
ATOM   4965 N N     . LYS D 1 69  ? -20.026 -8.410  28.449  1.00 40.21  ? 55  LYS D N     1 
ATOM   4966 C CA    . LYS D 1 69  ? -19.780 -7.087  27.938  1.00 37.69  ? 55  LYS D CA    1 
ATOM   4967 C C     . LYS D 1 69  ? -19.644 -7.244  26.406  1.00 33.40  ? 55  LYS D C     1 
ATOM   4968 O O     . LYS D 1 69  ? -19.999 -6.360  25.641  1.00 29.68  ? 55  LYS D O     1 
ATOM   4969 C CB    . LYS D 1 69  ? -18.489 -6.534  28.543  1.00 38.67  ? 55  LYS D CB    1 
ATOM   4970 C CG    . LYS D 1 69  ? -18.648 -5.111  29.020  1.00 45.72  ? 55  LYS D CG    1 
ATOM   4971 C CD    . LYS D 1 69  ? -17.418 -4.277  28.744  1.00 44.03  ? 55  LYS D CD    1 
ATOM   4972 C CE    . LYS D 1 69  ? -16.374 -4.530  29.781  1.00 36.96  ? 55  LYS D CE    1 
ATOM   4973 N NZ    . LYS D 1 69  ? -15.370 -3.451  29.655  1.00 38.83  ? 55  LYS D NZ    1 
ATOM   4974 N N     . THR D 1 70  ? -19.136 -8.389  25.969  1.00 29.58  ? 56  THR D N     1 
ATOM   4975 C CA    . THR D 1 70  ? -18.961 -8.632  24.560  1.00 35.46  ? 56  THR D CA    1 
ATOM   4976 C C     . THR D 1 70  ? -20.290 -8.533  23.825  1.00 38.63  ? 56  THR D C     1 
ATOM   4977 O O     . THR D 1 70  ? -20.339 -8.022  22.695  1.00 37.84  ? 56  THR D O     1 
ATOM   4978 C CB    . THR D 1 70  ? -18.323 -10.002 24.321  1.00 37.32  ? 56  THR D CB    1 
ATOM   4979 O OG1   . THR D 1 70  ? -16.989 -9.988  24.839  1.00 48.43  ? 56  THR D OG1   1 
ATOM   4980 C CG2   . THR D 1 70  ? -18.263 -10.326 22.830  1.00 38.14  ? 56  THR D CG2   1 
ATOM   4981 N N     . ARG D 1 71  ? -21.362 -9.004  24.472  1.00 34.30  ? 57  ARG D N     1 
ATOM   4982 C CA    . ARG D 1 71  ? -22.688 -8.964  23.882  1.00 37.92  ? 57  ARG D CA    1 
ATOM   4983 C C     . ARG D 1 71  ? -23.116 -7.533  23.712  1.00 36.34  ? 57  ARG D C     1 
ATOM   4984 O O     . ARG D 1 71  ? -23.776 -7.196  22.739  1.00 36.22  ? 57  ARG D O     1 
ATOM   4985 C CB    . ARG D 1 71  ? -23.721 -9.694  24.742  1.00 43.26  ? 57  ARG D CB    1 
ATOM   4986 C CG    . ARG D 1 71  ? -23.639 -11.214 24.702  1.00 54.50  ? 57  ARG D CG    1 
ATOM   4987 C CD    . ARG D 1 71  ? -23.980 -11.786 23.332  1.00 65.12  ? 57  ARG D CD    1 
ATOM   4988 N NE    . ARG D 1 71  ? -22.795 -11.883 22.488  1.00 75.12  ? 57  ARG D NE    1 
ATOM   4989 C CZ    . ARG D 1 71  ? -22.772 -12.456 21.288  1.00 81.21  ? 57  ARG D CZ    1 
ATOM   4990 N NH1   . ARG D 1 71  ? -23.876 -12.988 20.782  1.00 83.16  ? 57  ARG D NH1   1 
ATOM   4991 N NH2   . ARG D 1 71  ? -21.642 -12.502 20.592  1.00 82.94  ? 57  ARG D NH2   1 
ATOM   4992 N N     . MET D 1 72  ? -22.746 -6.682  24.657  1.00 33.20  ? 58  MET D N     1 
ATOM   4993 C CA    . MET D 1 72  ? -23.113 -5.281  24.539  1.00 35.78  ? 58  MET D CA    1 
ATOM   4994 C C     . MET D 1 72  ? -22.478 -4.643  23.287  1.00 37.66  ? 58  MET D C     1 
ATOM   4995 O O     . MET D 1 72  ? -23.129 -3.862  22.585  1.00 39.15  ? 58  MET D O     1 
ATOM   4996 C CB    . MET D 1 72  ? -22.687 -4.522  25.783  1.00 36.57  ? 58  MET D CB    1 
ATOM   4997 C CG    . MET D 1 72  ? -23.345 -5.039  27.052  1.00 43.45  ? 58  MET D CG    1 
ATOM   4998 S SD    . MET D 1 72  ? -22.922 -4.062  28.492  1.00 48.82  ? 58  MET D SD    1 
ATOM   4999 C CE    . MET D 1 72  ? -21.903 -5.236  29.352  1.00 53.20  ? 58  MET D CE    1 
ATOM   5000 N N     . PHE D 1 73  ? -21.222 -4.972  22.993  1.00 33.70  ? 59  PHE D N     1 
ATOM   5001 C CA    . PHE D 1 73  ? -20.579 -4.398  21.804  1.00 36.59  ? 59  PHE D CA    1 
ATOM   5002 C C     . PHE D 1 73  ? -21.123 -5.007  20.518  1.00 31.80  ? 59  PHE D C     1 
ATOM   5003 O O     . PHE D 1 73  ? -21.171 -4.343  19.484  1.00 37.40  ? 59  PHE D O     1 
ATOM   5004 C CB    . PHE D 1 73  ? -19.047 -4.541  21.882  1.00 30.40  ? 59  PHE D CB    1 
ATOM   5005 C CG    . PHE D 1 73  ? -18.404 -3.556  22.813  1.00 33.59  ? 59  PHE D CG    1 
ATOM   5006 C CD1   . PHE D 1 73  ? -18.330 -3.806  24.185  1.00 33.35  ? 59  PHE D CD1   1 
ATOM   5007 C CD2   . PHE D 1 73  ? -17.889 -2.364  22.319  1.00 26.95  ? 59  PHE D CD2   1 
ATOM   5008 C CE1   . PHE D 1 73  ? -17.735 -2.876  25.049  1.00 31.14  ? 59  PHE D CE1   1 
ATOM   5009 C CE2   . PHE D 1 73  ? -17.294 -1.435  23.175  1.00 29.40  ? 59  PHE D CE2   1 
ATOM   5010 C CZ    . PHE D 1 73  ? -17.218 -1.688  24.538  1.00 27.97  ? 59  PHE D CZ    1 
ATOM   5011 N N     . ASP D 1 74  ? -21.510 -6.279  20.590  1.00 37.48  ? 60  ASP D N     1 
ATOM   5012 C CA    . ASP D 1 74  ? -22.128 -6.979  19.467  1.00 38.53  ? 60  ASP D CA    1 
ATOM   5013 C C     . ASP D 1 74  ? -23.387 -6.196  19.099  1.00 35.42  ? 60  ASP D C     1 
ATOM   5014 O O     . ASP D 1 74  ? -23.658 -5.967  17.917  1.00 33.98  ? 60  ASP D O     1 
ATOM   5015 C CB    . ASP D 1 74  ? -22.563 -8.391  19.864  1.00 42.91  ? 60  ASP D CB    1 
ATOM   5016 C CG    . ASP D 1 74  ? -21.485 -9.427  19.636  1.00 47.77  ? 60  ASP D CG    1 
ATOM   5017 O OD1   . ASP D 1 74  ? -21.010 -9.554  18.481  1.00 47.04  ? 60  ASP D OD1   1 
ATOM   5018 O OD2   . ASP D 1 74  ? -21.128 -10.123 20.617  1.00 51.54  ? 60  ASP D OD2   1 
ATOM   5019 N N     . SER D 1 75  ? -24.138 -5.783  20.120  1.00 30.94  ? 61  SER D N     1 
ATOM   5020 C CA    . SER D 1 75  ? -25.367 -5.022  19.901  1.00 34.98  ? 61  SER D CA    1 
ATOM   5021 C C     . SER D 1 75  ? -25.032 -3.699  19.264  1.00 36.18  ? 61  SER D C     1 
ATOM   5022 O O     . SER D 1 75  ? -25.678 -3.288  18.308  1.00 36.97  ? 61  SER D O     1 
ATOM   5023 C CB    . SER D 1 75  ? -26.125 -4.769  21.202  1.00 35.05  ? 61  SER D CB    1 
ATOM   5024 O OG    . SER D 1 75  ? -26.675 -5.977  21.708  1.00 47.63  ? 61  SER D OG    1 
ATOM   5025 N N     . LEU D 1 76  ? -24.015 -3.030  19.788  1.00 33.14  ? 62  LEU D N     1 
ATOM   5026 C CA    . LEU D 1 76  ? -23.613 -1.746  19.233  1.00 30.89  ? 62  LEU D CA    1 
ATOM   5027 C C     . LEU D 1 76  ? -23.121 -1.927  17.777  1.00 31.53  ? 62  LEU D C     1 
ATOM   5028 O O     . LEU D 1 76  ? -23.384 -1.080  16.930  1.00 27.14  ? 62  LEU D O     1 
ATOM   5029 C CB    . LEU D 1 76  ? -22.522 -1.142  20.112  1.00 37.97  ? 62  LEU D CB    1 
ATOM   5030 C CG    . LEU D 1 76  ? -22.867 0.065   21.003  1.00 37.47  ? 62  LEU D CG    1 
ATOM   5031 C CD1   . LEU D 1 76  ? -24.287 0.030   21.455  1.00 33.70  ? 62  LEU D CD1   1 
ATOM   5032 C CD2   . LEU D 1 76  ? -21.937 0.101   22.186  1.00 31.94  ? 62  LEU D CD2   1 
ATOM   5033 N N     . ILE D 1 77  ? -22.434 -3.035  17.490  1.00 26.94  ? 63  ILE D N     1 
ATOM   5034 C CA    . ILE D 1 77  ? -21.945 -3.293  16.140  1.00 30.10  ? 63  ILE D CA    1 
ATOM   5035 C C     . ILE D 1 77  ? -23.128 -3.605  15.213  1.00 32.35  ? 63  ILE D C     1 
ATOM   5036 O O     . ILE D 1 77  ? -23.154 -3.154  14.063  1.00 28.42  ? 63  ILE D O     1 
ATOM   5037 C CB    . ILE D 1 77  ? -20.901 -4.455  16.135  1.00 28.64  ? 63  ILE D CB    1 
ATOM   5038 C CG1   . ILE D 1 77  ? -19.620 -4.009  16.856  1.00 27.78  ? 63  ILE D CG1   1 
ATOM   5039 C CG2   . ILE D 1 77  ? -20.554 -4.869  14.703  1.00 29.31  ? 63  ILE D CG2   1 
ATOM   5040 C CD1   . ILE D 1 77  ? -18.590 -5.154  17.120  1.00 23.62  ? 63  ILE D CD1   1 
ATOM   5041 N N     . GLU D 1 78  ? -24.117 -4.352  15.698  1.00 35.06  ? 64  GLU D N     1 
ATOM   5042 C CA    . GLU D 1 78  ? -25.268 -4.619  14.840  1.00 37.01  ? 64  GLU D CA    1 
ATOM   5043 C C     . GLU D 1 78  ? -25.950 -3.292  14.487  1.00 30.69  ? 64  GLU D C     1 
ATOM   5044 O O     . GLU D 1 78  ? -26.345 -3.073  13.330  1.00 27.72  ? 64  GLU D O     1 
ATOM   5045 C CB    . GLU D 1 78  ? -26.254 -5.567  15.508  1.00 42.92  ? 64  GLU D CB    1 
ATOM   5046 C CG    . GLU D 1 78  ? -25.832 -7.027  15.397  1.00 57.73  ? 64  GLU D CG    1 
ATOM   5047 C CD    . GLU D 1 78  ? -26.953 -7.988  15.778  1.00 66.42  ? 64  GLU D CD    1 
ATOM   5048 O OE1   . GLU D 1 78  ? -28.099 -7.785  15.295  1.00 69.02  ? 64  GLU D OE1   1 
ATOM   5049 O OE2   . GLU D 1 78  ? -26.681 -8.944  16.547  1.00 65.24  ? 64  GLU D OE2   1 
ATOM   5050 N N     . PHE D 1 79  ? -26.058 -2.397  15.466  1.00 27.83  ? 65  PHE D N     1 
ATOM   5051 C CA    . PHE D 1 79  ? -26.659 -1.096  15.206  1.00 25.76  ? 65  PHE D CA    1 
ATOM   5052 C C     . PHE D 1 79  ? -25.909 -0.401  14.067  1.00 27.48  ? 65  PHE D C     1 
ATOM   5053 O O     . PHE D 1 79  ? -26.520 0.028   13.100  1.00 24.55  ? 65  PHE D O     1 
ATOM   5054 C CB    . PHE D 1 79  ? -26.624 -0.193  16.446  1.00 27.58  ? 65  PHE D CB    1 
ATOM   5055 C CG    . PHE D 1 79  ? -27.150 1.208   16.185  1.00 26.44  ? 65  PHE D CG    1 
ATOM   5056 C CD1   . PHE D 1 79  ? -28.516 1.441   16.054  1.00 25.90  ? 65  PHE D CD1   1 
ATOM   5057 C CD2   . PHE D 1 79  ? -26.276 2.282   16.055  1.00 26.63  ? 65  PHE D CD2   1 
ATOM   5058 C CE1   . PHE D 1 79  ? -29.004 2.729   15.800  1.00 27.66  ? 65  PHE D CE1   1 
ATOM   5059 C CE2   . PHE D 1 79  ? -26.746 3.575   15.801  1.00 26.78  ? 65  PHE D CE2   1 
ATOM   5060 C CZ    . PHE D 1 79  ? -28.120 3.800   15.671  1.00 25.62  ? 65  PHE D CZ    1 
ATOM   5061 N N     . ILE D 1 80  ? -24.580 -0.294  14.175  1.00 28.19  ? 66  ILE D N     1 
ATOM   5062 C CA    . ILE D 1 80  ? -23.784 0.372   13.134  1.00 25.86  ? 66  ILE D CA    1 
ATOM   5063 C C     . ILE D 1 80  ? -23.997 -0.258  11.761  1.00 25.04  ? 66  ILE D C     1 
ATOM   5064 O O     . ILE D 1 80  ? -24.152 0.427   10.753  1.00 21.22  ? 66  ILE D O     1 
ATOM   5065 C CB    . ILE D 1 80  ? -22.259 0.296   13.447  1.00 26.07  ? 66  ILE D CB    1 
ATOM   5066 C CG1   . ILE D 1 80  ? -21.979 0.947   14.808  1.00 24.93  ? 66  ILE D CG1   1 
ATOM   5067 C CG2   . ILE D 1 80  ? -21.453 0.986   12.307  1.00 15.25  ? 66  ILE D CG2   1 
ATOM   5068 C CD1   . ILE D 1 80  ? -20.637 0.533   15.436  1.00 22.75  ? 66  ILE D CD1   1 
ATOM   5069 N N     . GLU D 1 81  ? -23.981 -1.580  11.720  1.00 22.67  ? 67  GLU D N     1 
ATOM   5070 C CA    . GLU D 1 81  ? -24.177 -2.285  10.481  1.00 24.59  ? 67  GLU D CA    1 
ATOM   5071 C C     . GLU D 1 81  ? -25.583 -1.982  9.881   1.00 31.15  ? 67  GLU D C     1 
ATOM   5072 O O     . GLU D 1 81  ? -25.716 -1.625  8.713   1.00 25.43  ? 67  GLU D O     1 
ATOM   5073 C CB    . GLU D 1 81  ? -24.007 -3.769  10.757  1.00 32.95  ? 67  GLU D CB    1 
ATOM   5074 C CG    . GLU D 1 81  ? -23.587 -4.559  9.557   1.00 51.18  ? 67  GLU D CG    1 
ATOM   5075 C CD    . GLU D 1 81  ? -23.490 -6.030  9.868   1.00 64.84  ? 67  GLU D CD    1 
ATOM   5076 O OE1   . GLU D 1 81  ? -23.198 -6.374  11.049  1.00 66.82  ? 67  GLU D OE1   1 
ATOM   5077 O OE2   . GLU D 1 81  ? -23.699 -6.838  8.928   1.00 66.59  ? 67  GLU D OE2   1 
ATOM   5078 N N     . ASP D 1 82  ? -26.637 -2.099  10.677  1.00 28.66  ? 68  ASP D N     1 
ATOM   5079 C CA    . ASP D 1 82  ? -27.965 -1.824  10.143  1.00 25.61  ? 68  ASP D CA    1 
ATOM   5080 C C     . ASP D 1 82  ? -28.033 -0.428  9.588   1.00 28.15  ? 68  ASP D C     1 
ATOM   5081 O O     . ASP D 1 82  ? -28.481 -0.225  8.444   1.00 35.73  ? 68  ASP D O     1 
ATOM   5082 C CB    . ASP D 1 82  ? -29.040 -1.964  11.226  1.00 34.96  ? 68  ASP D CB    1 
ATOM   5083 C CG    . ASP D 1 82  ? -29.117 -3.361  11.776  1.00 46.48  ? 68  ASP D CG    1 
ATOM   5084 O OD1   . ASP D 1 82  ? -29.761 -3.538  12.840  1.00 52.14  ? 68  ASP D OD1   1 
ATOM   5085 O OD2   . ASP D 1 82  ? -28.529 -4.276  11.138  1.00 47.43  ? 68  ASP D OD2   1 
ATOM   5086 N N     . SER D 1 83  ? -27.588 0.536   10.389  1.00 23.02  ? 69  SER D N     1 
ATOM   5087 C CA    . SER D 1 83  ? -27.621 1.937   9.977   1.00 24.17  ? 69  SER D CA    1 
ATOM   5088 C C     . SER D 1 83  ? -26.950 2.126   8.656   1.00 27.04  ? 69  SER D C     1 
ATOM   5089 O O     . SER D 1 83  ? -27.571 2.606   7.711   1.00 30.75  ? 69  SER D O     1 
ATOM   5090 C CB    . SER D 1 83  ? -26.926 2.821   10.978  1.00 22.96  ? 69  SER D CB    1 
ATOM   5091 O OG    . SER D 1 83  ? -27.365 2.497   12.284  1.00 34.86  ? 69  SER D OG    1 
ATOM   5092 N N     . LEU D 1 84  ? -25.694 1.710   8.556   1.00 24.13  ? 70  LEU D N     1 
ATOM   5093 C CA    . LEU D 1 84  ? -24.978 1.908   7.312   1.00 19.94  ? 70  LEU D CA    1 
ATOM   5094 C C     . LEU D 1 84  ? -25.504 1.147   6.121   1.00 24.52  ? 70  LEU D C     1 
ATOM   5095 O O     . LEU D 1 84  ? -25.598 1.687   5.004   1.00 27.76  ? 70  LEU D O     1 
ATOM   5096 C CB    . LEU D 1 84  ? -23.468 1.621   7.500   1.00 23.34  ? 70  LEU D CB    1 
ATOM   5097 C CG    . LEU D 1 84  ? -22.755 2.557   8.505   1.00 26.49  ? 70  LEU D CG    1 
ATOM   5098 C CD1   . LEU D 1 84  ? -21.261 2.229   8.589   1.00 27.42  ? 70  LEU D CD1   1 
ATOM   5099 C CD2   . LEU D 1 84  ? -22.939 4.033   8.056   1.00 24.67  ? 70  LEU D CD2   1 
ATOM   5100 N N     . ILE D 1 85  ? -25.850 -0.115  6.311   1.00 26.08  ? 71  ILE D N     1 
ATOM   5101 C CA    . ILE D 1 85  ? -26.309 -0.860  5.152   1.00 25.61  ? 71  ILE D CA    1 
ATOM   5102 C C     . ILE D 1 85  ? -27.678 -0.355  4.680   1.00 27.81  ? 71  ILE D C     1 
ATOM   5103 O O     . ILE D 1 85  ? -27.912 -0.229  3.483   1.00 26.70  ? 71  ILE D O     1 
ATOM   5104 C CB    . ILE D 1 85  ? -26.341 -2.369  5.453   1.00 25.30  ? 71  ILE D CB    1 
ATOM   5105 C CG1   . ILE D 1 85  ? -24.912 -2.868  5.726   1.00 27.88  ? 71  ILE D CG1   1 
ATOM   5106 C CG2   . ILE D 1 85  ? -26.944 -3.107  4.292   1.00 26.60  ? 71  ILE D CG2   1 
ATOM   5107 C CD1   . ILE D 1 85  ? -23.912 -2.473  4.626   1.00 30.79  ? 71  ILE D CD1   1 
ATOM   5108 N N     . THR D 1 86  ? -28.544 -0.024  5.632   1.00 26.29  ? 72  THR D N     1 
ATOM   5109 C CA    . THR D 1 86  ? -29.887 0.482   5.325   1.00 31.51  ? 72  THR D CA    1 
ATOM   5110 C C     . THR D 1 86  ? -29.753 1.799   4.547   1.00 31.74  ? 72  THR D C     1 
ATOM   5111 O O     . THR D 1 86  ? -30.430 2.011   3.534   1.00 27.00  ? 72  THR D O     1 
ATOM   5112 C CB    . THR D 1 86  ? -30.709 0.728   6.661   1.00 25.33  ? 72  THR D CB    1 
ATOM   5113 O OG1   . THR D 1 86  ? -30.863 -0.512  7.362   1.00 32.15  ? 72  THR D OG1   1 
ATOM   5114 C CG2   . THR D 1 86  ? -32.074 1.283   6.385   1.00 32.14  ? 72  THR D CG2   1 
ATOM   5115 N N     . ARG D 1 87  ? -28.862 2.679   5.008   1.00 31.21  ? 73  ARG D N     1 
ATOM   5116 C CA    . ARG D 1 87  ? -28.698 3.965   4.337   1.00 30.58  ? 73  ARG D CA    1 
ATOM   5117 C C     . ARG D 1 87  ? -28.081 3.793   2.964   1.00 28.40  ? 73  ARG D C     1 
ATOM   5118 O O     . ARG D 1 87  ? -28.433 4.507   2.035   1.00 25.49  ? 73  ARG D O     1 
ATOM   5119 C CB    . ARG D 1 87  ? -27.840 4.907   5.159   1.00 32.30  ? 73  ARG D CB    1 
ATOM   5120 C CG    . ARG D 1 87  ? -28.224 4.959   6.608   1.00 53.68  ? 73  ARG D CG    1 
ATOM   5121 C CD    . ARG D 1 87  ? -28.730 6.316   7.044   1.00 60.86  ? 73  ARG D CD    1 
ATOM   5122 N NE    . ARG D 1 87  ? -28.976 6.389   8.486   1.00 75.17  ? 73  ARG D NE    1 
ATOM   5123 C CZ    . ARG D 1 87  ? -29.571 5.438   9.213   1.00 83.00  ? 73  ARG D CZ    1 
ATOM   5124 N NH1   . ARG D 1 87  ? -29.985 4.307   8.657   1.00 83.18  ? 73  ARG D NH1   1 
ATOM   5125 N NH2   . ARG D 1 87  ? -29.793 5.630   10.504  1.00 85.40  ? 73  ARG D NH2   1 
ATOM   5126 N N     . ILE D 1 88  ? -27.171 2.836   2.821   1.00 31.47  ? 74  ILE D N     1 
ATOM   5127 C CA    . ILE D 1 88  ? -26.550 2.615   1.522   1.00 30.44  ? 74  ILE D CA    1 
ATOM   5128 C C     . ILE D 1 88  ? -27.611 2.183   0.503   1.00 30.82  ? 74  ILE D C     1 
ATOM   5129 O O     . ILE D 1 88  ? -27.667 2.724   -0.612  1.00 27.34  ? 74  ILE D O     1 
ATOM   5130 C CB    . ILE D 1 88  ? -25.438 1.549   1.597   1.00 26.39  ? 74  ILE D CB    1 
ATOM   5131 C CG1   . ILE D 1 88  ? -24.309 2.032   2.513   1.00 37.42  ? 74  ILE D CG1   1 
ATOM   5132 C CG2   . ILE D 1 88  ? -24.883 1.265   0.208   1.00 21.07  ? 74  ILE D CG2   1 
ATOM   5133 C CD1   . ILE D 1 88  ? -23.625 3.267   2.022   1.00 39.81  ? 74  ILE D CD1   1 
ATOM   5134 N N     . ASN D 1 89  ? -28.456 1.221   0.875   1.00 30.65  ? 75  ASN D N     1 
ATOM   5135 C CA    . ASN D 1 89  ? -29.528 0.768   -0.030  1.00 29.44  ? 75  ASN D CA    1 
ATOM   5136 C C     . ASN D 1 89  ? -30.436 1.925   -0.443  1.00 26.26  ? 75  ASN D C     1 
ATOM   5137 O O     . ASN D 1 89  ? -30.788 2.073   -1.616  1.00 29.06  ? 75  ASN D O     1 
ATOM   5138 C CB    . ASN D 1 89  ? -30.334 -0.344  0.629   1.00 30.22  ? 75  ASN D CB    1 
ATOM   5139 C CG    . ASN D 1 89  ? -29.471 -1.566  0.919   1.00 36.70  ? 75  ASN D CG    1 
ATOM   5140 O OD1   . ASN D 1 89  ? -28.431 -1.763  0.285   1.00 37.60  ? 75  ASN D OD1   1 
ATOM   5141 N ND2   . ASN D 1 89  ? -29.893 -2.389  1.867   1.00 38.37  ? 75  ASN D ND2   1 
ATOM   5142 N N     . LEU D 1 90  ? -30.805 2.760   0.510   1.00 25.93  ? 76  LEU D N     1 
ATOM   5143 C CA    . LEU D 1 90  ? -31.619 3.915   0.167   1.00 28.46  ? 76  LEU D CA    1 
ATOM   5144 C C     . LEU D 1 90  ? -30.907 4.758   -0.893  1.00 26.76  ? 76  LEU D C     1 
ATOM   5145 O O     . LEU D 1 90  ? -31.520 5.136   -1.888  1.00 31.16  ? 76  LEU D O     1 
ATOM   5146 C CB    . LEU D 1 90  ? -31.912 4.737   1.423   1.00 31.23  ? 76  LEU D CB    1 
ATOM   5147 C CG    . LEU D 1 90  ? -32.844 3.953   2.360   1.00 40.49  ? 76  LEU D CG    1 
ATOM   5148 C CD1   . LEU D 1 90  ? -33.029 4.677   3.689   1.00 39.58  ? 76  LEU D CD1   1 
ATOM   5149 C CD2   . LEU D 1 90  ? -34.202 3.769   1.660   1.00 40.06  ? 76  LEU D CD2   1 
ATOM   5150 N N     . ILE D 1 91  ? -29.612 5.024   -0.705  1.00 27.59  ? 77  ILE D N     1 
ATOM   5151 C CA    . ILE D 1 91  ? -28.819 5.817   -1.662  1.00 24.59  ? 77  ILE D CA    1 
ATOM   5152 C C     . ILE D 1 91  ? -28.907 5.241   -3.074  1.00 25.85  ? 77  ILE D C     1 
ATOM   5153 O O     . ILE D 1 91  ? -29.138 5.943   -4.082  1.00 25.98  ? 77  ILE D O     1 
ATOM   5154 C CB    . ILE D 1 91  ? -27.314 5.802   -1.281  1.00 24.74  ? 77  ILE D CB    1 
ATOM   5155 C CG1   . ILE D 1 91  ? -27.055 6.655   -0.033  1.00 32.31  ? 77  ILE D CG1   1 
ATOM   5156 C CG2   . ILE D 1 91  ? -26.485 6.185   -2.489  1.00 15.73  ? 77  ILE D CG2   1 
ATOM   5157 C CD1   . ILE D 1 91  ? -27.331 8.147   -0.222  1.00 35.21  ? 77  ILE D CD1   1 
ATOM   5158 N N     . LEU D 1 92  ? -28.712 3.939   -3.149  1.00 22.26  ? 78  LEU D N     1 
ATOM   5159 C CA    . LEU D 1 92  ? -28.722 3.267   -4.425  1.00 24.67  ? 78  LEU D CA    1 
ATOM   5160 C C     . LEU D 1 92  ? -30.077 3.417   -5.131  1.00 26.90  ? 78  LEU D C     1 
ATOM   5161 O O     . LEU D 1 92  ? -30.138 3.559   -6.358  1.00 29.39  ? 78  LEU D O     1 
ATOM   5162 C CB    . LEU D 1 92  ? -28.362 1.796   -4.199  1.00 26.30  ? 78  LEU D CB    1 
ATOM   5163 C CG    . LEU D 1 92  ? -26.933 1.616   -3.667  1.00 28.30  ? 78  LEU D CG    1 
ATOM   5164 C CD1   . LEU D 1 92  ? -26.656 0.128   -3.389  1.00 33.18  ? 78  LEU D CD1   1 
ATOM   5165 C CD2   . LEU D 1 92  ? -25.941 2.145   -4.715  1.00 29.43  ? 78  LEU D CD2   1 
ATOM   5166 N N     . LYS D 1 93  ? -31.160 3.401   -4.360  1.00 26.41  ? 79  LYS D N     1 
ATOM   5167 C CA    . LYS D 1 93  ? -32.474 3.562   -4.959  1.00 32.46  ? 79  LYS D CA    1 
ATOM   5168 C C     . LYS D 1 93  ? -32.770 5.019   -5.304  1.00 32.89  ? 79  LYS D C     1 
ATOM   5169 O O     . LYS D 1 93  ? -33.490 5.303   -6.242  1.00 36.12  ? 79  LYS D O     1 
ATOM   5170 C CB    . LYS D 1 93  ? -33.553 3.012   -4.033  1.00 35.58  ? 79  LYS D CB    1 
ATOM   5171 C CG    . LYS D 1 93  ? -33.581 1.489   -3.971  1.00 41.41  ? 79  LYS D CG    1 
ATOM   5172 C CD    . LYS D 1 93  ? -34.779 1.010   -3.169  1.00 47.13  ? 79  LYS D CD    1 
ATOM   5173 C CE    . LYS D 1 93  ? -34.906 -0.508  -3.149  1.00 55.67  ? 79  LYS D CE    1 
ATOM   5174 N NZ    . LYS D 1 93  ? -33.886 -1.195  -2.312  1.00 62.25  ? 79  LYS D NZ    1 
ATOM   5175 N N     . ASP D 1 94  ? -32.201 5.955   -4.569  1.00 31.42  ? 80  ASP D N     1 
ATOM   5176 C CA    . ASP D 1 94  ? -32.475 7.346   -4.885  1.00 38.81  ? 80  ASP D CA    1 
ATOM   5177 C C     . ASP D 1 94  ? -31.502 8.043   -5.856  1.00 37.38  ? 80  ASP D C     1 
ATOM   5178 O O     . ASP D 1 94  ? -31.787 9.126   -6.344  1.00 38.82  ? 80  ASP D O     1 
ATOM   5179 C CB    . ASP D 1 94  ? -32.590 8.140   -3.574  1.00 41.97  ? 80  ASP D CB    1 
ATOM   5180 C CG    . ASP D 1 94  ? -33.761 7.652   -2.708  1.00 59.73  ? 80  ASP D CG    1 
ATOM   5181 O OD1   . ASP D 1 94  ? -34.916 7.648   -3.214  1.00 61.19  ? 80  ASP D OD1   1 
ATOM   5182 O OD2   . ASP D 1 94  ? -33.542 7.261   -1.533  1.00 62.72  ? 80  ASP D OD2   1 
ATOM   5183 N N     . GLU D 1 95  ? -30.374 7.418   -6.162  1.00 36.62  ? 81  GLU D N     1 
ATOM   5184 C CA    . GLU D 1 95  ? -29.382 8.055   -7.018  1.00 33.37  ? 81  GLU D CA    1 
ATOM   5185 C C     . GLU D 1 95  ? -28.961 7.099   -8.142  1.00 32.16  ? 81  GLU D C     1 
ATOM   5186 O O     . GLU D 1 95  ? -28.583 5.962   -7.884  1.00 30.68  ? 81  GLU D O     1 
ATOM   5187 C CB    . GLU D 1 95  ? -28.199 8.465   -6.114  1.00 36.67  ? 81  GLU D CB    1 
ATOM   5188 C CG    . GLU D 1 95  ? -27.075 9.270   -6.751  1.00 33.38  ? 81  GLU D CG    1 
ATOM   5189 C CD    . GLU D 1 95  ? -27.582 10.308  -7.734  1.00 42.32  ? 81  GLU D CD    1 
ATOM   5190 O OE1   . GLU D 1 95  ? -27.674 9.981   -8.944  1.00 43.10  ? 81  GLU D OE1   1 
ATOM   5191 O OE2   . GLU D 1 95  ? -27.900 11.440  -7.300  1.00 39.08  ? 81  GLU D OE2   1 
ATOM   5192 N N     . LYS D 1 96  ? -29.039 7.555   -9.384  1.00 25.77  ? 82  LYS D N     1 
ATOM   5193 C CA    . LYS D 1 96  ? -28.700 6.709   -10.516 1.00 34.75  ? 82  LYS D CA    1 
ATOM   5194 C C     . LYS D 1 96  ? -27.273 6.911   -11.023 1.00 33.36  ? 82  LYS D C     1 
ATOM   5195 O O     . LYS D 1 96  ? -26.695 6.016   -11.632 1.00 30.49  ? 82  LYS D O     1 
ATOM   5196 C CB    . LYS D 1 96  ? -29.695 6.974   -11.640 1.00 34.31  ? 82  LYS D CB    1 
ATOM   5197 C CG    . LYS D 1 96  ? -29.075 7.169   -13.013 1.00 52.26  ? 82  LYS D CG    1 
ATOM   5198 C CD    . LYS D 1 96  ? -30.152 7.552   -14.055 1.00 59.60  ? 82  LYS D CD    1 
ATOM   5199 C CE    . LYS D 1 96  ? -29.867 6.950   -15.437 1.00 61.60  ? 82  LYS D CE    1 
ATOM   5200 N NZ    . LYS D 1 96  ? -30.980 7.274   -16.345 1.00 61.50  ? 82  LYS D NZ    1 
ATOM   5201 N N     . ASP D 1 97  ? -26.704 8.084   -10.768 1.00 32.15  ? 83  ASP D N     1 
ATOM   5202 C CA    . ASP D 1 97  ? -25.351 8.349   -11.230 1.00 31.02  ? 83  ASP D CA    1 
ATOM   5203 C C     . ASP D 1 97  ? -24.291 7.594   -10.403 1.00 30.08  ? 83  ASP D C     1 
ATOM   5204 O O     . ASP D 1 97  ? -24.278 7.638   -9.160  1.00 26.88  ? 83  ASP D O     1 
ATOM   5205 C CB    . ASP D 1 97  ? -25.060 9.839   -11.191 1.00 30.12  ? 83  ASP D CB    1 
ATOM   5206 C CG    . ASP D 1 97  ? -23.713 10.150  -11.750 1.00 31.99  ? 83  ASP D CG    1 
ATOM   5207 O OD1   . ASP D 1 97  ? -23.560 10.013  -12.981 1.00 37.98  ? 83  ASP D OD1   1 
ATOM   5208 O OD2   . ASP D 1 97  ? -22.806 10.495  -10.961 1.00 30.43  ? 83  ASP D OD2   1 
ATOM   5209 N N     . THR D 1 98  ? -23.392 6.912   -11.096 1.00 25.07  ? 84  THR D N     1 
ATOM   5210 C CA    . THR D 1 98  ? -22.379 6.150   -10.393 1.00 29.92  ? 84  THR D CA    1 
ATOM   5211 C C     . THR D 1 98  ? -21.483 6.959   -9.462  1.00 24.93  ? 84  THR D C     1 
ATOM   5212 O O     . THR D 1 98  ? -21.330 6.619   -8.293  1.00 27.21  ? 84  THR D O     1 
ATOM   5213 C CB    . THR D 1 98  ? -21.510 5.376   -11.368 1.00 25.42  ? 84  THR D CB    1 
ATOM   5214 O OG1   . THR D 1 98  ? -22.318 4.375   -12.002 1.00 30.93  ? 84  THR D OG1   1 
ATOM   5215 C CG2   . THR D 1 98  ? -20.358 4.692   -10.615 1.00 25.73  ? 84  THR D CG2   1 
ATOM   5216 N N     . THR D 1 99  ? -20.905 8.033   -9.977  1.00 26.67  ? 85  THR D N     1 
ATOM   5217 C CA    . THR D 1 99  ? -20.031 8.869   -9.170  1.00 27.71  ? 85  THR D CA    1 
ATOM   5218 C C     . THR D 1 99  ? -20.820 9.519   -8.024  1.00 29.41  ? 85  THR D C     1 
ATOM   5219 O O     . THR D 1 99  ? -20.282 9.711   -6.933  1.00 23.80  ? 85  THR D O     1 
ATOM   5220 C CB    . THR D 1 99  ? -19.364 9.989   -10.009 1.00 28.48  ? 85  THR D CB    1 
ATOM   5221 O OG1   . THR D 1 99  ? -18.683 9.420   -11.135 1.00 32.22  ? 85  THR D OG1   1 
ATOM   5222 C CG2   . THR D 1 99  ? -18.356 10.766  -9.157  1.00 25.60  ? 85  THR D CG2   1 
ATOM   5223 N N     . ALA D 1 100 ? -22.086 9.862   -8.271  1.00 28.24  ? 86  ALA D N     1 
ATOM   5224 C CA    . ALA D 1 100 ? -22.921 10.477  -7.244  1.00 23.72  ? 86  ALA D CA    1 
ATOM   5225 C C     . ALA D 1 100 ? -23.163 9.471   -6.137  1.00 21.91  ? 86  ALA D C     1 
ATOM   5226 O O     . ALA D 1 100 ? -23.230 9.806   -4.943  1.00 19.64  ? 86  ALA D O     1 
ATOM   5227 C CB    . ALA D 1 100 ? -24.264 10.933  -7.844  1.00 20.23  ? 86  ALA D CB    1 
ATOM   5228 N N     . ARG D 1 101 ? -23.314 8.219   -6.541  1.00 20.68  ? 87  ARG D N     1 
ATOM   5229 C CA    . ARG D 1 101 ? -23.536 7.144   -5.576  1.00 22.02  ? 87  ARG D CA    1 
ATOM   5230 C C     . ARG D 1 101 ? -22.311 6.920   -4.658  1.00 20.00  ? 87  ARG D C     1 
ATOM   5231 O O     . ARG D 1 101 ? -22.443 6.704   -3.436  1.00 21.06  ? 87  ARG D O     1 
ATOM   5232 C CB    . ARG D 1 101 ? -23.863 5.849   -6.322  1.00 20.22  ? 87  ARG D CB    1 
ATOM   5233 C CG    . ARG D 1 101 ? -25.224 5.846   -7.015  1.00 28.86  ? 87  ARG D CG    1 
ATOM   5234 C CD    . ARG D 1 101 ? -25.337 4.714   -8.034  1.00 30.35  ? 87  ARG D CD    1 
ATOM   5235 N NE    . ARG D 1 101 ? -26.697 4.212   -8.087  1.00 33.32  ? 87  ARG D NE    1 
ATOM   5236 C CZ    . ARG D 1 101 ? -27.008 2.943   -8.321  1.00 36.19  ? 87  ARG D CZ    1 
ATOM   5237 N NH1   . ARG D 1 101 ? -26.070 2.024   -8.538  1.00 26.87  ? 87  ARG D NH1   1 
ATOM   5238 N NH2   . ARG D 1 101 ? -28.267 2.581   -8.311  1.00 32.84  ? 87  ARG D NH2   1 
ATOM   5239 N N     . LEU D 1 102 ? -21.120 6.940   -5.243  1.00 21.23  ? 88  LEU D N     1 
ATOM   5240 C CA    . LEU D 1 102 ? -19.908 6.764   -4.449  1.00 20.32  ? 88  LEU D CA    1 
ATOM   5241 C C     . LEU D 1 102 ? -19.719 7.936   -3.470  1.00 24.92  ? 88  LEU D C     1 
ATOM   5242 O O     . LEU D 1 102 ? -19.377 7.741   -2.300  1.00 24.61  ? 88  LEU D O     1 
ATOM   5243 C CB    . LEU D 1 102 ? -18.697 6.612   -5.381  1.00 22.47  ? 88  LEU D CB    1 
ATOM   5244 C CG    . LEU D 1 102 ? -18.849 5.421   -6.338  1.00 21.19  ? 88  LEU D CG    1 
ATOM   5245 C CD1   . LEU D 1 102 ? -17.787 5.468   -7.402  1.00 25.97  ? 88  LEU D CD1   1 
ATOM   5246 C CD2   . LEU D 1 102 ? -18.770 4.114   -5.545  1.00 16.27  ? 88  LEU D CD2   1 
ATOM   5247 N N     . ARG D 1 103 ? -19.973 9.153   -3.939  1.00 18.83  ? 89  ARG D N     1 
ATOM   5248 C CA    . ARG D 1 103 ? -19.866 10.324  -3.104  1.00 21.20  ? 89  ARG D CA    1 
ATOM   5249 C C     . ARG D 1 103 ? -20.787 10.226  -1.881  1.00 25.03  ? 89  ARG D C     1 
ATOM   5250 O O     . ARG D 1 103 ? -20.356 10.447  -0.740  1.00 23.18  ? 89  ARG D O     1 
ATOM   5251 C CB    . ARG D 1 103 ? -20.232 11.538  -3.935  1.00 20.62  ? 89  ARG D CB    1 
ATOM   5252 C CG    . ARG D 1 103 ? -19.901 12.822  -3.275  1.00 22.73  ? 89  ARG D CG    1 
ATOM   5253 C CD    . ARG D 1 103 ? -20.384 14.004  -4.139  1.00 19.28  ? 89  ARG D CD    1 
ATOM   5254 N NE    . ARG D 1 103 ? -20.402 15.216  -3.326  1.00 32.37  ? 89  ARG D NE    1 
ATOM   5255 C CZ    . ARG D 1 103 ? -21.477 15.568  -2.635  1.00 38.33  ? 89  ARG D CZ    1 
ATOM   5256 N NH1   . ARG D 1 103 ? -22.542 14.805  -2.733  1.00 44.43  ? 89  ARG D NH1   1 
ATOM   5257 N NH2   . ARG D 1 103 ? -21.496 16.588  -1.788  1.00 32.02  ? 89  ARG D NH2   1 
ATOM   5258 N N     . LEU D 1 104 ? -22.062 9.899   -2.110  1.00 26.33  ? 90  LEU D N     1 
ATOM   5259 C CA    . LEU D 1 104 ? -23.012 9.793   -1.006  1.00 22.60  ? 90  LEU D CA    1 
ATOM   5260 C C     . LEU D 1 104 ? -22.654 8.661   -0.028  1.00 20.61  ? 90  LEU D C     1 
ATOM   5261 O O     . LEU D 1 104 ? -22.811 8.808   1.193   1.00 18.85  ? 90  LEU D O     1 
ATOM   5262 C CB    . LEU D 1 104 ? -24.452 9.625   -1.556  1.00 21.40  ? 90  LEU D CB    1 
ATOM   5263 C CG    . LEU D 1 104 ? -24.977 10.890  -2.252  1.00 27.76  ? 90  LEU D CG    1 
ATOM   5264 C CD1   . LEU D 1 104 ? -26.256 10.611  -3.017  1.00 27.26  ? 90  LEU D CD1   1 
ATOM   5265 C CD2   . LEU D 1 104 ? -25.194 11.975  -1.197  1.00 25.77  ? 90  LEU D CD2   1 
ATOM   5266 N N     . ILE D 1 105 ? -22.178 7.534   -0.544  1.00 17.83  ? 91  ILE D N     1 
ATOM   5267 C CA    . ILE D 1 105 ? -21.816 6.457   0.355   1.00 21.61  ? 91  ILE D CA    1 
ATOM   5268 C C     . ILE D 1 105 ? -20.635 6.881   1.269   1.00 23.94  ? 91  ILE D C     1 
ATOM   5269 O O     . ILE D 1 105 ? -20.638 6.630   2.482   1.00 24.21  ? 91  ILE D O     1 
ATOM   5270 C CB    . ILE D 1 105 ? -21.497 5.168   -0.465  1.00 21.94  ? 91  ILE D CB    1 
ATOM   5271 C CG1   . ILE D 1 105 ? -22.825 4.561   -0.984  1.00 22.50  ? 91  ILE D CG1   1 
ATOM   5272 C CG2   . ILE D 1 105 ? -20.774 4.144   0.414   1.00 15.95  ? 91  ILE D CG2   1 
ATOM   5273 C CD1   . ILE D 1 105 ? -22.645 3.456   -2.079  1.00 20.32  ? 91  ILE D CD1   1 
ATOM   5274 N N     . VAL D 1 106 ? -19.648 7.552   0.693   1.00 25.64  ? 92  VAL D N     1 
ATOM   5275 C CA    . VAL D 1 106 ? -18.506 8.028   1.460   1.00 23.41  ? 92  VAL D CA    1 
ATOM   5276 C C     . VAL D 1 106 ? -18.965 9.125   2.434   1.00 23.47  ? 92  VAL D C     1 
ATOM   5277 O O     . VAL D 1 106 ? -18.615 9.124   3.618   1.00 18.48  ? 92  VAL D O     1 
ATOM   5278 C CB    . VAL D 1 106 ? -17.403 8.524   0.505   1.00 24.91  ? 92  VAL D CB    1 
ATOM   5279 C CG1   . VAL D 1 106 ? -16.372 9.381   1.244   1.00 27.49  ? 92  VAL D CG1   1 
ATOM   5280 C CG2   . VAL D 1 106 ? -16.720 7.314   -0.130  1.00 28.45  ? 92  VAL D CG2   1 
ATOM   5281 N N     . LEU D 1 107 ? -19.776 10.053  1.955   1.00 22.98  ? 93  LEU D N     1 
ATOM   5282 C CA    . LEU D 1 107 ? -20.262 11.078  2.857   1.00 23.31  ? 93  LEU D CA    1 
ATOM   5283 C C     . LEU D 1 107 ? -21.031 10.425  4.010   1.00 25.69  ? 93  LEU D C     1 
ATOM   5284 O O     . LEU D 1 107 ? -20.868 10.817  5.162   1.00 26.48  ? 93  LEU D O     1 
ATOM   5285 C CB    . LEU D 1 107 ? -21.177 12.046  2.111   1.00 27.11  ? 93  LEU D CB    1 
ATOM   5286 C CG    . LEU D 1 107 ? -21.864 13.126  2.940   1.00 26.89  ? 93  LEU D CG    1 
ATOM   5287 C CD1   . LEU D 1 107 ? -20.810 13.982  3.663   1.00 24.32  ? 93  LEU D CD1   1 
ATOM   5288 C CD2   . LEU D 1 107 ? -22.746 13.941  2.024   1.00 24.19  ? 93  LEU D CD2   1 
ATOM   5289 N N     . LEU D 1 108 ? -21.852 9.420   3.702   1.00 25.80  ? 94  LEU D N     1 
ATOM   5290 C CA    . LEU D 1 108 ? -22.647 8.740   4.723   1.00 28.36  ? 94  LEU D CA    1 
ATOM   5291 C C     . LEU D 1 108 ? -21.771 8.134   5.785   1.00 26.21  ? 94  LEU D C     1 
ATOM   5292 O O     . LEU D 1 108 ? -22.064 8.225   6.988   1.00 24.24  ? 94  LEU D O     1 
ATOM   5293 C CB    . LEU D 1 108 ? -23.508 7.624   4.103   1.00 23.88  ? 94  LEU D CB    1 
ATOM   5294 C CG    . LEU D 1 108 ? -23.959 6.539   5.096   1.00 28.45  ? 94  LEU D CG    1 
ATOM   5295 C CD1   . LEU D 1 108 ? -25.065 7.113   5.979   1.00 30.89  ? 94  LEU D CD1   1 
ATOM   5296 C CD2   . LEU D 1 108 ? -24.433 5.281   4.368   1.00 27.22  ? 94  LEU D CD2   1 
ATOM   5297 N N     . ILE D 1 109 ? -20.704 7.478   5.353   1.00 27.57  ? 95  ILE D N     1 
ATOM   5298 C CA    . ILE D 1 109 ? -19.817 6.850   6.316   1.00 25.50  ? 95  ILE D CA    1 
ATOM   5299 C C     . ILE D 1 109 ? -19.190 7.921   7.204   1.00 23.57  ? 95  ILE D C     1 
ATOM   5300 O O     . ILE D 1 109 ? -19.194 7.826   8.441   1.00 25.86  ? 95  ILE D O     1 
ATOM   5301 C CB    . ILE D 1 109 ? -18.761 6.034   5.583   1.00 24.06  ? 95  ILE D CB    1 
ATOM   5302 C CG1   . ILE D 1 109 ? -19.458 4.826   4.931   1.00 19.75  ? 95  ILE D CG1   1 
ATOM   5303 C CG2   . ILE D 1 109 ? -17.614 5.676   6.545   1.00 17.94  ? 95  ILE D CG2   1 
ATOM   5304 C CD1   . ILE D 1 109 ? -18.631 4.152   3.783   1.00 22.99  ? 95  ILE D CD1   1 
ATOM   5305 N N     . LEU D 1 110 ? -18.704 8.975   6.573   1.00 28.45  ? 96  LEU D N     1 
ATOM   5306 C CA    . LEU D 1 110 ? -18.073 10.058  7.324   1.00 32.17  ? 96  LEU D CA    1 
ATOM   5307 C C     . LEU D 1 110 ? -19.058 10.759  8.257   1.00 28.79  ? 96  LEU D C     1 
ATOM   5308 O O     . LEU D 1 110 ? -18.735 11.046  9.407   1.00 27.53  ? 96  LEU D O     1 
ATOM   5309 C CB    . LEU D 1 110 ? -17.430 11.044  6.348   1.00 23.08  ? 96  LEU D CB    1 
ATOM   5310 C CG    . LEU D 1 110 ? -16.267 10.424  5.556   1.00 26.57  ? 96  LEU D CG    1 
ATOM   5311 C CD1   . LEU D 1 110 ? -15.561 11.513  4.777   1.00 32.50  ? 96  LEU D CD1   1 
ATOM   5312 C CD2   . LEU D 1 110 ? -15.280 9.734   6.516   1.00 22.14  ? 96  LEU D CD2   1 
ATOM   5313 N N     . GLY D 1 111 ? -20.264 11.010  7.761   1.00 30.29  ? 97  GLY D N     1 
ATOM   5314 C CA    . GLY D 1 111 ? -21.271 11.665  8.572   1.00 24.46  ? 97  GLY D CA    1 
ATOM   5315 C C     . GLY D 1 111 ? -21.760 10.794  9.702   1.00 24.18  ? 97  GLY D C     1 
ATOM   5316 O O     . GLY D 1 111 ? -22.026 11.281  10.787  1.00 24.12  ? 97  GLY D O     1 
ATOM   5317 N N     . PHE D 1 112 ? -21.900 9.497   9.458   1.00 26.06  ? 98  PHE D N     1 
ATOM   5318 C CA    . PHE D 1 112 ? -22.331 8.609   10.526  1.00 26.05  ? 98  PHE D CA    1 
ATOM   5319 C C     . PHE D 1 112 ? -21.292 8.616   11.644  1.00 25.50  ? 98  PHE D C     1 
ATOM   5320 O O     . PHE D 1 112 ? -21.613 8.678   12.850  1.00 24.05  ? 98  PHE D O     1 
ATOM   5321 C CB    . PHE D 1 112 ? -22.462 7.182   10.013  1.00 27.11  ? 98  PHE D CB    1 
ATOM   5322 C CG    . PHE D 1 112 ? -22.976 6.228   11.055  1.00 35.96  ? 98  PHE D CG    1 
ATOM   5323 C CD1   . PHE D 1 112 ? -24.331 6.150   11.333  1.00 26.58  ? 98  PHE D CD1   1 
ATOM   5324 C CD2   . PHE D 1 112 ? -22.100 5.442   11.790  1.00 29.67  ? 98  PHE D CD2   1 
ATOM   5325 C CE1   . PHE D 1 112 ? -24.802 5.293   12.323  1.00 29.20  ? 98  PHE D CE1   1 
ATOM   5326 C CE2   . PHE D 1 112 ? -22.579 4.583   12.786  1.00 30.39  ? 98  PHE D CE2   1 
ATOM   5327 C CZ    . PHE D 1 112 ? -23.929 4.519   13.047  1.00 26.95  ? 98  PHE D CZ    1 
ATOM   5328 N N     . GLY D 1 113 ? -20.029 8.520   11.233  1.00 21.00  ? 99  GLY D N     1 
ATOM   5329 C CA    . GLY D 1 113 ? -18.966 8.515   12.212  1.00 21.07  ? 99  GLY D CA    1 
ATOM   5330 C C     . GLY D 1 113 ? -18.970 9.802   13.000  1.00 21.11  ? 99  GLY D C     1 
ATOM   5331 O O     . GLY D 1 113 ? -18.875 9.803   14.234  1.00 20.06  ? 99  GLY D O     1 
ATOM   5332 N N     . GLU D 1 114 ? -19.089 10.918  12.296  1.00 23.56  ? 100 GLU D N     1 
ATOM   5333 C CA    . GLU D 1 114 ? -19.082 12.208  12.979  1.00 26.00  ? 100 GLU D CA    1 
ATOM   5334 C C     . GLU D 1 114 ? -20.202 12.402  14.044  1.00 31.16  ? 100 GLU D C     1 
ATOM   5335 O O     . GLU D 1 114 ? -19.946 12.907  15.137  1.00 30.82  ? 100 GLU D O     1 
ATOM   5336 C CB    . GLU D 1 114 ? -19.143 13.312  11.924  1.00 26.81  ? 100 GLU D CB    1 
ATOM   5337 C CG    . GLU D 1 114 ? -18.876 14.683  12.507  1.00 28.15  ? 100 GLU D CG    1 
ATOM   5338 C CD    . GLU D 1 114 ? -18.621 15.745  11.454  1.00 30.17  ? 100 GLU D CD    1 
ATOM   5339 O OE1   . GLU D 1 114 ? -17.951 15.462  10.438  1.00 32.91  ? 100 GLU D OE1   1 
ATOM   5340 O OE2   . GLU D 1 114 ? -19.067 16.885  11.663  1.00 32.44  ? 100 GLU D OE2   1 
ATOM   5341 N N     . ARG D 1 115 ? -21.435 12.004  13.724  1.00 29.90  ? 101 ARG D N     1 
ATOM   5342 C CA    . ARG D 1 115 ? -22.561 12.147  14.642  1.00 30.35  ? 101 ARG D CA    1 
ATOM   5343 C C     . ARG D 1 115 ? -22.585 11.091  15.748  1.00 31.93  ? 101 ARG D C     1 
ATOM   5344 O O     . ARG D 1 115 ? -23.405 11.164  16.649  1.00 32.57  ? 101 ARG D O     1 
ATOM   5345 C CB    . ARG D 1 115 ? -23.877 12.033  13.879  1.00 30.57  ? 101 ARG D CB    1 
ATOM   5346 C CG    . ARG D 1 115 ? -24.045 12.964  12.709  1.00 35.71  ? 101 ARG D CG    1 
ATOM   5347 C CD    . ARG D 1 115 ? -25.358 12.636  11.991  1.00 37.56  ? 101 ARG D CD    1 
ATOM   5348 N NE    . ARG D 1 115 ? -25.179 11.830  10.769  1.00 47.35  ? 101 ARG D NE    1 
ATOM   5349 C CZ    . ARG D 1 115 ? -25.523 10.551  10.641  1.00 41.03  ? 101 ARG D CZ    1 
ATOM   5350 N NH1   . ARG D 1 115 ? -26.067 9.900   11.657  1.00 37.16  ? 101 ARG D NH1   1 
ATOM   5351 N NH2   . ARG D 1 115 ? -25.335 9.933   9.487   1.00 47.76  ? 101 ARG D NH2   1 
ATOM   5352 N N     . ASN D 1 116 ? -21.702 10.103  15.654  1.00 30.41  ? 102 ASN D N     1 
ATOM   5353 C CA    . ASN D 1 116 ? -21.619 8.996   16.613  1.00 28.57  ? 102 ASN D CA    1 
ATOM   5354 C C     . ASN D 1 116 ? -20.144 8.732   16.995  1.00 30.73  ? 102 ASN D C     1 
ATOM   5355 O O     . ASN D 1 116 ? -19.623 7.638   16.741  1.00 28.10  ? 102 ASN D O     1 
ATOM   5356 C CB    . ASN D 1 116 ? -22.200 7.723   15.964  1.00 27.56  ? 102 ASN D CB    1 
ATOM   5357 C CG    . ASN D 1 116 ? -23.682 7.841   15.660  1.00 30.37  ? 102 ASN D CG    1 
ATOM   5358 O OD1   . ASN D 1 116 ? -24.495 7.756   16.564  1.00 29.80  ? 102 ASN D OD1   1 
ATOM   5359 N ND2   . ASN D 1 116 ? -24.037 8.043   14.379  1.00 25.60  ? 102 ASN D ND2   1 
ATOM   5360 N N     . PRO D 1 117 ? -19.468 9.709   17.632  1.00 27.21  ? 103 PRO D N     1 
ATOM   5361 C CA    . PRO D 1 117 ? -18.055 9.566   18.036  1.00 23.60  ? 103 PRO D CA    1 
ATOM   5362 C C     . PRO D 1 117 ? -17.780 8.262   18.765  1.00 28.33  ? 103 PRO D C     1 
ATOM   5363 O O     . PRO D 1 117 ? -16.816 7.551   18.435  1.00 27.85  ? 103 PRO D O     1 
ATOM   5364 C CB    . PRO D 1 117 ? -17.823 10.771  18.938  1.00 27.14  ? 103 PRO D CB    1 
ATOM   5365 C CG    . PRO D 1 117 ? -18.835 11.768  18.471  1.00 31.91  ? 103 PRO D CG    1 
ATOM   5366 C CD    . PRO D 1 117 ? -20.060 10.905  18.245  1.00 26.19  ? 103 PRO D CD    1 
ATOM   5367 N N     . GLY D 1 118 ? -18.626 7.958   19.759  1.00 26.20  ? 104 GLY D N     1 
ATOM   5368 C CA    . GLY D 1 118 ? -18.480 6.732   20.534  1.00 25.34  ? 104 GLY D CA    1 
ATOM   5369 C C     . GLY D 1 118 ? -18.478 5.488   19.665  1.00 24.06  ? 104 GLY D C     1 
ATOM   5370 O O     . GLY D 1 118 ? -17.672 4.593   19.857  1.00 28.75  ? 104 GLY D O     1 
ATOM   5371 N N     . LEU D 1 119 ? -19.381 5.425   18.696  1.00 26.01  ? 105 LEU D N     1 
ATOM   5372 C CA    . LEU D 1 119 ? -19.433 4.269   17.842  1.00 22.11  ? 105 LEU D CA    1 
ATOM   5373 C C     . LEU D 1 119 ? -18.247 4.253   16.864  1.00 22.45  ? 105 LEU D C     1 
ATOM   5374 O O     . LEU D 1 119 ? -17.802 3.193   16.446  1.00 21.22  ? 105 LEU D O     1 
ATOM   5375 C CB    . LEU D 1 119 ? -20.773 4.241   17.088  1.00 26.96  ? 105 LEU D CB    1 
ATOM   5376 C CG    . LEU D 1 119 ? -22.036 4.149   17.954  1.00 29.22  ? 105 LEU D CG    1 
ATOM   5377 C CD1   . LEU D 1 119 ? -23.247 4.024   17.059  1.00 26.18  ? 105 LEU D CD1   1 
ATOM   5378 C CD2   . LEU D 1 119 ? -21.965 2.966   18.891  1.00 25.72  ? 105 LEU D CD2   1 
ATOM   5379 N N     . THR D 1 120 ? -17.735 5.423   16.492  1.00 20.54  ? 106 THR D N     1 
ATOM   5380 C CA    . THR D 1 120 ? -16.599 5.476   15.580  1.00 26.14  ? 106 THR D CA    1 
ATOM   5381 C C     . THR D 1 120 ? -15.393 4.783   16.236  1.00 25.83  ? 106 THR D C     1 
ATOM   5382 O O     . THR D 1 120 ? -14.602 4.131   15.539  1.00 22.44  ? 106 THR D O     1 
ATOM   5383 C CB    . THR D 1 120 ? -16.217 6.933   15.225  1.00 27.15  ? 106 THR D CB    1 
ATOM   5384 O OG1   . THR D 1 120 ? -17.311 7.558   14.541  1.00 27.71  ? 106 THR D OG1   1 
ATOM   5385 C CG2   . THR D 1 120 ? -14.987 6.961   14.342  1.00 22.22  ? 106 THR D CG2   1 
ATOM   5386 N N     . ARG D 1 121 ? -15.275 4.943   17.568  1.00 25.19  ? 107 ARG D N     1 
ATOM   5387 C CA    . ARG D 1 121 ? -14.220 4.333   18.372  1.00 25.24  ? 107 ARG D CA    1 
ATOM   5388 C C     . ARG D 1 121 ? -14.320 2.824   18.238  1.00 27.26  ? 107 ARG D C     1 
ATOM   5389 O O     . ARG D 1 121 ? -13.343 2.114   18.428  1.00 28.46  ? 107 ARG D O     1 
ATOM   5390 C CB    . ARG D 1 121 ? -14.351 4.741   19.844  1.00 29.16  ? 107 ARG D CB    1 
ATOM   5391 C CG    . ARG D 1 121 ? -13.212 5.633   20.352  1.00 31.64  ? 107 ARG D CG    1 
ATOM   5392 C CD    . ARG D 1 121 ? -13.432 6.184   21.781  1.00 37.76  ? 107 ARG D CD    1 
ATOM   5393 N NE    . ARG D 1 121 ? -12.465 7.246   22.120  1.00 38.35  ? 107 ARG D NE    1 
ATOM   5394 C CZ    . ARG D 1 121 ? -12.775 8.365   22.778  1.00 33.44  ? 107 ARG D CZ    1 
ATOM   5395 N NH1   . ARG D 1 121 ? -14.017 8.582   23.181  1.00 34.88  ? 107 ARG D NH1   1 
ATOM   5396 N NH2   . ARG D 1 121 ? -11.857 9.292   23.013  1.00 42.09  ? 107 ARG D NH2   1 
ATOM   5397 N N     . ILE D 1 122 ? -15.506 2.322   17.910  1.00 27.42  ? 108 ILE D N     1 
ATOM   5398 C CA    . ILE D 1 122 ? -15.654 0.883   17.693  1.00 26.73  ? 108 ILE D CA    1 
ATOM   5399 C C     . ILE D 1 122 ? -15.248 0.602   16.253  1.00 25.43  ? 108 ILE D C     1 
ATOM   5400 O O     . ILE D 1 122 ? -14.484 -0.335  15.985  1.00 27.27  ? 108 ILE D O     1 
ATOM   5401 C CB    . ILE D 1 122 ? -17.103 0.405   17.906  1.00 26.03  ? 108 ILE D CB    1 
ATOM   5402 C CG1   . ILE D 1 122 ? -17.456 0.507   19.400  1.00 24.93  ? 108 ILE D CG1   1 
ATOM   5403 C CG2   . ILE D 1 122 ? -17.253 -1.039  17.408  1.00 23.47  ? 108 ILE D CG2   1 
ATOM   5404 C CD1   . ILE D 1 122 ? -18.970 0.393   19.710  1.00 19.57  ? 108 ILE D CD1   1 
ATOM   5405 N N     . LEU D 1 123 ? -15.742 1.433   15.335  1.00 21.43  ? 109 LEU D N     1 
ATOM   5406 C CA    . LEU D 1 123 ? -15.441 1.303   13.916  1.00 25.29  ? 109 LEU D CA    1 
ATOM   5407 C C     . LEU D 1 123 ? -13.936 1.332   13.623  1.00 26.44  ? 109 LEU D C     1 
ATOM   5408 O O     . LEU D 1 123 ? -13.467 0.625   12.726  1.00 24.86  ? 109 LEU D O     1 
ATOM   5409 C CB    . LEU D 1 123 ? -16.093 2.433   13.120  1.00 27.14  ? 109 LEU D CB    1 
ATOM   5410 C CG    . LEU D 1 123 ? -17.375 2.191   12.333  1.00 34.31  ? 109 LEU D CG    1 
ATOM   5411 C CD1   . LEU D 1 123 ? -17.674 3.458   11.564  1.00 26.59  ? 109 LEU D CD1   1 
ATOM   5412 C CD2   . LEU D 1 123 ? -17.228 0.995   11.386  1.00 27.89  ? 109 LEU D CD2   1 
ATOM   5413 N N     . THR D 1 124 ? -13.196 2.178   14.341  1.00 25.59  ? 110 THR D N     1 
ATOM   5414 C CA    . THR D 1 124 ? -11.754 2.277   14.140  1.00 26.15  ? 110 THR D CA    1 
ATOM   5415 C C     . THR D 1 124 ? -10.986 1.174   14.886  1.00 26.41  ? 110 THR D C     1 
ATOM   5416 O O     . THR D 1 124 ? -9.775  1.043   14.713  1.00 27.63  ? 110 THR D O     1 
ATOM   5417 C CB    . THR D 1 124 ? -11.200 3.645   14.598  1.00 25.30  ? 110 THR D CB    1 
ATOM   5418 O OG1   . THR D 1 124 ? -11.483 3.837   15.994  1.00 23.93  ? 110 THR D OG1   1 
ATOM   5419 C CG2   . THR D 1 124 ? -11.807 4.765   13.783  1.00 24.09  ? 110 THR D CG2   1 
ATOM   5420 N N     . GLY D 1 125 ? -11.672 0.415   15.739  1.00 24.45  ? 111 GLY D N     1 
ATOM   5421 C CA    . GLY D 1 125 ? -11.020 -0.677  16.436  1.00 20.97  ? 111 GLY D CA    1 
ATOM   5422 C C     . GLY D 1 125 ? -10.407 -0.363  17.789  1.00 24.80  ? 111 GLY D C     1 
ATOM   5423 O O     . GLY D 1 125 ? -10.026 -1.277  18.521  1.00 21.10  ? 111 GLY D O     1 
ATOM   5424 N N     . HIS D 1 126 ? -10.297 0.919   18.132  1.00 23.27  ? 112 HIS D N     1 
ATOM   5425 C CA    . HIS D 1 126 ? -9.720  1.299   19.412  1.00 25.33  ? 112 HIS D CA    1 
ATOM   5426 C C     . HIS D 1 126 ? -10.512 0.807   20.617  1.00 28.28  ? 112 HIS D C     1 
ATOM   5427 O O     . HIS D 1 126 ? -9.932  0.238   21.532  1.00 26.79  ? 112 HIS D O     1 
ATOM   5428 C CB    . HIS D 1 126 ? -9.565  2.816   19.482  1.00 24.51  ? 112 HIS D CB    1 
ATOM   5429 C CG    . HIS D 1 126 ? -8.688  3.364   18.402  1.00 33.05  ? 112 HIS D CG    1 
ATOM   5430 N ND1   . HIS D 1 126 ? -9.136  3.554   17.112  1.00 30.25  ? 112 HIS D ND1   1 
ATOM   5431 C CD2   . HIS D 1 126 ? -7.363  3.650   18.390  1.00 29.16  ? 112 HIS D CD2   1 
ATOM   5432 C CE1   . HIS D 1 126 ? -8.123  3.930   16.350  1.00 29.21  ? 112 HIS D CE1   1 
ATOM   5433 N NE2   . HIS D 1 126 ? -7.036  3.993   17.099  1.00 27.01  ? 112 HIS D NE2   1 
ATOM   5434 N N     . ALA D 1 127 ? -11.836 1.021   20.621  1.00 25.18  ? 113 ALA D N     1 
ATOM   5435 C CA    . ALA D 1 127 ? -12.659 0.611   21.758  1.00 26.46  ? 113 ALA D CA    1 
ATOM   5436 C C     . ALA D 1 127 ? -12.711 -0.911  21.895  1.00 28.74  ? 113 ALA D C     1 
ATOM   5437 O O     . ALA D 1 127 ? -13.035 -1.429  22.959  1.00 31.84  ? 113 ALA D O     1 
ATOM   5438 C CB    . ALA D 1 127 ? -14.091 1.172   21.622  1.00 21.24  ? 113 ALA D CB    1 
ATOM   5439 N N     . LEU D 1 128 ? -12.396 -1.624  20.820  1.00 26.38  ? 114 LEU D N     1 
ATOM   5440 C CA    . LEU D 1 128 ? -12.426 -3.087  20.843  1.00 26.04  ? 114 LEU D CA    1 
ATOM   5441 C C     . LEU D 1 128 ? -11.149 -3.717  21.420  1.00 27.11  ? 114 LEU D C     1 
ATOM   5442 O O     . LEU D 1 128 ? -11.089 -4.933  21.626  1.00 24.96  ? 114 LEU D O     1 
ATOM   5443 C CB    . LEU D 1 128 ? -12.677 -3.614  19.422  1.00 26.76  ? 114 LEU D CB    1 
ATOM   5444 C CG    . LEU D 1 128 ? -14.001 -3.141  18.791  1.00 26.99  ? 114 LEU D CG    1 
ATOM   5445 C CD1   . LEU D 1 128 ? -14.185 -3.723  17.378  1.00 24.19  ? 114 LEU D CD1   1 
ATOM   5446 C CD2   . LEU D 1 128 ? -15.149 -3.553  19.713  1.00 20.82  ? 114 LEU D CD2   1 
ATOM   5447 N N     . MET D 1 129 ? -10.130 -2.887  21.667  1.00 22.88  ? 115 MET D N     1 
ATOM   5448 C CA    . MET D 1 129 ? -8.865  -3.376  22.200  1.00 25.79  ? 115 MET D CA    1 
ATOM   5449 C C     . MET D 1 129 ? -9.076  -4.013  23.588  1.00 31.37  ? 115 MET D C     1 
ATOM   5450 O O     . MET D 1 129 ? -8.407  -4.969  23.973  1.00 30.56  ? 115 MET D O     1 
ATOM   5451 C CB    . MET D 1 129 ? -7.853  -2.220  22.288  1.00 22.26  ? 115 MET D CB    1 
ATOM   5452 C CG    . MET D 1 129 ? -7.303  -1.697  20.931  1.00 20.03  ? 115 MET D CG    1 
ATOM   5453 S SD    . MET D 1 129 ? -6.648  -3.034  19.905  1.00 28.64  ? 115 MET D SD    1 
ATOM   5454 C CE    . MET D 1 129 ? -5.209  -3.507  20.939  1.00 28.22  ? 115 MET D CE    1 
ATOM   5455 N N     . PHE D 1 130 ? -10.032 -3.483  24.328  1.00 31.37  ? 116 PHE D N     1 
ATOM   5456 C CA    . PHE D 1 130 ? -10.318 -3.984  25.667  1.00 35.45  ? 116 PHE D CA    1 
ATOM   5457 C C     . PHE D 1 130 ? -11.261 -5.178  25.631  1.00 33.14  ? 116 PHE D C     1 
ATOM   5458 O O     . PHE D 1 130 ? -11.474 -5.831  26.637  1.00 34.03  ? 116 PHE D O     1 
ATOM   5459 C CB    . PHE D 1 130 ? -10.986 -2.887  26.487  1.00 30.21  ? 116 PHE D CB    1 
ATOM   5460 C CG    . PHE D 1 130 ? -10.232 -1.613  26.491  1.00 29.40  ? 116 PHE D CG    1 
ATOM   5461 C CD1   . PHE D 1 130 ? -10.766 -0.481  25.898  1.00 24.50  ? 116 PHE D CD1   1 
ATOM   5462 C CD2   . PHE D 1 130 ? -8.993  -1.529  27.129  1.00 27.21  ? 116 PHE D CD2   1 
ATOM   5463 C CE1   . PHE D 1 130 ? -10.073 0.742   25.925  1.00 24.45  ? 116 PHE D CE1   1 
ATOM   5464 C CE2   . PHE D 1 130 ? -8.285  -0.306  27.167  1.00 26.70  ? 116 PHE D CE2   1 
ATOM   5465 C CZ    . PHE D 1 130 ? -8.836  0.828   26.564  1.00 24.32  ? 116 PHE D CZ    1 
ATOM   5466 N N     . GLU D 1 131 ? -11.801 -5.466  24.454  1.00 33.45  ? 117 GLU D N     1 
ATOM   5467 C CA    . GLU D 1 131 ? -12.796 -6.522  24.300  1.00 34.98  ? 117 GLU D CA    1 
ATOM   5468 C C     . GLU D 1 131 ? -12.321 -7.786  23.590  1.00 33.86  ? 117 GLU D C     1 
ATOM   5469 O O     . GLU D 1 131 ? -11.171 -7.874  23.158  1.00 38.07  ? 117 GLU D O     1 
ATOM   5470 C CB    . GLU D 1 131 ? -13.985 -5.928  23.545  1.00 30.63  ? 117 GLU D CB    1 
ATOM   5471 C CG    . GLU D 1 131 ? -15.113 -5.451  24.398  1.00 46.13  ? 117 GLU D CG    1 
ATOM   5472 C CD    . GLU D 1 131 ? -14.666 -4.672  25.596  1.00 48.61  ? 117 GLU D CD    1 
ATOM   5473 O OE1   . GLU D 1 131 ? -14.092 -3.579  25.403  1.00 60.50  ? 117 GLU D OE1   1 
ATOM   5474 O OE2   . GLU D 1 131 ? -14.900 -5.155  26.724  1.00 32.25  ? 117 GLU D OE2   1 
ATOM   5475 N N     . GLN D 1 132 ? -13.230 -8.755  23.464  1.00 38.74  ? 118 GLN D N     1 
ATOM   5476 C CA    . GLN D 1 132 ? -12.940 -10.026 22.798  1.00 43.96  ? 118 GLN D CA    1 
ATOM   5477 C C     . GLN D 1 132 ? -12.571 -9.755  21.332  1.00 45.41  ? 118 GLN D C     1 
ATOM   5478 O O     . GLN D 1 132 ? -13.188 -8.909  20.672  1.00 43.07  ? 118 GLN D O     1 
ATOM   5479 C CB    . GLN D 1 132 ? -14.169 -10.942 22.871  1.00 43.95  ? 118 GLN D CB    1 
ATOM   5480 C CG    . GLN D 1 132 ? -13.866 -12.452 22.889  1.00 61.39  ? 118 GLN D CG    1 
ATOM   5481 C CD    . GLN D 1 132 ? -13.077 -12.964 21.665  1.00 68.56  ? 118 GLN D CD    1 
ATOM   5482 O OE1   . GLN D 1 132 ? -13.381 -12.625 20.525  1.00 69.91  ? 118 GLN D OE1   1 
ATOM   5483 N NE2   . GLN D 1 132 ? -12.078 -13.808 21.912  1.00 71.81  ? 118 GLN D NE2   1 
ATOM   5484 N N     . ASP D 1 133 ? -11.574 -10.474 20.821  1.00 48.29  ? 119 ASP D N     1 
ATOM   5485 C CA    . ASP D 1 133 ? -11.120 -10.287 19.440  1.00 48.31  ? 119 ASP D CA    1 
ATOM   5486 C C     . ASP D 1 133 ? -12.131 -10.504 18.318  1.00 47.61  ? 119 ASP D C     1 
ATOM   5487 O O     . ASP D 1 133 ? -11.986 -9.901  17.249  1.00 50.42  ? 119 ASP D O     1 
ATOM   5488 C CB    . ASP D 1 133 ? -9.911  -11.168 19.141  1.00 48.84  ? 119 ASP D CB    1 
ATOM   5489 C CG    . ASP D 1 133 ? -8.692  -10.781 19.946  1.00 53.65  ? 119 ASP D CG    1 
ATOM   5490 O OD1   . ASP D 1 133 ? -8.531  -9.589  20.273  1.00 54.23  ? 119 ASP D OD1   1 
ATOM   5491 O OD2   . ASP D 1 133 ? -7.876  -11.673 20.233  1.00 62.19  ? 119 ASP D OD2   1 
ATOM   5492 N N     . ARG D 1 134 ? -13.135 -11.354 18.530  1.00 43.44  ? 120 ARG D N     1 
ATOM   5493 C CA    . ARG D 1 134 ? -14.104 -11.613 17.468  1.00 43.24  ? 120 ARG D CA    1 
ATOM   5494 C C     . ARG D 1 134 ? -14.886 -10.373 17.084  1.00 36.25  ? 120 ARG D C     1 
ATOM   5495 O O     . ARG D 1 134 ? -15.360 -10.263 15.961  1.00 41.39  ? 120 ARG D O     1 
ATOM   5496 C CB    . ARG D 1 134 ? -15.065 -12.754 17.828  1.00 47.12  ? 120 ARG D CB    1 
ATOM   5497 C CG    . ARG D 1 134 ? -15.782 -12.621 19.147  1.00 58.90  ? 120 ARG D CG    1 
ATOM   5498 C CD    . ARG D 1 134 ? -16.871 -13.673 19.274  1.00 61.73  ? 120 ARG D CD    1 
ATOM   5499 N NE    . ARG D 1 134 ? -18.128 -13.201 18.699  1.00 67.46  ? 120 ARG D NE    1 
ATOM   5500 C CZ    . ARG D 1 134 ? -18.802 -12.145 19.156  1.00 70.34  ? 120 ARG D CZ    1 
ATOM   5501 N NH1   . ARG D 1 134 ? -18.341 -11.452 20.192  1.00 73.44  ? 120 ARG D NH1   1 
ATOM   5502 N NH2   . ARG D 1 134 ? -19.941 -11.777 18.588  1.00 71.38  ? 120 ARG D NH2   1 
ATOM   5503 N N     . LEU D 1 135 ? -15.014 -9.431  18.000  1.00 30.83  ? 121 LEU D N     1 
ATOM   5504 C CA    . LEU D 1 135 ? -15.717 -8.205  17.677  1.00 32.66  ? 121 LEU D CA    1 
ATOM   5505 C C     . LEU D 1 135 ? -15.009 -7.436  16.543  1.00 34.25  ? 121 LEU D C     1 
ATOM   5506 O O     . LEU D 1 135 ? -15.684 -6.910  15.644  1.00 32.81  ? 121 LEU D O     1 
ATOM   5507 C CB    . LEU D 1 135 ? -15.840 -7.326  18.919  1.00 30.15  ? 121 LEU D CB    1 
ATOM   5508 C CG    . LEU D 1 135 ? -16.694 -7.895  20.065  1.00 36.45  ? 121 LEU D CG    1 
ATOM   5509 C CD1   . LEU D 1 135 ? -16.376 -7.146  21.322  1.00 30.36  ? 121 LEU D CD1   1 
ATOM   5510 C CD2   . LEU D 1 135 ? -18.191 -7.791  19.752  1.00 27.69  ? 121 LEU D CD2   1 
ATOM   5511 N N     . GLN D 1 136 ? -13.669 -7.374  16.561  1.00 31.22  ? 122 GLN D N     1 
ATOM   5512 C CA    . GLN D 1 136 ? -12.953 -6.652  15.501  1.00 32.73  ? 122 GLN D CA    1 
ATOM   5513 C C     . GLN D 1 136 ? -13.207 -7.372  14.181  1.00 30.19  ? 122 GLN D C     1 
ATOM   5514 O O     . GLN D 1 136 ? -13.403 -6.738  13.132  1.00 21.49  ? 122 GLN D O     1 
ATOM   5515 C CB    . GLN D 1 136 ? -11.444 -6.571  15.799  1.00 29.33  ? 122 GLN D CB    1 
ATOM   5516 C CG    . GLN D 1 136 ? -10.599 -5.958  14.683  1.00 31.62  ? 122 GLN D CG    1 
ATOM   5517 C CD    . GLN D 1 136 ? -10.954 -4.503  14.411  1.00 34.64  ? 122 GLN D CD    1 
ATOM   5518 O OE1   . GLN D 1 136 ? -11.221 -4.100  13.257  1.00 33.12  ? 122 GLN D OE1   1 
ATOM   5519 N NE2   . GLN D 1 136 ? -10.967 -3.706  15.469  1.00 33.02  ? 122 GLN D NE2   1 
ATOM   5520 N N     . GLY D 1 137 ? -13.231 -8.701  14.244  1.00 28.56  ? 123 GLY D N     1 
ATOM   5521 C CA    . GLY D 1 137 ? -13.500 -9.486  13.052  1.00 27.71  ? 123 GLY D CA    1 
ATOM   5522 C C     . GLY D 1 137 ? -14.862 -9.111  12.473  1.00 29.59  ? 123 GLY D C     1 
ATOM   5523 O O     . GLY D 1 137 ? -15.025 -9.030  11.257  1.00 32.34  ? 123 GLY D O     1 
ATOM   5524 N N     . ARG D 1 138 ? -15.837 -8.878  13.339  1.00 25.53  ? 124 ARG D N     1 
ATOM   5525 C CA    . ARG D 1 138 ? -17.167 -8.475  12.894  1.00 31.52  ? 124 ARG D CA    1 
ATOM   5526 C C     . ARG D 1 138 ? -17.070 -7.120  12.203  1.00 29.90  ? 124 ARG D C     1 
ATOM   5527 O O     . ARG D 1 138 ? -17.776 -6.858  11.239  1.00 32.88  ? 124 ARG D O     1 
ATOM   5528 C CB    . ARG D 1 138 ? -18.123 -8.364  14.094  1.00 36.60  ? 124 ARG D CB    1 
ATOM   5529 C CG    . ARG D 1 138 ? -19.221 -9.399  14.134  1.00 40.78  ? 124 ARG D CG    1 
ATOM   5530 C CD    . ARG D 1 138 ? -20.605 -8.748  14.059  1.00 44.68  ? 124 ARG D CD    1 
ATOM   5531 N NE    . ARG D 1 138 ? -21.275 -8.728  15.352  1.00 48.58  ? 124 ARG D NE    1 
ATOM   5532 C CZ    . ARG D 1 138 ? -22.565 -8.450  15.529  1.00 49.16  ? 124 ARG D CZ    1 
ATOM   5533 N NH1   . ARG D 1 138 ? -23.349 -8.164  14.497  1.00 41.57  ? 124 ARG D NH1   1 
ATOM   5534 N NH2   . ARG D 1 138 ? -23.067 -8.443  16.753  1.00 43.82  ? 124 ARG D NH2   1 
ATOM   5535 N N     . ILE D 1 139 ? -16.207 -6.242  12.707  1.00 31.11  ? 125 ILE D N     1 
ATOM   5536 C CA    . ILE D 1 139 ? -16.056 -4.935  12.083  1.00 26.21  ? 125 ILE D CA    1 
ATOM   5537 C C     . ILE D 1 139 ? -15.407 -5.136  10.729  1.00 25.20  ? 125 ILE D C     1 
ATOM   5538 O O     . ILE D 1 139 ? -15.812 -4.506  9.753   1.00 25.72  ? 125 ILE D O     1 
ATOM   5539 C CB    . ILE D 1 139 ? -15.223 -3.988  12.973  1.00 33.37  ? 125 ILE D CB    1 
ATOM   5540 C CG1   . ILE D 1 139 ? -16.082 -3.599  14.169  1.00 31.53  ? 125 ILE D CG1   1 
ATOM   5541 C CG2   . ILE D 1 139 ? -14.779 -2.714  12.204  1.00 23.33  ? 125 ILE D CG2   1 
ATOM   5542 C CD1   . ILE D 1 139 ? -17.360 -2.925  13.764  1.00 33.15  ? 125 ILE D CD1   1 
ATOM   5543 N N     . ASN D 1 140 ? -14.411 -6.015  10.653  1.00 22.97  ? 126 ASN D N     1 
ATOM   5544 C CA    . ASN D 1 140 ? -13.810 -6.281  9.368   1.00 22.73  ? 126 ASN D CA    1 
ATOM   5545 C C     . ASN D 1 140 ? -14.861 -6.826  8.384   1.00 26.19  ? 126 ASN D C     1 
ATOM   5546 O O     . ASN D 1 140 ? -14.772 -6.588  7.174   1.00 28.09  ? 126 ASN D O     1 
ATOM   5547 C CB    . ASN D 1 140 ? -12.646 -7.266  9.481   1.00 25.62  ? 126 ASN D CB    1 
ATOM   5548 C CG    . ASN D 1 140 ? -11.467 -6.684  10.233  1.00 27.30  ? 126 ASN D CG    1 
ATOM   5549 O OD1   . ASN D 1 140 ? -11.272 -5.471  10.262  1.00 25.09  ? 126 ASN D OD1   1 
ATOM   5550 N ND2   . ASN D 1 140 ? -10.675 -7.543  10.836  1.00 23.59  ? 126 ASN D ND2   1 
ATOM   5551 N N     . GLN D 1 141 ? -15.860 -7.547  8.871   1.00 26.70  ? 127 GLN D N     1 
ATOM   5552 C CA    . GLN D 1 141 ? -16.874 -8.030  7.933   1.00 30.35  ? 127 GLN D CA    1 
ATOM   5553 C C     . GLN D 1 141 ? -17.715 -6.861  7.378   1.00 24.39  ? 127 GLN D C     1 
ATOM   5554 O O     . GLN D 1 141 ? -18.030 -6.839  6.186   1.00 21.57  ? 127 GLN D O     1 
ATOM   5555 C CB    . GLN D 1 141 ? -17.777 -9.065  8.596   1.00 33.22  ? 127 GLN D CB    1 
ATOM   5556 C CG    . GLN D 1 141 ? -17.090 -10.414 8.783   1.00 46.98  ? 127 GLN D CG    1 
ATOM   5557 C CD    . GLN D 1 141 ? -17.959 -11.427 9.519   1.00 52.49  ? 127 GLN D CD    1 
ATOM   5558 O OE1   . GLN D 1 141 ? -18.122 -11.360 10.746  1.00 57.46  ? 127 GLN D OE1   1 
ATOM   5559 N NE2   . GLN D 1 141 ? -18.530 -12.366 8.770   1.00 55.33  ? 127 GLN D NE2   1 
ATOM   5560 N N     . LEU D 1 142 ? -18.057 -5.893  8.230   1.00 20.19  ? 128 LEU D N     1 
ATOM   5561 C CA    . LEU D 1 142 ? -18.839 -4.725  7.793   1.00 21.46  ? 128 LEU D CA    1 
ATOM   5562 C C     . LEU D 1 142 ? -18.045 -4.027  6.686   1.00 21.55  ? 128 LEU D C     1 
ATOM   5563 O O     . LEU D 1 142 ? -18.551 -3.756  5.597   1.00 25.57  ? 128 LEU D O     1 
ATOM   5564 C CB    . LEU D 1 142 ? -19.035 -3.754  8.961   1.00 20.81  ? 128 LEU D CB    1 
ATOM   5565 C CG    . LEU D 1 142 ? -20.339 -2.956  9.058   1.00 34.28  ? 128 LEU D CG    1 
ATOM   5566 C CD1   . LEU D 1 142 ? -20.096 -1.624  9.792   1.00 26.99  ? 128 LEU D CD1   1 
ATOM   5567 C CD2   . LEU D 1 142 ? -20.917 -2.734  7.677   1.00 25.29  ? 128 LEU D CD2   1 
ATOM   5568 N N     . PHE D 1 143 ? -16.775 -3.745  6.969   1.00 25.49  ? 129 PHE D N     1 
ATOM   5569 C CA    . PHE D 1 143 ? -15.920 -3.102  5.991   1.00 23.30  ? 129 PHE D CA    1 
ATOM   5570 C C     . PHE D 1 143 ? -15.868 -3.851  4.649   1.00 23.36  ? 129 PHE D C     1 
ATOM   5571 O O     . PHE D 1 143 ? -15.944 -3.228  3.586   1.00 22.69  ? 129 PHE D O     1 
ATOM   5572 C CB    . PHE D 1 143 ? -14.513 -2.933  6.564   1.00 23.49  ? 129 PHE D CB    1 
ATOM   5573 C CG    . PHE D 1 143 ? -14.368 -1.736  7.440   1.00 21.15  ? 129 PHE D CG    1 
ATOM   5574 C CD1   . PHE D 1 143 ? -14.729 -0.483  6.964   1.00 25.62  ? 129 PHE D CD1   1 
ATOM   5575 C CD2   . PHE D 1 143 ? -13.880 -1.849  8.737   1.00 18.85  ? 129 PHE D CD2   1 
ATOM   5576 C CE1   . PHE D 1 143 ? -14.601 0.645   7.763   1.00 24.76  ? 129 PHE D CE1   1 
ATOM   5577 C CE2   . PHE D 1 143 ? -13.741 -0.727  9.553   1.00 24.59  ? 129 PHE D CE2   1 
ATOM   5578 C CZ    . PHE D 1 143 ? -14.109 0.527   9.071   1.00 20.96  ? 129 PHE D CZ    1 
ATOM   5579 N N     . GLU D 1 144 ? -15.729 -5.175  4.688   1.00 20.38  ? 130 GLU D N     1 
ATOM   5580 C CA    . GLU D 1 144 ? -15.690 -5.964  3.451   1.00 26.48  ? 130 GLU D CA    1 
ATOM   5581 C C     . GLU D 1 144 ? -17.051 -5.803  2.736   1.00 25.93  ? 130 GLU D C     1 
ATOM   5582 O O     . GLU D 1 144 ? -17.133 -5.639  1.506   1.00 25.58  ? 130 GLU D O     1 
ATOM   5583 C CB    . GLU D 1 144 ? -15.430 -7.448  3.775   1.00 26.30  ? 130 GLU D CB    1 
ATOM   5584 C CG    . GLU D 1 144 ? -14.004 -7.746  4.303   1.00 40.17  ? 130 GLU D CG    1 
ATOM   5585 C CD    . GLU D 1 144 ? -12.914 -7.263  3.347   1.00 44.26  ? 130 GLU D CD    1 
ATOM   5586 O OE1   . GLU D 1 144 ? -13.077 -7.462  2.111   1.00 45.41  ? 130 GLU D OE1   1 
ATOM   5587 O OE2   . GLU D 1 144 ? -11.900 -6.692  3.826   1.00 38.65  ? 130 GLU D OE2   1 
ATOM   5588 N N     . ARG D 1 145 ? -18.117 -5.836  3.527   1.00 26.24  ? 131 ARG D N     1 
ATOM   5589 C CA    . ARG D 1 145 ? -19.458 -5.676  2.988   1.00 24.79  ? 131 ARG D CA    1 
ATOM   5590 C C     . ARG D 1 145 ? -19.572 -4.344  2.260   1.00 27.39  ? 131 ARG D C     1 
ATOM   5591 O O     . ARG D 1 145 ? -20.039 -4.273  1.101   1.00 22.50  ? 131 ARG D O     1 
ATOM   5592 C CB    . ARG D 1 145 ? -20.466 -5.715  4.113   1.00 28.55  ? 131 ARG D CB    1 
ATOM   5593 C CG    . ARG D 1 145 ? -21.886 -5.665  3.648   1.00 37.49  ? 131 ARG D CG    1 
ATOM   5594 C CD    . ARG D 1 145 ? -22.477 -7.012  3.891   1.00 50.46  ? 131 ARG D CD    1 
ATOM   5595 N NE    . ARG D 1 145 ? -23.574 -6.920  4.841   1.00 54.27  ? 131 ARG D NE    1 
ATOM   5596 C CZ    . ARG D 1 145 ? -24.791 -6.510  4.519   1.00 52.25  ? 131 ARG D CZ    1 
ATOM   5597 N NH1   . ARG D 1 145 ? -25.050 -6.161  3.270   1.00 59.94  ? 131 ARG D NH1   1 
ATOM   5598 N NH2   . ARG D 1 145 ? -25.739 -6.452  5.440   1.00 51.12  ? 131 ARG D NH2   1 
ATOM   5599 N N     . ILE D 1 146 ? -19.142 -3.282  2.942   1.00 25.39  ? 132 ILE D N     1 
ATOM   5600 C CA    . ILE D 1 146 ? -19.176 -1.957  2.336   1.00 24.29  ? 132 ILE D CA    1 
ATOM   5601 C C     . ILE D 1 146 ? -18.273 -1.902  1.107   1.00 28.17  ? 132 ILE D C     1 
ATOM   5602 O O     . ILE D 1 146 ? -18.651 -1.340  0.070   1.00 28.14  ? 132 ILE D O     1 
ATOM   5603 C CB    . ILE D 1 146 ? -18.761 -0.880  3.359   1.00 21.98  ? 132 ILE D CB    1 
ATOM   5604 C CG1   . ILE D 1 146 ? -19.874 -0.728  4.383   1.00 21.78  ? 132 ILE D CG1   1 
ATOM   5605 C CG2   . ILE D 1 146 ? -18.434 0.459   2.648   1.00 18.26  ? 132 ILE D CG2   1 
ATOM   5606 C CD1   . ILE D 1 146 ? -19.454 0.014   5.645   1.00 32.62  ? 132 ILE D CD1   1 
ATOM   5607 N N     . GLU D 1 147 ? -17.083 -2.494  1.195   1.00 24.44  ? 133 GLU D N     1 
ATOM   5608 C CA    . GLU D 1 147 ? -16.186 -2.451  0.040   1.00 23.25  ? 133 GLU D CA    1 
ATOM   5609 C C     . GLU D 1 147 ? -16.773 -3.178  -1.171  1.00 23.15  ? 133 GLU D C     1 
ATOM   5610 O O     . GLU D 1 147 ? -16.640 -2.708  -2.302  1.00 21.54  ? 133 GLU D O     1 
ATOM   5611 C CB    . GLU D 1 147 ? -14.814 -3.038  0.412   1.00 21.81  ? 133 GLU D CB    1 
ATOM   5612 C CG    . GLU D 1 147 ? -13.703 -2.485  -0.420  1.00 31.92  ? 133 GLU D CG    1 
ATOM   5613 C CD    . GLU D 1 147 ? -12.356 -2.886  0.102   1.00 33.69  ? 133 GLU D CD    1 
ATOM   5614 O OE1   . GLU D 1 147 ? -12.176 -2.838  1.339   1.00 41.44  ? 133 GLU D OE1   1 
ATOM   5615 O OE2   . GLU D 1 147 ? -11.486 -3.239  -0.713  1.00 36.30  ? 133 GLU D OE2   1 
ATOM   5616 N N     . VAL D 1 148 ? -17.425 -4.320  -0.930  1.00 26.60  ? 134 VAL D N     1 
ATOM   5617 C CA    . VAL D 1 148 ? -18.041 -5.081  -2.006  1.00 26.45  ? 134 VAL D CA    1 
ATOM   5618 C C     . VAL D 1 148 ? -19.136 -4.252  -2.702  1.00 28.20  ? 134 VAL D C     1 
ATOM   5619 O O     . VAL D 1 148 ? -19.258 -4.298  -3.927  1.00 23.64  ? 134 VAL D O     1 
ATOM   5620 C CB    . VAL D 1 148 ? -18.660 -6.393  -1.478  1.00 27.74  ? 134 VAL D CB    1 
ATOM   5621 C CG1   . VAL D 1 148 ? -19.402 -7.114  -2.594  1.00 19.99  ? 134 VAL D CG1   1 
ATOM   5622 C CG2   . VAL D 1 148 ? -17.577 -7.289  -0.892  1.00 19.98  ? 134 VAL D CG2   1 
ATOM   5623 N N     . GLN D 1 149 ? -19.908 -3.490  -1.923  1.00 27.54  ? 135 GLN D N     1 
ATOM   5624 C CA    . GLN D 1 149 ? -20.978 -2.639  -2.467  1.00 28.91  ? 135 GLN D CA    1 
ATOM   5625 C C     . GLN D 1 149 ? -20.365 -1.603  -3.355  1.00 27.87  ? 135 GLN D C     1 
ATOM   5626 O O     . GLN D 1 149 ? -20.833 -1.360  -4.469  1.00 29.44  ? 135 GLN D O     1 
ATOM   5627 C CB    . GLN D 1 149 ? -21.703 -1.876  -1.369  1.00 26.45  ? 135 GLN D CB    1 
ATOM   5628 C CG    . GLN D 1 149 ? -23.083 -2.352  -1.027  1.00 40.51  ? 135 GLN D CG    1 
ATOM   5629 C CD    . GLN D 1 149 ? -24.044 -2.365  -2.205  1.00 39.94  ? 135 GLN D CD    1 
ATOM   5630 O OE1   . GLN D 1 149 ? -23.767 -1.860  -3.307  1.00 46.72  ? 135 GLN D OE1   1 
ATOM   5631 N NE2   . GLN D 1 149 ? -25.188 -2.953  -1.973  1.00 41.87  ? 135 GLN D NE2   1 
ATOM   5632 N N     . LEU D 1 150 ? -19.332 -0.958  -2.815  1.00 28.19  ? 136 LEU D N     1 
ATOM   5633 C CA    . LEU D 1 150 ? -18.599 0.080   -3.541  1.00 25.96  ? 136 LEU D CA    1 
ATOM   5634 C C     . LEU D 1 150 ? -18.172 -0.496  -4.902  1.00 25.88  ? 136 LEU D C     1 
ATOM   5635 O O     . LEU D 1 150 ? -18.336 0.135   -5.952  1.00 25.95  ? 136 LEU D O     1 
ATOM   5636 C CB    . LEU D 1 150 ? -17.374 0.537   -2.724  1.00 21.42  ? 136 LEU D CB    1 
ATOM   5637 C CG    . LEU D 1 150 ? -17.630 1.461   -1.550  1.00 30.28  ? 136 LEU D CG    1 
ATOM   5638 C CD1   . LEU D 1 150 ? -16.254 1.893   -0.933  1.00 20.23  ? 136 LEU D CD1   1 
ATOM   5639 C CD2   . LEU D 1 150 ? -18.383 2.694   -2.067  1.00 19.10  ? 136 LEU D CD2   1 
ATOM   5640 N N     . ARG D 1 151 ? -17.652 -1.719  -4.871  1.00 27.05  ? 137 ARG D N     1 
ATOM   5641 C CA    . ARG D 1 151 ? -17.212 -2.425  -6.066  1.00 28.01  ? 137 ARG D CA    1 
ATOM   5642 C C     . ARG D 1 151 ? -18.360 -2.631  -7.061  1.00 32.27  ? 137 ARG D C     1 
ATOM   5643 O O     . ARG D 1 151 ? -18.199 -2.393  -8.272  1.00 32.17  ? 137 ARG D O     1 
ATOM   5644 C CB    . ARG D 1 151 ? -16.645 -3.777  -5.642  1.00 28.94  ? 137 ARG D CB    1 
ATOM   5645 C CG    . ARG D 1 151 ? -15.263 -4.051  -6.142  1.00 34.81  ? 137 ARG D CG    1 
ATOM   5646 C CD    . ARG D 1 151 ? -14.383 -4.612  -5.041  1.00 30.46  ? 137 ARG D CD    1 
ATOM   5647 N NE    . ARG D 1 151 ? -15.005 -5.744  -4.347  1.00 31.78  ? 137 ARG D NE    1 
ATOM   5648 C CZ    . ARG D 1 151 ? -14.648 -6.163  -3.134  1.00 35.59  ? 137 ARG D CZ    1 
ATOM   5649 N NH1   . ARG D 1 151 ? -13.668 -5.558  -2.470  1.00 36.00  ? 137 ARG D NH1   1 
ATOM   5650 N NH2   . ARG D 1 151 ? -15.282 -7.177  -2.569  1.00 38.67  ? 137 ARG D NH2   1 
ATOM   5651 N N     . GLN D 1 152 ? -19.509 -3.085  -6.540  1.00 30.94  ? 138 GLN D N     1 
ATOM   5652 C CA    . GLN D 1 152 ? -20.710 -3.323  -7.338  1.00 26.67  ? 138 GLN D CA    1 
ATOM   5653 C C     . GLN D 1 152 ? -21.100 -2.026  -8.018  1.00 26.82  ? 138 GLN D C     1 
ATOM   5654 O O     . GLN D 1 152 ? -21.275 -2.004  -9.235  1.00 28.80  ? 138 GLN D O     1 
ATOM   5655 C CB    . GLN D 1 152 ? -21.884 -3.806  -6.465  1.00 32.26  ? 138 GLN D CB    1 
ATOM   5656 C CG    . GLN D 1 152 ? -23.173 -4.187  -7.275  1.00 45.33  ? 138 GLN D CG    1 
ATOM   5657 C CD    . GLN D 1 152 ? -24.501 -3.577  -6.730  1.00 60.20  ? 138 GLN D CD    1 
ATOM   5658 O OE1   . GLN D 1 152 ? -24.771 -2.376  -6.875  1.00 60.88  ? 138 GLN D OE1   1 
ATOM   5659 N NE2   . GLN D 1 152 ? -25.326 -4.419  -6.108  1.00 61.36  ? 138 GLN D NE2   1 
ATOM   5660 N N     . VAL D 1 153 ? -21.258 -0.945  -7.246  1.00 24.84  ? 139 VAL D N     1 
ATOM   5661 C CA    . VAL D 1 153 ? -21.610 0.343   -7.850  1.00 23.89  ? 139 VAL D CA    1 
ATOM   5662 C C     . VAL D 1 153 ? -20.652 0.653   -9.000  1.00 26.84  ? 139 VAL D C     1 
ATOM   5663 O O     . VAL D 1 153 ? -21.084 1.022   -10.096 1.00 23.67  ? 139 VAL D O     1 
ATOM   5664 C CB    . VAL D 1 153 ? -21.596 1.473   -6.797  1.00 20.39  ? 139 VAL D CB    1 
ATOM   5665 C CG1   . VAL D 1 153 ? -21.666 2.879   -7.440  1.00 20.10  ? 139 VAL D CG1   1 
ATOM   5666 C CG2   . VAL D 1 153 ? -22.798 1.291   -5.892  1.00 24.24  ? 139 VAL D CG2   1 
ATOM   5667 N N     . MET D 1 154 ? -19.353 0.455   -8.776  1.00 29.20  ? 140 MET D N     1 
ATOM   5668 C CA    . MET D 1 154 ? -18.366 0.724   -9.817  1.00 29.05  ? 140 MET D CA    1 
ATOM   5669 C C     . MET D 1 154 ? -18.515 -0.157  -11.051 1.00 23.25  ? 140 MET D C     1 
ATOM   5670 O O     . MET D 1 154 ? -18.413 0.325   -12.174 1.00 22.99  ? 140 MET D O     1 
ATOM   5671 C CB    . MET D 1 154 ? -16.940 0.580   -9.240  1.00 28.91  ? 140 MET D CB    1 
ATOM   5672 C CG    . MET D 1 154 ? -16.633 1.608   -8.176  1.00 32.19  ? 140 MET D CG    1 
ATOM   5673 S SD    . MET D 1 154 ? -15.004 1.372   -7.403  1.00 29.32  ? 140 MET D SD    1 
ATOM   5674 C CE    . MET D 1 154 ? -15.243 2.178   -5.880  1.00 31.56  ? 140 MET D CE    1 
ATOM   5675 N N     . ARG D 1 155 ? -18.746 -1.449  -10.848 1.00 28.09  ? 141 ARG D N     1 
ATOM   5676 C CA    . ARG D 1 155 ? -18.903 -2.382  -11.968 1.00 29.39  ? 141 ARG D CA    1 
ATOM   5677 C C     . ARG D 1 155 ? -20.071 -2.071  -12.892 1.00 29.84  ? 141 ARG D C     1 
ATOM   5678 O O     . ARG D 1 155 ? -20.064 -2.444  -14.078 1.00 25.92  ? 141 ARG D O     1 
ATOM   5679 C CB    . ARG D 1 155 ? -19.090 -3.806  -11.446 1.00 34.04  ? 141 ARG D CB    1 
ATOM   5680 C CG    . ARG D 1 155 ? -17.810 -4.410  -10.910 1.00 49.86  ? 141 ARG D CG    1 
ATOM   5681 C CD    . ARG D 1 155 ? -17.916 -5.918  -10.768 1.00 55.98  ? 141 ARG D CD    1 
ATOM   5682 N NE    . ARG D 1 155 ? -16.797 -6.439  -9.992  1.00 62.00  ? 141 ARG D NE    1 
ATOM   5683 C CZ    . ARG D 1 155 ? -16.834 -6.638  -8.677  1.00 63.83  ? 141 ARG D CZ    1 
ATOM   5684 N NH1   . ARG D 1 155 ? -17.947 -6.362  -7.994  1.00 59.64  ? 141 ARG D NH1   1 
ATOM   5685 N NH2   . ARG D 1 155 ? -15.761 -7.116  -8.049  1.00 57.13  ? 141 ARG D NH2   1 
ATOM   5686 N N     . GLU D 1 156 ? -21.079 -1.404  -12.341 1.00 29.76  ? 142 GLU D N     1 
ATOM   5687 C CA    . GLU D 1 156 ? -22.265 -1.076  -13.115 1.00 30.14  ? 142 GLU D CA    1 
ATOM   5688 C C     . GLU D 1 156 ? -22.124 0.193   -13.918 1.00 29.05  ? 142 GLU D C     1 
ATOM   5689 O O     . GLU D 1 156 ? -23.028 0.563   -14.630 1.00 25.09  ? 142 GLU D O     1 
ATOM   5690 C CB    . GLU D 1 156 ? -23.469 -0.966  -12.188 1.00 25.71  ? 142 GLU D CB    1 
ATOM   5691 C CG    . GLU D 1 156 ? -23.792 -2.278  -11.497 1.00 29.21  ? 142 GLU D CG    1 
ATOM   5692 C CD    . GLU D 1 156 ? -25.067 -2.228  -10.677 1.00 29.72  ? 142 GLU D CD    1 
ATOM   5693 O OE1   . GLU D 1 156 ? -25.389 -3.253  -10.036 1.00 34.09  ? 142 GLU D OE1   1 
ATOM   5694 O OE2   . GLU D 1 156 ? -25.746 -1.171  -10.683 1.00 30.70  ? 142 GLU D OE2   1 
ATOM   5695 N N     . LYS D 1 157 ? -20.982 0.857   -13.823 1.00 32.98  ? 143 LYS D N     1 
ATOM   5696 C CA    . LYS D 1 157 ? -20.804 2.102   -14.557 1.00 34.06  ? 143 LYS D CA    1 
ATOM   5697 C C     . LYS D 1 157 ? -20.918 1.921   -16.061 1.00 33.86  ? 143 LYS D C     1 
ATOM   5698 O O     . LYS D 1 157 ? -21.565 2.725   -16.732 1.00 26.30  ? 143 LYS D O     1 
ATOM   5699 C CB    . LYS D 1 157 ? -19.450 2.700   -14.237 1.00 36.37  ? 143 LYS D CB    1 
ATOM   5700 C CG    . LYS D 1 157 ? -19.241 4.065   -14.814 1.00 37.24  ? 143 LYS D CG    1 
ATOM   5701 C CD    . LYS D 1 157 ? -17.769 4.407   -14.705 1.00 49.47  ? 143 LYS D CD    1 
ATOM   5702 C CE    . LYS D 1 157 ? -17.500 5.833   -15.122 1.00 54.74  ? 143 LYS D CE    1 
ATOM   5703 N NZ    . LYS D 1 157 ? -18.230 6.763   -14.232 1.00 46.96  ? 143 LYS D NZ    1 
ATOM   5704 N N     . LYS D 1 158 ? -20.300 0.862   -16.579 1.00 36.12  ? 144 LYS D N     1 
ATOM   5705 C CA    . LYS D 1 158 ? -20.316 0.578   -18.011 1.00 45.35  ? 144 LYS D CA    1 
ATOM   5706 C C     . LYS D 1 158 ? -21.740 0.442   -18.591 1.00 43.51  ? 144 LYS D C     1 
ATOM   5707 O O     . LYS D 1 158 ? -22.096 1.129   -19.565 1.00 39.13  ? 144 LYS D O     1 
ATOM   5708 C CB    . LYS D 1 158 ? -19.550 -0.722  -18.304 1.00 54.45  ? 144 LYS D CB    1 
ATOM   5709 C CG    . LYS D 1 158 ? -18.485 -1.101  -17.275 1.00 64.83  ? 144 LYS D CG    1 
ATOM   5710 C CD    . LYS D 1 158 ? -17.869 -2.470  -17.585 1.00 68.41  ? 144 LYS D CD    1 
ATOM   5711 C CE    . LYS D 1 158 ? -16.631 -2.729  -16.730 1.00 73.35  ? 144 LYS D CE    1 
ATOM   5712 N NZ    . LYS D 1 158 ? -15.921 -3.980  -17.117 1.00 78.40  ? 144 LYS D NZ    1 
ATOM   5713 N N     . MET D 1 159 ? -22.538 -0.449  -18.004 1.00 37.93  ? 145 MET D N     1 
ATOM   5714 C CA    . MET D 1 159 ? -23.900 -0.684  -18.495 1.00 41.78  ? 145 MET D CA    1 
ATOM   5715 C C     . MET D 1 159 ? -24.778 0.516   -18.340 1.00 34.70  ? 145 MET D C     1 
ATOM   5716 O O     . MET D 1 159 ? -25.631 0.792   -19.187 1.00 40.39  ? 145 MET D O     1 
ATOM   5717 C CB    . MET D 1 159 ? -24.574 -1.827  -17.765 1.00 38.06  ? 145 MET D CB    1 
ATOM   5718 C CG    . MET D 1 159 ? -23.725 -2.527  -16.797 1.00 51.96  ? 145 MET D CG    1 
ATOM   5719 S SD    . MET D 1 159 ? -24.651 -3.934  -16.328 1.00 57.22  ? 145 MET D SD    1 
ATOM   5720 C CE    . MET D 1 159 ? -23.919 -5.130  -17.421 1.00 61.75  ? 145 MET D CE    1 
ATOM   5721 N N     . ARG D 1 160 ? -24.561 1.226   -17.248 1.00 34.28  ? 146 ARG D N     1 
ATOM   5722 C CA    . ARG D 1 160 ? -25.326 2.412   -16.940 1.00 31.97  ? 146 ARG D CA    1 
ATOM   5723 C C     . ARG D 1 160 ? -24.946 3.681   -17.713 1.00 36.00  ? 146 ARG D C     1 
ATOM   5724 O O     . ARG D 1 160 ? -25.817 4.400   -18.189 1.00 41.51  ? 146 ARG D O     1 
ATOM   5725 C CB    . ARG D 1 160 ? -25.244 2.705   -15.446 1.00 25.83  ? 146 ARG D CB    1 
ATOM   5726 C CG    . ARG D 1 160 ? -25.929 1.710   -14.530 1.00 24.20  ? 146 ARG D CG    1 
ATOM   5727 C CD    . ARG D 1 160 ? -25.942 2.232   -13.076 1.00 21.32  ? 146 ARG D CD    1 
ATOM   5728 N NE    . ARG D 1 160 ? -26.442 1.222   -12.161 1.00 31.70  ? 146 ARG D NE    1 
ATOM   5729 C CZ    . ARG D 1 160 ? -27.675 1.215   -11.643 1.00 39.59  ? 146 ARG D CZ    1 
ATOM   5730 N NH1   . ARG D 1 160 ? -28.522 2.176   -11.942 1.00 28.26  ? 146 ARG D NH1   1 
ATOM   5731 N NH2   . ARG D 1 160 ? -28.074 0.224   -10.843 1.00 34.07  ? 146 ARG D NH2   1 
ATOM   5732 N N     . GLU D 1 161 ? -23.659 3.961   -17.869 1.00 38.67  ? 147 GLU D N     1 
ATOM   5733 C CA    . GLU D 1 161 ? -23.287 5.206   -18.531 1.00 38.63  ? 147 GLU D CA    1 
ATOM   5734 C C     . GLU D 1 161 ? -22.457 5.025   -19.768 1.00 40.23  ? 147 GLU D C     1 
ATOM   5735 O O     . GLU D 1 161 ? -22.102 5.994   -20.423 1.00 45.26  ? 147 GLU D O     1 
ATOM   5736 C CB    . GLU D 1 161 ? -22.581 6.090   -17.511 1.00 36.12  ? 147 GLU D CB    1 
ATOM   5737 C CG    . GLU D 1 161 ? -22.996 5.631   -16.141 1.00 45.31  ? 147 GLU D CG    1 
ATOM   5738 C CD    . GLU D 1 161 ? -22.548 6.512   -15.015 1.00 47.52  ? 147 GLU D CD    1 
ATOM   5739 O OE1   . GLU D 1 161 ? -21.408 7.024   -15.102 1.00 35.44  ? 147 GLU D OE1   1 
ATOM   5740 O OE2   . GLU D 1 161 ? -23.351 6.650   -14.040 1.00 34.21  ? 147 GLU D OE2   1 
ATOM   5741 N N     . GLY D 1 162 ? -22.173 3.779   -20.110 1.00 44.52  ? 148 GLY D N     1 
ATOM   5742 C CA    . GLY D 1 162 ? -21.382 3.518   -21.291 1.00 55.35  ? 148 GLY D CA    1 
ATOM   5743 C C     . GLY D 1 162 ? -20.037 2.912   -20.940 1.00 66.29  ? 148 GLY D C     1 
ATOM   5744 O O     . GLY D 1 162 ? -19.883 1.677   -20.900 1.00 72.02  ? 148 GLY D O     1 
ATOM   5745 N N     . GLU D 1 163 ? -19.057 3.767   -20.664 1.00 64.96  ? 149 GLU D N     1 
ATOM   5746 C CA    . GLU D 1 163 ? -17.734 3.263   -20.335 1.00 63.08  ? 149 GLU D CA    1 
ATOM   5747 C C     . GLU D 1 163 ? -17.476 3.165   -18.835 1.00 55.58  ? 149 GLU D C     1 
ATOM   5748 O O     . GLU D 1 163 ? -17.868 4.035   -18.047 1.00 48.24  ? 149 GLU D O     1 
ATOM   5749 C CB    . GLU D 1 163 ? -16.652 4.126   -21.013 1.00 69.17  ? 149 GLU D CB    1 
ATOM   5750 C CG    . GLU D 1 163 ? -16.114 5.306   -20.191 1.00 74.56  ? 149 GLU D CG    1 
ATOM   5751 C CD    . GLU D 1 163 ? -17.192 6.262   -19.691 1.00 77.85  ? 149 GLU D CD    1 
ATOM   5752 O OE1   . GLU D 1 163 ? -16.824 7.367   -19.238 1.00 82.64  ? 149 GLU D OE1   1 
ATOM   5753 O OE2   . GLU D 1 163 ? -18.394 5.919   -19.737 1.00 78.20  ? 149 GLU D OE2   1 
ATOM   5754 N N     . GLY D 1 164 ? -16.824 2.070   -18.464 1.00 48.35  ? 150 GLY D N     1 
ATOM   5755 C CA    . GLY D 1 164 ? -16.476 1.844   -17.085 1.00 49.22  ? 150 GLY D CA    1 
ATOM   5756 C C     . GLY D 1 164 ? -15.153 2.506   -16.781 1.00 45.40  ? 150 GLY D C     1 
ATOM   5757 O O     . GLY D 1 164 ? -14.710 3.392   -17.500 1.00 46.65  ? 150 GLY D O     1 
ATOM   5758 N N     . TYR D 1 165 ? -14.530 2.058   -15.704 1.00 43.03  ? 151 TYR D N     1 
ATOM   5759 C CA    . TYR D 1 165 ? -13.256 2.579   -15.245 1.00 37.44  ? 151 TYR D CA    1 
ATOM   5760 C C     . TYR D 1 165 ? -12.125 1.796   -15.898 1.00 37.34  ? 151 TYR D C     1 
ATOM   5761 O O     . TYR D 1 165 ? -12.269 0.608   -16.191 1.00 38.62  ? 151 TYR D O     1 
ATOM   5762 C CB    . TYR D 1 165 ? -13.170 2.411   -13.732 1.00 34.07  ? 151 TYR D CB    1 
ATOM   5763 C CG    . TYR D 1 165 ? -14.223 3.169   -12.966 1.00 35.03  ? 151 TYR D CG    1 
ATOM   5764 C CD1   . TYR D 1 165 ? -14.103 4.538   -12.778 1.00 31.69  ? 151 TYR D CD1   1 
ATOM   5765 C CD2   . TYR D 1 165 ? -15.322 2.520   -12.411 1.00 30.81  ? 151 TYR D CD2   1 
ATOM   5766 C CE1   . TYR D 1 165 ? -15.038 5.246   -12.061 1.00 37.03  ? 151 TYR D CE1   1 
ATOM   5767 C CE2   . TYR D 1 165 ? -16.283 3.231   -11.686 1.00 36.22  ? 151 TYR D CE2   1 
ATOM   5768 C CZ    . TYR D 1 165 ? -16.124 4.598   -11.522 1.00 31.64  ? 151 TYR D CZ    1 
ATOM   5769 O OH    . TYR D 1 165 ? -17.060 5.350   -10.868 1.00 38.77  ? 151 TYR D OH    1 
ATOM   5770 N N     . THR D 1 166 ? -10.992 2.448   -16.110 1.00 35.82  ? 152 THR D N     1 
ATOM   5771 C CA    . THR D 1 166 ? -9.848  1.778   -16.714 1.00 37.59  ? 152 THR D CA    1 
ATOM   5772 C C     . THR D 1 166 ? -9.178  0.862   -15.709 1.00 36.38  ? 152 THR D C     1 
ATOM   5773 O O     . THR D 1 166 ? -8.680  -0.203  -16.063 1.00 40.01  ? 152 THR D O     1 
ATOM   5774 C CB    . THR D 1 166 ? -8.800  2.779   -17.154 1.00 41.32  ? 152 THR D CB    1 
ATOM   5775 O OG1   . THR D 1 166 ? -9.356  3.625   -18.164 1.00 51.86  ? 152 THR D OG1   1 
ATOM   5776 C CG2   . THR D 1 166 ? -7.579  2.056   -17.687 1.00 49.94  ? 152 THR D CG2   1 
ATOM   5777 N N     . LEU D 1 167 ? -9.164  1.299   -14.451 1.00 31.87  ? 153 LEU D N     1 
ATOM   5778 C CA    . LEU D 1 167 ? -8.536  0.564   -13.381 1.00 31.96  ? 153 LEU D CA    1 
ATOM   5779 C C     . LEU D 1 167 ? -9.453  -0.488  -12.766 1.00 34.78  ? 153 LEU D C     1 
ATOM   5780 O O     . LEU D 1 167 ? -10.683 -0.456  -12.927 1.00 31.93  ? 153 LEU D O     1 
ATOM   5781 C CB    . LEU D 1 167 ? -8.059  1.571   -12.327 1.00 36.49  ? 153 LEU D CB    1 
ATOM   5782 C CG    . LEU D 1 167 ? -7.151  2.638   -12.965 1.00 40.13  ? 153 LEU D CG    1 
ATOM   5783 C CD1   . LEU D 1 167 ? -7.055  3.890   -12.137 1.00 41.96  ? 153 LEU D CD1   1 
ATOM   5784 C CD2   . LEU D 1 167 ? -5.780  2.031   -13.165 1.00 48.70  ? 153 LEU D CD2   1 
ATOM   5785 N N     . ASP D 1 168 ? -8.850  -1.430  -12.064 1.00 30.83  ? 154 ASP D N     1 
ATOM   5786 C CA    . ASP D 1 168 ? -9.621  -2.480  -11.415 1.00 37.40  ? 154 ASP D CA    1 
ATOM   5787 C C     . ASP D 1 168 ? -10.477 -1.887  -10.279 1.00 33.24  ? 154 ASP D C     1 
ATOM   5788 O O     . ASP D 1 168 ? -9.963  -1.084  -9.496  1.00 26.22  ? 154 ASP D O     1 
ATOM   5789 C CB    . ASP D 1 168 ? -8.664  -3.530  -10.853 1.00 46.33  ? 154 ASP D CB    1 
ATOM   5790 C CG    . ASP D 1 168 ? -9.371  -4.779  -10.426 1.00 55.72  ? 154 ASP D CG    1 
ATOM   5791 O OD1   . ASP D 1 168 ? -10.173 -4.708  -9.467  1.00 63.98  ? 154 ASP D OD1   1 
ATOM   5792 O OD2   . ASP D 1 168 ? -9.130  -5.832  -11.061 1.00 69.33  ? 154 ASP D OD2   1 
ATOM   5793 N N     . GLU D 1 169 ? -11.763 -2.284  -10.205 1.00 26.03  ? 155 GLU D N     1 
ATOM   5794 C CA    . GLU D 1 169 ? -12.698 -1.799  -9.197  1.00 26.46  ? 155 GLU D CA    1 
ATOM   5795 C C     . GLU D 1 169 ? -12.196 -2.150  -7.806  1.00 27.53  ? 155 GLU D C     1 
ATOM   5796 O O     . GLU D 1 169 ? -12.450 -1.425  -6.847  1.00 24.66  ? 155 GLU D O     1 
ATOM   5797 C CB    . GLU D 1 169 ? -14.114 -2.404  -9.388  1.00 31.95  ? 155 GLU D CB    1 
ATOM   5798 C CG    . GLU D 1 169 ? -14.889 -1.977  -10.653 1.00 45.40  ? 155 GLU D CG    1 
ATOM   5799 C CD    . GLU D 1 169 ? -14.376 -2.639  -11.931 1.00 49.86  ? 155 GLU D CD    1 
ATOM   5800 O OE1   . GLU D 1 169 ? -13.673 -3.672  -11.814 1.00 51.81  ? 155 GLU D OE1   1 
ATOM   5801 O OE2   . GLU D 1 169 ? -14.688 -2.141  -13.043 1.00 44.80  ? 155 GLU D OE2   1 
ATOM   5802 N N     . THR D 1 170 ? -11.498 -3.275  -7.683  1.00 28.90  ? 156 THR D N     1 
ATOM   5803 C CA    . THR D 1 170 ? -10.945 -3.659  -6.385  1.00 33.03  ? 156 THR D CA    1 
ATOM   5804 C C     . THR D 1 170 ? -9.923  -2.618  -5.874  1.00 31.22  ? 156 THR D C     1 
ATOM   5805 O O     . THR D 1 170 ? -9.893  -2.308  -4.681  1.00 31.43  ? 156 THR D O     1 
ATOM   5806 C CB    . THR D 1 170 ? -10.269 -5.018  -6.441  1.00 32.28  ? 156 THR D CB    1 
ATOM   5807 O OG1   . THR D 1 170 ? -11.217 -6.009  -6.878  1.00 40.37  ? 156 THR D OG1   1 
ATOM   5808 C CG2   . THR D 1 170 ? -9.794  -5.384  -5.064  1.00 30.20  ? 156 THR D CG2   1 
ATOM   5809 N N     . LEU D 1 171 ? -9.102  -2.090  -6.780  1.00 27.42  ? 157 LEU D N     1 
ATOM   5810 C CA    . LEU D 1 171 ? -8.122  -1.053  -6.454  1.00 27.51  ? 157 LEU D CA    1 
ATOM   5811 C C     . LEU D 1 171 ? -8.898  0.230   -6.089  1.00 26.37  ? 157 LEU D C     1 
ATOM   5812 O O     . LEU D 1 171 ? -8.669  0.796   -5.019  1.00 25.04  ? 157 LEU D O     1 
ATOM   5813 C CB    . LEU D 1 171 ? -7.218  -0.773  -7.656  1.00 22.95  ? 157 LEU D CB    1 
ATOM   5814 C CG    . LEU D 1 171 ? -6.050  0.222   -7.567  1.00 28.82  ? 157 LEU D CG    1 
ATOM   5815 C CD1   . LEU D 1 171 ? -4.952  -0.366  -6.726  1.00 24.47  ? 157 LEU D CD1   1 
ATOM   5816 C CD2   . LEU D 1 171 ? -5.500  0.525   -8.982  1.00 22.85  ? 157 LEU D CD2   1 
ATOM   5817 N N     . LEU D 1 172 ? -9.833  0.657   -6.949  1.00 23.37  ? 158 LEU D N     1 
ATOM   5818 C CA    . LEU D 1 172 ? -10.613 1.883   -6.691  1.00 24.77  ? 158 LEU D CA    1 
ATOM   5819 C C     . LEU D 1 172 ? -11.457 1.821   -5.405  1.00 23.93  ? 158 LEU D C     1 
ATOM   5820 O O     . LEU D 1 172 ? -11.478 2.774   -4.644  1.00 22.99  ? 158 LEU D O     1 
ATOM   5821 C CB    . LEU D 1 172 ? -11.515 2.235   -7.898  1.00 20.76  ? 158 LEU D CB    1 
ATOM   5822 C CG    . LEU D 1 172 ? -10.790 2.381   -9.248  1.00 27.62  ? 158 LEU D CG    1 
ATOM   5823 C CD1   . LEU D 1 172 ? -11.772 2.852   -10.320 1.00 23.44  ? 158 LEU D CD1   1 
ATOM   5824 C CD2   . LEU D 1 172 ? -9.624  3.367   -9.131  1.00 25.76  ? 158 LEU D CD2   1 
ATOM   5825 N N     . ALA D 1 173 ? -12.123 0.702   -5.139  1.00 20.77  ? 159 ALA D N     1 
ATOM   5826 C CA    . ALA D 1 173 ? -12.930 0.607   -3.937  1.00 24.88  ? 159 ALA D CA    1 
ATOM   5827 C C     . ALA D 1 173 ? -12.078 0.618   -2.678  1.00 22.91  ? 159 ALA D C     1 
ATOM   5828 O O     . ALA D 1 173 ? -12.451 1.250   -1.699  1.00 23.80  ? 159 ALA D O     1 
ATOM   5829 C CB    . ALA D 1 173 ? -13.800 -0.648  -3.976  1.00 21.74  ? 159 ALA D CB    1 
ATOM   5830 N N     . SER D 1 174 ? -10.956 -0.099  -2.657  1.00 19.43  ? 160 SER D N     1 
ATOM   5831 C CA    . SER D 1 174 ? -10.114 -0.058  -1.452  1.00 24.82  ? 160 SER D CA    1 
ATOM   5832 C C     . SER D 1 174 ? -9.521  1.352   -1.248  1.00 20.94  ? 160 SER D C     1 
ATOM   5833 O O     . SER D 1 174 ? -9.336  1.796   -0.120  1.00 21.54  ? 160 SER D O     1 
ATOM   5834 C CB    . SER D 1 174 ? -8.980  -1.096  -1.518  1.00 18.05  ? 160 SER D CB    1 
ATOM   5835 O OG    . SER D 1 174 ? -8.104  -0.853  -2.581  1.00 23.12  ? 160 SER D OG    1 
ATOM   5836 N N     . GLN D 1 175 ? -9.203  2.031   -2.346  1.00 18.58  ? 161 GLN D N     1 
ATOM   5837 C CA    . GLN D 1 175 ? -8.692  3.393   -2.310  1.00 21.30  ? 161 GLN D CA    1 
ATOM   5838 C C     . GLN D 1 175 ? -9.746  4.270   -1.608  1.00 24.53  ? 161 GLN D C     1 
ATOM   5839 O O     . GLN D 1 175 ? -9.423  5.125   -0.795  1.00 29.36  ? 161 GLN D O     1 
ATOM   5840 C CB    . GLN D 1 175 ? -8.498  3.842   -3.741  1.00 20.77  ? 161 GLN D CB    1 
ATOM   5841 C CG    . GLN D 1 175 ? -7.600  4.993   -3.952  1.00 26.49  ? 161 GLN D CG    1 
ATOM   5842 C CD    . GLN D 1 175 ? -6.142  4.743   -3.581  1.00 29.60  ? 161 GLN D CD    1 
ATOM   5843 O OE1   . GLN D 1 175 ? -5.683  3.608   -3.369  1.00 25.31  ? 161 GLN D OE1   1 
ATOM   5844 N NE2   . GLN D 1 175 ? -5.404  5.825   -3.501  1.00 21.88  ? 161 GLN D NE2   1 
ATOM   5845 N N     . LEU D 1 176 ? -11.016 4.057   -1.935  1.00 24.02  ? 162 LEU D N     1 
ATOM   5846 C CA    . LEU D 1 176 ? -12.085 4.815   -1.328  1.00 24.97  ? 162 LEU D CA    1 
ATOM   5847 C C     . LEU D 1 176 ? -12.217 4.477   0.152   1.00 22.96  ? 162 LEU D C     1 
ATOM   5848 O O     . LEU D 1 176 ? -12.287 5.368   0.994   1.00 20.44  ? 162 LEU D O     1 
ATOM   5849 C CB    . LEU D 1 176 ? -13.386 4.530   -2.065  1.00 31.91  ? 162 LEU D CB    1 
ATOM   5850 C CG    . LEU D 1 176 ? -13.997 5.631   -2.925  1.00 33.14  ? 162 LEU D CG    1 
ATOM   5851 C CD1   . LEU D 1 176 ? -12.962 6.447   -3.637  1.00 29.25  ? 162 LEU D CD1   1 
ATOM   5852 C CD2   . LEU D 1 176 ? -14.915 4.955   -3.926  1.00 35.23  ? 162 LEU D CD2   1 
ATOM   5853 N N     . LEU D 1 177 ? -12.236 3.194   0.491   1.00 23.13  ? 163 LEU D N     1 
ATOM   5854 C CA    . LEU D 1 177 ? -12.326 2.835   1.897   1.00 26.00  ? 163 LEU D CA    1 
ATOM   5855 C C     . LEU D 1 177 ? -11.118 3.369   2.688   1.00 21.01  ? 163 LEU D C     1 
ATOM   5856 O O     . LEU D 1 177 ? -11.278 3.796   3.830   1.00 19.94  ? 163 LEU D O     1 
ATOM   5857 C CB    . LEU D 1 177 ? -12.409 1.319   2.065   1.00 34.35  ? 163 LEU D CB    1 
ATOM   5858 C CG    . LEU D 1 177 ? -13.686 0.694   2.636   1.00 41.48  ? 163 LEU D CG    1 
ATOM   5859 C CD1   . LEU D 1 177 ? -13.300 -0.664  3.197   1.00 45.56  ? 163 LEU D CD1   1 
ATOM   5860 C CD2   . LEU D 1 177 ? -14.292 1.543   3.748   1.00 38.62  ? 163 LEU D CD2   1 
ATOM   5861 N N     . ALA D 1 178 ? -9.923  3.324   2.093   1.00 19.50  ? 164 ALA D N     1 
ATOM   5862 C CA    . ALA D 1 178 ? -8.721  3.812   2.771   1.00 26.60  ? 164 ALA D CA    1 
ATOM   5863 C C     . ALA D 1 178 ? -8.910  5.262   3.170   1.00 25.25  ? 164 ALA D C     1 
ATOM   5864 O O     . ALA D 1 178 ? -8.517  5.664   4.277   1.00 23.50  ? 164 ALA D O     1 
ATOM   5865 C CB    . ALA D 1 178 ? -7.473  3.681   1.869   1.00 19.35  ? 164 ALA D CB    1 
ATOM   5866 N N     . PHE D 1 179 ? -9.484  6.052   2.262   1.00 20.92  ? 165 PHE D N     1 
ATOM   5867 C CA    . PHE D 1 179 ? -9.740  7.462   2.571   1.00 23.18  ? 165 PHE D CA    1 
ATOM   5868 C C     . PHE D 1 179 ? -10.708 7.585   3.760   1.00 25.23  ? 165 PHE D C     1 
ATOM   5869 O O     . PHE D 1 179 ? -10.495 8.418   4.678   1.00 20.20  ? 165 PHE D O     1 
ATOM   5870 C CB    . PHE D 1 179 ? -10.310 8.177   1.353   1.00 19.26  ? 165 PHE D CB    1 
ATOM   5871 C CG    . PHE D 1 179 ? -10.944 9.508   1.669   1.00 18.77  ? 165 PHE D CG    1 
ATOM   5872 C CD1   . PHE D 1 179 ? -10.158 10.613  2.012   1.00 15.61  ? 165 PHE D CD1   1 
ATOM   5873 C CD2   . PHE D 1 179 ? -12.339 9.649   1.622   1.00 16.54  ? 165 PHE D CD2   1 
ATOM   5874 C CE1   . PHE D 1 179 ? -10.748 11.867  2.301   1.00 22.27  ? 165 PHE D CE1   1 
ATOM   5875 C CE2   . PHE D 1 179 ? -12.952 10.891  1.905   1.00 26.91  ? 165 PHE D CE2   1 
ATOM   5876 C CZ    . PHE D 1 179 ? -12.142 12.010  2.248   1.00 20.70  ? 165 PHE D CZ    1 
ATOM   5877 N N     . CYS D 1 180 ? -11.757 6.749   3.760   1.00 22.58  ? 166 CYS D N     1 
ATOM   5878 C CA    . CYS D 1 180 ? -12.725 6.763   4.855   1.00 26.67  ? 166 CYS D CA    1 
ATOM   5879 C C     . CYS D 1 180 ? -12.084 6.361   6.180   1.00 24.69  ? 166 CYS D C     1 
ATOM   5880 O O     . CYS D 1 180 ? -12.240 7.059   7.174   1.00 16.22  ? 166 CYS D O     1 
ATOM   5881 C CB    . CYS D 1 180 ? -13.901 5.821   4.565   1.00 27.64  ? 166 CYS D CB    1 
ATOM   5882 S SG    . CYS D 1 180 ? -14.948 6.384   3.212   1.00 25.67  ? 166 CYS D SG    1 
ATOM   5883 N N     . GLU D 1 181 ? -11.360 5.237   6.191   1.00 21.39  ? 167 GLU D N     1 
ATOM   5884 C CA    . GLU D 1 181 ? -10.734 4.775   7.414   1.00 22.32  ? 167 GLU D CA    1 
ATOM   5885 C C     . GLU D 1 181 ? -9.714  5.797   7.913   1.00 25.27  ? 167 GLU D C     1 
ATOM   5886 O O     . GLU D 1 181 ? -9.606  6.031   9.109   1.00 23.05  ? 167 GLU D O     1 
ATOM   5887 C CB    . GLU D 1 181 ? -10.068 3.405   7.187   1.00 21.35  ? 167 GLU D CB    1 
ATOM   5888 C CG    . GLU D 1 181 ? -11.074 2.349   6.752   1.00 24.11  ? 167 GLU D CG    1 
ATOM   5889 C CD    . GLU D 1 181 ? -10.558 0.917   6.888   1.00 29.61  ? 167 GLU D CD    1 
ATOM   5890 O OE1   . GLU D 1 181 ? -10.139 0.525   7.998   1.00 24.58  ? 167 GLU D OE1   1 
ATOM   5891 O OE2   . GLU D 1 181 ? -10.583 0.180   5.881   1.00 30.68  ? 167 GLU D OE2   1 
ATOM   5892 N N     . GLY D 1 182 ? -8.982  6.423   6.993   1.00 23.28  ? 168 GLY D N     1 
ATOM   5893 C CA    . GLY D 1 182 ? -8.006  7.422   7.399   1.00 21.85  ? 168 GLY D CA    1 
ATOM   5894 C C     . GLY D 1 182 ? -8.659  8.628   8.063   1.00 29.06  ? 168 GLY D C     1 
ATOM   5895 O O     . GLY D 1 182 ? -8.168  9.155   9.079   1.00 29.26  ? 168 GLY D O     1 
ATOM   5896 N N     . MET D 1 183 ? -9.779  9.060   7.496   1.00 27.42  ? 169 MET D N     1 
ATOM   5897 C CA    . MET D 1 183 ? -10.509 10.185  8.049   1.00 26.96  ? 169 MET D CA    1 
ATOM   5898 C C     . MET D 1 183 ? -11.060 9.848   9.425   1.00 25.10  ? 169 MET D C     1 
ATOM   5899 O O     . MET D 1 183 ? -10.996 10.687  10.323  1.00 20.75  ? 169 MET D O     1 
ATOM   5900 C CB    . MET D 1 183 ? -11.640 10.619  7.093   1.00 26.79  ? 169 MET D CB    1 
ATOM   5901 C CG    . MET D 1 183 ? -11.131 11.311  5.803   1.00 29.35  ? 169 MET D CG    1 
ATOM   5902 S SD    . MET D 1 183 ? -10.106 12.816  6.091   1.00 27.12  ? 169 MET D SD    1 
ATOM   5903 C CE    . MET D 1 183 ? -11.401 13.964  6.454   1.00 26.74  ? 169 MET D CE    1 
ATOM   5904 N N     . LEU D 1 184 ? -11.575 8.627   9.609   1.00 22.51  ? 170 LEU D N     1 
ATOM   5905 C CA    . LEU D 1 184 ? -12.120 8.231   10.906  1.00 25.24  ? 170 LEU D CA    1 
ATOM   5906 C C     . LEU D 1 184 ? -11.010 8.062   11.938  1.00 26.65  ? 170 LEU D C     1 
ATOM   5907 O O     . LEU D 1 184 ? -11.163 8.485   13.080  1.00 23.77  ? 170 LEU D O     1 
ATOM   5908 C CB    . LEU D 1 184 ? -12.923 6.936   10.774  1.00 19.15  ? 170 LEU D CB    1 
ATOM   5909 C CG    . LEU D 1 184 ? -14.150 7.085   9.851   1.00 27.40  ? 170 LEU D CG    1 
ATOM   5910 C CD1   . LEU D 1 184 ? -14.844 5.740   9.696   1.00 16.76  ? 170 LEU D CD1   1 
ATOM   5911 C CD2   . LEU D 1 184 ? -15.124 8.118   10.417  1.00 24.03  ? 170 LEU D CD2   1 
ATOM   5912 N N     . SER D 1 185 ? -9.906  7.435   11.526  1.00 23.63  ? 171 SER D N     1 
ATOM   5913 C CA    . SER D 1 185 ? -8.751  7.249   12.390  1.00 29.11  ? 171 SER D CA    1 
ATOM   5914 C C     . SER D 1 185 ? -8.286  8.603   12.966  1.00 23.47  ? 171 SER D C     1 
ATOM   5915 O O     . SER D 1 185 ? -8.034  8.722   14.177  1.00 25.98  ? 171 SER D O     1 
ATOM   5916 C CB    . SER D 1 185 ? -7.619  6.582   11.595  1.00 28.00  ? 171 SER D CB    1 
ATOM   5917 O OG    . SER D 1 185 ? -6.386  6.677   12.284  1.00 37.46  ? 171 SER D OG    1 
ATOM   5918 N N     . ARG D 1 186 ? -8.176  9.611   12.101  1.00 23.45  ? 172 ARG D N     1 
ATOM   5919 C CA    . ARG D 1 186 ? -7.774  10.973  12.518  1.00 22.09  ? 172 ARG D CA    1 
ATOM   5920 C C     . ARG D 1 186 ? -8.816  11.575  13.478  1.00 24.10  ? 172 ARG D C     1 
ATOM   5921 O O     . ARG D 1 186 ? -8.465  12.217  14.466  1.00 25.82  ? 172 ARG D O     1 
ATOM   5922 C CB    . ARG D 1 186 ? -7.628  11.885  11.289  1.00 22.12  ? 172 ARG D CB    1 
ATOM   5923 C CG    . ARG D 1 186 ? -6.409  11.598  10.409  1.00 35.32  ? 172 ARG D CG    1 
ATOM   5924 C CD    . ARG D 1 186 ? -6.471  12.272  9.013   1.00 39.83  ? 172 ARG D CD    1 
ATOM   5925 N NE    . ARG D 1 186 ? -6.193  13.720  9.018   1.00 45.33  ? 172 ARG D NE    1 
ATOM   5926 C CZ    . ARG D 1 186 ? -4.970  14.255  9.049   1.00 42.62  ? 172 ARG D CZ    1 
ATOM   5927 N NH1   . ARG D 1 186 ? -3.907  13.461  9.074   1.00 41.60  ? 172 ARG D NH1   1 
ATOM   5928 N NH2   . ARG D 1 186 ? -4.801  15.579  9.067   1.00 28.01  ? 172 ARG D NH2   1 
ATOM   5929 N N     . PHE D 1 187 ? -10.100 11.372  13.170  1.00 27.48  ? 173 PHE D N     1 
ATOM   5930 C CA    . PHE D 1 187 ? -11.182 11.880  14.008  1.00 25.43  ? 173 PHE D CA    1 
ATOM   5931 C C     . PHE D 1 187 ? -10.939 11.342  15.420  1.00 25.03  ? 173 PHE D C     1 
ATOM   5932 O O     . PHE D 1 187 ? -10.980 12.096  16.381  1.00 24.63  ? 173 PHE D O     1 
ATOM   5933 C CB    . PHE D 1 187 ? -12.542 11.418  13.443  1.00 27.57  ? 173 PHE D CB    1 
ATOM   5934 C CG    . PHE D 1 187 ? -13.752 11.871  14.242  1.00 21.95  ? 173 PHE D CG    1 
ATOM   5935 C CD1   . PHE D 1 187 ? -13.876 13.191  14.679  1.00 28.00  ? 173 PHE D CD1   1 
ATOM   5936 C CD2   . PHE D 1 187 ? -14.812 11.004  14.447  1.00 24.70  ? 173 PHE D CD2   1 
ATOM   5937 C CE1   . PHE D 1 187 ? -15.063 13.644  15.299  1.00 23.10  ? 173 PHE D CE1   1 
ATOM   5938 C CE2   . PHE D 1 187 ? -16.015 11.438  15.067  1.00 23.45  ? 173 PHE D CE2   1 
ATOM   5939 C CZ    . PHE D 1 187 ? -16.129 12.763  15.492  1.00 23.44  ? 173 PHE D CZ    1 
ATOM   5940 N N     . VAL D 1 188 ? -10.660 10.044  15.544  1.00 21.23  ? 174 VAL D N     1 
ATOM   5941 C CA    . VAL D 1 188 ? -10.390 9.452   16.846  1.00 23.71  ? 174 VAL D CA    1 
ATOM   5942 C C     . VAL D 1 188 ? -9.094  9.931   17.563  1.00 27.91  ? 174 VAL D C     1 
ATOM   5943 O O     . VAL D 1 188 ? -9.129  10.285  18.742  1.00 26.70  ? 174 VAL D O     1 
ATOM   5944 C CB    . VAL D 1 188 ? -10.354 7.924   16.709  1.00 26.74  ? 174 VAL D CB    1 
ATOM   5945 C CG1   . VAL D 1 188 ? -9.939  7.289   18.009  1.00 27.59  ? 174 VAL D CG1   1 
ATOM   5946 C CG2   . VAL D 1 188 ? -11.730 7.436   16.305  1.00 24.76  ? 174 VAL D CG2   1 
ATOM   5947 N N     . ARG D 1 189 ? -7.971  9.944   16.846  1.00 26.06  ? 175 ARG D N     1 
ATOM   5948 C CA    . ARG D 1 189 ? -6.669  10.361  17.393  1.00 31.32  ? 175 ARG D CA    1 
ATOM   5949 C C     . ARG D 1 189 ? -6.747  11.706  18.081  1.00 27.61  ? 175 ARG D C     1 
ATOM   5950 O O     . ARG D 1 189 ? -6.119  11.957  19.109  1.00 27.20  ? 175 ARG D O     1 
ATOM   5951 C CB    . ARG D 1 189 ? -5.613  10.647  16.295  1.00 34.53  ? 175 ARG D CB    1 
ATOM   5952 C CG    . ARG D 1 189 ? -5.258  9.634   15.267  1.00 32.85  ? 175 ARG D CG    1 
ATOM   5953 C CD    . ARG D 1 189 ? -3.817  9.944   14.760  1.00 29.89  ? 175 ARG D CD    1 
ATOM   5954 N NE    . ARG D 1 189 ? -3.721  10.719  13.522  1.00 26.23  ? 175 ARG D NE    1 
ATOM   5955 C CZ    . ARG D 1 189 ? -3.308  11.982  13.446  1.00 19.92  ? 175 ARG D CZ    1 
ATOM   5956 N NH1   . ARG D 1 189 ? -2.947  12.637  14.550  1.00 18.78  ? 175 ARG D NH1   1 
ATOM   5957 N NH2   . ARG D 1 189 ? -3.229  12.585  12.268  1.00 24.31  ? 175 ARG D NH2   1 
ATOM   5958 N N     . SER D 1 190 ? -7.420  12.601  17.376  1.00 30.65  ? 176 SER D N     1 
ATOM   5959 C CA    . SER D 1 190 ? -7.553  13.981  17.753  1.00 26.38  ? 176 SER D CA    1 
ATOM   5960 C C     . SER D 1 190 ? -8.608  14.226  18.792  1.00 28.40  ? 176 SER D C     1 
ATOM   5961 O O     . SER D 1 190 ? -8.999  15.364  19.017  1.00 27.98  ? 176 SER D O     1 
ATOM   5962 C CB    . SER D 1 190 ? -7.845  14.796  16.498  1.00 23.77  ? 176 SER D CB    1 
ATOM   5963 O OG    . SER D 1 190 ? -9.142  14.514  15.998  1.00 24.56  ? 176 SER D OG    1 
ATOM   5964 N N     . GLU D 1 191 ? -9.060  13.167  19.444  1.00 24.70  ? 177 GLU D N     1 
ATOM   5965 C CA    . GLU D 1 191 ? -10.091 13.320  20.468  1.00 37.62  ? 177 GLU D CA    1 
ATOM   5966 C C     . GLU D 1 191 ? -11.299 14.036  19.856  1.00 34.53  ? 177 GLU D C     1 
ATOM   5967 O O     . GLU D 1 191 ? -11.878 14.953  20.467  1.00 31.63  ? 177 GLU D O     1 
ATOM   5968 C CB    . GLU D 1 191 ? -9.581  14.135  21.668  1.00 44.50  ? 177 GLU D CB    1 
ATOM   5969 C CG    . GLU D 1 191 ? -8.053  14.166  21.825  1.00 63.33  ? 177 GLU D CG    1 
ATOM   5970 C CD    . GLU D 1 191 ? -7.563  15.178  22.861  1.00 72.07  ? 177 GLU D CD    1 
ATOM   5971 O OE1   . GLU D 1 191 ? -7.943  15.020  24.043  1.00 69.43  ? 177 GLU D OE1   1 
ATOM   5972 O OE2   . GLU D 1 191 ? -6.801  16.114  22.494  1.00 74.36  ? 177 GLU D OE2   1 
ATOM   5973 N N     . PHE D 1 192 ? -11.633 13.624  18.631  1.00 26.66  ? 178 PHE D N     1 
ATOM   5974 C CA    . PHE D 1 192 ? -12.773 14.131  17.877  1.00 26.86  ? 178 PHE D CA    1 
ATOM   5975 C C     . PHE D 1 192 ? -12.699 15.575  17.416  1.00 30.32  ? 178 PHE D C     1 
ATOM   5976 O O     . PHE D 1 192 ? -13.730 16.155  17.106  1.00 26.85  ? 178 PHE D O     1 
ATOM   5977 C CB    . PHE D 1 192 ? -14.060 13.913  18.688  1.00 21.28  ? 178 PHE D CB    1 
ATOM   5978 C CG    . PHE D 1 192 ? -14.232 12.490  19.141  1.00 25.15  ? 178 PHE D CG    1 
ATOM   5979 C CD1   . PHE D 1 192 ? -14.549 12.195  20.465  1.00 25.92  ? 178 PHE D CD1   1 
ATOM   5980 C CD2   . PHE D 1 192 ? -14.021 11.438  18.250  1.00 16.68  ? 178 PHE D CD2   1 
ATOM   5981 C CE1   . PHE D 1 192 ? -14.662 10.856  20.908  1.00 28.58  ? 178 PHE D CE1   1 
ATOM   5982 C CE2   . PHE D 1 192 ? -14.132 10.097  18.686  1.00 27.68  ? 178 PHE D CE2   1 
ATOM   5983 C CZ    . PHE D 1 192 ? -14.450 9.817   20.019  1.00 17.74  ? 178 PHE D CZ    1 
ATOM   5984 N N     . LYS D 1 193 ? -11.507 16.168  17.374  1.00 34.43  ? 179 LYS D N     1 
ATOM   5985 C CA    . LYS D 1 193 ? -11.393 17.559  16.905  1.00 33.99  ? 179 LYS D CA    1 
ATOM   5986 C C     . LYS D 1 193 ? -11.364 17.617  15.379  1.00 33.64  ? 179 LYS D C     1 
ATOM   5987 O O     . LYS D 1 193 ? -11.816 18.597  14.777  1.00 30.86  ? 179 LYS D O     1 
ATOM   5988 C CB    . LYS D 1 193 ? -10.128 18.243  17.449  1.00 41.13  ? 179 LYS D CB    1 
ATOM   5989 C CG    . LYS D 1 193 ? -10.321 18.920  18.805  1.00 53.91  ? 179 LYS D CG    1 
ATOM   5990 C CD    . LYS D 1 193 ? -9.565  18.223  19.942  1.00 64.72  ? 179 LYS D CD    1 
ATOM   5991 C CE    . LYS D 1 193 ? -8.105  18.673  20.031  1.00 68.77  ? 179 LYS D CE    1 
ATOM   5992 N NZ    . LYS D 1 193 ? -7.268  17.778  20.880  1.00 69.41  ? 179 LYS D NZ    1 
ATOM   5993 N N     . TYR D 1 194 ? -10.848 16.569  14.744  1.00 28.95  ? 180 TYR D N     1 
ATOM   5994 C CA    . TYR D 1 194 ? -10.775 16.565  13.282  1.00 33.47  ? 180 TYR D CA    1 
ATOM   5995 C C     . TYR D 1 194 ? -11.973 15.826  12.737  1.00 32.69  ? 180 TYR D C     1 
ATOM   5996 O O     . TYR D 1 194 ? -11.883 14.627  12.434  1.00 32.93  ? 180 TYR D O     1 
ATOM   5997 C CB    . TYR D 1 194 ? -9.489  15.885  12.779  1.00 37.51  ? 180 TYR D CB    1 
ATOM   5998 C CG    . TYR D 1 194 ? -8.204  16.612  13.093  1.00 45.40  ? 180 TYR D CG    1 
ATOM   5999 C CD1   . TYR D 1 194 ? -6.990  15.925  13.123  1.00 50.88  ? 180 TYR D CD1   1 
ATOM   6000 C CD2   . TYR D 1 194 ? -8.194  17.986  13.351  1.00 53.13  ? 180 TYR D CD2   1 
ATOM   6001 C CE1   . TYR D 1 194 ? -5.792  16.579  13.400  1.00 52.21  ? 180 TYR D CE1   1 
ATOM   6002 C CE2   . TYR D 1 194 ? -6.997  18.658  13.633  1.00 56.97  ? 180 TYR D CE2   1 
ATOM   6003 C CZ    . TYR D 1 194 ? -5.801  17.947  13.652  1.00 58.63  ? 180 TYR D CZ    1 
ATOM   6004 O OH    . TYR D 1 194 ? -4.615  18.612  13.895  1.00 63.02  ? 180 TYR D OH    1 
ATOM   6005 N N     . ARG D 1 195 ? -13.086 16.550  12.622  1.00 29.46  ? 181 ARG D N     1 
ATOM   6006 C CA    . ARG D 1 195 ? -14.335 15.993  12.118  1.00 32.59  ? 181 ARG D CA    1 
ATOM   6007 C C     . ARG D 1 195 ? -14.180 15.483  10.677  1.00 31.20  ? 181 ARG D C     1 
ATOM   6008 O O     . ARG D 1 195 ? -13.674 16.187  9.791   1.00 31.17  ? 181 ARG D O     1 
ATOM   6009 C CB    . ARG D 1 195 ? -15.441 17.040  12.169  1.00 36.65  ? 181 ARG D CB    1 
ATOM   6010 C CG    . ARG D 1 195 ? -15.698 17.636  13.523  1.00 38.47  ? 181 ARG D CG    1 
ATOM   6011 C CD    . ARG D 1 195 ? -16.573 18.859  13.299  1.00 55.54  ? 181 ARG D CD    1 
ATOM   6012 N NE    . ARG D 1 195 ? -17.107 19.460  14.516  1.00 67.75  ? 181 ARG D NE    1 
ATOM   6013 C CZ    . ARG D 1 195 ? -18.005 20.447  14.517  1.00 73.51  ? 181 ARG D CZ    1 
ATOM   6014 N NH1   . ARG D 1 195 ? -18.459 20.931  13.361  1.00 73.74  ? 181 ARG D NH1   1 
ATOM   6015 N NH2   . ARG D 1 195 ? -18.452 20.954  15.666  1.00 73.62  ? 181 ARG D NH2   1 
ATOM   6016 N N     . PRO D 1 196 ? -14.635 14.246  10.428  1.00 32.84  ? 182 PRO D N     1 
ATOM   6017 C CA    . PRO D 1 196 ? -14.576 13.566  9.131   1.00 30.94  ? 182 PRO D CA    1 
ATOM   6018 C C     . PRO D 1 196 ? -15.140 14.323  7.940   1.00 30.31  ? 182 PRO D C     1 
ATOM   6019 O O     . PRO D 1 196 ? -14.589 14.221  6.841   1.00 33.36  ? 182 PRO D O     1 
ATOM   6020 C CB    . PRO D 1 196 ? -15.381 12.281  9.359   1.00 34.74  ? 182 PRO D CB    1 
ATOM   6021 C CG    . PRO D 1 196 ? -15.215 12.012  10.761  1.00 36.26  ? 182 PRO D CG    1 
ATOM   6022 C CD    . PRO D 1 196 ? -15.263 13.380  11.441  1.00 26.78  ? 182 PRO D CD    1 
ATOM   6023 N N     . THR D 1 197 ? -16.248 15.041  8.123   1.00 29.04  ? 183 THR D N     1 
ATOM   6024 C CA    . THR D 1 197 ? -16.858 15.731  6.975   1.00 28.94  ? 183 THR D CA    1 
ATOM   6025 C C     . THR D 1 197 ? -16.348 17.142  6.788   1.00 31.38  ? 183 THR D C     1 
ATOM   6026 O O     . THR D 1 197 ? -16.800 17.878  5.906   1.00 34.88  ? 183 THR D O     1 
ATOM   6027 C CB    . THR D 1 197 ? -18.416 15.760  7.065   1.00 24.88  ? 183 THR D CB    1 
ATOM   6028 O OG1   . THR D 1 197 ? -18.808 16.563  8.182   1.00 23.27  ? 183 THR D OG1   1 
ATOM   6029 C CG2   . THR D 1 197 ? -18.978 14.351  7.247   1.00 21.03  ? 183 THR D CG2   1 
ATOM   6030 N N     . ASP D 1 198 ? -15.405 17.541  7.620   1.00 35.09  ? 184 ASP D N     1 
ATOM   6031 C CA    . ASP D 1 198 ? -14.847 18.864  7.440   1.00 35.43  ? 184 ASP D CA    1 
ATOM   6032 C C     . ASP D 1 198 ? -14.226 18.943  6.023   1.00 32.47  ? 184 ASP D C     1 
ATOM   6033 O O     . ASP D 1 198 ? -13.419 18.090  5.598   1.00 31.25  ? 184 ASP D O     1 
ATOM   6034 C CB    . ASP D 1 198 ? -13.799 19.139  8.521   1.00 40.67  ? 184 ASP D CB    1 
ATOM   6035 C CG    . ASP D 1 198 ? -14.429 19.562  9.861   1.00 51.64  ? 184 ASP D CG    1 
ATOM   6036 O OD1   . ASP D 1 198 ? -15.674 19.719  9.919   1.00 49.74  ? 184 ASP D OD1   1 
ATOM   6037 O OD2   . ASP D 1 198 ? -13.679 19.742  10.856  1.00 54.76  ? 184 ASP D OD2   1 
ATOM   6038 N N     . ASP D 1 199 ? -14.659 19.943  5.274   1.00 26.77  ? 185 ASP D N     1 
ATOM   6039 C CA    . ASP D 1 199 ? -14.153 20.173  3.922   1.00 29.73  ? 185 ASP D CA    1 
ATOM   6040 C C     . ASP D 1 199 ? -14.457 19.073  2.940   1.00 28.33  ? 185 ASP D C     1 
ATOM   6041 O O     . ASP D 1 199 ? -13.826 18.964  1.884   1.00 27.50  ? 185 ASP D O     1 
ATOM   6042 C CB    . ASP D 1 199 ? -12.645 20.443  3.965   1.00 30.99  ? 185 ASP D CB    1 
ATOM   6043 C CG    . ASP D 1 199 ? -12.329 21.698  4.726   1.00 40.69  ? 185 ASP D CG    1 
ATOM   6044 O OD1   . ASP D 1 199 ? -12.710 22.786  4.250   1.00 52.17  ? 185 ASP D OD1   1 
ATOM   6045 O OD2   . ASP D 1 199 ? -11.734 21.610  5.811   1.00 47.26  ? 185 ASP D OD2   1 
ATOM   6046 N N     . PHE D 1 200 ? -15.473 18.289  3.265   1.00 29.90  ? 186 PHE D N     1 
ATOM   6047 C CA    . PHE D 1 200 ? -15.848 17.208  2.393   1.00 29.11  ? 186 PHE D CA    1 
ATOM   6048 C C     . PHE D 1 200 ? -15.985 17.629  0.931   1.00 29.00  ? 186 PHE D C     1 
ATOM   6049 O O     . PHE D 1 200 ? -15.495 16.948  0.034   1.00 25.56  ? 186 PHE D O     1 
ATOM   6050 C CB    . PHE D 1 200 ? -17.175 16.594  2.828   1.00 30.57  ? 186 PHE D CB    1 
ATOM   6051 C CG    . PHE D 1 200 ? -17.592 15.443  1.945   1.00 29.82  ? 186 PHE D CG    1 
ATOM   6052 C CD1   . PHE D 1 200 ? -16.963 14.216  2.069   1.00 25.64  ? 186 PHE D CD1   1 
ATOM   6053 C CD2   . PHE D 1 200 ? -18.577 15.604  0.968   1.00 23.69  ? 186 PHE D CD2   1 
ATOM   6054 C CE1   . PHE D 1 200 ? -17.272 13.172  1.208   1.00 25.20  ? 186 PHE D CE1   1 
ATOM   6055 C CE2   . PHE D 1 200 ? -18.892 14.577  0.107   1.00 24.43  ? 186 PHE D CE2   1 
ATOM   6056 C CZ    . PHE D 1 200 ? -18.247 13.348  0.237   1.00 21.74  ? 186 PHE D CZ    1 
ATOM   6057 N N     . GLU D 1 201 ? -16.677 18.745  0.695   1.00 25.60  ? 187 GLU D N     1 
ATOM   6058 C CA    . GLU D 1 201 ? -16.911 19.260  -0.662  1.00 26.37  ? 187 GLU D CA    1 
ATOM   6059 C C     . GLU D 1 201 ? -15.647 19.634  -1.365  1.00 25.62  ? 187 GLU D C     1 
ATOM   6060 O O     . GLU D 1 201 ? -15.586 19.642  -2.590  1.00 27.69  ? 187 GLU D O     1 
ATOM   6061 C CB    . GLU D 1 201 ? -17.697 20.555  -0.665  1.00 33.81  ? 187 GLU D CB    1 
ATOM   6062 C CG    . GLU D 1 201 ? -19.067 20.519  -0.063  1.00 38.98  ? 187 GLU D CG    1 
ATOM   6063 C CD    . GLU D 1 201 ? -19.528 19.131  0.273   1.00 19.97  ? 187 GLU D CD    1 
ATOM   6064 O OE1   . GLU D 1 201 ? -19.629 18.305  -0.655  1.00 20.00  ? 187 GLU D OE1   1 
ATOM   6065 O OE2   . GLU D 1 201 ? -19.783 18.865  1.478   1.00 20.02  ? 187 GLU D OE2   1 
ATOM   6066 N N     . ALA D 1 202 ? -14.631 19.973  -0.589  1.00 24.32  ? 188 ALA D N     1 
ATOM   6067 C CA    . ALA D 1 202 ? -13.354 20.370  -1.169  1.00 26.76  ? 188 ALA D CA    1 
ATOM   6068 C C     . ALA D 1 202 ? -12.528 19.093  -1.363  1.00 23.93  ? 188 ALA D C     1 
ATOM   6069 O O     . ALA D 1 202 ? -11.729 18.997  -2.288  1.00 24.47  ? 188 ALA D O     1 
ATOM   6070 C CB    . ALA D 1 202 ? -12.631 21.342  -0.243  1.00 23.27  ? 188 ALA D CB    1 
ATOM   6071 N N     . ARG D 1 203 ? -12.745 18.098  -0.502  1.00 24.81  ? 189 ARG D N     1 
ATOM   6072 C CA    . ARG D 1 203 ? -11.989 16.831  -0.597  1.00 25.20  ? 189 ARG D CA    1 
ATOM   6073 C C     . ARG D 1 203 ? -12.520 15.848  -1.620  1.00 23.51  ? 189 ARG D C     1 
ATOM   6074 O O     . ARG D 1 203 ? -11.742 15.207  -2.310  1.00 23.56  ? 189 ARG D O     1 
ATOM   6075 C CB    . ARG D 1 203 ? -11.946 16.106  0.755   1.00 21.97  ? 189 ARG D CB    1 
ATOM   6076 C CG    . ARG D 1 203 ? -11.284 16.869  1.885   1.00 16.88  ? 189 ARG D CG    1 
ATOM   6077 C CD    . ARG D 1 203 ? -11.146 16.004  3.113   1.00 16.53  ? 189 ARG D CD    1 
ATOM   6078 N NE    . ARG D 1 203 ? -10.616 16.761  4.240   1.00 24.05  ? 189 ARG D NE    1 
ATOM   6079 C CZ    . ARG D 1 203 ? -9.334  17.054  4.438   1.00 27.39  ? 189 ARG D CZ    1 
ATOM   6080 N NH1   . ARG D 1 203 ? -8.390  16.651  3.586   1.00 31.66  ? 189 ARG D NH1   1 
ATOM   6081 N NH2   . ARG D 1 203 ? -8.999  17.776  5.492   1.00 23.13  ? 189 ARG D NH2   1 
ATOM   6082 N N     . TRP D 1 204 ? -13.847 15.737  -1.729  1.00 25.13  ? 190 TRP D N     1 
ATOM   6083 C CA    . TRP D 1 204 ? -14.439 14.777  -2.638  1.00 21.39  ? 190 TRP D CA    1 
ATOM   6084 C C     . TRP D 1 204 ? -13.990 14.854  -4.088  1.00 20.96  ? 190 TRP D C     1 
ATOM   6085 O O     . TRP D 1 204 ? -13.735 13.826  -4.703  1.00 25.47  ? 190 TRP D O     1 
ATOM   6086 C CB    . TRP D 1 204 ? -15.973 14.789  -2.556  1.00 20.60  ? 190 TRP D CB    1 
ATOM   6087 C CG    . TRP D 1 204 ? -16.534 13.859  -3.571  1.00 20.72  ? 190 TRP D CG    1 
ATOM   6088 C CD1   . TRP D 1 204 ? -17.013 14.189  -4.804  1.00 24.34  ? 190 TRP D CD1   1 
ATOM   6089 C CD2   . TRP D 1 204 ? -16.438 12.426  -3.554  1.00 21.64  ? 190 TRP D CD2   1 
ATOM   6090 N NE1   . TRP D 1 204 ? -17.200 13.062  -5.565  1.00 18.81  ? 190 TRP D NE1   1 
ATOM   6091 C CE2   . TRP D 1 204 ? -16.853 11.963  -4.822  1.00 22.37  ? 190 TRP D CE2   1 
ATOM   6092 C CE3   . TRP D 1 204 ? -16.030 11.494  -2.593  1.00 22.22  ? 190 TRP D CE3   1 
ATOM   6093 C CZ2   . TRP D 1 204 ? -16.875 10.597  -5.165  1.00 20.80  ? 190 TRP D CZ2   1 
ATOM   6094 C CZ3   . TRP D 1 204 ? -16.050 10.135  -2.931  1.00 26.81  ? 190 TRP D CZ3   1 
ATOM   6095 C CH2   . TRP D 1 204 ? -16.469 9.706   -4.211  1.00 23.42  ? 190 TRP D CH2   1 
ATOM   6096 N N     . PRO D 1 205 ? -13.883 16.057  -4.666  1.00 23.61  ? 191 PRO D N     1 
ATOM   6097 C CA    . PRO D 1 205 ? -13.431 16.113  -6.061  1.00 22.92  ? 191 PRO D CA    1 
ATOM   6098 C C     . PRO D 1 205 ? -12.016 15.509  -6.182  1.00 25.18  ? 191 PRO D C     1 
ATOM   6099 O O     . PRO D 1 205 ? -11.658 14.949  -7.215  1.00 24.82  ? 191 PRO D O     1 
ATOM   6100 C CB    . PRO D 1 205 ? -13.423 17.607  -6.370  1.00 28.63  ? 191 PRO D CB    1 
ATOM   6101 C CG    . PRO D 1 205 ? -14.454 18.175  -5.418  1.00 29.61  ? 191 PRO D CG    1 
ATOM   6102 C CD    . PRO D 1 205 ? -14.245 17.391  -4.155  1.00 27.28  ? 191 PRO D CD    1 
ATOM   6103 N N     . LEU D 1 206 ? -11.220 15.640  -5.125  1.00 26.08  ? 192 LEU D N     1 
ATOM   6104 C CA    . LEU D 1 206 ? -9.858  15.099  -5.107  1.00 30.58  ? 192 LEU D CA    1 
ATOM   6105 C C     . LEU D 1 206 ? -9.902  13.576  -5.071  1.00 27.63  ? 192 LEU D C     1 
ATOM   6106 O O     . LEU D 1 206 ? -9.156  12.898  -5.794  1.00 27.88  ? 192 LEU D O     1 
ATOM   6107 C CB    . LEU D 1 206 ? -9.087  15.626  -3.886  1.00 25.64  ? 192 LEU D CB    1 
ATOM   6108 C CG    . LEU D 1 206 ? -8.347  16.961  -4.072  1.00 32.33  ? 192 LEU D CG    1 
ATOM   6109 C CD1   . LEU D 1 206 ? -9.141  17.915  -4.902  1.00 37.37  ? 192 LEU D CD1   1 
ATOM   6110 C CD2   . LEU D 1 206 ? -8.028  17.560  -2.737  1.00 26.00  ? 192 LEU D CD2   1 
ATOM   6111 N N     . VAL D 1 207 ? -10.769 13.050  -4.206  1.00 27.05  ? 193 VAL D N     1 
ATOM   6112 C CA    . VAL D 1 207 ? -10.944 11.599  -4.085  1.00 28.09  ? 193 VAL D CA    1 
ATOM   6113 C C     . VAL D 1 207 ? -11.481 11.039  -5.410  1.00 30.18  ? 193 VAL D C     1 
ATOM   6114 O O     . VAL D 1 207 ? -11.076 9.967   -5.861  1.00 28.55  ? 193 VAL D O     1 
ATOM   6115 C CB    . VAL D 1 207 ? -11.920 11.247  -2.939  1.00 30.47  ? 193 VAL D CB    1 
ATOM   6116 C CG1   . VAL D 1 207 ? -12.187 9.752   -2.912  1.00 29.75  ? 193 VAL D CG1   1 
ATOM   6117 C CG2   . VAL D 1 207 ? -11.354 11.722  -1.606  1.00 21.47  ? 193 VAL D CG2   1 
ATOM   6118 N N     . ALA D 1 208 ? -12.392 11.787  -6.021  1.00 25.44  ? 194 ALA D N     1 
ATOM   6119 C CA    . ALA D 1 208 ? -13.025 11.392  -7.270  1.00 25.93  ? 194 ALA D CA    1 
ATOM   6120 C C     . ALA D 1 208 ? -12.040 11.381  -8.426  1.00 22.68  ? 194 ALA D C     1 
ATOM   6121 O O     . ALA D 1 208 ? -12.232 10.672  -9.417  1.00 24.30  ? 194 ALA D O     1 
ATOM   6122 C CB    . ALA D 1 208 ? -14.201 12.343  -7.580  1.00 22.33  ? 194 ALA D CB    1 
ATOM   6123 N N     . ALA D 1 209 ? -10.968 12.156  -8.306  1.00 23.25  ? 195 ALA D N     1 
ATOM   6124 C CA    . ALA D 1 209 ? -9.990  12.198  -9.380  1.00 25.08  ? 195 ALA D CA    1 
ATOM   6125 C C     . ALA D 1 209 ? -9.230  10.870  -9.431  1.00 23.97  ? 195 ALA D C     1 
ATOM   6126 O O     . ALA D 1 209 ? -8.534  10.598  -10.379 1.00 29.20  ? 195 ALA D O     1 
ATOM   6127 C CB    . ALA D 1 209 ? -9.020  13.365  -9.159  1.00 30.01  ? 195 ALA D CB    1 
ATOM   6128 N N     . GLN D 1 210 ? -9.361  10.070  -8.380  1.00 30.85  ? 196 GLN D N     1 
ATOM   6129 C CA    . GLN D 1 210 ? -8.717  8.759   -8.278  1.00 33.67  ? 196 GLN D CA    1 
ATOM   6130 C C     . GLN D 1 210 ? -9.521  7.699   -9.043  1.00 36.01  ? 196 GLN D C     1 
ATOM   6131 O O     . GLN D 1 210 ? -9.004  6.634   -9.386  1.00 39.44  ? 196 GLN D O     1 
ATOM   6132 C CB    . GLN D 1 210 ? -8.633  8.343   -6.803  1.00 29.04  ? 196 GLN D CB    1 
ATOM   6133 C CG    . GLN D 1 210 ? -7.721  9.175   -5.979  1.00 30.58  ? 196 GLN D CG    1 
ATOM   6134 C CD    . GLN D 1 210 ? -7.732  8.793   -4.508  1.00 37.83  ? 196 GLN D CD    1 
ATOM   6135 O OE1   . GLN D 1 210 ? -8.702  9.042   -3.796  1.00 53.09  ? 196 GLN D OE1   1 
ATOM   6136 N NE2   . GLN D 1 210 ? -6.652  8.200   -4.043  1.00 33.99  ? 196 GLN D NE2   1 
ATOM   6137 N N     . LEU D 1 211 ? -10.792 8.001   -9.293  1.00 34.38  ? 197 LEU D N     1 
ATOM   6138 C CA    . LEU D 1 211 ? -11.680 7.089   -9.977  1.00 37.58  ? 197 LEU D CA    1 
ATOM   6139 C C     . LEU D 1 211 ? -11.438 7.132   -11.485 1.00 38.11  ? 197 LEU D C     1 
ATOM   6140 O O     . LEU D 1 211 ? -12.154 7.806   -12.220 1.00 41.38  ? 197 LEU D O     1 
ATOM   6141 C CB    . LEU D 1 211 ? -13.140 7.444   -9.630  1.00 34.51  ? 197 LEU D CB    1 
ATOM   6142 C CG    . LEU D 1 211 ? -13.445 7.484   -8.119  1.00 37.41  ? 197 LEU D CG    1 
ATOM   6143 C CD1   . LEU D 1 211 ? -14.960 7.563   -7.825  1.00 27.00  ? 197 LEU D CD1   1 
ATOM   6144 C CD2   . LEU D 1 211 ? -12.885 6.224   -7.490  1.00 32.69  ? 197 LEU D CD2   1 
ATOM   6145 N N     . GLN D 1 212 ? -10.433 6.391   -11.948 1.00 39.99  ? 198 GLN D N     1 
ATOM   6146 C CA    . GLN D 1 212 ? -10.083 6.377   -13.383 1.00 41.14  ? 198 GLN D CA    1 
ATOM   6147 C C     . GLN D 1 212 ? -10.315 5.046   -14.112 1.00 37.53  ? 198 GLN D C     1 
ATOM   6148 O O     . GLN D 1 212 ? -10.140 3.975   -13.491 1.00 34.89  ? 198 GLN D O     1 
ATOM   6149 C CB    . GLN D 1 212 ? -8.612  6.785   -13.552 1.00 37.10  ? 198 GLN D CB    1 
ATOM   6150 C CG    . GLN D 1 212 ? -8.277  8.151   -12.952 1.00 39.01  ? 198 GLN D CG    1 
ATOM   6151 C CD    . GLN D 1 212 ? -6.770  8.386   -12.829 1.00 36.55  ? 198 GLN D CD    1 
ATOM   6152 O OE1   . GLN D 1 212 ? -5.996  7.950   -13.680 1.00 40.97  ? 198 GLN D OE1   1 
ATOM   6153 N NE2   . GLN D 1 212 ? -6.357  9.086   -11.780 1.00 33.70  ? 198 GLN D NE2   1 
ATOM   6154 O OXT   . GLN D 1 212 ? -10.636 5.098   -15.320 1.00 36.11  ? 198 GLN D OXT   1 
ATOM   6155 O "O5'" . DG  E 2 1   ? -18.649 -10.352 48.710  1.00 56.41  ? 2   DG  W "O5'" 1 
ATOM   6156 C "C5'" . DG  E 2 1   ? -19.184 -11.510 49.345  1.00 50.58  ? 2   DG  W "C5'" 1 
ATOM   6157 C "C4'" . DG  E 2 1   ? -18.864 -12.730 48.518  1.00 46.61  ? 2   DG  W "C4'" 1 
ATOM   6158 O "O4'" . DG  E 2 1   ? -19.557 -12.560 47.256  1.00 53.46  ? 2   DG  W "O4'" 1 
ATOM   6159 C "C3'" . DG  E 2 1   ? -17.378 -12.858 48.193  1.00 45.57  ? 2   DG  W "C3'" 1 
ATOM   6160 O "O3'" . DG  E 2 1   ? -16.839 -14.154 48.382  1.00 40.11  ? 2   DG  W "O3'" 1 
ATOM   6161 C "C2'" . DG  E 2 1   ? -17.261 -12.502 46.730  1.00 48.44  ? 2   DG  W "C2'" 1 
ATOM   6162 C "C1'" . DG  E 2 1   ? -18.660 -12.580 46.156  1.00 48.68  ? 2   DG  W "C1'" 1 
ATOM   6163 N N9    . DG  E 2 1   ? -18.885 -11.371 45.370  1.00 49.02  ? 2   DG  W N9    1 
ATOM   6164 C C8    . DG  E 2 1   ? -19.327 -10.146 45.823  1.00 49.30  ? 2   DG  W C8    1 
ATOM   6165 N N7    . DG  E 2 1   ? -19.262 -9.211  44.911  1.00 49.36  ? 2   DG  W N7    1 
ATOM   6166 C C5    . DG  E 2 1   ? -18.785 -9.867  43.781  1.00 46.22  ? 2   DG  W C5    1 
ATOM   6167 C C6    . DG  E 2 1   ? -18.484 -9.371  42.477  1.00 44.49  ? 2   DG  W C6    1 
ATOM   6168 O O6    . DG  E 2 1   ? -18.566 -8.213  42.054  1.00 41.01  ? 2   DG  W O6    1 
ATOM   6169 N N1    . DG  E 2 1   ? -18.043 -10.388 41.633  1.00 38.87  ? 2   DG  W N1    1 
ATOM   6170 C C2    . DG  E 2 1   ? -17.909 -11.708 41.987  1.00 39.50  ? 2   DG  W C2    1 
ATOM   6171 N N2    . DG  E 2 1   ? -17.487 -12.536 41.029  1.00 43.16  ? 2   DG  W N2    1 
ATOM   6172 N N3    . DG  E 2 1   ? -18.170 -12.182 43.198  1.00 44.03  ? 2   DG  W N3    1 
ATOM   6173 C C4    . DG  E 2 1   ? -18.595 -11.212 44.039  1.00 46.65  ? 2   DG  W C4    1 
ATOM   6174 P P     . DT  E 2 2   ? -15.256 -14.352 48.249  1.00 50.01  ? 3   DT  W P     1 
ATOM   6175 O OP1   . DT  E 2 2   ? -14.835 -15.575 48.980  1.00 57.12  ? 3   DT  W OP1   1 
ATOM   6176 O OP2   . DT  E 2 2   ? -14.620 -13.044 48.580  1.00 52.09  ? 3   DT  W OP2   1 
ATOM   6177 O "O5'" . DT  E 2 2   ? -15.033 -14.590 46.690  1.00 52.44  ? 3   DT  W "O5'" 1 
ATOM   6178 C "C5'" . DT  E 2 2   ? -15.503 -15.773 46.058  1.00 46.86  ? 3   DT  W "C5'" 1 
ATOM   6179 C "C4'" . DT  E 2 2   ? -14.833 -15.940 44.716  1.00 48.14  ? 3   DT  W "C4'" 1 
ATOM   6180 O "O4'" . DT  E 2 2   ? -15.247 -14.866 43.835  1.00 46.41  ? 3   DT  W "O4'" 1 
ATOM   6181 C "C3'" . DT  E 2 2   ? -13.310 -15.883 44.762  1.00 47.88  ? 3   DT  W "C3'" 1 
ATOM   6182 O "O3'" . DT  E 2 2   ? -12.794 -16.762 43.777  1.00 54.59  ? 3   DT  W "O3'" 1 
ATOM   6183 C "C2'" . DT  E 2 2   ? -12.995 -14.455 44.352  1.00 48.90  ? 3   DT  W "C2'" 1 
ATOM   6184 C "C1'" . DT  E 2 2   ? -14.115 -14.142 43.373  1.00 44.01  ? 3   DT  W "C1'" 1 
ATOM   6185 N N1    . DT  E 2 2   ? -14.487 -12.706 43.308  1.00 46.49  ? 3   DT  W N1    1 
ATOM   6186 C C2    . DT  E 2 2   ? -14.323 -12.055 42.100  1.00 43.55  ? 3   DT  W C2    1 
ATOM   6187 O O2    . DT  E 2 2   ? -13.920 -12.608 41.097  1.00 43.04  ? 3   DT  W O2    1 
ATOM   6188 N N3    . DT  E 2 2   ? -14.654 -10.727 42.112  1.00 40.19  ? 3   DT  W N3    1 
ATOM   6189 C C4    . DT  E 2 2   ? -15.125 -9.996  43.177  1.00 40.91  ? 3   DT  W C4    1 
ATOM   6190 O O4    . DT  E 2 2   ? -15.373 -8.799  43.035  1.00 47.40  ? 3   DT  W O4    1 
ATOM   6191 C C5    . DT  E 2 2   ? -15.287 -10.731 44.408  1.00 37.88  ? 3   DT  W C5    1 
ATOM   6192 C C7    . DT  E 2 2   ? -15.795 -10.004 45.611  1.00 35.58  ? 3   DT  W C7    1 
ATOM   6193 C C6    . DT  E 2 2   ? -14.970 -12.037 44.415  1.00 37.34  ? 3   DT  W C6    1 
ATOM   6194 P P     . DG  E 2 3   ? -11.658 -17.810 44.177  1.00 57.07  ? 4   DG  W P     1 
ATOM   6195 O OP1   . DG  E 2 3   ? -12.370 -19.019 44.664  1.00 67.00  ? 4   DG  W OP1   1 
ATOM   6196 O OP2   . DG  E 2 3   ? -10.679 -17.119 45.059  1.00 63.27  ? 4   DG  W OP2   1 
ATOM   6197 O "O5'" . DG  E 2 3   ? -10.962 -18.168 42.796  1.00 57.04  ? 4   DG  W "O5'" 1 
ATOM   6198 C "C5'" . DG  E 2 3   ? -11.726 -18.729 41.739  1.00 56.01  ? 4   DG  W "C5'" 1 
ATOM   6199 C "C4'" . DG  E 2 3   ? -11.199 -18.254 40.409  1.00 56.06  ? 4   DG  W "C4'" 1 
ATOM   6200 O "O4'" . DG  E 2 3   ? -11.408 -16.828 40.282  1.00 55.14  ? 4   DG  W "O4'" 1 
ATOM   6201 C "C3'" . DG  E 2 3   ? -9.709  -18.491 40.206  1.00 55.08  ? 4   DG  W "C3'" 1 
ATOM   6202 O "O3'" . DG  E 2 3   ? -9.519  -18.970 38.880  1.00 60.74  ? 4   DG  W "O3'" 1 
ATOM   6203 C "C2'" . DG  E 2 3   ? -9.077  -17.131 40.471  1.00 53.35  ? 4   DG  W "C2'" 1 
ATOM   6204 C "C1'" . DG  E 2 3   ? -10.176 -16.136 40.109  1.00 53.40  ? 4   DG  W "C1'" 1 
ATOM   6205 N N9    . DG  E 2 3   ? -10.243 -14.927 40.934  1.00 50.40  ? 4   DG  W N9    1 
ATOM   6206 C C8    . DG  E 2 3   ? -10.016 -14.838 42.284  1.00 46.65  ? 4   DG  W C8    1 
ATOM   6207 N N7    . DG  E 2 3   ? -10.235 -13.644 42.767  1.00 51.78  ? 4   DG  W N7    1 
ATOM   6208 C C5    . DG  E 2 3   ? -10.611 -12.883 41.665  1.00 48.91  ? 4   DG  W C5    1 
ATOM   6209 C C6    . DG  E 2 3   ? -10.992 -11.488 41.559  1.00 46.88  ? 4   DG  W C6    1 
ATOM   6210 O O6    . DG  E 2 3   ? -11.075 -10.615 42.450  1.00 35.06  ? 4   DG  W O6    1 
ATOM   6211 N N1    . DG  E 2 3   ? -11.297 -11.149 40.248  1.00 43.47  ? 4   DG  W N1    1 
ATOM   6212 C C2    . DG  E 2 3   ? -11.246 -12.005 39.180  1.00 47.83  ? 4   DG  W C2    1 
ATOM   6213 N N2    . DG  E 2 3   ? -11.591 -11.479 38.001  1.00 51.37  ? 4   DG  W N2    1 
ATOM   6214 N N3    . DG  E 2 3   ? -10.892 -13.280 39.258  1.00 48.48  ? 4   DG  W N3    1 
ATOM   6215 C C4    . DG  E 2 3   ? -10.597 -13.653 40.521  1.00 49.63  ? 4   DG  W C4    1 
ATOM   6216 P P     . DA  E 2 4   ? -8.040  -19.232 38.326  1.00 67.35  ? 5   DA  W P     1 
ATOM   6217 O OP1   . DA  E 2 4   ? -8.163  -20.187 37.199  1.00 65.91  ? 5   DA  W OP1   1 
ATOM   6218 O OP2   . DA  E 2 4   ? -7.098  -19.518 39.436  1.00 67.45  ? 5   DA  W OP2   1 
ATOM   6219 O "O5'" . DA  E 2 4   ? -7.657  -17.818 37.724  1.00 65.12  ? 5   DA  W "O5'" 1 
ATOM   6220 C "C5'" . DA  E 2 4   ? -8.543  -17.158 36.834  1.00 57.46  ? 5   DA  W "C5'" 1 
ATOM   6221 C "C4'" . DA  E 2 4   ? -7.881  -15.913 36.305  1.00 54.86  ? 5   DA  W "C4'" 1 
ATOM   6222 O "O4'" . DA  E 2 4   ? -8.139  -14.805 37.203  1.00 56.14  ? 5   DA  W "O4'" 1 
ATOM   6223 C "C3'" . DA  E 2 4   ? -6.361  -16.063 36.212  1.00 56.36  ? 5   DA  W "C3'" 1 
ATOM   6224 O "O3'" . DA  E 2 4   ? -5.902  -15.643 34.929  1.00 54.47  ? 5   DA  W "O3'" 1 
ATOM   6225 C "C2'" . DA  E 2 4   ? -5.836  -15.212 37.362  1.00 52.84  ? 5   DA  W "C2'" 1 
ATOM   6226 C "C1'" . DA  E 2 4   ? -6.923  -14.164 37.547  1.00 52.98  ? 5   DA  W "C1'" 1 
ATOM   6227 N N9    . DA  E 2 4   ? -7.047  -13.639 38.912  1.00 52.52  ? 5   DA  W N9    1 
ATOM   6228 C C8    . DA  E 2 4   ? -6.765  -14.298 40.084  1.00 52.56  ? 5   DA  W C8    1 
ATOM   6229 N N7    . DA  E 2 4   ? -6.905  -13.557 41.157  1.00 45.65  ? 5   DA  W N7    1 
ATOM   6230 C C5    . DA  E 2 4   ? -7.316  -12.326 40.665  1.00 46.19  ? 5   DA  W C5    1 
ATOM   6231 C C6    . DA  E 2 4   ? -7.598  -11.096 41.297  1.00 43.08  ? 5   DA  W C6    1 
ATOM   6232 N N6    . DA  E 2 4   ? -7.464  -10.886 42.609  1.00 42.58  ? 5   DA  W N6    1 
ATOM   6233 N N1    . DA  E 2 4   ? -8.005  -10.069 40.521  1.00 40.31  ? 5   DA  W N1    1 
ATOM   6234 C C2    . DA  E 2 4   ? -8.086  -10.260 39.199  1.00 43.80  ? 5   DA  W C2    1 
ATOM   6235 N N3    . DA  E 2 4   ? -7.819  -11.354 38.486  1.00 45.81  ? 5   DA  W N3    1 
ATOM   6236 C C4    . DA  E 2 4   ? -7.436  -12.366 39.284  1.00 50.08  ? 5   DA  W C4    1 
ATOM   6237 P P     . DG  E 2 5   ? -4.354  -15.292 34.701  1.00 62.45  ? 6   DG  W P     1 
ATOM   6238 O OP1   . DG  E 2 5   ? -4.140  -15.385 33.237  1.00 63.14  ? 6   DG  W OP1   1 
ATOM   6239 O OP2   . DG  E 2 5   ? -3.486  -16.061 35.622  1.00 70.06  ? 6   DG  W OP2   1 
ATOM   6240 O "O5'" . DG  E 2 5   ? -4.344  -13.754 35.097  1.00 67.86  ? 6   DG  W "O5'" 1 
ATOM   6241 C "C5'" . DG  E 2 5   ? -5.522  -13.007 34.804  1.00 71.83  ? 6   DG  W "C5'" 1 
ATOM   6242 C "C4'" . DG  E 2 5   ? -5.335  -11.538 35.071  1.00 63.25  ? 6   DG  W "C4'" 1 
ATOM   6243 O "O4'" . DG  E 2 5   ? -5.545  -11.303 36.480  1.00 59.98  ? 6   DG  W "O4'" 1 
ATOM   6244 C "C3'" . DG  E 2 5   ? -3.971  -10.964 34.719  1.00 56.30  ? 6   DG  W "C3'" 1 
ATOM   6245 O "O3'" . DG  E 2 5   ? -4.054  -10.125 33.544  1.00 61.44  ? 6   DG  W "O3'" 1 
ATOM   6246 C "C2'" . DG  E 2 5   ? -3.432  -10.382 36.027  1.00 56.78  ? 6   DG  W "C2'" 1 
ATOM   6247 C "C1'" . DG  E 2 5   ? -4.651  -10.330 36.949  1.00 53.85  ? 6   DG  W "C1'" 1 
ATOM   6248 N N9    . DG  E 2 5   ? -4.447  -10.588 38.377  1.00 48.64  ? 6   DG  W N9    1 
ATOM   6249 C C8    . DG  E 2 5   ? -4.056  -11.759 38.981  1.00 44.99  ? 6   DG  W C8    1 
ATOM   6250 N N7    . DG  E 2 5   ? -3.945  -11.650 40.281  1.00 43.48  ? 6   DG  W N7    1 
ATOM   6251 C C5    . DG  E 2 5   ? -4.286  -10.329 40.548  1.00 43.60  ? 6   DG  W C5    1 
ATOM   6252 C C6    . DG  E 2 5   ? -4.326  -9.598  41.778  1.00 38.46  ? 6   DG  W C6    1 
ATOM   6253 O O6    . DG  E 2 5   ? -4.032  -9.973  42.920  1.00 40.51  ? 6   DG  W O6    1 
ATOM   6254 N N1    . DG  E 2 5   ? -4.749  -8.291  41.579  1.00 43.87  ? 6   DG  W N1    1 
ATOM   6255 C C2    . DG  E 2 5   ? -5.078  -7.740  40.367  1.00 41.44  ? 6   DG  W C2    1 
ATOM   6256 N N2    . DG  E 2 5   ? -5.484  -6.463  40.377  1.00 40.03  ? 6   DG  W N2    1 
ATOM   6257 N N3    . DG  E 2 5   ? -5.019  -8.392  39.226  1.00 37.16  ? 6   DG  W N3    1 
ATOM   6258 C C4    . DG  E 2 5   ? -4.619  -9.669  39.386  1.00 41.22  ? 6   DG  W C4    1 
ATOM   6259 P P     . DT  E 2 6   ? -4.854  -8.731  33.556  1.00 49.36  ? 7   DT  W P     1 
ATOM   6260 O OP1   . DT  E 2 6   ? -6.168  -8.952  34.187  1.00 61.16  ? 7   DT  W OP1   1 
ATOM   6261 O OP2   . DT  E 2 6   ? -4.796  -8.211  32.182  1.00 59.74  ? 7   DT  W OP2   1 
ATOM   6262 O "O5'" . DT  E 2 6   ? -3.917  -7.787  34.437  1.00 61.94  ? 7   DT  W "O5'" 1 
ATOM   6263 C "C5'" . DT  E 2 6   ? -4.093  -6.380  34.399  1.00 52.91  ? 7   DT  W "C5'" 1 
ATOM   6264 C "C4'" . DT  E 2 6   ? -2.956  -5.653  35.083  1.00 47.43  ? 7   DT  W "C4'" 1 
ATOM   6265 O "O4'" . DT  E 2 6   ? -2.958  -5.902  36.515  1.00 39.29  ? 7   DT  W "O4'" 1 
ATOM   6266 C "C3'" . DT  E 2 6   ? -1.530  -5.912  34.589  1.00 44.64  ? 7   DT  W "C3'" 1 
ATOM   6267 O "O3'" . DT  E 2 6   ? -0.926  -4.704  34.124  1.00 38.54  ? 7   DT  W "O3'" 1 
ATOM   6268 C "C2'" . DT  E 2 6   ? -0.791  -6.351  35.842  1.00 46.60  ? 7   DT  W "C2'" 1 
ATOM   6269 C "C1'" . DT  E 2 6   ? -1.631  -5.808  36.990  1.00 41.81  ? 7   DT  W "C1'" 1 
ATOM   6270 N N1    . DT  E 2 6   ? -1.519  -6.668  38.191  1.00 40.35  ? 7   DT  W N1    1 
ATOM   6271 C C2    . DT  E 2 6   ? -1.609  -6.144  39.475  1.00 38.21  ? 7   DT  W C2    1 
ATOM   6272 O O2    . DT  E 2 6   ? -1.778  -4.957  39.730  1.00 33.04  ? 7   DT  W O2    1 
ATOM   6273 N N3    . DT  E 2 6   ? -1.502  -7.077  40.464  1.00 33.27  ? 7   DT  W N3    1 
ATOM   6274 C C4    . DT  E 2 6   ? -1.315  -8.437  40.320  1.00 40.30  ? 7   DT  W C4    1 
ATOM   6275 O O4    . DT  E 2 6   ? -1.288  -9.156  41.310  1.00 39.98  ? 7   DT  W O4    1 
ATOM   6276 C C5    . DT  E 2 6   ? -1.183  -8.905  38.957  1.00 39.08  ? 7   DT  W C5    1 
ATOM   6277 C C7    . DT  E 2 6   ? -0.887  -10.351 38.697  1.00 38.92  ? 7   DT  W C7    1 
ATOM   6278 C C6    . DT  E 2 6   ? -1.310  -8.014  37.984  1.00 39.21  ? 7   DT  W C6    1 
ATOM   6279 P P     . DA  E 2 7   ? 0.510   -4.748  33.399  1.00 37.00  ? 8   DA  W P     1 
ATOM   6280 O OP1   . DA  E 2 7   ? 0.346   -4.294  31.985  1.00 39.14  ? 8   DA  W OP1   1 
ATOM   6281 O OP2   . DA  E 2 7   ? 1.210   -6.022  33.675  1.00 30.26  ? 8   DA  W OP2   1 
ATOM   6282 O "O5'" . DA  E 2 7   ? 1.314   -3.592  34.132  1.00 31.46  ? 8   DA  W "O5'" 1 
ATOM   6283 C "C5'" . DA  E 2 7   ? 0.697   -2.329  34.386  1.00 27.84  ? 8   DA  W "C5'" 1 
ATOM   6284 C "C4'" . DA  E 2 7   ? 1.433   -1.605  35.491  1.00 30.79  ? 8   DA  W "C4'" 1 
ATOM   6285 O "O4'" . DA  E 2 7   ? 1.272   -2.323  36.739  1.00 29.38  ? 8   DA  W "O4'" 1 
ATOM   6286 C "C3'" . DA  E 2 7   ? 2.936   -1.449  35.290  1.00 25.50  ? 8   DA  W "C3'" 1 
ATOM   6287 O "O3'" . DA  E 2 7   ? 3.332   -0.219  35.890  1.00 28.87  ? 8   DA  W "O3'" 1 
ATOM   6288 C "C2'" . DA  E 2 7   ? 3.524   -2.622  36.058  1.00 29.34  ? 8   DA  W "C2'" 1 
ATOM   6289 C "C1'" . DA  E 2 7   ? 2.537   -2.799  37.207  1.00 32.94  ? 8   DA  W "C1'" 1 
ATOM   6290 N N9    . DA  E 2 7   ? 2.358   -4.194  37.626  1.00 35.03  ? 8   DA  W N9    1 
ATOM   6291 C C8    . DA  E 2 7   ? 2.352   -5.334  36.854  1.00 38.67  ? 8   DA  W C8    1 
ATOM   6292 N N7    . DA  E 2 7   ? 2.175   -6.446  37.545  1.00 36.70  ? 8   DA  W N7    1 
ATOM   6293 C C5    . DA  E 2 7   ? 2.062   -6.003  38.860  1.00 40.19  ? 8   DA  W C5    1 
ATOM   6294 C C6    . DA  E 2 7   ? 1.885   -6.685  40.100  1.00 33.05  ? 8   DA  W C6    1 
ATOM   6295 N N6    . DA  E 2 7   ? 1.828   -8.018  40.237  1.00 26.99  ? 8   DA  W N6    1 
ATOM   6296 N N1    . DA  E 2 7   ? 1.787   -5.933  41.212  1.00 32.74  ? 8   DA  W N1    1 
ATOM   6297 C C2    . DA  E 2 7   ? 1.893   -4.602  41.105  1.00 37.08  ? 8   DA  W C2    1 
ATOM   6298 N N3    . DA  E 2 7   ? 2.089   -3.851  40.021  1.00 39.74  ? 8   DA  W N3    1 
ATOM   6299 C C4    . DA  E 2 7   ? 2.162   -4.616  38.921  1.00 39.24  ? 8   DA  W C4    1 
ATOM   6300 P P     . DC  E 2 8   ? 4.872   0.213   35.890  1.00 29.03  ? 9   DC  W P     1 
ATOM   6301 O OP1   . DC  E 2 8   ? 4.892   1.692   35.847  1.00 32.00  ? 9   DC  W OP1   1 
ATOM   6302 O OP2   . DC  E 2 8   ? 5.577   -0.564  34.855  1.00 36.08  ? 9   DC  W OP2   1 
ATOM   6303 O "O5'" . DC  E 2 8   ? 5.403   -0.246  37.316  1.00 35.01  ? 9   DC  W "O5'" 1 
ATOM   6304 C "C5'" . DC  E 2 8   ? 4.682   0.105   38.479  1.00 30.36  ? 9   DC  W "C5'" 1 
ATOM   6305 C "C4'" . DC  E 2 8   ? 5.284   -0.566  39.688  1.00 30.15  ? 9   DC  W "C4'" 1 
ATOM   6306 O "O4'" . DC  E 2 8   ? 4.876   -1.957  39.754  1.00 31.71  ? 9   DC  W "O4'" 1 
ATOM   6307 C "C3'" . DC  E 2 8   ? 6.814   -0.552  39.723  1.00 33.37  ? 9   DC  W "C3'" 1 
ATOM   6308 O "O3'" . DC  E 2 8   ? 7.240   0.050   40.939  1.00 31.16  ? 9   DC  W "O3'" 1 
ATOM   6309 C "C2'" . DC  E 2 8   ? 7.200   -2.023  39.673  1.00 27.78  ? 9   DC  W "C2'" 1 
ATOM   6310 C "C1'" . DC  E 2 8   ? 5.963   -2.701  40.243  1.00 34.65  ? 9   DC  W "C1'" 1 
ATOM   6311 N N1    . DC  E 2 8   ? 5.757   -4.105  39.874  1.00 30.19  ? 9   DC  W N1    1 
ATOM   6312 C C2    . DC  E 2 8   ? 5.615   -5.058  40.894  1.00 37.42  ? 9   DC  W C2    1 
ATOM   6313 O O2    . DC  E 2 8   ? 5.678   -4.691  42.080  1.00 32.59  ? 9   DC  W O2    1 
ATOM   6314 N N3    . DC  E 2 8   ? 5.427   -6.353  40.563  1.00 33.68  ? 9   DC  W N3    1 
ATOM   6315 C C4    . DC  E 2 8   ? 5.392   -6.714  39.279  1.00 34.39  ? 9   DC  W C4    1 
ATOM   6316 N N4    . DC  E 2 8   ? 5.204   -8.006  39.001  1.00 37.48  ? 9   DC  W N4    1 
ATOM   6317 C C5    . DC  E 2 8   ? 5.543   -5.769  38.226  1.00 29.69  ? 9   DC  W C5    1 
ATOM   6318 C C6    . DC  E 2 8   ? 5.715   -4.487  38.566  1.00 34.74  ? 9   DC  W C6    1 
ATOM   6319 P P     . DT  E 2 9   ? 8.786   -0.013  41.372  1.00 39.38  ? 10  DT  W P     1 
ATOM   6320 O OP1   . DT  E 2 9   ? 9.090   1.324   41.921  1.00 33.73  ? 10  DT  W OP1   1 
ATOM   6321 O OP2   . DT  E 2 9   ? 9.637   -0.539  40.282  1.00 38.05  ? 10  DT  W OP2   1 
ATOM   6322 O "O5'" . DT  E 2 9   ? 8.737   -1.117  42.519  1.00 33.44  ? 10  DT  W "O5'" 1 
ATOM   6323 C "C5'" . DT  E 2 9   ? 7.800   -1.012  43.591  1.00 33.06  ? 10  DT  W "C5'" 1 
ATOM   6324 C "C4'" . DT  E 2 9   ? 8.245   -1.859  44.761  1.00 34.41  ? 10  DT  W "C4'" 1 
ATOM   6325 O "O4'" . DT  E 2 9   ? 7.995   -3.258  44.496  1.00 34.23  ? 10  DT  W "O4'" 1 
ATOM   6326 C "C3'" . DT  E 2 9   ? 9.729   -1.757  45.125  1.00 35.04  ? 10  DT  W "C3'" 1 
ATOM   6327 O "O3'" . DT  E 2 9   ? 9.864   -1.825  46.555  1.00 39.74  ? 10  DT  W "O3'" 1 
ATOM   6328 C "C2'" . DT  E 2 9   ? 10.324  -2.995  44.482  1.00 33.93  ? 10  DT  W "C2'" 1 
ATOM   6329 C "C1'" . DT  E 2 9   ? 9.191   -3.999  44.643  1.00 34.00  ? 10  DT  W "C1'" 1 
ATOM   6330 N N1    . DT  E 2 9   ? 9.160   -5.066  43.646  1.00 39.21  ? 10  DT  W N1    1 
ATOM   6331 C C2    . DT  E 2 9   ? 9.044   -6.363  44.095  1.00 45.46  ? 10  DT  W C2    1 
ATOM   6332 O O2    . DT  E 2 9   ? 9.009   -6.655  45.279  1.00 44.99  ? 10  DT  W O2    1 
ATOM   6333 N N3    . DT  E 2 9   ? 8.975   -7.310  43.101  1.00 41.04  ? 10  DT  W N3    1 
ATOM   6334 C C4    . DT  E 2 9   ? 9.031   -7.094  41.735  1.00 40.31  ? 10  DT  W C4    1 
ATOM   6335 O O4    . DT  E 2 9   ? 8.958   -8.056  40.963  1.00 32.28  ? 10  DT  W O4    1 
ATOM   6336 C C5    . DT  E 2 9   ? 9.179   -5.698  41.335  1.00 39.59  ? 10  DT  W C5    1 
ATOM   6337 C C7    . DT  E 2 9   ? 9.273   -5.354  39.875  1.00 35.73  ? 10  DT  W C7    1 
ATOM   6338 C C6    . DT  E 2 9   ? 9.230   -4.770  42.303  1.00 37.24  ? 10  DT  W C6    1 
ATOM   6339 P P     . DC  E 2 10  ? 11.234  -1.362  47.268  1.00 38.13  ? 11  DC  W P     1 
ATOM   6340 O OP1   . DC  E 2 10  ? 10.875  -0.336  48.275  1.00 45.43  ? 11  DC  W OP1   1 
ATOM   6341 O OP2   . DC  E 2 10  ? 12.337  -1.086  46.300  1.00 41.40  ? 11  DC  W OP2   1 
ATOM   6342 O "O5'" . DC  E 2 10  ? 11.674  -2.685  48.014  1.00 42.00  ? 11  DC  W "O5'" 1 
ATOM   6343 C "C5'" . DC  E 2 10  ? 10.732  -3.447  48.723  1.00 37.36  ? 11  DC  W "C5'" 1 
ATOM   6344 C "C4'" . DC  E 2 10  ? 11.367  -4.742  49.150  1.00 43.87  ? 11  DC  W "C4'" 1 
ATOM   6345 O "O4'" . DC  E 2 10  ? 11.173  -5.723  48.106  1.00 38.70  ? 11  DC  W "O4'" 1 
ATOM   6346 C "C3'" . DC  E 2 10  ? 12.877  -4.616  49.386  1.00 45.58  ? 11  DC  W "C3'" 1 
ATOM   6347 O "O3'" . DC  E 2 10  ? 13.214  -5.118  50.675  1.00 40.47  ? 11  DC  W "O3'" 1 
ATOM   6348 C "C2'" . DC  E 2 10  ? 13.502  -5.428  48.259  1.00 42.65  ? 11  DC  W "C2'" 1 
ATOM   6349 C "C1'" . DC  E 2 10  ? 12.394  -6.381  47.834  1.00 42.85  ? 11  DC  W "C1'" 1 
ATOM   6350 N N1    . DC  E 2 10  ? 12.382  -6.727  46.406  1.00 44.88  ? 11  DC  W N1    1 
ATOM   6351 C C2    . DC  E 2 10  ? 12.036  -8.034  46.046  1.00 44.82  ? 11  DC  W C2    1 
ATOM   6352 O O2    . DC  E 2 10  ? 11.778  -8.857  46.945  1.00 42.26  ? 11  DC  W O2    1 
ATOM   6353 N N3    . DC  E 2 10  ? 11.984  -8.367  44.733  1.00 38.83  ? 11  DC  W N3    1 
ATOM   6354 C C4    . DC  E 2 10  ? 12.259  -7.456  43.800  1.00 37.36  ? 11  DC  W C4    1 
ATOM   6355 N N4    . DC  E 2 10  ? 12.160  -7.831  42.528  1.00 34.47  ? 11  DC  W N4    1 
ATOM   6356 C C5    . DC  E 2 10  ? 12.636  -6.120  44.136  1.00 39.95  ? 11  DC  W C5    1 
ATOM   6357 C C6    . DC  E 2 10  ? 12.685  -5.799  45.442  1.00 41.72  ? 11  DC  W C6    1 
ATOM   6358 P P     . DA  E 2 11  ? 14.703  -4.936  51.265  1.00 40.24  ? 12  DA  W P     1 
ATOM   6359 O OP1   . DA  E 2 11  ? 14.519  -4.441  52.659  1.00 42.32  ? 12  DA  W OP1   1 
ATOM   6360 O OP2   . DA  E 2 11  ? 15.669  -4.231  50.381  1.00 30.49  ? 12  DA  W OP2   1 
ATOM   6361 O "O5'" . DA  E 2 11  ? 15.185  -6.450  51.363  1.00 35.08  ? 12  DA  W "O5'" 1 
ATOM   6362 C "C5'" . DA  E 2 11  ? 14.388  -7.403  52.069  1.00 36.66  ? 12  DA  W "C5'" 1 
ATOM   6363 C "C4'" . DA  E 2 11  ? 14.965  -8.789  51.914  1.00 42.27  ? 12  DA  W "C4'" 1 
ATOM   6364 O "O4'" . DA  E 2 11  ? 14.881  -9.171  50.514  1.00 41.65  ? 12  DA  W "O4'" 1 
ATOM   6365 C "C3'" . DA  E 2 11  ? 16.441  -8.912  52.301  1.00 38.31  ? 12  DA  W "C3'" 1 
ATOM   6366 O "O3'" . DA  E 2 11  ? 16.675  -10.235 52.832  1.00 45.77  ? 12  DA  W "O3'" 1 
ATOM   6367 C "C2'" . DA  E 2 11  ? 17.151  -8.684  50.976  1.00 39.42  ? 12  DA  W "C2'" 1 
ATOM   6368 C "C1'" . DA  E 2 11  ? 16.185  -9.277  49.950  1.00 36.38  ? 12  DA  W "C1'" 1 
ATOM   6369 N N9    . DA  E 2 11  ? 16.170  -8.584  48.658  1.00 41.18  ? 12  DA  W N9    1 
ATOM   6370 C C8    . DA  E 2 11  ? 16.500  -7.267  48.417  1.00 43.61  ? 12  DA  W C8    1 
ATOM   6371 N N7    . DA  E 2 11  ? 16.398  -6.914  47.159  1.00 42.50  ? 12  DA  W N7    1 
ATOM   6372 C C5    . DA  E 2 11  ? 15.975  -8.074  46.519  1.00 41.26  ? 12  DA  W C5    1 
ATOM   6373 C C6    . DA  E 2 11  ? 15.703  -8.366  45.159  1.00 42.69  ? 12  DA  W C6    1 
ATOM   6374 N N6    . DA  E 2 11  ? 15.826  -7.482  44.170  1.00 34.04  ? 12  DA  W N6    1 
ATOM   6375 N N1    . DA  E 2 11  ? 15.300  -9.622  44.855  1.00 38.88  ? 12  DA  W N1    1 
ATOM   6376 C C2    . DA  E 2 11  ? 15.194  -10.519 45.844  1.00 42.33  ? 12  DA  W C2    1 
ATOM   6377 N N3    . DA  E 2 11  ? 15.436  -10.371 47.154  1.00 45.01  ? 12  DA  W N3    1 
ATOM   6378 C C4    . DA  E 2 11  ? 15.828  -9.108  47.430  1.00 40.25  ? 12  DA  W C4    1 
ATOM   6379 P P     . DC  E 2 12  ? 18.171  -10.707 53.254  1.00 51.17  ? 13  DC  W P     1 
ATOM   6380 O OP1   . DC  E 2 12  ? 18.040  -11.753 54.298  1.00 43.78  ? 13  DC  W OP1   1 
ATOM   6381 O OP2   . DC  E 2 12  ? 19.082  -9.548  53.469  1.00 43.77  ? 13  DC  W OP2   1 
ATOM   6382 O "O5'" . DC  E 2 12  ? 18.696  -11.459 51.962  1.00 51.26  ? 13  DC  W "O5'" 1 
ATOM   6383 C "C5'" . DC  E 2 12  ? 18.052  -12.638 51.513  1.00 44.40  ? 13  DC  W "C5'" 1 
ATOM   6384 C "C4'" . DC  E 2 12  ? 18.776  -13.165 50.301  1.00 55.61  ? 13  DC  W "C4'" 1 
ATOM   6385 O "O4'" . DC  E 2 12  ? 18.419  -12.378 49.131  1.00 51.06  ? 13  DC  W "O4'" 1 
ATOM   6386 C "C3'" . DC  E 2 12  ? 20.300  -13.079 50.443  1.00 50.47  ? 13  DC  W "C3'" 1 
ATOM   6387 O "O3'" . DC  E 2 12  ? 20.890  -14.294 50.024  1.00 57.30  ? 13  DC  W "O3'" 1 
ATOM   6388 C "C2'" . DC  E 2 12  ? 20.687  -11.937 49.517  1.00 50.45  ? 13  DC  W "C2'" 1 
ATOM   6389 C "C1'" . DC  E 2 12  ? 19.605  -12.018 48.446  1.00 51.82  ? 13  DC  W "C1'" 1 
ATOM   6390 N N1    . DC  E 2 12  ? 19.350  -10.783 47.676  1.00 49.03  ? 13  DC  W N1    1 
ATOM   6391 C C2    . DC  E 2 12  ? 18.832  -10.889 46.357  1.00 48.62  ? 13  DC  W C2    1 
ATOM   6392 O O2    . DC  E 2 12  ? 18.513  -11.998 45.911  1.00 49.34  ? 13  DC  W O2    1 
ATOM   6393 N N3    . DC  E 2 12  ? 18.682  -9.775  45.620  1.00 43.24  ? 13  DC  W N3    1 
ATOM   6394 C C4    . DC  E 2 12  ? 18.996  -8.586  46.137  1.00 46.87  ? 13  DC  W C4    1 
ATOM   6395 N N4    . DC  E 2 12  ? 18.850  -7.519  45.355  1.00 41.18  ? 13  DC  W N4    1 
ATOM   6396 C C5    . DC  E 2 12  ? 19.475  -8.441  47.480  1.00 43.16  ? 13  DC  W C5    1 
ATOM   6397 C C6    . DC  E 2 12  ? 19.635  -9.555  48.203  1.00 44.63  ? 13  DC  W C6    1 
ATOM   6398 O "O5'" . DG  F 2 1   ? 19.312  -9.658  35.550  1.00 52.11  ? 23  DG  Z "O5'" 1 
ATOM   6399 C "C5'" . DG  F 2 1   ? 19.797  -10.810 34.873  1.00 47.16  ? 23  DG  Z "C5'" 1 
ATOM   6400 C "C4'" . DG  F 2 1   ? 19.504  -12.060 35.666  1.00 42.63  ? 23  DG  Z "C4'" 1 
ATOM   6401 O "O4'" . DG  F 2 1   ? 20.178  -11.938 36.942  1.00 48.47  ? 23  DG  Z "O4'" 1 
ATOM   6402 C "C3'" . DG  F 2 1   ? 18.021  -12.262 35.971  1.00 42.13  ? 23  DG  Z "C3'" 1 
ATOM   6403 O "O3'" . DG  F 2 1   ? 17.588  -13.600 35.810  1.00 42.25  ? 23  DG  Z "O3'" 1 
ATOM   6404 C "C2'" . DG  F 2 1   ? 17.873  -11.920 37.435  1.00 49.67  ? 23  DG  Z "C2'" 1 
ATOM   6405 C "C1'" . DG  F 2 1   ? 19.265  -12.049 38.025  1.00 48.04  ? 23  DG  Z "C1'" 1 
ATOM   6406 N N9    . DG  F 2 1   ? 19.459  -10.896 38.894  1.00 45.66  ? 23  DG  Z N9    1 
ATOM   6407 C C8    . DG  F 2 1   ? 19.869  -9.632  38.529  1.00 43.80  ? 23  DG  Z C8    1 
ATOM   6408 N N7    . DG  F 2 1   ? 19.774  -8.766  39.501  1.00 43.89  ? 23  DG  Z N7    1 
ATOM   6409 C C5    . DG  F 2 1   ? 19.319  -9.516  40.579  1.00 42.54  ? 23  DG  Z C5    1 
ATOM   6410 C C6    . DG  F 2 1   ? 19.001  -9.124  41.904  1.00 41.33  ? 23  DG  Z C6    1 
ATOM   6411 O O6    . DG  F 2 1   ? 19.057  -7.995  42.407  1.00 39.20  ? 23  DG  Z O6    1 
ATOM   6412 N N1    . DG  F 2 1   ? 18.565  -10.205 42.664  1.00 33.67  ? 23  DG  Z N1    1 
ATOM   6413 C C2    . DG  F 2 1   ? 18.444  -11.492 42.209  1.00 37.14  ? 23  DG  Z C2    1 
ATOM   6414 N N2    . DG  F 2 1   ? 17.991  -12.386 43.084  1.00 40.58  ? 23  DG  Z N2    1 
ATOM   6415 N N3    . DG  F 2 1   ? 18.739  -11.872 40.977  1.00 43.27  ? 23  DG  Z N3    1 
ATOM   6416 C C4    . DG  F 2 1   ? 19.160  -10.839 40.222  1.00 42.21  ? 23  DG  Z C4    1 
ATOM   6417 P P     . DT  F 2 2   ? 16.016  -13.895 35.742  1.00 46.48  ? 24  DT  Z P     1 
ATOM   6418 O OP1   . DT  F 2 2   ? 15.751  -15.106 34.913  1.00 50.31  ? 24  DT  Z OP1   1 
ATOM   6419 O OP2   . DT  F 2 2   ? 15.359  -12.602 35.403  1.00 46.00  ? 24  DT  Z OP2   1 
ATOM   6420 O "O5'" . DT  F 2 2   ? 15.629  -14.238 37.237  1.00 46.58  ? 24  DT  Z "O5'" 1 
ATOM   6421 C "C5'" . DT  F 2 2   ? 16.157  -15.370 37.892  1.00 43.59  ? 24  DT  Z "C5'" 1 
ATOM   6422 C "C4'" . DT  F 2 2   ? 15.498  -15.506 39.242  1.00 44.85  ? 24  DT  Z "C4'" 1 
ATOM   6423 O "O4'" . DT  F 2 2   ? 15.896  -14.389 40.074  1.00 45.27  ? 24  DT  Z "O4'" 1 
ATOM   6424 C "C3'" . DT  F 2 2   ? 13.974  -15.450 39.178  1.00 43.39  ? 24  DT  Z "C3'" 1 
ATOM   6425 O "O3'" . DT  F 2 2   ? 13.441  -16.243 40.213  1.00 48.31  ? 24  DT  Z "O3'" 1 
ATOM   6426 C "C2'" . DT  F 2 2   ? 13.659  -14.009 39.522  1.00 43.54  ? 24  DT  Z "C2'" 1 
ATOM   6427 C "C1'" . DT  F 2 2   ? 14.733  -13.725 40.545  1.00 42.85  ? 24  DT  Z "C1'" 1 
ATOM   6428 N N1    . DT  F 2 2   ? 15.050  -12.303 40.699  1.00 42.60  ? 24  DT  Z N1    1 
ATOM   6429 C C2    . DT  F 2 2   ? 14.955  -11.775 41.966  1.00 41.74  ? 24  DT  Z C2    1 
ATOM   6430 O O2    . DT  F 2 2   ? 14.672  -12.449 42.947  1.00 35.63  ? 24  DT  Z O2    1 
ATOM   6431 N N3    . DT  F 2 2   ? 15.207  -10.430 42.045  1.00 36.48  ? 24  DT  Z N3    1 
ATOM   6432 C C4    . DT  F 2 2   ? 15.562  -9.584  41.012  1.00 40.76  ? 24  DT  Z C4    1 
ATOM   6433 O O4    . DT  F 2 2   ? 15.757  -8.388  41.234  1.00 41.47  ? 24  DT  Z O4    1 
ATOM   6434 C C5    . DT  F 2 2   ? 15.676  -10.213 39.710  1.00 40.38  ? 24  DT  Z C5    1 
ATOM   6435 C C7    . DT  F 2 2   ? 16.084  -9.378  38.537  1.00 37.06  ? 24  DT  Z C7    1 
ATOM   6436 C C6    . DT  F 2 2   ? 15.414  -11.525 39.620  1.00 37.07  ? 24  DT  Z C6    1 
ATOM   6437 P P     . DG  F 2 3   ? 12.431  -17.427 39.858  1.00 53.64  ? 25  DG  Z P     1 
ATOM   6438 O OP1   . DG  F 2 3   ? 13.288  -18.538 39.371  1.00 55.19  ? 25  DG  Z OP1   1 
ATOM   6439 O OP2   . DG  F 2 3   ? 11.331  -16.898 39.006  1.00 54.31  ? 25  DG  Z OP2   1 
ATOM   6440 O "O5'" . DG  F 2 3   ? 11.804  -17.836 41.261  1.00 52.57  ? 25  DG  Z "O5'" 1 
ATOM   6441 C "C5'" . DG  F 2 3   ? 12.626  -18.376 42.287  1.00 49.31  ? 25  DG  Z "C5'" 1 
ATOM   6442 C "C4'" . DG  F 2 3   ? 12.066  -18.001 43.633  1.00 49.25  ? 25  DG  Z "C4'" 1 
ATOM   6443 O "O4'" . DG  F 2 3   ? 12.173  -16.568 43.811  1.00 55.63  ? 25  DG  Z "O4'" 1 
ATOM   6444 C "C3'" . DG  F 2 3   ? 10.587  -18.331 43.786  1.00 49.08  ? 25  DG  Z "C3'" 1 
ATOM   6445 O "O3'" . DG  F 2 3   ? 10.369  -18.714 45.141  1.00 53.38  ? 25  DG  Z "O3'" 1 
ATOM   6446 C "C2'" . DG  F 2 3   ? 9.892   -17.024 43.437  1.00 49.30  ? 25  DG  Z "C2'" 1 
ATOM   6447 C "C1'" . DG  F 2 3   ? 10.878  -15.978 43.938  1.00 51.78  ? 25  DG  Z "C1'" 1 
ATOM   6448 N N9    . DG  F 2 3   ? 10.903  -14.741 43.167  1.00 51.90  ? 25  DG  Z N9    1 
ATOM   6449 C C8    . DG  F 2 3   ? 10.667  -14.607 41.821  1.00 45.95  ? 25  DG  Z C8    1 
ATOM   6450 N N7    . DG  F 2 3   ? 10.872  -13.394 41.383  1.00 48.17  ? 25  DG  Z N7    1 
ATOM   6451 C C5    . DG  F 2 3   ? 11.234  -12.673 42.513  1.00 49.67  ? 25  DG  Z C5    1 
ATOM   6452 C C6    . DG  F 2 3   ? 11.588  -11.291 42.664  1.00 51.65  ? 25  DG  Z C6    1 
ATOM   6453 O O6    . DG  F 2 3   ? 11.651  -10.409 41.796  1.00 48.98  ? 25  DG  Z O6    1 
ATOM   6454 N N1    . DG  F 2 3   ? 11.887  -10.980 43.991  1.00 46.85  ? 25  DG  Z N1    1 
ATOM   6455 C C2    . DG  F 2 3   ? 11.846  -11.866 45.035  1.00 48.77  ? 25  DG  Z C2    1 
ATOM   6456 N N2    . DG  F 2 3   ? 12.160  -11.359 46.233  1.00 46.94  ? 25  DG  Z N2    1 
ATOM   6457 N N3    . DG  F 2 3   ? 11.522  -13.153 44.912  1.00 46.81  ? 25  DG  Z N3    1 
ATOM   6458 C C4    . DG  F 2 3   ? 11.234  -13.484 43.632  1.00 51.17  ? 25  DG  Z C4    1 
ATOM   6459 P P     . DA  F 2 4   ? 8.957   -19.321 45.583  1.00 58.33  ? 26  DA  Z P     1 
ATOM   6460 O OP1   . DA  F 2 4   ? 9.218   -20.438 46.535  1.00 63.04  ? 26  DA  Z OP1   1 
ATOM   6461 O OP2   . DA  F 2 4   ? 8.112   -19.556 44.383  1.00 62.69  ? 26  DA  Z OP2   1 
ATOM   6462 O "O5'" . DA  F 2 4   ? 8.339   -18.120 46.414  1.00 60.41  ? 26  DA  Z "O5'" 1 
ATOM   6463 C "C5'" . DA  F 2 4   ? 9.144   -17.415 47.348  1.00 51.06  ? 26  DA  Z "C5'" 1 
ATOM   6464 C "C4'" . DA  F 2 4   ? 8.441   -16.151 47.770  1.00 49.64  ? 26  DA  Z "C4'" 1 
ATOM   6465 O "O4'" . DA  F 2 4   ? 8.713   -15.105 46.807  1.00 49.22  ? 26  DA  Z "O4'" 1 
ATOM   6466 C "C3'" . DA  F 2 4   ? 6.921   -16.306 47.818  1.00 53.88  ? 26  DA  Z "C3'" 1 
ATOM   6467 O "O3'" . DA  F 2 4   ? 6.355   -15.756 49.018  1.00 50.76  ? 26  DA  Z "O3'" 1 
ATOM   6468 C "C2'" . DA  F 2 4   ? 6.451   -15.563 46.578  1.00 46.32  ? 26  DA  Z "C2'" 1 
ATOM   6469 C "C1'" . DA  F 2 4   ? 7.497   -14.480 46.457  1.00 48.69  ? 26  DA  Z "C1'" 1 
ATOM   6470 N N9    . DA  F 2 4   ? 7.645   -13.885 45.128  1.00 50.48  ? 26  DA  Z N9    1 
ATOM   6471 C C8    . DA  F 2 4   ? 7.376   -14.445 43.899  1.00 51.02  ? 26  DA  Z C8    1 
ATOM   6472 N N7    . DA  F 2 4   ? 7.553   -13.623 42.896  1.00 48.08  ? 26  DA  Z N7    1 
ATOM   6473 C C5    . DA  F 2 4   ? 7.978   -12.447 43.497  1.00 43.13  ? 26  DA  Z C5    1 
ATOM   6474 C C6    . DA  F 2 4   ? 8.305   -11.180 42.979  1.00 44.36  ? 26  DA  Z C6    1 
ATOM   6475 N N6    . DA  F 2 4   ? 8.272   -10.873 41.682  1.00 42.26  ? 26  DA  Z N6    1 
ATOM   6476 N N1    . DA  F 2 4   ? 8.675   -10.221 43.855  1.00 44.15  ? 26  DA  Z N1    1 
ATOM   6477 C C2    . DA  F 2 4   ? 8.720   -10.523 45.157  1.00 42.81  ? 26  DA  Z C2    1 
ATOM   6478 N N3    . DA  F 2 4   ? 8.438   -11.671 45.763  1.00 43.14  ? 26  DA  Z N3    1 
ATOM   6479 C C4    . DA  F 2 4   ? 8.062   -12.601 44.870  1.00 46.96  ? 26  DA  Z C4    1 
ATOM   6480 P P     . DG  F 2 5   ? 4.757   -15.766 49.211  1.00 59.36  ? 27  DG  Z P     1 
ATOM   6481 O OP1   . DG  F 2 5   ? 4.437   -16.021 50.630  1.00 63.77  ? 27  DG  Z OP1   1 
ATOM   6482 O OP2   . DG  F 2 5   ? 4.103   -16.584 48.156  1.00 68.66  ? 27  DG  Z OP2   1 
ATOM   6483 O "O5'" . DG  F 2 5   ? 4.357   -14.267 48.895  1.00 57.17  ? 27  DG  Z "O5'" 1 
ATOM   6484 C "C5'" . DG  F 2 5   ? 4.766   -13.261 49.776  1.00 61.27  ? 27  DG  Z "C5'" 1 
ATOM   6485 C "C4'" . DG  F 2 5   ? 5.456   -12.143 49.038  1.00 58.44  ? 27  DG  Z "C4'" 1 
ATOM   6486 O "O4'" . DG  F 2 5   ? 5.576   -12.273 47.587  1.00 53.39  ? 27  DG  Z "O4'" 1 
ATOM   6487 C "C3'" . DG  F 2 5   ? 4.759   -10.814 49.298  1.00 48.94  ? 27  DG  Z "C3'" 1 
ATOM   6488 O "O3'" . DG  F 2 5   ? 5.792   -9.902  49.600  1.00 50.35  ? 27  DG  Z "O3'" 1 
ATOM   6489 C "C2'" . DG  F 2 5   ? 4.183   -10.466 47.935  1.00 51.18  ? 27  DG  Z "C2'" 1 
ATOM   6490 C "C1'" . DG  F 2 5   ? 5.309   -10.981 47.061  1.00 48.25  ? 27  DG  Z "C1'" 1 
ATOM   6491 N N9    . DG  F 2 5   ? 5.052   -11.070 45.627  1.00 43.74  ? 27  DG  Z N9    1 
ATOM   6492 C C8    . DG  F 2 5   ? 4.677   -12.174 44.904  1.00 42.22  ? 27  DG  Z C8    1 
ATOM   6493 N N7    . DG  F 2 5   ? 4.496   -11.920 43.635  1.00 40.52  ? 27  DG  Z N7    1 
ATOM   6494 C C5    . DG  F 2 5   ? 4.777   -10.568 43.511  1.00 40.27  ? 27  DG  Z C5    1 
ATOM   6495 C C6    . DG  F 2 5   ? 4.746   -9.718  42.366  1.00 41.07  ? 27  DG  Z C6    1 
ATOM   6496 O O6    . DG  F 2 5   ? 4.468   -10.010 41.194  1.00 44.25  ? 27  DG  Z O6    1 
ATOM   6497 N N1    . DG  F 2 5   ? 5.096   -8.409  42.690  1.00 37.63  ? 27  DG  Z N1    1 
ATOM   6498 C C2    . DG  F 2 5   ? 5.449   -7.973  43.945  1.00 37.68  ? 27  DG  Z C2    1 
ATOM   6499 N N2    . DG  F 2 5   ? 5.791   -6.685  44.044  1.00 34.17  ? 27  DG  Z N2    1 
ATOM   6500 N N3    . DG  F 2 5   ? 5.477   -8.751  45.018  1.00 35.18  ? 27  DG  Z N3    1 
ATOM   6501 C C4    . DG  F 2 5   ? 5.132   -10.030 44.729  1.00 39.88  ? 27  DG  Z C4    1 
ATOM   6502 P P     . DT  F 2 6   ? 5.713   -9.016  50.916  1.00 42.67  ? 28  DT  Z P     1 
ATOM   6503 O OP1   . DT  F 2 6   ? 7.111   -8.654  51.200  1.00 40.39  ? 28  DT  Z OP1   1 
ATOM   6504 O OP2   . DT  F 2 6   ? 4.886   -9.690  51.946  1.00 42.93  ? 28  DT  Z OP2   1 
ATOM   6505 O "O5'" . DT  F 2 6   ? 4.955   -7.714  50.439  1.00 42.75  ? 28  DT  Z "O5'" 1 
ATOM   6506 C "C5'" . DT  F 2 6   ? 3.623   -7.783  49.958  1.00 36.09  ? 28  DT  Z "C5'" 1 
ATOM   6507 C "C4'" . DT  F 2 6   ? 3.216   -6.426  49.447  1.00 36.34  ? 28  DT  Z "C4'" 1 
ATOM   6508 O "O4'" . DT  F 2 6   ? 3.544   -6.337  48.035  1.00 39.36  ? 28  DT  Z "O4'" 1 
ATOM   6509 C "C3'" . DT  F 2 6   ? 1.721   -6.201  49.563  1.00 40.29  ? 28  DT  Z "C3'" 1 
ATOM   6510 O "O3'" . DT  F 2 6   ? 1.427   -5.159  50.482  1.00 37.42  ? 28  DT  Z "O3'" 1 
ATOM   6511 C "C2'" . DT  F 2 6   ? 1.246   -5.863  48.158  1.00 37.44  ? 28  DT  Z "C2'" 1 
ATOM   6512 C "C1'" . DT  F 2 6   ? 2.479   -5.783  47.283  1.00 38.73  ? 28  DT  Z "C1'" 1 
ATOM   6513 N N1    . DT  F 2 6   ? 2.259   -6.655  46.113  1.00 39.82  ? 28  DT  Z N1    1 
ATOM   6514 C C2    . DT  F 2 6   ? 2.346   -6.141  44.827  1.00 36.32  ? 28  DT  Z C2    1 
ATOM   6515 O O2    . DT  F 2 6   ? 2.593   -4.974  44.580  1.00 42.98  ? 28  DT  Z O2    1 
ATOM   6516 N N3    . DT  F 2 6   ? 2.112   -7.053  43.838  1.00 30.86  ? 28  DT  Z N3    1 
ATOM   6517 C C4    . DT  F 2 6   ? 1.794   -8.396  43.993  1.00 37.69  ? 28  DT  Z C4    1 
ATOM   6518 O O4    . DT  F 2 6   ? 1.649   -9.103  43.007  1.00 31.86  ? 28  DT  Z O4    1 
ATOM   6519 C C5    . DT  F 2 6   ? 1.676   -8.856  45.362  1.00 33.09  ? 28  DT  Z C5    1 
ATOM   6520 C C7    . DT  F 2 6   ? 1.251   -10.267 45.622  1.00 33.25  ? 28  DT  Z C7    1 
ATOM   6521 C C6    . DT  F 2 6   ? 1.937   -7.981  46.337  1.00 33.70  ? 28  DT  Z C6    1 
ATOM   6522 P P     . DA  F 2 7   ? -0.021  -5.119  51.154  1.00 34.00  ? 29  DA  Z P     1 
ATOM   6523 O OP1   . DA  F 2 7   ? 0.099   -4.630  52.572  1.00 35.72  ? 29  DA  Z OP1   1 
ATOM   6524 O OP2   . DA  F 2 7   ? -0.645  -6.450  50.874  1.00 26.02  ? 29  DA  Z OP2   1 
ATOM   6525 O "O5'" . DA  F 2 7   ? -0.800  -4.010  50.317  1.00 32.81  ? 29  DA  Z "O5'" 1 
ATOM   6526 C "C5'" . DA  F 2 7   ? -0.237  -2.720  50.133  1.00 27.66  ? 29  DA  Z "C5'" 1 
ATOM   6527 C "C4'" . DA  F 2 7   ? -0.988  -1.981  49.053  1.00 34.45  ? 29  DA  Z "C4'" 1 
ATOM   6528 O "O4'" . DA  F 2 7   ? -0.832  -2.697  47.804  1.00 32.34  ? 29  DA  Z "O4'" 1 
ATOM   6529 C "C3'" . DA  F 2 7   ? -2.494  -1.856  49.281  1.00 33.47  ? 29  DA  Z "C3'" 1 
ATOM   6530 O "O3'" . DA  F 2 7   ? -2.924  -0.592  48.747  1.00 28.80  ? 29  DA  Z "O3'" 1 
ATOM   6531 C "C2'" . DA  F 2 7   ? -3.061  -3.037  48.507  1.00 28.65  ? 29  DA  Z "C2'" 1 
ATOM   6532 C "C1'" . DA  F 2 7   ? -2.091  -3.159  47.334  1.00 29.15  ? 29  DA  Z "C1'" 1 
ATOM   6533 N N9    . DA  F 2 7   ? -1.899  -4.521  46.833  1.00 38.60  ? 29  DA  Z N9    1 
ATOM   6534 C C8    . DA  F 2 7   ? -1.915  -5.705  47.534  1.00 38.07  ? 29  DA  Z C8    1 
ATOM   6535 N N7    . DA  F 2 7   ? -1.746  -6.770  46.782  1.00 39.51  ? 29  DA  Z N7    1 
ATOM   6536 C C5    . DA  F 2 7   ? -1.604  -6.254  45.496  1.00 41.02  ? 29  DA  Z C5    1 
ATOM   6537 C C6    . DA  F 2 7   ? -1.420  -6.867  44.224  1.00 41.44  ? 29  DA  Z C6    1 
ATOM   6538 N N6    . DA  F 2 7   ? -1.370  -8.195  44.022  1.00 27.00  ? 29  DA  Z N6    1 
ATOM   6539 N N1    . DA  F 2 7   ? -1.303  -6.050  43.149  1.00 33.25  ? 29  DA  Z N1    1 
ATOM   6540 C C2    . DA  F 2 7   ? -1.384  -4.728  43.335  1.00 35.84  ? 29  DA  Z C2    1 
ATOM   6541 N N3    . DA  F 2 7   ? -1.571  -4.040  44.463  1.00 42.49  ? 29  DA  Z N3    1 
ATOM   6542 C C4    . DA  F 2 7   ? -1.678  -4.870  45.519  1.00 41.55  ? 29  DA  Z C4    1 
ATOM   6543 P P     . DC  F 2 8   ? -4.471  -0.167  48.821  1.00 29.83  ? 30  DC  Z P     1 
ATOM   6544 O OP1   . DC  F 2 8   ? -4.472  1.310   48.901  1.00 35.00  ? 30  DC  Z OP1   1 
ATOM   6545 O OP2   . DC  F 2 8   ? -5.194  -0.957  49.835  1.00 33.83  ? 30  DC  Z OP2   1 
ATOM   6546 O "O5'" . DC  F 2 8   ? -5.022  -0.577  47.393  1.00 35.35  ? 30  DC  Z "O5'" 1 
ATOM   6547 C "C5'" . DC  F 2 8   ? -4.276  -0.242  46.243  1.00 30.12  ? 30  DC  Z "C5'" 1 
ATOM   6548 C "C4'" . DC  F 2 8   ? -4.925  -0.828  45.017  1.00 32.85  ? 30  DC  Z "C4'" 1 
ATOM   6549 O "O4'" . DC  F 2 8   ? -4.480  -2.182  44.814  1.00 35.42  ? 30  DC  Z "O4'" 1 
ATOM   6550 C "C3'" . DC  F 2 8   ? -6.459  -0.848  44.977  1.00 35.63  ? 30  DC  Z "C3'" 1 
ATOM   6551 O "O3'" . DC  F 2 8   ? -6.853  -0.143  43.804  1.00 35.05  ? 30  DC  Z "O3'" 1 
ATOM   6552 C "C2'" . DC  F 2 8   ? -6.815  -2.331  44.889  1.00 24.49  ? 30  DC  Z "C2'" 1 
ATOM   6553 C "C1'" . DC  F 2 8   ? -5.551  -2.931  44.282  1.00 36.74  ? 30  DC  Z "C1'" 1 
ATOM   6554 N N1    . DC  F 2 8   ? -5.286  -4.353  44.569  1.00 32.79  ? 30  DC  Z N1    1 
ATOM   6555 C C2    . DC  F 2 8   ? -5.031  -5.209  43.493  1.00 36.90  ? 30  DC  Z C2    1 
ATOM   6556 O O2    . DC  F 2 8   ? -5.017  -4.735  42.341  1.00 38.08  ? 30  DC  Z O2    1 
ATOM   6557 N N3    . DC  F 2 8   ? -4.801  -6.522  43.732  1.00 35.22  ? 30  DC  Z N3    1 
ATOM   6558 C C4    . DC  F 2 8   ? -4.802  -6.982  44.991  1.00 40.00  ? 30  DC  Z C4    1 
ATOM   6559 N N4    . DC  F 2 8   ? -4.530  -8.275  45.187  1.00 33.19  ? 30  DC  Z N4    1 
ATOM   6560 C C5    . DC  F 2 8   ? -5.065  -6.129  46.105  1.00 32.30  ? 30  DC  Z C5    1 
ATOM   6561 C C6    . DC  F 2 8   ? -5.294  -4.833  45.849  1.00 36.54  ? 30  DC  Z C6    1 
ATOM   6562 P P     . DT  F 2 9   ? -8.380  -0.162  43.319  1.00 34.62  ? 31  DT  Z P     1 
ATOM   6563 O OP1   . DT  F 2 9   ? -8.591  1.214   42.802  1.00 39.03  ? 31  DT  Z OP1   1 
ATOM   6564 O OP2   . DT  F 2 9   ? -9.305  -0.717  44.339  1.00 33.73  ? 31  DT  Z OP2   1 
ATOM   6565 O "O5'" . DT  F 2 9   ? -8.330  -1.175  42.103  1.00 36.99  ? 31  DT  Z "O5'" 1 
ATOM   6566 C "C5'" . DT  F 2 9   ? -7.408  -0.979  41.048  1.00 36.06  ? 31  DT  Z "C5'" 1 
ATOM   6567 C "C4'" . DT  F 2 9   ? -7.842  -1.773  39.842  1.00 35.27  ? 31  DT  Z "C4'" 1 
ATOM   6568 O "O4'" . DT  F 2 9   ? -7.566  -3.183  40.038  1.00 36.23  ? 31  DT  Z "O4'" 1 
ATOM   6569 C "C3'" . DT  F 2 9   ? -9.328  -1.668  39.494  1.00 32.09  ? 31  DT  Z "C3'" 1 
ATOM   6570 O "O3'" . DT  F 2 9   ? -9.412  -1.600  38.060  1.00 37.10  ? 31  DT  Z "O3'" 1 
ATOM   6571 C "C2'" . DT  F 2 9   ? -9.906  -2.959  40.053  1.00 31.62  ? 31  DT  Z "C2'" 1 
ATOM   6572 C "C1'" . DT  F 2 9   ? -8.750  -3.948  39.868  1.00 29.60  ? 31  DT  Z "C1'" 1 
ATOM   6573 N N1    . DT  F 2 9   ? -8.679  -5.065  40.840  1.00 42.24  ? 31  DT  Z N1    1 
ATOM   6574 C C2    . DT  F 2 9   ? -8.549  -6.352  40.362  1.00 40.31  ? 31  DT  Z C2    1 
ATOM   6575 O O2    . DT  F 2 9   ? -8.511  -6.625  39.183  1.00 37.23  ? 31  DT  Z O2    1 
ATOM   6576 N N3    . DT  F 2 9   ? -8.460  -7.315  41.327  1.00 41.79  ? 31  DT  Z N3    1 
ATOM   6577 C C4    . DT  F 2 9   ? -8.484  -7.135  42.689  1.00 38.90  ? 31  DT  Z C4    1 
ATOM   6578 O O4    . DT  F 2 9   ? -8.394  -8.103  43.429  1.00 32.88  ? 31  DT  Z O4    1 
ATOM   6579 C C5    . DT  F 2 9   ? -8.617  -5.768  43.128  1.00 41.04  ? 31  DT  Z C5    1 
ATOM   6580 C C7    . DT  F 2 9   ? -8.623  -5.476  44.596  1.00 41.54  ? 31  DT  Z C7    1 
ATOM   6581 C C6    . DT  F 2 9   ? -8.718  -4.813  42.195  1.00 40.31  ? 31  DT  Z C6    1 
ATOM   6582 P P     . DC  F 2 10  ? -10.793 -1.200  37.335  1.00 33.71  ? 32  DC  Z P     1 
ATOM   6583 O OP1   . DC  F 2 10  ? -10.451 -0.246  36.252  1.00 42.54  ? 32  DC  Z OP1   1 
ATOM   6584 O OP2   . DC  F 2 10  ? -11.849 -0.856  38.312  1.00 39.59  ? 32  DC  Z OP2   1 
ATOM   6585 O "O5'" . DC  F 2 10  ? -11.195 -2.577  36.660  1.00 41.00  ? 32  DC  Z "O5'" 1 
ATOM   6586 C "C5'" . DC  F 2 10  ? -10.286 -3.220  35.787  1.00 38.36  ? 32  DC  Z "C5'" 1 
ATOM   6587 C "C4'" . DC  F 2 10  ? -10.891 -4.499  35.272  1.00 40.69  ? 32  DC  Z "C4'" 1 
ATOM   6588 O "O4'" . DC  F 2 10  ? -10.635 -5.558  36.221  1.00 35.28  ? 32  DC  Z "O4'" 1 
ATOM   6589 C "C3'" . DC  F 2 10  ? -12.409 -4.427  35.065  1.00 44.61  ? 32  DC  Z "C3'" 1 
ATOM   6590 O "O3'" . DC  F 2 10  ? -12.748 -4.763  33.711  1.00 37.64  ? 32  DC  Z "O3'" 1 
ATOM   6591 C "C2'" . DC  F 2 10  ? -12.980 -5.399  36.090  1.00 41.27  ? 32  DC  Z "C2'" 1 
ATOM   6592 C "C1'" . DC  F 2 10  ? -11.808 -6.309  36.454  1.00 43.85  ? 32  DC  Z "C1'" 1 
ATOM   6593 N N1    . DC  F 2 10  ? -11.789 -6.715  37.873  1.00 45.41  ? 32  DC  Z N1    1 
ATOM   6594 C C2    . DC  F 2 10  ? -11.453 -8.029  38.194  1.00 43.50  ? 32  DC  Z C2    1 
ATOM   6595 O O2    . DC  F 2 10  ? -11.163 -8.812  37.278  1.00 47.19  ? 32  DC  Z O2    1 
ATOM   6596 N N3    . DC  F 2 10  ? -11.443 -8.410  39.496  1.00 42.26  ? 32  DC  Z N3    1 
ATOM   6597 C C4    . DC  F 2 10  ? -11.742 -7.528  40.455  1.00 38.32  ? 32  DC  Z C4    1 
ATOM   6598 N N4    . DC  F 2 10  ? -11.716 -7.942  41.729  1.00 28.05  ? 32  DC  Z N4    1 
ATOM   6599 C C5    . DC  F 2 10  ? -12.081 -6.181  40.154  1.00 38.79  ? 32  DC  Z C5    1 
ATOM   6600 C C6    . DC  F 2 10  ? -12.095 -5.821  38.864  1.00 41.17  ? 32  DC  Z C6    1 
ATOM   6601 P P     . DA  F 2 11  ? -14.280 -4.682  33.200  1.00 36.15  ? 33  DA  Z P     1 
ATOM   6602 O OP1   . DA  F 2 11  ? -14.171 -4.180  31.798  1.00 35.29  ? 33  DA  Z OP1   1 
ATOM   6603 O OP2   . DA  F 2 11  ? -15.282 -4.066  34.111  1.00 35.38  ? 33  DA  Z OP2   1 
ATOM   6604 O "O5'" . DA  F 2 11  ? -14.648 -6.220  33.127  1.00 31.95  ? 33  DA  Z "O5'" 1 
ATOM   6605 C "C5'" . DA  F 2 11  ? -13.876 -7.104  32.321  1.00 32.21  ? 33  DA  Z "C5'" 1 
ATOM   6606 C "C4'" . DA  F 2 11  ? -14.436 -8.499  32.432  1.00 38.68  ? 33  DA  Z "C4'" 1 
ATOM   6607 O "O4'" . DA  F 2 11  ? -14.346 -8.891  33.822  1.00 33.28  ? 33  DA  Z "O4'" 1 
ATOM   6608 C "C3'" . DA  F 2 11  ? -15.913 -8.622  32.054  1.00 36.26  ? 33  DA  Z "C3'" 1 
ATOM   6609 O "O3'" . DA  F 2 11  ? -16.126 -9.913  31.450  1.00 42.35  ? 33  DA  Z "O3'" 1 
ATOM   6610 C "C2'" . DA  F 2 11  ? -16.625 -8.480  33.388  1.00 34.74  ? 33  DA  Z "C2'" 1 
ATOM   6611 C "C1'" . DA  F 2 11  ? -15.640 -9.091  34.368  1.00 33.32  ? 33  DA  Z "C1'" 1 
ATOM   6612 N N9    . DA  F 2 11  ? -15.656 -8.467  35.692  1.00 35.59  ? 33  DA  Z N9    1 
ATOM   6613 C C8    . DA  F 2 11  ? -16.044 -7.185  35.989  1.00 30.87  ? 33  DA  Z C8    1 
ATOM   6614 N N7    . DA  F 2 11  ? -15.962 -6.887  37.258  1.00 35.43  ? 33  DA  Z N7    1 
ATOM   6615 C C5    . DA  F 2 11  ? -15.485 -8.053  37.845  1.00 38.91  ? 33  DA  Z C5    1 
ATOM   6616 C C6    . DA  F 2 11  ? -15.186 -8.390  39.196  1.00 37.61  ? 33  DA  Z C6    1 
ATOM   6617 N N6    . DA  F 2 11  ? -15.311 -7.523  40.206  1.00 30.55  ? 33  DA  Z N6    1 
ATOM   6618 N N1    . DA  F 2 11  ? -14.748 -9.652  39.457  1.00 28.62  ? 33  DA  Z N1    1 
ATOM   6619 C C2    . DA  F 2 11  ? -14.605 -10.505 38.417  1.00 36.84  ? 33  DA  Z C2    1 
ATOM   6620 N N3    . DA  F 2 11  ? -14.842 -10.295 37.104  1.00 36.07  ? 33  DA  Z N3    1 
ATOM   6621 C C4    . DA  F 2 11  ? -15.290 -9.039  36.889  1.00 31.41  ? 33  DA  Z C4    1 
ATOM   6622 P P     . DC  F 2 12  ? -17.601 -10.364 30.963  1.00 44.64  ? 34  DC  Z P     1 
ATOM   6623 O OP1   . DC  F 2 12  ? -17.409 -11.330 29.849  1.00 45.43  ? 34  DC  Z OP1   1 
ATOM   6624 O OP2   . DC  F 2 12  ? -18.517 -9.198  30.790  1.00 38.49  ? 34  DC  Z OP2   1 
ATOM   6625 O "O5'" . DC  F 2 12  ? -18.140 -11.215 32.186  1.00 46.20  ? 34  DC  Z "O5'" 1 
ATOM   6626 C "C5'" . DC  F 2 12  ? -17.477 -12.418 32.556  1.00 44.07  ? 34  DC  Z "C5'" 1 
ATOM   6627 C "C4'" . DC  F 2 12  ? -18.126 -13.004 33.786  1.00 47.40  ? 34  DC  Z "C4'" 1 
ATOM   6628 O "O4'" . DC  F 2 12  ? -17.768 -12.231 34.962  1.00 42.20  ? 34  DC  Z "O4'" 1 
ATOM   6629 C "C3'" . DC  F 2 12  ? -19.658 -13.039 33.732  1.00 45.34  ? 34  DC  Z "C3'" 1 
ATOM   6630 O "O3'" . DC  F 2 12  ? -20.100 -14.360 34.012  1.00 47.70  ? 34  DC  Z "O3'" 1 
ATOM   6631 C "C2'" . DC  F 2 12  ? -20.085 -12.015 34.772  1.00 42.82  ? 34  DC  Z "C2'" 1 
ATOM   6632 C "C1'" . DC  F 2 12  ? -18.925 -12.060 35.755  1.00 43.67  ? 34  DC  Z "C1'" 1 
ATOM   6633 N N1    . DC  F 2 12  ? -18.740 -10.861 36.594  1.00 46.24  ? 34  DC  Z N1    1 
ATOM   6634 C C2    . DC  F 2 12  ? -18.246 -11.028 37.910  1.00 43.55  ? 34  DC  Z C2    1 
ATOM   6635 O O2    . DC  F 2 12  ? -17.939 -12.166 38.303  1.00 41.32  ? 34  DC  Z O2    1 
ATOM   6636 N N3    . DC  F 2 12  ? -18.111 -9.950  38.704  1.00 34.19  ? 34  DC  Z N3    1 
ATOM   6637 C C4    . DC  F 2 12  ? -18.422 -8.739  38.242  1.00 41.54  ? 34  DC  Z C4    1 
ATOM   6638 N N4    . DC  F 2 12  ? -18.254 -7.713  39.065  1.00 33.13  ? 34  DC  Z N4    1 
ATOM   6639 C C5    . DC  F 2 12  ? -18.913 -8.532  36.907  1.00 38.16  ? 34  DC  Z C5    1 
ATOM   6640 C C6    . DC  F 2 12  ? -19.052 -9.611  36.128  1.00 40.70  ? 34  DC  Z C6    1 
HETATM 6641 O O     . HOH G 3 .   ? -7.147  -5.289  69.786  1.00 14.21  ? 201 HOH A O     1 
HETATM 6642 O O     . HOH G 3 .   ? 3.112   -2.871  80.531  1.00 20.93  ? 202 HOH A O     1 
HETATM 6643 O O     . HOH G 3 .   ? 6.353   -4.639  84.137  1.00 26.44  ? 203 HOH A O     1 
HETATM 6644 O O     . HOH G 3 .   ? -1.522  2.871   54.590  1.00 26.53  ? 204 HOH A O     1 
HETATM 6645 O O     . HOH G 3 .   ? 2.730   6.110   68.478  1.00 25.94  ? 205 HOH A O     1 
HETATM 6646 O O     . HOH G 3 .   ? 0.171   -3.120  60.592  1.00 26.46  ? 206 HOH A O     1 
HETATM 6647 O O     . HOH G 3 .   ? 0.050   -0.472  85.983  1.00 23.44  ? 207 HOH A O     1 
HETATM 6648 O O     . HOH G 3 .   ? 3.701   7.408   53.787  1.00 34.70  ? 208 HOH A O     1 
HETATM 6649 O O     . HOH G 3 .   ? -9.572  7.792   90.706  1.00 27.09  ? 209 HOH A O     1 
HETATM 6650 O O     . HOH G 3 .   ? -6.463  12.135  66.158  1.00 32.51  ? 210 HOH A O     1 
HETATM 6651 O O     . HOH G 3 .   ? 8.436   -0.936  72.294  1.00 37.09  ? 211 HOH A O     1 
HETATM 6652 O O     . HOH G 3 .   ? -9.831  -4.405  69.639  1.00 26.74  ? 212 HOH A O     1 
HETATM 6653 O O     . HOH G 3 .   ? 1.661   -5.298  61.854  1.00 28.57  ? 213 HOH A O     1 
HETATM 6654 O O     . HOH G 3 .   ? -3.321  3.085   95.616  1.00 37.28  ? 214 HOH A O     1 
HETATM 6655 O O     . HOH G 3 .   ? 0.168   -3.736  57.983  1.00 25.40  ? 215 HOH A O     1 
HETATM 6656 O O     . HOH G 3 .   ? 0.713   9.864   54.371  1.00 37.54  ? 216 HOH A O     1 
HETATM 6657 O O     . HOH G 3 .   ? 1.933   18.394  78.652  1.00 33.96  ? 217 HOH A O     1 
HETATM 6658 O O     . HOH G 3 .   ? -3.709  1.561   51.544  1.00 40.61  ? 218 HOH A O     1 
HETATM 6659 O O     . HOH G 3 .   ? -13.255 -0.172  46.928  1.00 37.67  ? 219 HOH A O     1 
HETATM 6660 O O     . HOH G 3 .   ? 3.284   6.094   71.956  1.00 32.30  ? 220 HOH A O     1 
HETATM 6661 O O     . HOH G 3 .   ? 5.316   -14.025 55.209  1.00 47.83  ? 221 HOH A O     1 
HETATM 6662 O O     . HOH G 3 .   ? -5.907  24.133  79.669  1.00 43.69  ? 222 HOH A O     1 
HETATM 6663 O O     . HOH G 3 .   ? -8.078  17.919  74.625  1.00 38.20  ? 223 HOH A O     1 
HETATM 6664 O O     . HOH G 3 .   ? 4.776   4.496   55.226  1.00 55.06  ? 224 HOH A O     1 
HETATM 6665 O O     . HOH G 3 .   ? -9.660  18.978  87.783  1.00 32.10  ? 225 HOH A O     1 
HETATM 6666 O O     . HOH G 3 .   ? 1.886   14.043  73.035  1.00 31.36  ? 226 HOH A O     1 
HETATM 6667 O O     . HOH G 3 .   ? -4.359  17.241  95.863  1.00 55.85  ? 227 HOH A O     1 
HETATM 6668 O O     . HOH G 3 .   ? 2.730   14.285  63.675  1.00 37.58  ? 228 HOH A O     1 
HETATM 6669 O O     . HOH G 3 .   ? -12.986 -5.029  76.002  1.00 37.94  ? 229 HOH A O     1 
HETATM 6670 O O     . HOH G 3 .   ? 7.621   2.730   71.682  1.00 50.22  ? 230 HOH A O     1 
HETATM 6671 O O     . HOH G 3 .   ? -7.246  16.272  94.112  1.00 36.27  ? 231 HOH A O     1 
HETATM 6672 O O     . HOH G 3 .   ? -0.534  -15.736 67.741  1.00 42.15  ? 232 HOH A O     1 
HETATM 6673 O O     . HOH G 3 .   ? -8.210  -9.650  73.728  1.00 44.41  ? 233 HOH A O     1 
HETATM 6674 O O     . HOH G 3 .   ? 4.682   17.856  75.988  1.00 38.66  ? 234 HOH A O     1 
HETATM 6675 O O     . HOH G 3 .   ? -1.756  -6.147  88.992  1.00 49.83  ? 235 HOH A O     1 
HETATM 6676 O O     . HOH G 3 .   ? -10.618 16.682  73.817  1.00 47.40  ? 236 HOH A O     1 
HETATM 6677 O O     . HOH G 3 .   ? -8.856  20.118  76.721  1.00 48.71  ? 237 HOH A O     1 
HETATM 6678 O O     . HOH G 3 .   ? -16.178 -16.836 56.248  1.00 48.93  ? 238 HOH A O     1 
HETATM 6679 O O     . HOH G 3 .   ? -15.422 0.885   47.674  1.00 61.33  ? 239 HOH A O     1 
HETATM 6680 O O     . HOH G 3 .   ? -3.733  -14.831 57.386  1.00 39.92  ? 240 HOH A O     1 
HETATM 6681 O O     . HOH G 3 .   ? 2.664   5.429   59.543  1.00 34.25  ? 241 HOH A O     1 
HETATM 6682 O O     . HOH G 3 .   ? -5.956  -13.721 63.568  1.00 57.88  ? 242 HOH A O     1 
HETATM 6683 O O     . HOH G 3 .   ? 4.255   -9.865  83.499  1.00 50.46  ? 243 HOH A O     1 
HETATM 6684 O O     . HOH G 3 .   ? -12.334 -1.532  74.756  1.00 42.62  ? 244 HOH A O     1 
HETATM 6685 O O     . HOH G 3 .   ? -11.815 26.287  97.451  1.00 46.47  ? 245 HOH A O     1 
HETATM 6686 O O     . HOH G 3 .   ? -3.349  20.133  71.520  1.00 47.76  ? 246 HOH A O     1 
HETATM 6687 O O     . HOH G 3 .   ? -9.074  -18.193 54.207  1.00 54.63  ? 247 HOH A O     1 
HETATM 6688 O O     . HOH G 3 .   ? -3.321  22.733  76.616  1.00 39.80  ? 248 HOH A O     1 
HETATM 6689 O O     . HOH G 3 .   ? -1.933  -0.004  52.482  1.00 49.50  ? 249 HOH A O     1 
HETATM 6690 O O     . HOH G 3 .   ? -1.970  -9.633  47.218  1.00 34.33  ? 250 HOH A O     1 
HETATM 6691 O O     . HOH G 3 .   ? -3.811  27.362  85.808  1.00 47.62  ? 251 HOH A O     1 
HETATM 6692 O O     . HOH G 3 .   ? -7.352  9.759   93.941  1.00 46.81  ? 252 HOH A O     1 
HETATM 6693 O O     . HOH G 3 .   ? -10.788 0.507   46.217  1.00 37.62  ? 253 HOH A O     1 
HETATM 6694 O O     . HOH G 3 .   ? 0.592   2.910   52.053  1.00 40.84  ? 254 HOH A O     1 
HETATM 6695 O O     . HOH G 3 .   ? -20.370 -1.964  48.785  1.00 51.56  ? 255 HOH A O     1 
HETATM 6696 O O     . HOH G 3 .   ? -9.936  12.521  64.094  1.00 49.80  ? 256 HOH A O     1 
HETATM 6697 O O     . HOH G 3 .   ? 3.668   -4.396  83.659  1.00 41.70  ? 257 HOH A O     1 
HETATM 6698 O O     . HOH G 3 .   ? -9.636  29.258  94.304  1.00 46.10  ? 258 HOH A O     1 
HETATM 6699 O O     . HOH G 3 .   ? 7.408   -3.024  54.273  1.00 40.57  ? 259 HOH A O     1 
HETATM 6700 O O     . HOH G 3 .   ? -2.018  -3.147  92.007  1.00 37.36  ? 260 HOH A O     1 
HETATM 6701 O O     . HOH G 3 .   ? -16.608 13.478  92.442  1.00 43.19  ? 261 HOH A O     1 
HETATM 6702 O O     . HOH G 3 .   ? -13.345 -2.371  66.254  1.00 44.24  ? 262 HOH A O     1 
HETATM 6703 O O     . HOH G 3 .   ? 4.674   4.537   63.197  1.00 28.55  ? 263 HOH A O     1 
HETATM 6704 O O     . HOH G 3 .   ? 2.263   14.214  69.647  1.00 37.28  ? 264 HOH A O     1 
HETATM 6705 O O     . HOH G 3 .   ? -14.466 3.909   81.228  1.00 36.84  ? 265 HOH A O     1 
HETATM 6706 O O     . HOH G 3 .   ? 2.105   -4.000  96.033  1.00 37.83  ? 266 HOH A O     1 
HETATM 6707 O O     . HOH G 3 .   ? 3.979   -9.581  69.440  1.00 35.21  ? 267 HOH A O     1 
HETATM 6708 O O     . HOH G 3 .   ? 3.102   -7.231  84.055  1.00 39.79  ? 268 HOH A O     1 
HETATM 6709 O O     . HOH G 3 .   ? 4.593   3.953   73.538  1.00 40.57  ? 269 HOH A O     1 
HETATM 6710 O O     . HOH G 3 .   ? 3.527   -10.202 56.398  1.00 30.67  ? 270 HOH A O     1 
HETATM 6711 O O     . HOH G 3 .   ? 6.739   19.127  77.121  1.00 44.02  ? 271 HOH A O     1 
HETATM 6712 O O     . HOH G 3 .   ? -14.874 -0.721  64.747  1.00 47.25  ? 272 HOH A O     1 
HETATM 6713 O O     . HOH G 3 .   ? 1.282   -11.905 52.050  1.00 34.44  ? 273 HOH A O     1 
HETATM 6714 O O     . HOH G 3 .   ? -7.561  -8.334  69.059  1.00 42.89  ? 274 HOH A O     1 
HETATM 6715 O O     . HOH G 3 .   ? -18.896 11.024  76.780  1.00 43.07  ? 275 HOH A O     1 
HETATM 6716 O O     . HOH G 3 .   ? 6.971   -5.483  54.844  1.00 39.29  ? 276 HOH A O     1 
HETATM 6717 O O     . HOH G 3 .   ? -1.222  19.106  73.283  1.00 43.69  ? 277 HOH A O     1 
HETATM 6718 O O     . HOH G 3 .   ? 6.275   -7.784  57.322  1.00 34.08  ? 278 HOH A O     1 
HETATM 6719 O O     . HOH G 3 .   ? -12.885 18.736  93.599  1.00 47.01  ? 279 HOH A O     1 
HETATM 6720 O O     . HOH G 3 .   ? -6.648  -8.464  76.169  1.00 43.70  ? 280 HOH A O     1 
HETATM 6721 O O     . HOH G 3 .   ? 0.648   -13.740 72.653  1.00 58.54  ? 281 HOH A O     1 
HETATM 6722 O O     . HOH G 3 .   ? -5.790  -13.513 47.750  1.00 46.93  ? 282 HOH A O     1 
HETATM 6723 O O     . HOH G 3 .   ? -16.236 0.995   49.978  1.00 46.53  ? 283 HOH A O     1 
HETATM 6724 O O     . HOH G 3 .   ? 3.692   11.671  61.120  1.00 52.07  ? 284 HOH A O     1 
HETATM 6725 O O     . HOH G 3 .   ? -18.306 12.707  75.006  1.00 42.10  ? 285 HOH A O     1 
HETATM 6726 O O     . HOH G 3 .   ? 5.152   -4.540  67.414  1.00 40.30  ? 286 HOH A O     1 
HETATM 6727 O O     . HOH G 3 .   ? -4.369  9.164   94.034  1.00 41.93  ? 287 HOH A O     1 
HETATM 6728 O O     . HOH G 3 .   ? -15.274 12.959  70.031  1.00 49.80  ? 288 HOH A O     1 
HETATM 6729 O O     . HOH G 3 .   ? 5.503   13.964  64.062  1.00 44.12  ? 289 HOH A O     1 
HETATM 6730 O O     . HOH G 3 .   ? 1.323   -10.247 59.400  1.00 32.53  ? 290 HOH A O     1 
HETATM 6731 O O     . HOH G 3 .   ? -2.436  28.261  93.813  1.00 45.35  ? 291 HOH A O     1 
HETATM 6732 O O     . HOH G 3 .   ? -14.987 2.106   64.040  1.00 46.91  ? 292 HOH A O     1 
HETATM 6733 O O     . HOH G 3 .   ? 5.387   9.242   85.145  1.00 44.98  ? 293 HOH A O     1 
HETATM 6734 O O     . HOH G 3 .   ? 5.382   -3.088  82.443  1.00 38.29  ? 294 HOH A O     1 
HETATM 6735 O O     . HOH G 3 .   ? 9.255   14.089  96.984  1.00 46.18  ? 295 HOH A O     1 
HETATM 6736 O O     . HOH G 3 .   ? -17.527 17.988  82.562  1.00 41.52  ? 296 HOH A O     1 
HETATM 6737 O O     . HOH G 3 .   ? -15.655 -10.958 63.216  1.00 51.96  ? 297 HOH A O     1 
HETATM 6738 O O     . HOH G 3 .   ? -4.226  3.343   92.737  1.00 46.39  ? 298 HOH A O     1 
HETATM 6739 O O     . HOH G 3 .   ? -10.170 19.160  92.610  1.00 49.57  ? 299 HOH A O     1 
HETATM 6740 O O     . HOH G 3 .   ? -4.906  25.243  89.283  1.00 48.33  ? 300 HOH A O     1 
HETATM 6741 O O     . HOH G 3 .   ? 5.572   5.730   69.452  1.00 47.92  ? 301 HOH A O     1 
HETATM 6742 O O     . HOH G 3 .   ? -5.626  22.163  77.373  1.00 47.00  ? 302 HOH A O     1 
HETATM 6743 O O     . HOH H 3 .   ? 21.968  7.241   65.077  1.00 14.38  ? 201 HOH B O     1 
HETATM 6744 O O     . HOH H 3 .   ? 33.991  1.752   92.982  1.00 32.18  ? 202 HOH B O     1 
HETATM 6745 O O     . HOH H 3 .   ? 23.406  0.971   94.936  1.00 22.22  ? 203 HOH B O     1 
HETATM 6746 O O     . HOH H 3 .   ? 12.570  -5.020  80.703  1.00 21.16  ? 204 HOH B O     1 
HETATM 6747 O O     . HOH H 3 .   ? 14.703  -0.524  59.616  1.00 24.76  ? 205 HOH B O     1 
HETATM 6748 O O     . HOH H 3 .   ? 31.203  1.501   95.054  1.00 33.25  ? 206 HOH B O     1 
HETATM 6749 O O     . HOH H 3 .   ? 10.932  12.256  74.541  1.00 23.18  ? 207 HOH B O     1 
HETATM 6750 O O     . HOH H 3 .   ? 31.220  -1.423  87.167  1.00 32.43  ? 208 HOH B O     1 
HETATM 6751 O O     . HOH H 3 .   ? 11.560  -2.146  72.075  1.00 26.45  ? 209 HOH B O     1 
HETATM 6752 O O     . HOH H 3 .   ? 14.140  14.611  80.307  1.00 30.40  ? 210 HOH B O     1 
HETATM 6753 O O     . HOH H 3 .   ? 12.155  -4.976  87.586  1.00 31.03  ? 211 HOH B O     1 
HETATM 6754 O O     . HOH H 3 .   ? 9.891   -6.816  84.643  1.00 41.48  ? 212 HOH B O     1 
HETATM 6755 O O     . HOH H 3 .   ? 7.252   7.576   85.331  1.00 38.08  ? 213 HOH B O     1 
HETATM 6756 O O     . HOH H 3 .   ? 10.571  0.023   74.245  1.00 36.01  ? 214 HOH B O     1 
HETATM 6757 O O     . HOH H 3 .   ? 23.590  11.879  89.559  1.00 31.79  ? 215 HOH B O     1 
HETATM 6758 O O     . HOH H 3 .   ? 27.259  2.332   64.899  1.00 44.70  ? 216 HOH B O     1 
HETATM 6759 O O     . HOH H 3 .   ? 11.578  -7.682  77.974  1.00 49.04  ? 217 HOH B O     1 
HETATM 6760 O O     . HOH H 3 .   ? 18.589  12.993  92.695  1.00 36.16  ? 218 HOH B O     1 
HETATM 6761 O O     . HOH H 3 .   ? 14.014  -12.255 74.674  1.00 34.52  ? 219 HOH B O     1 
HETATM 6762 O O     . HOH H 3 .   ? 7.163   -4.978  88.790  1.00 37.23  ? 220 HOH B O     1 
HETATM 6763 O O     . HOH H 3 .   ? 24.597  6.580   65.886  1.00 37.46  ? 221 HOH B O     1 
HETATM 6764 O O     . HOH H 3 .   ? 12.260  -7.305  84.372  1.00 39.71  ? 222 HOH B O     1 
HETATM 6765 O O     . HOH H 3 .   ? 13.224  1.946   59.363  1.00 26.55  ? 223 HOH B O     1 
HETATM 6766 O O     . HOH H 3 .   ? 24.872  14.967  85.216  1.00 44.95  ? 224 HOH B O     1 
HETATM 6767 O O     . HOH H 3 .   ? 28.932  -5.455  77.109  1.00 46.09  ? 225 HOH B O     1 
HETATM 6768 O O     . HOH H 3 .   ? 32.576  -4.098  89.539  1.00 36.11  ? 226 HOH B O     1 
HETATM 6769 O O     . HOH H 3 .   ? 32.815  -2.129  81.423  1.00 32.68  ? 227 HOH B O     1 
HETATM 6770 O O     . HOH H 3 .   ? 15.393  -8.853  83.969  1.00 40.45  ? 228 HOH B O     1 
HETATM 6771 O O     . HOH H 3 .   ? 9.142   -9.159  67.111  1.00 40.39  ? 229 HOH B O     1 
HETATM 6772 O O     . HOH H 3 .   ? 22.138  15.112  78.304  1.00 48.14  ? 230 HOH B O     1 
HETATM 6773 O O     . HOH H 3 .   ? 25.241  -6.293  82.902  1.00 40.75  ? 231 HOH B O     1 
HETATM 6774 O O     . HOH H 3 .   ? 25.011  9.425   82.489  1.00 30.92  ? 232 HOH B O     1 
HETATM 6775 O O     . HOH H 3 .   ? 21.716  10.667  99.528  1.00 50.31  ? 233 HOH B O     1 
HETATM 6776 O O     . HOH H 3 .   ? 21.507  11.650  95.480  1.00 39.01  ? 234 HOH B O     1 
HETATM 6777 O O     . HOH H 3 .   ? 14.198  -13.986 69.821  1.00 56.30  ? 235 HOH B O     1 
HETATM 6778 O O     . HOH H 3 .   ? 21.019  7.680   97.703  1.00 34.37  ? 236 HOH B O     1 
HETATM 6779 O O     . HOH H 3 .   ? 26.031  9.943   50.004  1.00 64.65  ? 237 HOH B O     1 
HETATM 6780 O O     . HOH H 3 .   ? 20.795  11.898  92.921  1.00 46.69  ? 238 HOH B O     1 
HETATM 6781 O O     . HOH H 3 .   ? 27.933  -7.271  90.422  1.00 46.22  ? 239 HOH B O     1 
HETATM 6782 O O     . HOH H 3 .   ? 6.067   -3.029  96.602  1.00 36.56  ? 240 HOH B O     1 
HETATM 6783 O O     . HOH H 3 .   ? 10.148  2.958   73.647  1.00 37.26  ? 241 HOH B O     1 
HETATM 6784 O O     . HOH H 3 .   ? 14.086  -10.826 77.503  1.00 46.84  ? 242 HOH B O     1 
HETATM 6785 O O     . HOH H 3 .   ? 4.896   -5.017  94.171  1.00 54.24  ? 243 HOH B O     1 
HETATM 6786 O O     . HOH H 3 .   ? 25.531  -3.460  83.704  1.00 37.46  ? 244 HOH B O     1 
HETATM 6787 O O     . HOH H 3 .   ? 30.683  10.342  93.269  1.00 54.62  ? 245 HOH B O     1 
HETATM 6788 O O     . HOH H 3 .   ? 34.651  -10.757 51.406  1.00 49.93  ? 246 HOH B O     1 
HETATM 6789 O O     . HOH H 3 .   ? 14.632  -2.024  57.363  1.00 33.29  ? 247 HOH B O     1 
HETATM 6790 O O     . HOH H 3 .   ? 21.554  -5.346  104.078 1.00 22.37  ? 248 HOH B O     1 
HETATM 6791 O O     . HOH H 3 .   ? 31.798  3.083   93.540  1.00 39.08  ? 249 HOH B O     1 
HETATM 6792 O O     . HOH H 3 .   ? 9.761   -4.592  66.694  1.00 25.23  ? 250 HOH B O     1 
HETATM 6793 O O     . HOH H 3 .   ? 16.393  6.564   95.839  1.00 38.70  ? 251 HOH B O     1 
HETATM 6794 O O     . HOH H 3 .   ? 21.001  17.271  80.998  1.00 49.20  ? 252 HOH B O     1 
HETATM 6795 O O     . HOH H 3 .   ? 8.265   0.919   54.190  1.00 40.69  ? 253 HOH B O     1 
HETATM 6796 O O     . HOH H 3 .   ? 33.052  0.259   81.595  1.00 38.13  ? 254 HOH B O     1 
HETATM 6797 O O     . HOH H 3 .   ? 13.262  -14.318 63.813  1.00 38.65  ? 255 HOH B O     1 
HETATM 6798 O O     . HOH H 3 .   ? 10.681  -12.966 61.658  1.00 38.78  ? 256 HOH B O     1 
HETATM 6799 O O     . HOH H 3 .   ? 9.873   -6.949  65.755  1.00 38.71  ? 257 HOH B O     1 
HETATM 6800 O O     . HOH H 3 .   ? 20.758  -8.181  74.004  1.00 33.43  ? 258 HOH B O     1 
HETATM 6801 O O     . HOH H 3 .   ? 15.931  20.946  78.531  1.00 65.12  ? 259 HOH B O     1 
HETATM 6802 O O     . HOH H 3 .   ? 6.010   5.953   66.828  1.00 45.39  ? 260 HOH B O     1 
HETATM 6803 O O     . HOH H 3 .   ? 11.621  18.645  74.018  1.00 48.04  ? 261 HOH B O     1 
HETATM 6804 O O     . HOH H 3 .   ? 18.777  -10.071 79.566  1.00 51.77  ? 262 HOH B O     1 
HETATM 6805 O O     . HOH H 3 .   ? 11.020  19.330  89.365  1.00 45.97  ? 263 HOH B O     1 
HETATM 6806 O O     . HOH H 3 .   ? 13.884  -12.435 87.483  1.00 50.93  ? 264 HOH B O     1 
HETATM 6807 O O     . HOH H 3 .   ? 33.864  -0.264  84.267  1.00 43.23  ? 265 HOH B O     1 
HETATM 6808 O O     . HOH H 3 .   ? 12.504  -9.708  89.199  1.00 44.08  ? 266 HOH B O     1 
HETATM 6809 O O     . HOH H 3 .   ? 14.503  -7.819  55.452  1.00 55.67  ? 267 HOH B O     1 
HETATM 6810 O O     . HOH H 3 .   ? 7.598   16.240  76.274  1.00 37.94  ? 268 HOH B O     1 
HETATM 6811 O O     . HOH H 3 .   ? 32.721  5.312   93.622  1.00 34.11  ? 269 HOH B O     1 
HETATM 6812 O O     . HOH H 3 .   ? 8.993   14.129  75.771  1.00 44.34  ? 270 HOH B O     1 
HETATM 6813 O O     . HOH H 3 .   ? 12.280  -7.960  65.276  1.00 37.40  ? 271 HOH B O     1 
HETATM 6814 O O     . HOH H 3 .   ? 14.708  8.785   95.772  1.00 43.18  ? 272 HOH B O     1 
HETATM 6815 O O     . HOH H 3 .   ? 36.539  1.094   84.591  1.00 49.42  ? 273 HOH B O     1 
HETATM 6816 O O     . HOH H 3 .   ? 9.811   4.996   63.533  1.00 38.89  ? 274 HOH B O     1 
HETATM 6817 O O     . HOH H 3 .   ? 23.561  11.254  78.776  1.00 39.01  ? 275 HOH B O     1 
HETATM 6818 O O     . HOH H 3 .   ? 16.751  -0.895  98.966  1.00 44.16  ? 276 HOH B O     1 
HETATM 6819 O O     . HOH H 3 .   ? 5.754   4.591   100.643 1.00 49.11  ? 277 HOH B O     1 
HETATM 6820 O O     . HOH H 3 .   ? 24.060  9.864   65.710  1.00 42.75  ? 278 HOH B O     1 
HETATM 6821 O O     . HOH H 3 .   ? 26.112  -4.587  90.683  1.00 46.76  ? 279 HOH B O     1 
HETATM 6822 O O     . HOH H 3 .   ? 12.059  -8.075  93.759  1.00 47.45  ? 280 HOH B O     1 
HETATM 6823 O O     . HOH I 3 .   ? 0.215   -2.436  24.003  1.00 18.01  ? 201 HOH C O     1 
HETATM 6824 O O     . HOH I 3 .   ? -2.958  -1.446  3.977   1.00 26.66  ? 202 HOH C O     1 
HETATM 6825 O O     . HOH I 3 .   ? 7.356   -4.168  14.647  1.00 20.60  ? 203 HOH C O     1 
HETATM 6826 O O     . HOH I 3 .   ? 6.282   13.181  18.839  1.00 24.46  ? 204 HOH C O     1 
HETATM 6827 O O     . HOH I 3 .   ? 9.287   20.647  -2.709  1.00 24.35  ? 205 HOH C O     1 
HETATM 6828 O O     . HOH I 3 .   ? -0.806  -10.696 14.314  1.00 34.27  ? 206 HOH C O     1 
HETATM 6829 O O     . HOH I 3 .   ? -1.327  -4.579  22.581  1.00 27.25  ? 207 HOH C O     1 
HETATM 6830 O O     . HOH I 3 .   ? 1.651   3.489   29.921  1.00 28.33  ? 208 HOH C O     1 
HETATM 6831 O O     . HOH I 3 .   ? 0.017   0.663   -1.512  1.00 33.56  ? 209 HOH C O     1 
HETATM 6832 O O     . HOH I 3 .   ? 0.048   -3.047  26.659  1.00 22.90  ? 210 HOH C O     1 
HETATM 6833 O O     . HOH I 3 .   ? -2.700  6.994   16.084  1.00 28.30  ? 211 HOH C O     1 
HETATM 6834 O O     . HOH I 3 .   ? 10.014  -3.255  14.836  1.00 27.43  ? 212 HOH C O     1 
HETATM 6835 O O     . HOH I 3 .   ? -8.118  2.849   12.879  1.00 29.34  ? 213 HOH C O     1 
HETATM 6836 O O     . HOH I 3 .   ? 1.744   13.169  -10.997 1.00 43.86  ? 214 HOH C O     1 
HETATM 6837 O O     . HOH I 3 .   ? -3.162  -9.706  27.855  1.00 31.91  ? 215 HOH C O     1 
HETATM 6838 O O     . HOH I 3 .   ? 10.585  17.502  11.028  1.00 40.73  ? 216 HOH C O     1 
HETATM 6839 O O     . HOH I 3 .   ? 6.596   11.290  -9.092  1.00 38.91  ? 217 HOH C O     1 
HETATM 6840 O O     . HOH I 3 .   ? 0.614   -15.916 23.144  1.00 38.44  ? 218 HOH C O     1 
HETATM 6841 O O     . HOH I 3 .   ? 15.632  13.203  14.555  1.00 42.25  ? 219 HOH C O     1 
HETATM 6842 O O     . HOH I 3 .   ? 17.383  17.923  -3.435  1.00 43.34  ? 220 HOH C O     1 
HETATM 6843 O O     . HOH I 3 .   ? 9.122   -13.134 36.573  1.00 45.74  ? 221 HOH C O     1 
HETATM 6844 O O     . HOH I 3 .   ? 14.780  0.258   19.463  1.00 45.71  ? 222 HOH C O     1 
HETATM 6845 O O     . HOH I 3 .   ? 6.859   17.877  -9.320  1.00 30.97  ? 223 HOH C O     1 
HETATM 6846 O O     . HOH I 3 .   ? 18.658  12.409  7.693   1.00 36.79  ? 224 HOH C O     1 
HETATM 6847 O O     . HOH I 3 .   ? 13.074  -1.704  12.367  1.00 39.47  ? 225 HOH C O     1 
HETATM 6848 O O     . HOH I 3 .   ? -2.654  15.275  21.177  1.00 28.54  ? 226 HOH C O     1 
HETATM 6849 O O     . HOH I 3 .   ? 8.769   11.258  19.738  1.00 56.35  ? 227 HOH C O     1 
HETATM 6850 O O     . HOH I 3 .   ? -0.795  10.394  30.566  1.00 33.76  ? 228 HOH C O     1 
HETATM 6851 O O     . HOH I 3 .   ? 7.933   19.125  10.400  1.00 34.50  ? 229 HOH C O     1 
HETATM 6852 O O     . HOH I 3 .   ? -8.332  25.229  -1.342  1.00 33.52  ? 230 HOH C O     1 
HETATM 6853 O O     . HOH I 3 .   ? -4.734  -3.664  17.154  1.00 31.51  ? 231 HOH C O     1 
HETATM 6854 O O     . HOH I 3 .   ? 11.253  16.486  8.748   1.00 33.84  ? 232 HOH C O     1 
HETATM 6855 O O     . HOH I 3 .   ? 7.575   13.267  -10.790 1.00 41.41  ? 233 HOH C O     1 
HETATM 6856 O O     . HOH I 3 .   ? -3.405  6.942   12.722  1.00 31.56  ? 234 HOH C O     1 
HETATM 6857 O O     . HOH I 3 .   ? 17.311  15.408  -7.190  1.00 43.03  ? 235 HOH C O     1 
HETATM 6858 O O     . HOH I 3 .   ? 12.405  21.249  1.154   1.00 38.87  ? 236 HOH C O     1 
HETATM 6859 O O     . HOH I 3 .   ? 17.811  6.124   4.509   1.00 48.04  ? 237 HOH C O     1 
HETATM 6860 O O     . HOH I 3 .   ? -2.465  19.614  6.488   1.00 33.42  ? 238 HOH C O     1 
HETATM 6861 O O     . HOH I 3 .   ? 9.648   9.277   -6.180  1.00 56.47  ? 239 HOH C O     1 
HETATM 6862 O O     . HOH I 3 .   ? -1.553  -6.754  0.645   1.00 50.81  ? 240 HOH C O     1 
HETATM 6863 O O     . HOH I 3 .   ? -3.574  7.821   31.027  1.00 36.20  ? 241 HOH C O     1 
HETATM 6864 O O     . HOH I 3 .   ? -0.451  -11.389 31.906  1.00 36.04  ? 242 HOH C O     1 
HETATM 6865 O O     . HOH I 3 .   ? 12.978  -4.748  8.320   1.00 42.68  ? 243 HOH C O     1 
HETATM 6866 O O     . HOH I 3 .   ? -2.764  5.067   -13.436 1.00 36.85  ? 244 HOH C O     1 
HETATM 6867 O O     . HOH I 3 .   ? -1.894  26.669  -3.088  1.00 41.56  ? 245 HOH C O     1 
HETATM 6868 O O     . HOH I 3 .   ? -4.974  5.618   28.879  1.00 48.50  ? 246 HOH C O     1 
HETATM 6869 O O     . HOH I 3 .   ? 7.187   7.128   33.188  1.00 50.30  ? 247 HOH C O     1 
HETATM 6870 O O     . HOH I 3 .   ? -5.888  6.516   15.250  1.00 42.15  ? 248 HOH C O     1 
HETATM 6871 O O     . HOH I 3 .   ? -1.886  15.176  11.837  1.00 26.74  ? 249 HOH C O     1 
HETATM 6872 O O     . HOH I 3 .   ? 7.220   3.181   37.715  1.00 46.95  ? 250 HOH C O     1 
HETATM 6873 O O     . HOH I 3 .   ? 6.204   -13.250 36.273  1.00 38.88  ? 251 HOH C O     1 
HETATM 6874 O O     . HOH I 3 .   ? 19.664  14.491  6.006   1.00 33.81  ? 252 HOH C O     1 
HETATM 6875 O O     . HOH I 3 .   ? 16.835  17.657  4.387   1.00 44.75  ? 253 HOH C O     1 
HETATM 6876 O O     . HOH I 3 .   ? -0.831  -9.459  25.082  1.00 32.98  ? 254 HOH C O     1 
HETATM 6877 O O     . HOH I 3 .   ? 1.034   9.638   35.581  1.00 45.76  ? 255 HOH C O     1 
HETATM 6878 O O     . HOH I 3 .   ? -1.955  -11.711 25.065  1.00 34.48  ? 256 HOH C O     1 
HETATM 6879 O O     . HOH I 3 .   ? 15.114  9.419   -5.373  1.00 38.20  ? 257 HOH C O     1 
HETATM 6880 O O     . HOH I 3 .   ? 4.118   17.398  -11.398 1.00 55.22  ? 258 HOH C O     1 
HETATM 6881 O O     . HOH I 3 .   ? 18.238  14.071  9.765   1.00 38.82  ? 259 HOH C O     1 
HETATM 6882 O O     . HOH I 3 .   ? 13.896  19.087  6.499   1.00 48.69  ? 260 HOH C O     1 
HETATM 6883 O O     . HOH I 3 .   ? 6.700   27.755  1.846   1.00 55.16  ? 261 HOH C O     1 
HETATM 6884 O O     . HOH I 3 .   ? -4.778  6.429   24.265  1.00 44.63  ? 262 HOH C O     1 
HETATM 6885 O O     . HOH I 3 .   ? -6.157  -7.020  27.286  1.00 34.59  ? 263 HOH C O     1 
HETATM 6886 O O     . HOH I 3 .   ? 2.665   13.807  24.775  1.00 44.79  ? 264 HOH C O     1 
HETATM 6887 O O     . HOH I 3 .   ? 3.447   23.678  7.989   1.00 47.02  ? 265 HOH C O     1 
HETATM 6888 O O     . HOH I 3 .   ? -5.848  2.978   29.531  1.00 41.36  ? 266 HOH C O     1 
HETATM 6889 O O     . HOH I 3 .   ? 5.856   -12.243 16.740  1.00 47.03  ? 267 HOH C O     1 
HETATM 6890 O O     . HOH I 3 .   ? 21.009  19.172  7.318   1.00 43.71  ? 268 HOH C O     1 
HETATM 6891 O O     . HOH I 3 .   ? 7.365   -2.806  0.008   1.00 49.78  ? 269 HOH C O     1 
HETATM 6892 O O     . HOH I 3 .   ? 3.956   10.721  -9.596  1.00 37.32  ? 270 HOH C O     1 
HETATM 6893 O O     . HOH I 3 .   ? 16.506  13.220  -8.042  1.00 42.41  ? 271 HOH C O     1 
HETATM 6894 O O     . HOH I 3 .   ? -4.413  4.969   11.352  1.00 32.67  ? 272 HOH C O     1 
HETATM 6895 O O     . HOH I 3 .   ? 6.238   13.253  26.065  1.00 39.91  ? 273 HOH C O     1 
HETATM 6896 O O     . HOH I 3 .   ? 17.299  6.510   26.635  1.00 55.08  ? 274 HOH C O     1 
HETATM 6897 O O     . HOH I 3 .   ? 17.423  1.498   24.408  1.00 68.19  ? 275 HOH C O     1 
HETATM 6898 O O     . HOH I 3 .   ? -4.965  -2.544  1.837   1.00 40.10  ? 276 HOH C O     1 
HETATM 6899 O O     . HOH I 3 .   ? 13.149  -1.122  18.129  1.00 38.14  ? 277 HOH C O     1 
HETATM 6900 O O     . HOH I 3 .   ? 16.920  20.417  -3.316  1.00 34.29  ? 278 HOH C O     1 
HETATM 6901 O O     . HOH I 3 .   ? 8.405   25.982  3.167   1.00 47.44  ? 279 HOH C O     1 
HETATM 6902 O O     . HOH I 3 .   ? -2.661  3.039   -11.541 1.00 40.43  ? 280 HOH C O     1 
HETATM 6903 O O     . HOH I 3 .   ? -4.598  5.540   21.453  1.00 21.39  ? 281 HOH C O     1 
HETATM 6904 O O     . HOH I 3 .   ? 10.863  1.062   38.608  1.00 35.50  ? 282 HOH C O     1 
HETATM 6905 O O     . HOH I 3 .   ? -4.654  19.206  8.660   1.00 37.42  ? 283 HOH C O     1 
HETATM 6906 O O     . HOH I 3 .   ? 19.610  18.588  -1.928  1.00 51.77  ? 284 HOH C O     1 
HETATM 6907 O O     . HOH I 3 .   ? 21.026  10.606  8.958   1.00 43.27  ? 285 HOH C O     1 
HETATM 6908 O O     . HOH I 3 .   ? 4.199   2.284   32.847  1.00 41.95  ? 286 HOH C O     1 
HETATM 6909 O O     . HOH I 3 .   ? 0.468   15.857  -8.594  1.00 50.30  ? 287 HOH C O     1 
HETATM 6910 O O     . HOH I 3 .   ? 14.129  21.650  -6.387  1.00 44.17  ? 288 HOH C O     1 
HETATM 6911 O O     . HOH I 3 .   ? 15.112  3.583   30.158  1.00 46.64  ? 289 HOH C O     1 
HETATM 6912 O O     . HOH I 3 .   ? -0.171  -0.322  31.725  1.00 39.97  ? 290 HOH C O     1 
HETATM 6913 O O     . HOH I 3 .   ? 2.199   -4.576  -4.760  1.00 48.49  ? 291 HOH C O     1 
HETATM 6914 O O     . HOH I 3 .   ? 1.363   18.111  -10.050 1.00 53.02  ? 292 HOH C O     1 
HETATM 6915 O O     . HOH I 3 .   ? -6.584  -9.810  16.694  1.00 36.69  ? 293 HOH C O     1 
HETATM 6916 O O     . HOH I 3 .   ? -0.331  16.320  20.667  1.00 44.63  ? 294 HOH C O     1 
HETATM 6917 O O     . HOH I 3 .   ? -7.768  -12.705 15.690  1.00 48.62  ? 295 HOH C O     1 
HETATM 6918 O O     . HOH I 3 .   ? 12.700  -0.303  10.167  1.00 54.90  ? 296 HOH C O     1 
HETATM 6919 O O     . HOH I 3 .   ? 4.139   -12.999 21.481  1.00 47.33  ? 297 HOH C O     1 
HETATM 6920 O O     . HOH I 3 .   ? -1.401  -11.023 3.030   1.00 51.53  ? 298 HOH C O     1 
HETATM 6921 O O     . HOH I 3 .   ? 17.579  -4.100  18.432  1.00 54.23  ? 299 HOH C O     1 
HETATM 6922 O O     . HOH I 3 .   ? 16.362  16.267  -10.960 1.00 41.29  ? 300 HOH C O     1 
HETATM 6923 O O     . HOH I 3 .   ? 21.969  13.922  -2.747  1.00 47.92  ? 301 HOH C O     1 
HETATM 6924 O O     . HOH I 3 .   ? -6.420  -3.447  0.222   1.00 29.29  ? 302 HOH C O     1 
HETATM 6925 O O     . HOH I 3 .   ? -3.128  -4.045  0.962   1.00 39.09  ? 303 HOH C O     1 
HETATM 6926 O O     . HOH I 3 .   ? -6.958  -5.974  14.886  1.00 34.44  ? 304 HOH C O     1 
HETATM 6927 O O     . HOH I 3 .   ? 7.275   20.350  12.825  1.00 46.40  ? 305 HOH C O     1 
HETATM 6928 O O     . HOH I 3 .   ? 1.062   20.142  11.829  1.00 36.41  ? 306 HOH C O     1 
HETATM 6929 O O     . HOH I 3 .   ? -10.222 16.667  -10.102 1.00 46.62  ? 307 HOH C O     1 
HETATM 6930 O O     . HOH I 3 .   ? 8.944   -4.574  4.828   1.00 53.14  ? 308 HOH C O     1 
HETATM 6931 O O     . HOH I 3 .   ? -5.060  -11.181 18.794  1.00 44.59  ? 309 HOH C O     1 
HETATM 6932 O O     . HOH I 3 .   ? -4.047  12.493  23.614  1.00 46.33  ? 310 HOH C O     1 
HETATM 6933 O O     . HOH I 3 .   ? 2.430   17.316  -7.626  1.00 46.28  ? 311 HOH C O     1 
HETATM 6934 O O     . HOH I 3 .   ? 9.654   20.345  -7.809  1.00 37.32  ? 312 HOH C O     1 
HETATM 6935 O O     . HOH I 3 .   ? 4.358   4.831   -8.286  1.00 46.44  ? 313 HOH C O     1 
HETATM 6936 O O     . HOH I 3 .   ? 7.001   14.689  17.025  1.00 48.96  ? 314 HOH C O     1 
HETATM 6937 O O     . HOH I 3 .   ? -6.245  3.952   13.253  1.00 42.29  ? 315 HOH C O     1 
HETATM 6938 O O     . HOH I 3 .   ? 2.406   -9.308  37.179  1.00 35.44  ? 316 HOH C O     1 
HETATM 6939 O O     . HOH J 3 .   ? -11.873 -2.353  -14.881 1.00 50.83  ? 201 HOH D O     1 
HETATM 6940 O O     . HOH J 3 .   ? -21.737 7.661   19.742  1.00 12.71  ? 202 HOH D O     1 
HETATM 6941 O O     . HOH J 3 .   ? -14.465 -0.065  24.998  1.00 19.97  ? 203 HOH D O     1 
HETATM 6942 O O     . HOH J 3 .   ? -23.529 2.519   -10.425 1.00 21.67  ? 204 HOH D O     1 
HETATM 6943 O O     . HOH J 3 .   ? -16.558 7.674   -11.319 1.00 32.38  ? 205 HOH D O     1 
HETATM 6944 O O     . HOH J 3 .   ? -11.023 13.425  10.152  1.00 23.24  ? 206 HOH D O     1 
HETATM 6945 O O     . HOH J 3 .   ? -12.358 -3.979  3.930   1.00 27.57  ? 207 HOH D O     1 
HETATM 6946 O O     . HOH J 3 .   ? -12.879 2.436   25.188  1.00 25.80  ? 208 HOH D O     1 
HETATM 6947 O O     . HOH J 3 .   ? -27.508 2.567   20.157  1.00 44.12  ? 209 HOH D O     1 
HETATM 6948 O O     . HOH J 3 .   ? -9.413  -3.729  17.674  1.00 18.72  ? 210 HOH D O     1 
HETATM 6949 O O     . HOH J 3 .   ? -11.547 21.072  -4.319  1.00 38.19  ? 211 HOH D O     1 
HETATM 6950 O O     . HOH J 3 .   ? -28.351 8.834   4.957   1.00 29.21  ? 212 HOH D O     1 
HETATM 6951 O O     . HOH J 3 .   ? -31.400 3.247   -10.119 1.00 43.84  ? 213 HOH D O     1 
HETATM 6952 O O     . HOH J 3 .   ? -11.597 -6.398  6.281   1.00 32.02  ? 214 HOH D O     1 
HETATM 6953 O O     . HOH J 3 .   ? -11.362 -1.477  12.600  1.00 22.97  ? 215 HOH D O     1 
HETATM 6954 O O     . HOH J 3 .   ? -14.259 15.660  4.591   1.00 31.01  ? 216 HOH D O     1 
HETATM 6955 O O     . HOH J 3 .   ? -18.228 13.680  -8.177  1.00 36.99  ? 217 HOH D O     1 
HETATM 6956 O O     . HOH J 3 .   ? -38.414 -1.383  -4.385  1.00 42.72  ? 218 HOH D O     1 
HETATM 6957 O O     . HOH J 3 .   ? -7.007  -2.125  30.359  1.00 37.55  ? 219 HOH D O     1 
HETATM 6958 O O     . HOH J 3 .   ? -14.296 -1.091  27.400  1.00 29.75  ? 220 HOH D O     1 
HETATM 6959 O O     . HOH J 3 .   ? -21.414 12.927  -10.759 1.00 43.66  ? 221 HOH D O     1 
HETATM 6960 O O     . HOH J 3 .   ? -7.861  -7.568  24.787  1.00 36.82  ? 222 HOH D O     1 
HETATM 6961 O O     . HOH J 3 .   ? -8.251  0.080   12.321  1.00 34.20  ? 223 HOH D O     1 
HETATM 6962 O O     . HOH J 3 .   ? -31.314 -0.089  -2.656  1.00 48.88  ? 224 HOH D O     1 
HETATM 6963 O O     . HOH J 3 .   ? -9.839  4.046   11.049  1.00 31.28  ? 225 HOH D O     1 
HETATM 6964 O O     . HOH J 3 .   ? -13.939 -10.057 6.691   1.00 46.56  ? 226 HOH D O     1 
HETATM 6965 O O     . HOH J 3 .   ? -23.486 12.723  -4.902  1.00 34.13  ? 227 HOH D O     1 
HETATM 6966 O O     . HOH J 3 .   ? -22.159 11.842  -14.670 1.00 42.84  ? 228 HOH D O     1 
HETATM 6967 O O     . HOH J 3 .   ? -18.402 17.301  -3.482  1.00 41.43  ? 229 HOH D O     1 
HETATM 6968 O O     . HOH J 3 .   ? -26.880 8.454   13.703  1.00 37.94  ? 230 HOH D O     1 
HETATM 6969 O O     . HOH J 3 .   ? -9.239  -6.426  18.659  1.00 30.29  ? 231 HOH D O     1 
HETATM 6970 O O     . HOH J 3 .   ? -15.052 -7.119  0.401   1.00 38.60  ? 232 HOH D O     1 
HETATM 6971 O O     . HOH J 3 .   ? -26.971 -4.007  -2.890  1.00 44.09  ? 233 HOH D O     1 
HETATM 6972 O O     . HOH J 3 .   ? -17.474 19.386  -4.488  1.00 41.83  ? 234 HOH D O     1 
HETATM 6973 O O     . HOH J 3 .   ? -32.401 -1.654  3.083   1.00 32.23  ? 235 HOH D O     1 
HETATM 6974 O O     . HOH J 3 .   ? -20.337 -7.501  10.067  1.00 34.00  ? 236 HOH D O     1 
HETATM 6975 O O     . HOH J 3 .   ? -27.100 11.854  14.673  1.00 40.51  ? 237 HOH D O     1 
HETATM 6976 O O     . HOH J 3 .   ? -6.970  -3.876  -4.386  1.00 37.76  ? 238 HOH D O     1 
HETATM 6977 O O     . HOH J 3 .   ? -11.328 20.375  -6.930  1.00 44.03  ? 239 HOH D O     1 
HETATM 6978 O O     . HOH J 3 .   ? -16.311 21.474  6.098   1.00 48.11  ? 240 HOH D O     1 
HETATM 6979 O O     . HOH J 3 .   ? -22.066 -5.683  0.003   1.00 37.57  ? 241 HOH D O     1 
HETATM 6980 O O     . HOH J 3 .   ? -9.503  -5.245  -0.861  1.00 39.59  ? 242 HOH D O     1 
HETATM 6981 O O     . HOH J 3 .   ? -20.901 13.422  -8.211  1.00 37.10  ? 243 HOH D O     1 
HETATM 6982 O O     . HOH J 3 .   ? -18.838 -8.999  1.680   1.00 40.09  ? 244 HOH D O     1 
HETATM 6983 O O     . HOH J 3 .   ? -15.319 -1.052  -19.782 1.00 50.18  ? 245 HOH D O     1 
HETATM 6984 O O     . HOH J 3 .   ? -2.283  15.029  15.113  1.00 42.61  ? 246 HOH D O     1 
HETATM 6985 O O     . HOH J 3 .   ? -5.822  -1.459  -11.960 1.00 39.42  ? 247 HOH D O     1 
HETATM 6986 O O     . HOH J 3 .   ? -10.599 10.201  -14.956 1.00 60.02  ? 248 HOH D O     1 
HETATM 6987 O O     . HOH J 3 .   ? -14.716 -7.224  28.793  1.00 40.89  ? 249 HOH D O     1 
HETATM 6988 O O     . HOH J 3 .   ? -27.519 12.735  -9.885  1.00 50.85  ? 250 HOH D O     1 
HETATM 6989 O O     . HOH J 3 .   ? -10.363 -12.305 22.521  1.00 38.73  ? 251 HOH D O     1 
HETATM 6990 O O     . HOH J 3 .   ? -14.768 10.080  -11.040 1.00 39.68  ? 252 HOH D O     1 
HETATM 6991 O O     . HOH J 3 .   ? -17.389 -7.939  -4.782  1.00 34.15  ? 253 HOH D O     1 
HETATM 6992 O O     . HOH J 3 .   ? -27.911 -5.978  -5.966  1.00 45.35  ? 254 HOH D O     1 
HETATM 6993 O O     . HOH J 3 .   ? -31.413 5.514   26.984  1.00 54.09  ? 255 HOH D O     1 
HETATM 6994 O O     . HOH J 3 .   ? -21.235 14.622  17.368  1.00 41.79  ? 256 HOH D O     1 
HETATM 6995 O O     . HOH J 3 .   ? -30.498 -8.737  14.678  1.00 58.02  ? 257 HOH D O     1 
HETATM 6996 O O     . HOH J 3 .   ? -8.748  -3.445  -15.108 1.00 49.20  ? 258 HOH D O     1 
HETATM 6997 O O     . HOH J 3 .   ? -8.708  -8.465  17.079  1.00 42.69  ? 259 HOH D O     1 
HETATM 6998 O O     . HOH J 3 .   ? -31.065 9.016   23.171  1.00 46.07  ? 260 HOH D O     1 
HETATM 6999 O O     . HOH J 3 .   ? -29.405 6.963   2.940   1.00 41.51  ? 261 HOH D O     1 
HETATM 7000 O O     . HOH J 3 .   ? -11.057 -10.439 10.553  1.00 38.36  ? 262 HOH D O     1 
HETATM 7001 O O     . HOH J 3 .   ? -11.542 -6.821  0.290   1.00 44.16  ? 263 HOH D O     1 
HETATM 7002 O O     . HOH J 3 .   ? -33.717 0.484   0.428   1.00 44.34  ? 264 HOH D O     1 
HETATM 7003 O O     . HOH J 3 .   ? -32.647 5.713   -9.253  1.00 51.17  ? 265 HOH D O     1 
HETATM 7004 O O     . HOH J 3 .   ? -22.668 -4.699  -9.835  1.00 42.14  ? 266 HOH D O     1 
HETATM 7005 O O     . HOH J 3 .   ? -11.820 -3.383  -3.031  1.00 35.14  ? 267 HOH D O     1 
HETATM 7006 O O     . HOH J 3 .   ? -38.960 -4.135  -2.591  1.00 38.93  ? 268 HOH D O     1 
HETATM 7007 O O     . HOH J 3 .   ? -9.312  11.292  -12.852 1.00 52.08  ? 269 HOH D O     1 
HETATM 7008 O O     . HOH J 3 .   ? -32.771 0.753   2.956   1.00 31.97  ? 270 HOH D O     1 
HETATM 7009 O O     . HOH J 3 .   ? -7.560  -4.353  -2.203  1.00 40.33  ? 271 HOH D O     1 
HETATM 7010 O O     . HOH J 3 .   ? -26.345 -0.913  -8.084  1.00 51.83  ? 272 HOH D O     1 
HETATM 7011 O O     . HOH J 3 .   ? -1.933  -2.402  -11.694 1.00 37.64  ? 273 HOH D O     1 
HETATM 7012 O O     . HOH J 3 .   ? -20.615 -10.241 9.646   1.00 54.66  ? 274 HOH D O     1 
HETATM 7013 O O     . HOH J 3 .   ? -13.592 -11.697 9.746   1.00 36.18  ? 275 HOH D O     1 
HETATM 7014 O O     . HOH J 3 .   ? -10.597 1.142   10.626  1.00 47.50  ? 276 HOH D O     1 
HETATM 7015 O O     . HOH J 3 .   ? -7.004  6.833   20.423  1.00 45.50  ? 277 HOH D O     1 
HETATM 7016 O O     . HOH J 3 .   ? -13.686 23.509  2.161   1.00 45.57  ? 278 HOH D O     1 
HETATM 7017 O O     . HOH J 3 .   ? -8.033  1.551   30.426  1.00 39.03  ? 279 HOH D O     1 
HETATM 7018 O O     . HOH J 3 .   ? -24.327 6.903   19.193  1.00 50.76  ? 280 HOH D O     1 
HETATM 7019 O O     . HOH J 3 .   ? -26.299 9.796   20.191  1.00 51.12  ? 281 HOH D O     1 
HETATM 7020 O O     . HOH J 3 .   ? -5.814  6.875   17.922  1.00 30.81  ? 282 HOH D O     1 
HETATM 7021 O O     . HOH J 3 .   ? -7.195  7.847   -0.869  1.00 46.62  ? 283 HOH D O     1 
HETATM 7022 O O     . HOH J 3 .   ? -3.211  -0.180  -12.205 1.00 38.37  ? 284 HOH D O     1 
HETATM 7023 O O     . HOH J 3 .   ? -21.570 -8.151  0.373   1.00 41.65  ? 285 HOH D O     1 
HETATM 7024 O O     . HOH J 3 .   ? -11.144 23.634  -2.742  1.00 38.43  ? 286 HOH D O     1 
HETATM 7025 O O     . HOH J 3 .   ? -10.454 19.703  6.614   1.00 44.88  ? 287 HOH D O     1 
HETATM 7026 O O     . HOH J 3 .   ? -10.995 21.980  9.127   1.00 47.43  ? 288 HOH D O     1 
HETATM 7027 O O     . HOH J 3 .   ? -31.378 -2.988  20.585  1.00 53.29  ? 289 HOH D O     1 
HETATM 7028 O O     . HOH J 3 .   ? -6.813  -4.399  29.745  1.00 36.22  ? 290 HOH D O     1 
HETATM 7029 O O     . HOH J 3 .   ? -29.313 -4.467  7.107   1.00 51.94  ? 291 HOH D O     1 
HETATM 7030 O O     . HOH J 3 .   ? -17.497 15.727  18.492  1.00 49.61  ? 292 HOH D O     1 
HETATM 7031 O O     . HOH J 3 .   ? -25.815 -7.925  0.850   1.00 61.55  ? 293 HOH D O     1 
HETATM 7032 O O     . HOH J 3 .   ? -26.838 -6.519  11.640  1.00 54.17  ? 294 HOH D O     1 
HETATM 7033 O O     . HOH J 3 .   ? -8.822  15.690  9.197   1.00 34.14  ? 295 HOH D O     1 
HETATM 7034 O O     . HOH J 3 .   ? -11.194 19.018  10.399  1.00 43.31  ? 296 HOH D O     1 
HETATM 7035 O O     . HOH J 3 .   ? -21.120 8.797   -13.118 1.00 37.90  ? 297 HOH D O     1 
HETATM 7036 O O     . HOH J 3 .   ? -26.086 6.136   -14.151 1.00 43.44  ? 298 HOH D O     1 
HETATM 7037 O O     . HOH J 3 .   ? -9.577  5.653   21.282  1.00 41.64  ? 299 HOH D O     1 
HETATM 7038 O O     . HOH J 3 .   ? -36.562 2.775   -0.910  1.00 47.89  ? 300 HOH D O     1 
HETATM 7039 O O     . HOH J 3 .   ? -12.474 15.021  -9.710  1.00 38.89  ? 301 HOH D O     1 
HETATM 7040 O O     . HOH J 3 .   ? -2.853  0.585   -15.049 1.00 46.12  ? 302 HOH D O     1 
HETATM 7041 O O     . HOH J 3 .   ? -11.710 -6.768  19.035  1.00 42.24  ? 303 HOH D O     1 
HETATM 7042 O O     . HOH J 3 .   ? -8.898  -6.670  21.683  1.00 52.09  ? 304 HOH D O     1 
HETATM 7043 O O     . HOH J 3 .   ? -8.034  -8.889  22.387  1.00 47.93  ? 305 HOH D O     1 
HETATM 7044 O O     . HOH J 3 .   ? -7.331  6.625   28.890  1.00 45.82  ? 306 HOH D O     1 
HETATM 7045 O O     . HOH J 3 .   ? -9.191  11.144  26.102  1.00 49.44  ? 307 HOH D O     1 
HETATM 7046 O O     . HOH J 3 .   ? -11.841 12.115  23.928  1.00 48.26  ? 308 HOH D O     1 
HETATM 7047 O O     . HOH K 3 .   ? 1.496   -8.532  34.505  1.00 29.98  ? 101 HOH W O     1 
HETATM 7048 O O     . HOH K 3 .   ? 7.567   -7.186  47.422  1.00 41.18  ? 102 HOH W O     1 
HETATM 7049 O O     . HOH K 3 .   ? 16.637  -5.118  43.374  1.00 45.21  ? 103 HOH W O     1 
HETATM 7050 O O     . HOH K 3 .   ? 4.330   -2.632  43.655  1.00 47.38  ? 104 HOH W O     1 
HETATM 7051 O O     . HOH K 3 .   ? 11.697  -2.624  40.934  1.00 38.76  ? 105 HOH W O     1 
HETATM 7052 O O     . HOH K 3 .   ? 12.596  -5.052  40.952  1.00 38.55  ? 106 HOH W O     1 
HETATM 7053 O O     . HOH K 3 .   ? -5.252  -12.388 44.768  1.00 41.47  ? 107 HOH W O     1 
HETATM 7054 O O     . HOH K 3 .   ? -0.333  -10.097 34.645  1.00 33.69  ? 108 HOH W O     1 
HETATM 7055 O O     . HOH K 3 .   ? 0.117   -12.634 36.108  1.00 36.45  ? 109 HOH W O     1 
HETATM 7056 O O     . HOH K 3 .   ? -6.602  -14.275 44.027  1.00 50.28  ? 110 HOH W O     1 
HETATM 7057 O O     . HOH K 3 .   ? 1.672   -1.332  40.528  1.00 41.41  ? 111 HOH W O     1 
HETATM 7058 O O     . HOH K 3 .   ? -1.660  -10.885 43.364  1.00 38.45  ? 112 HOH W O     1 
HETATM 7059 O O     . HOH K 3 .   ? 15.614  -2.565  43.204  1.00 52.35  ? 113 HOH W O     1 
HETATM 7060 O O     . HOH K 3 .   ? 2.014   -1.511  45.710  1.00 54.73  ? 114 HOH W O     1 
HETATM 7061 O O     . HOH K 3 .   ? -3.007  -11.205 31.305  1.00 38.57  ? 115 HOH W O     1 
HETATM 7062 O O     . HOH K 3 .   ? -19.987 -16.569 49.700  1.00 48.28  ? 116 HOH W O     1 
HETATM 7063 O O     . HOH K 3 .   ? 4.624   -3.069  47.134  1.00 50.91  ? 117 HOH W O     1 
HETATM 7064 O O     . HOH K 3 .   ? 1.624   -14.892 34.934  1.00 47.76  ? 118 HOH W O     1 
HETATM 7065 O O     . HOH K 3 .   ? -4.120  -13.686 42.701  1.00 46.57  ? 119 HOH W O     1 
HETATM 7066 O O     . HOH K 3 .   ? 22.628  -10.119 45.453  1.00 48.07  ? 120 HOH W O     1 
HETATM 7067 O O     . HOH K 3 .   ? 16.385  -3.418  47.926  1.00 52.79  ? 121 HOH W O     1 
HETATM 7068 O O     . HOH L 3 .   ? -0.905  -12.701 40.965  1.00 42.95  ? 101 HOH Z O     1 
HETATM 7069 O O     . HOH L 3 .   ? -0.986  -8.612  49.702  1.00 33.27  ? 102 HOH Z O     1 
HETATM 7070 O O     . HOH L 3 .   ? 10.500  -10.838 39.142  1.00 37.86  ? 103 HOH Z O     1 
HETATM 7071 O O     . HOH L 3 .   ? 1.198   -10.487 49.534  1.00 39.93  ? 104 HOH Z O     1 
HETATM 7072 O O     . HOH L 3 .   ? -8.190  -7.069  36.478  1.00 45.74  ? 105 HOH Z O     1 
HETATM 7073 O O     . HOH L 3 .   ? -1.113  -1.355  44.352  1.00 40.50  ? 106 HOH Z O     1 
HETATM 7074 O O     . HOH L 3 .   ? 6.366   -14.110 40.394  1.00 48.79  ? 107 HOH Z O     1 
HETATM 7075 O O     . HOH L 3 .   ? 2.243   -14.517 45.701  1.00 44.43  ? 108 HOH Z O     1 
HETATM 7076 O O     . HOH L 3 .   ? 0.311   -10.906 42.105  1.00 34.94  ? 109 HOH Z O     1 
HETATM 7077 O O     . HOH L 3 .   ? -3.897  -2.707  41.142  1.00 45.83  ? 110 HOH Z O     1 
HETATM 7078 O O     . HOH L 3 .   ? -11.805 -5.725  43.345  1.00 44.92  ? 111 HOH Z O     1 
HETATM 7079 O O     . HOH L 3 .   ? 3.538   -11.584 52.797  1.00 40.48  ? 112 HOH Z O     1 
HETATM 7080 O O     . HOH L 3 .   ? -11.194 -3.179  43.404  1.00 41.70  ? 113 HOH Z O     1 
HETATM 7081 O O     . HOH L 3 .   ? -13.470 -2.899  38.430  1.00 42.43  ? 114 HOH Z O     1 
HETATM 7082 O O     . HOH L 3 .   ? 4.214   -13.996 41.872  1.00 42.29  ? 115 HOH Z O     1 
HETATM 7083 O O     . HOH L 3 .   ? 0.592   -12.728 48.197  1.00 35.84  ? 116 HOH Z O     1 
HETATM 7084 O O     . HOH L 3 .   ? 2.372   -11.056 40.554  1.00 38.61  ? 117 HOH Z O     1 
HETATM 7085 O O     . HOH L 3 .   ? 22.495  -11.518 42.011  1.00 52.19  ? 118 HOH Z O     1 
HETATM 7086 O O     . HOH L 3 .   ? -0.054  -15.292 49.103  1.00 42.28  ? 119 HOH Z O     1 
HETATM 7087 O O     . HOH L 3 .   ? -5.617  0.647   38.206  1.00 50.36  ? 120 HOH Z O     1 
HETATM 7088 O O     . HOH L 3 .   ? -16.046 -3.327  36.636  1.00 42.85  ? 121 HOH Z O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -13 ?   ?   ?   A . n 
A 1 2   PRO 2   -12 ?   ?   ?   A . n 
A 1 3   PRO 3   -11 ?   ?   ?   A . n 
A 1 4   GLY 4   -10 ?   ?   ?   A . n 
A 1 5   LYS 5   -9  ?   ?   ?   A . n 
A 1 6   CYS 6   -8  ?   ?   ?   A . n 
A 1 7   LEU 7   -7  ?   ?   ?   A . n 
A 1 8   PHE 8   -6  ?   ?   ?   A . n 
A 1 9   SER 9   -5  ?   ?   ?   A . n 
A 1 10  GLY 10  -4  ?   ?   ?   A . n 
A 1 11  VAL 11  -3  ?   ?   ?   A . n 
A 1 12  PHE 12  -2  ?   ?   ?   A . n 
A 1 13  CYS 13  -1  ?   ?   ?   A . n 
A 1 14  ASN 14  0   ?   ?   ?   A . n 
A 1 15  MET 15  1   ?   ?   ?   A . n 
A 1 16  ALA 16  2   ?   ?   ?   A . n 
A 1 17  GLU 17  3   ?   ?   ?   A . n 
A 1 18  LYS 18  4   ?   ?   ?   A . n 
A 1 19  GLN 19  5   ?   ?   ?   A . n 
A 1 20  THR 20  6   ?   ?   ?   A . n 
A 1 21  ALA 21  7   ?   ?   ?   A . n 
A 1 22  LYS 22  8   ?   ?   ?   A . n 
A 1 23  ARG 23  9   9   ARG ARG A . n 
A 1 24  ASN 24  10  10  ASN ASN A . n 
A 1 25  ARG 25  11  11  ARG ARG A . n 
A 1 26  ARG 26  12  12  ARG ARG A . n 
A 1 27  GLU 27  13  13  GLU GLU A . n 
A 1 28  GLU 28  14  14  GLU GLU A . n 
A 1 29  ILE 29  15  15  ILE ILE A . n 
A 1 30  LEU 30  16  16  LEU LEU A . n 
A 1 31  GLN 31  17  17  GLN GLN A . n 
A 1 32  SER 32  18  18  SER SER A . n 
A 1 33  LEU 33  19  19  LEU LEU A . n 
A 1 34  ALA 34  20  20  ALA ALA A . n 
A 1 35  LEU 35  21  21  LEU LEU A . n 
A 1 36  MET 36  22  22  MET MET A . n 
A 1 37  LEU 37  23  23  LEU LEU A . n 
A 1 38  GLU 38  24  24  GLU GLU A . n 
A 1 39  SER 39  25  25  SER SER A . n 
A 1 40  SER 40  26  26  SER SER A . n 
A 1 41  ASP 41  27  27  ASP ASP A . n 
A 1 42  GLY 42  28  28  GLY GLY A . n 
A 1 43  SER 43  29  29  SER SER A . n 
A 1 44  GLN 44  30  30  GLN GLN A . n 
A 1 45  ARG 45  31  31  ARG ARG A . n 
A 1 46  ILE 46  32  32  ILE ILE A . n 
A 1 47  THR 47  33  33  THR THR A . n 
A 1 48  THR 48  34  34  THR THR A . n 
A 1 49  ALA 49  35  35  ALA ALA A . n 
A 1 50  LYS 50  36  36  LYS LYS A . n 
A 1 51  LEU 51  37  37  LEU LEU A . n 
A 1 52  ALA 52  38  38  ALA ALA A . n 
A 1 53  ALA 53  39  39  ALA ALA A . n 
A 1 54  SER 54  40  40  SER SER A . n 
A 1 55  VAL 55  41  41  VAL VAL A . n 
A 1 56  GLY 56  42  42  GLY GLY A . n 
A 1 57  VAL 57  43  43  VAL VAL A . n 
A 1 58  SER 58  44  44  SER SER A . n 
A 1 59  GLU 59  45  45  GLU GLU A . n 
A 1 60  ALA 60  46  46  ALA ALA A . n 
A 1 61  ALA 61  47  47  ALA ALA A . n 
A 1 62  LEU 62  48  48  LEU LEU A . n 
A 1 63  TYR 63  49  49  TYR TYR A . n 
A 1 64  ARG 64  50  50  ARG ARG A . n 
A 1 65  HIS 65  51  51  HIS HIS A . n 
A 1 66  PHE 66  52  52  PHE PHE A . n 
A 1 67  PRO 67  53  53  PRO PRO A . n 
A 1 68  SER 68  54  54  SER SER A . n 
A 1 69  LYS 69  55  55  LYS LYS A . n 
A 1 70  THR 70  56  56  THR THR A . n 
A 1 71  ARG 71  57  57  ARG ARG A . n 
A 1 72  MET 72  58  58  MET MET A . n 
A 1 73  PHE 73  59  59  PHE PHE A . n 
A 1 74  ASP 74  60  60  ASP ASP A . n 
A 1 75  SER 75  61  61  SER SER A . n 
A 1 76  LEU 76  62  62  LEU LEU A . n 
A 1 77  ILE 77  63  63  ILE ILE A . n 
A 1 78  GLU 78  64  64  GLU GLU A . n 
A 1 79  PHE 79  65  65  PHE PHE A . n 
A 1 80  ILE 80  66  66  ILE ILE A . n 
A 1 81  GLU 81  67  67  GLU GLU A . n 
A 1 82  ASP 82  68  68  ASP ASP A . n 
A 1 83  SER 83  69  69  SER SER A . n 
A 1 84  LEU 84  70  70  LEU LEU A . n 
A 1 85  ILE 85  71  71  ILE ILE A . n 
A 1 86  THR 86  72  72  THR THR A . n 
A 1 87  ARG 87  73  73  ARG ARG A . n 
A 1 88  ILE 88  74  74  ILE ILE A . n 
A 1 89  ASN 89  75  75  ASN ASN A . n 
A 1 90  LEU 90  76  76  LEU LEU A . n 
A 1 91  ILE 91  77  77  ILE ILE A . n 
A 1 92  LEU 92  78  78  LEU LEU A . n 
A 1 93  LYS 93  79  79  LYS LYS A . n 
A 1 94  ASP 94  80  80  ASP ASP A . n 
A 1 95  GLU 95  81  81  GLU GLU A . n 
A 1 96  LYS 96  82  82  LYS LYS A . n 
A 1 97  ASP 97  83  83  ASP ASP A . n 
A 1 98  THR 98  84  84  THR THR A . n 
A 1 99  THR 99  85  85  THR THR A . n 
A 1 100 ALA 100 86  86  ALA ALA A . n 
A 1 101 ARG 101 87  87  ARG ARG A . n 
A 1 102 LEU 102 88  88  LEU LEU A . n 
A 1 103 ARG 103 89  89  ARG ARG A . n 
A 1 104 LEU 104 90  90  LEU LEU A . n 
A 1 105 ILE 105 91  91  ILE ILE A . n 
A 1 106 VAL 106 92  92  VAL VAL A . n 
A 1 107 LEU 107 93  93  LEU LEU A . n 
A 1 108 LEU 108 94  94  LEU LEU A . n 
A 1 109 ILE 109 95  95  ILE ILE A . n 
A 1 110 LEU 110 96  96  LEU LEU A . n 
A 1 111 GLY 111 97  97  GLY GLY A . n 
A 1 112 PHE 112 98  98  PHE PHE A . n 
A 1 113 GLY 113 99  99  GLY GLY A . n 
A 1 114 GLU 114 100 100 GLU GLU A . n 
A 1 115 ARG 115 101 101 ARG ARG A . n 
A 1 116 ASN 116 102 102 ASN ASN A . n 
A 1 117 PRO 117 103 103 PRO PRO A . n 
A 1 118 GLY 118 104 104 GLY GLY A . n 
A 1 119 LEU 119 105 105 LEU LEU A . n 
A 1 120 THR 120 106 106 THR THR A . n 
A 1 121 ARG 121 107 107 ARG ARG A . n 
A 1 122 ILE 122 108 108 ILE ILE A . n 
A 1 123 LEU 123 109 109 LEU LEU A . n 
A 1 124 THR 124 110 110 THR THR A . n 
A 1 125 GLY 125 111 111 GLY GLY A . n 
A 1 126 HIS 126 112 112 HIS HIS A . n 
A 1 127 ALA 127 113 113 ALA ALA A . n 
A 1 128 LEU 128 114 114 LEU LEU A . n 
A 1 129 MET 129 115 115 MET MET A . n 
A 1 130 PHE 130 116 116 PHE PHE A . n 
A 1 131 GLU 131 117 117 GLU GLU A . n 
A 1 132 GLN 132 118 118 GLN GLN A . n 
A 1 133 ASP 133 119 119 ASP ASP A . n 
A 1 134 ARG 134 120 120 ARG ARG A . n 
A 1 135 LEU 135 121 121 LEU LEU A . n 
A 1 136 GLN 136 122 122 GLN GLN A . n 
A 1 137 GLY 137 123 123 GLY GLY A . n 
A 1 138 ARG 138 124 124 ARG ARG A . n 
A 1 139 ILE 139 125 125 ILE ILE A . n 
A 1 140 ASN 140 126 126 ASN ASN A . n 
A 1 141 GLN 141 127 127 GLN GLN A . n 
A 1 142 LEU 142 128 128 LEU LEU A . n 
A 1 143 PHE 143 129 129 PHE PHE A . n 
A 1 144 GLU 144 130 130 GLU GLU A . n 
A 1 145 ARG 145 131 131 ARG ARG A . n 
A 1 146 ILE 146 132 132 ILE ILE A . n 
A 1 147 GLU 147 133 133 GLU GLU A . n 
A 1 148 VAL 148 134 134 VAL VAL A . n 
A 1 149 GLN 149 135 135 GLN GLN A . n 
A 1 150 LEU 150 136 136 LEU LEU A . n 
A 1 151 ARG 151 137 137 ARG ARG A . n 
A 1 152 GLN 152 138 138 GLN GLN A . n 
A 1 153 VAL 153 139 139 VAL VAL A . n 
A 1 154 MET 154 140 140 MET MET A . n 
A 1 155 ARG 155 141 141 ARG ARG A . n 
A 1 156 GLU 156 142 142 GLU GLU A . n 
A 1 157 LYS 157 143 143 LYS LYS A . n 
A 1 158 LYS 158 144 144 LYS LYS A . n 
A 1 159 MET 159 145 145 MET MET A . n 
A 1 160 ARG 160 146 146 ARG ARG A . n 
A 1 161 GLU 161 147 147 GLU GLU A . n 
A 1 162 GLY 162 148 148 GLY GLY A . n 
A 1 163 GLU 163 149 149 GLU GLU A . n 
A 1 164 GLY 164 150 150 GLY GLY A . n 
A 1 165 TYR 165 151 151 TYR TYR A . n 
A 1 166 THR 166 152 152 THR THR A . n 
A 1 167 LEU 167 153 153 LEU LEU A . n 
A 1 168 ASP 168 154 154 ASP ASP A . n 
A 1 169 GLU 169 155 155 GLU GLU A . n 
A 1 170 THR 170 156 156 THR THR A . n 
A 1 171 LEU 171 157 157 LEU LEU A . n 
A 1 172 LEU 172 158 158 LEU LEU A . n 
A 1 173 ALA 173 159 159 ALA ALA A . n 
A 1 174 SER 174 160 160 SER SER A . n 
A 1 175 GLN 175 161 161 GLN GLN A . n 
A 1 176 LEU 176 162 162 LEU LEU A . n 
A 1 177 LEU 177 163 163 LEU LEU A . n 
A 1 178 ALA 178 164 164 ALA ALA A . n 
A 1 179 PHE 179 165 165 PHE PHE A . n 
A 1 180 CYS 180 166 166 CYS CYS A . n 
A 1 181 GLU 181 167 167 GLU GLU A . n 
A 1 182 GLY 182 168 168 GLY GLY A . n 
A 1 183 MET 183 169 169 MET MET A . n 
A 1 184 LEU 184 170 170 LEU LEU A . n 
A 1 185 SER 185 171 171 SER SER A . n 
A 1 186 ARG 186 172 172 ARG ARG A . n 
A 1 187 PHE 187 173 173 PHE PHE A . n 
A 1 188 VAL 188 174 174 VAL VAL A . n 
A 1 189 ARG 189 175 175 ARG ARG A . n 
A 1 190 SER 190 176 176 SER SER A . n 
A 1 191 GLU 191 177 177 GLU GLU A . n 
A 1 192 PHE 192 178 178 PHE PHE A . n 
A 1 193 LYS 193 179 179 LYS LYS A . n 
A 1 194 TYR 194 180 180 TYR TYR A . n 
A 1 195 ARG 195 181 181 ARG ARG A . n 
A 1 196 PRO 196 182 182 PRO PRO A . n 
A 1 197 THR 197 183 183 THR THR A . n 
A 1 198 ASP 198 184 184 ASP ASP A . n 
A 1 199 ASP 199 185 185 ASP ASP A . n 
A 1 200 PHE 200 186 186 PHE PHE A . n 
A 1 201 GLU 201 187 187 GLU GLU A . n 
A 1 202 ALA 202 188 188 ALA ALA A . n 
A 1 203 ARG 203 189 189 ARG ARG A . n 
A 1 204 TRP 204 190 190 TRP TRP A . n 
A 1 205 PRO 205 191 191 PRO PRO A . n 
A 1 206 LEU 206 192 192 LEU LEU A . n 
A 1 207 VAL 207 193 193 VAL VAL A . n 
A 1 208 ALA 208 194 194 ALA ALA A . n 
A 1 209 ALA 209 195 195 ALA ALA A . n 
A 1 210 GLN 210 196 196 GLN GLN A . n 
A 1 211 LEU 211 197 197 LEU LEU A . n 
A 1 212 GLN 212 198 198 GLN GLN A . n 
B 1 1   MET 1   -13 ?   ?   ?   B . n 
B 1 2   PRO 2   -12 ?   ?   ?   B . n 
B 1 3   PRO 3   -11 ?   ?   ?   B . n 
B 1 4   GLY 4   -10 ?   ?   ?   B . n 
B 1 5   LYS 5   -9  ?   ?   ?   B . n 
B 1 6   CYS 6   -8  ?   ?   ?   B . n 
B 1 7   LEU 7   -7  ?   ?   ?   B . n 
B 1 8   PHE 8   -6  ?   ?   ?   B . n 
B 1 9   SER 9   -5  ?   ?   ?   B . n 
B 1 10  GLY 10  -4  ?   ?   ?   B . n 
B 1 11  VAL 11  -3  ?   ?   ?   B . n 
B 1 12  PHE 12  -2  ?   ?   ?   B . n 
B 1 13  CYS 13  -1  ?   ?   ?   B . n 
B 1 14  ASN 14  0   ?   ?   ?   B . n 
B 1 15  MET 15  1   ?   ?   ?   B . n 
B 1 16  ALA 16  2   ?   ?   ?   B . n 
B 1 17  GLU 17  3   ?   ?   ?   B . n 
B 1 18  LYS 18  4   ?   ?   ?   B . n 
B 1 19  GLN 19  5   ?   ?   ?   B . n 
B 1 20  THR 20  6   ?   ?   ?   B . n 
B 1 21  ALA 21  7   ?   ?   ?   B . n 
B 1 22  LYS 22  8   ?   ?   ?   B . n 
B 1 23  ARG 23  9   ?   ?   ?   B . n 
B 1 24  ASN 24  10  10  ASN ASN B . n 
B 1 25  ARG 25  11  11  ARG ARG B . n 
B 1 26  ARG 26  12  12  ARG ARG B . n 
B 1 27  GLU 27  13  13  GLU GLU B . n 
B 1 28  GLU 28  14  14  GLU GLU B . n 
B 1 29  ILE 29  15  15  ILE ILE B . n 
B 1 30  LEU 30  16  16  LEU LEU B . n 
B 1 31  GLN 31  17  17  GLN GLN B . n 
B 1 32  SER 32  18  18  SER SER B . n 
B 1 33  LEU 33  19  19  LEU LEU B . n 
B 1 34  ALA 34  20  20  ALA ALA B . n 
B 1 35  LEU 35  21  21  LEU LEU B . n 
B 1 36  MET 36  22  22  MET MET B . n 
B 1 37  LEU 37  23  23  LEU LEU B . n 
B 1 38  GLU 38  24  24  GLU GLU B . n 
B 1 39  SER 39  25  25  SER SER B . n 
B 1 40  SER 40  26  26  SER SER B . n 
B 1 41  ASP 41  27  27  ASP ASP B . n 
B 1 42  GLY 42  28  28  GLY GLY B . n 
B 1 43  SER 43  29  29  SER SER B . n 
B 1 44  GLN 44  30  30  GLN GLN B . n 
B 1 45  ARG 45  31  31  ARG ARG B . n 
B 1 46  ILE 46  32  32  ILE ILE B . n 
B 1 47  THR 47  33  33  THR THR B . n 
B 1 48  THR 48  34  34  THR THR B . n 
B 1 49  ALA 49  35  35  ALA ALA B . n 
B 1 50  LYS 50  36  36  LYS LYS B . n 
B 1 51  LEU 51  37  37  LEU LEU B . n 
B 1 52  ALA 52  38  38  ALA ALA B . n 
B 1 53  ALA 53  39  39  ALA ALA B . n 
B 1 54  SER 54  40  40  SER SER B . n 
B 1 55  VAL 55  41  41  VAL VAL B . n 
B 1 56  GLY 56  42  42  GLY GLY B . n 
B 1 57  VAL 57  43  43  VAL VAL B . n 
B 1 58  SER 58  44  44  SER SER B . n 
B 1 59  GLU 59  45  45  GLU GLU B . n 
B 1 60  ALA 60  46  46  ALA ALA B . n 
B 1 61  ALA 61  47  47  ALA ALA B . n 
B 1 62  LEU 62  48  48  LEU LEU B . n 
B 1 63  TYR 63  49  49  TYR TYR B . n 
B 1 64  ARG 64  50  50  ARG ARG B . n 
B 1 65  HIS 65  51  51  HIS HIS B . n 
B 1 66  PHE 66  52  52  PHE PHE B . n 
B 1 67  PRO 67  53  53  PRO PRO B . n 
B 1 68  SER 68  54  54  SER SER B . n 
B 1 69  LYS 69  55  55  LYS LYS B . n 
B 1 70  THR 70  56  56  THR THR B . n 
B 1 71  ARG 71  57  57  ARG ARG B . n 
B 1 72  MET 72  58  58  MET MET B . n 
B 1 73  PHE 73  59  59  PHE PHE B . n 
B 1 74  ASP 74  60  60  ASP ASP B . n 
B 1 75  SER 75  61  61  SER SER B . n 
B 1 76  LEU 76  62  62  LEU LEU B . n 
B 1 77  ILE 77  63  63  ILE ILE B . n 
B 1 78  GLU 78  64  64  GLU GLU B . n 
B 1 79  PHE 79  65  65  PHE PHE B . n 
B 1 80  ILE 80  66  66  ILE ILE B . n 
B 1 81  GLU 81  67  67  GLU GLU B . n 
B 1 82  ASP 82  68  68  ASP ASP B . n 
B 1 83  SER 83  69  69  SER SER B . n 
B 1 84  LEU 84  70  70  LEU LEU B . n 
B 1 85  ILE 85  71  71  ILE ILE B . n 
B 1 86  THR 86  72  72  THR THR B . n 
B 1 87  ARG 87  73  73  ARG ARG B . n 
B 1 88  ILE 88  74  74  ILE ILE B . n 
B 1 89  ASN 89  75  75  ASN ASN B . n 
B 1 90  LEU 90  76  76  LEU LEU B . n 
B 1 91  ILE 91  77  77  ILE ILE B . n 
B 1 92  LEU 92  78  78  LEU LEU B . n 
B 1 93  LYS 93  79  79  LYS LYS B . n 
B 1 94  ASP 94  80  80  ASP ASP B . n 
B 1 95  GLU 95  81  81  GLU GLU B . n 
B 1 96  LYS 96  82  82  LYS LYS B . n 
B 1 97  ASP 97  83  83  ASP ASP B . n 
B 1 98  THR 98  84  84  THR THR B . n 
B 1 99  THR 99  85  85  THR THR B . n 
B 1 100 ALA 100 86  86  ALA ALA B . n 
B 1 101 ARG 101 87  87  ARG ARG B . n 
B 1 102 LEU 102 88  88  LEU LEU B . n 
B 1 103 ARG 103 89  89  ARG ARG B . n 
B 1 104 LEU 104 90  90  LEU LEU B . n 
B 1 105 ILE 105 91  91  ILE ILE B . n 
B 1 106 VAL 106 92  92  VAL VAL B . n 
B 1 107 LEU 107 93  93  LEU LEU B . n 
B 1 108 LEU 108 94  94  LEU LEU B . n 
B 1 109 ILE 109 95  95  ILE ILE B . n 
B 1 110 LEU 110 96  96  LEU LEU B . n 
B 1 111 GLY 111 97  97  GLY GLY B . n 
B 1 112 PHE 112 98  98  PHE PHE B . n 
B 1 113 GLY 113 99  99  GLY GLY B . n 
B 1 114 GLU 114 100 100 GLU GLU B . n 
B 1 115 ARG 115 101 101 ARG ARG B . n 
B 1 116 ASN 116 102 102 ASN ASN B . n 
B 1 117 PRO 117 103 103 PRO PRO B . n 
B 1 118 GLY 118 104 104 GLY GLY B . n 
B 1 119 LEU 119 105 105 LEU LEU B . n 
B 1 120 THR 120 106 106 THR THR B . n 
B 1 121 ARG 121 107 107 ARG ARG B . n 
B 1 122 ILE 122 108 108 ILE ILE B . n 
B 1 123 LEU 123 109 109 LEU LEU B . n 
B 1 124 THR 124 110 110 THR THR B . n 
B 1 125 GLY 125 111 111 GLY GLY B . n 
B 1 126 HIS 126 112 112 HIS HIS B . n 
B 1 127 ALA 127 113 113 ALA ALA B . n 
B 1 128 LEU 128 114 114 LEU LEU B . n 
B 1 129 MET 129 115 115 MET MET B . n 
B 1 130 PHE 130 116 116 PHE PHE B . n 
B 1 131 GLU 131 117 117 GLU GLU B . n 
B 1 132 GLN 132 118 118 GLN GLN B . n 
B 1 133 ASP 133 119 119 ASP ASP B . n 
B 1 134 ARG 134 120 120 ARG ARG B . n 
B 1 135 LEU 135 121 121 LEU LEU B . n 
B 1 136 GLN 136 122 122 GLN GLN B . n 
B 1 137 GLY 137 123 123 GLY GLY B . n 
B 1 138 ARG 138 124 124 ARG ARG B . n 
B 1 139 ILE 139 125 125 ILE ILE B . n 
B 1 140 ASN 140 126 126 ASN ASN B . n 
B 1 141 GLN 141 127 127 GLN GLN B . n 
B 1 142 LEU 142 128 128 LEU LEU B . n 
B 1 143 PHE 143 129 129 PHE PHE B . n 
B 1 144 GLU 144 130 130 GLU GLU B . n 
B 1 145 ARG 145 131 131 ARG ARG B . n 
B 1 146 ILE 146 132 132 ILE ILE B . n 
B 1 147 GLU 147 133 133 GLU GLU B . n 
B 1 148 VAL 148 134 134 VAL VAL B . n 
B 1 149 GLN 149 135 135 GLN GLN B . n 
B 1 150 LEU 150 136 136 LEU LEU B . n 
B 1 151 ARG 151 137 137 ARG ARG B . n 
B 1 152 GLN 152 138 138 GLN GLN B . n 
B 1 153 VAL 153 139 139 VAL VAL B . n 
B 1 154 MET 154 140 140 MET MET B . n 
B 1 155 ARG 155 141 141 ARG ARG B . n 
B 1 156 GLU 156 142 142 GLU GLU B . n 
B 1 157 LYS 157 143 143 LYS LYS B . n 
B 1 158 LYS 158 144 144 LYS LYS B . n 
B 1 159 MET 159 145 145 MET MET B . n 
B 1 160 ARG 160 146 146 ARG ARG B . n 
B 1 161 GLU 161 147 147 GLU GLU B . n 
B 1 162 GLY 162 148 148 GLY GLY B . n 
B 1 163 GLU 163 149 149 GLU GLU B . n 
B 1 164 GLY 164 150 150 GLY GLY B . n 
B 1 165 TYR 165 151 151 TYR TYR B . n 
B 1 166 THR 166 152 152 THR THR B . n 
B 1 167 LEU 167 153 153 LEU LEU B . n 
B 1 168 ASP 168 154 154 ASP ASP B . n 
B 1 169 GLU 169 155 155 GLU GLU B . n 
B 1 170 THR 170 156 156 THR THR B . n 
B 1 171 LEU 171 157 157 LEU LEU B . n 
B 1 172 LEU 172 158 158 LEU LEU B . n 
B 1 173 ALA 173 159 159 ALA ALA B . n 
B 1 174 SER 174 160 160 SER SER B . n 
B 1 175 GLN 175 161 161 GLN GLN B . n 
B 1 176 LEU 176 162 162 LEU LEU B . n 
B 1 177 LEU 177 163 163 LEU LEU B . n 
B 1 178 ALA 178 164 164 ALA ALA B . n 
B 1 179 PHE 179 165 165 PHE PHE B . n 
B 1 180 CYS 180 166 166 CYS CYS B . n 
B 1 181 GLU 181 167 167 GLU GLU B . n 
B 1 182 GLY 182 168 168 GLY GLY B . n 
B 1 183 MET 183 169 169 MET MET B . n 
B 1 184 LEU 184 170 170 LEU LEU B . n 
B 1 185 SER 185 171 171 SER SER B . n 
B 1 186 ARG 186 172 172 ARG ARG B . n 
B 1 187 PHE 187 173 173 PHE PHE B . n 
B 1 188 VAL 188 174 174 VAL VAL B . n 
B 1 189 ARG 189 175 175 ARG ARG B . n 
B 1 190 SER 190 176 176 SER SER B . n 
B 1 191 GLU 191 177 177 GLU GLU B . n 
B 1 192 PHE 192 178 178 PHE PHE B . n 
B 1 193 LYS 193 179 179 LYS LYS B . n 
B 1 194 TYR 194 180 180 TYR TYR B . n 
B 1 195 ARG 195 181 181 ARG ARG B . n 
B 1 196 PRO 196 182 182 PRO PRO B . n 
B 1 197 THR 197 183 183 THR THR B . n 
B 1 198 ASP 198 184 184 ASP ASP B . n 
B 1 199 ASP 199 185 185 ASP ASP B . n 
B 1 200 PHE 200 186 186 PHE PHE B . n 
B 1 201 GLU 201 187 187 GLU GLU B . n 
B 1 202 ALA 202 188 188 ALA ALA B . n 
B 1 203 ARG 203 189 189 ARG ARG B . n 
B 1 204 TRP 204 190 190 TRP TRP B . n 
B 1 205 PRO 205 191 191 PRO PRO B . n 
B 1 206 LEU 206 192 192 LEU LEU B . n 
B 1 207 VAL 207 193 193 VAL VAL B . n 
B 1 208 ALA 208 194 194 ALA ALA B . n 
B 1 209 ALA 209 195 195 ALA ALA B . n 
B 1 210 GLN 210 196 196 GLN GLN B . n 
B 1 211 LEU 211 197 197 LEU LEU B . n 
B 1 212 GLN 212 198 198 GLN GLN B . n 
C 1 1   MET 1   -13 ?   ?   ?   C . n 
C 1 2   PRO 2   -12 ?   ?   ?   C . n 
C 1 3   PRO 3   -11 ?   ?   ?   C . n 
C 1 4   GLY 4   -10 ?   ?   ?   C . n 
C 1 5   LYS 5   -9  ?   ?   ?   C . n 
C 1 6   CYS 6   -8  ?   ?   ?   C . n 
C 1 7   LEU 7   -7  ?   ?   ?   C . n 
C 1 8   PHE 8   -6  ?   ?   ?   C . n 
C 1 9   SER 9   -5  ?   ?   ?   C . n 
C 1 10  GLY 10  -4  ?   ?   ?   C . n 
C 1 11  VAL 11  -3  ?   ?   ?   C . n 
C 1 12  PHE 12  -2  ?   ?   ?   C . n 
C 1 13  CYS 13  -1  ?   ?   ?   C . n 
C 1 14  ASN 14  0   ?   ?   ?   C . n 
C 1 15  MET 15  1   ?   ?   ?   C . n 
C 1 16  ALA 16  2   ?   ?   ?   C . n 
C 1 17  GLU 17  3   ?   ?   ?   C . n 
C 1 18  LYS 18  4   ?   ?   ?   C . n 
C 1 19  GLN 19  5   ?   ?   ?   C . n 
C 1 20  THR 20  6   ?   ?   ?   C . n 
C 1 21  ALA 21  7   ?   ?   ?   C . n 
C 1 22  LYS 22  8   ?   ?   ?   C . n 
C 1 23  ARG 23  9   9   ARG ARG C . n 
C 1 24  ASN 24  10  10  ASN ASN C . n 
C 1 25  ARG 25  11  11  ARG ARG C . n 
C 1 26  ARG 26  12  12  ARG ARG C . n 
C 1 27  GLU 27  13  13  GLU GLU C . n 
C 1 28  GLU 28  14  14  GLU GLU C . n 
C 1 29  ILE 29  15  15  ILE ILE C . n 
C 1 30  LEU 30  16  16  LEU LEU C . n 
C 1 31  GLN 31  17  17  GLN GLN C . n 
C 1 32  SER 32  18  18  SER SER C . n 
C 1 33  LEU 33  19  19  LEU LEU C . n 
C 1 34  ALA 34  20  20  ALA ALA C . n 
C 1 35  LEU 35  21  21  LEU LEU C . n 
C 1 36  MET 36  22  22  MET MET C . n 
C 1 37  LEU 37  23  23  LEU LEU C . n 
C 1 38  GLU 38  24  24  GLU GLU C . n 
C 1 39  SER 39  25  25  SER SER C . n 
C 1 40  SER 40  26  26  SER SER C . n 
C 1 41  ASP 41  27  27  ASP ASP C . n 
C 1 42  GLY 42  28  28  GLY GLY C . n 
C 1 43  SER 43  29  29  SER SER C . n 
C 1 44  GLN 44  30  30  GLN GLN C . n 
C 1 45  ARG 45  31  31  ARG ARG C . n 
C 1 46  ILE 46  32  32  ILE ILE C . n 
C 1 47  THR 47  33  33  THR THR C . n 
C 1 48  THR 48  34  34  THR THR C . n 
C 1 49  ALA 49  35  35  ALA ALA C . n 
C 1 50  LYS 50  36  36  LYS LYS C . n 
C 1 51  LEU 51  37  37  LEU LEU C . n 
C 1 52  ALA 52  38  38  ALA ALA C . n 
C 1 53  ALA 53  39  39  ALA ALA C . n 
C 1 54  SER 54  40  40  SER SER C . n 
C 1 55  VAL 55  41  41  VAL VAL C . n 
C 1 56  GLY 56  42  42  GLY GLY C . n 
C 1 57  VAL 57  43  43  VAL VAL C . n 
C 1 58  SER 58  44  44  SER SER C . n 
C 1 59  GLU 59  45  45  GLU GLU C . n 
C 1 60  ALA 60  46  46  ALA ALA C . n 
C 1 61  ALA 61  47  47  ALA ALA C . n 
C 1 62  LEU 62  48  48  LEU LEU C . n 
C 1 63  TYR 63  49  49  TYR TYR C . n 
C 1 64  ARG 64  50  50  ARG ARG C . n 
C 1 65  HIS 65  51  51  HIS HIS C . n 
C 1 66  PHE 66  52  52  PHE PHE C . n 
C 1 67  PRO 67  53  53  PRO PRO C . n 
C 1 68  SER 68  54  54  SER SER C . n 
C 1 69  LYS 69  55  55  LYS LYS C . n 
C 1 70  THR 70  56  56  THR THR C . n 
C 1 71  ARG 71  57  57  ARG ARG C . n 
C 1 72  MET 72  58  58  MET MET C . n 
C 1 73  PHE 73  59  59  PHE PHE C . n 
C 1 74  ASP 74  60  60  ASP ASP C . n 
C 1 75  SER 75  61  61  SER SER C . n 
C 1 76  LEU 76  62  62  LEU LEU C . n 
C 1 77  ILE 77  63  63  ILE ILE C . n 
C 1 78  GLU 78  64  64  GLU GLU C . n 
C 1 79  PHE 79  65  65  PHE PHE C . n 
C 1 80  ILE 80  66  66  ILE ILE C . n 
C 1 81  GLU 81  67  67  GLU GLU C . n 
C 1 82  ASP 82  68  68  ASP ASP C . n 
C 1 83  SER 83  69  69  SER SER C . n 
C 1 84  LEU 84  70  70  LEU LEU C . n 
C 1 85  ILE 85  71  71  ILE ILE C . n 
C 1 86  THR 86  72  72  THR THR C . n 
C 1 87  ARG 87  73  73  ARG ARG C . n 
C 1 88  ILE 88  74  74  ILE ILE C . n 
C 1 89  ASN 89  75  75  ASN ASN C . n 
C 1 90  LEU 90  76  76  LEU LEU C . n 
C 1 91  ILE 91  77  77  ILE ILE C . n 
C 1 92  LEU 92  78  78  LEU LEU C . n 
C 1 93  LYS 93  79  79  LYS LYS C . n 
C 1 94  ASP 94  80  80  ASP ASP C . n 
C 1 95  GLU 95  81  81  GLU GLU C . n 
C 1 96  LYS 96  82  82  LYS LYS C . n 
C 1 97  ASP 97  83  83  ASP ASP C . n 
C 1 98  THR 98  84  84  THR THR C . n 
C 1 99  THR 99  85  85  THR THR C . n 
C 1 100 ALA 100 86  86  ALA ALA C . n 
C 1 101 ARG 101 87  87  ARG ARG C . n 
C 1 102 LEU 102 88  88  LEU LEU C . n 
C 1 103 ARG 103 89  89  ARG ARG C . n 
C 1 104 LEU 104 90  90  LEU LEU C . n 
C 1 105 ILE 105 91  91  ILE ILE C . n 
C 1 106 VAL 106 92  92  VAL VAL C . n 
C 1 107 LEU 107 93  93  LEU LEU C . n 
C 1 108 LEU 108 94  94  LEU LEU C . n 
C 1 109 ILE 109 95  95  ILE ILE C . n 
C 1 110 LEU 110 96  96  LEU LEU C . n 
C 1 111 GLY 111 97  97  GLY GLY C . n 
C 1 112 PHE 112 98  98  PHE PHE C . n 
C 1 113 GLY 113 99  99  GLY GLY C . n 
C 1 114 GLU 114 100 100 GLU GLU C . n 
C 1 115 ARG 115 101 101 ARG ARG C . n 
C 1 116 ASN 116 102 102 ASN ASN C . n 
C 1 117 PRO 117 103 103 PRO PRO C . n 
C 1 118 GLY 118 104 104 GLY GLY C . n 
C 1 119 LEU 119 105 105 LEU LEU C . n 
C 1 120 THR 120 106 106 THR THR C . n 
C 1 121 ARG 121 107 107 ARG ARG C . n 
C 1 122 ILE 122 108 108 ILE ILE C . n 
C 1 123 LEU 123 109 109 LEU LEU C . n 
C 1 124 THR 124 110 110 THR THR C . n 
C 1 125 GLY 125 111 111 GLY GLY C . n 
C 1 126 HIS 126 112 112 HIS HIS C . n 
C 1 127 ALA 127 113 113 ALA ALA C . n 
C 1 128 LEU 128 114 114 LEU LEU C . n 
C 1 129 MET 129 115 115 MET MET C . n 
C 1 130 PHE 130 116 116 PHE PHE C . n 
C 1 131 GLU 131 117 117 GLU GLU C . n 
C 1 132 GLN 132 118 118 GLN GLN C . n 
C 1 133 ASP 133 119 119 ASP ASP C . n 
C 1 134 ARG 134 120 120 ARG ARG C . n 
C 1 135 LEU 135 121 121 LEU LEU C . n 
C 1 136 GLN 136 122 122 GLN GLN C . n 
C 1 137 GLY 137 123 123 GLY GLY C . n 
C 1 138 ARG 138 124 124 ARG ARG C . n 
C 1 139 ILE 139 125 125 ILE ILE C . n 
C 1 140 ASN 140 126 126 ASN ASN C . n 
C 1 141 GLN 141 127 127 GLN GLN C . n 
C 1 142 LEU 142 128 128 LEU LEU C . n 
C 1 143 PHE 143 129 129 PHE PHE C . n 
C 1 144 GLU 144 130 130 GLU GLU C . n 
C 1 145 ARG 145 131 131 ARG ARG C . n 
C 1 146 ILE 146 132 132 ILE ILE C . n 
C 1 147 GLU 147 133 133 GLU GLU C . n 
C 1 148 VAL 148 134 134 VAL VAL C . n 
C 1 149 GLN 149 135 135 GLN GLN C . n 
C 1 150 LEU 150 136 136 LEU LEU C . n 
C 1 151 ARG 151 137 137 ARG ARG C . n 
C 1 152 GLN 152 138 138 GLN GLN C . n 
C 1 153 VAL 153 139 139 VAL VAL C . n 
C 1 154 MET 154 140 140 MET MET C . n 
C 1 155 ARG 155 141 141 ARG ARG C . n 
C 1 156 GLU 156 142 142 GLU GLU C . n 
C 1 157 LYS 157 143 143 LYS LYS C . n 
C 1 158 LYS 158 144 144 LYS LYS C . n 
C 1 159 MET 159 145 145 MET MET C . n 
C 1 160 ARG 160 146 146 ARG ARG C . n 
C 1 161 GLU 161 147 147 GLU GLU C . n 
C 1 162 GLY 162 148 148 GLY GLY C . n 
C 1 163 GLU 163 149 149 GLU GLU C . n 
C 1 164 GLY 164 150 150 GLY GLY C . n 
C 1 165 TYR 165 151 151 TYR TYR C . n 
C 1 166 THR 166 152 152 THR THR C . n 
C 1 167 LEU 167 153 153 LEU LEU C . n 
C 1 168 ASP 168 154 154 ASP ASP C . n 
C 1 169 GLU 169 155 155 GLU GLU C . n 
C 1 170 THR 170 156 156 THR THR C . n 
C 1 171 LEU 171 157 157 LEU LEU C . n 
C 1 172 LEU 172 158 158 LEU LEU C . n 
C 1 173 ALA 173 159 159 ALA ALA C . n 
C 1 174 SER 174 160 160 SER SER C . n 
C 1 175 GLN 175 161 161 GLN GLN C . n 
C 1 176 LEU 176 162 162 LEU LEU C . n 
C 1 177 LEU 177 163 163 LEU LEU C . n 
C 1 178 ALA 178 164 164 ALA ALA C . n 
C 1 179 PHE 179 165 165 PHE PHE C . n 
C 1 180 CYS 180 166 166 CYS CYS C . n 
C 1 181 GLU 181 167 167 GLU GLU C . n 
C 1 182 GLY 182 168 168 GLY GLY C . n 
C 1 183 MET 183 169 169 MET MET C . n 
C 1 184 LEU 184 170 170 LEU LEU C . n 
C 1 185 SER 185 171 171 SER SER C . n 
C 1 186 ARG 186 172 172 ARG ARG C . n 
C 1 187 PHE 187 173 173 PHE PHE C . n 
C 1 188 VAL 188 174 174 VAL VAL C . n 
C 1 189 ARG 189 175 175 ARG ARG C . n 
C 1 190 SER 190 176 176 SER SER C . n 
C 1 191 GLU 191 177 177 GLU GLU C . n 
C 1 192 PHE 192 178 178 PHE PHE C . n 
C 1 193 LYS 193 179 179 LYS LYS C . n 
C 1 194 TYR 194 180 180 TYR TYR C . n 
C 1 195 ARG 195 181 181 ARG ARG C . n 
C 1 196 PRO 196 182 182 PRO PRO C . n 
C 1 197 THR 197 183 183 THR THR C . n 
C 1 198 ASP 198 184 184 ASP ASP C . n 
C 1 199 ASP 199 185 185 ASP ASP C . n 
C 1 200 PHE 200 186 186 PHE PHE C . n 
C 1 201 GLU 201 187 187 GLU GLU C . n 
C 1 202 ALA 202 188 188 ALA ALA C . n 
C 1 203 ARG 203 189 189 ARG ARG C . n 
C 1 204 TRP 204 190 190 TRP TRP C . n 
C 1 205 PRO 205 191 191 PRO PRO C . n 
C 1 206 LEU 206 192 192 LEU LEU C . n 
C 1 207 VAL 207 193 193 VAL VAL C . n 
C 1 208 ALA 208 194 194 ALA ALA C . n 
C 1 209 ALA 209 195 195 ALA ALA C . n 
C 1 210 GLN 210 196 196 GLN GLN C . n 
C 1 211 LEU 211 197 197 LEU LEU C . n 
C 1 212 GLN 212 198 198 GLN GLN C . n 
D 1 1   MET 1   -13 ?   ?   ?   D . n 
D 1 2   PRO 2   -12 ?   ?   ?   D . n 
D 1 3   PRO 3   -11 ?   ?   ?   D . n 
D 1 4   GLY 4   -10 ?   ?   ?   D . n 
D 1 5   LYS 5   -9  ?   ?   ?   D . n 
D 1 6   CYS 6   -8  ?   ?   ?   D . n 
D 1 7   LEU 7   -7  ?   ?   ?   D . n 
D 1 8   PHE 8   -6  ?   ?   ?   D . n 
D 1 9   SER 9   -5  ?   ?   ?   D . n 
D 1 10  GLY 10  -4  ?   ?   ?   D . n 
D 1 11  VAL 11  -3  ?   ?   ?   D . n 
D 1 12  PHE 12  -2  ?   ?   ?   D . n 
D 1 13  CYS 13  -1  ?   ?   ?   D . n 
D 1 14  ASN 14  0   ?   ?   ?   D . n 
D 1 15  MET 15  1   ?   ?   ?   D . n 
D 1 16  ALA 16  2   ?   ?   ?   D . n 
D 1 17  GLU 17  3   ?   ?   ?   D . n 
D 1 18  LYS 18  4   ?   ?   ?   D . n 
D 1 19  GLN 19  5   ?   ?   ?   D . n 
D 1 20  THR 20  6   ?   ?   ?   D . n 
D 1 21  ALA 21  7   ?   ?   ?   D . n 
D 1 22  LYS 22  8   ?   ?   ?   D . n 
D 1 23  ARG 23  9   ?   ?   ?   D . n 
D 1 24  ASN 24  10  10  ASN ASN D . n 
D 1 25  ARG 25  11  11  ARG ARG D . n 
D 1 26  ARG 26  12  12  ARG ARG D . n 
D 1 27  GLU 27  13  13  GLU GLU D . n 
D 1 28  GLU 28  14  14  GLU GLU D . n 
D 1 29  ILE 29  15  15  ILE ILE D . n 
D 1 30  LEU 30  16  16  LEU LEU D . n 
D 1 31  GLN 31  17  17  GLN GLN D . n 
D 1 32  SER 32  18  18  SER SER D . n 
D 1 33  LEU 33  19  19  LEU LEU D . n 
D 1 34  ALA 34  20  20  ALA ALA D . n 
D 1 35  LEU 35  21  21  LEU LEU D . n 
D 1 36  MET 36  22  22  MET MET D . n 
D 1 37  LEU 37  23  23  LEU LEU D . n 
D 1 38  GLU 38  24  24  GLU GLU D . n 
D 1 39  SER 39  25  25  SER SER D . n 
D 1 40  SER 40  26  26  SER SER D . n 
D 1 41  ASP 41  27  27  ASP ASP D . n 
D 1 42  GLY 42  28  28  GLY GLY D . n 
D 1 43  SER 43  29  29  SER SER D . n 
D 1 44  GLN 44  30  30  GLN GLN D . n 
D 1 45  ARG 45  31  31  ARG ARG D . n 
D 1 46  ILE 46  32  32  ILE ILE D . n 
D 1 47  THR 47  33  33  THR THR D . n 
D 1 48  THR 48  34  34  THR THR D . n 
D 1 49  ALA 49  35  35  ALA ALA D . n 
D 1 50  LYS 50  36  36  LYS LYS D . n 
D 1 51  LEU 51  37  37  LEU LEU D . n 
D 1 52  ALA 52  38  38  ALA ALA D . n 
D 1 53  ALA 53  39  39  ALA ALA D . n 
D 1 54  SER 54  40  40  SER SER D . n 
D 1 55  VAL 55  41  41  VAL VAL D . n 
D 1 56  GLY 56  42  42  GLY GLY D . n 
D 1 57  VAL 57  43  43  VAL VAL D . n 
D 1 58  SER 58  44  44  SER SER D . n 
D 1 59  GLU 59  45  45  GLU GLU D . n 
D 1 60  ALA 60  46  46  ALA ALA D . n 
D 1 61  ALA 61  47  47  ALA ALA D . n 
D 1 62  LEU 62  48  48  LEU LEU D . n 
D 1 63  TYR 63  49  49  TYR TYR D . n 
D 1 64  ARG 64  50  50  ARG ARG D . n 
D 1 65  HIS 65  51  51  HIS HIS D . n 
D 1 66  PHE 66  52  52  PHE PHE D . n 
D 1 67  PRO 67  53  53  PRO PRO D . n 
D 1 68  SER 68  54  54  SER SER D . n 
D 1 69  LYS 69  55  55  LYS LYS D . n 
D 1 70  THR 70  56  56  THR THR D . n 
D 1 71  ARG 71  57  57  ARG ARG D . n 
D 1 72  MET 72  58  58  MET MET D . n 
D 1 73  PHE 73  59  59  PHE PHE D . n 
D 1 74  ASP 74  60  60  ASP ASP D . n 
D 1 75  SER 75  61  61  SER SER D . n 
D 1 76  LEU 76  62  62  LEU LEU D . n 
D 1 77  ILE 77  63  63  ILE ILE D . n 
D 1 78  GLU 78  64  64  GLU GLU D . n 
D 1 79  PHE 79  65  65  PHE PHE D . n 
D 1 80  ILE 80  66  66  ILE ILE D . n 
D 1 81  GLU 81  67  67  GLU GLU D . n 
D 1 82  ASP 82  68  68  ASP ASP D . n 
D 1 83  SER 83  69  69  SER SER D . n 
D 1 84  LEU 84  70  70  LEU LEU D . n 
D 1 85  ILE 85  71  71  ILE ILE D . n 
D 1 86  THR 86  72  72  THR THR D . n 
D 1 87  ARG 87  73  73  ARG ARG D . n 
D 1 88  ILE 88  74  74  ILE ILE D . n 
D 1 89  ASN 89  75  75  ASN ASN D . n 
D 1 90  LEU 90  76  76  LEU LEU D . n 
D 1 91  ILE 91  77  77  ILE ILE D . n 
D 1 92  LEU 92  78  78  LEU LEU D . n 
D 1 93  LYS 93  79  79  LYS LYS D . n 
D 1 94  ASP 94  80  80  ASP ASP D . n 
D 1 95  GLU 95  81  81  GLU GLU D . n 
D 1 96  LYS 96  82  82  LYS LYS D . n 
D 1 97  ASP 97  83  83  ASP ASP D . n 
D 1 98  THR 98  84  84  THR THR D . n 
D 1 99  THR 99  85  85  THR THR D . n 
D 1 100 ALA 100 86  86  ALA ALA D . n 
D 1 101 ARG 101 87  87  ARG ARG D . n 
D 1 102 LEU 102 88  88  LEU LEU D . n 
D 1 103 ARG 103 89  89  ARG ARG D . n 
D 1 104 LEU 104 90  90  LEU LEU D . n 
D 1 105 ILE 105 91  91  ILE ILE D . n 
D 1 106 VAL 106 92  92  VAL VAL D . n 
D 1 107 LEU 107 93  93  LEU LEU D . n 
D 1 108 LEU 108 94  94  LEU LEU D . n 
D 1 109 ILE 109 95  95  ILE ILE D . n 
D 1 110 LEU 110 96  96  LEU LEU D . n 
D 1 111 GLY 111 97  97  GLY GLY D . n 
D 1 112 PHE 112 98  98  PHE PHE D . n 
D 1 113 GLY 113 99  99  GLY GLY D . n 
D 1 114 GLU 114 100 100 GLU GLU D . n 
D 1 115 ARG 115 101 101 ARG ARG D . n 
D 1 116 ASN 116 102 102 ASN ASN D . n 
D 1 117 PRO 117 103 103 PRO PRO D . n 
D 1 118 GLY 118 104 104 GLY GLY D . n 
D 1 119 LEU 119 105 105 LEU LEU D . n 
D 1 120 THR 120 106 106 THR THR D . n 
D 1 121 ARG 121 107 107 ARG ARG D . n 
D 1 122 ILE 122 108 108 ILE ILE D . n 
D 1 123 LEU 123 109 109 LEU LEU D . n 
D 1 124 THR 124 110 110 THR THR D . n 
D 1 125 GLY 125 111 111 GLY GLY D . n 
D 1 126 HIS 126 112 112 HIS HIS D . n 
D 1 127 ALA 127 113 113 ALA ALA D . n 
D 1 128 LEU 128 114 114 LEU LEU D . n 
D 1 129 MET 129 115 115 MET MET D . n 
D 1 130 PHE 130 116 116 PHE PHE D . n 
D 1 131 GLU 131 117 117 GLU GLU D . n 
D 1 132 GLN 132 118 118 GLN GLN D . n 
D 1 133 ASP 133 119 119 ASP ASP D . n 
D 1 134 ARG 134 120 120 ARG ARG D . n 
D 1 135 LEU 135 121 121 LEU LEU D . n 
D 1 136 GLN 136 122 122 GLN GLN D . n 
D 1 137 GLY 137 123 123 GLY GLY D . n 
D 1 138 ARG 138 124 124 ARG ARG D . n 
D 1 139 ILE 139 125 125 ILE ILE D . n 
D 1 140 ASN 140 126 126 ASN ASN D . n 
D 1 141 GLN 141 127 127 GLN GLN D . n 
D 1 142 LEU 142 128 128 LEU LEU D . n 
D 1 143 PHE 143 129 129 PHE PHE D . n 
D 1 144 GLU 144 130 130 GLU GLU D . n 
D 1 145 ARG 145 131 131 ARG ARG D . n 
D 1 146 ILE 146 132 132 ILE ILE D . n 
D 1 147 GLU 147 133 133 GLU GLU D . n 
D 1 148 VAL 148 134 134 VAL VAL D . n 
D 1 149 GLN 149 135 135 GLN GLN D . n 
D 1 150 LEU 150 136 136 LEU LEU D . n 
D 1 151 ARG 151 137 137 ARG ARG D . n 
D 1 152 GLN 152 138 138 GLN GLN D . n 
D 1 153 VAL 153 139 139 VAL VAL D . n 
D 1 154 MET 154 140 140 MET MET D . n 
D 1 155 ARG 155 141 141 ARG ARG D . n 
D 1 156 GLU 156 142 142 GLU GLU D . n 
D 1 157 LYS 157 143 143 LYS LYS D . n 
D 1 158 LYS 158 144 144 LYS LYS D . n 
D 1 159 MET 159 145 145 MET MET D . n 
D 1 160 ARG 160 146 146 ARG ARG D . n 
D 1 161 GLU 161 147 147 GLU GLU D . n 
D 1 162 GLY 162 148 148 GLY GLY D . n 
D 1 163 GLU 163 149 149 GLU GLU D . n 
D 1 164 GLY 164 150 150 GLY GLY D . n 
D 1 165 TYR 165 151 151 TYR TYR D . n 
D 1 166 THR 166 152 152 THR THR D . n 
D 1 167 LEU 167 153 153 LEU LEU D . n 
D 1 168 ASP 168 154 154 ASP ASP D . n 
D 1 169 GLU 169 155 155 GLU GLU D . n 
D 1 170 THR 170 156 156 THR THR D . n 
D 1 171 LEU 171 157 157 LEU LEU D . n 
D 1 172 LEU 172 158 158 LEU LEU D . n 
D 1 173 ALA 173 159 159 ALA ALA D . n 
D 1 174 SER 174 160 160 SER SER D . n 
D 1 175 GLN 175 161 161 GLN GLN D . n 
D 1 176 LEU 176 162 162 LEU LEU D . n 
D 1 177 LEU 177 163 163 LEU LEU D . n 
D 1 178 ALA 178 164 164 ALA ALA D . n 
D 1 179 PHE 179 165 165 PHE PHE D . n 
D 1 180 CYS 180 166 166 CYS CYS D . n 
D 1 181 GLU 181 167 167 GLU GLU D . n 
D 1 182 GLY 182 168 168 GLY GLY D . n 
D 1 183 MET 183 169 169 MET MET D . n 
D 1 184 LEU 184 170 170 LEU LEU D . n 
D 1 185 SER 185 171 171 SER SER D . n 
D 1 186 ARG 186 172 172 ARG ARG D . n 
D 1 187 PHE 187 173 173 PHE PHE D . n 
D 1 188 VAL 188 174 174 VAL VAL D . n 
D 1 189 ARG 189 175 175 ARG ARG D . n 
D 1 190 SER 190 176 176 SER SER D . n 
D 1 191 GLU 191 177 177 GLU GLU D . n 
D 1 192 PHE 192 178 178 PHE PHE D . n 
D 1 193 LYS 193 179 179 LYS LYS D . n 
D 1 194 TYR 194 180 180 TYR TYR D . n 
D 1 195 ARG 195 181 181 ARG ARG D . n 
D 1 196 PRO 196 182 182 PRO PRO D . n 
D 1 197 THR 197 183 183 THR THR D . n 
D 1 198 ASP 198 184 184 ASP ASP D . n 
D 1 199 ASP 199 185 185 ASP ASP D . n 
D 1 200 PHE 200 186 186 PHE PHE D . n 
D 1 201 GLU 201 187 187 GLU GLU D . n 
D 1 202 ALA 202 188 188 ALA ALA D . n 
D 1 203 ARG 203 189 189 ARG ARG D . n 
D 1 204 TRP 204 190 190 TRP TRP D . n 
D 1 205 PRO 205 191 191 PRO PRO D . n 
D 1 206 LEU 206 192 192 LEU LEU D . n 
D 1 207 VAL 207 193 193 VAL VAL D . n 
D 1 208 ALA 208 194 194 ALA ALA D . n 
D 1 209 ALA 209 195 195 ALA ALA D . n 
D 1 210 GLN 210 196 196 GLN GLN D . n 
D 1 211 LEU 211 197 197 LEU LEU D . n 
D 1 212 GLN 212 198 198 GLN GLN D . n 
E 2 1   DG  1   2   2   DG  GUA W . n 
E 2 2   DT  2   3   3   DT  THY W . n 
E 2 3   DG  3   4   4   DG  GUA W . n 
E 2 4   DA  4   5   5   DA  ADE W . n 
E 2 5   DG  5   6   6   DG  GUA W . n 
E 2 6   DT  6   7   7   DT  THY W . n 
E 2 7   DA  7   8   8   DA  ADE W . n 
E 2 8   DC  8   9   9   DC  CYT W . n 
E 2 9   DT  9   10  10  DT  THY W . n 
E 2 10  DC  10  11  11  DC  CYT W . n 
E 2 11  DA  11  12  12  DA  ADE W . n 
E 2 12  DC  12  13  13  DC  CYT W . n 
F 2 1   DG  1   23  23  DG  GUA Z . n 
F 2 2   DT  2   24  24  DT  THY Z . n 
F 2 3   DG  3   25  25  DG  GUA Z . n 
F 2 4   DA  4   26  26  DA  ADE Z . n 
F 2 5   DG  5   27  27  DG  GUA Z . n 
F 2 6   DT  6   28  28  DT  THY Z . n 
F 2 7   DA  7   29  29  DA  ADE Z . n 
F 2 8   DC  8   30  30  DC  CYT Z . n 
F 2 9   DT  9   31  31  DT  THY Z . n 
F 2 10  DC  10  32  32  DC  CYT Z . n 
F 2 11  DA  11  33  33  DA  ADE Z . n 
F 2 12  DC  12  34  34  DC  CYT Z . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 10760 ? 
1 MORE         -51   ? 
1 'SSA (A^2)'  33700 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-06-19 
2 'Structure model' 1 1 2013-07-10 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC   'data collection' Quantum ? 1 
MOLREP phasing           .       ? 2 
CNS    refinement        1.2     ? 3 
MOSFLM 'data reduction'  .       ? 4 
SCALA  'data scaling'    .       ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE2 C GLU 147 ? ? O C HOH 312 ? ? 1.99 
2 1 OE1 C GLU 67  ? ? O C HOH 314 ? ? 2.03 
3 1 NH1 C ARG 12  ? ? O C HOH 275 ? ? 2.03 
4 1 OE2 B GLU 117 ? ? O B HOH 267 ? ? 2.03 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    NH2 
_pdbx_validate_symm_contact.auth_asym_id_1    C 
_pdbx_validate_symm_contact.auth_comp_id_1    ARG 
_pdbx_validate_symm_contact.auth_seq_id_1     146 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    OE2 
_pdbx_validate_symm_contact.auth_asym_id_2    D 
_pdbx_validate_symm_contact.auth_comp_id_2    GLU 
_pdbx_validate_symm_contact.auth_seq_id_2     187 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   4_555 
_pdbx_validate_symm_contact.dist              2.07 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB    C ASP 80 ? ? CG    C ASP 80 ? ? OD1   C ASP 80 ? ? 126.13 118.30 7.83 0.90 N 
2 1 "C5'" Z DG  27 ? ? "C4'" Z DG  27 ? ? "O4'" Z DG  27 ? ? 117.24 109.80 7.44 1.10 N 
3 1 "O3'" Z DC  32 ? ? P     Z DA  33 ? ? OP2   Z DA  33 ? ? 117.73 110.50 7.23 1.10 Y 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    VAL 
_pdbx_validate_torsion.auth_asym_id    D 
_pdbx_validate_torsion.auth_seq_id     41 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -54.99 
_pdbx_validate_torsion.psi             -73.71 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DG W 2  ? ? 0.063 'SIDE CHAIN' 
2 1 DG Z 23 ? ? 0.058 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -13 ? A MET 1  
2  1 Y 1 A PRO -12 ? A PRO 2  
3  1 Y 1 A PRO -11 ? A PRO 3  
4  1 Y 1 A GLY -10 ? A GLY 4  
5  1 Y 1 A LYS -9  ? A LYS 5  
6  1 Y 1 A CYS -8  ? A CYS 6  
7  1 Y 1 A LEU -7  ? A LEU 7  
8  1 Y 1 A PHE -6  ? A PHE 8  
9  1 Y 1 A SER -5  ? A SER 9  
10 1 Y 1 A GLY -4  ? A GLY 10 
11 1 Y 1 A VAL -3  ? A VAL 11 
12 1 Y 1 A PHE -2  ? A PHE 12 
13 1 Y 1 A CYS -1  ? A CYS 13 
14 1 Y 1 A ASN 0   ? A ASN 14 
15 1 Y 1 A MET 1   ? A MET 15 
16 1 Y 1 A ALA 2   ? A ALA 16 
17 1 Y 1 A GLU 3   ? A GLU 17 
18 1 Y 1 A LYS 4   ? A LYS 18 
19 1 Y 1 A GLN 5   ? A GLN 19 
20 1 Y 1 A THR 6   ? A THR 20 
21 1 Y 1 A ALA 7   ? A ALA 21 
22 1 Y 1 A LYS 8   ? A LYS 22 
23 1 Y 1 B MET -13 ? B MET 1  
24 1 Y 1 B PRO -12 ? B PRO 2  
25 1 Y 1 B PRO -11 ? B PRO 3  
26 1 Y 1 B GLY -10 ? B GLY 4  
27 1 Y 1 B LYS -9  ? B LYS 5  
28 1 Y 1 B CYS -8  ? B CYS 6  
29 1 Y 1 B LEU -7  ? B LEU 7  
30 1 Y 1 B PHE -6  ? B PHE 8  
31 1 Y 1 B SER -5  ? B SER 9  
32 1 Y 1 B GLY -4  ? B GLY 10 
33 1 Y 1 B VAL -3  ? B VAL 11 
34 1 Y 1 B PHE -2  ? B PHE 12 
35 1 Y 1 B CYS -1  ? B CYS 13 
36 1 Y 1 B ASN 0   ? B ASN 14 
37 1 Y 1 B MET 1   ? B MET 15 
38 1 Y 1 B ALA 2   ? B ALA 16 
39 1 Y 1 B GLU 3   ? B GLU 17 
40 1 Y 1 B LYS 4   ? B LYS 18 
41 1 Y 1 B GLN 5   ? B GLN 19 
42 1 Y 1 B THR 6   ? B THR 20 
43 1 Y 1 B ALA 7   ? B ALA 21 
44 1 Y 1 B LYS 8   ? B LYS 22 
45 1 Y 1 B ARG 9   ? B ARG 23 
46 1 Y 1 C MET -13 ? C MET 1  
47 1 Y 1 C PRO -12 ? C PRO 2  
48 1 Y 1 C PRO -11 ? C PRO 3  
49 1 Y 1 C GLY -10 ? C GLY 4  
50 1 Y 1 C LYS -9  ? C LYS 5  
51 1 Y 1 C CYS -8  ? C CYS 6  
52 1 Y 1 C LEU -7  ? C LEU 7  
53 1 Y 1 C PHE -6  ? C PHE 8  
54 1 Y 1 C SER -5  ? C SER 9  
55 1 Y 1 C GLY -4  ? C GLY 10 
56 1 Y 1 C VAL -3  ? C VAL 11 
57 1 Y 1 C PHE -2  ? C PHE 12 
58 1 Y 1 C CYS -1  ? C CYS 13 
59 1 Y 1 C ASN 0   ? C ASN 14 
60 1 Y 1 C MET 1   ? C MET 15 
61 1 Y 1 C ALA 2   ? C ALA 16 
62 1 Y 1 C GLU 3   ? C GLU 17 
63 1 Y 1 C LYS 4   ? C LYS 18 
64 1 Y 1 C GLN 5   ? C GLN 19 
65 1 Y 1 C THR 6   ? C THR 20 
66 1 Y 1 C ALA 7   ? C ALA 21 
67 1 Y 1 C LYS 8   ? C LYS 22 
68 1 Y 1 D MET -13 ? D MET 1  
69 1 Y 1 D PRO -12 ? D PRO 2  
70 1 Y 1 D PRO -11 ? D PRO 3  
71 1 Y 1 D GLY -10 ? D GLY 4  
72 1 Y 1 D LYS -9  ? D LYS 5  
73 1 Y 1 D CYS -8  ? D CYS 6  
74 1 Y 1 D LEU -7  ? D LEU 7  
75 1 Y 1 D PHE -6  ? D PHE 8  
76 1 Y 1 D SER -5  ? D SER 9  
77 1 Y 1 D GLY -4  ? D GLY 10 
78 1 Y 1 D VAL -3  ? D VAL 11 
79 1 Y 1 D PHE -2  ? D PHE 12 
80 1 Y 1 D CYS -1  ? D CYS 13 
81 1 Y 1 D ASN 0   ? D ASN 14 
82 1 Y 1 D MET 1   ? D MET 15 
83 1 Y 1 D ALA 2   ? D ALA 16 
84 1 Y 1 D GLU 3   ? D GLU 17 
85 1 Y 1 D LYS 4   ? D LYS 18 
86 1 Y 1 D GLN 5   ? D GLN 19 
87 1 Y 1 D THR 6   ? D THR 20 
88 1 Y 1 D ALA 7   ? D ALA 21 
89 1 Y 1 D LYS 8   ? D LYS 22 
90 1 Y 1 D ARG 9   ? D ARG 23 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4GCK 'double helix'        
4GCK 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 E DG 1  1_555 F DC 12 1_555 0.006  0.111  -0.671 -34.724 5.740   1.329  1  W_DG2:DC34_Z  W 2  ? Z 34 ? 19 1 
1 E DT 2  1_555 F DA 11 1_555 0.146  -0.004 0.248  -21.622 7.687   2.916  2  W_DT3:DA33_Z  W 3  ? Z 33 ? 20 1 
1 E DG 3  1_555 F DC 10 1_555 0.054  -0.174 -0.401 3.530   -12.204 2.588  3  W_DG4:DC32_Z  W 4  ? Z 32 ? 19 1 
1 E DA 4  1_555 F DT 9  1_555 0.240  -0.016 0.163  9.565   -8.002  1.058  4  W_DA5:DT31_Z  W 5  ? Z 31 ? 20 1 
1 E DG 5  1_555 F DC 8  1_555 -0.079 -0.200 -0.275 -3.992  -11.738 3.248  5  W_DG6:DC30_Z  W 6  ? Z 30 ? 19 1 
1 E DT 6  1_555 F DA 7  1_555 -0.077 -0.114 -0.382 -4.827  -6.936  -0.604 6  W_DT7:DA29_Z  W 7  ? Z 29 ? 20 1 
1 E DA 7  1_555 F DT 6  1_555 0.021  -0.111 -0.440 4.865   -11.393 3.201  7  W_DA8:DT28_Z  W 8  ? Z 28 ? 20 1 
1 E DC 8  1_555 F DG 5  1_555 0.023  -0.012 0.192  3.559   -11.567 1.076  8  W_DC9:DG27_Z  W 9  ? Z 27 ? 19 1 
1 E DT 9  1_555 F DA 4  1_555 -0.192 0.063  -0.019 -10.662 -8.832  -2.231 9  W_DT10:DA26_Z W 10 ? Z 26 ? 20 1 
1 E DC 10 1_555 F DG 3  1_555 0.001  -0.316 -0.459 -1.475  -11.403 2.219  10 W_DC11:DG25_Z W 11 ? Z 25 ? 19 1 
1 E DA 11 1_555 F DT 2  1_555 -0.256 -0.009 0.184  17.903  4.962   1.859  11 W_DA12:DT24_Z W 12 ? Z 24 ? 20 1 
1 E DC 12 1_555 F DG 1  1_555 0.154  0.097  -0.636 35.401  5.318   -0.193 12 W_DC13:DG23_Z W 13 ? Z 23 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 E DG 1  1_555 F DC 12 1_555 E DT 2  1_555 F DA 11 1_555 -0.520 -0.661 3.056 -3.271 8.224  28.051 -2.920 0.382  2.795 16.456 
6.546  29.387 1  WW_DG2DT3:DA33DC34_ZZ   W 2  ? Z 34 ? W 3  ? Z 33 ? 
1 E DT 2  1_555 F DA 11 1_555 E DG 3  1_555 F DC 10 1_555 -0.977 1.835  3.020 2.909  -5.947 39.626 3.264  1.712  2.653 -8.699 
-4.255 40.153 2  WW_DT3DG4:DC32DA33_ZZ   W 3  ? Z 33 ? W 4  ? Z 32 ? 
1 E DG 3  1_555 F DC 10 1_555 E DA 4  1_555 F DT 9  1_555 0.614  0.087  3.116 -3.322 -0.005 33.674 0.150  -1.560 3.044 -0.008 
5.717  33.833 3  WW_DG4DA5:DT31DC32_ZZ   W 4  ? Z 32 ? W 5  ? Z 31 ? 
1 E DA 4  1_555 F DT 9  1_555 E DG 5  1_555 F DC 8  1_555 0.993  -1.135 3.815 2.758  0.033  30.426 -2.162 -1.239 3.886 0.063  
-5.242 30.548 4  WW_DA5DG6:DC30DT31_ZZ   W 5  ? Z 31 ? W 6  ? Z 30 ? 
1 E DG 5  1_555 F DC 8  1_555 E DT 6  1_555 F DA 7  1_555 -0.783 -0.755 3.295 0.882  9.834  31.013 -3.020 1.549  2.903 17.833 
-1.600 32.510 5  WW_DG6DT7:DA29DC30_ZZ   W 6  ? Z 30 ? W 7  ? Z 29 ? 
1 E DT 6  1_555 F DA 7  1_555 E DA 7  1_555 F DT 6  1_555 -0.137 1.582  3.231 -1.507 14.749 29.514 0.013  -0.041 3.600 26.917 
2.750  32.955 6  WW_DT7DA8:DT28DA29_ZZ   W 7  ? Z 29 ? W 8  ? Z 28 ? 
1 E DA 7  1_555 F DT 6  1_555 E DC 8  1_555 F DG 5  1_555 0.726  -0.873 3.342 -5.842 5.379  34.458 -2.221 -2.046 3.017 8.933  
9.702  35.334 7  WW_DA8DC9:DG27DT28_ZZ   W 8  ? Z 28 ? W 9  ? Z 27 ? 
1 E DC 8  1_555 F DG 5  1_555 E DT 9  1_555 F DA 4  1_555 -1.242 -1.315 3.820 2.075  -2.524 29.210 -1.957 2.969  3.822 -4.985 
-4.097 29.388 8  WW_DC9DT10:DA26DG27_ZZ  W 9  ? Z 27 ? W 10 ? Z 26 ? 
1 E DT 9  1_555 F DA 4  1_555 E DC 10 1_555 F DG 3  1_555 -0.447 0.247  2.992 3.285  1.712  32.005 0.168  1.339  2.942 3.092  
-5.933 32.213 9  WW_DT10DC11:DG25DA26_ZZ W 10 ? Z 26 ? W 11 ? Z 25 ? 
1 E DC 10 1_555 F DG 3  1_555 E DA 11 1_555 F DT 2  1_555 0.843  1.843  3.104 -3.580 -2.977 40.984 2.911  -1.552 2.889 -4.235 
5.093  41.236 10 WW_DC11DA12:DT24DG25_ZZ W 11 ? Z 25 ? W 12 ? Z 24 ? 
1 E DA 11 1_555 F DT 2  1_555 E DC 12 1_555 F DG 1  1_555 0.455  -0.546 3.016 1.691  5.751  28.313 -2.254 -0.570 2.872 11.594 
-3.410 28.928 11 WW_DA12DC13:DG23DT24_ZZ W 12 ? Z 24 ? W 13 ? Z 23 ? 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 3 HOH 1   201 1   HOH TIP A . 
G 3 HOH 2   202 4   HOH TIP A . 
G 3 HOH 3   203 6   HOH TIP A . 
G 3 HOH 4   204 8   HOH TIP A . 
G 3 HOH 5   205 17  HOH TIP A . 
G 3 HOH 6   206 18  HOH TIP A . 
G 3 HOH 7   207 19  HOH TIP A . 
G 3 HOH 8   208 23  HOH TIP A . 
G 3 HOH 9   209 27  HOH TIP A . 
G 3 HOH 10  210 36  HOH TIP A . 
G 3 HOH 11  211 48  HOH TIP A . 
G 3 HOH 12  212 54  HOH TIP A . 
G 3 HOH 13  213 55  HOH TIP A . 
G 3 HOH 14  214 74  HOH TIP A . 
G 3 HOH 15  215 81  HOH TIP A . 
G 3 HOH 16  216 84  HOH TIP A . 
G 3 HOH 17  217 96  HOH TIP A . 
G 3 HOH 18  218 101 HOH TIP A . 
G 3 HOH 19  219 103 HOH TIP A . 
G 3 HOH 20  220 109 HOH TIP A . 
G 3 HOH 21  221 110 HOH TIP A . 
G 3 HOH 22  222 113 HOH TIP A . 
G 3 HOH 23  223 115 HOH TIP A . 
G 3 HOH 24  224 117 HOH TIP A . 
G 3 HOH 25  225 122 HOH TIP A . 
G 3 HOH 26  226 126 HOH TIP A . 
G 3 HOH 27  227 129 HOH TIP A . 
G 3 HOH 28  228 130 HOH TIP A . 
G 3 HOH 29  229 131 HOH TIP A . 
G 3 HOH 30  230 132 HOH TIP A . 
G 3 HOH 31  231 134 HOH TIP A . 
G 3 HOH 32  232 137 HOH TIP A . 
G 3 HOH 33  233 142 HOH TIP A . 
G 3 HOH 34  234 151 HOH TIP A . 
G 3 HOH 35  235 152 HOH TIP A . 
G 3 HOH 36  236 154 HOH TIP A . 
G 3 HOH 37  237 163 HOH TIP A . 
G 3 HOH 38  238 166 HOH TIP A . 
G 3 HOH 39  239 169 HOH TIP A . 
G 3 HOH 40  240 173 HOH TIP A . 
G 3 HOH 41  241 178 HOH TIP A . 
G 3 HOH 42  242 184 HOH TIP A . 
G 3 HOH 43  243 185 HOH TIP A . 
G 3 HOH 44  244 189 HOH TIP A . 
G 3 HOH 45  245 194 HOH TIP A . 
G 3 HOH 46  246 202 HOH TIP A . 
G 3 HOH 47  247 206 HOH TIP A . 
G 3 HOH 48  248 207 HOH TIP A . 
G 3 HOH 49  249 210 HOH TIP A . 
G 3 HOH 50  250 215 HOH TIP A . 
G 3 HOH 51  251 217 HOH TIP A . 
G 3 HOH 52  252 221 HOH TIP A . 
G 3 HOH 53  253 224 HOH TIP A . 
G 3 HOH 54  254 230 HOH TIP A . 
G 3 HOH 55  255 235 HOH TIP A . 
G 3 HOH 56  256 241 HOH TIP A . 
G 3 HOH 57  257 243 HOH TIP A . 
G 3 HOH 58  258 246 HOH TIP A . 
G 3 HOH 59  259 250 HOH TIP A . 
G 3 HOH 60  260 252 HOH TIP A . 
G 3 HOH 61  261 258 HOH TIP A . 
G 3 HOH 62  262 268 HOH TIP A . 
G 3 HOH 63  263 273 HOH TIP A . 
G 3 HOH 64  264 280 HOH TIP A . 
G 3 HOH 65  265 285 HOH TIP A . 
G 3 HOH 66  266 287 HOH TIP A . 
G 3 HOH 67  267 289 HOH TIP A . 
G 3 HOH 68  268 297 HOH TIP A . 
G 3 HOH 69  269 299 HOH TIP A . 
G 3 HOH 70  270 301 HOH TIP A . 
G 3 HOH 71  271 305 HOH TIP A . 
G 3 HOH 72  272 306 HOH TIP A . 
G 3 HOH 73  273 317 HOH TIP A . 
G 3 HOH 74  274 320 HOH TIP A . 
G 3 HOH 75  275 321 HOH TIP A . 
G 3 HOH 76  276 325 HOH TIP A . 
G 3 HOH 77  277 329 HOH TIP A . 
G 3 HOH 78  278 332 HOH TIP A . 
G 3 HOH 79  279 340 HOH TIP A . 
G 3 HOH 80  280 342 HOH TIP A . 
G 3 HOH 81  281 346 HOH TIP A . 
G 3 HOH 82  282 348 HOH TIP A . 
G 3 HOH 83  283 350 HOH TIP A . 
G 3 HOH 84  284 356 HOH TIP A . 
G 3 HOH 85  285 360 HOH TIP A . 
G 3 HOH 86  286 361 HOH TIP A . 
G 3 HOH 87  287 369 HOH TIP A . 
G 3 HOH 88  288 376 HOH TIP A . 
G 3 HOH 89  289 377 HOH TIP A . 
G 3 HOH 90  290 398 HOH TIP A . 
G 3 HOH 91  291 399 HOH TIP A . 
G 3 HOH 92  292 413 HOH TIP A . 
G 3 HOH 93  293 415 HOH TIP A . 
G 3 HOH 94  294 423 HOH TIP A . 
G 3 HOH 95  295 425 HOH TIP A . 
G 3 HOH 96  296 427 HOH TIP A . 
G 3 HOH 97  297 429 HOH TIP A . 
G 3 HOH 98  298 431 HOH TIP A . 
G 3 HOH 99  299 433 HOH TIP A . 
G 3 HOH 100 300 434 HOH TIP A . 
G 3 HOH 101 301 435 HOH TIP A . 
G 3 HOH 102 302 436 HOH TIP A . 
H 3 HOH 1   201 3   HOH TIP B . 
H 3 HOH 2   202 11  HOH TIP B . 
H 3 HOH 3   203 15  HOH TIP B . 
H 3 HOH 4   204 16  HOH TIP B . 
H 3 HOH 5   205 25  HOH TIP B . 
H 3 HOH 6   206 31  HOH TIP B . 
H 3 HOH 7   207 37  HOH TIP B . 
H 3 HOH 8   208 40  HOH TIP B . 
H 3 HOH 9   209 42  HOH TIP B . 
H 3 HOH 10  210 45  HOH TIP B . 
H 3 HOH 11  211 51  HOH TIP B . 
H 3 HOH 12  212 53  HOH TIP B . 
H 3 HOH 13  213 61  HOH TIP B . 
H 3 HOH 14  214 63  HOH TIP B . 
H 3 HOH 15  215 67  HOH TIP B . 
H 3 HOH 16  216 76  HOH TIP B . 
H 3 HOH 17  217 87  HOH TIP B . 
H 3 HOH 18  218 89  HOH TIP B . 
H 3 HOH 19  219 98  HOH TIP B . 
H 3 HOH 20  220 99  HOH TIP B . 
H 3 HOH 21  221 107 HOH TIP B . 
H 3 HOH 22  222 114 HOH TIP B . 
H 3 HOH 23  223 133 HOH TIP B . 
H 3 HOH 24  224 155 HOH TIP B . 
H 3 HOH 25  225 157 HOH TIP B . 
H 3 HOH 26  226 159 HOH TIP B . 
H 3 HOH 27  227 162 HOH TIP B . 
H 3 HOH 28  228 164 HOH TIP B . 
H 3 HOH 29  229 165 HOH TIP B . 
H 3 HOH 30  230 176 HOH TIP B . 
H 3 HOH 31  231 182 HOH TIP B . 
H 3 HOH 32  232 187 HOH TIP B . 
H 3 HOH 33  233 191 HOH TIP B . 
H 3 HOH 34  234 200 HOH TIP B . 
H 3 HOH 35  235 201 HOH TIP B . 
H 3 HOH 36  236 211 HOH TIP B . 
H 3 HOH 37  237 216 HOH TIP B . 
H 3 HOH 38  238 222 HOH TIP B . 
H 3 HOH 39  239 228 HOH TIP B . 
H 3 HOH 40  240 237 HOH TIP B . 
H 3 HOH 41  241 239 HOH TIP B . 
H 3 HOH 42  242 248 HOH TIP B . 
H 3 HOH 43  243 249 HOH TIP B . 
H 3 HOH 44  244 253 HOH TIP B . 
H 3 HOH 45  245 254 HOH TIP B . 
H 3 HOH 46  246 255 HOH TIP B . 
H 3 HOH 47  247 256 HOH TIP B . 
H 3 HOH 48  248 266 HOH TIP B . 
H 3 HOH 49  249 270 HOH TIP B . 
H 3 HOH 50  250 276 HOH TIP B . 
H 3 HOH 51  251 279 HOH TIP B . 
H 3 HOH 52  252 281 HOH TIP B . 
H 3 HOH 53  253 295 HOH TIP B . 
H 3 HOH 54  254 300 HOH TIP B . 
H 3 HOH 55  255 303 HOH TIP B . 
H 3 HOH 56  256 311 HOH TIP B . 
H 3 HOH 57  257 312 HOH TIP B . 
H 3 HOH 58  258 313 HOH TIP B . 
H 3 HOH 59  259 322 HOH TIP B . 
H 3 HOH 60  260 336 HOH TIP B . 
H 3 HOH 61  261 343 HOH TIP B . 
H 3 HOH 62  262 347 HOH TIP B . 
H 3 HOH 63  263 359 HOH TIP B . 
H 3 HOH 64  264 363 HOH TIP B . 
H 3 HOH 65  265 373 HOH TIP B . 
H 3 HOH 66  266 374 HOH TIP B . 
H 3 HOH 67  267 380 HOH TIP B . 
H 3 HOH 68  268 388 HOH TIP B . 
H 3 HOH 69  269 390 HOH TIP B . 
H 3 HOH 70  270 391 HOH TIP B . 
H 3 HOH 71  271 392 HOH TIP B . 
H 3 HOH 72  272 393 HOH TIP B . 
H 3 HOH 73  273 401 HOH TIP B . 
H 3 HOH 74  274 404 HOH TIP B . 
H 3 HOH 75  275 408 HOH TIP B . 
H 3 HOH 76  276 412 HOH TIP B . 
H 3 HOH 77  277 417 HOH TIP B . 
H 3 HOH 78  278 419 HOH TIP B . 
H 3 HOH 79  279 428 HOH TIP B . 
H 3 HOH 80  280 437 HOH TIP B . 
I 3 HOH 1   201 5   HOH TIP C . 
I 3 HOH 2   202 7   HOH TIP C . 
I 3 HOH 3   203 9   HOH TIP C . 
I 3 HOH 4   204 12  HOH TIP C . 
I 3 HOH 5   205 14  HOH TIP C . 
I 3 HOH 6   206 21  HOH TIP C . 
I 3 HOH 7   207 22  HOH TIP C . 
I 3 HOH 8   208 24  HOH TIP C . 
I 3 HOH 9   209 28  HOH TIP C . 
I 3 HOH 10  210 29  HOH TIP C . 
I 3 HOH 11  211 33  HOH TIP C . 
I 3 HOH 12  212 34  HOH TIP C . 
I 3 HOH 13  213 38  HOH TIP C . 
I 3 HOH 14  214 39  HOH TIP C . 
I 3 HOH 15  215 46  HOH TIP C . 
I 3 HOH 16  216 47  HOH TIP C . 
I 3 HOH 17  217 52  HOH TIP C . 
I 3 HOH 18  218 58  HOH TIP C . 
I 3 HOH 19  219 69  HOH TIP C . 
I 3 HOH 20  220 72  HOH TIP C . 
I 3 HOH 21  221 77  HOH TIP C . 
I 3 HOH 22  222 78  HOH TIP C . 
I 3 HOH 23  223 80  HOH TIP C . 
I 3 HOH 24  224 82  HOH TIP C . 
I 3 HOH 25  225 83  HOH TIP C . 
I 3 HOH 26  226 86  HOH TIP C . 
I 3 HOH 27  227 88  HOH TIP C . 
I 3 HOH 28  228 90  HOH TIP C . 
I 3 HOH 29  229 93  HOH TIP C . 
I 3 HOH 30  230 95  HOH TIP C . 
I 3 HOH 31  231 102 HOH TIP C . 
I 3 HOH 32  232 104 HOH TIP C . 
I 3 HOH 33  233 111 HOH TIP C . 
I 3 HOH 34  234 112 HOH TIP C . 
I 3 HOH 35  235 119 HOH TIP C . 
I 3 HOH 36  236 120 HOH TIP C . 
I 3 HOH 37  237 128 HOH TIP C . 
I 3 HOH 38  238 136 HOH TIP C . 
I 3 HOH 39  239 138 HOH TIP C . 
I 3 HOH 40  240 139 HOH TIP C . 
I 3 HOH 41  241 141 HOH TIP C . 
I 3 HOH 42  242 143 HOH TIP C . 
I 3 HOH 43  243 147 HOH TIP C . 
I 3 HOH 44  244 148 HOH TIP C . 
I 3 HOH 45  245 156 HOH TIP C . 
I 3 HOH 46  246 158 HOH TIP C . 
I 3 HOH 47  247 161 HOH TIP C . 
I 3 HOH 48  248 167 HOH TIP C . 
I 3 HOH 49  249 174 HOH TIP C . 
I 3 HOH 50  250 175 HOH TIP C . 
I 3 HOH 51  251 177 HOH TIP C . 
I 3 HOH 52  252 181 HOH TIP C . 
I 3 HOH 53  253 183 HOH TIP C . 
I 3 HOH 54  254 186 HOH TIP C . 
I 3 HOH 55  255 188 HOH TIP C . 
I 3 HOH 56  256 196 HOH TIP C . 
I 3 HOH 57  257 198 HOH TIP C . 
I 3 HOH 58  258 203 HOH TIP C . 
I 3 HOH 59  259 204 HOH TIP C . 
I 3 HOH 60  260 205 HOH TIP C . 
I 3 HOH 61  261 212 HOH TIP C . 
I 3 HOH 62  262 213 HOH TIP C . 
I 3 HOH 63  263 218 HOH TIP C . 
I 3 HOH 64  264 220 HOH TIP C . 
I 3 HOH 65  265 223 HOH TIP C . 
I 3 HOH 66  266 225 HOH TIP C . 
I 3 HOH 67  267 226 HOH TIP C . 
I 3 HOH 68  268 229 HOH TIP C . 
I 3 HOH 69  269 231 HOH TIP C . 
I 3 HOH 70  270 244 HOH TIP C . 
I 3 HOH 71  271 247 HOH TIP C . 
I 3 HOH 72  272 251 HOH TIP C . 
I 3 HOH 73  273 261 HOH TIP C . 
I 3 HOH 74  274 263 HOH TIP C . 
I 3 HOH 75  275 265 HOH TIP C . 
I 3 HOH 76  276 267 HOH TIP C . 
I 3 HOH 77  277 269 HOH TIP C . 
I 3 HOH 78  278 271 HOH TIP C . 
I 3 HOH 79  279 286 HOH TIP C . 
I 3 HOH 80  280 294 HOH TIP C . 
I 3 HOH 81  281 296 HOH TIP C . 
I 3 HOH 82  282 309 HOH TIP C . 
I 3 HOH 83  283 316 HOH TIP C . 
I 3 HOH 84  284 318 HOH TIP C . 
I 3 HOH 85  285 323 HOH TIP C . 
I 3 HOH 86  286 326 HOH TIP C . 
I 3 HOH 87  287 330 HOH TIP C . 
I 3 HOH 88  288 331 HOH TIP C . 
I 3 HOH 89  289 335 HOH TIP C . 
I 3 HOH 90  290 337 HOH TIP C . 
I 3 HOH 91  291 351 HOH TIP C . 
I 3 HOH 92  292 353 HOH TIP C . 
I 3 HOH 93  293 354 HOH TIP C . 
I 3 HOH 94  294 357 HOH TIP C . 
I 3 HOH 95  295 366 HOH TIP C . 
I 3 HOH 96  296 370 HOH TIP C . 
I 3 HOH 97  297 371 HOH TIP C . 
I 3 HOH 98  298 375 HOH TIP C . 
I 3 HOH 99  299 381 HOH TIP C . 
I 3 HOH 100 300 382 HOH TIP C . 
I 3 HOH 101 301 383 HOH TIP C . 
I 3 HOH 102 302 387 HOH TIP C . 
I 3 HOH 103 303 394 HOH TIP C . 
I 3 HOH 104 304 400 HOH TIP C . 
I 3 HOH 105 305 403 HOH TIP C . 
I 3 HOH 106 306 414 HOH TIP C . 
I 3 HOH 107 307 418 HOH TIP C . 
I 3 HOH 108 308 421 HOH TIP C . 
I 3 HOH 109 309 441 HOH TIP C . 
I 3 HOH 110 310 444 HOH TIP C . 
I 3 HOH 111 311 445 HOH TIP C . 
I 3 HOH 112 312 446 HOH TIP C . 
I 3 HOH 113 313 447 HOH TIP C . 
I 3 HOH 114 314 448 HOH TIP C . 
I 3 HOH 115 315 449 HOH TIP C . 
I 3 HOH 116 316 179 HOH TIP C . 
J 3 HOH 1   201 432 HOH TIP D . 
J 3 HOH 2   202 2   HOH TIP D . 
J 3 HOH 3   203 10  HOH TIP D . 
J 3 HOH 4   204 13  HOH TIP D . 
J 3 HOH 5   205 20  HOH TIP D . 
J 3 HOH 6   206 26  HOH TIP D . 
J 3 HOH 7   207 30  HOH TIP D . 
J 3 HOH 8   208 32  HOH TIP D . 
J 3 HOH 9   209 35  HOH TIP D . 
J 3 HOH 10  210 41  HOH TIP D . 
J 3 HOH 11  211 44  HOH TIP D . 
J 3 HOH 12  212 49  HOH TIP D . 
J 3 HOH 13  213 50  HOH TIP D . 
J 3 HOH 14  214 56  HOH TIP D . 
J 3 HOH 15  215 57  HOH TIP D . 
J 3 HOH 16  216 60  HOH TIP D . 
J 3 HOH 17  217 62  HOH TIP D . 
J 3 HOH 18  218 64  HOH TIP D . 
J 3 HOH 19  219 66  HOH TIP D . 
J 3 HOH 20  220 68  HOH TIP D . 
J 3 HOH 21  221 70  HOH TIP D . 
J 3 HOH 22  222 71  HOH TIP D . 
J 3 HOH 23  223 75  HOH TIP D . 
J 3 HOH 24  224 79  HOH TIP D . 
J 3 HOH 25  225 91  HOH TIP D . 
J 3 HOH 26  226 92  HOH TIP D . 
J 3 HOH 27  227 94  HOH TIP D . 
J 3 HOH 28  228 97  HOH TIP D . 
J 3 HOH 29  229 100 HOH TIP D . 
J 3 HOH 30  230 105 HOH TIP D . 
J 3 HOH 31  231 106 HOH TIP D . 
J 3 HOH 32  232 116 HOH TIP D . 
J 3 HOH 33  233 121 HOH TIP D . 
J 3 HOH 34  234 124 HOH TIP D . 
J 3 HOH 35  235 127 HOH TIP D . 
J 3 HOH 36  236 135 HOH TIP D . 
J 3 HOH 37  237 145 HOH TIP D . 
J 3 HOH 38  238 146 HOH TIP D . 
J 3 HOH 39  239 149 HOH TIP D . 
J 3 HOH 40  240 150 HOH TIP D . 
J 3 HOH 41  241 160 HOH TIP D . 
J 3 HOH 42  242 168 HOH TIP D . 
J 3 HOH 43  243 170 HOH TIP D . 
J 3 HOH 44  244 171 HOH TIP D . 
J 3 HOH 45  245 172 HOH TIP D . 
J 3 HOH 46  246 190 HOH TIP D . 
J 3 HOH 47  247 192 HOH TIP D . 
J 3 HOH 48  248 195 HOH TIP D . 
J 3 HOH 49  249 197 HOH TIP D . 
J 3 HOH 50  250 199 HOH TIP D . 
J 3 HOH 51  251 208 HOH TIP D . 
J 3 HOH 52  252 209 HOH TIP D . 
J 3 HOH 53  253 214 HOH TIP D . 
J 3 HOH 54  254 219 HOH TIP D . 
J 3 HOH 55  255 232 HOH TIP D . 
J 3 HOH 56  256 236 HOH TIP D . 
J 3 HOH 57  257 238 HOH TIP D . 
J 3 HOH 58  258 240 HOH TIP D . 
J 3 HOH 59  259 242 HOH TIP D . 
J 3 HOH 60  260 245 HOH TIP D . 
J 3 HOH 61  261 257 HOH TIP D . 
J 3 HOH 62  262 259 HOH TIP D . 
J 3 HOH 63  263 260 HOH TIP D . 
J 3 HOH 64  264 262 HOH TIP D . 
J 3 HOH 65  265 264 HOH TIP D . 
J 3 HOH 66  266 272 HOH TIP D . 
J 3 HOH 67  267 274 HOH TIP D . 
J 3 HOH 68  268 275 HOH TIP D . 
J 3 HOH 69  269 278 HOH TIP D . 
J 3 HOH 70  270 282 HOH TIP D . 
J 3 HOH 71  271 290 HOH TIP D . 
J 3 HOH 72  272 292 HOH TIP D . 
J 3 HOH 73  273 298 HOH TIP D . 
J 3 HOH 74  274 308 HOH TIP D . 
J 3 HOH 75  275 314 HOH TIP D . 
J 3 HOH 76  276 319 HOH TIP D . 
J 3 HOH 77  277 324 HOH TIP D . 
J 3 HOH 78  278 328 HOH TIP D . 
J 3 HOH 79  279 333 HOH TIP D . 
J 3 HOH 80  280 334 HOH TIP D . 
J 3 HOH 81  281 339 HOH TIP D . 
J 3 HOH 82  282 341 HOH TIP D . 
J 3 HOH 83  283 345 HOH TIP D . 
J 3 HOH 84  284 352 HOH TIP D . 
J 3 HOH 85  285 355 HOH TIP D . 
J 3 HOH 86  286 362 HOH TIP D . 
J 3 HOH 87  287 364 HOH TIP D . 
J 3 HOH 88  288 367 HOH TIP D . 
J 3 HOH 89  289 372 HOH TIP D . 
J 3 HOH 90  290 378 HOH TIP D . 
J 3 HOH 91  291 379 HOH TIP D . 
J 3 HOH 92  292 384 HOH TIP D . 
J 3 HOH 93  293 385 HOH TIP D . 
J 3 HOH 94  294 386 HOH TIP D . 
J 3 HOH 95  295 389 HOH TIP D . 
J 3 HOH 96  296 396 HOH TIP D . 
J 3 HOH 97  297 397 HOH TIP D . 
J 3 HOH 98  298 406 HOH TIP D . 
J 3 HOH 99  299 409 HOH TIP D . 
J 3 HOH 100 300 410 HOH TIP D . 
J 3 HOH 101 301 416 HOH TIP D . 
J 3 HOH 102 302 422 HOH TIP D . 
J 3 HOH 103 303 424 HOH TIP D . 
J 3 HOH 104 304 439 HOH TIP D . 
J 3 HOH 105 305 440 HOH TIP D . 
J 3 HOH 106 306 442 HOH TIP D . 
J 3 HOH 107 307 443 HOH TIP D . 
J 3 HOH 108 308 450 HOH TIP D . 
K 3 HOH 1   101 59  HOH TIP W . 
K 3 HOH 2   102 73  HOH TIP W . 
K 3 HOH 3   103 118 HOH TIP W . 
K 3 HOH 4   104 123 HOH TIP W . 
K 3 HOH 5   105 153 HOH TIP W . 
K 3 HOH 6   106 180 HOH TIP W . 
K 3 HOH 7   107 193 HOH TIP W . 
K 3 HOH 8   108 234 HOH TIP W . 
K 3 HOH 9   109 283 HOH TIP W . 
K 3 HOH 10  110 288 HOH TIP W . 
K 3 HOH 11  111 293 HOH TIP W . 
K 3 HOH 12  112 304 HOH TIP W . 
K 3 HOH 13  113 310 HOH TIP W . 
K 3 HOH 14  114 315 HOH TIP W . 
K 3 HOH 15  115 338 HOH TIP W . 
K 3 HOH 16  116 365 HOH TIP W . 
K 3 HOH 17  117 402 HOH TIP W . 
K 3 HOH 18  118 405 HOH TIP W . 
K 3 HOH 19  119 407 HOH TIP W . 
K 3 HOH 20  120 411 HOH TIP W . 
K 3 HOH 21  121 430 HOH TIP W . 
L 3 HOH 1   101 140 HOH TIP Z . 
L 3 HOH 2   102 43  HOH TIP Z . 
L 3 HOH 3   103 65  HOH TIP Z . 
L 3 HOH 4   104 108 HOH TIP Z . 
L 3 HOH 5   105 125 HOH TIP Z . 
L 3 HOH 6   106 144 HOH TIP Z . 
L 3 HOH 7   107 227 HOH TIP Z . 
L 3 HOH 8   108 233 HOH TIP Z . 
L 3 HOH 9   109 277 HOH TIP Z . 
L 3 HOH 10  110 284 HOH TIP Z . 
L 3 HOH 11  111 291 HOH TIP Z . 
L 3 HOH 12  112 302 HOH TIP Z . 
L 3 HOH 13  113 307 HOH TIP Z . 
L 3 HOH 14  114 327 HOH TIP Z . 
L 3 HOH 15  115 344 HOH TIP Z . 
L 3 HOH 16  116 349 HOH TIP Z . 
L 3 HOH 17  117 358 HOH TIP Z . 
L 3 HOH 18  118 368 HOH TIP Z . 
L 3 HOH 19  119 395 HOH TIP Z . 
L 3 HOH 20  120 420 HOH TIP Z . 
L 3 HOH 21  121 426 HOH TIP Z . 
#